2A6HA

Crystal structure of the t. thermophilus rna polymerase holoenzyme in complex with antibiotic sterptolydigin
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
229
structure length
229
Chain Sequence
MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase alpha chain
publication title Structural basis of transcription inhibition by antibiotic streptolydigin.
pubmed doi rcsb
molecule tags Transferase
total genus 42
structure length 229
sequence length 229
chains with identical sequence B, K, L
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2005-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01000 RNA_pol_A_bac RNA polymerase Rpb3/RpoA insert domain
A PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain
A PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.12 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 DNA-directed RNA polymerase, insert domain 2a6hA02
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 2a6hA01
4G7HA 3PO3C 1SFOC 2NVTC 3H0GK 4A3IK 2NVXK 4C3HK 4KMUA 4LLGA 5FLMC 4BY1C 3K7AC 2E2IK 2R92C 3GTMK 4OINA 2R93K 1I6VA 1I50C 4XLPA 1HQMA 4A3BC 5IP7C 4MEYA 1TWFC 4MQ9A 4AYBL 4A3EC 4A93K 4OIOA 4AYBD 5C44C 4A3DC 4A3KK 3GTJK 4XSZA 2A69A 4C3IK 4C2MC 2NVYC 3FKIC 3EQLA 5IYDC 2A6HA 3GTLC 3M4OC 2JA8C 4Y7NK 1R9TC 3M3YK 1TWHC 4BXXK 4A3LK 3CQZC 1TWAK 4A3JC 2O5JA 2NVQK 4A3GC 2A68A 1YNJA 1I3QC 2E2JK 2YU9K 2Y0SL 4C3JC 3S15K 1TWGK 2Y0SD 3DXJA 2B63C 5IP9K 1Y1VC 4A3MC 3RZDK 4BBSK 3S17C 3HOUK 3GTGC 3S1NK 3S14C 1WCMK 4OIPA 5M3MK 3RZOK 3HKZL 4KN7A 4YFXA 3HOXC 3S1RK 3HKZD 5M5YK 3HOVK 3I4MK 3S2DK 5TMCA 1IW7A 3I4NC 5IYCC 4A3CC 4YFKA 3HOWK 3S1QK 2JA5K 4ZH4A 4QIWL 2JA7K 3GTQK 1K83K 4QIWD 3GTPK 3H0GC 4BY7K 4A3IC 2JA6K 4A3FK 2CW0A 4C3HC 5C4XC 5FLMK 4BY1K 3PO2K 4KN4A 1YNNA 4MEXA 3GTMC 2PA8D 3S2HC 5D4DA 2E2HK 1I6HK 2R7ZK 4BBRK 4A93C 2VUMK 4A3DK 4A3KC 4LJZA 1TWCK 4OIRA 4JK1A 1Y1WC 4YG2A 3FKIK 3S1MK 1BDFA 5IYBK 4Y52K 4OIQA 3M4OK 2JA8K 4Y7NC 4XSXA 3M3YC 5C3EK 5C4JK 4BXXC 4A3LC 3CQZK 1TWAC 3GTKK 2NVQC 3GTOK 3WODA 2E2JC 2YU9C 3S16C 1TWGC 5IP9C 4X6AK 3HOZK 2WB1L 3HOYK 2WB1D 3HOUC 4BBSC 1XPPA 3S17K 3PO3K 3S1NC 1SFOK 2NVXC 2NVTK 4LK0A 1WCMC 2E2IC 4Q4ZA 3K7AK 3I4MC 4QJVB 3HOVC 3S1RC 2PA8L 3HOXK 3S2DC 2R92K 2R93C 3I4NK 1I50K 4A3BK 2WAQL 3S1QC 5IP7K 2WAQD 2JA5C 1TWFK 5M5WK 4A3EK 4G7OA 2JA7C 4XLNA 1K83C 4NOIA 3GTQC 3GTJC 5C44K 4BY7C 4C3IC 2JA6C 4C2MK 4A3FC 2NVYK 5C4XK 5IYDK 1SMYA 