1IW7A

Crystal structure of the rna polymerase holoenzyme from thermus thermophilus at 2.6a resolution
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
229
structure length
229
Chain Sequence
MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA polymerase alpha subunit
publication title Crystal structure of a bacterial RNA polymerase holoenzyme at 2.6 A resolution
pubmed doi rcsb
molecule tags Transferase
total genus 40
structure length 229
sequence length 229
chains with identical sequence B, K, L
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2002-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01000 RNA_pol_A_bac RNA polymerase Rpb3/RpoA insert domain
A PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain
A PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.12 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 DNA-directed RNA polymerase, insert domain 1iw7A02
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 1iw7A01
1K83C 5IYBK 5FLMC 4LK0A 4AYBD 3I4MK 4X6AK 3S1RC 4A3LK 1WCMK 1I3QK 5IP9K 4XSZA 4KN7A 4A3CC 3S2DC 3PO3C 5C44C 1R9TK 2PA8D 3GTPC 1XPPA 2PMZL 4Y52K 4YG2A 5C4JC 4A3MK 2JA5K 4YFXA 1TWCC 1TWGC 4MEXA 4BXXC 2VUMC 2E2JK 4ZH4A 3HOUC 3GTOC 3GTGC 2NVYK 5M5WK 4A3IK 3S17K 3GTKK 3S1MK 3H0GC 3M4OC 1HQMA 2NVXK 4XLNA 3HKZD 4QIWD 4G7ZA 4BY1C 5M3FK 2B63C 4KN4A 1I50K 3PO2C 4A3GK 5M5XK 1Y1WC 2JA7C 1Y1VK 3GTQK 4QJVB 4A3JC 4XLPA 1TWFC 3H3VD 2A6EA 2YU9K 3S2HC 1ZYRA 4A3BC 4KMUA 4BBSC 2Y0SL 4MEYA 3M3YC 5C3EK 3HOZK 4OIPA 1TWAK 1I6HC 3CQZK 1TWHK 3S1NK 2JA6K 4A3FC 3S14K 4LLGA 2JA8C 2R93C 3WODA 4BBRK 4C3IK 1YNNA 3S16K 4OIQA 2R92K 2CW0A 4BY7C 4A3DK 5IP7C 2A68A 3S15C 2A69A 1I6VA 3I4MC 2WAQL 3HOYC 3S1RK 4LJZA 4A3CK 3HOVC 4GZYA 4Q5SA 4AYBL 3HOXK 5C44K 3PO3K 3S2DK 5FJ8K 2NVTK 4OIOA 4OIRA 2E2JC 4G7OA 5C4XC 5IYCC 2WB1L 1TWCK 1TWGK 4A3KK 2E2HC 2VUMK 4MQ9A 3K7AK 3HOUK 4C2MC 2NVYC 3FKIC 4A3IC 3GTGK 3GTOK 2NVXC 3H0GK 3M4OK 2PPBA 4A3EC 3RZDC 3I4NC 3S1QK 2E2IC 3DXJA 3GTMK 2R7ZK 5TMFA 2NVQK 4C3JC 5IYDK 1BDFA 3HOWK 4A3GC 2B63K 2Y0SD 4JK1A 3PO2K 1SFOC 3GTJK 3EQLA 4Y7NK 1Y1WK 4G7HA 4C3HC 5M5YK 4A93C 2R7ZC 1TWFK 3GTLK 3RZOC 4Q4ZA 4BBSK 5IYBC 4X6AC 1TWAC 1K83K 5FLMK 1I6HK 1TWHC 1WCMC 1I3QC 5IP9C 2PMZD 2O5IA 2JA6C 4A3LC 4A3FK 4BBRC 4XSXA 4C3IC 2JA8K 3S16C 2R93K 1R9TC 2WAQD 4Y52C 4A3DC 3GTPK 4A3MC 2JA5C 5IP7K 5C4JK 3S15K 4BXXK 1YNJA 2PA8L 3S17C 3S1MC 3HOYK 3GTKC 2WB1D 3HOXC 4NOIA 