2A6HA

Crystal structure of the t. thermophilus rna polymerase holoenzyme in complex with antibiotic sterptolydigin
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
229
structure length
229
Chain Sequence
MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase alpha chain
publication title Structural basis of transcription inhibition by antibiotic streptolydigin.
pubmed doi rcsb
molecule tags Transferase
total genus 42
structure length 229
sequence length 229
chains with identical sequence B, K, L
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2005-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01000 RNA_pol_A_bac RNA polymerase Rpb3/RpoA insert domain
A PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain
A PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.12 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 DNA-directed RNA polymerase, insert domain 2a6hA02
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 2a6hA01
4A3BK 5C44K 4XSXA 4XSZA 3GTMK 4Y7NK 4C3IK 4YFKA 4BY7K 4G7ZA 2PMZD 3M4OK 3GTGK 5C3EK 3GTLK 5M5WK 5IYBC 5C4JK 3GTQK 5IYDK 3HKZD 3HOYC 4ZH4A 4C2MK 2E2IK 3HOUK 3M3YK 5FLMK 4A93K 4XLNA 2PMZL 4MQ9A 3H3VD 2Y0SL 3S1MC 4C3JK 4A3JC 5C4XC 3HOWK 4Y52K 4A3LK 3HOXC 3HOVC 5IP7C 3S17C 1WCMC 1Y1VK 3I4NC 5IYCK 2A68A 2NVTC 4BBSC 3FKIK 3S1RK 1I6HK 4A3KC 2O5JA 2NVYK 3S2DC 4BXXC 4A3MC 4KN7A 2NVXC 2R92K 2VUMK 2WB1D 4LJZA 3H0GC 2YU9C 3S1QC 1IW7A 4GZYA 3GTKK 3GTOC 3S1NC 3S2HK 4A3DK 4A3GK 2R7ZC 3PO2C 1TWFC 2JA5C 4AYBL 1TWGK 1YNJA 3I4MK 3HOUC 1TWAK 1Y1WK 4BBRK 2PA8D 4A3CC 1R9TK 2PPBA 2O5IA 3GTPC 4NOIA 2NVQC 4A3FK 4C3HK 1SFOK 4LLGA 3RZDK 2JA8C 3S15C 5M3MK 4QJVA 3S16K 3FKIC 4BY1C 1XPPA 2E2HK 2JA7K 3PO3K 1I3QC 3HKZL 2R92C 5IP9K 2WAQD 1I50C 2VUMC 2R93C 5M5XK 3K7AC 2BE5A 3GTJK 4LK1A 4MEYA 3GTKC 4YFXA 5TMCA 5C44C 4A3BC 1HQMA 1TWCK 4Q4ZA 2JA6K 3H3VL 3GTMC 4A3EK 1TWHK 2B63K 4Y7NC 3S14K 4KN4A 1TWAC 4C3IC 4BY7C 5FJ8K 3M4OC 3WODA 1K83K 3GTGC 4X6AK 5C3EC 3GTLC 4A3IK 3CQZK 5C4JC 3GTQC 3RZOK 5IYDC 4A93C 2E2IC 4JK1A 4C2MC 2A6HA 3M3YC 5FLMC 2E2JK 1I50K 2WB1L 1ZYRA 4G7OA 4C3JC 2A69A 1BDFA 1SMYA 3HOWC 4Y52C 5TMFA 4A3LC 2CW0A 5IYBK 4YFNA 1Y1VC 5IYCC 4QIWD 2PA8L 3HOYK 3S1RC 1I6HC 2NVYC 3S1MK 1I6VA 5C4XK 4A3JK 4YG2A 4Q5SA 3HOXK 3HOVK 5IP7K 3S2HC 4A3DC 4A3GC 3S17K 3RZOC 1WCMK 3I4MC 1TWGC 3I4NK 2NVTK 4BBSK 2E2JC 4KMUA 1Y1WC 4BBRC 2WAQL 4A3KK 3HOZK 1R9TC 3S2DK 4BXXK 2A6EA 4A3MK 4G7HA 