3GTLK 4LK1A 3PO2C 1R9TK 1TWHK 3S2HK 4YFNA 2E2HC 4GZYA 1I6HC 2R7ZC 2BE5A 4A3JK 4BBRC 4A3GK 5M5XK 2VUMC 5FJ8K 1I3QK 3H3VL 1TWCC 3S15C 4C3JK 3H3VD 4QJVA 1Y1WK 5TMFA 3RZDC 3S1MC 4Y52C 5IYBC 2PPBA 1Y1VK 4A3MK 2B63K 4G7ZA 1ZYRA 5C3EC 2A6EA 5C4JC 3GTGK 3GTKC 3S14K 3GTOC 3RZOC 2O5IA 3S16K 4Q5SA 3HOWC 4X6AC 5IYCK 4A3CK 3HOZC 2PMZL 5M3FK 3HOYC 3GTPC 2PMZD
chains in the Genus database with same CATH superfamily
1SFOC 3QX3A 4KMUA 4LLGA 5FLMC 4BY1C 3K7AC 1XXAA 1F9NA 2R93K 1TWFC 4AYBL 4A3DC 4AYBD 5C44C 1ZXOA 1ISEA 4A3KK 3GEEA 2ZUEA 2NVYC 3FKIC 2JA8C 4FM9A 4Y7NK 1TWGA 1TWHC 1O24A 1WOSA 3G4AA 1O25A 4BXXK 4IOAS 2O5JA 2A68A 1YNJA 2NVXA 2Y0SL 1TWGK 2Y0SD 4WFNS 2B63C 4BKWA 4A3MC 3RZDK 4BBSK 2KPUA 5IORA 3GTGC 3GIRA 4XCHA 3GEHA 3I4MK 1O2FB 5TMCA 4YFKA 4ZH4A 1RU0A 4QIWL 4KAWX 2E2HA 4QIWD 4A3IC 2L3UA 1USMA 3PO2K 4WJ4A 1J6VA 2PA8D 2E2HK 1I6HK 3AQOA 3OEPA 1KQ4A 4A93C 1DD5A 3CQZA 4LJZA 4U67S 4OIRA 3GTOA 2P5MA 3S0XA 1B4BA 1EQRA 4GTFA 4XSXA 2GAHC 5C4JK 3CQZK 4PAAA 3GTOK 3GTPA 4G0VA 2R92A 3HOUC 1XPPA 5CHPA 3PO3K 3S1NC 4G0WA 5JVGS 4QJVB 3HOVC 3S1RC 2R92K 1O2BA 2FQTA 3GTLA 1R9TA 2JA5C 5M5WK 3GTQC 3GTJC 4BY7C 4A3FC 3GTLK 4LK1A 2PHCB 1R9TK 1O29A 3S2HK 4BLBA 4BBRC 2ZJPS 3S15C 5JVHS 4WFBS 4Y52C 2PPBA 2A6EA 4RMFA 3A8KA 3AD9C 3H0GA 5JVOA 3S16K 4Q5SA 5M3FK 3TTGA 3GTMA 1WSVA 2ZUFA 1XXCA 3H0GK 1IS1A 3BP8C 4GTBA 1JOEA 4C3HK 2E2IK 3PIOS 3AD8C 3GTMK 4OINA 1I50C 1HQMA 2Y3PA 5IP7C 4MEYA 1YCLA 5CJ9A 4A3EC 4OIOA 1TWAA 1EFWA 4XSZA 4C3IK 4C2MC 5EGHA 1IBAA 3AH5A 4GFQA 2YU9A 3M4OC 4WCES 3M3YK 4A3LK 1TWAK 4A3JC 2JH3A 2NVQK 4A3GC 2W7VA 1I3QC 2YU9K 4C3JC 5IP9K 1Y1VC 2R93A 4OIPA 1K83A 1J6XA 4KN7A 4KB4A 3S2DK 1IW7A 3I4NC 5IYCC 1K83K 5FLMK 4BY1K 1TWCA 4LR2A 5HL7S 2L5NA 1INNA 4P5BA 2ZJQS 4A3DK 4A3KC 1TWCK 3GTKA 3GDZA 4JK1A 1Y1WC 4YG2A 3FKIK 2ZFZA 1BDFA 5IOQA 4FZBA 4OIQA 5IYBK 4G0UA 4Y7NC 2JA8K 4BXXC 3GTKK 3T01A 1TWGC 1UV7A 4X6AK 3HOZK 2WB1L 4WFAS 4C45A 2WB1D 4BBSC 4GTAA 4O2DA 2NVTK 2NVXC 3TFIA 5IOTA 2GAGC 4Q4ZA 1EK8A 3I4MC 1G51A 1XZPA 2PA8L 1XZQB 4KDDA 2XCRB 4A3BK 2WAQL 4WJ3M 2WAQD 4XLNA 4NOIA 4WILA 5IYDK 1SMYA 3PO2C 3LYWA 5IOSA 2E2HC 1I6HC 1O2AA 2KXYA 3V4GA 2V6SA 4DDQA 5TMFA 1IL2A 4J3NA 1ZVUA 3ADAC 3CF5S 4GTLA 1ZYRA 5C4JC 3S14K 3GTOC 4KC6A 3L4JA 3RZOC 1VJEA 1JVIA 1WOOA 3HOWC 4A3CK 4KMAA 1WQGA 1PJ5A 3GTPC 5L46A 4GTEA 3PO3C 2R92C 1I6VA 4XLPA 3DLLS 3FOFA 4MQ9A 1WQFA 1PJ7A 1WOPA 4KASA 3GTJK 3BP3A 2A69A 3T00A 1ZQ1C 3TFHA 3GTLC 1R9TC 3G4CA 