1IW7A

Crystal structure of the rna polymerase holoenzyme from thermus thermophilus at 2.6a resolution
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
229
structure length
229
Chain Sequence
MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords RNA polymerase alpha subunit
publication title Crystal structure of a bacterial RNA polymerase holoenzyme at 2.6 A resolution
pubmed doi rcsb
total genus 40
structure length 229
sequence length 229
chains with identical sequence B, K, L
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2002-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01000 RNA_pol_A_bac RNA polymerase Rpb3/RpoA insert domain
A PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain
A PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.12 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 DNA-directed RNA polymerase, insert domain 1iw7A02
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 1iw7A01
3M3YK 2E2JK 1SMYA 4LLGA 4Y7NC 3RZDC 2R7ZC 2NVYC 4A93C 2E2HC 2B63C 1I6HC 1I3QK 4QJVB 5C4JK 3S15K 3S1RC 1HQMA 5C4XK 2NVXC 4Q5SA 4C2MC 1Y1WK 2NVQK 3HOZK 3S17K 4BY7K 3I4NK 4BXXK 4BBSC 2R93K 2PMZD 5IYBC 4XLPA 4G7ZA 5IYCK 1R9TK 2O5JA 3GTKK 5IYDK 4BY1C 4KN7A 3GTLC 1SFOC 3GTGC 3EQLA 3HOVC 4QIWD 3HOYC 3S2HC 1K83C 1WCMK 3GTPK 4OIPA 3RZOK 4YG2A 1YNJA 4MQ9A 4OIRA 4A3BC 3FKIK 4A3EK 2YU9C 2NVTK 3HKZD 4Y52C 3GTOK 4A3FC 5M5WK 2JA7C 4LK1A 4Y7NK 3PO3K 1I6HK 5FLMC 3S1MC 2PMZL 2VUMK 3DXJA 4G7OA 3GTMK 4A3IK 5D4DA 2JA6C 1TWAC 2A68A 3HOWC 1TWFK 2A6EA 4QIWL 5TMCA 5FJ8K 3S1NK 1BDFA 2R92C 4BBSK 5C44C 2A69A 4XSZA 2E2IK 4BBRC 3HKZL 2PPBA 2Y0SD 3GTJK 4QJVA 3WODA 4BY1K 3S2HK 3GTGK 3I4MC 4GZYA 5IP9C 3HOUK 1TWCC 4A3LC 2PA8L 3S14K 3K7AC 5C3EK 5M3FK 2WB1D 4Q4ZA 4A3JC 4A3KK 4AYBD 3GTQC 1TWGC 3CQZK 1I50C 4C3HC 4G7HA 4X6AC 2Y0SL 1Y1VC 1TWHK 2JA5C 2BE5A 4YFXA 3M4OC 2A6HA 2R7ZK 4C3IC 3RZDK 4A93K 2NVYK 5C44K 2E2HK 2B63K 4A3CC 3H3VD 4BBRK 4A3DC 3S1RK 1ZYRA 5IP7C 2O5IA 3S2DC 4YFKA 3PO2C 2NVXK 3H0GC 4C2MK 3M3YC 4A3LK 2E2JC 2WAQD 3K7AK 5IYBK 3S15C 3S1QC 5M5XK 5C4JC 2JA8C 4A3GC 3GTLK 3HOVK 1SFOK 3HOYK 5C4XC 1K83K 1TWGK 4MEYA 4XLNA 1Y1WC 4BY7C 2R93C 3S17C 4C3HK 4A3BK 3I4NC 4BXXC 2JA5K 4NOIA 5M5YK 2YU9K 5IYCC 1R9TC 4Y52K 4A3FK 2JA7K 3GTKC 5IYDC 4A3MC 5FLMK 3S1MK 3HOXC 3GTPC 4ZH4A 5TMFA 3RZOC 4LJZA 2JA6K 5M3MK 3FKIC 1TWAK 4A3EC 4JK1A 3HOWK 2NVTC 3GTOC 1XPPA 2R92K 1YNNA 4MEXA 3PO3C 2CW0A 2VUMC 2WB1L 3S1QK 4C3JC 3GTMC 4A3IC 4YFNA 3S16C 4AYBL 2JA8K 4A3GK 1TWFC 3I4MK 5IP9K 1TWCK 3S1NC 4KN4A 4KMUA 4OIQA 4OIOA 1I3QC 2E2IC 3GTJC 4A3JK 4OINA 4A3MK 3GTQK 3HOXK 1I50K 2NVQC 4X6AK 3HOZC 3H3VL 3HOUC 3S14C 4LK0A 1Y1VK 4XSXA 5C3EC 1I6VA 3M4OK 4A3KC 1WCMC 4C3IK 2WAQL 1IW7A 3CQZC 4A3CK 2PA8D 4A3DK 4C3JK 1TWHC 5IP7K 3S16K 3S2DK 3PO2K 3H0GK