3HOVK 1IW7A 2NVTC 3RZOK 4A3KC 1I50C 4BY1K 1SMYA 5C4XK 5IYCK 3K7AC 1Y1VC 2E2HK 3GTQC 3HKZL 5D4DA 4QIWL 2YU9C 4C2MK 5M3MK 3FKIK 4A3JK 2JA7K 5C3EC 3S1QC 3HOZC 3S2HK 4A3BK 4YFKA 4A3EK 3GTMC 3RZDK 3I4NK 2E2IK 3M3YK 3CQZC 2O5JA 2NVQC 5IYDC 3H3VL 5TMCA 3HOWC 3S1NC 4C3JK 3S14C 4LK1A 2BE5A 3GTJC 4Y7NC 1SFOK 4YFNA 2R92C 4C3HK 4A93K 4QJVA 3GTLC 4BY7K 2A6HA 4OINA
chains in the Genus database with same CATH superfamily
1K83C 1V5VA 4A3LK 4G0WA 1I3QK 5EGHA 2ZUFA 4GTCA 3PIOS 2GAHC 5C44C 1R9TK 5HL7S 4KMDA 2JA5K 4YFXA 1BS2A 1TWGC 5DM6S 4BXXC 2E2JK 1J98A 3GTOC 3GTGC 2NVYK 3M4OC 2NVXK 4KB2A 4WFAS 2JA7A 5TJ3A 2V6UA 3FKIA 4G7ZA 4LR2A 5M3FK 3CF5S 4KN4A 4QJVB 4XLPA 2A6EA 4GTEA 2Y0SL 4BBSC 4MEYA 1VJEA 1SFOA 4KASA 3S1NK 1PJ5A 4BBRK 3S16K 4DDQA 1WCMA 1WIHA 3S15C 3T01A 1I6VA 3I4MC 4KC6A 2WAQL 3HOYC 3S1RK 4LQYA 1VGXA 3HOVC 3GDZA 4WILA 5FJ8K 2NVTK 1O24A 4OIRA 4G7OA 5C4XC 3BP8C 5IYCC 4P5AA 3FKIC 3GEIA 1EFWA 3RZDC 2ZJQS 2R7ZK 2ZUEA 3LYWA 1BDFA 4GFQA 4A3GC 3ERED 2B63K 1SFOC 1TWAA 5M5YK 5HL8A 3N0CA 5IYBC 1J6VA 3TFIA 1WCMC 3A8IA 2O5IA 2ZJRS 2R93K 3T02A 4WJ3M 5IP7K 3LPXA 2PHCB 5C4JK 3V4GA 4KDDA 3S17C 2GSOA 2GSNA 2WB1D 1TWCA 4IOAS 4BY1K 2JH3A 1O2FB 1GE9A 3AD7C 3HKZL 5D4DA 4QIWL 4C2MK 4GTFA 1EH1A 2D6FC 5C3EC 3S2HK 4A3BK 2W7VA 3JSTA 3GTMC 2XCRB 3M3YK 3H3VL 3HOWC 4C3JK 3S14C 3AD8C 3GTJC 4Y7NC 1K83A 4YFNA 4A93K 3GTLC 1ZBSA 4BY7K 1IL2A 4AYBD 2XCOA 2GAGC 3S2DC 5IOSA 2PA8D 1RU0A 4Y52K 4P5BA 5JVOA 1WQGA 1TWCC 4ZH4A 2ZFZA 1ZQ1C 3S1MK 4GTBA 4A3IK 3GTKK 5CJ9A 2P8TA 3TTGA 4XLNA 1XXBA 1WOOA 1PJ7A 1I50K 5M5XK 4XCHA 2E2IA 1Y1VK 1DCPA 4A3JC 1ZYRA 4KMUA 1AB4A 3HOZK 1I6HC 3CQZK 1TWHK 2JA6K 5JVHS 4FZBA 3IPJA 1O2BA 4C3IK 1DCHA 5JFEA 4OIQA 1O27A 4A3DK 2A68A 4G0UA 4GTLA 1VLOA 3BP3A 4PAAA 4WF9S 5EGEA 4AYBL 3HOXK 5C44K 2FQOA 4KMHA 2E2JC 3L4KA 1F7UA 1TWGK 3K7AK 3LAJA 2NVYC 1XXCA 3GTGK 3GTOK 3G4AA 2NVXC 3QX3A 3TFHA 3M4OK 2PPBA 3S1QK 3I4NC 2E2IC 4GTDA 3GTQA 2YU9A 3DLLS 2NVQK 5IYDK 1J6XA 3ADAC 4WJ4A 4C3HC 3SZZA 4FM9A 3RZOC 4M1XA 3AH5A 4IOCS 4BBSK 4X6AC 2R92A 5FLMK 3A8KA 3TFJA 5IP9C 2PMZD 4C45A 2ZJPS 4BBRC 3S16C 3GTPK 4KATA 4A3MC 3S15K 3LAPA 3HOYK 4BLBA 2VUMA 4P9SA 3HOVK 2NVTC 3CAGA 3H0GA 5C4XK 5IYCK 4G0VA 3GTMA 3GTQC 2V6TA 2JA7K 2YU9C 3FKIK 5IORA 3GTJA 3NUHA 3RZDK 1Y1WA 1TWFA 3GTLA 2BE5A 1USMA 1SFOK 2R92C 1JOEA 4WCES 3OEPA 5IYBK 4LK0A 3GEEA 1WCMK 4XSZA 1O26A 4WFBS 4A3CC 3PO3C 3PIPS 1XPPA 2PMZL 5C4JC 2Y3PA 4BKWA 2VUMC 5E68A 3HOUC 1JQWA 5CHPA 3S17K 