4LOWA 1HI9A 1EI6A 2E2JK 3S15K 1WCMA 2E2IA 1XXBA 3IPJA 1VLOA 3S17C 1WCMK 2JA7A 1GE9A 3HKZL 3HOXC 3HKZD 5M5YK 2JA6A 1WORA 5DM6S 3S1QK 2EBBA 4IO9S 3T02A 2JA7K 2R7ZA 1J6WA 1BJTA 3H0GC 2JA6K 2VUMA 4C3HC 5C4XC 1DCOA 3OREA 1WSRA 4KN4A 1YNNA 3GTMC 5D4DA 2R7ZK 2VUMK 4WF9S 1WIHA 3NUHA 4KM9A 1USOA 3S1MK 1VGXA 1EH1A 1F93A 3L4KA 3M4OK 3M3YC 5C3EK 1PJ6A 4A3LC 1TWAC 4GT9A 4PABA 2NVQC 5DM7S 4GTCA 2YU9C 1SFOA 4AH6A 5IP9C 3HOYK 3GEIA 2RH6A 5TJ3A 1SFOK 1TWFA 4LK0A 3K7AK 2GSOA 1FEUA 3LAJA 3S2DC 3N3YA 2ZJRS 2R93C 2NVYA 1BS2A 3FKIA 3LPXA 3I4NK 1TWFK 3PIPS 1TWHA 3HXAA 4G7OA 3SZZA 1VRQC 1K83C 4P5AA 5C44K 2NVYK 5EGEA 2XCOA 1Y1WA 1TWHK 2B63A 1VH2A 2CFAA 5M5XK 3GTGA 1TWCC 4QJVA 1Y1WK 3RZDC 2B63K 5IYBC 4A3MK 1L0WA 5JFEA 1V5VA 3GTGK 3GTKC 2V6TA 3CAGA 3MMLB 4X6AC 3HOZC 4G7HA 4A3IK 2NVTC 2NVXK 1F7UA 1F7VA 5HQHA 2RGRA 3FHZA 4A3BC 4IOCS 3N0BA 1J98A 4A93K 3LAPA 3AD7C 2FQOA 5IYDC 3EQLA 2A6HA 2D6FC 3OPFA 1C0AA 3CQZC 1ZBSA 3FOEA 1WQHA 3JSTA 5HL8A 3DXJA 2GSNA 1O26A 3HOUK 1JQWA 3S1NK 2JA5A 3S14C 3GTQA 5M3MK 3VA7A 3GTJA 3RZOK 4YFXA 3HOVK 3S1RK 3TFJA 1IQ0A 4A3CC 3HOWK 3A8JA 2JA5K 5E68A 3GTPK 3GTQK 3ERED 4KB2A 2CFAB 4BY7K 2P8TA 4A3FK 2CW0A 1O27A 4MEXA 3S2HC 2KQ1A 1X31C 4BBRK 4ILDA 4M1XA 1XZPB 4KATA 4Y52K 1DCPA 3WODA 2E2JC 3S16C 2GSUA 1I50A 4KM8A 3S17K 1IE0A 4P9SA 1WCMC 2E2IC 3A8IA 4BLAA 3AQPA 3HOXK 1O28A 1I50K 2KWAA 3S1QC 5IP7K 3GSIA 4A3EK 2JA7C 4C3IC 2JA6C 1B4AA 4C2MK 1DCHA 3BUEA 5C4XK 1I3QA 1BGWA 4YFNA 4GZYA 1Y1VA 2R7ZC 2BE5A 4A3JK 4A3GK 3N0CA 1YX2A 2VUMC 5FJ8K 1AB4A 1I3QK 3H3VL 4C3JK 3H3VD 1XZQA 3S1MC 4KMHA 1Y1VK 4G7ZA 5C3EC 4KMDA 4GTDA 4LQYA 2O5IA 3SZYA 3Q3QA 5IYCK 2V6UA 2XCQA 2PMZL 4KARA 3HOYC 2PMZD
chains in the Genus database with same CATH topology
4G7HA 3PO3C 1SFOC 2NVTC 3H0GK 4A3IK 2NVXK 4C3HK 4KMUA 4LLGA 5FLMC 4BY1C 3K7AC 2E2IK 2R92C 3GTMK 4OINA 2R93K 1I6VA 1I50C 4XLPA 1HQMA 4A3BC 5IP7C 4MEYA 1TWFC 4MQ9A 4AYBL 4A3EC 4A93K 4OIOA 4AYBD 5C44C 4A3DC 4A3KK 3GTJK 4XSZA 2A69A 4C3IK 4C2MC 2NVYC 3FKIC 3EQLA 5IYDC 2A6HA 3GTLC 3M4OC 2JA8C 4Y7NK 1R9TC 3M3YK 1TWHC 4BXXK 4A3LK 3CQZC 1TWAK 4A3JC 2O5JA 2NVQK 4A3GC 2A68A 1YNJA 1I3QC 2E2JK 2YU9K 2Y0SL 4C3JC 3S15K 1TWGK 2Y0SD 3DXJA 2B63C 5IP9K 1Y1VC 4A3MC 3RZDK 4BBSK 3S17C 3HOUK 3GTGC 3S1NK 3S14C 1WCMK 4OIPA 5M3MK 3RZOK 3HKZL 4KN7A 4YFXA 3HOXC 3S1RK 3HKZD 5M5YK 3HOVK 3I4MK 3S2DK 5TMCA 1IW7A 3I4NC 5IYCC 4A3CC 4YFKA 3HOWK 3S1QK 2JA5K 4ZH4A 4QIWL 2JA7K 3GTQK 1K83K 4QIWD 3GTPK 3H0GC 