chains in the Genus database with same CATH superfamily
4BKWA 2E2JK 4Y7NC 2R7ZC 1I6HC 4GFQA 4QJVB 2B63C 1I3QK 2ZUFA 3S1RC 4KASA 1O29A 2NVQK 4BY7K 3I4NK 4BBSC 4KMAA 4XLPA 4G7ZA 5TJ3A 3GTKK 4BY1C 3GTLC 2KQ1A 2ZJRS 1SFOC 4QIWD 4ILDA 4YG2A 4A3EK 2NVTK 3HKZD 4Y52C 1VH2A 1TWGA 4LK1A 5E68A 2FQTA 5FLMC 1Y1VA 3DXJA 3GTMK 3AQOA 1UV7A 4WJ4A 1B4BA 5FJ8K 2CFAA 1WIHA 4GTCA 4BBRC 3GTJK 4QJVA 1ZBSA 1G51A 3GTGK 3I4MC 3LAJA 4G0WA 3BP8C 4A3JC 4FM9A 1Y1WA 1PJ6A 2R93A 1TWGC 3BP3A 4WFAS 1WSRA 2Y0SL 1Y1VC 1WORA 3NUHA 1XZPA 3M4OC 5DM6S 4A3DC 1ZYRA 2O5IA 1DD5A 3SZYA 4GTDA 3M3YC 4A3LK 1F9NA 5IYBK 4XCHA 1O2BA 2JA8C 5IOSA 3HOYK 4MEYA 1Y1WC 2R93C 3S17C 2E2IA 4BXXC 2JA5K 1HI9A 2JA7K 2KXYA 1O24A 2JA6K 1TWAK 3HOWK 1WCMA 3CQZA 1XPPA 4MEXA 3N0BA 1IQ0A 4DDQA 4C3JC 4AH6A 1EQRA 2P8TA 5IP9K 2E2HA 3GEHA 2E2IC 4KDDA 2NVXA 1XXAA 4PAAA 4A3MK 3GTQK 1F7VA 3HOUC 1C0AA 1WCMC 1DCOA 4C3IK 3CQZC 2PA8D 3G4CA 1WQFA 2YU9A 5CHPA 5IP7K 3S16K 3T00A 3S2DK 3Q3QA 3PIPS 4WFBS 4A93C 2E2HC 4O2DA 5C4JK 5C4XK 2NVXC 3A8KA 4C2MC 1INNA 2Y3PA 3GEEA 4FZBA 2L3UA 4GT9A 1EFWA 4G0VA 4GTEA 5IYCK 1O28A 1J6XA 3HOVC 1TWCA 3RZOK 1V5VA 3GIRA 4C45A 4OIRA 2YU9C 4A3FC 1IE0A 2GSNA 4Y7NK 3PO3K 1I6HK 5D4DA 1XZQB 2A68A 1DCPA 3S1NK 1BDFA 4BBSK 5C44C 4XSZA 2Y0SD 1ISEA 4BY1K 1WOOA 2ZFZA 1TWCC 2PA8L 4GTLA 3AH5A 2W7VA 1IL2A 2WB1D 1O2AA 4KATA 1VJEA 1BJTA 1BS2A 1ZQ1C 1XXBA 4KC6A 3LYWA 3GTKA 2BE5A 4YFXA 4WFNS 1JQWA 1KQ4A 3RZDK 2NVYK 4J3NA 4BBRK 4U67S 3JSTA 4YFKA 3PO2C 1YCLA 2E2JC 3GTMA 3S1QC 5M5XK 5HL7S 4A3GC 3OREA 4P5AA 4GTAA 5IOQA 1K83K 1TWGK 4XLNA 4BY7C 4A3BK 3OPFA 3I4NC 3GTJA 5M5YK 3GTKC 2RGRA 3S1MK 5TMFA 5JVOA 5M3MK 4A3EC 2NVTC 4IO9S 2R92K 3QX3A 1YNNA 2CW0A 2V6UA 2WB1L 3FHZA 3GTMC 1USOA 2JA8K 1J98A 4KN4A 1EH1A 3T01A 3GTJC 4OINA 1IBAA 4KMDA 4KAWX 1I50K 4X6AK 3HOZC 3LAPA 4XSXA 4KB2A 4A3CK 4C3JK 2JA7A 4WILA 3H0GK 4LLGA 4WF9S 3S15K 2JA6A 4GTBA 1TWAA 3V4GA 2P5MA 3N0CA 1HQMA 1O2FB 4P9SA 5IORA 4KB4A 5IYBC 1R9TK 3PIOS 2O5JA 5IYDK 3S2HC 1WCMK 2KPUA 1XXCA 3EQLA 5HQHA 3HOYC 3GTPK 3TTGA 3FKIK 3ADAC 3CF5S 3GTOK 3GTQA 2JA7C 3FOEA 2PMZL 2VUMK 3DLLS 