3H0GC 1HQMA 3T00A 2E2HA 1KQ4A 2L5NA 1YX2A 4BY1C 1HI9A 1WSRA 3PO2C 1Y1WC 1TWFC 2KPUA 3BUEA 3S2HC 4A3BC 5C3EK 3M3YC 3VA7A 3Q3QA 1C0AA 1TWAK 3AD9C 2R7ZA 4A3FC 1XZPB 2JA8C 3S14K 1XZPA 2CFAB 3HXAA 2CFAA 1XXAA 1I3QA 2JA6A 4BY7C 2GSUA 2A69A 2XCQA 1R9TA 2RGRA 1BJTA 2JA5A 1ISEA 4LJZA 4Q5SA 3S2DK 2KXYA 2NVYA 4OIOA 2NVXA 2WB1L 3FOEA 4A3KK 1TWCK 5IOTA 2V6SA 2E2HC 4MQ9A 1WQFA 1O28A 4PABA 4A3IC 4ILDA 4AH6A 4A3EC 3DXJA 4KAWX 5HQHA 2Y0SD 3OPFA 3EQLA 4G7HA 1WSVA 1ZVUA 2R7ZC 3OREA 1VRQC 1JVIA 1VH2A 1K83K 1I6HK 1TWHC 4A3LC 1I3QC 2JA6C 4WFNS 4C3IC 5IOQA 1R9TC 3G4CA 2WAQD 4KM8A 4A3DC 2JA5C 5L46A 4BXXK 1YNJA 2KWAA 2PA8L 1XZQB 3GTPA 1XZQA 1DD5A 1ZXOA 3HOXC 4KARA 2RH6A 1IW7A 1L0WA 3K7AC 4O2DA 5M3MK 3L4JA 3GIRA 2B63A 3S1QC 1F93A 2EBBA 2L3UA 3I4NK 2E2IK 1J6WA 2O5JA 2NVQC 5IYDC 3S1NC 4LK1A 4C3HK 4QJVA 1O25A 4OINA 3RZOK 2R93A 1F9NA 5FLMC 3I4MK 4X6AK 3S1RC 5IP9K 4KN7A 3GTPC 4YG2A 4A3MK 4MEXA 1O29A 4GT9A 1BGWA 2FQTA 3GSIA 5M5WK 3MMLB 4GTAA 4BLAA 2KQ1A 1IBAA 3HKZD 4QIWD 2P5MA 2B63C 3SZYA 3AQPA 1X31C 5JVGS 4A3GK 4IO9S 2JA7C 3GTQK 2YU9K 3H3VD 1DCOA 4OIPA 1WOSA 4LLGA 2R93C 3WODA 3N3YA 1YNNA 1EK8A 4KMAA 1F7VA 2R92K 1WQHA 2CW0A 5IP7C 1IE0A 4A3CK 4GZYA 3PO3K 1FEUA 3GTKA 2VUMK 3HOUK 4C2MC 3FOFA 1I50A 3H0GK 3GTMK 1Y1VA 5TMFA 1B4BA 4C3JC 3HOWK 3FHZA 4JK1A 1IQ0A 3GTJK 3PO2K 4Y7NK 3CQZA 1Y1WK 4A93C 1UV7A 1TWHA 1TWFK 1WORA 3GTLK 4Q4ZA 3A8JA 1TWAC 3N0BA 4J3NA 1PJ6A 4A3FK 2JA8K 4XSXA 1EQRA 3GEHA 4Y52C 4KM9A 3S0XA 3S1MC 3AQOA 3GTKC 1EI6A 1USOA 1O2AA 1TWGA 4NOIA 1IS1A 1WOPA 4KB4A 3GTGA 3GTOA 4A3KC 1I50C 1SMYA 1G51A 4RMFA 1Y1VC 2E2HK 4A3JK 1B4AA 3HOZC 4YFKA 4A3EK 3CQZC 5TMCA 1INNA 4LOWA 5DM7S 4U67S 2A6HA 1YCLA
chains in the Genus database with same CATH topology
1K83C 5IYBK 5FLMC 4LK0A 4AYBD 3I4MK 4X6AK 3S1RC 4A3LK 1WCMK 1I3QK 5IP9K 4XSZA 4KN7A 4A3CC 3S2DC 3PO3C 5C44C 1R9TK 2PA8D 3GTPC 1XPPA 2PMZL 4Y52K 4YG2A 5C4JC 4A3MK 2JA5K 4YFXA 1TWCC 1TWGC 4MEXA 4BXXC 2VUMC 2E2JK 4ZH4A 3HOUC 3GTOC 3GTGC 2NVYK 5M5WK 4A3IK 3S17K 3GTKK 3S1MK 3H0GC 3M4OC 1HQMA 2NVXK 4XLNA 3HKZD 4QIWD 4G7ZA 4BY1C 5M3FK 2B63C 4KN4A 1I50K 3PO2C 4A3GK 5M5XK 1Y1WC 2JA7C 1Y1VK 3GTQK 4QJVB 4A3JC 4XLPA 1TWFC 3H3VD 2A6EA 2YU9K 3S2HC 1ZYRA 4A3BC 4KMUA 4BBSC 2Y0SL 4MEYA 3M3YC 5C3EK 3HOZK 4OIPA 1TWAK 1I6HC 3CQZK 1TWHK 3S1NK 2JA6K 4A3FC 3S14K 4LLGA 2JA8C 2R93C 3WODA 4BBRK 4C3IK 1YNNA 3S16K 4OIQA 2R92K 2CW0A 4BY7C 4A3DK 5IP7C 2A68A 3S15C 2A69A 1I6VA 3I4MC 2WAQL 3HOYC 3S1RK 