4BY7K 4A3IC 2JA6K 4A3FK 2CW0A 4C3HC 5C4XC 5FLMK 4BY1K 3PO2K 4KN4A 1YNNA 4MEXA 3GTMC 2PA8D 3S2HC 5D4DA 2E2HK 1I6HK 2R7ZK 4BBRK 4A93C 2VUMK 4A3DK 4A3KC 4LJZA 1TWCK 4OIRA 4JK1A 1Y1WC 4YG2A 3FKIK 3S1MK 1BDFA 5IYBK 4Y52K 4OIQA 3M4OK 2JA8K 4Y7NC 4XSXA 3M3YC 5C3EK 5C4JK 4BXXC 4A3LC 3CQZK 1TWAC 3GTKK 2NVQC 3GTOK 3WODA 2E2JC 2YU9C 3S16C 1TWGC 5IP9C 4X6AK 3HOZK 2WB1L 3HOYK 2WB1D 3HOUC 4BBSC 1XPPA 3S17K 3PO3K 3S1NC 1SFOK 2NVXC 2NVTK 4LK0A 1WCMC 2E2IC 4Q4ZA 3K7AK 3I4MC 4QJVB 3HOVC 3S1RC 2PA8L 3HOXK 3S2DC 2R92K 2R93C 3I4NK 1I50K 4A3BK 2WAQL 3S1QC 5IP7K 2WAQD 2JA5C 1TWFK 5M5WK 4A3EK 4G7OA 2JA7C 4XLNA 1K83C 4NOIA 3GTQC 3GTJC 5C44K 4BY7C 4C3IC 2JA6C 4C2MK 4A3FC 2NVYK 5C4XK 5IYDK 1SMYA 3GTLK 4LK1A 3PO2C 1R9TK 1TWHK 3S2HK 4YFNA 2E2HC 4GZYA 1I6HC 2R7ZC 2BE5A 4A3JK 4BBRC 4A3GK 5M5XK 2VUMC 5FJ8K 1I3QK 3H3VL 1TWCC 3S15C 4C3JK 3H3VD 4QJVA 1Y1WK 5TMFA 3RZDC 3S1MC 4Y52C 5IYBC 2PPBA 1Y1VK 4A3MK 2B63K 4G7ZA 1ZYRA 5C3EC 2A6EA 5C4JC 3GTGK 3GTKC 3S14K 3GTOC 3RZOC 2O5IA 3S16K 4Q5SA 3HOWC 4X6AC 5IYCK 4A3CK 3HOZC 2PMZL 5M3FK 3HOYC 3GTPC 2PMZD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G7H A;  3PO3 C;  1SFO C;  2NVT C;  3H0G K;  4A3I K;  2NVX K;  4C3H K;  4KMU A;  4LLG A;  5FLM C;  4BY1 C;  3K7A C;  2E2I K;  2R92 C;  3GTM K;  4OIN A;  2R93 K;  1I6V A;  1I50 C;  4XLP A;  1HQM A;  4A3B C;  5IP7 C;  4MEY A;  1TWF C;  4MQ9 A;  4AYB L;  4A3E C;  4A93 K;  4OIO A;  4AYB D;  5C44 C;  4A3D C;  4A3K K;  3GTJ K;  4XSZ A;  2A69 A;  4C3I K;  4C2M C;  2NVY C;  3FKI C;  3EQL A;  5IYD C;  2A6H A;  3GTL C;  3M4O C;  2JA8 C;  4Y7N K;  1R9T C;  3M3Y K;  1TWH C;  4BXX K;  4A3L K;  3CQZ C;  1TWA K;  4A3J C;  2O5J A;  2NVQ K;  4A3G C;  2A68 A;  1YNJ A;  1I3Q C;  2E2J K;  2YU9 K;  2Y0S L;  4C3J C;  3S15 K;  1TWG K;  2Y0S D;  3DXJ A;  2B63 C;  5IP9 K;  1Y1V C;  4A3M C;  3RZD K;  4BBS K;  3S17 C;  3HOU K;  3GTG C;  3S1N K;  3S14 C;  1WCM K;  4OIP A;  5M3M K;  3RZO K;  3HKZ L;  4KN7 A;  4YFX A;  3HOX C;  3S1R K;  3HKZ D;  5M5Y K;  3HOV K;  3I4M K;  3S2D K;  5TMC A;  1IW7 A;  3I4N C;  5IYC C;  4A3C C;  4YFK A;  3HOW K;  3S1Q K;  2JA5 K;  4ZH4 A;  4QIW L;  2JA7 K;  3GTQ K;  1K83 K;  4QIW D;  3GTP K;  3H0G C;  4BY7 K;  4A3I C;  2JA6 K;  4A3F K;  2CW0 A;  4C3H C;  5C4X C;  5FLM K;  4BY1 K;  3PO2 K;  4KN4 A;  1YNN A;  4MEX A;  3GTM C;  2PA8 D;  3S2H C;  5D4D A;  2E2H K;  1I6H K;  2R7Z K;  4BBR K;  4A93 C;  2VUM K;  4A3D K;  4A3K C;  4LJZ A;  1TWC K;  4OIR A;  4JK1 A;  1Y1W C;  4YG2 A;  3FKI K;  3S1M K;  1BDF A;  5IYB K;  4Y52 K;  4OIQ A;  3M4O K;  2JA8 K;  4Y7N C;  4XSX A;  3M3Y C;  5C3E K;  5C4J K;  4BXX C;  4A3L C;  3CQZ K;  1TWA C;  3GTK K;  2NVQ C;  3GTO K;  3WOD A;  2E2J C;  2YU9 C;  3S16 C;  1TWG C;  5IP9 C;  4X6A K;  3HOZ K;  2WB1 L;  3HOY K;  2WB1 D;  3HOU C;  4BBS C;  1XPP A;  3S17 K;  3PO3 K;  3S1N C;  1SFO K;  2NVX C;  2NVT K;  4LK0 A;  1WCM C;  2E2I C;  4Q4Z A;  3K7A K;  3I4M C;  4QJV B;  3HOV C;  3S1R C;  2PA8 L;  3HOX K;  3S2D C;  2R92 K;  2R93 C;  3I4N K;  1I50 K;  4A3B K;  2WAQ L;  3S1Q C;  5IP7 K;  2WAQ D;  2JA5 C;  1TWF K;  5M5W K;  4A3E K;  4G7O A;  2JA7 C;  4XLN A;  1K83 C;  4NOI A;  3GTQ C;  3GTJ C;  5C44 K;  4BY7 C;  4C3I C;  2JA6 C;  4C2M K;  4A3F C;  2NVY K;  5C4X K;  5IYD K;  1SMY A;  3GTL K;  4LK1 A;  3PO2 C;  1R9T K;  1TWH K;  3S2H K;  4YFN A;  2E2H C;  4GZY A;  1I6H C;  2R7Z C;  2BE5 A;  4A3J K;  4BBR C;  4A3G K;  5M5X K;  2VUM C;  5FJ8 K;  1I3Q K;  3H3V L;  1TWC C;  3S15 C;  4C3J K;  3H3V D;  4QJV A;  1Y1W K;  5TMF A;  3RZD C;  3S1M C;  4Y52 C;  5IYB C;  2PPB A;  1Y1V K;  4A3M K;  2B63 K;  4G7Z A;  1ZYR A;  5C3E C;  2A6E A;  5C4J C;  3GTG K;  3GTK C;  3S14 K;  3GTO C;  3RZO C;  2O5I A;  3S16 K;  4Q5S A;  3HOW C;  4X6A C;  5IYC K;  4A3C K;  3HOZ C;  2PMZ L;  5M3F K;  3HOY C;  3GTP C;  2PMZ D; 
#chains in the Genus database with same CATH topology
 1SFO C;  3QX3 A;  4KMU A;  4LLG A;  5FLM C;  4BY1 C;  3K7A C;  1XXA A;  1F9N A;  2R93 K;  1TWF C;  4AYB L;  4A3D C;  4AYB D;  5C44 C;  1ZXO A;  1ISE A;  4A3K K;  3GEE A;  2ZUE A;  2NVY C;  3FKI C;  2JA8 C;  4FM9 A;  4Y7N K;  1TWG A;  1TWH C;  1O24 A;  1WOS A;  3G4A A;  1O25 A;  4BXX K;  4IOA S;  2O5J A;  2A68 A;  1YNJ A;  2NVX A;  2Y0S L;  1TWG K;  2Y0S D;  4WFN S;  2B63 C;  4BKW A;  4A3M C;  3RZD K;  4BBS K;  2KPU A;  5IOR A;  3GTG C;  3GIR A;  4XCH A;  3GEH A;  3I4M K;  1O2F B;  5TMC A;  4YFK A;  4ZH4 A;  1RU0 A;  4QIW L;  4KAW X;  2E2H A;  4QIW D;  4A3I C;  2L3U A;  1USM A;  3PO2 K;  4WJ4 A;  1J6V A;  2PA8 D;  2E2H K;  1I6H K;  3AQO A;  3OEP A;  1KQ4 A;  4A93 C;  1DD5 A;  3CQZ A;  4LJZ A;  4U67 S;  4OIR A;  3GTO A;  2P5M A;  3S0X A;  1B4B A;  1EQR A;  4GTF A;  4XSX A;  2GAH C;  5C4J K;  3CQZ K;  4PAA A;  3GTO K;  3GTP A;  4G0V A;  2R92 A;  3HOU C;  1XPP A;  5CHP A;  3PO3 K;  3S1N C;  4G0W A;  5JVG S;  4QJV B;  3HOV C;  3S1R C;  2R92 K;  