1ZVUA 4A3IK 2JA6C 1TWAC 3HOWC 1TWFK 2ZUEA 3AD8C 5TMCA 4LOWA 2A69A 2PPBA 1J6VA 1WOSA 5CJ9A 3WODA 4GZYA 5IP9C 3S14K 3K7AC 3FOFA 3GEIA 5C3EK 1EI6A 4Q4ZA 4A3KK 4AYBD 3ERED 3GTQC 2XCOA 5EGEA 4C3HC 1TWHK 2R7ZK 4C3IC 5C44K 2B63K 4LR2A 4IOCS 3H3VD 4IOAS 3N3YA 4KARA 2L5NA 5IP7C 3S1RK 3S2DC 4LQYA 2WAQD 5C4JC 3GTLK 1SFOK 1GE9A 5C4XC 3AQPA 3L4KA 1I3QA 2GAGC 5IYCC 4BLBA 4Y52K 5FLMK 3HOXC 3RZOC 4WCES 2V6SA 2CFAB 3OEPA 3PO3C 2PHCB 3HXAA 3S1QK 4YFNA 4A3GK 4AYBL 1L0WA 3I4MK 2JH3A 1PJ5A 1RU0A 1XZQA 2NVYA 3S1NC 4KMUA 4OIQA 4OIOA 1I3QC 5HL8A 4A3JK 3SZZA 2NVQC 3H3VL 1Y1VK 4LK0A 5L46A 1XZPB 2V6TA 3GTGA 2ZJPS 3M4OK 1K83A 3MMLB 2GAHC 2WAQL 1IW7A 3AD7C 1PJ7A 1WSVA 2FQOA 3AD9C 4A3DK 3T02A 3VA7A 3M3YK 1SMYA 3RZDC 2NVYC 3GSIA 1F7UA 2XCQA 2R92A 4Q5SA 1Y1WK 3HOZK 3S17K 2R93K 1WQHA 4BXXK 2PMZD 2EBBA 4KN7A 3TFJA 3GTGC 4P5BA 1O25A 3CAGA 1K83C 3LPXA 4OIPA 2ZJQS 1YNJA 4MQ9A 4A3BC 3TFIA 1X31C 5M5WK 1O26A 1I50A 1F93A 4PABA 3S1MC 2JA5A 4G7OA 1JVIA 2A6EA 4QIWL 2R92C 2E2IK 3HKZL 3H0GA 3S2HK 1WQGA 5IOTA 3HOUK 4A3LC 1J6WA 2GSUA 5M3FK 4G0UA 4WJ3M 5DM7S 1O27A 3GDZA 4BLAA 1AB4A 3CQZK 3S0XA 1I50C 3TFHA 4G7HA 4X6AC 1R9TA 1EK8A 2JA5C 3A8IA 2D6FC 3GTPA 3BUEA 2A6HA 1VRQC 4A93K 2E2HK 3FKIA 4A3CC 4M1XA 3L4JA 3GTOA 2GSOA 3IPJA 2NVXK 3H0GC 4C2MK 4KM9A 2VUMA 1VGXA 5EGHA 3K7AK 4GTFA 3S15C 5JVHS 1DCHA 1TWFA 1VLOA 4KM8A 3HOVK 4C3HK 1WOPA 4NOIA 2YU9K 1R9TC 4KMHA 4A3FK 5IYDC 4A3MC 3GTPC 4ZH4A 4LJZA 1FEUA 3FKIC 4JK1A 3GTOC 1B4AA 1BGWA 1IS1A 1TWHA 2VUMC 2KWAA 4A3IC 3S16C 1ZXOA 1TWFC 2XCRB 2R7ZA 1TWCK 5JFEA 2B63A 2RH6A 5JVGS 1JOEA 3HOXK 1YX2A 3S14C 3A8JA 3GTLA 5C3EC 1I6VA 1SFOA 4RMFA 4A3KC 1USMA 3G4AA 1TWHC 3PO2K
chains in the Genus database with same CATH topology
3M3YK 2E2JK 1SMYA 4LLGA 4Y7NC 3RZDC 2R7ZC 2NVYC 4A93C 2E2HC 2B63C 1I6HC 1I3QK 4QJVB 5C4JK 3S15K 3S1RC 1HQMA 5C4XK 2NVXC 4Q5SA 4C2MC 1Y1WK 2NVQK 3HOZK 3S17K 4BY7K 3I4NK 4BXXK 4BBSC 2R93K 2PMZD 5IYBC 4XLPA 4G7ZA 5IYCK 1R9TK 2O5JA 3GTKK 5IYDK 4BY1C 4KN7A 3GTLC 1SFOC 3GTGC 3EQLA 3HOVC 4QIWD 3HOYC 3S2HC 1K83C 1WCMK 3GTPK 4OIPA 3RZOK 4YG2A 1YNJA 4MQ9A 4OIRA 4A3BC 3FKIK 4A3EK 2YU9C 2NVTK 3HKZD 4Y52C 3GTOK 4A3FC 5M5WK 2JA7C 4LK1A 4Y7NK 3PO3K 1I6HK 5FLMC 3S1MC 2PMZL 2VUMK 3DXJA 4G7OA 3GTMK 4A3IK 5D4DA 2JA6C 1TWAC 2A68A 3HOWC 1TWFK 2A6EA 4QIWL 5TMCA 5FJ8K 3S1NK 1BDFA 2R92C 4BBSK 5C44C 2A69A 4XSZA 2E2IK 4BBRC 3HKZL 2PPBA 2Y0SD 3GTJK 4QJVA 3WODA 4BY1K 3S2HK 3GTGK 3I4MC 4GZYA 5IP9C 3HOUK 1TWCC 