1IW7A

Crystal structure of the rna polymerase holoenzyme from thermus thermophilus at 2.6a resolution
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
229
structure length
229
Chain Sequence
MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a bacterial RNA polymerase holoenzyme at 2.6 A resolution
pubmed doi rcsb
molecule tags Transferase
molecule keywords RNA polymerase alpha subunit
total genus 40
structure length 229
sequence length 229
chains with identical sequence B, K, L
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2002-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01000 RNA_pol_A_bac RNA polymerase Rpb3/RpoA insert domain
A PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain
A PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.12 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 DNA-directed RNA polymerase, insert domain 1iw7A02
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 1iw7A01
4MEXA 2JA7C 3M3YK 4Y52C 2WB1D 3HOWC 4A3GC 4BXXC 1I6HC 3PO3K 1TWAK 3S1NC 3GTMC 4A3KK 4A3CC 4Y52K 2O5IA 1HQMA 1WCMC 4MEYA 4BBSC 4A3IC 3GTJK 2E2IK 4C2MK 3HOYK 4G7OA 2R92K 1K83C 5M5WK 3GTKC 4Q4ZA 4LK1A 1Y1VK 4A3MC 2NVXC 5C44C 4QIWL 5C4JC 2PA8D 5C4XK 2NVYK 3GTLC 3S14C 4KN4A 1TWGK 3S1RC 3GTOC 2VUMC 3CQZK 2JA6K 3WODA 4BBRK 2Y0SD 2E2JC 1R9TC 5IYBC 3RZOK 5TMFA 4ZH4A 4BY7C 3GTJC 2E2IC 4KN7A 4BY1C 1Y1WC 1I50K 3H3VL 4A3FC 1TWAC 4OIPA 5M3MK 2NVTK 4BY7K 4XLNA 2E2JK 4A3FK 3CQZC 3S1RK 1TWGC 2JA6C 3FKIC 3GTOK 1IW7A 4X6AK 4JK1A 4BY1K 3H0GK 5C4XC 4QJVB 5C4JK 2NVYC 5M3FK 3RZDK 1Y1VC 3HOUC 2NVXK 3RZOC 4XSZA 5IYBK 5IYCK 5IP7K 3S2HC 2VUMK 3I4MK 4C2MC 3PO2C 2PA8L 3I4NK 4BBSK 3HOXK 1SFOK 4A3KC 4A3JC 4LK0A 4C3HK 4A3MK 3DXJA 1K83K 3S1NK 3PO3C 3HOWK 4BXXK 4A3JK 3M4OC 4A3DK 3M3YC 3HOXC 5M5YK 4A3IK 2JA7K 4YFXA 3I4MC 2R7ZK 2YU9K 3M4OK 2PMZD 3S2HK 1ZYRA 1BDFA 5IP9K 4NOIA 4A93K 4AYBD 4C3HC 5TMCA 1I6VA 2A6HA 3RZDC 1SFOC 2E2HC 3PO2K 3EQLA 4KMUA 5IYDC 3GTPC 5FLMK 2R93K 1TWFK 3S2DK 5IP7C 1SMYA 3K7AK 4OIRA 5C3EK 4MQ9A 4A3BK 2WAQL 5IP9C 2A6EA 3HOVC 4Y7NC 2YU9C 3HKZL 3FKIK 1I50C 2PMZL 3GTQC 4YFNA 3S17K 3GTGK 5D4DA 2PPBA 1TWHK 4C3IK 4C3JK 2A68A 2NVTC 1R9TK 5M5XK 4C3IC 3S15K 2NVQC 4OIQA 3GTQK 4YFKA 4OIOA 3GTPK 4G7HA 4A3EK 4Y7NK 2B63K 3GTLK 3S14K 3S1MC 4A3LK 4GZYA 2BE5A 2R92C 4BBRC 3HOUK 5C3EC 3HOYC 1YNJA 1TWCK 3S16K 2B63C 4AYBL 3H0GC 3S1MK 4LLGA 1WCMK 5FJ8K 4X6AC 4OINA 4XSXA 1TWCC 3S16C 2WB1L 5C44K 2NVQK 3S15C 4QJVA 4Q5SA 4LJZA 2A69A 2Y0SL 4XLPA 2R7ZC 1TWHC 1I6HK 4A3LC 4C3JC 3S17C 4A3EC 3S1QC 4A3DC 1Y1WK 3GTMK 4A3CK 4QIWD 4A3BC 2JA8K 4A3GK 2O5JA 3HOZK 3K7AC 1I3QK 3HOZC 2JA5K 3GTGC 3I4NC 2R93C 1TWFC 3S1QK 2E2HK 5IYDK 1I3QC 3HOVK 4YG2A 5IYCC 2WAQD 4A93C 3GTKK 1YNNA 2JA8C 4G7ZA 3HKZD 2CW0A 3S2DC 1XPPA 5FLMC 3H3VD 2JA5C