2NVXK 2Y0SD 3H0GK 2YU9K 3S1QK 4OIPA 4A3FC 3GTOK 4C3HC 1SFOC 3S1NK 3RZDC 2R7ZK 4LK0A 1TWFK 3S16C 2JA5K 3PO2K 2JA7C 2E2HC 3PO3C 4QJVB 4A3CK 5IP9C 4OIQA 3GTPK 4A3EC 3GTJC 3DXJA 1TWCC 3HOZC 2NVQK 4XLPA 2JA6C 5M5YK 3S14C 1TWHC 2B63C 5M3FK 2JA8K 3S15K 4BY1K 4OIRA 4OIOA 4AYBD 4X6AC 1K83C 3EQLA 5D4DA 4MEXA 4OINA 1I3QK 4QIWL 4A3IC 1YNNA 3CQZC 2R93K 3K7AK
chains in the Genus database with same CATH superfamily
3SZYA 4XSZA 4O2DA 4Y7NK 1J6VA 3M4OK 3GTLK 1JVIA 1BGWA 3CF5S 4WILA 3M3YK 4XLNA 2PMZL 3PIPS 4MQ9A 3AQOA 1B4BA 3HOXC 3HOVC 1WCMC 1ZQ1C 3FKIA 5IYCK 2GSNA 2O5JA 2NVYK 2R92A 1VRQC 4LJZA 2XCQA 3GTKK 4WJ4A 4KMDA 1TWAA 1TWFC 4AYBL 1YNJA 3HOUC 4M1XA 3GSIA 3GTLA 1PJ7A 1R9TK 3GTPC 3JSTA 2NVQC 4A3FK 2JH3A 3RZDK 3S0XA 4BY1C 3PO3K 5CJ9A 4U67S 1J98A 4KATA 5M5XK 2VUMC 2R93C 3GTJK 1YCLA 3K7AC 4XCHA 3HOZK 5TMCA 5C44C 1TWHA 2JA6K 2B63A 2NVYA 2V6TA 5IORA 1DD5A 4X6AK 3WODA 3GTGC 4KAWX 4A3IK 4KDDA 5C4JC 3AH5A 2E2IC 4JK1A 2A6HA 5FLMC 1ZVUA 1DCPA 4J3NA 5EGHA 3HOWC 4Y52C 5TMFA 4IOAS 4A3LC 2CW0A 1O2AA 4KASA 3Q3QA 5HL7S 5L46A 2JA6A 2KXYA 3SZZA 3S2HC 4A3DC 4A3GC 1HI9A 3RZOC 3S17K 3I4MC 1TWGC 1O2BA 3I4NK 2WAQL 4A3KK 2NVXK 3H0GK 3MMLB 1TWFA 3GTOK 1SFOC 1FEUA 4AH6A 2R7ZK 3S16C 2JA7C 4GTFA 3A8KA 3LPXA 4OIQA 2ZUFA 4MEXA 4KC6A 4OINA 1VLOA 2R93A 4QIWL 4WFAS 2BE5A 1I50K 3T01A 4A3BK 1WOPA 4XSXA 2ZJPS 3GTMK 3L4KA 2NVXA 3GTGA 4GTLA 4LR2A 5C3EK 2R7ZA 5DM7S 1INNA 4C2MK 1IS1A 5IOTA 4A3JC 5C4XC 5IP7C 1WQHA 4BBSC 3FKIK 3S1RK 4RMFA 5JVOA 4GTAA 3A8JA 1ZBSA 1I50A 4BXXC 4KN7A 2GAGC 3GEHA 2R92K 2WB1D 2ZJQS 2YU9C 3S1QC 1IW7A 3HXAA 4KB2A 2RGRA 3GTMA 3S1NC 1DCOA 1G51A 1O28A 3AD8C 1F7UA 1V5VA 4LOWA 1TWAK 4GT9A 4BBRK 2PA8D 4A3CC 1SFOA 1YX2A 4C3HK 2JA7A 2XCOA 5M3MK 3OEPA 1PJ5A 1DCHA 1RU0A 3HKZL 5IP9K 4A3EK 3GTKC 1TWCK 1UV7A 3H3VL 1HQMA 1BJTA 1TWHK 2B63K 5FJ8K 4C3IC 4BY7C 1XZQB 4G0WA 3TTGA 3GTQC 2D6FC 5IYDC 4A93C 3OPFA 2XCRB 3CAGA 2E2JK 2KPUA 1ZYRA 4G7OA 4C3JC 2A69A 1XZPB 4KMAA 4YFNA 1Y1VC 4LQYA 1X31C 3FOEA 1I6HC 2GAHC 2ZFZA 1TWCA 3HOXK 3HOVK 1WCMK 1Y1WC 1KQ4A 2KQ1A 1O2FB 2KWAA 4OIPA 3VA7A 2L5NA 3GEEA 1TWFK 3PIOS 2E2HC 3AD9C 1XXAA 1IQ0A 4WFNS 1WQFA 3GTPK 3DXJA 1AB4A 2NVQK 5M5YK 3S14C 5M3FK 4BY1K 4GTBA 4GTCA 1JQWA 4OIRA 4OIOA 1VJEA 4AYBD 1K83C 3EQLA 5D4DA 2V6SA 1WCMA 4GTDA 1WIHA 3CQZC 2R93K 3K7AK 5C44K 1XZQA 4IOCS 4FZBA 3GTGK 3GTQA 5IYBC 5C4JK 3HOYC 4ZH4A 1EQRA 2E2IK 5FLMK 4KARA 2Y0SL 1F9NA 3S1MC 3GTPA 3BP8C 3HOWK 2P5MA 4Y52K 4A3LK 1Y1VA 