4A3LC 2PA8L 3S14K 3K7AC 5C3EK 5M3FK 2WB1D 4Q4ZA 4A3JC 4A3KK 4AYBD 3GTQC 1TWGC 3CQZK 1I50C 4C3HC 4G7HA 4X6AC 2Y0SL 1Y1VC 1TWHK 2JA5C 2BE5A 4YFXA 3M4OC 2A6HA 2R7ZK 4C3IC 3RZDK 4A93K 2NVYK 5C44K 2E2HK 2B63K 4A3CC 3H3VD 4BBRK 4A3DC 3S1RK 1ZYRA 5IP7C 2O5IA 3S2DC 4YFKA 3PO2C 2NVXK 3H0GC 4C2MK 3M3YC 4A3LK 2E2JC 2WAQD 3K7AK 5IYBK 3S15C 3S1QC 5M5XK 5C4JC 2JA8C 4A3GC 3GTLK 3HOVK 1SFOK 3HOYK 5C4XC 1K83K 1TWGK 4MEYA 4XLNA 1Y1WC 4BY7C 2R93C 3S17C 4C3HK 4A3BK 3I4NC 4BXXC 2JA5K 4NOIA 5M5YK 2YU9K 5IYCC 1R9TC 4Y52K 4A3FK 2JA7K 3GTKC 5IYDC 4A3MC 5FLMK 3S1MK 3HOXC 3GTPC 4ZH4A 5TMFA 3RZOC 4LJZA 2JA6K 5M3MK 3FKIC 1TWAK 4A3EC 4JK1A 3HOWK 2NVTC 3GTOC 1XPPA 2R92K 1YNNA 4MEXA 3PO3C 2CW0A 2VUMC 2WB1L 3S1QK 4C3JC 3GTMC 4A3IC 4YFNA 3S16C 4AYBL 2JA8K 4A3GK 1TWFC 3I4MK 5IP9K 1TWCK 3S1NC 4KN4A 4KMUA 4OIQA 4OIOA 1I3QC 2E2IC 3GTJC 4A3JK 4OINA 4A3MK 3GTQK 3HOXK 1I50K 2NVQC 4X6AK 3HOZC 3H3VL 3HOUC 3S14C 4LK0A 1Y1VK 4XSXA 5C3EC 1I6VA 3M4OK 4A3KC 1WCMC 4C3IK 2WAQL 1IW7A 3CQZC 4A3CK 2PA8D 4A3DK 4C3JK 1TWHC 5IP7K 3S16K 3S2DK 3PO2K 3H0GK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M3Y K;  2E2J K;  1SMY A;  4LLG A;  4Y7N C;  3RZD C;  2R7Z C;  2NVY C;  4A93 C;  2E2H C;  2B63 C;  1I6H C;  1I3Q K;  4QJV B;  5C4J K;  3S15 K;  3S1R C;  1HQM A;  5C4X K;  2NVX C;  4Q5S A;  4C2M C;  1Y1W K;  2NVQ K;  3HOZ K;  3S17 K;  4BY7 K;  3I4N K;  4BXX K;  4BBS C;  2R93 K;  2PMZ D;  5IYB C;  4XLP A;  4G7Z A;  5IYC K;  1R9T K;  2O5J A;  3GTK K;  5IYD K;  4BY1 C;  4KN7 A;  3GTL C;  1SFO C;  3GTG C;  3EQL A;  3HOV C;  4QIW D;  3HOY C;  3S2H C;  1K83 C;  1WCM K;  3GTP K;  4OIP A;  3RZO K;  4YG2 A;  1YNJ A;  4MQ9 A;  4OIR A;  4A3B C;  3FKI K;  4A3E K;  2YU9 C;  2NVT K;  3HKZ D;  4Y52 C;  3GTO K;  4A3F C;  5M5W K;  2JA7 C;  4LK1 A;  4Y7N K;  3PO3 K;  1I6H K;  5FLM C;  3S1M C;  2PMZ L;  2VUM K;  3DXJ A;  4G7O A;  3GTM K;  4A3I K;  5D4D A;  2JA6 C;  1TWA C;  2A68 A;  3HOW C;  1TWF K;  2A6E A;  4QIW L;  5TMC A;  5FJ8 K;  3S1N K;  1BDF A;  2R92 C;  4BBS K;  5C44 C;  2A69 A;  4XSZ A;  2E2I K;  4BBR C;  3HKZ L;  2PPB A;  2Y0S D;  3GTJ K;  4QJV A;  3WOD A;  4BY1 K;  3S2H K;  3GTG K;  3I4M C;  4GZY A;  5IP9 C;  3HOU K;  1TWC C;  4A3L C;  2PA8 L;  3S14 K;  3K7A C;  5C3E K;  5M3F K;  2WB1 D;  4Q4Z A;  4A3J C;  4A3K K;  4AYB D;  3GTQ C;  1TWG C;  3CQZ K;  1I50 C;  4C3H C;  4G7H A;  4X6A C;  2Y0S L;  1Y1V C;  1TWH K;  2JA5 C;  2BE5 A;  4YFX A;  3M4O