1IW7A

Crystal structure of the rna polymerase holoenzyme from thermus thermophilus at 2.6a resolution
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
229
structure length
229
Chain Sequence
b'MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA polymerase alpha subunit
publication title Crystal structure of a bacterial RNA polymerase holoenzyme at 2.6 A resolution
pubmed doi rcsb
molecule tags Transferase
total genus 40
structure length 229
sequence length 229
chains with identical sequence B, K, L
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2002-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01000 RNA_pol_A_bac RNA polymerase Rpb3/RpoA insert domain
A PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain
A PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.12 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 DNA-directed RNA polymerase, insert domain 1iw7A02
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 1iw7A01
1SMYA 3S2DC 5C4XC 1TWHK 2VUMC 4A3DC 1TWGC 4BBRC 4A3EC 4G7ZA 1I6HK 2B63C 1TWFK 4LK0A 1Y1WK 5TMFA 4A3FK 5C4XK 2YU9C 5IP7C 3H3VL 4A3KC 1TWGK 2O5JA 3H0GC 4QJVB 4A3EK 4A3GK 3GTOK 3HOWC 4A3BC 4LJZA 3GTLK 3FKIC 2A6EA 2NVXK 1SFOC 5M3FK 1Y1VC 3DXJA 1YNNA 1ZYRA 2A69A 2Y0SD 3H3VD 1XPPA 2JA5K 3HOWK 3S2HK 4BXXK 3GTGC 4MQ9A 2PA8D 2E2IC 5IYCC 1I50C 1WCMC 2JA7C 3GTKC 1TWCK 5TMCA 3FKIK 1IW7A 4ZH4A 2JA6K 3WODA 3CQZC 4YG2A 4MEXA 3RZDC 3S15K 5IP9C 1K83C 4Y52C 4Q5SA 3HOYC 1WCMK 3GTKK 3RZOK 2R7ZC 1I6VA 4QJVA 3CQZK 3S1MC 4OIQA 4A3CC 4X6AC 4XSXA 3RZDK 2A68A 2A6HA 2JA8K 3S1NK 3S2DK 4Y52K 2Y0SL 2VUMK 3HOYK 4A3DK 4XSZA 5D4DA 4BBRK 2PA8L 4C3IC 4A3JC 4OIOA 4C3JC 2B63K 4NOIA 4A3CK 2E2JC 4X6AK 2WB1L 2YU9K 5IYBC 1HQMA 1R9TC 3GTMC 3S17C 5IP7K 4A3KK 3H0GK 4BY7C 3M3YC 3EQLA 4A3MC 2R93C 4C3IK 4C3JK 5M5WK 2PPBA 2E2JK 3S1QC 4A3BK 3GTMK 2PMZL 3S17K 4KN4A 5C3EC 3S16C 2R93K 1SFOK 3HKZD 2WB1D 1I3QC 1Y1VK 4JK1A 4Y7NC 4OIRA 3S1QK 4QIWL 4YFXA 1TWAC 3PO2C 3K7AC 3GTPC 2NVQC 4AYBD 2R92C 1I50K 5IYCK 2E2IK 4C2MC 3I4MC 2JA7K 3I4NC 5C3EK 4A93C 3S16K 3PO3C 1I3QK 3S14K 4G7HA 4Q4ZA 1BDFA 2PMZD 4BBSC 4A3LC 2NVYC 3K7AK 2NVQK 5IP9K 1K83K 2R92K 5IYDC 4C2MK 3I4NK 4KMUA 4OINA 4G7OA 2R7ZK 4QIWD 4A93K 4A3IC 3S1MK 3GTGK 3HKZL 5FLMC 3S14C 5C44C 3S1RC 1TWHC 4XLPA 4AYBL 4YFKA 4A3JK 1I6HC 5M5YK 4YFNA 3HOUC 5FLMK 1Y1WC 4BY1C 5C44K 5IYBK 1R9TK 4LLGA 4A3FC 3S1RK 4BY7K 3M3YK 4A3MK 3M4OC 4XLNA 5M5XK 