1IW7A

Crystal structure of the rna polymerase holoenzyme from thermus thermophilus at 2.6a resolution
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
229
structure length
229
Chain Sequence
MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a bacterial RNA polymerase holoenzyme at 2.6 A resolution
pubmed doi rcsb
molecule tags Transferase
molecule keywords RNA polymerase alpha subunit
total genus 40
structure length 229
sequence length 229
chains with identical sequence B, K, L
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2002-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01000 RNA_pol_A_bac RNA polymerase Rpb3/RpoA insert domain
A PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain
A PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.12 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 DNA-directed RNA polymerase, insert domain 1iw7A02
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 1iw7A01
4G7HA 5D4DA 3HOVC 3HOZK 4BY7K 2WB1L 4ZH4A 2YU9K 3M3YC 4A3EC 4A3FK 2A68A 3RZDC 3S2HK 2PMZD 2E2HK 3GTKC 1I50K 3GTOK 1BDFA 3H3VD 3GTGK 4A3DK 3S1MK 5TMFA 1TWHK 2R93K 1TWGC 3I4NK 3S17C 4C2MK 4LJZA 4C3JK 3RZOC 2NVTC 1TWFC 4A3MK 2JA8K 3S15K 2PMZL 4OIOA 1I3QC 3GTGC 4OIRA 4A3JK 2R93C 4NOIA 5FLMK 3H3VL 4JK1A 1IW7A 2WAQD 2PA8L 3HOYK 2JA6K 4C2MC 4A3FC 4A3EK 2BE5A 1R9TC 4QIWL 3HOUC 4BBSC 1WCMC 2PPBA 5IYCC 4A93C 1K83C 4X6AC 1TWAK 3CQZK 3GTLK 3HOUK 3S2DK 4BBSK 4C3IC 1Y1VC 1YNNA 2B63K 3H0GK 1ZYRA 4KN4A 4Y7NC 4A3JC 3S1RC 2JA6C 3M4OK 3FKIC 3S16K 1I6HC 1I6HK 4YG2A 4A3CC 1SFOK 2R92K 4A3CK 3HOXC 5M5WK 3S1QK 2A6EA 5IYBC 4BXXK 4A3MC 2JA8C 1YNJA 4QIWD 4BXXC 2NVTK 5M3MK 2Y0SL 2B63C 4GZYA 4C3IK 4YFXA 3I4NC 1TWGK 5C4JK 3HOWC 5TMCA 4LK1A 3GTMK 4A3LK 4A3BK 4AYBL 4A3GK 3HKZD 5IYDC 3GTQC 5IYDK 3GTQK 2E2HC 5IYCK 3S2HC 4LLGA 3GTLC 2JA7K 2PA8D 2WAQL 5FJ8K 3HOWK 4XLNA 3K7AC 5C3EK 3HOZC 5C44K 3HOVK 3HOYC 3S14C 2JA5C 3PO3K 1I6VA 3PO3C 3S14K 2R92C 3S1QC 4A3GC 5M5XK 5M3FK 4XSZA 5IYBK 4OIQA 3GTPC 4BY1K 1TWFK 1XPPA 4G7ZA 1I50C 3GTOC 3GTPK 4MEYA 2E2IC 2NVQC 3S1MC 3S15C 5C4XC 5C44C 1TWCC 3H0GC 3K7AK 2JA5K 4A3KK 2YU9C 4KMUA 4BY7C 2A69A 3M3YK 4QJVA 2O5IA 3GTKK 4BBRC 1Y1VK 4Y7NK 4A3KC 2E2IK 5FLMC 4XLPA 1TWCK 3S1NK 3GTJC 3PO2C 3HKZL 4MQ9A 5IP9K 3S16C 3FKIK 2Y0SD 4XSXA 4C3JC 2O5JA 2WB1D 4Y52K 3HOXK 1SMYA 4Y52C 5IP7C 5C4XK 2NVXC 1TWAC 3S2DC 3EQLA 4G7OA 1K83K 3DXJA 1I3QK 3S1NC 2NVYK 5M5YK 3S1RK 2E2JK 5IP9C 4AYBD 4A3IK 3GTJK 3PO2K 2R7ZK 4KN7A 1Y1WC 1Y1WK 2A6HA 3GTMC 4A3BC 4A3LC 3RZDK 1R9TK 4X6AK 4BY1C 3CQZC 1WCMK 4A93K 4Q4ZA 2JA7C 4A3IC 2NVYC 2E2JC 4QJVB 4YFKA 5IP7K 4A3DC 2CW0A 5C4JC 2VUMC 1HQMA 2R7ZC 2NVQK 3S17K 4OIPA 5C3EC 3I4MC 4C3HK 1SFOC 3WODA 4C3HC 3I4MK 4YFNA 4Q5SA 3RZOK 2NVXK 2VUMK 4OINA 4BBRK 4LK0A 3M4OC 1TWHC 4MEXA