chains in the Genus database with same CATH superfamily
3M3YK 1F7UA 3HOWC 1XZPB 3PO3K 4BXXC 4KMHA 3GTMC 3TFJA 4Y52K 2O5IA 1ZBSA 4BBSC 1WCMC 2ZUEA 3BUEA 1USMA 3HOYK 4QIWL 5C44C 5C4XK 3NUHA 4KN4A 3CF5S 1VLOA 1EH1A 1TWGK 1IE0A 2E2JC 4U67S 4GTBA 4ZH4A 4KN7A 1Y1WC 5IOTA 3GTLA 1XXCA 5M3MK 4XLNA 3SZZA 3AD8C 1WCMA 2ZJQS 3CQZC 1EQRA 3GTOK 3GTGA 4GTLA 1O26A 1WQFA 4KB4A 3H0GK 2L3UA 4IOCS 1ZVUA 3RZOC 1WORA 3JSTA 5IP7K 2VUMK 3GTJA 2E2IA 3PO2C 3L4JA 1O24A 3HOXK 1R9TA 3PIOS 4A3KC 4C3HK 1HI9A 2FQOA 1K83K 4A3JK 3M4OC 2GSNA 3HOXC 1EFWA 4GTAA 3AH5A 4YFXA 1IBAA 3BP3A 2YU9K 3S2HK 1BDFA 4ILDA 2L5NA 5TJ3A 2CFAB 1IQ0A 1O29A 1TWFK 1SMYA 4MQ9A 1TWHA 2A6EA 4Y7NC 2B63A 2YU9A 2PMZL 5HQHA 5D4DA 2PPBA 2EBBA 4WJ4A 4C3IC 4OIQA 4YFKA 3S14K 1DD5A 2R92C 4BBRC 1YNJA 1TWCK 1F9NA 1WCMK 2GSOA 4OINA 4XSXA 4P5BA 4Q5SA 4M1XA 3GSIA 4XCHA 1TWHC 4A3LC 1JQWA 1Y1VA 3GEEA 4A3DC 3CAGA 3G4AA 3GTKA 4A3BC 4DDQA 1I3QK 3MMLB 5JFEA 1PJ5A 3T00A 1TWFC 4KB2A 3AD7C 1YNNA 2JA8C 1WIHA 3HKZD 1Y1WA 3S0XA 1XPPA 3H3VD 3HOZK 2JA7C 1V5VA 4Y52C 2KPUA 4GT9A 1BJTA 1UV7A 3GTJK 3FHZA 2E2IK 4C2MK 4BLAA 2R92K 1K83C 5M5WK 3GTKC 4Q4ZA 4A3MC 5C4JC 2PA8D 4WFNS 2NVYK 4LOWA 1WOSA 3WODA 2Y0SD 3RZOK 2ZUFA 1WOOA 1I50K 4WILA 5L46A 1SFOA 1TWGA 1IS1A 2JA6C 1IW7A 4JK1A 4BY1K 4QJVB 3RZDK 4WF9S 3HOUC 3GTMA 5IYCK 2JA7A 4WFBS 3I4NK 4P9SA 1SFOK 4A3JC 5E68A 5JVOA 3M3YC 5IORA 3N0CA 3A8KA 2ZFZA 4AYBD 3N0BA 2E2HC 5IYDC 4KMUA 3S2DK 5C3EK 3HOVC 4LQYA 1G51A 1I50C 3S17K 3GTGK 3GTOA 2XCOA 4C3IK 1I3QA 3OREA 4G0WA 4WCES 3S15K 3GTPA 3VA7A 2B63K 4BLBA 3GTLK 3S1MC 4GZYA 2BE5A 2V6SA 3HOYC 2CFAA 2B63C 3H0GC 3S1MK 4LLGA 5FJ8K 1J6WA 5C44K 3S16C 2VUMA 3TFHA 2R7ZC 4C3JC 3N3YA 3S17C 3TFIA 3GTMK 3LAPA 2E2HA 2JA8K 1USOA 3K7AC 3HOZC 5DM7S 1O2FB 3I4NC 1TWAA 3GEIA 1GE9A 2WAQD 3QX3A 4A93C 1XZQB 3GTKK 4G7ZA 1I50A 3L4KA 2ZJPS 2JA5C 4MEXA 1YX2A 1ISEA 4KATA 1VJEA 4A3GC 3HXAA 1TWAK 2RGRA 4A3KK 4A3CC 3AQPA 2W7VA 4LR2A 3ADAC 4KDDA 4MEYA 3FKIA 5JVGS 4AH6A 1WQHA 1DCHA 1DCPA 1ZQ1C 4LK1A 2NVXC 1EK8A 3S14C 4FZBA 2XCRB 3S1RC 3GTOC 2VUMC 4KMAA 4BBRK 1B4AA 3T01A 4BY1C 4RMFA 3H3VL 