4A3GC 3HOUK 3HOZC 3GTOC 4BY1K 4OIPA 5FJ8K 2E2HC 1YNJA 3GTLC 3M4OK 3S1NC 4Y7NK 2CW0A 2NVXC 2WAQL 4KN7A 4C3HC 1TWAK 3HOXC 3GTPK 3HOZK 2JA5C 4BXXC 3PO2K 3S2HC 2NVTC 2E2HK 3GTJC 3I4MK 1TWCC 5C4JC 2BE5A 3PO3K 3HOVC 2JA6C 4C3HK 4BBSK 4A3LK 2NVYK 3HOXK 3GTQC 2NVTK 4GZYA 3S15C 3GTJK 5IYDK 5C4JK 2WAQD 3RZOC 3HOVK 2O5IA 4A3IK 5M3MK 4MEYA 3GTQK 2JA8C 1TWFC 4LK1A
chains in the Genus database with same CATH superfamily
5C4XC 1JQWA 1TWHK 4G7ZA 1ZXOA 3A8IA 4KM8A 4ILDA 1Y1WK 2VUMA 1DD5A 4IOAS 5TMFA 3NUHA 2XCQA 4G0VA 4A3KC 3HXAA 3GEIA 4XCHA 1PJ6A 3SZYA 4G0UA 5HL8A 4A3GK 4WFBS 3H0GA 4LJZA 4P5AA 1VH2A 4KB2A 4GTFA 2Y0SD 2A69A 1IBAA 3S2HK 3GTGC 4BKWA 5IYCC 1I50C 3FKIK 5TMCA 4KMAA 3AH5A 4GTDA 4KB4A 2E2IA 4YG2A 2JA7A 3RZDC 4Y52C 4GTAA 1K83A 1X31C 4X6AC 3ERED 4XSZA 3T02A 4IO9S 1HI9A 4C3IC 1C0AA 3S0XA 2WB1L 2V6SA 4A3KK 3M3YC 2KWAA 3EQLA 2R93C 1JVIA 4WJ3M 1DCOA 3OEPA 1F7VA 4PAAA 1JOEA 2WB1D 1O25A 1I3QC 1WOSA 3S1QK 5JVHS 3GTGK 4AYBD 5IYCK 1I50K 5EGHA 3I4MC 2V6UA 1TWAA 3PO3C 3GTPA 4G7HA 4BBSC 2NVQK 5EGEA 2R92K 4C2MK 4KMUA 4A93K 1EFWA 1J6XA 2Y3PA 3HKZL 1O26A 4P9SA 3L4KA 3BUEA 5M5YK 5FLMK 1DCHA 4LLGA 4A3FC 1J6VA 4BLAA 3M3YK 3M4OC 1TWFA 2L3UA 4KDDA 4DDQA 4BY1K 4U67S 1VGXA 3AD9C 4LQYA 5CJ9A 4KN7A 3HOZK 2E2HK 3GTJC 3I4MK 2P5MA 1TWCC 2NVXA 2BE5A 3PO3K 5JVGS 4C3HK 4BBSK 3GDZA 3S15C 2JA6A 3HOVK 1ZVUA 1EQRA 2XCRB 3S2DC 1V5VA 4A3DC 1ZBSA 3LYWA 2GAGC 3L4JA 4A3FK 1F9NA 2YU9C 4PABA 5IP7C 1WOOA 3H3VL 1TWGK 2B63A 4C45A 1EK8A 1FEUA 4M1XA 4A3BC 2FQOA 3OPFA 3OREA 3FKIC 2A6EA 1SFOC 5M3FK 1Y1VC 3DXJA 1YNNA 3H3VD 2PA8D 1TWCK 2R93A 1F93A 3BP8C 4WJ4A 3S15K 4Q5SA 3TFIA 3CQZA 1I3QA 2R7ZC 1EH1A 3ADAC 5JVOA 3S1MC 4GTEA 4XSXA 2A68A 3S2DK 2Y0SL 3HOYK 4A3DK 1WQGA 3GSIA 2PHCB 4NOIA 4A3CK 1G51A 2YU9K 5IP7K 1R9TC 4BLBA 4BY7C 3T01A 5DM6S 3TTGA 3LPXA 3S1QC 4A3BK 3GTMK 1SFOK 1Y1VK 4JK1A 4Y7NC 4QIWL 1BS2A 3PO2C 2NVQC 2R92C 4C2MC 5DM7S 4A93C 3GEEA 3S16K 3GEHA 4Q4ZA 5IOTA 3AQOA 2KXYA 3JSTA 4GT9A 2XCOA 3I4NK 4OINA 2R7ZK 4QIWD 2NVYA 4A3IC 3S1MK 1O29A 3GTJA 5FLMC 3T00A 4WFNS 4J3NA 4AYBL 1XZQB 1O2AA 1I6HC 4YFNA 3AD7C 1TWHA 4BY1C 1INNA 1R9TK 3FOEA 4BY7K 1USOA 1Y1WA 3HOZC 4WILA 3GTOC 4G0WA 2E2HC 3GTLC 4Y7NK 2CW0A 4C3HC 3PO2K 2KQ1A 2JA5C 4BXXC 3G4AA 3HOVC 1O2BA 3HOXK 3FKIA 2NVTK 4GZYA 5C4JK 3RZOC 3CAGA 4A3IK 5M3MK 4MEYA 3GTQK 2JA8C 4WF9S 1SMYA 2VUMC 1TWGC 4BBRC 1I6HK 1PJ7A 3AD8C 1IE0A 3GTKA 3H0GC 4QJVB 5IOQA 4A3EK 1B4AA 3IPJA 3A8KA 3GTOK 1IL2A 1J98A 3GTLK 