chains in the Genus database with same CATH superfamily
3HOZK 4WJ3M 1IE0A 1ZBSA 2VUMA 3RZDC 3N0CA 2PMZD 3LAJA 5TJ3A 1INNA 3T02A 2GAHC 3I4NK 3OREA 1PJ6A 4LJZA 1B4BA 1KQ4A 1O29A 1Y1VA 3N3YA 1VLOA 3RZOC 5CJ9A 2PMZL 1I3QC 3GTGC 4OIRA 3A8JA 4JK1A 1IW7A 2ZJRS 4A3FC 2E2IA 4QIWL 4BBSC 4X6AC 1WCMC 2PPBA 4A93C 1DD5A 3H0GA 1F93A 4BKWA 3HOUK 2B63K 1I50A 3GTOA 2JA6C 1IBAA 1I6HC 2XCQA 4A3CK 3HOXC 1O28A 3GTKA 4LQYA 1EH1A 4QIWD 4BXXC 5M3MK 3AH5A 5C4JK 3HOWC 4IO9S 4LK1A 1TWGA 4P5BA 4A3GK 5IYDC 3GEIA 3A8IA 2KXYA 1J98A 2ZUEA 2RH6A 5IYCK 5JVGS 3K7AC 1WQHA 1PJ7A 3HOZC 3HOYC 2JA5C 2ZJQS 3PO3C 4A3GC 1TWFK 1XPPA 3CQZA 1IL2A 3S1MC 2NVYA 1ISEA 5C44C 4XCHA 1K83A 2YU9C 4KMUA 1DCPA 3M3YK 3FKIA 2XCRB 1WORA 1BS2A 4RMFA 5CHPA 3OPFA 2ZJPS 4XLPA 5IORA 4GTBA 3PO2C 3AD7C 4MQ9A 4Y52C 1AB4A 4O2DA 3FOFA 1TWAC 3S2DC 3EQLA 1K83K 3DXJA 1VH2A 1XXBA 1Y1WK 2A6HA 3RZDK 4BY1C 3G4AA 3CQZC 2NVYC 2E2JC 4YFKA 4GTDA 5C4JC 1EI6A 3TFIA 2R7ZC 3OEPA 4OIPA 1WQGA 3I4MC 1EFWA 4C3HC 4KC6A 1XZQA 3ADAC 4OINA 3BUEA 1DCHA 4FM9A 4MEXA 1JVIA 4G7HA 3S17K 2WB1L 2YU9K 3M3YC 3HXAA 4A3FK 2A68A 2NVXA 3S2HK 3L4KA 2KQ1A 3VA7A 1BDFA 3H3VD 4A3DK 2B63A 3S1MK 4WFNS 1TWGC 4P5AA 5HL7S 3S17C 2D6FC 3G4CA 4C2MK 3SZYA 1USOA 3BP3A 2V6UA 4A3MK 3S0XA 2L3UA 1J6WA 2PA8L 3FOEA 3NUHA 1I3QA 2BE5A 3PIOS 3CQZK 5IYCC 3GTPA 1K83C 1TWAK 1TWFA 3S2DK 1Y1VC 3H0GK 4Y7NC 3M4OK 3FKIC 3S16K 2P5MA 1I6HK 5HL8A 1SFOK 2A6EA 5IYBC 1O2AA 3BP8C 4A3MC 1YNJA 2B63C 4G0WA 1IS1A 3GTMK 4KDDA 3GTQK 3S2HC 2JA7K 2PA8D 3DLLS 2R92A 3CF5S 1XZQB 4GTCA 1XXAA 3S14C 3FHZA 1O2FB 5IYBK 3GTPC 1ZXOA 1VJEA 3ERED 5C4XC 1O26A 3IPJA 1TWCC 3K7AK 2JA5K 2RGRA 4BY7C 4PABA 3LYWA 4QJVA 3GIRA 5L46A 3Q3QA 3GTKK 4Y7NK 1Y1VK 4A3KC 1TWCK 5JVHS 3S1NK 1C0AA 4C3JC 4XSXA 3HOXK 2PHCB 5C4XK 3LPXA 4AYBD 4KAWX 3PO2K 4GTFA 3GTMC 1XZPB 2JA7C 2JH3A 2EBBA 3MMLB 4QJVB 4A3DC 1HQMA 3AQPA 2ZUFA 3GTQA 1WOPA 3I4MK 4Q5SA 5IOQA 4BBRK 3AD9C 3HOVC 1V5VA 4BY7K 1SFOA 2L5NA 2E2HK 3GTKC 5TMFA 1TWHK 1VGXA 2R93K 4KARA 3SZZA 1B4AA 3GTMA 1WCMA 1UV7A 2JA8K 3S15K 1WSVA 4A3JK 3H3VL 4NOIA 5FLMK 3T00A 2CFAB 2JA6K 4C2MC 1O27A 