2NVTC 1WORA 2VUMA 3S2DC 4A3MC 1C0AA 1F93A 3S2HK 4A3DK 4A3GK 3PO2C 3AQPA 2JA5C 3I4MK 1TWGK 1Y1WA 5DM6S 2GSOA 2E2IA 4KM8A 1SFOK 4LLGA 5JVGS 2JA8C 3S15C 3S16K 3FKIC 2JA7K 1XPPA 5JVHS 1I3QC 4P5AA 2R92C 1WSVA 2WAQD 1B4AA 3BUEA 3FOFA 4LK1A 4MEYA 1O24A 5IOQA 2W7VA 4Q4ZA 1F7VA 4Y7NC 3FHZA 1TWAC 1K83A 5HQHA 1EI6A 4C45A 3M4OC 4PABA 3CQZA 3GTLC 3TFIA 1ISEA 4ILDA 1TWGA 2GSUA 5JFEA 2P8TA 3M3YC 1EK8A 3T02A 1BDFA 5IYCC 4QIWD 2NVYC 1IBAA 1I6VA 5C4XK 4A3JK 4KB4A 4YG2A 4Q5SA 1IL2A 2L3UA 5CHPA 5IP7K 2FQTA 4BBSK 2E2JC 4BLBA 3N3YA 5TJ3A 1R9TC 3DLLS 4BXXK 2A6EA 4G7HA 2YU9K 3S1QK 4A3FC 4IO9S 3S1NK 2JA5A 3RZDC 4LK0A 1O25A 1EH1A 4PAAA 3PO3C 4QJVB 4A3CK 3TFHA 3GTJC 3HOZC 4BLAA 4XLPA 2JA6C 3T00A 4P9SA 1I3QA 4X6AC 4A3IC 1VGXA 2CFAB 4G0UA 3OREA 4KMHA 1WSRA 3GDZA 4C3IK 4YFKA 4BY7K 4G7ZA 2YU9A 2PMZD 3TFJA 5M5WK 3GTQK 5IYDK 3HKZD 4A93K 4WCES 3LAJA 3HOUK 3H3VD 1BS2A 4DDQA 4C3JK 1USOA 3N0CA 3S17C 1Y1VK 3I4NC 3LAPA 2A68A 3NUHA 1I6HK 4A3KC 1XXCA 3GIRA 4KM9A 1EFWA 2NVXC 3LYWA 2VUMK 3H0GC 3GTKA 4GZYA 3GTOC 2R7ZC 1J6XA 1R9TA 4WF9S 1Y1WK 2PPBA 2O5IA 2Y3PA 4NOIA 4GTEA 1XXBA 2ZJRS 4QJVA 2EBBA 2E2HK 5IOSA 1XZPA 1WOOA 4P5BA 3GTJA 1I50C 3ERED 1IE0A 4A3BC 4YFXA 3IPJA 3L4JA 3S14K 3GTMC 4KN4A 3ADAC 3G4CA 1K83K 5C3EC 2CFAA 5EGEA 4G0VA 3CQZK 1VH2A 4GFQA 1WOSA 3RZOK 1O26A 4C2MC 2WB1L 3N0BA 1JOEA 1SMYA 1O27A 2FQOA 5IYBK 3QX3A 2PHCB 2E2HA 5E68A 2PA8L 3HOYK 4FM9A 3S1RC 3GEIA 3S1MK 1ZXOA 4WJ3M 1J6WA 2RH6A 3BP3A 2NVTK 4KMUA 4BBRC 1GE9A 3V4GA 3H0GA 3S2DK 4A3MK 2Y0SD 1PJ6A 3GTOA 4C3HC 1WQGA 1O29A 2V6UA 4BKWA 3PO2K 2JA5K 4WFBS 5IP9C 4A3EC 3AD7C 1USMA 1TWCC 3A8IA 1TWHC 2B63C 2JA8K 3S15K 1L0WA 5HL8A 1I3QK 2ZUEA 1YNNA 3G4AA
chains in the Genus database with same CATH topology
4A3BK 5C44K 4XSXA 4XSZA 3GTMK 4Y7NK 4C3IK 4YFKA 4BY7K 4G7ZA 2PMZD 3M4OK 3GTGK 5C3EK 3GTLK 5M5WK 5IYBC 5C4JK 3GTQK 5IYDK 3HKZD 3HOYC 4ZH4A 4C2MK 2E2IK 3HOUK 3M3YK 5FLMK 4A93K 4XLNA 2PMZL 4MQ9A 3H3VD 2Y0SL 3S1MC 4C3JK 4A3JC 5C4XC 3HOWK 4Y52K 4A3LK 3HOXC 3HOVC 5IP7C 3S17C 1WCMC 1Y1VK 3I4NC 5IYCK 2A68A 2NVTC 4BBSC 3FKIK 3S1RK 1I6HK 4A3KC 2O5JA 2NVYK 3S2DC 4BXXC 4A3MC 4KN7A 2NVXC 2R92K 2VUMK 2WB1D 4LJZA 3H0GC 2YU9C 3S1QC 1IW7A 4GZYA 3GTKK 3GTOC 3S1NC 3S2HK 4A3DK 4A3GK 2R7ZC 3PO2C 1TWFC 2JA5C 4AYBL 1TWGK 1YNJA 3I4MK 3HOUC 1TWAK 1Y1WK 4BBRK 2PA8D 4A3CC 1R9TK 2PPBA 2O5IA 3GTPC 4NOIA 2NVQC 4A3FK 4C3HK 1SFOK 4LLGA 3RZDK 2JA8C 3S15C 5M3MK 4QJVA 3S16K 3FKIC 4BY1C 1XPPA 2E2HK 2JA7K 