1O2B A;  2FQT A;  3GTL A;  1R9T A;  2JA5 C;  5M5W K;  3GTQ C;  3GTJ C;  4BY7 C;  4A3F C;  3GTL K;  4LK1 A;  2PHC B;  1R9T K;  1O29 A;  3S2H K;  4BLB A;  4BBR C;  2ZJP S;  3S15 C;  5JVH S;  4WFB S;  4Y52 C;  2PPB A;  2A6E A;  4RMF A;  3A8K A;  3AD9 C;  3H0G A;  5JVO A;  3S16 K;  4Q5S A;  5M3F K;  3TTG A;  3GTM A;  1WSV A;  2ZUF A;  1XXC A;  3H0G K;  1IS1 A;  3BP8 C;  4GTB A;  1JOE A;  4C3H K;  2E2I K;  3PIO S;  3AD8 C;  3GTM K;  4OIN A;  1I50 C;  1HQM A;  2Y3P A;  5IP7 C;  4MEY A;  1YCL A;  5CJ9 A;  4A3E C;  4OIO A;  1TWA A;  1EFW A;  4XSZ A;  4C3I K;  4C2M C;  5EGH A;  1IBA A;  3AH5 A;  4GFQ A;  2YU9 A;  3M4O C;  4WCE S;  3M3Y K;  4A3L K;  1TWA K;  4A3J C;  2JH3 A;  2NVQ K;  4A3G C;  2W7V A;  1I3Q C;  2YU9 K;  4C3J C;  5IP9 K;  1Y1V C;  2R93 A;  4OIP A;  1K83 A;  1J6X A;  4KN7 A;  4KB4 A;  3S2D K;  1IW7 A;  3I4N C;  5IYC C;  1K83 K;  5FLM K;  4BY1 K;  1TWC A;  4LR2 A;  5HL7 S;  2L5N A;  1INN A;  4P5B A;  2ZJQ S;  4A3D K;  4A3K C;  1TWC K;  3GTK A;  3GDZ A;  4JK1 A;  1Y1W C;  4YG2 A;  3FKI K;  2ZFZ A;  1BDF A;  5IOQ A;  4FZB A;  4OIQ A;  5IYB K;  4G0U A;  4Y7N C;  2JA8 K;  4BXX C;  3GTK K;  3T01 A;  1TWG C;  1UV7 A;  4X6A K;  3HOZ K;  2WB1 L;  4WFA S;  4C45 A;  2WB1 D;  4BBS C;  4GTA A;  4O2D A;  2NVT K;  2NVX C;  3TFI A;  5IOT A;  2GAG C;  4Q4Z A;  1EK8 A;  3I4M C;  1G51 A;  1XZP A;  2PA8 L;  1XZQ B;  4KDD A;  2XCR B;  4A3B K;  2WAQ L;  4WJ3 M;  2WAQ D;  4XLN A;  4NOI A;  4WIL A;  5IYD K;  1SMY A;  3PO2 C;  3LYW A;  5IOS A;  2E2H C;  1I6H C;  1O2A A;  2KXY A;  3V4G A;  2V6S A;  4DDQ A;  5TMF A;  1IL2 A;  4J3N A;  1ZVU A;  3ADA C;  3CF5 S;  4GTL A;  1ZYR A;  5C4J C;  3S14 K;  3GTO C;  4KC6 A;  3L4J A;  3RZO C;  1VJE A;  1JVI A;  1WOO A;  3HOW C;  4A3C K;  4KMA A;  1WQG A;  1PJ5 A;  3GTP C;  5L46 A;  4GTE A;  3PO3 C;  2R92 C;  1I6V A;  4XLP A;  3DLL S;  3FOF A;  4MQ9 A;  1WQF A;  1PJ7 A;  1WOP A;  4KAS A;  3GTJ K;  3BP3 A;  2A69 A;  3T00 A;  1ZQ1 C;  3TFH A;  3GTL C;  1R9T C;  3G4C A;  4LOW A;  1HI9 A;  1EI6 A;  2E2J K;  3S15 K;  1WCM A;  2E2I A;  1XXB A;  3IPJ A;  1VLO A;  3S17 C;  1WCM K;  2JA7 A;  1GE9 A;  3HKZ L;  3HOX C;  3HKZ D;  5M5Y K;  2JA6 A;  1WOR A;  5DM6 S;  3S1Q K;  2EBB A;  4IO9 S;  3T02 A;  2JA7 K;  2R7Z A;  1J6W A;  1BJT A;  3H0G C;  2JA6 K;  2VUM A;  4C3H C;  5C4X C;  1DCO A;  3ORE A;  1WSR A;  4KN4 A;  1YNN A;  3GTM C;  5D4D A;  2R7Z K;  2VUM K;  4WF9 S;  1WIH A;  