C;  2A6H A;  2R7Z K;  4C3I C;  3RZD K;  4A93 K;  2NVY K;  5C44 K;  2E2H K;  2B63 K;  4A3C C;  3H3V D;  4BBR K;  4A3D C;  3S1R K;  1ZYR A;  5IP7 C;  2O5I A;  3S2D C;  4YFK A;  3PO2 C;  2NVX K;  3H0G C;  4C2M K;  3M3Y C;  4A3L K;  2E2J C;  2WAQ D;  3K7A K;  5IYB K;  3S15 C;  3S1Q C;  5M5X K;  5C4J C;  2JA8 C;  4A3G C;  3GTL K;  3HOV K;  1SFO K;  3HOY K;  5C4X C;  1K83 K;  1TWG K;  4MEY A;  4XLN A;  1Y1W C;  4BY7 C;  2R93 C;  3S17 C;  4C3H K;  4A3B K;  3I4N C;  4BXX C;  2JA5 K;  4NOI A;  5M5Y K;  2YU9 K;  5IYC C;  1R9T C;  4Y52 K;  4A3F K;  2JA7 K;  3GTK C;  5IYD C;  4A3M C;  5FLM K;  3S1M K;  3HOX C;  3GTP C;  4ZH4 A;  5TMF A;  3RZO C;  4LJZ A;  2JA6 K;  5M3M K;  3FKI C;  1TWA K;  4A3E C;  4JK1 A;  3HOW K;  2NVT C;  3GTO C;  1XPP A;  2R92 K;  1YNN A;  4MEX A;  3PO3 C;  2CW0 A;  2VUM C;  2WB1 L;  3S1Q K;  4C3J C;  3GTM C;  4A3I C;  4YFN A;  3S16 C;  4AYB L;  2JA8 K;  4A3G K;  1TWF C;  3I4M K;  5IP9 K;  1TWC K;  3S1N C;  4KN4 A;  4KMU A;  4OIQ A;  4OIO A;  1I3Q C;  2E2I C;  3GTJ C;  4A3J K;  4OIN A;  4A3M K;  3GTQ K;  3HOX K;  1I50 K;  2NVQ C;  4X6A K;  3HOZ C;  3H3V L;  3HOU C;  3S14 C;  4LK0 A;  1Y1V K;  4XSX A;  5C3E C;  1I6V A;  3M4O K;  4A3K C;  1WCM C;  4C3I K;  2WAQ L;  1IW7 A;  3CQZ C;  4A3C K;  2PA8 D;  4A3D K;  4C3J K;  1TWH C;  5IP7 K;  3S16 K;  3S2D K;  3PO2 K;  3H0G K; 
#chains in the Genus database with same CATH topology
 4BKW A;  2E2J K;  4Y7N C;  2R7Z C;  1I6H C;  4GFQ A;  4QJV B;  2B63 C;  1I3Q K;  2ZUF A;  3S1R C;  4KAS A;  1O29 A;  2NVQ K;  4BY7 K;  3I4N K;  4BBS C;  4KMA A;  4XLP A;  4G7Z A;  5TJ3 A;  3GTK K;  4BY1 C;  3GTL C;  2KQ1 A;  2ZJR S;  1SFO C;  4QIW D;  4ILD A;  4YG2 A;  4A3E K;  2NVT K;  3HKZ D;  4Y52 C;  1VH2 A;  1TWG A;  4LK1 A;  5E68 A;  2FQT A;  5FLM C;  1Y1V A;  3DXJ A;  3GTM K;  3AQO A;  1UV7 A;  4WJ4 A;  1B4B A;  5FJ8 K;  2CFA A;  1WIH A;  4GTC A;  4BBR C;  3GTJ K;  4QJV A;  1ZBS A;  1G51 A;  3GTG K;  3I4M C;  3LAJ A;  4G0W A;  3BP8 C;  4A3J C;  4FM9 A;  1Y1W A;  1PJ6 A;  2R93 A;  1TWG C;  3BP3 A;  4WFA S;  1WSR A;  2Y0S L;  1Y1V C;  1WOR A;  3NUH A;  1XZP A;  3M4O C;  5DM6 S;  4A3D C;  1ZYR A;  2O5I A;  1DD5 A;  3SZY A;  4GTD A;  3M3Y C;  4A3L K;  1F9N A;  5IYB K;  4XCH A;  1O2B A;  2JA8 C;  5IOS A;  3HOY K;  4MEY A;  1Y1W C;  2R93 C;  3S17 C;  2E2I A;  4BXX C;  2JA5 K;  1HI9 A;  2JA7 K;  2KXY A;  1O24 A;  2JA6 K;  1TWA K;  3HOW K;  1WCM A;  