3PO3K 1I3QC 3HKZL 2R92C 5IP9K 2WAQD 1I50C 2VUMC 2R93C 5M5XK 3K7AC 2BE5A 3GTJK 4LK1A 4MEYA 3GTKC 4YFXA 5TMCA 5C44C 4A3BC 1HQMA 1TWCK 4Q4ZA 2JA6K 3H3VL 3GTMC 4A3EK 1TWHK 2B63K 4Y7NC 3S14K 4KN4A 1TWAC 4C3IC 4BY7C 5FJ8K 3M4OC 3WODA 1K83K 3GTGC 4X6AK 5C3EC 3GTLC 4A3IK 3CQZK 5C4JC 3GTQC 3RZOK 5IYDC 4A93C 2E2IC 4JK1A 4C2MC 2A6HA 3M3YC 5FLMC 2E2JK 1I50K 2WB1L 1ZYRA 4G7OA 4C3JC 2A69A 1BDFA 1SMYA 3HOWC 4Y52C 5TMFA 4A3LC 2CW0A 5IYBK 4YFNA 1Y1VC 5IYCC 4QIWD 2PA8L 3HOYK 3S1RC 1I6HC 2NVYC 3S1MK 1I6VA 5C4XK 4A3JK 4YG2A 4Q5SA 3HOXK 3HOVK 5IP7K 3S2HC 4A3DC 4A3GC 3S17K 3RZOC 1WCMK 3I4MC 1TWGC 3I4NK 2NVTK 4BBSK 2E2JC 4KMUA 1Y1WC 4BBRC 2WAQL 4A3KK 3HOZK 1R9TC 3S2DK 4BXXK 2A6EA 4A3MK 4G7HA 2NVXK 2Y0SD 3H0GK 2YU9K 3S1QK 4OIPA 4A3FC 3GTOK 4C3HC 1SFOC 3S1NK 3RZDC 2R7ZK 4LK0A 1TWFK 3S16C 2JA5K 3PO2K 2JA7C 2E2HC 3PO3C 4QJVB 4A3CK 5IP9C 4OIQA 3GTPK 4A3EC 3GTJC 3DXJA 1TWCC 3HOZC 2NVQK 4XLPA 2JA6C 5M5YK 3S14C 1TWHC 2B63C 5M3FK 2JA8K 3S15K 4BY1K 4OIRA 4OIOA 4AYBD 4X6AC 1K83C 3EQLA 5D4DA 4MEXA 4OINA 1I3QK 4QIWL 4A3IC 1YNNA 3CQZC 2R93K 3K7AK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A3B K;  5C44 K;  4XSX A;  4XSZ A;  3GTM K;  4Y7N K;  4C3I K;  4YFK A;  4BY7 K;  4G7Z A;  2PMZ D;  3M4O K;  3GTG K;  5C3E K;  3GTL K;  5M5W K;  5IYB C;  5C4J K;  3GTQ K;  5IYD K;  3HKZ D;  3HOY C;  4ZH4 A;  4C2M K;  2E2I K;  3HOU K;  3M3Y K;  5FLM K;  4A93 K;  4XLN A;  2PMZ L;  4MQ9 A;  3H3V D;  2Y0S L;  3S1M C;  4C3J K;  4A3J C;  5C4X C;  3HOW K;  4Y52 K;  4A3L K;  3HOX C;  3HOV C;  5IP7 C;  3S17 C;  1WCM C;  1Y1V K;  3I4N C;  5IYC K;  2A68 A;  2NVT C;  4BBS C;  3FKI K;  3S1R K;  1I6H K;  4A3K C;  2O5J A;  2NVY K;  3S2D C;  4BXX C;  4A3M C;  4KN7 A;  2NVX C;  2R92 K;  2VUM K;  2WB1 D;  4LJZ A;  3H0G C;  2YU9 C;  3S1Q C;  1IW7 A;  4GZY A;  3GTK K;  3GTO C;  3S1N C;  3S2H K;  4A3D K;  4A3G K;  2R7Z C;  3PO2 C;  1TWF C;  2JA5 C;  4AYB L;  1TWG K;  1YNJ A;  3I4M K;  3HOU C;  1TWA K;  1Y1W K;  4BBR K;  2PA8 D;  4A3C C;  1R9T K;  2PPB A;  2O5I A;  3GTP C;  4NOI A;  2NVQ C;  4A3F K;  4C3H K;  1SFO K;  4LLG A;  3RZD K;  2JA8 C;  3S15 C;  5M3M K;  4QJV A;  3S16 K;  3FKI C;  4BY1 C;  1XPP A;  2E2H K;  2JA7 K;  3PO3 K;  1I3Q C;  3HKZ L;  2R92 C;  5IP9 K;  2WAQ D;  1I50 C;  2VUM C;  2R93 C;  5M5X K;  3K7A C;  2BE5 A;  3GTJ K;  4LK1 A;  4MEY A;  3GTK C;  4YFX A;  5TMC A;  5C44 C;  4A3B C;  1HQM A;  1TWC K;  4Q4Z A;  2JA6 K;  3H3V L;  3GTM