3PIOS 5E68A 1ZYRA 4WFAS 2JA5K 4BXXK 3HOWK 4MQ9A 2E2IC 2JA7C 5JFEA 3GIRA 1IW7A 4RMFA 3GTGA 4MEXA 1I50A 5IP9C 1K83C 1IS1A 1WCMK 3HOYC 1ZQ1C 3GTKK 3RZOK 1I6VA 1VRQC 3CQZK 2R92A 1IQ0A 2JA8K 4OIQA 4A3CC 4WCES 3Q3QA 2VUMK 5D4DA 4BBRK 2PA8L 1WSVA 4A3JC 3N0BA 1O28A 2GAHC 1HQMA 3GTMC 1WQFA 3H0GK 4A3MC 4C3JK 5M5WK 2E2JK 4KMDA 3G4CA 3S17K 4KN4A 2D6FC 3S16C 1XZPA 4OIRA 2KPUA 4YFXA 1TWAC 3GTPC 2E2IK 2JA7K 5CHPA 2FQTA 3I4NC 1O2FB 5C3EK 3FHZA 1XZPB 3VA7A 1XXAA 1BDFA 4KARA 5IOSA 3K7AK 5IP9K 1K83K 1WQHA 2RH6A 4LR2A 2RGRA 3PIPS 2L5NA 4GTLA 4LOWA 1BJTA 1XXCA 4XLPA 4YFKA 4A3JK 1WIHA 2W7VA 5C44K 3S1RK 1YX2A 3QX3A 4A3MK 1KQ4A 4XLNA 5M5XK 3HOUK 4OIPA 5FJ8K 1TWGA 1YNJA 1F7UA 1UV7A 3SZZA 1VLOA 2NVXC 2WAQL 1TWAK 3V4GA 3HOXC 3GTPK 2NVTC 1ISEA 5C4JC 2ZFZA 3DLLS 2JA6C 1XZQA 4FM9A 1B4BA 3GTQC 4O2DA 1TWCA 2WAQD 2O5IA 2CFAA 5L46A 5HQHA 3S1NC 4P5BA 2JH3A 3N3YA 4A3EC 4KATA 2CFAB 2B63C 1TWFK 4LK0A 2EBBA 5C4XK 3LAJA 5TJ3A 1WSRA 2O5JA 1O24A 2YU9A 3HOWC 1L0WA 4KAWX 2GSNA 2NVXK 1XPPA 3GTMA 1EI6A 4KM9A 1WCMC 4KMHA 3GTKC 1Y1VA 1SFOA 4ZH4A 2JA6K 3WODA 3CQZC 2GSOA 4KASA 2V6TA 1DCPA 4QJVA 2ZJQS 3RZDK 3TFHA 3S1NK 2A6HA 2GSUA 3A8JA 2R7ZA 3BP3A 4Y52K 2ZJRS 1O27A 4GFQA 4OIOA 4C3JC 2B63K 2E2JC 4KC6A 4X6AK 1AB4A 2P8TA 5IYBC 4FZBA 3FOFA 3S17C 4C3IK 2PPBA 1R9TA 2PMZL 4GTCA 5C3EC 2R93K 1WOPA 3HKZD 1USMA 1XXBA 3K7AC 1I3QK 2PMZD 3AQPA 4A3LC 2NVYC 1GE9A 2ZJPS 5IYDC 4G7OA 1VJEA 3LAPA 3S14C 5C44C 3S1RC 1TWHC 3GTQA 3HOUC 1Y1WC 5IYBK 5IORA 1BGWA 2ZUEA 3CF5S 4A3GC 4IOCS 1J6WA 3M4OK 1PJ5A 1WORA 3GTOA 2E2HA 3GTLA 4AH6A 3S2HC 1YCLA 2JA5A 1RU0A 3TFJA 4A3LK 2NVYK 3N0CA 4GTBA 5IYDK 3GTJK 2ZUFA 5HL7S 1WCMA 3S14K 1TWFC 3MMLB 4LK1A
chains in the Genus database with same CATH topology
1SMYA 3S2DC 5C4XC 1TWHK 2VUMC 4A3DC 1TWGC 4BBRC 4A3EC 4G7ZA 1I6HK 2B63C 1TWFK 4LK0A 1Y1WK 5TMFA 4A3FK 5C4XK 2YU9C 5IP7C 3H3VL 4A3KC 1TWGK 2O5JA 3H0GC 4QJVB 4A3EK 4A3GK 3GTOK 3HOWC 4A3BC 4LJZA 3GTLK 3FKIC 2A6EA 2NVXK 1SFOC 5M3FK 1Y1VC 3DXJA 1YNNA 1ZYRA 2A69A 2Y0SD 3H3VD 1XPPA 2JA5K 3HOWK 3S2HK 4BXXK 3GTGC 4MQ9A 2PA8D 2E2IC 5IYCC 1I50C 1WCMC 2JA7C 3GTKC 1TWCK 5TMCA 3FKIK 1IW7A 4ZH4A 2JA6K 3WODA 3CQZC 4YG2A 4MEXA 3RZDC 3S15K 5IP9C 1K83C 4Y52C 4Q5SA 3HOYC 1WCMK 3GTKK 3RZOK 2R7ZC 1I6VA 4QJVA 3CQZK 3S1MC 4OIQA 4A3CC 4X6AC 4XSXA 3RZDK 2A68A 2A6HA 2JA8K 3S1NK 3S2DK 4Y52K 2Y0SL 2VUMK 3HOYK 4A3DK 4XSZA 5D4DA 4BBRK 2PA8L 4C3IC 4A3JC 4OIOA 4C3JC 2B63K 4NOIA 4A3CK 2E2JC 4X6AK 2WB1L 