3CQZ A;  1XPP A;  4MEX A;  3N0B A;  1IQ0 A;  4DDQ A;  4C3J C;  4AH6 A;  1EQR A;  2P8T A;  5IP9 K;  2E2H A;  3GEH A;  2E2I C;  4KDD A;  2NVX A;  1XXA A;  4PAA A;  4A3M K;  3GTQ K;  1F7V A;  3HOU C;  1C0A A;  1WCM C;  1DCO A;  4C3I K;  3CQZ C;  2PA8 D;  3G4C A;  1WQF A;  2YU9 A;  5CHP A;  5IP7 K;  3S16 K;  3T00 A;  3S2D K;  3Q3Q A;  3PIP S;  4WFB S;  4A93 C;  2E2H C;  4O2D A;  5C4J K;  5C4X K;  2NVX C;  3A8K A;  4C2M C;  1INN A;  2Y3P A;  3GEE A;  4FZB A;  2L3U A;  4GT9 A;  1EFW A;  4G0V A;  4GTE A;  5IYC K;  1O28 A;  1J6X A;  3HOV C;  1TWC A;  3RZO K;  1V5V A;  3GIR A;  4C45 A;  4OIR A;  2YU9 C;  4A3F C;  1IE0 A;  2GSN A;  4Y7N K;  3PO3 K;  1I6H K;  5D4D A;  1XZQ B;  2A68 A;  1DCP A;  3S1N K;  1BDF A;  4BBS K;  5C44 C;  4XSZ A;  2Y0S D;  1ISE A;  4BY1 K;  1WOO A;  2ZFZ A;  1TWC C;  2PA8 L;  4GTL A;  3AH5 A;  2W7V A;  1IL2 A;  2WB1 D;  1O2A A;  4KAT A;  1VJE A;  1BJT A;  1BS2 A;  1ZQ1 C;  1XXB A;  4KC6 A;  3LYW A;  3GTK A;  2BE5 A;  4YFX A;  4WFN S;  1JQW A;  1KQ4 A;  3RZD K;  2NVY K;  4J3N A;  4BBR K;  4U67 S;  3JST A;  4YFK A;  3PO2 C;  1YCL A;  2E2J C;  3GTM A;  3S1Q C;  5M5X K;  5HL7 S;  4A3G C;  3ORE A;  4P5A A;  4GTA A;  5IOQ A;  1K83 K;  1TWG K;  4XLN A;  4BY7 C;  4A3B K;  3OPF A;  3I4N C;  3GTJ A;  5M5Y K;  3GTK C;  2RGR A;  3S1M K;  5TMF A;  5JVO A;  5M3M K;  4A3E C;  2NVT C;  4IO9 S;  2R92 K;  3QX3 A;  1YNN A;  2CW0 A;  2V6U A;  2WB1 L;  3FHZ A;  3GTM C;  1USO A;  2JA8 K;  1J98 A;  4KN4 A;  1EH1 A;  3T01 A;  3GTJ C;  4OIN A;  1IBA A;  4KMD A;  4KAW X;  1I50 K;  4X6A K;  3HOZ C;  3LAP A;  4XSX A;  4KB2 A;  4A3C K;  4C3J K;  2JA7 A;  4WIL A;  3H0G K;  4LLG A;  4WF9 S;  3S15 K;  2JA6 A;  4GTB A;  1TWA A;  3V4G A;  2P5M A;  3N0C A;  1HQM A;  1O2F B;  4P9S A;  5IOR A;  4KB4 A;  5IYB C;  1R9T K;  3PIO S;  2O5J A;  5IYD K;  3S2H C;  1WCM K;  2KPU A;  1XXC A;  3EQL A;  5HQH A;  3HOY C;  3GTP K;  3TTG A;  3FKI K;  3ADA C;  3CF5 S;  3GTO K;  3GTQ A;  2JA7 C;  3FOE A;  2PMZ L;  2VUM K;  3DLL S;  1ZVU A;  4A3I K;  2JA6 C;  1TWA C;  3HOW C;  1TWF K;  2ZUE A;  3AD8 C;  5TMC A;  4LOW A;  2A69 A;  2PPB A;  1J6V A;  1WOS A;  5CJ9 A;  3WOD A;  4GZY A;  5IP9 C;  3S14 K;  3K7A C;  3FOF A;  3GEI A;  5C3E K;  1EI6 A;  4Q4Z A;  4A3K K;  4AYB D;  3ERE D;  3GTQ C;  2XCO A;  5EGE A;  4C3H C;  1TWH K;  2R7Z K;  4C3I C;  5C44 K;  2B63 K;  4LR2 A;  4IOC S;  3H3V D;  4IOA S;  3N3Y A;  4KAR A;  2L5N