1TWAC 3T02A 4OIPA 2NVTK 1TWFA 4A3FK 1TWGC 3GEHA 3ERED 5C4XC 4GTFA 5IYBK 2NVXK 4PAAA 4C2MC 2PA8L 4O2DA 4GFQA 4A3MK 2P5MA 3PO3C 3HOWK 4BXXK 4A3DK 2JA7K 1VGXA 3I4MC 2PMZD 1YCLA 1EI6A 4A93K 2A6HA 1SFOC 2XCQA 3LYWA 3EQLA 4IOAS 2R93K 5IP7C 4OIRA 3LAJA 3GDZA 1DCOA 5IP9C 1XZPA 3SZYA 2YU9C 3FKIK 3GTQC 4YFNA 4GTDA 1TWHK 4WJ3M 3BP8C 2NVTC 1JOEA 1VH2A 1R9TK 5M5XK 2R93A 2NVQC 3GTQK 4G7HA 4KASA 4BKWA 1L0WA 5JVHS 2D6FC 3S16K 2ZJRS 2V6UA 4AYBL 4PABA 4X6AC 3IPJA 3GTQA 2WB1L 2Y0SL 1I6HK 4XLPA 4A3EC 1O28A 2R92A 4A3GK 1JVIA 2JA5K 1KQ4A 3GTGC 2R93C 1INNA 1X31C 5IYCC 4GTEA 4KM8A 2CW0A 3S2DC 3S1QK 5FLMC 3GTPK 1XXAA 2WB1D 1I6HC 2KQ1A 3S1NC 2RH6A 4C45A 1O25A 3OEPA 3FOFA 1J6VA 1HQMA 4A3IC 3OPFA 2NVXA 2KWAA 1AB4A 4G7OA 1FEUA 1Y1VK 1WSRA 3GTLC 4IO9S 1XZQA 3CQZK 3Q3QA 2JA6K 1WOPA 1R9TC 5IYBC 5TMFA 4BY7C 3GTJC 2E2IC 1PJ7A 5CJ9A 3FOEA 4G0UA 3TTGA 4A3FC 4GTCA 3H0GA 4BY7K 2E2JK 3S1RK 3GIRA 5EGEA 3FKIC 5HL8A 1XXBA 4X6AK 2GAHC 5C4JK 5M3FK 2NVYC 1Y1VC 2KXYA 4XSZA 4FM9A 4KAWX 3S2HC 3DLLS 3I4MK 4BBSK 2JA5A 1RU0A 4LK0A 3A8JA 1F93A 4KMDA 3DXJA 5CHPA 1TWCA 3LPXA 4KARA 3S1NK 5M5YK 4A3IK 2GSUA 2R7ZK 3M4OK 1ZYRA 5IP9K 4NOIA 3G4CA 3AD9C 5IOSA 4C3HC 5TMCA 1I6VA 1ZXOA 3RZDC 3AQOA 1PJ6A 3PO2K 3GTPC 5FLMK 1VRQC 3K7AK 1BS2A 2R7ZA 2JH3A 4P5AA 4A3BK 2WAQL 4J3NA 3HKZL 5EGHA 5HL7S 1J98A 4C3JK 2A68A 1O2AA 4OIOA 1O2BA 4KC6A 2NVYA 4A3EK 1F7VA 4Y7NK 4WFAS 4A3LK 2GAGC 1WQGA 1IL2A 4G0VA 2V6TA 5C3EC 3HOUK 3PIPS 1BGWA 3V4GA 1TWCC 1O27A 2NVQK 3S15C 4QJVA 1J6XA 5DM6S 2P8TA 4LJZA 2A69A 5IOQA 3S1QC 1Y1WK 2Y3PA 4A3CK 1B4BA 4QIWD 3CQZA 2O5JA 1C0AA 1K83A 2JA6A 2E2HK 5IYDK 1I3QC 3HOVK 4YG2A 4KM9A 2FQTA 1WSVA 3A8IA 2PHCB
chains in the Genus database with same CATH topology
4MEXA 2JA7C 3M3YK 4Y52C 2WB1D 3HOWC 4A3GC 4BXXC 1I6HC 3PO3K 1TWAK 3S1NC 3GTMC 4A3KK 4A3CC 4Y52K 2O5IA 1HQMA 1WCMC 4MEYA 4BBSC 4A3IC 3GTJK 2E2IK 4C2MK 3HOYK 4G7OA 2R92K 1K83C 5M5WK 3GTKC 4Q4ZA 4LK1A 1Y1VK 4A3MC 2NVXC 5C44C 4QIWL 5C4JC 2PA8D 5C4XK 2NVYK 3GTLC 3S14C 4KN4A 1TWGK 3S1RC 3GTOC 2VUMC 3CQZK 2JA6K 3WODA 4BBRK 2Y0SD 2E2JC 1R9TC 5IYBC 3RZOK 5TMFA 4ZH4A 4BY7C 3GTJC 2E2IC 4KN7A 4BY1C 1Y1WC 1I50K 3H3VL 4A3FC 1TWAC 4OIPA 5M3MK 2NVTK 4BY7K 4XLNA 2E2JK 4A3FK 3CQZC 3S1RK 1TWGC 2JA6C 3FKIC 3GTOK 1IW7A 4X6AK 4JK1A 4BY1K 3H0GK 5C4XC 4QJVB 5C4JK 2NVYC 5M3FK 3RZDK 1Y1VC 3HOUC 2NVXK 3RZOC 4XSZA 5IYBK 5IYCK 5IP7K 3S2HC 2VUMK 3I4MK 4C2MC 3PO2C 2PA8L 3I4NK 4BBSK 3HOXK 1SFOK 4A3KC 4A3JC 4LK0A 