C;  4A3E K;  1TWH K;  2B63 K;  4Y7N C;  3S14 K;  4KN4 A;  1TWA C;  4C3I C;  4BY7 C;  5FJ8 K;  3M4O C;  3WOD A;  1K83 K;  3GTG C;  4X6A K;  5C3E C;  3GTL C;  4A3I K;  3CQZ K;  5C4J C;  3GTQ C;  3RZO K;  5IYD C;  4A93 C;  2E2I C;  4JK1 A;  4C2M C;  2A6H A;  3M3Y C;  5FLM C;  2E2J K;  1I50 K;  2WB1 L;  1ZYR A;  4G7O A;  4C3J C;  2A69 A;  1BDF A;  1SMY A;  3HOW C;  4Y52 C;  5TMF A;  4A3L C;  2CW0 A;  5IYB K;  4YFN A;  1Y1V C;  5IYC C;  4QIW D;  2PA8 L;  3HOY K;  3S1R C;  1I6H C;  2NVY C;  3S1M K;  1I6V A;  5C4X K;  4A3J K;  4YG2 A;  4Q5S A;  3HOX K;  3HOV K;  5IP7 K;  3S2H C;  4A3D C;  4A3G C;  3S17 K;  3RZO C;  1WCM K;  3I4M C;  1TWG C;  3I4N K;  2NVT K;  4BBS K;  2E2J C;  4KMU A;  1Y1W C;  4BBR C;  2WAQ L;  4A3K K;  3HOZ K;  1R9T C;  3S2D K;  4BXX K;  2A6E A;  4A3M K;  4G7H A;  2NVX K;  2Y0S D;  3H0G K;  2YU9 K;  3S1Q K;  4OIP A;  4A3F C;  3GTO K;  4C3H C;  1SFO C;  3S1N K;  3RZD C;  2R7Z K;  4LK0 A;  1TWF K;  3S16 C;  2JA5 K;  3PO2 K;  2JA7 C;  2E2H C;  3PO3 C;  4QJV B;  4A3C K;  5IP9 C;  4OIQ A;  3GTP K;  4A3E C;  3GTJ C;  3DXJ A;  1TWC C;  3HOZ C;  2NVQ K;  4XLP A;  2JA6 C;  5M5Y K;  3S14 C;  1TWH C;  2B63 C;  5M3F K;  2JA8 K;  3S15 K;  4BY1 K;  4OIR A;  4OIO A;  4AYB D;  4X6A C;  1K83 C;  3EQL A;  5D4D A;  4MEX A;  4OIN A;  1I3Q K;  4QIW L;  4A3I C;  1YNN A;  3CQZ C;  2R93 K;  3K7A K; 
#chains in the Genus database with same CATH topology
 3SZY A;  4XSZ A;  4O2D A;  4Y7N K;  1J6V A;  3M4O K;  3GTL K;  1JVI A;  1BGW A;  3CF5 S;  4WIL A;  3M3Y K;  4XLN A;  2PMZ L;  3PIP S;  4MQ9 A;  3AQO A;  1B4B A;  3HOX C;  3HOV C;  1WCM C;  1ZQ1 C;  3FKI A;  5IYC K;  2GSN A;  2O5J A;  2NVY K;  2R92 A;  1VRQ C;  4LJZ A;  2XCQ A;  3GTK K;  4WJ4 A;  4KMD A;  1TWA A;  1TWF C;  4AYB L;  1YNJ A;  3HOU C;  4M1X A;  3GSI A;  3GTL A;  1PJ7 A;  1R9T K;  3GTP C;  3JST A;  2NVQ C;  4A3F K;  2JH3 A;  3RZD K;  3S0X A;  4BY1 C;  3PO3 K;  5CJ9 A;  4U67 S;  1J98 A;  4KAT A;  5M5X K;  2VUM C;  2R93 C;  3GTJ K;  1YCL A;  3K7A C;  4XCH A;  3HOZ K;  5TMC A;  5C44 C;  1TWH A;  2JA6 K;  2B63 A;  2NVY A;  2V6T A;  5IOR A;  1DD5 A;  4X6A K;  3WOD A;  3GTG C;  4KAW X;  4A3I K;  4KDD A;  5C4J C;  3AH5 A;  2E2I C;  4JK1 A;  2A6H A;  5FLM C;  1ZVU A;  1DCP A;  4J3N A;  5EGH A;  3HOW C;  4Y52 C;  5TMF A;  4IOA S;  4A3L C;  2CW0 A;  1O2A A;  4KAS A;  3Q3Q A;  5HL7 S;  5L46 A;  2JA6 A;  2KXY A;  3SZZ A;  3S2H C;  4A3D C;  