3NUH A;  4KM9 A;  1USO A;  3S1M K;  1VGX A;  1EH1 A;  1F93 A;  3L4K A;  3M4O K;  3M3Y C;  5C3E K;  1PJ6 A;  4A3L C;  1TWA C;  4GT9 A;  4PAB A;  2NVQ C;  5DM7 S;  4GTC A;  2YU9 C;  1SFO A;  4AH6 A;  5IP9 C;  3HOY K;  3GEI A;  2RH6 A;  5TJ3 A;  1SFO K;  1TWF A;  4LK0 A;  3K7A K;  2GSO A;  1FEU A;  3LAJ A;  3S2D C;  3N3Y A;  2ZJR S;  2R93 C;  2NVY A;  1BS2 A;  3FKI A;  3LPX A;  3I4N K;  1TWF K;  3PIP S;  1TWH A;  3HXA A;  4G7O A;  3SZZ A;  1VRQ C;  1K83 C;  4P5A A;  5C44 K;  2NVY K;  5EGE A;  2XCO A;  1Y1W A;  1TWH K;  2B63 A;  1VH2 A;  2CFA A;  5M5X K;  3GTG A;  1TWC C;  4QJV A;  1Y1W K;  3RZD C;  2B63 K;  5IYB C;  4A3M K;  1L0W A;  5JFE A;  1V5V A;  3GTG K;  3GTK C;  2V6T A;  3CAG A;  3MML B;  4X6A C;  3HOZ C;  4G7H A;  4A3I K;  2NVT C;  2NVX K;  1F7U A;  1F7V A;  5HQH A;  2RGR A;  3FHZ A;  4A3B C;  4IOC S;  3N0B A;  1J98 A;  4A93 K;  3LAP A;  3AD7 C;  2FQO A;  5IYD C;  3EQL A;  2A6H A;  2D6F C;  3OPF A;  1C0A A;  3CQZ C;  1ZBS A;  3FOE A;  1WQH A;  3JST A;  5HL8 A;  3DXJ A;  2GSN A;  1O26 A;  3HOU K;  1JQW A;  3S1N K;  2JA5 A;  3S14 C;  3GTQ A;  5M3M K;  3VA7 A;  3GTJ A;  3RZO K;  4YFX A;  3HOV K;  3S1R K;  3TFJ A;  1IQ0 A;  4A3C C;  3HOW K;  3A8J A;  2JA5 K;  5E68 A;  3GTP K;  3GTQ K;  3ERE D;  4KB2 A;  2CFA B;  4BY7 K;  2P8T A;  4A3F K;  2CW0 A;  1O27 A;  4MEX A;  3S2H C;  2KQ1 A;  1X31 C;  4BBR K;  4ILD A;  4M1X A;  1XZP B;  4KAT A;  4Y52 K;  1DCP A;  3WOD A;  2E2J C;  3S16 C;  2GSU A;  1I50 A;  4KM8 A;  3S17 K;  1IE0 A;  4P9S A;  1WCM C;  2E2I C;  3A8I A;  4BLA A;  3AQP A;  3HOX K;  1O28 A;  1I50 K;  2KWA A;  3S1Q C;  5IP7 K;  3GSI A;  4A3E K;  2JA7 C;  4C3I C;  2JA6 C;  1B4A A;  4C2M K;  1DCH A;  3BUE A;  5C4X K;  1I3Q A;  1BGW A;  4YFN A;  4GZY A;  1Y1V A;  2R7Z C;  2BE5 A;  4A3J K;  4A3G K;  3N0C A;  1YX2 A;  2VUM C;  5FJ8 K;  1AB4 A;  1I3Q K;  3H3V L;  4C3J K;  3H3V D;  1XZQ A;  3S1M C;  4KMH A;  1Y1V K;  4G7Z A;  5C3E C;  4KMD A;  4GTD A;  4LQY A;  2O5I A;  3SZY A;  3Q3Q A;  5IYC K;  2V6U A;  2XCQ A;  2PMZ L;  4KAR A;  3HOY C;  2PMZ D; 
#chains in the Genus database with same CATH homology