2YU9K 5IYBC 1HQMA 1R9TC 3GTMC 3S17C 5IP7K 4A3KK 3H0GK 4BY7C 3M3YC 3EQLA 4A3MC 2R93C 4C3IK 4C3JK 5M5WK 2PPBA 2E2JK 3S1QC 4A3BK 3GTMK 2PMZL 3S17K 4KN4A 5C3EC 3S16C 2R93K 1SFOK 3HKZD 2WB1D 1I3QC 1Y1VK 4JK1A 4Y7NC 4OIRA 3S1QK 4QIWL 4YFXA 1TWAC 3PO2C 3K7AC 3GTPC 2NVQC 4AYBD 2R92C 1I50K 5IYCK 2E2IK 4C2MC 3I4MC 2JA7K 3I4NC 5C3EK 4A93C 3S16K 3PO3C 1I3QK 3S14K 4G7HA 4Q4ZA 1BDFA 2PMZD 4BBSC 4A3LC 2NVYC 3K7AK 2NVQK 5IP9K 1K83K 2R92K 5IYDC 4C2MK 3I4NK 4KMUA 4OINA 4G7OA 2R7ZK 4QIWD 4A93K 4A3IC 3S1MK 3GTGK 3HKZL 5FLMC 3S14C 5C44C 3S1RC 1TWHC 4XLPA 4AYBL 4YFKA 4A3JK 1I6HC 5M5YK 4YFNA 3HOUC 5FLMK 1Y1WC 4BY1C 5C44K 5IYBK 1R9TK 4LLGA 4A3FC 3S1RK 4BY7K 3M3YK 4A3MK 3M4OC 4XLNA 5M5XK 4A3GC 3HOUK 3HOZC 3GTOC 4BY1K 4OIPA 5FJ8K 2E2HC 1YNJA 3GTLC 3M4OK 3S1NC 4Y7NK 2CW0A 2NVXC 2WAQL 4KN7A 4C3HC 1TWAK 3HOXC 3GTPK 3HOZK 2JA5C 4BXXC 3PO2K 3S2HC 2NVTC 2E2HK 3GTJC 3I4MK 1TWCC 5C4JC 2BE5A 3PO3K 3HOVC 2JA6C 4C3HK 4BBSK 4A3LK 2NVYK 3HOXK 3GTQC 2NVTK 4GZYA 3S15C 3GTJK 5IYDK 5C4JK 2WAQD 3RZOC 3HOVK 2O5IA 4A3IK 5M3MK 4MEYA 3GTQK 2JA8C 1TWFC 4LK1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SMY A;  3S2D C;  5C4X C;  1TWH K;  2VUM C;  4A3D C;  1TWG C;  4BBR C;  4A3E C;  4G7Z A;  1I6H K;  2B63 C;  1TWF K;  4LK0 A;  1Y1W K;  5TMF A;  4A3F K;  5C4X K;  2YU9 C;  5IP7 C;  3H3V L;  4A3K C;  1TWG K;  2O5J A;  3H0G C;  4QJV B;  4A3E K;  4A3G K;  3GTO K;  3HOW C;  4A3B C;  4LJZ A;  3GTL K;  3FKI C;  2A6E A;  2NVX K;  1SFO C;  5M3F K;  1Y1V C;  3DXJ A;  1YNN A;  1ZYR A;  2A69 A;  2Y0S D;  3H3V D;  1XPP A;  2JA5 K;  3HOW K;  3S2H K;  4BXX K;  3GTG C;  4MQ9 A;  2PA8 D;  2E2I C;  5IYC C;  1I50 C;  1WCM C;  2JA7 C;  3GTK C;  1TWC K;  5TMC A;  3FKI K;  1IW7 A;  4ZH4 A;  2JA6 K;  3WOD A;  3CQZ C;  4YG2 A;  4MEX A;  3RZD C;  3S15 K;  5IP9 C;  1K83 C;  4Y52 C;  4Q5S A;  3HOY C;  1WCM K;  3GTK K;  3RZO K;  2R7Z C;  1I6V A;  4QJV A;  3CQZ K;  3S1M C;  4OIQ A;  4A3C C;  4X6A C;  4XSX A;  3RZD K;  2A68 A;  2A6H A;  2JA8 K;  3S1N K;  3S2D K;  4Y52 K;  2Y0S L;  2VUM K;  3HOY K;  4A3D K;  4XSZ A;  5D4D A;  4BBR K;  2PA8 L;  4C3I C;  4A3J C;  4OIO A;  4C3J C;  2B63 K;  4NOI A;  4A3C K;  2E2J C;  4X6A K;  2WB1 L;  2YU9 K;  5IYB C;  1HQM A;  1R9T C;  3GTM C;  3S17 C;  5IP7 K;  4A3K K;  3H0G K;  4BY7 C;  3M3Y C;  3EQL A;  4A3M C;  2R93 C;  4C3I K;  4C3J K;  5M5W K;  2PPB A;  2E2J K;  3S1Q C;  4A3B K;  3GTM K;  2PMZ L;  3S17 K;  4KN4 A;  