4A3G C;  1HI9 A;  3RZO C;  3S17 K;  3I4M C;  1TWG C;  1O2B A;  3I4N K;  2WAQ L;  4A3K K;  2NVX K;  3H0G K;  3MML B;  1TWF A;  3GTO K;  1SFO C;  1FEU A;  4AH6 A;  2R7Z K;  3S16 C;  2JA7 C;  4GTF A;  3A8K A;  3LPX A;  4OIQ A;  2ZUF A;  4MEX A;  4KC6 A;  4OIN A;  1VLO A;  2R93 A;  4QIW L;  4WFA S;  2BE5 A;  1I50 K;  3T01 A;  4A3B K;  1WOP A;  4XSX A;  2ZJP S;  3GTM K;  3L4K A;  2NVX A;  3GTG A;  4GTL A;  4LR2 A;  5C3E K;  2R7Z A;  5DM7 S;  1INN A;  4C2M K;  1IS1 A;  5IOT A;  4A3J C;  5C4X C;  5IP7 C;  1WQH A;  4BBS C;  3FKI K;  3S1R K;  4RMF A;  5JVO A;  4GTA A;  3A8J A;  1ZBS A;  1I50 A;  4BXX C;  4KN7 A;  2GAG C;  3GEH A;  2R92 K;  2WB1 D;  2ZJQ S;  2YU9 C;  3S1Q C;  1IW7 A;  3HXA A;  4KB2 A;  2RGR A;  3GTM A;  3S1N C;  1DCO A;  1G51 A;  1O28 A;  3AD8 C;  1F7U A;  1V5V A;  4LOW A;  1TWA K;  4GT9 A;  4BBR K;  2PA8 D;  4A3C C;  1SFO A;  1YX2 A;  4C3H K;  2JA7 A;  2XCO A;  5M3M K;  3OEP A;  1PJ5 A;  1DCH A;  1RU0 A;  3HKZ L;  5IP9 K;  4A3E K;  3GTK C;  1TWC K;  1UV7 A;  3H3V L;  1HQM A;  1BJT A;  1TWH K;  2B63 K;  5FJ8 K;  4C3I C;  4BY7 C;  1XZQ B;  4G0W A;  3TTG A;  3GTQ C;  2D6F C;  5IYD C;  4A93 C;  3OPF A;  2XCR B;  3CAG A;  2E2J K;  2KPU A;  1ZYR A;  4G7O A;  4C3J C;  2A69 A;  1XZP B;  4KMA A;  4YFN A;  1Y1V C;  4LQY A;  1X31 C;  3FOE A;  1I6H C;  2GAH C;  2ZFZ A;  1TWC A;  3HOX K;  3HOV K;  1WCM K;  1Y1W C;  1KQ4 A;  2KQ1 A;  1O2F B;  2KWA A;  4OIP A;  3VA7 A;  2L5N A;  3GEE A;  1TWF K;  3PIO S;  2E2H C;  3AD9 C;  1XXA A;  1IQ0 A;  4WFN S;  1WQF A;  3GTP K;  3DXJ A;  1AB4 A;  2NVQ K;  5M5Y K;  3S14 C;  5M3F K;  4BY1 K;  4GTB A;  4GTC A;  1JQW A;  4OIR A;  4OIO A;  1VJE A;  4AYB D;  1K83 C;  3EQL A;  5D4D A;  2V6S A;  1WCM A;  4GTD A;  1WIH A;  3CQZ C;  2R93 K;  3K7A K;  5C44 K;  1XZQ A;  4IOC S;  4FZB A;  3GTG K;  3GTQ A;  5IYB C;  5C4J K;  3HOY C;  4ZH4 A;  1EQR A;  2E2I K;  5FLM K;  4KAR A;  2Y0S L;  1F9N A;  3S1M C;  3GTP A;  3BP8 C;  3HOW K;  2P5M A;  4Y52 K;  4A3L K;  1Y1V A;  2NVT C;  1WOR A;  2VUM A;  3S2D C;  4A3M C;  1C0A A;  1F93 A;  3S2H K;  4A3D K;  4A3G K;  3PO2 C;  3AQP A;  2JA5 C;  3I4M K;  1TWG K;  1Y1W A;  5DM6 S;  2GSO A;  2E2I A;  4KM8 A;  1SFO K;  4LLG A;  5JVG S;  2JA8 C;  3S15 C;  3S16 K;  3FKI C;  2JA7 K;  1XPP A;  5JVH S;  1I3Q C;  4P5A A;  2R92 C;  1WSV A;  2WAQ D;  1B4A A;  3BUE A;  3FOF A;  4LK1 A;  4MEY A;  1O24 A;  5IOQ A;  2W7V A;  4Q4Z A;  1F7V A;  