4LJZA 4A3CK 3HOVC 4GZYA 4Q5SA 4AYBL 3HOXK 5C44K 3PO3K 3S2DK 5FJ8K 2NVTK 4OIOA 4OIRA 2E2JC 4G7OA 5C4XC 5IYCC 2WB1L 1TWCK 1TWGK 4A3KK 2E2HC 2VUMK 4MQ9A 3K7AK 3HOUK 4C2MC 2NVYC 3FKIC 4A3IC 3GTGK 3GTOK 2NVXC 3H0GK 3M4OK 2PPBA 4A3EC 3RZDC 3I4NC 3S1QK 2E2IC 3DXJA 3GTMK 2R7ZK 5TMFA 2NVQK 4C3JC 5IYDK 1BDFA 3HOWK 4A3GC 2B63K 2Y0SD 4JK1A 3PO2K 1SFOC 3GTJK 3EQLA 4Y7NK 1Y1WK 4G7HA 4C3HC 5M5YK 4A93C 2R7ZC 1TWFK 3GTLK 3RZOC 4Q4ZA 4BBSK 5IYBC 4X6AC 1TWAC 1K83K 5FLMK 1I6HK 1TWHC 1WCMC 1I3QC 5IP9C 2PMZD 2O5IA 2JA6C 4A3LC 4A3FK 4BBRC 4XSXA 4C3IC 2JA8K 3S16C 2R93K 1R9TC 2WAQD 4Y52C 4A3DC 3GTPK 4A3MC 2JA5C 5IP7K 5C4JK 3S15K 4BXXK 1YNJA 2PA8L 3S17C 3S1MC 3HOYK 3GTKC 2WB1D 3HOXC 4NOIA 3HOVK 1IW7A 2NVTC 3RZOK 4A3KC 1I50C 4BY1K 1SMYA 5C4XK 5IYCK 3K7AC 1Y1VC 2E2HK 3GTQC 3HKZL 5D4DA 4QIWL 2YU9C 4C2MK 5M3MK 3FKIK 4A3JK 2JA7K 5C3EC 3S1QC 3HOZC 3S2HK 4A3BK 4YFKA 4A3EK 3GTMC 3RZDK 3I4NK 2E2IK 3M3YK 3CQZC 2O5JA 2NVQC 5IYDC 3H3VL 5TMCA 3HOWC 3S1NC 4C3JK 3S14C 4LK1A 2BE5A 3GTJC 4Y7NC 1SFOK 4YFNA 2R92C 4C3HK 4A93K 4QJVA 3GTLC 4BY7K 2A6HA 4OINA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K83 C;  5IYB K;  5FLM C;  4LK0 A;  4AYB D;  3I4M K;  4X6A K;  3S1R C;  4A3L K;  1WCM K;  1I3Q K;  5IP9 K;  4XSZ A;  4KN7 A;  4A3C C;  3S2D C;  3PO3 C;  5C44 C;  1R9T K;  2PA8 D;  3GTP C;  1XPP A;  2PMZ L;  4Y52 K;  4YG2 A;  5C4J C;  4A3M K;  2JA5 K;  4YFX A;  1TWC C;  1TWG C;  4MEX A;  4BXX C;  2VUM C;  2E2J K;  4ZH4 A;  3HOU C;  3GTO C;  3GTG C;  2NVY K;  5M5W K;  4A3I K;  3S17 K;  3GTK K;  3S1M K;  3H0G C;  3M4O C;  1HQM A;  2NVX K;  4XLN A;  3HKZ D;  4QIW D;  4G7Z A;  4BY1 C;  5M3F K;  2B63 C;  4KN4 A;  1I50 K;  3PO2 C;  4A3G K;  5M5X K;  1Y1W C;  2JA7 C;  1Y1V K;  3GTQ K;  4QJV B;  4A3J C;  4XLP A;  1TWF C;  3H3V D;  2A6E A;  2YU9 K;  3S2H C;  1ZYR A;  4A3B C;  4KMU A;  4BBS C;  2Y0S L;  4MEY A;  3M3Y C;  5C3E K;  3HOZ K;  4OIP A;  1TWA K;  1I6H C;  3CQZ K;  1TWH K;  3S1N K;  2JA6 K;  4A3F C;  3S14 K;  4LLG A;  2JA8 C;  2R93 C;  3WOD A;  4BBR K;  4C3I K;  1YNN A;  3S16 K;  4OIQ A;  2R92 K;  2CW0 A;  4BY7 C;  4A3D K;  5IP7 C;  2A68 A;  3S15 C;  2A69 A;  1I6V A;  3I4M C;  2WAQ L;  3HOY C;  3S1R K;  4LJZ A;  4A3C K;  3HOV C;  4GZY A;  4Q5S A;  4AYB L;  3HOX K;  5C44 K;  3PO3 K;  3S2D K;  5FJ8 K;  2NVT K;  4OIO A;  4OIR A;  2E2J C;  4G7O A;  5C4X C;  5IYC C;  2WB1 L;  1TWC K;  1TWG K;  4A3K K;  2E2H C;  2VUM K;  4MQ9 A;  