1IQ0A 4A3EK 3HOUC 4KM8A 4BBSK 1X31C 4C3IC 1WSRA 4KM9A 3GTGA 1TWAA 4A3JC 1G51A 2FQTA 4J3NA 4PAAA 4YG2A 4KATA 2R92K 2YU9A 2JA8C 1J6XA 3I4NC 2FQOA 2Y3PA 2JA5A 5IYDK 4WF9S 4AYBL 3HKZD 2GSUA 2E2HC 1DCOA 4LLGA 3GTLC 3HOWK 4C45A 5C3EK 3HOVK 4WCES 1EK8A 1I6VA 3S14K 2R92C 1Y1WA 5EGHA 5IOTA 2JA7A 3GTLA 4G7ZA 1I50C 3GTOC 3GTPK 2NVQC 4FZBA 4WFAS 4KASA 2V6TA 3QX3A 2KWAA 5FLMC 1VRQC 1PJ5A 5E68A 3GTJC 3HKZL 5IP9K 3L4JA 4WFBS 3S16C 3FKIK 2Y0SD 3GEEA 2O5JA 1USMA 4KMDA 4DDQA 4KB2A 2NVQK 2NVXC 5JFEA 1I3QK 3S1NC 2NVYK 2XCOA 3TTGA 3S1RK 2E2JK 1GE9A 2V6SA 2R7ZK 4ILDA 1Y1WC 1WQFA 4BLBA 1O25A 1R9TK 4GTEA 5HQHA 4LOWA 1JOEA 2CW0A 2VUMC 1RU0A 4U67S 3WODA 1J6VA 1L0WA 3GSIA 1F9NA 4P9SA 2NVXK 1JQWA 1F7VA 2R7ZA 5D4DA 2P8TA 4ZH4A 1YX2A 4A3EC 1I50K 4KMAA 3GTOK 3GTGK 4KMHA 5JVOA 1ZQ1C 4LR2A 4C3JK 2JA6A 2NVTC 1TWFC 1YCLA 1R9TA 4OIOA 4M1XA 2R93C 2WAQD 3HOYK 3TFJA 1R9TC 3PIPS 4GT9A 1FEUA 3GTLK 2R93A 4IOCS 1YNNA 1ZYRA 4KN4A 3S1RC 3AD8C 2GSNA 4A3CC 3S1QK 3T01A 5M5WK 4BXXK 2NVTK 2Y0SL 4WJ4A 1BJTA 4GZYA 3AQOA 4C3IK 2ZFZA 4YFXA 1TWGK 5TMCA 4KB4A 4A3LK 4A3BK 3GTQC 2GAGC 4BLAA 3LAPA 3JSTA 2WAQL 5FJ8K 1WIHA 1WOSA 4XLNA 2E2HA 5IOSA 5C44K 2KPUA 3PO3K 3S1QC 1ZVUA 5M5XK 5M3FK 4XSZA 4OIQA 4BY1K 1F7UA 3GEHA 4MEYA 2E2IC 3S15C 1WOOA 3V4GA 1O24A 3H0GC 3N0BA 1BGWA 4WILA 4A3KK 2W7VA 1TWHC 2A69A 1XZPA 4IOAS 2O5IA 4G0UA 4AH6A 4BBRC 5DM7S 4GFQA 3TFHA 4GTAA 3GTJA 2WB1D 4Y52K 2GSOA 1SMYA 5IP7C 4A3IK 4G7OA 2E2IK 5M5YK 5IP9C 4G0VA 3GTJK 1EQRA 1O2BA 4KN7A 1HI9A 4X6AK 4A3BC 4A3LC 3GDZA 4GTLA 1WCMK 1TWCA 4A93K 5DM6S 4Q4ZA 4A3IC 5IP7K 5C3EC 1TWHA 4C3HK 1SFOC 1XXCA 4YFNA 3A8KA 3RZOK 2CFAA 5EGEA 2VUMK 4LK0A 3M4OC 3CAGA
chains in the Genus database with same CATH topology
4G7HA 5D4DA 3HOVC 3HOZK 4BY7K 2WB1L 4ZH4A 2YU9K 3M3YC 4A3EC 4A3FK 2A68A 3RZDC 3S2HK 2PMZD 2E2HK 3GTKC 1I50K 3GTOK 1BDFA 3H3VD 3GTGK 4A3DK 3S1MK 5TMFA 1TWHK 2R93K 1TWGC 3I4NK 3S17C 4C2MK 4LJZA 4C3JK 3RZOC 2NVTC 1TWFC 4A3MK 2JA8K 3S15K 2PMZL 4OIOA 1I3QC 3GTGC 4OIRA 4A3JK 2R93C 4NOIA 5FLMK 3H3VL 4JK1A 1IW7A 2WAQD 2PA8L 3HOYK 2JA6K 4C2MC 4A3FC 4A3EK 2BE5A 1R9TC 4QIWL 3HOUC 4BBSC 1WCMC 2PPBA 5IYCC 4A93C 1K83C 4X6AC 1TWAK 3CQZK 3GTLK 3HOUK 3S2DK 4BBSK 4C3IC 1Y1VC 1YNNA 2B63K 3H0GK 1ZYRA 4KN4A 4Y7NC 4A3JC 3S1RC 2JA6C 3M4OK 3FKIC 3S16K 1I6HC 1I6HK 4YG2A 4A3CC 1SFOK 2R92K 4A3CK 3HOXC 5M5WK 3S1QK 2A6EA 5IYBC 4BXXK 4A3MC 2JA8C 1YNJA 4QIWD 4BXXC 2NVTK 5M3MK 2Y0SL 2B63C 4GZYA 4C3IK 4YFXA 3I4NC 