5C3E C;  3S16 C;  2R93 K;  1SFO K;  3HKZ D;  2WB1 D;  1I3Q C;  1Y1V K;  4JK1 A;  4Y7N C;  4OIR A;  3S1Q K;  4QIW L;  4YFX A;  1TWA C;  3PO2 C;  3K7A C;  3GTP C;  2NVQ C;  4AYB D;  2R92 C;  1I50 K;  5IYC K;  2E2I K;  4C2M C;  3I4M C;  2JA7 K;  3I4N C;  5C3E K;  4A93 C;  3S16 K;  3PO3 C;  1I3Q K;  3S14 K;  4G7H A;  4Q4Z A;  1BDF A;  2PMZ D;  4BBS C;  4A3L C;  2NVY C;  3K7A K;  2NVQ K;  5IP9 K;  1K83 K;  2R92 K;  5IYD C;  4C2M K;  3I4N K;  4KMU A;  4OIN A;  4G7O A;  2R7Z K;  4QIW D;  4A93 K;  4A3I C;  3S1M K;  3GTG K;  3HKZ L;  5FLM C;  3S14 C;  5C44 C;  3S1R C;  1TWH C;  4XLP A;  4AYB L;  4YFK A;  4A3J K;  1I6H C;  5M5Y K;  4YFN A;  3HOU C;  5FLM K;  1Y1W C;  4BY1 C;  5C44 K;  5IYB K;  1R9T K;  4LLG A;  4A3F C;  3S1R K;  4BY7 K;  3M3Y K;  4A3M K;  3M4O C;  4XLN A;  5M5X K;  4A3G C;  3HOU K;  3HOZ C;  3GTO C;  4BY1 K;  4OIP A;  5FJ8 K;  2E2H C;  1YNJ A;  3GTL C;  3M4O K;  3S1N C;  4Y7N K;  2CW0 A;  2NVX C;  2WAQ L;  4KN7 A;  4C3H C;  1TWA K;  3HOX C;  3GTP K;  3HOZ K;  2JA5 C;  4BXX C;  3PO2 K;  3S2H C;  2NVT C;  2E2H K;  3GTJ C;  3I4M K;  1TWC C;  5C4J C;  2BE5 A;  3PO3 K;  3HOV C;  2JA6 C;  4C3H K;  4BBS K;  4A3L K;  2NVY K;  3HOX K;  3GTQ C;  2NVT K;  4GZY A;  3S15 C;  3GTJ K;  5IYD K;  5C4J K;  2WAQ D;  3RZO C;  3HOV K;  2O5I A;  4A3I K;  5M3M K;  4MEY A;  3GTQ K;  2JA8 C;  1TWF C;  4LK1 A; 
#chains in the Genus database with same CATH topology
 5C4X C;  1JQW A;  1TWH K;  4G7Z A;  1ZXO A;  3A8I A;  4KM8 A;  4ILD A;  1Y1W K;  2VUM A;  1DD5 A;  4IOA S;  5TMF A;  3NUH A;  2XCQ A;  4G0V A;  4A3K C;  3HXA A;  3GEI A;  4XCH A;  1PJ6 A;  3SZY A;  4G0U A;  5HL8 A;  4A3G K;  4WFB S;  3H0G A;  4LJZ A;  4P5A A;  1VH2 A;  4KB2 A;  4GTF A;  2Y0S D;  2A69 A;  1IBA A;  3S2H K;  3GTG C;  4BKW A;  5IYC C;  1I50 C;  3FKI K;  5TMC A;  4KMA A;  3AH5 A;  4GTD A;  4KB4 A;  2E2I A;  4YG2 A;  2JA7 A;  3RZD C;  4Y52 C;  4GTA A;  1K83 A;  1X31 C;  4X6A C;  3ERE D;  4XSZ A;  3T02 A;  4IO9 S;  1HI9 A;  4C3I C;  1C0A A;  3S0X A;  2WB1 L;  2V6S A;  4A3K K;  3M3Y C;  2KWA A;  3EQL A;  2R93 C;  1JVI A;  4WJ3 M;  1DCO A;  3OEP A;  1F7V A;  4PAA A;  1JOE A;  2WB1 D;  1O25 A;  1I3Q C;  1WOS A;  3S1Q K;  5JVH S;  3GTG K;  4AYB D;  5IYC K;  1I50 K;  5EGH A;  3I4M C;  2V6U A;  1TWA A;  3PO3 C;  3GTP A;  4G7H A;  4BBS C;  2NVQ K;  5EGE A;  2R92 K;  4C2M K;  4KMU A;  4A93 K;  1EFW A;  1J6X A;  2Y3P A;  3HKZ L;  1O26 A;  