4C3HK 4A3MK 3DXJA 1K83K 3S1NK 3PO3C 3HOWK 4BXXK 4A3JK 3M4OC 4A3DK 3M3YC 3HOXC 5M5YK 4A3IK 2JA7K 4YFXA 3I4MC 2R7ZK 2YU9K 3M4OK 2PMZD 3S2HK 1ZYRA 1BDFA 5IP9K 4NOIA 4A93K 4AYBD 4C3HC 5TMCA 1I6VA 2A6HA 3RZDC 1SFOC 2E2HC 3PO2K 3EQLA 4KMUA 5IYDC 3GTPC 5FLMK 2R93K 1TWFK 3S2DK 5IP7C 1SMYA 3K7AK 4OIRA 5C3EK 4MQ9A 4A3BK 2WAQL 5IP9C 2A6EA 3HOVC 4Y7NC 2YU9C 3HKZL 3FKIK 1I50C 2PMZL 3GTQC 4YFNA 3S17K 3GTGK 5D4DA 2PPBA 1TWHK 4C3IK 4C3JK 2A68A 2NVTC 1R9TK 5M5XK 4C3IC 3S15K 2NVQC 4OIQA 3GTQK 4YFKA 4OIOA 3GTPK 4G7HA 4A3EK 4Y7NK 2B63K 3GTLK 3S14K 3S1MC 4A3LK 4GZYA 2BE5A 2R92C 4BBRC 3HOUK 5C3EC 3HOYC 1YNJA 1TWCK 3S16K 2B63C 4AYBL 3H0GC 3S1MK 4LLGA 1WCMK 5FJ8K 4X6AC 4OINA 4XSXA 1TWCC 3S16C 2WB1L 5C44K 2NVQK 3S15C 4QJVA 4Q5SA 4LJZA 2A69A 2Y0SL 4XLPA 2R7ZC 1TWHC 1I6HK 4A3LC 4C3JC 3S17C 4A3EC 3S1QC 4A3DC 1Y1WK 3GTMK 4A3CK 4QIWD 4A3BC 2JA8K 4A3GK 2O5JA 3HOZK 3K7AC 1I3QK 3HOZC 2JA5K 3GTGC 3I4NC 2R93C 1TWFC 3S1QK 2E2HK 5IYDK 1I3QC 3HOVK 4YG2A 5IYCC 2WAQD 4A93C 3GTKK 1YNNA 2JA8C 4G7ZA 3HKZD 2CW0A 3S2DC 1XPPA 5FLMC 3H3VD 2JA5C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MEX A;  2JA7 C;  3M3Y K;  4Y52 C;  2WB1 D;  3HOW C;  4A3G C;  4BXX C;  1I6H C;  3PO3 K;  1TWA K;  3S1N C;  3GTM C;  4A3K K;  4A3C C;  4Y52 K;  2O5I A;  1HQM A;  1WCM C;  4MEY A;  4BBS C;  4A3I C;  3GTJ K;  2E2I K;  4C2M K;  3HOY K;  4G7O A;  2R92 K;  1K83 C;  5M5W K;  3GTK C;  4Q4Z A;  4LK1 A;  1Y1V K;  4A3M C;  2NVX C;  5C44 C;  4QIW L;  5C4J C;  2PA8 D;  5C4X K;  2NVY K;  3GTL C;  3S14 C;  4KN4 A;  1TWG K;  3S1R C;  3GTO C;  2VUM C;  3CQZ K;  2JA6 K;  3WOD A;  4BBR K;  2Y0S D;  2E2J C;  1R9T C;  5IYB C;  3RZO K;  5TMF A;  4ZH4 A;  4BY7 C;  3GTJ C;  2E2I C;  4KN7 A;  4BY1 C;  1Y1W C;  1I50 K;  3H3V L;  4A3F C;  1TWA C;  4OIP A;  5M3M K;  2NVT K;  4BY7 K;  4XLN A;  2E2J K;  4A3F K;  3CQZ C;  3S1R K;  1TWG C;  2JA6 C;  3FKI C;  3GTO K;  1IW7 A;  4X6A K;  4JK1 A;  4BY1 K;  3H0G K;  5C4X C;  4QJV B;  5C4J K;  2NVY C;  5M3F K;  3RZD K;  1Y1V C;  3HOU C;  2NVX K;  3RZO C;  4XSZ A;  5IYB K;  5IYC K;  5IP7 K;  3S2H C;  2VUM K;  3I4M K;  4C2M C;  3PO2 C;  2PA8 L;  3I4N K;  4BBS K;  3HOX K;  1SFO K;  4A3K C;  4A3J C;  4LK0 A;  4C3H K;  4A3M K;  3DXJ A;  1K83 K;  3S1N K;  3PO3 C;  3HOW K;  4BXX K;  4A3J K;  3M4O C;  4A3D K;  3M3Y C;  3HOX C;  5M5Y K;  4A3I K;  2JA7 K;  4YFX A;  3I4M C;  2R7Z K;  2YU9 K;  3M4O K;  2PMZ D;  3S2H K;  1ZYR A;  1BDF