1TWGK 5C4JK 3HOWC 5TMCA 4LK1A 3GTMK 4A3LK 4A3BK 4AYBL 4A3GK 3HKZD 5IYDC 3GTQC 5IYDK 3GTQK 2E2HC 5IYCK 3S2HC 4LLGA 3GTLC 2JA7K 2PA8D 2WAQL 5FJ8K 3HOWK 4XLNA 3K7AC 5C3EK 3HOZC 5C44K 3HOVK 3HOYC 3S14C 2JA5C 3PO3K 1I6VA 3PO3C 3S14K 2R92C 3S1QC 4A3GC 5M5XK 5M3FK 4XSZA 5IYBK 4OIQA 3GTPC 4BY1K 1TWFK 1XPPA 4G7ZA 1I50C 3GTOC 3GTPK 4MEYA 2E2IC 2NVQC 3S1MC 3S15C 5C4XC 5C44C 1TWCC 3H0GC 3K7AK 2JA5K 4A3KK 2YU9C 4KMUA 4BY7C 2A69A 3M3YK 4QJVA 2O5IA 3GTKK 4BBRC 1Y1VK 4Y7NK 4A3KC 2E2IK 5FLMC 4XLPA 1TWCK 3S1NK 3GTJC 3PO2C 3HKZL 4MQ9A 5IP9K 3S16C 3FKIK 2Y0SD 4XSXA 4C3JC 2O5JA 2WB1D 4Y52K 3HOXK 1SMYA 4Y52C 5IP7C 5C4XK 2NVXC 1TWAC 3S2DC 3EQLA 4G7OA 1K83K 3DXJA 1I3QK 3S1NC 2NVYK 5M5YK 3S1RK 2E2JK 5IP9C 4AYBD 4A3IK 3GTJK 3PO2K 2R7ZK 4KN7A 1Y1WC 1Y1WK 2A6HA 3GTMC 4A3BC 4A3LC 3RZDK 1R9TK 4X6AK 4BY1C 3CQZC 1WCMK 4A93K 4Q4ZA 2JA7C 4A3IC 2NVYC 2E2JC 4QJVB 4YFKA 5IP7K 4A3DC 2CW0A 5C4JC 2VUMC 1HQMA 2R7ZC 2NVQK 3S17K 4OIPA 5C3EC 3I4MC 4C3HK 1SFOC 3WODA 4C3HC 3I4MK 4YFNA 4Q5SA 3RZOK 2NVXK 2VUMK 4OINA 4BBRK 4LK0A 3M4OC 1TWHC 4MEXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G7H A;  5D4D A;  3HOV C;  3HOZ K;  4BY7 K;  2WB1 L;  4ZH4 A;  2YU9 K;  3M3Y C;  4A3E C;  4A3F K;  2A68 A;  3RZD C;  3S2H K;  2PMZ D;  2E2H K;  3GTK C;  1I50 K;  3GTO K;  1BDF A;  3H3V D;  3GTG K;  4A3D K;  3S1M K;  5TMF A;  1TWH K;  2R93 K;  1TWG C;  3I4N K;  3S17 C;  4C2M K;  4LJZ A;  4C3J K;  3RZO C;  2NVT C;  1TWF C;  4A3M K;  2JA8 K;  3S15 K;  2PMZ L;  4OIO A;  1I3Q C;  3GTG C;  4OIR A;  4A3J K;  2R93 C;  4NOI A;  5FLM K;  3H3V L;  4JK1 A;  1IW7 A;  2WAQ D;  2PA8 L;  3HOY K;  2JA6 K;  4C2M C;  4A3F C;  4A3E K;  2BE5 A;  1R9T C;  4QIW L;  3HOU C;  4BBS C;  1WCM C;  2PPB A;  5IYC C;  4A93 C;  1K83 C;  4X6A C;  1TWA K;  3CQZ K;  3GTL K;  3HOU K;  3S2D K;  4BBS K;  4C3I C;  1Y1V C;  1YNN A;  2B63 K;  3H0G K;  1ZYR A;  4KN4 A;  4Y7N C;  4A3J C;  3S1R C;  2JA6 C;  3M4O K;  3FKI C;  3S16 K;  1I6H C;  1I6H K;  4YG2 A;  4A3C C;  1SFO K;  2R92 K;  4A3C K;  3HOX C;  5M5W K;  3S1Q K;  2A6E A;  5IYB C;  4BXX K;  4A3M C;  2JA8 C;  1YNJ A;  4QIW D;  4BXX C;  2NVT K;  5M3M K;  2Y0S L;  2B63 C;  4GZY A;  4C3I K;  4YFX A;  3I4N C;  1TWG K;  5C4J K;  3HOW C;  5TMC A;  4LK1 A;  3GTM K;  4A3L K;  4A3B K;  4AYB L;  4A3G K;  3HKZ D;  5IYD C;  3GTQ C;  5IYD K;  3GTQ K;  2E2H C;  5IYC K;  3S2H C;  4LLG A;  3GTL C;  2JA7 K;  2PA8 D;  2WAQ L;  5FJ8 K;  3HOW