3K7A K;  3HOU K;  4C2M C;  2NVY C;  3FKI C;  4A3I C;  3GTG K;  3GTO K;  2NVX C;  3H0G K;  3M4O K;  2PPB A;  4A3E C;  3RZD C;  3I4N C;  3S1Q K;  2E2I C;  3DXJ A;  3GTM K;  2R7Z K;  5TMF A;  2NVQ K;  4C3J C;  5IYD K;  1BDF A;  3HOW K;  4A3G C;  2B63 K;  2Y0S D;  4JK1 A;  3PO2 K;  1SFO C;  3GTJ K;  3EQL A;  4Y7N K;  1Y1W K;  4G7H A;  4C3H C;  5M5Y K;  4A93 C;  2R7Z C;  1TWF K;  3GTL K;  3RZO C;  4Q4Z A;  4BBS K;  5IYB C;  4X6A C;  1TWA C;  1K83 K;  5FLM K;  1I6H K;  1TWH C;  1WCM C;  1I3Q C;  5IP9 C;  2PMZ D;  2O5I A;  2JA6 C;  4A3L C;  4A3F K;  4BBR C;  4XSX A;  4C3I C;  2JA8 K;  3S16 C;  2R93 K;  1R9T C;  2WAQ D;  4Y52 C;  4A3D C;  3GTP K;  4A3M C;  2JA5 C;  5IP7 K;  5C4J K;  3S15 K;  4BXX K;  1YNJ A;  2PA8 L;  3S17 C;  3S1M C;  3HOY K;  3GTK C;  2WB1 D;  3HOX C;  4NOI A;  3HOV K;  1IW7 A;  2NVT C;  3RZO K;  4A3K C;  1I50 C;  4BY1 K;  1SMY A;  5C4X K;  5IYC K;  3K7A C;  1Y1V C;  2E2H K;  3GTQ C;  3HKZ L;  5D4D A;  4QIW L;  2YU9 C;  4C2M K;  5M3M K;  3FKI K;  4A3J K;  2JA7 K;  5C3E C;  3S1Q C;  3HOZ C;  3S2H K;  4A3B K;  4YFK A;  4A3E K;  3GTM C;  3RZD K;  3I4N K;  2E2I K;  3M3Y K;  3CQZ C;  2O5J A;  2NVQ C;  5IYD C;  3H3V L;  5TMC A;  3HOW C;  3S1N C;  4C3J K;  3S14 C;  4LK1 A;  2BE5 A;  3GTJ C;  4Y7N C;  1SFO K;  4YFN A;  2R92 C;  4C3H K;  4A93 K;  4QJV A;  3GTL C;  4BY7 K;  2A6H A;  4OIN A; 
#chains in the Genus database with same CATH topology
 1K83 C;  1V5V A;  4A3L K;  4G0W A;  1I3Q K;  5EGH A;  2ZUF A;  4GTC A;  3PIO S;  2GAH C;  5C44 C;  1R9T K;  5HL7 S;  4KMD A;  2JA5 K;  4YFX A;  1BS2 A;  1TWG C;  5DM6 S;  4BXX C;  2E2J K;  1J98 A;  3GTO C;  3GTG C;  2NVY K;  3M4O C;  2NVX K;  4KB2 A;  4WFA S;  2JA7 A;  5TJ3 A;  2V6U A;  3FKI A;  4G7Z A;  4LR2 A;  5M3F K;  3CF5 S;  4KN4 A;  4QJV B;  4XLP A;  2A6E A;  4GTE A;  2Y0S L;  4BBS C;  4MEY A;  1VJE A;  1SFO A;  4KAS A;  3S1N K;  1PJ5 A;  4BBR K;  3S16 K;  4DDQ A;  1WCM A;  1WIH A;  3S15 C;  3T01 A;  1I6V A;  3I4M C;  4KC6 A;  2WAQ L;  3HOY C;  3S1R K;  4LQY A;  1VGX A;  3HOV C;  3GDZ A;  4WIL A;  5FJ8 K;  2NVT K;  1O24 A;  4OIR A;  4G7O A;  5C4X C;  3BP8 C;  5IYC C;  4P5A A;  3FKI C;  3GEI A;  1EFW A;  3RZD C;  2ZJQ S;  2R7Z K;  2ZUE A;  3LYW A;  1BDF A;  4GFQ A;  4A3G C;  3ERE D;  2B63 K;  1SFO C;  1TWA A;  5M5Y K;  5HL8 A;  3N0C A;  5IYB C;  1J6V A;  3TFI A;  1WCM C;  3A8I A;  2O5I A;  2ZJR S;  2R93 K;  3T02 A;  4WJ3 M;  5IP7 K;  