A;  5IP9 K;  4NOI A;  4A93 K;  4AYB D;  4C3H C;  5TMC A;  1I6V A;  2A6H A;  3RZD C;  1SFO C;  2E2H C;  3PO2 K;  3EQL A;  4KMU A;  5IYD C;  3GTP C;  5FLM K;  2R93 K;  1TWF K;  3S2D K;  5IP7 C;  1SMY A;  3K7A K;  4OIR A;  5C3E K;  4MQ9 A;  4A3B K;  2WAQ L;  5IP9 C;  2A6E A;  3HOV C;  4Y7N C;  2YU9 C;  3HKZ L;  3FKI K;  1I50 C;  2PMZ L;  3GTQ C;  4YFN A;  3S17 K;  3GTG K;  5D4D A;  2PPB A;  1TWH K;  4C3I K;  4C3J K;  2A68 A;  2NVT C;  1R9T K;  5M5X K;  4C3I C;  3S15 K;  2NVQ C;  4OIQ A;  3GTQ K;  4YFK A;  4OIO A;  3GTP K;  4G7H A;  4A3E K;  4Y7N K;  2B63 K;  3GTL K;  3S14 K;  3S1M C;  4A3L K;  4GZY A;  2BE5 A;  2R92 C;  4BBR C;  3HOU K;  5C3E C;  3HOY C;  1YNJ A;  1TWC K;  3S16 K;  2B63 C;  4AYB L;  3H0G C;  3S1M K;  4LLG A;  1WCM K;  5FJ8 K;  4X6A C;  4OIN A;  4XSX A;  1TWC C;  3S16 C;  2WB1 L;  5C44 K;  2NVQ K;  3S15 C;  4QJV A;  4Q5S A;  4LJZ A;  2A69 A;  2Y0S L;  4XLP A;  2R7Z C;  1TWH C;  1I6H K;  4A3L C;  4C3J C;  3S17 C;  4A3E C;  3S1Q C;  4A3D C;  1Y1W K;  3GTM K;  4A3C K;  4QIW D;  4A3B C;  2JA8 K;  4A3G K;  2O5J A;  3HOZ K;  3K7A C;  1I3Q K;  3HOZ C;  2JA5 K;  3GTG C;  3I4N C;  2R93 C;  1TWF C;  3S1Q K;  2E2H K;  5IYD K;  1I3Q C;  3HOV K;  4YG2 A;  5IYC C;  2WAQ D;  4A93 C;  3GTK K;  1YNN A;  2JA8 C;  4G7Z A;  3HKZ D;  2CW0 A;  3S2D C;  1XPP A;  5FLM C;  3H3V D;  2JA5 C; 
#chains in the Genus database with same CATH topology
 3M3Y K;  1F7U A;  3HOW C;  1XZP B;  3PO3 K;  4BXX C;  4KMH A;  3GTM C;  3TFJ A;  4Y52 K;  2O5I A;  1ZBS A;  4BBS C;  1WCM C;  2ZUE A;  3BUE A;  1USM A;  3HOY K;  4QIW L;  5C44 C;  5C4X K;  3NUH A;  4KN4 A;  3CF5 S;  1VLO A;  1EH1 A;  1TWG K;  1IE0 A;  2E2J C;  4U67 S;  4GTB A;  4ZH4 A;  4KN7 A;  1Y1W C;  5IOT A;  3GTL A;  1XXC A;  5M3M K;  4XLN A;  3SZZ A;  3AD8 C;  1WCM A;  2ZJQ S;  3CQZ C;  1EQR A;  3GTO K;  3GTG A;  4GTL A;  1O26 A;  1WQF A;  4KB4 A;  3H0G K;  2L3U A;  4IOC S;  1ZVU A;  3RZO C;  1WOR A;  3JST A;  5IP7 K;  2VUM K;  3GTJ A;  2E2I A;  3PO2 C;  3L4J A;  1O24 A;  3HOX K;  1R9T A;  3PIO S;  4A3K C;  4C3H K;  1HI9 A;  2FQO A;  1K83 K;  4A3J K;  3M4O C;  2GSN A;  3HOX C;  1EFW A;  4GTA A;  3AH5 A;  4YFX A;  1IBA A;  3BP3 A;  2YU9 K;  3S2H K;  1BDF A;  4ILD A;  2L5N A;  5TJ3 A;  2CFA B;  1IQ0 A;  1O29 A;  1TWF K;  1SMY A;  4MQ9 A;  1TWH A;  2A6E A;  4Y7N C;  2B63 A;  2YU9 A;  2PMZ L;  5HQH A;  5D4D A;  2PPB A;  2EBB A;  4WJ4 A;  4C3I C;  