4P9S A;  3L4K A;  3BUE A;  5M5Y K;  5FLM K;  1DCH A;  4LLG A;  4A3F C;  1J6V A;  4BLA A;  3M3Y K;  3M4O C;  1TWF A;  2L3U A;  4KDD A;  4DDQ A;  4BY1 K;  4U67 S;  1VGX A;  3AD9 C;  4LQY A;  5CJ9 A;  4KN7 A;  3HOZ K;  2E2H K;  3GTJ C;  3I4M K;  2P5M A;  1TWC C;  2NVX A;  2BE5 A;  3PO3 K;  5JVG S;  4C3H K;  4BBS K;  3GDZ A;  3S15 C;  2JA6 A;  3HOV K;  1ZVU A;  1EQR A;  2XCR B;  3S2D C;  1V5V A;  4A3D C;  1ZBS A;  3LYW A;  2GAG C;  3L4J A;  4A3F K;  1F9N A;  2YU9 C;  4PAB A;  5IP7 C;  1WOO A;  3H3V L;  1TWG K;  2B63 A;  4C45 A;  1EK8 A;  1FEU A;  4M1X A;  4A3B C;  2FQO A;  3OPF A;  3ORE A;  3FKI C;  2A6E A;  1SFO C;  5M3F K;  1Y1V C;  3DXJ A;  1YNN A;  3H3V D;  2PA8 D;  1TWC K;  2R93 A;  1F93 A;  3BP8 C;  4WJ4 A;  3S15 K;  4Q5S A;  3TFI A;  3CQZ A;  1I3Q A;  2R7Z C;  1EH1 A;  3ADA C;  5JVO A;  3S1M C;  4GTE A;  4XSX A;  2A68 A;  3S2D K;  2Y0S L;  3HOY K;  4A3D K;  1WQG A;  3GSI A;  2PHC B;  4NOI A;  4A3C K;  1G51 A;  2YU9 K;  5IP7 K;  1R9T C;  4BLB A;  4BY7 C;  3T01 A;  5DM6 S;  3TTG A;  3LPX A;  3S1Q C;  4A3B K;  3GTM K;  1SFO K;  1Y1V K;  4JK1 A;  4Y7N C;  4QIW L;  1BS2 A;  3PO2 C;  2NVQ C;  2R92 C;  4C2M C;  5DM7 S;  4A93 C;  3GEE A;  3S16 K;  3GEH A;  4Q4Z A;  5IOT A;  3AQO A;  2KXY A;  3JST A;  4GT9 A;  2XCO A;  3I4N K;  4OIN A;  2R7Z K;  4QIW D;  2NVY A;  4A3I C;  3S1M K;  1O29 A;  3GTJ A;  5FLM C;  3T00 A;  4WFN S;  4J3N A;  4AYB L;  1XZQ B;  1O2A A;  1I6H C;  4YFN A;  3AD7 C;  1TWH A;  4BY1 C;  1INN A;  1R9T K;  3FOE A;  4BY7 K;  1USO A;  1Y1W A;  3HOZ C;  4WIL A;  3GTO C;  4G0W A;  2E2H C;  3GTL C;  4Y7N K;  2CW0 A;  4C3H C;  3PO2 K;  2KQ1 A;  2JA5 C;  4BXX C;  3G4A A;  3HOV C;  1O2B A;  3HOX K;  3FKI A;  2NVT K;  4GZY A;  5C4J K;  3RZO C;  3CAG A;  4A3I K;  5M3M K;  4MEY A;  3GTQ K;  2JA8 C;  4WF9 S;  1SMY A;  2VUM C;  1TWG C;  4BBR C;  1I6H K;  1PJ7 A;  3AD8 C;  1IE0 A;  3GTK A;  3H0G C;  4QJV B;  5IOQ A;  4A3E K;  1B4A A;  3IPJ A;  3A8K A;  3GTO K;  1IL2 A;  1J98 A;  3GTL K;  3PIO S;  5E68 A;  1ZYR A;  4WFA S;  2JA5 K;  4BXX K;  3HOW K;  4MQ9 A;  2E2I C;  2JA7 C;  5JFE A;  3GIR A;  1IW7 A;  4RMF A;  3GTG A;  4MEX A;  1I50 A;  5IP9 C;  1K83 C;  1IS1 A;  1WCM K;  3HOY C;  1ZQ1 C;  3GTK K;  3RZO K;  1I6V A;  1VRQ C;  3CQZ K;  2R92 A;  1IQ0 A;  2JA8 K;  4OIQ A;  4A3C C;  4WCE S;  3Q3Q A;  2VUM K;  5D4D A;  4BBR K;  2PA8 L;  1WSV A;  4A3J C;  3N0B A;  1O28 A;  2GAH C;  1HQM A;  