A;  5IP7 C;  3S1R K;  3S2D C;  4LQY A;  2WAQ D;  5C4J C;  3GTL K;  1SFO K;  1GE9 A;  5C4X C;  3AQP A;  3L4K A;  1I3Q A;  2GAG C;  5IYC C;  4BLB A;  4Y52 K;  5FLM K;  3HOX C;  3RZO C;  4WCE S;  2V6S A;  2CFA B;  3OEP A;  3PO3 C;  2PHC B;  3HXA A;  3S1Q K;  4YFN A;  4A3G K;  4AYB L;  1L0W A;  3I4M K;  2JH3 A;  1PJ5 A;  1RU0 A;  1XZQ A;  2NVY A;  3S1N C;  4KMU A;  4OIQ A;  4OIO A;  1I3Q C;  5HL8 A;  4A3J K;  3SZZ A;  2NVQ C;  3H3V L;  1Y1V K;  4LK0 A;  5L46 A;  1XZP B;  2V6T A;  3GTG A;  2ZJP S;  3M4O K;  1K83 A;  3MML B;  2GAH C;  2WAQ L;  1IW7 A;  3AD7 C;  1PJ7 A;  1WSV A;  2FQO A;  3AD9 C;  4A3D K;  3T02 A;  3VA7 A;  3M3Y K;  1SMY A;  3RZD C;  2NVY C;  3GSI A;  1F7U A;  2XCQ A;  2R92 A;  4Q5S A;  1Y1W K;  3HOZ K;  3S17 K;  2R93 K;  1WQH A;  4BXX K;  2PMZ D;  2EBB A;  4KN7 A;  3TFJ A;  3GTG C;  4P5B A;  1O25 A;  3CAG A;  1K83 C;  3LPX A;  4OIP A;  2ZJQ S;  1YNJ A;  4MQ9 A;  4A3B C;  3TFI A;  1X31 C;  5M5W K;  1O26 A;  1I50 A;  1F93 A;  4PAB A;  3S1M C;  2JA5 A;  4G7O A;  1JVI A;  2A6E A;  4QIW L;  2R92 C;  2E2I K;  3HKZ L;  3H0G A;  3S2H K;  1WQG A;  5IOT A;  3HOU K;  4A3L C;  1J6W A;  2GSU A;  5M3F K;  4G0U A;  4WJ3 M;  5DM7 S;  1O27 A;  3GDZ A;  4BLA A;  1AB4 A;  3CQZ K;  3S0X A;  1I50 C;  3TFH A;  4G7H A;  4X6A C;  1R9T A;  1EK8 A;  2JA5 C;  3A8I A;  2D6F C;  3GTP A;  3BUE A;  2A6H A;  1VRQ C;  4A93 K;  2E2H K;  3FKI A;  4A3C C;  4M1X A;  3L4J A;  3GTO A;  2GSO A;  3IPJ A;  2NVX K;  3H0G C;  4C2M K;  4KM9 A;  2VUM A;  1VGX A;  5EGH A;  3K7A K;  4GTF A;  3S15 C;  5JVH S;  1DCH A;  1TWF A;  1VLO A;  4KM8 A;  3HOV K;  4C3H K;  1WOP A;  4NOI A;  2YU9 K;  1R9T C;  4KMH A;  4A3F K;  5IYD C;  4A3M C;  3GTP C;  4ZH4 A;  4LJZ A;  1FEU A;  3FKI C;  4JK1 A;  3GTO C;  1B4A A;  1BGW A;  1IS1 A;  1TWH A;  2VUM C;  2KWA A;  4A3I C;  3S16 C;  1ZXO A;  1TWF C;  2XCR B;  2R7Z A;  1TWC K;  5JFE A;  2B63 A;  2RH6 A;  5JVG S;  1JOE A;  3HOX K;  1YX2 A;  3S14 C;  3A8J A;  3GTL A;  5C3E C;  1I6V A;  1SFO A;  4RMF A;  4A3K C;  1USM A;  3G4A A;  1TWH C;  3PO2 K; 
#chains in the Genus database with same CATH homology