4Y7N C;  3FHZ A;  1TWA C;  1K83 A;  5HQH A;  1EI6 A;  4C45 A;  3M4O C;  4PAB A;  3CQZ A;  3GTL C;  3TFI A;  1ISE A;  4ILD A;  1TWG A;  2GSU A;  5JFE A;  2P8T A;  3M3Y C;  1EK8 A;  3T02 A;  1BDF A;  5IYC C;  4QIW D;  2NVY C;  1IBA A;  1I6V A;  5C4X K;  4A3J K;  4KB4 A;  4YG2 A;  4Q5S A;  1IL2 A;  2L3U A;  5CHP A;  5IP7 K;  2FQT A;  4BBS K;  2E2J C;  4BLB A;  3N3Y A;  5TJ3 A;  1R9T C;  3DLL S;  4BXX K;  2A6E A;  4G7H A;  2YU9 K;  3S1Q K;  4A3F C;  4IO9 S;  3S1N K;  2JA5 A;  3RZD C;  4LK0 A;  1O25 A;  1EH1 A;  4PAA A;  3PO3 C;  4QJV B;  4A3C K;  3TFH A;  3GTJ C;  3HOZ C;  4BLA A;  4XLP A;  2JA6 C;  3T00 A;  4P9S A;  1I3Q A;  4X6A C;  4A3I C;  1VGX A;  2CFA B;  4G0U A;  3ORE A;  4KMH A;  1WSR A;  3GDZ A;  4C3I K;  4YFK A;  4BY7 K;  4G7Z A;  2YU9 A;  2PMZ D;  3TFJ A;  5M5W K;  3GTQ K;  5IYD K;  3HKZ D;  4A93 K;  4WCE S;  3LAJ A;  3HOU K;  3H3V D;  1BS2 A;  4DDQ A;  4C3J K;  1USO A;  3N0C A;  3S17 C;  1Y1V K;  3I4N C;  3LAP A;  2A68 A;  3NUH A;  1I6H K;  4A3K C;  1XXC A;  3GIR A;  4KM9 A;  1EFW A;  2NVX C;  3LYW A;  2VUM K;  3H0G C;  3GTK A;  4GZY A;  3GTO C;  2R7Z C;  1J6X A;  1R9T A;  4WF9 S;  1Y1W K;  2PPB A;  2O5I A;  2Y3P A;  4NOI A;  4GTE A;  1XXB A;  2ZJR S;  4QJV A;  2EBB A;  2E2H K;  5IOS A;  1XZP A;  1WOO A;  4P5B A;  3GTJ A;  1I50 C;  3ERE D;  1IE0 A;  4A3B C;  4YFX A;  3IPJ A;  3L4J A;  3S14 K;  3GTM C;  4KN4 A;  3ADA C;  3G4C A;  1K83 K;  5C3E C;  2CFA A;  5EGE A;  4G0V A;  3CQZ K;  1VH2 A;  4GFQ A;  1WOS A;  3RZO K;  1O26 A;  4C2M C;  2WB1 L;  3N0B A;  1JOE A;  1SMY A;  1O27 A;  2FQO A;  5IYB K;  3QX3 A;  2PHC B;  2E2H A;  5E68 A;  2PA8 L;  3HOY K;  4FM9 A;  3S1R C;  3GEI A;  3S1M K;  1ZXO A;  4WJ3 M;  1J6W A;  2RH6 A;  3BP3 A;  2NVT K;  4KMU A;  4BBR C;  1GE9 A;  3V4G A;  3H0G A;  3S2D K;  4A3M K;  2Y0S D;  1PJ6 A;  3GTO A;  4C3H C;  1WQG A;  1O29 A;  2V6U A;  4BKW A;  3PO2 K;  2JA5 K;  4WFB S;  5IP9 C;  4A3E C;  3AD7 C;  1USM A;  1TWC C;  3A8I A;  1TWH C;  2B63 C;  2JA8 K;  3S15 K;  1L0W A;  5HL8 A;  1I3Q K;  2ZUE A;  1YNN A;  3G4A A; 
#chains in the Genus database with same CATH homology