K;  4XLN A;  3K7A C;  5C3E K;  3HOZ C;  5C44 K;  3HOV K;  3HOY C;  3S14 C;  2JA5 C;  3PO3 K;  1I6V A;  3PO3 C;  3S14 K;  2R92 C;  3S1Q C;  4A3G C;  5M5X K;  5M3F K;  4XSZ A;  5IYB K;  4OIQ A;  3GTP C;  4BY1 K;  1TWF K;  1XPP A;  4G7Z A;  1I50 C;  3GTO C;  3GTP K;  4MEY A;  2E2I C;  2NVQ C;  3S1M C;  3S15 C;  5C4X C;  5C44 C;  1TWC C;  3H0G C;  3K7A K;  2JA5 K;  4A3K K;  2YU9 C;  4KMU A;  4BY7 C;  2A69 A;  3M3Y K;  4QJV A;  2O5I A;  3GTK K;  4BBR C;  1Y1V K;  4Y7N K;  4A3K C;  2E2I K;  5FLM C;  4XLP A;  1TWC K;  3S1N K;  3GTJ C;  3PO2 C;  3HKZ L;  4MQ9 A;  5IP9 K;  3S16 C;  3FKI K;  2Y0S D;  4XSX A;  4C3J C;  2O5J A;  2WB1 D;  4Y52 K;  3HOX K;  1SMY A;  4Y52 C;  5IP7 C;  5C4X K;  2NVX C;  1TWA C;  3S2D C;  3EQL A;  4G7O A;  1K83 K;  3DXJ A;  1I3Q K;  3S1N C;  2NVY K;  5M5Y K;  3S1R K;  2E2J K;  5IP9 C;  4AYB D;  4A3I K;  3GTJ K;  3PO2 K;  2R7Z K;  4KN7 A;  1Y1W C;  1Y1W K;  2A6H A;  3GTM C;  4A3B C;  4A3L C;  3RZD K;  1R9T K;  4X6A K;  4BY1 C;  3CQZ C;  1WCM K;  4A93 K;  4Q4Z A;  2JA7 C;  4A3I C;  2NVY C;  2E2J C;  4QJV B;  4YFK A;  5IP7 K;  4A3D C;  2CW0 A;  5C4J C;  2VUM C;  1HQM A;  2R7Z C;  2NVQ K;  3S17 K;  4OIP A;  5C3E C;  3I4M C;  4C3H K;  1SFO C;  3WOD A;  4C3H C;  3I4M K;  4YFN A;  4Q5S A;  3RZO K;  2NVX K;  2VUM K;  4OIN A;  4BBR K;  4LK0 A;  3M4O C;  1TWH C;  4MEX A; 
#chains in the Genus database with same CATH topology
 3HOZ K;  4WJ3 M;  1IE0 A;  1ZBS A;  2VUM A;  3RZD C;  3N0C A;  2PMZ D;  3LAJ A;  5TJ3 A;  1INN A;  3T02 A;  2GAH C;  3I4N K;  3ORE A;  1PJ6 A;  4LJZ A;  1B4B A;  1KQ4 A;  1O29 A;  1Y1V A;  3N3Y A;  1VLO A;  3RZO C;  5CJ9 A;  2PMZ L;  1I3Q C;  3GTG C;  4OIR A;  3A8J A;  4JK1 A;  1IW7 A;  2ZJR S;  4A3F C;  2E2I A;  4QIW L;  4BBS C;  4X6A C;  1WCM C;  2PPB A;  4A93 C;  1DD5 A;  3H0G A;  1F93 A;  4BKW A;  3HOU K;  2B63 K;  1I50 A;  3GTO A;  2JA6 C;  1IBA A;  1I6H C;  2XCQ A;  4A3C K;  3HOX C;  1O28 A;  3GTK A;  4LQY A;  1EH1 A;  4QIW D;  4BXX C;  5M3M K;  3AH5 A;  5C4J K;  3HOW C;  4IO9 S;  4LK1 A;  1TWG A;  4P5B A;  4A3G K;  5IYD C;  3GEI A;  3A8I A;  2KXY A;  1J98 A;  2ZUE A;  2RH6 A;  5IYC K;  5JVG S;  3K7A C;  1WQH A;  1PJ7 A;  3HOZ C;  3HOY C;  2JA5 C;  2ZJQ S;  3PO3 C;  4A3G C;  1TWF K;  1XPP A;  3CQZ A;  1IL2 A;  3S1M C;  2NVY A;  1ISE A;  5C44 C;  4XCH A;  1K83 A;  2YU9 C;  4KMU A;  1DCP A;  3M3Y K;  3FKI A;  2XCR B;  1WOR A;  1BS2 A;  4RMF A;  