 3M3Y K;  2E2J K;  1SMY A;  4LLG A;  4Y7N C;  3RZD C;  2R7Z C;  2NVY C;  4A93 C;  2E2H C;  2B63 C;  1I6H C;  1I3Q K;  4QJV B;  5C4J K;  3S15 K;  3S1R C;  1HQM A;  5C4X K;  2NVX C;  4Q5S A;  4C2M C;  1Y1W K;  2NVQ K;  3HOZ K;  3S17 K;  4BY7 K;  3I4N K;  4BXX K;  4BBS C;  2R93 K;  2PMZ D;  5IYB C;  4XLP A;  4G7Z A;  5IYC K;  1R9T K;  2O5J A;  3GTK K;  5IYD K;  4BY1 C;  4KN7 A;  3GTL C;  1SFO C;  3GTG C;  3EQL A;  3HOV C;  4QIW D;  3HOY C;  3S2H C;  1K83 C;  1WCM K;  3GTP K;  4OIP A;  3RZO K;  4YG2 A;  1YNJ A;  4MQ9 A;  4OIR A;  4A3B C;  3FKI K;  4A3E K;  2YU9 C;  2NVT K;  3HKZ D;  4Y52 C;  3GTO K;  4A3F C;  5M5W K;  2JA7 C;  4LK1 A;  4Y7N K;  3PO3 K;  1I6H K;  5FLM C;  3S1M C;  2PMZ L;  2VUM K;  3DXJ A;  4G7O A;  3GTM K;  4A3I K;  5D4D A;  2JA6 C;  1TWA C;  2A68 A;  3HOW C;  1TWF K;  2A6E A;  4QIW L;  5TMC A;  5FJ8 K;  3S1N K;  1BDF A;  2R92 C;  4BBS K;  5C44 C;  2A69 A;  4XSZ A;  2E2I K;  4BBR C;  3HKZ L;  2PPB A;  2Y0S D;  3GTJ K;  4QJV A;  3WOD A;  4BY1 K;  3S2H K;  3GTG K;  3I4M C;  4GZY A;  5IP9 C;  3HOU K;  1TWC C;  4A3L C;  2PA8 L;  3S14 K;  3K7A C;  5C3E K;  5M3F K;  2WB1 D;  4Q4Z A;  4A3J C;  4A3K K;  4AYB D;  3GTQ C;  1TWG C;  3CQZ K;  1I50 C;  4C3H C;  4G7H A;  4X6A C;  2Y0S L;  1Y1V C;  1TWH K;  2JA5 C;  2BE5 A;  4YFX A;  3M4O C;  2A6H A;  2R7Z K;  4C3I C;  3RZD K;  4A93 K;  2NVY K;  5C44 K;  2E2H K;  2B63 K;  4A3C C;  3H3V D;  4BBR K;  4A3D C;  3S1R K;  1ZYR A;  5IP7 C;  2O5I A;  3S2D C;  4YFK A;  3PO2 C;  2NVX K;  3H0G C;  4C2M K;  3M3Y C;  4A3L K;  2E2J C;  2WAQ D;  3K7A K;  5IYB K;  3S15 C;  3S1Q C;  5M5X K;  5C4J C;  2JA8 C;  4A3G C;  3GTL K;  3HOV K;  1SFO K;  3HOY K;  5C4X C;  1K83 K;  1TWG K;  4MEY A;  4XLN A;  1Y1W C;  4BY7 C;  2R93 C;  3S17 C;  4C3H K;  4A3B K;  3I4N C;  4BXX C;  2JA5 K;  4NOI A;  5M5Y K;  2YU9 K;  5IYC C;  1R9T C;  4Y52 K;  4A3F K;  2JA7 K;  3GTK C;  5IYD C;  4A3M C;  5FLM K;  3S1M K;  3HOX C;  3GTP C;  4ZH4 A;  5TMF A;  3RZO C;  4LJZ A;  2JA6 K;  5M3M K;  3FKI C;  1TWA K;  4A3E C;  4JK1 A;  3HOW K;  2NVT C;  3GTO C;  1XPP A;  2R92 K;  1YNN A;  4MEX A;  3PO3 C;  2CW0 A;  2VUM C;  2WB1 L;  3S1Q K;  4C3J C;  3GTM C;  4A3I C;  4YFN A;  3S16 C;  4AYB L;  2JA8 K;  4A3G K;  1TWF C;  3I4M K;  5IP9 K;  1TWC K;  3S1N C;  4KN4 A;  4KMU A;  4OIQ A;  4OIO A;  1I3Q C;  2E2I C;  3GTJ C;  4A3J K;  4OIN A;  4A3M K;  3GTQ K;  3HOX K;  1I50 K;  2NVQ C;  4X6A K;  3HOZ C;  3H3V L;  3HOU C;  3S14 C;  4LK0 A;  1Y1V K;  4XSX A;  5C3E C;  1I6V A;  3M4O K;  4A3K C;  1WCM C;  4C3I K;  2WAQ L;  1IW7 A;  3CQZ C;  4A3C K;  2PA8 D;  4A3D K;  4C3J K;  1TWH C;  5IP7 K;  3S16 K;  3S2D K;  3PO2 K;  3H0G K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...