 4G7H A;  3PO3 C;  1SFO C;  2NVT C;  3H0G K;  4A3I K;  2NVX K;  4C3H K;  4KMU A;  4LLG A;  5FLM C;  4BY1 C;  3K7A C;  2E2I K;  2R92 C;  3GTM K;  4OIN A;  2R93 K;  1I6V A;  1I50 C;  4XLP A;  1HQM A;  4A3B C;  5IP7 C;  4MEY A;  1TWF C;  4MQ9 A;  4AYB L;  4A3E C;  4A93 K;  4OIO A;  4AYB D;  5C44 C;  4A3D C;  4A3K K;  3GTJ K;  4XSZ A;  2A69 A;  4C3I K;  4C2M C;  2NVY C;  3FKI C;  3EQL A;  5IYD C;  2A6H A;  3GTL C;  3M4O C;  2JA8 C;  4Y7N K;  1R9T C;  3M3Y K;  1TWH C;  4BXX K;  4A3L K;  3CQZ C;  1TWA K;  4A3J C;  2O5J A;  2NVQ K;  4A3G C;  2A68 A;  1YNJ A;  1I3Q C;  2E2J K;  2YU9 K;  2Y0S L;  4C3J C;  3S15 K;  1TWG K;  2Y0S D;  3DXJ A;  2B63 C;  5IP9 K;  1Y1V C;  4A3M C;  3RZD K;  4BBS K;  3S17 C;  3HOU K;  3GTG C;  3S1N K;  3S14 C;  1WCM K;  4OIP A;  5M3M K;  3RZO K;  3HKZ L;  4KN7 A;  4YFX A;  3HOX C;  3S1R K;  3HKZ D;  5M5Y K;  3HOV K;  3I4M K;  3S2D K;  5TMC A;  1IW7 A;  3I4N C;  5IYC C;  4A3C C;  4YFK A;  3HOW K;  3S1Q K;  2JA5 K;  4ZH4 A;  4QIW L;  2JA7 K;  3GTQ K;  1K83 K;  4QIW D;  3GTP K;  3H0G C;  4BY7 K;  4A3I C;  2JA6 K;  4A3F K;  2CW0 A;  4C3H C;  5C4X C;  5FLM K;  4BY1 K;  3PO2 K;  4KN4 A;  1YNN A;  4MEX A;  3GTM C;  2PA8 D;  3S2H C;  5D4D A;  2E2H K;  1I6H K;  2R7Z K;  4BBR K;  4A93 C;  2VUM K;  4A3D K;  4A3K C;  4LJZ A;  1TWC K;  4OIR A;  4JK1 A;  1Y1W C;  4YG2 A;  3FKI K;  3S1M K;  1BDF A;  5IYB K;  4Y52 K;  4OIQ A;  3M4O K;  2JA8 K;  4Y7N C;  4XSX A;  3M3Y C;  5C3E K;  5C4J K;  4BXX C;  4A3L C;  3CQZ K;  1TWA C;  3GTK K;  2NVQ C;  3GTO K;  3WOD A;  2E2J C;  2YU9 C;  3S16 C;  1TWG C;  5IP9 C;  4X6A K;  3HOZ K;  2WB1 L;  3HOY K;  2WB1 D;  3HOU C;  4BBS C;  1XPP A;  3S17 K;  3PO3 K;  3S1N C;  1SFO K;  2NVX C;  2NVT K;  4LK0 A;  1WCM C;  2E2I C;  4Q4Z A;  3K7A K;  3I4M C;  4QJV B;  3HOV C;  3S1R C;  2PA8 L;  3HOX K;  3S2D C;  2R92 K;  2R93 C;  3I4N K;  1I50 K;  4A3B K;  2WAQ L;  3S1Q C;  5IP7 K;  2WAQ D;  2JA5 C;  1TWF K;  5M5W K;  4A3E K;  4G7O A;  2JA7 C;  4XLN A;  1K83 C;  4NOI A;  3GTQ C;  3GTJ C;  5C44 K;  4BY7 C;  4C3I C;  2JA6 C;  4C2M K;  4A3F C;  2NVY K;  5C4X K;  5IYD K;  1SMY A;  3GTL K;  4LK1 A;  3PO2 C;  1R9T K;  1TWH K;  3S2H K;  4YFN A;  2E2H C;  4GZY A;  1I6H C;  2R7Z C;  2BE5 A;  4A3J K;  4BBR C;  4A3G K;  5M5X K;  2VUM C;  5FJ8 K;  1I3Q K;  3H3V L;  1TWC C;  3S15 C;  4C3J K;  3H3V D;  4QJV A;  1Y1W K;  5TMF A;  3RZD C;  3S1M C;  4Y52 C;  5IYB C;  2PPB A;  1Y1V K;  4A3M K;  2B63 K;  4G7Z A;  1ZYR A;  5C3E C;  2A6E A;  5C4J C;  3GTG K;  3GTK C;  3S14 K;  3GTO C;  3RZO C;  2O5I A;  3S16 K;  4Q5S A;  3HOW C;  4X6A C;  5IYC K;  4A3C K;  3HOZ C;  2PMZ L;  5M3F K;  3HOY C;  3GTP C;  2PMZ D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...