4OIQ A;  4YFK A;  3S14 K;  1DD5 A;  2R92 C;  4BBR C;  1YNJ A;  1TWC K;  1F9N A;  1WCM K;  2GSO A;  4OIN A;  4XSX A;  4P5B A;  4Q5S A;  4M1X A;  3GSI A;  4XCH A;  1TWH C;  4A3L C;  1JQW A;  1Y1V A;  3GEE A;  4A3D C;  3CAG A;  3G4A A;  3GTK A;  4A3B C;  4DDQ A;  1I3Q K;  3MML B;  5JFE A;  1PJ5 A;  3T00 A;  1TWF C;  4KB2 A;  3AD7 C;  1YNN A;  2JA8 C;  1WIH A;  3HKZ D;  1Y1W A;  3S0X A;  1XPP A;  3H3V D;  3HOZ K;  2JA7 C;  1V5V A;  4Y52 C;  2KPU A;  4GT9 A;  1BJT A;  1UV7 A;  3GTJ K;  3FHZ A;  2E2I K;  4C2M K;  4BLA A;  2R92 K;  1K83 C;  5M5W K;  3GTK C;  4Q4Z A;  4A3M C;  5C4J C;  2PA8 D;  4WFN S;  2NVY K;  4LOW A;  1WOS A;  3WOD A;  2Y0S D;  3RZO K;  2ZUF A;  1WOO A;  1I50 K;  4WIL A;  5L46 A;  1SFO A;  1TWG A;  1IS1 A;  2JA6 C;  1IW7 A;  4JK1 A;  4BY1 K;  4QJV B;  3RZD K;  4WF9 S;  3HOU C;  3GTM A;  5IYC K;  2JA7 A;  4WFB S;  3I4N K;  4P9S A;  1SFO K;  4A3J C;  5E68 A;  5JVO A;  3M3Y C;  5IOR A;  3N0C A;  3A8K A;  2ZFZ A;  4AYB D;  3N0B A;  2E2H C;  5IYD C;  4KMU A;  3S2D K;  5C3E K;  3HOV C;  4LQY A;  1G51 A;  1I50 C;  3S17 K;  3GTG K;  3GTO A;  2XCO A;  4C3I K;  1I3Q A;  3ORE A;  4G0W A;  4WCE S;  3S15 K;  3GTP A;  3VA7 A;  2B63 K;  4BLB A;  3GTL K;  3S1M C;  4GZY A;  2BE5 A;  2V6S A;  3HOY C;  2CFA A;  2B63 C;  3H0G C;  3S1M K;  4LLG A;  5FJ8 K;  1J6W A;  5C44 K;  3S16 C;  2VUM A;  3TFH A;  2R7Z C;  4C3J C;  3N3Y A;  3S17 C;  3TFI A;  3GTM K;  3LAP A;  2E2H A;  2JA8 K;  1USO A;  3K7A C;  3HOZ C;  5DM7 S;  1O2F B;  3I4N C;  1TWA A;  3GEI A;  1GE9 A;  2WAQ D;  3QX3 A;  4A93 C;  1XZQ B;  3GTK K;  4G7Z A;  1I50 A;  3L4K A;  2ZJP S;  2JA5 C;  4MEX A;  1YX2 A;  1ISE A;  4KAT A;  1VJE A;  4A3G C;  3HXA A;  1TWA K;  2RGR A;  4A3K K;  4A3C C;  3AQP A;  2W7V A;  4LR2 A;  3ADA C;  4KDD A;  4MEY A;  3FKI A;  5JVG S;  4AH6 A;  1WQH A;  1DCH A;  1DCP A;  1ZQ1 C;  4LK1 A;  2NVX C;  1EK8 A;  3S14 C;  4FZB A;  2XCR B;  3S1R C;  3GTO C;  2VUM C;  4KMA A;  4BBR K;  1B4A A;  3T01 A;  4BY1 C;  4RMF A;  3H3V L;  1TWA C;  3T02 A;  4OIP A;  2NVT K;  1TWF A;  4A3F K;  1TWG C;  3GEH A;  3ERE D;  5C4X C;  4GTF A;  5IYB K;  2NVX K;  4PAA A;  4C2M C;  2PA8 L;  4O2D A;  4GFQ A;  4A3M K;  2P5M A;  3PO3 C;  3HOW K;  4BXX K;  4A3D K;  2JA7 K;  1VGX A;  3I4M C;  2PMZ D;  1YCL A;  1EI6 A;  4A93 K;  2A6H A;  1SFO C;  2XCQ A;  3LYW A;  3EQL A;  4IOA S;  2R93 K;  5IP7 C;  4OIR A;  3LAJ A;  3GDZ A;  1DCO A;  5IP9 