3GTM C;  1WQF A;  3H0G K;  4A3M C;  4C3J K;  5M5W K;  2E2J K;  4KMD A;  3G4C A;  3S17 K;  4KN4 A;  2D6F C;  3S16 C;  1XZP A;  4OIR A;  2KPU A;  4YFX A;  1TWA C;  3GTP C;  2E2I K;  2JA7 K;  5CHP A;  2FQT A;  3I4N C;  1O2F B;  5C3E K;  3FHZ A;  1XZP B;  3VA7 A;  1XXA A;  1BDF A;  4KAR A;  5IOS A;  3K7A K;  5IP9 K;  1K83 K;  1WQH A;  2RH6 A;  4LR2 A;  2RGR A;  3PIP S;  2L5N A;  4GTL A;  4LOW A;  1BJT A;  1XXC A;  4XLP A;  4YFK A;  4A3J K;  1WIH A;  2W7V A;  5C44 K;  3S1R K;  1YX2 A;  3QX3 A;  4A3M K;  1KQ4 A;  4XLN A;  5M5X K;  3HOU K;  4OIP A;  5FJ8 K;  1TWG A;  1YNJ A;  1F7U A;  1UV7 A;  3SZZ A;  1VLO A;  2NVX C;  2WAQ L;  1TWA K;  3V4G A;  3HOX C;  3GTP K;  2NVT C;  1ISE A;  5C4J C;  2ZFZ A;  3DLL S;  2JA6 C;  1XZQ A;  4FM9 A;  1B4B A;  3GTQ C;  4O2D A;  1TWC A;  2WAQ D;  2O5I A;  2CFA A;  5L46 A;  5HQH A;  3S1N C;  4P5B A;  2JH3 A;  3N3Y A;  4A3E C;  4KAT A;  2CFA B;  2B63 C;  1TWF K;  4LK0 A;  2EBB A;  5C4X K;  3LAJ A;  5TJ3 A;  1WSR A;  2O5J A;  1O24 A;  2YU9 A;  3HOW C;  1L0W A;  4KAW X;  2GSN A;  2NVX K;  1XPP A;  3GTM A;  1EI6 A;  4KM9 A;  1WCM C;  4KMH A;  3GTK C;  1Y1V A;  1SFO A;  4ZH4 A;  2JA6 K;  3WOD A;  3CQZ C;  2GSO A;  4KAS A;  2V6T A;  1DCP A;  4QJV A;  2ZJQ S;  3RZD K;  3TFH A;  3S1N K;  2A6H A;  2GSU A;  3A8J A;  2R7Z A;  3BP3 A;  4Y52 K;  2ZJR S;  1O27 A;  4GFQ A;  4OIO A;  4C3J C;  2B63 K;  2E2J C;  4KC6 A;  4X6A K;  1AB4 A;  2P8T A;  5IYB C;  4FZB A;  3FOF A;  3S17 C;  4C3I K;  2PPB A;  1R9T A;  2PMZ L;  4GTC A;  5C3E C;  2R93 K;  1WOP A;  3HKZ D;  1USM A;  1XXB A;  3K7A C;  1I3Q K;  2PMZ D;  3AQP A;  4A3L C;  2NVY C;  1GE9 A;  2ZJP S;  5IYD C;  4G7O A;  1VJE A;  3LAP A;  3S14 C;  5C44 C;  3S1R C;  1TWH C;  3GTQ A;  3HOU C;  1Y1W C;  5IYB K;  5IOR A;  1BGW A;  2ZUE A;  3CF5 S;  4A3G C;  4IOC S;  1J6W A;  3M4O K;  1PJ5 A;  1WOR A;  3GTO A;  2E2H A;  3GTL A;  4AH6 A;  3S2H C;  1YCL A;  2JA5 A;  1RU0 A;  3TFJ A;  4A3L K;  2NVY K;  3N0C A;  4GTB A;  5IYD K;  3GTJ K;  2ZUF A;  5HL7 S;  1WCM A;  3S14 K;  1TWF C;  3MML B;  4LK1 A; 
#chains in the Genus database with same CATH homology