5CHP A;  3OPF A;  2ZJP S;  4XLP A;  5IOR A;  4GTB A;  3PO2 C;  3AD7 C;  4MQ9 A;  4Y52 C;  1AB4 A;  4O2D A;  3FOF A;  1TWA C;  3S2D C;  3EQL A;  1K83 K;  3DXJ A;  1VH2 A;  1XXB A;  1Y1W K;  2A6H A;  3RZD K;  4BY1 C;  3G4A A;  3CQZ C;  2NVY C;  2E2J C;  4YFK A;  4GTD A;  5C4J C;  1EI6 A;  3TFI A;  2R7Z C;  3OEP A;  4OIP A;  1WQG A;  3I4M C;  1EFW A;  4C3H C;  4KC6 A;  1XZQ A;  3ADA C;  4OIN A;  3BUE A;  1DCH A;  4FM9 A;  4MEX A;  1JVI A;  4G7H A;  3S17 K;  2WB1 L;  2YU9 K;  3M3Y C;  3HXA A;  4A3F K;  2A68 A;  2NVX A;  3S2H K;  3L4K A;  2KQ1 A;  3VA7 A;  1BDF A;  3H3V D;  4A3D K;  2B63 A;  3S1M K;  4WFN S;  1TWG C;  4P5A A;  5HL7 S;  3S17 C;  2D6F C;  3G4C A;  4C2M K;  3SZY A;  1USO A;  3BP3 A;  2V6U A;  4A3M K;  3S0X A;  2L3U A;  1J6W A;  2PA8 L;  3FOE A;  3NUH A;  1I3Q A;  2BE5 A;  3PIO S;  3CQZ K;  5IYC C;  3GTP A;  1K83 C;  1TWA K;  1TWF A;  3S2D K;  1Y1V C;  3H0G K;  4Y7N C;  3M4O K;  3FKI C;  3S16 K;  2P5M A;  1I6H K;  5HL8 A;  1SFO K;  2A6E A;  5IYB C;  1O2A A;  3BP8 C;  4A3M C;  1YNJ A;  2B63 C;  4G0W A;  1IS1 A;  3GTM K;  4KDD A;  3GTQ K;  3S2H C;  2JA7 K;  2PA8 D;  3DLL S;  2R92 A;  3CF5 S;  1XZQ B;  4GTC A;  1XXA A;  3S14 C;  3FHZ A;  1O2F B;  5IYB K;  3GTP C;  1ZXO A;  1VJE A;  3ERE D;  5C4X C;  1O26 A;  3IPJ A;  1TWC C;  3K7A K;  2JA5 K;  2RGR A;  4BY7 C;  4PAB A;  3LYW A;  4QJV A;  3GIR A;  5L46 A;  3Q3Q A;  3GTK K;  4Y7N K;  1Y1V K;  4A3K C;  1TWC K;  5JVH S;  3S1N K;  1C0A A;  4C3J C;  4XSX A;  3HOX K;  2PHC B;  5C4X K;  3LPX A;  4AYB D;  4KAW X;  3PO2 K;  4GTF A;  3GTM C;  1XZP B;  2JA7 C;  2JH3 A;  2EBB A;  3MML B;  4QJV B;  4A3D C;  1HQM A;  3AQP A;  2ZUF A;  3GTQ A;  1WOP A;  3I4M K;  4Q5S A;  5IOQ A;  4BBR K;  3AD9 C;  3HOV C;  1V5V A;  4BY7 K;  1SFO A;  2L5N A;  2E2H K;  3GTK C;  5TMF A;  1TWH K;  1VGX A;  2R93 K;  4KAR A;  3SZZ A;  1B4A A;  3GTM A;  1WCM A;  1UV7 A;  2JA8 K;  3S15 K;  1WSV A;  4A3J K;  3H3V L;  4NOI A;  5FLM K;  3T00 A;  2CFA B;  2JA6 K;  4C2M C;  1O27 A;  1IQ0 A;  4A3E K;  3HOU C;  4KM8 A;  4BBS K;  1X31 C;  4C3I C;  1WSR A;  4KM9 A;  3GTG A;  1TWA A;  4A3J C;  1G51 A;  2FQT A;  4J3N A;  4PAA A;  4YG2 A;  4KAT A;  2R92 K;  2YU9 A;  2JA8 C;  1J6X A;  3I4N C;  2FQO A;  2Y3P A;  2JA5 A;  5IYD K;  4WF9 S;  4AYB L;  3HKZ D;  2GSU A;  2E2H C;  1DCO A;  4LLG A;  3GTL C;  3HOW K;  4C45 A;  5C3E K;  3HOV K;  4WCE S;  1EK8 A;  1I6V A;  3S14 K;  2R92 