 4A3B K;  5C44 K;  4XSX A;  4XSZ A;  3GTM K;  4Y7N K;  4C3I K;  4YFK A;  4BY7 K;  4G7Z A;  2PMZ D;  3M4O K;  3GTG K;  5C3E K;  3GTL K;  5M5W K;  5IYB C;  5C4J K;  3GTQ K;  5IYD K;  3HKZ D;  3HOY C;  4ZH4 A;  4C2M K;  2E2I K;  3HOU K;  3M3Y K;  5FLM K;  4A93 K;  4XLN A;  2PMZ L;  4MQ9 A;  3H3V D;  2Y0S L;  3S1M C;  4C3J K;  4A3J C;  5C4X C;  3HOW K;  4Y52 K;  4A3L K;  3HOX C;  3HOV C;  5IP7 C;  3S17 C;  1WCM C;  1Y1V K;  3I4N C;  5IYC K;  2A68 A;  2NVT C;  4BBS C;  3FKI K;  3S1R K;  1I6H K;  4A3K C;  2O5J A;  2NVY K;  3S2D C;  4BXX C;  4A3M C;  4KN7 A;  2NVX C;  2R92 K;  2VUM K;  2WB1 D;  4LJZ A;  3H0G C;  2YU9 C;  3S1Q C;  1IW7 A;  4GZY A;  3GTK K;  3GTO C;  3S1N C;  3S2H K;  4A3D K;  4A3G K;  2R7Z C;  3PO2 C;  1TWF C;  2JA5 C;  4AYB L;  1TWG K;  1YNJ A;  3I4M K;  3HOU C;  1TWA K;  1Y1W K;  4BBR K;  2PA8 D;  4A3C C;  1R9T K;  2PPB A;  2O5I A;  3GTP C;  4NOI A;  2NVQ C;  4A3F K;  4C3H K;  1SFO K;  4LLG A;  3RZD K;  2JA8 C;  3S15 C;  5M3M K;  4QJV A;  3S16 K;  3FKI C;  4BY1 C;  1XPP A;  2E2H K;  2JA7 K;  3PO3 K;  1I3Q C;  3HKZ L;  2R92 C;  5IP9 K;  2WAQ D;  1I50 C;  2VUM C;  2R93 C;  5M5X K;  3K7A C;  2BE5 A;  3GTJ K;  4LK1 A;  4MEY A;  3GTK C;  4YFX A;  5TMC A;  5C44 C;  4A3B C;  1HQM A;  1TWC K;  4Q4Z A;  2JA6 K;  3H3V L;  3GTM C;  4A3E K;  1TWH K;  2B63 K;  4Y7N C;  3S14 K;  4KN4 A;  1TWA C;  4C3I C;  4BY7 C;  5FJ8 K;  3M4O C;  3WOD A;  1K83 K;  3GTG C;  4X6A K;  5C3E C;  3GTL C;  4A3I K;  3CQZ K;  5C4J C;  3GTQ C;  3RZO K;  5IYD C;  4A93 C;  2E2I C;  4JK1 A;  4C2M C;  2A6H A;  3M3Y C;  5FLM C;  2E2J K;  1I50 K;  2WB1 L;  1ZYR A;  4G7O A;  4C3J C;  2A69 A;  1BDF A;  1SMY A;  3HOW C;  4Y52 C;  5TMF A;  4A3L C;  2CW0 A;  5IYB K;  4YFN A;  1Y1V C;  5IYC C;  4QIW D;  2PA8 L;  3HOY K;  3S1R C;  1I6H C;  2NVY C;  3S1M K;  1I6V A;  5C4X K;  4A3J K;  4YG2 A;  4Q5S A;  3HOX K;  3HOV K;  5IP7 K;  3S2H C;  4A3D C;  4A3G C;  3S17 K;  3RZO C;  1WCM K;  3I4M C;  1TWG C;  3I4N K;  2NVT K;  4BBS K;  2E2J C;  4KMU A;  1Y1W C;  4BBR C;  2WAQ L;  4A3K K;  3HOZ K;  1R9T C;  3S2D K;  4BXX K;  2A6E A;  4A3M K;  4G7H A;  2NVX K;  2Y0S D;  3H0G K;  2YU9 K;  3S1Q K;  4OIP A;  4A3F C;  3GTO K;  4C3H C;  1SFO C;  3S1N K;  3RZD C;  2R7Z K;  4LK0 A;  1TWF K;  3S16 C;  2JA5 K;  3PO2 K;  2JA7 C;  2E2H C;  3PO3 C;  4QJV B;  4A3C K;  5IP9 C;  4OIQ A;  3GTP K;  4A3E C;  3GTJ C;  3DXJ A;  1TWC C;  3HOZ C;  2NVQ K;  4XLP A;  2JA6 C;  5M5Y K;  3S14 C;  1TWH C;  2B63 C;  5M3F K;  2JA8 K;  3S15 K;  4BY1 K;  4OIR A;  4OIO A;  4AYB D;  4X6A C;  1K83 C;  3EQL A;  5D4D A;  4MEX A;  4OIN A;  1I3Q K;  4QIW L;  4A3I C;  1YNN A;  3CQZ C;  2R93 K;  3K7A K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...