C;  1XZP A;  3SZY A;  2YU9 C;  3FKI K;  3GTQ C;  4YFN A;  4GTD A;  1TWH K;  4WJ3 M;  3BP8 C;  2NVT C;  1JOE A;  1VH2 A;  1R9T K;  5M5X K;  2R93 A;  2NVQ C;  3GTQ K;  4G7H A;  4KAS A;  4BKW A;  1L0W A;  5JVH S;  2D6F C;  3S16 K;  2ZJR S;  2V6U A;  4AYB L;  4PAB A;  4X6A C;  3IPJ A;  3GTQ A;  2WB1 L;  2Y0S L;  1I6H K;  4XLP A;  4A3E C;  1O28 A;  2R92 A;  4A3G K;  1JVI A;  2JA5 K;  1KQ4 A;  3GTG C;  2R93 C;  1INN A;  1X31 C;  5IYC C;  4GTE A;  4KM8 A;  2CW0 A;  3S2D C;  3S1Q K;  5FLM C;  3GTP K;  1XXA A;  2WB1 D;  1I6H C;  2KQ1 A;  3S1N C;  2RH6 A;  4C45 A;  1O25 A;  3OEP A;  3FOF A;  1J6V A;  1HQM A;  4A3I C;  3OPF A;  2NVX A;  2KWA A;  1AB4 A;  4G7O A;  1FEU A;  1Y1V K;  1WSR A;  3GTL C;  4IO9 S;  1XZQ A;  3CQZ K;  3Q3Q A;  2JA6 K;  1WOP A;  1R9T C;  5IYB C;  5TMF A;  4BY7 C;  3GTJ C;  2E2I C;  1PJ7 A;  5CJ9 A;  3FOE A;  4G0U A;  3TTG A;  4A3F C;  4GTC A;  3H0G A;  4BY7 K;  2E2J K;  3S1R K;  3GIR A;  5EGE A;  3FKI C;  5HL8 A;  1XXB A;  4X6A K;  2GAH C;  5C4J K;  5M3F K;  2NVY C;  1Y1V C;  2KXY A;  4XSZ A;  4FM9 A;  4KAW X;  3S2H C;  3DLL S;  3I4M K;  4BBS K;  2JA5 A;  1RU0 A;  4LK0 A;  3A8J A;  1F93 A;  4KMD A;  3DXJ A;  5CHP A;  1TWC A;  3LPX A;  4KAR A;  3S1N K;  5M5Y K;  4A3I K;  2GSU A;  2R7Z K;  3M4O K;  1ZYR A;  5IP9 K;  4NOI A;  3G4C A;  3AD9 C;  5IOS A;  4C3H C;  5TMC A;  1I6V A;  1ZXO A;  3RZD C;  3AQO A;  1PJ6 A;  3PO2 K;  3GTP C;  5FLM K;  1VRQ C;  3K7A K;  1BS2 A;  2R7Z A;  2JH3 A;  4P5A A;  4A3B K;  2WAQ L;  4J3N A;  3HKZ L;  5EGH A;  5HL7 S;  1J98 A;  4C3J K;  2A68 A;  1O2A A;  4OIO A;  1O2B A;  4KC6 A;  2NVY A;  4A3E K;  1F7V A;  4Y7N K;  4WFA S;  4A3L K;  2GAG C;  1WQG A;  1IL2 A;  4G0V A;  2V6T A;  5C3E C;  3HOU K;  3PIP S;  1BGW A;  3V4G A;  1TWC C;  1O27 A;  2NVQ K;  3S15 C;  4QJV A;  1J6X A;  5DM6 S;  2P8T A;  4LJZ A;  2A69 A;  5IOQ A;  3S1Q C;  1Y1W K;  2Y3P A;  4A3C K;  1B4B A;  4QIW D;  3CQZ A;  2O5J A;  1C0A A;  1K83 A;  2JA6 A;  2E2H K;  5IYD K;  1I3Q C;  3HOV K;  4YG2 A;  4KM9 A;  2FQT A;  1WSV A;  3A8I A;  2PHC B; 
#chains in the Genus database with same CATH homology