C;  1Y1W A;  5EGH A;  5IOT A;  2JA7 A;  3GTL A;  4G7Z A;  1I50 C;  3GTO C;  3GTP K;  2NVQ C;  4FZB A;  4WFA S;  4KAS A;  2V6T A;  3QX3 A;  2KWA A;  5FLM C;  1VRQ C;  1PJ5 A;  5E68 A;  3GTJ C;  3HKZ L;  5IP9 K;  3L4J A;  4WFB S;  3S16 C;  3FKI K;  2Y0S D;  3GEE A;  2O5J A;  1USM A;  4KMD A;  4DDQ A;  4KB2 A;  2NVQ K;  2NVX C;  5JFE A;  1I3Q K;  3S1N C;  2NVY K;  2XCO A;  3TTG A;  3S1R K;  2E2J K;  1GE9 A;  2V6S A;  2R7Z K;  4ILD A;  1Y1W C;  1WQF A;  4BLB A;  1O25 A;  1R9T K;  4GTE A;  5HQH A;  4LOW A;  1JOE A;  2CW0 A;  2VUM C;  1RU0 A;  4U67 S;  3WOD A;  1J6V A;  1L0W A;  3GSI A;  1F9N A;  4P9S A;  2NVX K;  1JQW A;  1F7V A;  2R7Z A;  5D4D A;  2P8T A;  4ZH4 A;  1YX2 A;  4A3E C;  1I50 K;  4KMA A;  3GTO K;  3GTG K;  4KMH A;  5JVO A;  1ZQ1 C;  4LR2 A;  4C3J K;  2JA6 A;  2NVT C;  1TWF C;  1YCL A;  1R9T A;  4OIO A;  4M1X A;  2R93 C;  2WAQ D;  3HOY K;  3TFJ A;  1R9T C;  3PIP S;  4GT9 A;  1FEU A;  3GTL K;  2R93 A;  4IOC S;  1YNN A;  1ZYR A;  4KN4 A;  3S1R C;  3AD8 C;  2GSN A;  4A3C C;  3S1Q K;  3T01 A;  5M5W K;  4BXX K;  2NVT K;  2Y0S L;  4WJ4 A;  1BJT A;  4GZY A;  3AQO A;  4C3I K;  2ZFZ A;  4YFX A;  1TWG K;  5TMC A;  4KB4 A;  4A3L K;  4A3B K;  3GTQ C;  2GAG C;  4BLA A;  3LAP A;  3JST A;  2WAQ L;  5FJ8 K;  1WIH A;  1WOS A;  4XLN A;  2E2H A;  5IOS A;  5C44 K;  2KPU A;  3PO3 K;  3S1Q C;  1ZVU A;  5M5X K;  5M3F K;  4XSZ A;  4OIQ A;  4BY1 K;  1F7U A;  3GEH A;  4MEY A;  2E2I C;  3S15 C;  1WOO A;  3V4G A;  1O24 A;  3H0G C;  3N0B A;  1BGW A;  4WIL A;  4A3K K;  2W7V A;  1TWH C;  2A69 A;  1XZP A;  4IOA S;  2O5I A;  4G0U A;  4AH6 A;  4BBR C;  5DM7 S;  4GFQ A;  3TFH A;  4GTA A;  3GTJ A;  2WB1 D;  4Y52 K;  2GSO A;  1SMY A;  5IP7 C;  4A3I K;  4G7O A;  2E2I K;  5M5Y K;  5IP9 C;  4G0V A;  3GTJ K;  1EQR A;  1O2B A;  4KN7 A;  1HI9 A;  4X6A K;  4A3B C;  4A3L C;  3GDZ A;  4GTL A;  1WCM K;  1TWC A;  4A93 K;  5DM6 S;  4Q4Z A;  4A3I C;  5IP7 K;  5C3E C;  1TWH A;  4C3H K;  1SFO C;  1XXC A;  4YFN A;  3A8K A;  3RZO K;  2CFA A;  5EGE A;  2VUM K;  4LK0 A;  3M4O C;  3CAG A; 
#chains in the Genus database with same CATH homology