 1SMY A;  3S2D C;  5C4X C;  1TWH K;  2VUM C;  4A3D C;  1TWG C;  4BBR C;  4A3E C;  4G7Z A;  1I6H K;  2B63 C;  1TWF K;  4LK0 A;  1Y1W K;  5TMF A;  4A3F K;  5C4X K;  2YU9 C;  5IP7 C;  3H3V L;  4A3K C;  1TWG K;  2O5J A;  3H0G C;  4QJV B;  4A3E K;  4A3G K;  3GTO K;  3HOW C;  4A3B C;  4LJZ A;  3GTL K;  3FKI C;  2A6E A;  2NVX K;  1SFO C;  5M3F K;  1Y1V C;  3DXJ A;  1YNN A;  1ZYR A;  2A69 A;  2Y0S D;  3H3V D;  1XPP A;  2JA5 K;  3HOW K;  3S2H K;  4BXX K;  3GTG C;  4MQ9 A;  2PA8 D;  2E2I C;  5IYC C;  1I50 C;  1WCM C;  2JA7 C;  3GTK C;  1TWC K;  5TMC A;  3FKI K;  1IW7 A;  4ZH4 A;  2JA6 K;  3WOD A;  3CQZ C;  4YG2 A;  4MEX A;  3RZD C;  3S15 K;  5IP9 C;  1K83 C;  4Y52 C;  4Q5S A;  3HOY C;  1WCM K;  3GTK K;  3RZO K;  2R7Z C;  1I6V A;  4QJV A;  3CQZ K;  3S1M C;  4OIQ A;  4A3C C;  4X6A C;  4XSX A;  3RZD K;  2A68 A;  2A6H A;  2JA8 K;  3S1N K;  3S2D K;  4Y52 K;  2Y0S L;  2VUM K;  3HOY K;  4A3D K;  4XSZ A;  5D4D A;  4BBR K;  2PA8 L;  4C3I C;  4A3J C;  4OIO A;  4C3J C;  2B63 K;  4NOI A;  4A3C K;  2E2J C;  4X6A K;  2WB1 L;  2YU9 K;  5IYB C;  1HQM A;  1R9T C;  3GTM C;  3S17 C;  5IP7 K;  4A3K K;  3H0G K;  4BY7 C;  3M3Y C;  3EQL A;  4A3M C;  2R93 C;  4C3I K;  4C3J K;  5M5W K;  2PPB A;  2E2J K;  3S1Q C;  4A3B K;  3GTM K;  2PMZ L;  3S17 K;  4KN4 A;  5C3E C;  3S16 C;  2R93 K;  1SFO K;  3HKZ D;  2WB1 D;  1I3Q C;  1Y1V K;  4JK1 A;  4Y7N C;  4OIR A;  3S1Q K;  4QIW L;  4YFX A;  1TWA C;  3PO2 C;  3K7A C;  3GTP C;  2NVQ C;  4AYB D;  2R92 C;  1I50 K;  5IYC K;  2E2I K;  4C2M C;  3I4M C;  2JA7 K;  3I4N C;  5C3E K;  4A93 C;  3S16 K;  3PO3 C;  1I3Q K;  3S14 K;  4G7H A;  4Q4Z A;  1BDF A;  2PMZ D;  4BBS C;  4A3L C;  2NVY C;  3K7A K;  2NVQ K;  5IP9 K;  1K83 K;  2R92 K;  5IYD C;  4C2M K;  3I4N K;  4KMU A;  4OIN A;  4G7O A;  2R7Z K;  4QIW D;  4A93 K;  4A3I C;  3S1M K;  3GTG K;  3HKZ L;  5FLM C;  3S14 C;  5C44 C;  3S1R C;  1TWH C;  4XLP A;  4AYB L;  4YFK A;  4A3J K;  1I6H C;  5M5Y K;  4YFN A;  3HOU C;  5FLM K;  1Y1W C;  4BY1 C;  5C44 K;  5IYB K;  1R9T K;  4LLG A;  4A3F C;  3S1R K;  4BY7 K;  3M3Y K;  4A3M K;  3M4O C;  4XLN A;  5M5X K;  4A3G C;  3HOU K;  3HOZ C;  3GTO C;  4BY1 K;  4OIP A;  5FJ8 K;  2E2H C;  1YNJ A;  3GTL C;  3M4O K;  3S1N C;  4Y7N K;  2CW0 A;  2NVX C;  2WAQ L;  4KN7 A;  4C3H C;  1TWA K;  3HOX C;  3GTP K;  3HOZ K;  2JA5 C;  4BXX C;  3PO2 K;  3S2H C;  2NVT C;  2E2H K;  3GTJ C;  3I4M K;  1TWC C;  5C4J C;  2BE5 A;  3PO3 K;  3HOV C;  2JA6 C;  4C3H K;  4BBS K;  4A3L K;  2NVY K;  3HOX K;  3GTQ C;  2NVT K;  4GZY A;  3S15 C;  3GTJ K;  5IYD K;  5C4J K;  2WAQ D;  3RZO C;  3HOV K;  2O5I A;  4A3I K;  5M3M K;  4MEY A;  3GTQ K;  2JA8 C;  1TWF C;  4LK1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...