3LPX A;  2PHC B;  5C4J K;  3V4G A;  4KDD A;  3S17 C;  2GSO A;  2GSN A;  2WB1 D;  1TWC A;  4IOA S;  4BY1 K;  2JH3 A;  1O2F B;  1GE9 A;  3AD7 C;  3HKZ L;  5D4D A;  4QIW L;  4C2M K;  4GTF A;  1EH1 A;  2D6F C;  5C3E C;  3S2H K;  4A3B K;  2W7V A;  3JST A;  3GTM C;  2XCR B;  3M3Y K;  3H3V L;  3HOW C;  4C3J K;  3S14 C;  3AD8 C;  3GTJ C;  4Y7N C;  1K83 A;  4YFN A;  4A93 K;  3GTL C;  1ZBS A;  4BY7 K;  1IL2 A;  4AYB D;  2XCO A;  2GAG C;  3S2D C;  5IOS A;  2PA8 D;  1RU0 A;  4Y52 K;  4P5B A;  5JVO A;  1WQG A;  1TWC C;  4ZH4 A;  2ZFZ A;  1ZQ1 C;  3S1M K;  4GTB A;  4A3I K;  3GTK K;  5CJ9 A;  2P8T A;  3TTG A;  4XLN A;  1XXB A;  1WOO A;  1PJ7 A;  1I50 K;  5M5X K;  4XCH A;  2E2I A;  1Y1V K;  1DCP A;  4A3J C;  1ZYR A;  4KMU A;  1AB4 A;  3HOZ K;  1I6H C;  3CQZ K;  1TWH K;  2JA6 K;  5JVH S;  4FZB A;  3IPJ A;  1O2B A;  4C3I K;  1DCH A;  5JFE A;  4OIQ A;  1O27 A;  4A3D K;  2A68 A;  4G0U A;  4GTL A;  1VLO A;  3BP3 A;  4PAA A;  4WF9 S;  5EGE A;  4AYB L;  3HOX K;  5C44 K;  2FQO A;  4KMH A;  2E2J C;  3L4K A;  1F7U A;  1TWG K;  3K7A K;  3LAJ A;  2NVY C;  1XXC A;  3GTG K;  3GTO K;  3G4A A;  2NVX C;  3QX3 A;  3TFH A;  3M4O K;  2PPB A;  3S1Q K;  3I4N C;  2E2I C;  4GTD A;  3GTQ A;  2YU9 A;  3DLL S;  2NVQ K;  5IYD K;  1J6X A;  3ADA C;  4WJ4 A;  4C3H C;  3SZZ A;  4FM9 A;  3RZO C;  4M1X A;  3AH5 A;  4IOC S;  4BBS K;  4X6A C;  2R92 A;  5FLM K;  3A8K A;  3TFJ A;  5IP9 C;  2PMZ D;  4C45 A;  2ZJP S;  4BBR C;  3S16 C;  3GTP K;  4KAT A;  4A3M C;  3S15 K;  3LAP A;  3HOY K;  4BLB A;  2VUM A;  4P9S A;  3HOV K;  2NVT C;  3CAG A;  3H0G A;  5C4X K;  5IYC K;  4G0V A;  3GTM A;  3GTQ C;  2V6T A;  2JA7 K;  2YU9 C;  3FKI K;  5IOR A;  3GTJ A;  3NUH A;  3RZD K;  1Y1W A;  1TWF A;  3GTL A;  2BE5 A;  1USM A;  1SFO K;  2R92 C;  1JOE A;  4WCE S;  3OEP A;  5IYB K;  4LK0 A;  3GEE A;  1WCM K;  4XSZ A;  1O26 A;  4WFB S;  4A3C C;  3PO3 C;  3PIP S;  1XPP A;  2PMZ L;  5C4J C;  2Y3P A;  4BKW A;  2VUM C;  5E68 A;  3HOU C;  1JQW A;  5CHP A;  3S17 K;  3H0G C;  1HQM A;  3T00 A;  2E2H A;  1KQ4 A;  2L5N A;  1YX2 A;  4BY1 C;  1HI9 A;  1WSR A;  3PO2 C;  1Y1W C;  1TWF C;  2KPU A;  3BUE A;  3S2H C;  4A3B C;  5C3E K;  3M3Y C;  3VA7 A;  3Q3Q A;  1C0A A;  1TWA K;  3AD9 C;  2R7Z A;  4A3F C;  1XZP B;  2JA8 C;  3S14 K;  1XZP A;  2CFA B;  3HXA A;  2CFA A;  1XXA A;  1I3Q A;  2JA6 A;  4BY7 C;  2GSU A;  2A69 A;  2XCQ A;  1R9T A;  2RGR A;  1BJT A;  2JA5 A;  1ISE A;  