 4G7H A;  5D4D A;  3HOV C;  3HOZ K;  4BY7 K;  2WB1 L;  4ZH4 A;  2YU9 K;  3M3Y C;  4A3E C;  4A3F K;  2A68 A;  3RZD C;  3S2H K;  2PMZ D;  2E2H K;  3GTK C;  1I50 K;  3GTO K;  1BDF A;  3H3V D;  3GTG K;  4A3D K;  3S1M K;  5TMF A;  1TWH K;  2R93 K;  1TWG C;  3I4N K;  3S17 C;  4C2M K;  4LJZ A;  4C3J K;  3RZO C;  2NVT C;  1TWF C;  4A3M K;  2JA8 K;  3S15 K;  2PMZ L;  4OIO A;  1I3Q C;  3GTG C;  4OIR A;  4A3J K;  2R93 C;  4NOI A;  5FLM K;  3H3V L;  4JK1 A;  1IW7 A;  2WAQ D;  2PA8 L;  3HOY K;  2JA6 K;  4C2M C;  4A3F C;  4A3E K;  2BE5 A;  1R9T C;  4QIW L;  3HOU C;  4BBS C;  1WCM C;  2PPB A;  5IYC C;  4A93 C;  1K83 C;  4X6A C;  1TWA K;  3CQZ K;  3GTL K;  3HOU K;  3S2D K;  4BBS K;  4C3I C;  1Y1V C;  1YNN A;  2B63 K;  3H0G K;  1ZYR A;  4KN4 A;  4Y7N C;  4A3J C;  3S1R C;  2JA6 C;  3M4O K;  3FKI C;  3S16 K;  1I6H C;  1I6H K;  4YG2 A;  4A3C C;  1SFO K;  2R92 K;  4A3C K;  3HOX C;  5M5W K;  3S1Q K;  2A6E A;  5IYB C;  4BXX K;  4A3M C;  2JA8 C;  1YNJ A;  4QIW D;  4BXX C;  2NVT K;  5M3M K;  2Y0S L;  2B63 C;  4GZY A;  4C3I K;  4YFX A;  3I4N C;  1TWG K;  5C4J K;  3HOW C;  5TMC A;  4LK1 A;  3GTM K;  4A3L K;  4A3B K;  4AYB L;  4A3G K;  3HKZ D;  5IYD C;  3GTQ C;  5IYD K;  3GTQ K;  2E2H C;  5IYC K;  3S2H C;  4LLG A;  3GTL C;  2JA7 K;  2PA8 D;  2WAQ L;  5FJ8 K;  3HOW K;  4XLN A;  3K7A C;  5C3E K;  3HOZ C;  5C44 K;  3HOV K;  3HOY C;  3S14 C;  2JA5 C;  3PO3 K;  1I6V A;  3PO3 C;  3S14 K;  2R92 C;  3S1Q C;  4A3G C;  5M5X K;  5M3F K;  4XSZ A;  5IYB K;  4OIQ A;  3GTP C;  4BY1 K;  1TWF K;  1XPP A;  4G7Z A;  1I50 C;  3GTO C;  3GTP K;  4MEY A;  2E2I C;  2NVQ C;  3S1M C;  3S15 C;  5C4X C;  5C44 C;  1TWC C;  3H0G C;  3K7A K;  2JA5 K;  4A3K K;  2YU9 C;  4KMU A;  4BY7 C;  2A69 A;  3M3Y K;  4QJV A;  2O5I A;  3GTK K;  4BBR C;  1Y1V K;  4Y7N K;  4A3K C;  2E2I K;  5FLM C;  4XLP A;  1TWC K;  3S1N K;  3GTJ C;  3PO2 C;  3HKZ L;  4MQ9 A;  5IP9 K;  3S16 C;  3FKI K;  2Y0S D;  4XSX A;  4C3J C;  2O5J A;  2WB1 D;  4Y52 K;  3HOX K;  1SMY A;  4Y52 C;  5IP7 C;  5C4X K;  2NVX C;  1TWA C;  3S2D C;  3EQL A;  4G7O A;  1K83 K;  3DXJ A;  1I3Q K;  3S1N C;  2NVY K;  5M5Y K;  3S1R K;  2E2J K;  5IP9 C;  4AYB D;  4A3I K;  3GTJ K;  3PO2 K;  2R7Z K;  4KN7 A;  1Y1W C;  1Y1W K;  2A6H A;  3GTM C;  4A3B C;  4A3L C;  3RZD K;  1R9T K;  4X6A K;  4BY1 C;  3CQZ C;  1WCM K;  4A93 K;  4Q4Z A;  2JA7 C;  4A3I C;  2NVY C;  2E2J C;  4QJV B;  4YFK A;  5IP7 K;  4A3D C;  2CW0 A;  5C4J C;  2VUM C;  1HQM A;  2R7Z C;  2NVQ K;  3S17 K;  4OIP A;  5C3E C;  3I4M C;  4C3H K;  1SFO C;  3WOD A;  4C3H C;  3I4M K;  4YFN A;  4Q5S A;  3RZO K;  2NVX K;  2VUM K;  4OIN A;  4BBR K;  4LK0 A;  3M4O C;  1TWH C;  4MEX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...