 4MEX A;  2JA7 C;  3M3Y K;  4Y52 C;  2WB1 D;  3HOW C;  4A3G C;  4BXX C;  1I6H C;  3PO3 K;  1TWA K;  3S1N C;  3GTM C;  4A3K K;  4A3C C;  4Y52 K;  2O5I A;  1HQM A;  1WCM C;  4MEY A;  4BBS C;  4A3I C;  3GTJ K;  2E2I K;  4C2M K;  3HOY K;  4G7O A;  2R92 K;  1K83 C;  5M5W K;  3GTK C;  4Q4Z A;  4LK1 A;  1Y1V K;  4A3M C;  2NVX C;  5C44 C;  4QIW L;  5C4J C;  2PA8 D;  5C4X K;  2NVY K;  3GTL C;  3S14 C;  4KN4 A;  1TWG K;  3S1R C;  3GTO C;  2VUM C;  3CQZ K;  2JA6 K;  3WOD A;  4BBR K;  2Y0S D;  2E2J C;  1R9T C;  5IYB C;  3RZO K;  5TMF A;  4ZH4 A;  4BY7 C;  3GTJ C;  2E2I C;  4KN7 A;  4BY1 C;  1Y1W C;  1I50 K;  3H3V L;  4A3F C;  1TWA C;  4OIP A;  5M3M K;  2NVT K;  4BY7 K;  4XLN A;  2E2J K;  4A3F K;  3CQZ C;  3S1R K;  1TWG C;  2JA6 C;  3FKI C;  3GTO K;  1IW7 A;  4X6A K;  4JK1 A;  4BY1 K;  3H0G K;  5C4X C;  4QJV B;  5C4J K;  2NVY C;  5M3F K;  3RZD K;  1Y1V C;  3HOU C;  2NVX K;  3RZO C;  4XSZ A;  5IYB K;  5IYC K;  5IP7 K;  3S2H C;  2VUM K;  3I4M K;  4C2M C;  3PO2 C;  2PA8 L;  3I4N K;  4BBS K;  3HOX K;  1SFO K;  4A3K C;  4A3J C;  4LK0 A;  4C3H K;  4A3M K;  3DXJ A;  1K83 K;  3S1N K;  3PO3 C;  3HOW K;  4BXX K;  4A3J K;  3M4O C;  4A3D K;  3M3Y C;  3HOX C;  5M5Y K;  4A3I K;  2JA7 K;  4YFX A;  3I4M C;  2R7Z K;  2YU9 K;  3M4O K;  2PMZ D;  3S2H K;  1ZYR A;  1BDF A;  5IP9 K;  4NOI A;  4A93 K;  4AYB D;  4C3H C;  5TMC A;  1I6V A;  2A6H A;  3RZD C;  1SFO C;  2E2H C;  3PO2 K;  3EQL A;  4KMU A;  5IYD C;  3GTP C;  5FLM K;  2R93 K;  1TWF K;  3S2D K;  5IP7 C;  1SMY A;  3K7A K;  4OIR A;  5C3E K;  4MQ9 A;  4A3B K;  2WAQ L;  5IP9 C;  2A6E A;  3HOV C;  4Y7N C;  2YU9 C;  3HKZ L;  3FKI K;  1I50 C;  2PMZ L;  3GTQ C;  4YFN A;  3S17 K;  3GTG K;  5D4D A;  2PPB A;  1TWH K;  4C3I K;  4C3J K;  2A68 A;  2NVT C;  1R9T K;  5M5X K;  4C3I C;  3S15 K;  2NVQ C;  4OIQ A;  3GTQ K;  4YFK A;  4OIO A;  3GTP K;  4G7H A;  4A3E K;  4Y7N K;  2B63 K;  3GTL K;  3S14 K;  3S1M C;  4A3L K;  4GZY A;  2BE5 A;  2R92 C;  4BBR C;  3HOU K;  5C3E C;  3HOY C;  1YNJ A;  1TWC K;  3S16 K;  2B63 C;  4AYB L;  3H0G C;  3S1M K;  4LLG A;  1WCM K;  5FJ8 K;  4X6A C;  4OIN A;  4XSX A;  1TWC C;  3S16 C;  2WB1 L;  5C44 K;  2NVQ K;  3S15 C;  4QJV A;  4Q5S A;  4LJZ A;  2A69 A;  2Y0S L;  4XLP A;  2R7Z C;  1TWH C;  1I6H K;  4A3L C;  4C3J C;  3S17 C;  4A3E C;  3S1Q C;  4A3D C;  1Y1W K;  3GTM K;  4A3C K;  4QIW D;  4A3B C;  2JA8 K;  4A3G K;  2O5J A;  3HOZ K;  3K7A C;  1I3Q K;  3HOZ C;  2JA5 K;  3GTG C;  3I4N C;  2R93 C;  1TWF C;  3S1Q K;  2E2H K;  5IYD K;  1I3Q C;  3HOV K;  4YG2 A;  5IYC C;  2WAQ D;  4A93 C;  3GTK K;  1YNN A;  2JA8 C;  4G7Z A;  3HKZ D;  2CW0 A;  3S2D C;  1XPP A;  5FLM C;  3H3V D;  2JA5 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...