4LJZ A;  4Q5S A;  3S2D K;  2KXY A;  2NVY A;  4OIO A;  2NVX A;  2WB1 L;  3FOE A;  4A3K K;  1TWC K;  5IOT A;  2V6S A;  2E2H C;  4MQ9 A;  1WQF A;  1O28 A;  4PAB A;  4A3I C;  4ILD A;  4AH6 A;  4A3E C;  3DXJ A;  4KAW X;  5HQH A;  2Y0S D;  3OPF A;  3EQL A;  4G7H A;  1WSV A;  1ZVU A;  2R7Z C;  3ORE A;  1VRQ C;  1JVI A;  1VH2 A;  1K83 K;  1I6H K;  1TWH C;  4A3L C;  1I3Q C;  2JA6 C;  4WFN S;  4C3I C;  5IOQ A;  1R9T C;  3G4C A;  2WAQ D;  4KM8 A;  4A3D C;  2JA5 C;  5L46 A;  4BXX K;  1YNJ A;  2KWA A;  2PA8 L;  1XZQ B;  3GTP A;  1XZQ A;  1DD5 A;  1ZXO A;  3HOX C;  4KAR A;  2RH6 A;  1IW7 A;  1L0W A;  3K7A C;  4O2D A;  5M3M K;  3L4J A;  3GIR A;  2B63 A;  3S1Q C;  1F93 A;  2EBB A;  2L3U A;  3I4N K;  2E2I K;  1J6W A;  2O5J A;  2NVQ C;  5IYD C;  3S1N C;  4LK1 A;  4C3H K;  4QJV A;  1O25 A;  4OIN A;  3RZO K;  2R93 A;  1F9N A;  5FLM C;  3I4M K;  4X6A K;  3S1R C;  5IP9 K;  4KN7 A;  3GTP C;  4YG2 A;  4A3M K;  4MEX A;  1O29 A;  4GT9 A;  1BGW A;  2FQT A;  3GSI A;  5M5W K;  3MML B;  4GTA A;  4BLA A;  2KQ1 A;  1IBA A;  3HKZ D;  4QIW D;  2P5M A;  2B63 C;  3SZY A;  3AQP A;  1X31 C;  5JVG S;  4A3G K;  4IO9 S;  2JA7 C;  3GTQ K;  2YU9 K;  3H3V D;  1DCO A;  4OIP A;  1WOS A;  4LLG A;  2R93 C;  3WOD A;  3N3Y A;  1YNN A;  1EK8 A;  4KMA A;  1F7V A;  2R92 K;  1WQH A;  2CW0 A;  5IP7 C;  1IE0 A;  4A3C K;  4GZY A;  3PO3 K;  1FEU A;  3GTK A;  2VUM K;  3HOU K;  4C2M C;  3FOF A;  1I50 A;  3H0G K;  3GTM K;  1Y1V A;  5TMF A;  1B4B A;  4C3J C;  3HOW K;  3FHZ A;  4JK1 A;  1IQ0 A;  3GTJ K;  3PO2 K;  4Y7N K;  3CQZ A;  1Y1W K;  4A93 C;  1UV7 A;  1TWH A;  1TWF K;  1WOR A;  3GTL K;  4Q4Z A;  3A8J A;  1TWA C;  3N0B A;  4J3N A;  1PJ6 A;  4A3F K;  2JA8 K;  4XSX A;  1EQR A;  3GEH A;  4Y52 C;  4KM9 A;  3S0X A;  3S1M C;  3AQO A;  3GTK C;  1EI6 A;  1USO A;  1O2A A;  1TWG A;  4NOI A;  1IS1 A;  1WOP A;  4KB4 A;  3GTG A;  3GTO A;  4A3K C;  1I50 C;  1SMY A;  1G51 A;  4RMF A;  1Y1V C;  2E2H K;  4A3J K;  1B4A A;  3HOZ C;  4YFK A;  4A3E K;  3CQZ C;  5TMC A;  1INN A;  4LOW A;  5DM7 S;  4U67 S;  2A6H A;  1YCL A; 
#chains in the Genus database with same CATH homology
 1K83 C;  5IYB K;  5FLM C;  4LK0 A;  4AYB D;  3I4M K;  4X6A K;  3S1R C;  4A3L K;  1WCM K;  1I3Q K;  5IP9 K;  4XSZ A;  4KN7 A;  4A3C C;  3S2D C;  3PO3 C;  5C44 C;  1R9T K;  2PA8 D;  3GTP C;  1XPP A;  2PMZ L;  4Y52 K;  4YG2 A;  5C4J C;  4A3M K;  2JA5 K;  4YFX A;  1TWC C;  1TWG C;  4MEX A;  4BXX C;  2VUM C;  2E2J K;  4ZH4 A;  3HOU C;  3GTO C;  3GTG C;  2NVY K;  5M5W K;  4A3I K;  3S17 K;  3GTK K;  3S1M K;  3H0G C;  3M4O C;  1HQM A;  2NVX K;  4XLN A;  3HKZ D;  4QIW D;  4G7Z A;  4BY1 C;  5M3F K;  2B63 C;  4KN4 A;  1I50 K;  3PO2 C;  4A3G K;  5M5X K;  1Y1W C;  2JA7 C;  1Y1V K;  3GTQ K;  4QJV B;  4A3J C;  4XLP A;  1TWF C;  3H3V D;  2A6E A;  2YU9 K;  3S2H C;  1ZYR A;  4A3B C;  4KMU A;  4BBS C;  2Y0S L;  4MEY A;  3M3Y C;  5C3E K;  3HOZ K;  4OIP A;  1TWA K;  1I6H C;  3CQZ K;  1TWH K;  3S1N K;  2JA6 K;  4A3F C;  3S14 K;  4LLG A;  2JA8 C;  2R93 C;  3WOD A;  4BBR K;  4C3I K;  1YNN A;  3S16 K;  4OIQ A;  2R92 K;  2CW0 A;  4BY7 C;  4A3D K;  5IP7 C;  2A68 A;  3S15 C;  2A69 A;  1I6V A;  3I4M C;  2WAQ L;  3HOY C;  3S1R K;  4LJZ A;  4A3C K;  3HOV C;  4GZY A;  4Q5S A;  4AYB L;  3HOX K;  5C44 K;  3PO3 K;  3S2D K;  5FJ8 K;  2NVT K;  4OIO A;  4OIR A;  2E2J C;  4G7O A;  5C4X C;  5IYC C;  2WB1 L;  1TWC K;  1TWG K;  4A3K K;  2E2H C;  2VUM K;  4MQ9 A;  3K7A K;  3HOU K;  4C2M C;  2NVY C;  3FKI C;  4A3I C;  3GTG K;  3GTO K;  2NVX C;  3H0G K;  3M4O K;  2PPB A;  4A3E C;  3RZD C;  3I4N C;  3S1Q K;  2E2I C;  3DXJ A;  3GTM K;  2R7Z K;  5TMF A;  2NVQ K;  4C3J C;  5IYD K;  1BDF A;  3HOW K;  4A3G C;  2B63 K;  2Y0S D;  4JK1 A;  3PO2 K;  1SFO C;  3GTJ K;  3EQL A;  4Y7N K;  1Y1W K;  4G7H A;  4C3H C;  5M5Y K;  4A93 C;  2R7Z C;  1TWF K;  3GTL K;  3RZO C;  4Q4Z A;  4BBS K;  5IYB C;  4X6A C;  1TWA C;  1K83 K;  5FLM K;  1I6H K;  1TWH C;  1WCM C;  1I3Q C;  5IP9 C;  2PMZ D;  2O5I A;  2JA6 C;  4A3L C;  4A3F K;  4BBR C;  4XSX A;  4C3I C;  2JA8 K;  3S16 C;  2R93 K;  1R9T C;  2WAQ D;  4Y52 C;  4A3D C;  3GTP K;  4A3M C;  2JA5 C;  5IP7 K;  5C4J K;  3S15 K;  4BXX K;  1YNJ A;  2PA8 L;  3S17 C;  3S1M C;  3HOY K;  3GTK C;  2WB1 D;  3HOX C;  4NOI A;  3HOV K;  1IW7 A;  2NVT C;  3RZO K;  4A3K C;  1I50 C;  4BY1 K;  1SMY A;  5C4X K;  5IYC K;  3K7A C;  1Y1V C;  2E2H K;  3GTQ C;  3HKZ L;  5D4D A;  4QIW L;  2YU9 C;  4C2M K;  5M3M K;  3FKI K;  4A3J K;  2JA7 K;  5C3E C;  3S1Q C;  3HOZ C;  3S2H K;  4A3B K;  4YFK A;  4A3E K;  3GTM C;  3RZD K;  3I4N K;  2E2I K;  3M3Y K;  3CQZ C;  2O5J A;  2NVQ C;  5IYD C;  3H3V L;  5TMC A;  3HOW C;  3S1N C;  4C3J K;  3S14 C;  4LK1 A;  2BE5 A;  3GTJ C;  4Y7N C;  1SFO K;  4YFN A;  2R92 C;  4C3H K;  4A93 K;  4QJV A;  3GTL C;  4BY7 K;  2A6H A;  4OIN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...