2A6HA

Crystal structure of the t. thermophilus rna polymerase holoenzyme in complex with antibiotic sterptolydigin
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
229
structure length
229
Chain Sequence
b'MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase alpha chain
publication title Structural basis of transcription inhibition by antibiotic streptolydigin.
pubmed doi rcsb
molecule tags Transferase
total genus 42
structure length 229
sequence length 229
chains with identical sequence B, K, L
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2005-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01000 RNA_pol_A_bac RNA polymerase Rpb3/RpoA insert domain
A PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain
A PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.12 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 DNA-directed RNA polymerase, insert domain 2a6hA02
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 2a6hA01
2R93K 5M3MK 4Y52K 1TWFC 3HOUC 3RZOK 2Y0SL 3PO2C 3GTQK 5C4XK 4KN4A 3GTKC 5C44C 3S1NK 4A3GK 3S14C 3GTOC 4Q5SA 1I6VA 2A69A 2B63C 2PMZD 3EQLA 2R92K 3HOZC 1YNJA 1TWHC 2NVQC 2NVXC 1I50C 4BXXC 1Y1VC 3HOVK 4C2MC 1SFOK 3HOUK 3S2DK 3GTJK 3RZDK 3CQZK 2E2HK 3H3VD 3DXJA 2VUMK 1Y1WC 4BY1K 4QIWD 2PA8L 4A3MK 3HOWK 3GTPK 5M3FK 4MQ9A 3M4OC 5M5YK 3HOXC 4YFNA 3S1MC 3S1RK 1IW7A 4Y7NC 4A3DC 2JA7K 3M3YK 4C3IC 2YU9K 1WCMC 2WB1L 4LLGA 1TWHK 2E2IK 4MEYA 2NVXK 3PO3K 2NVTC 2NVYC 4LK0A 5IP9C 4AYBD 4YFKA 1TWAK 1HQMA 4C3JK 5FLMC 1K83K 3S15K 4JK1A 3HKZD 2E2JC 3M4OK 5IYDC 5IYBC 4G7OA 4A93K 4Y7NK 1XPPA 4C3HK 4A3CK 1I6HK 4MEXA 2R7ZC 3HOYC 3GTMC 5IYCC 1WCMK 5C3EC 3H0GK 4C3IK 4A3KK 2JA6K 2JA8K 3S2HK 2WAQL 4BBRC 1TWFK 2NVTK 4A3LC 4X6AC 4A3JC 4XSZA 4QJVB 3PO2K 1I3QC 2Y0SD 3GTKK 5IP7C 5C44K 4KMUA 5C4JC 3S14K 3I4NC 3GTGC 2A68A 1YNNA 3FKIC 3I4MC 3GTOK 2B63K 3HOYK 3HOZK 3S17C 5C3EK 2JA5C 4A3FC 2NVQK 4OIOA 4KN7A 4ZH4A 1I50K 1BDFA 5M5WK 4BXXK 1Y1VK 4A3IC 4C2MK 3S16C 4XSXA 1TWGC 5D4DA 4XLNA 3K7AC 3GTLC 2A6EA 1Y1WK 4QJVA 4A3EC 5TMFA 1R9TC 1TWCC 4A3BC 4BBSC 5C4JK 2PA8D 3M3YC 2CW0A 3WODA 4NOIA 3S1QC 4GZYA 2R93C 3HOXK 3S1MK 4Y52C 4Q4ZA 4A3DK 4BY7C 2BE5A 4OIPA 3RZOC 4A3FK 2A6HA 3GTQC 5C4XC 2WB1D 5TMCA 3S16K 3S1NC 2NVYK 4LJZA 5IP9K 5FLMK 2R92C 4OIQA 2E2JK 4A3BK 4YG2A 5IYDK 5IYBK 4OIRA 3HOVC 4BY7K 2R7ZK 1SFOC 5IYCK 3S2DC 3GTJC 3RZDC 3H3VL 3GTMK 4QIWL 3CQZC 2E2HC 2VUMC 4BY1C 4BBRK 4A3MC 3HOWC 2WAQD 3GTPC 4A3LK 4A3JK 4X6AK 1I3QK 2PPBA 3S1RC 2JA7C 5IP7K 1ZYRA 2YU9C 3I4NK 2E2IC 3GTGK 4OINA 4XLPA 3FKIK 5M5XK 3I4MK 3PO3C 2O5IA 4AYBL 3S17K 2JA5K 4YFXA 4LK1A 4C3JC 1TWAC 3HKZL 1K83C 4A3IK 3S15C 1SMYA 4A3GC 2O5JA 1TWGK 4G7HA 3K7AK 2PMZL 3GTLK 4A93C 4C3HC 4A3CC 1I6HC 4A3EK 1R9TK 2JA6C 1TWCK 3S2HC 4BBSK 3H0GC 4G7ZA 4A3KC 2JA8C 5FJ8K 3S1QK
chains in the Genus database with same CATH superfamily
1BGWA 3RZOK 2YU9A 2E2IA 1XZQB 5C4XK 2NVXA 3T02A 2A69A 2RGRA 3HOZC 1BS2A 2NVQC 3Q3QA 4WILA 3GEEA 4AH6A 2JA6A 2KPUA 4P5BA 3DXJA 2FQTA 3A8IA 3L4JA 1J98A 1INNA 4A3DC 4WCES 5CJ9A 3ADAC 3PO3K 3GTOA 1O29A 4GTAA 4LK0A 1JOEA 1TWAK 4JK1A 4FM9A 1J6WA 1O25A 5IYBC 4G7OA 2GAGC 1O28A 4C3HK 4MEXA 3HOYC 3S2HK 2JA8K 1VGXA 3T00A 4A3LC 4X6AC 1USMA 3GTKK 3A8JA 3S14K 4O2DA 1YNNA 5EGEA 1B4AA 3HOYK 4OIOA 4ZH4A 1Y1VK 4A3IC 3FOEA 3S16C 4XSXA 1TWGC 4XLNA 1YX2A 3L4KA 3GTMA 1Y1WK 1TWCC 4GZYA 2KWAA 2R93C 4BY7C 4OIPA 1B4BA 1WORA 1VRQC 3S16K 1DCOA 3SZZA 5FLMK 2R92C 5JVGS 2KQ1A 4OIRA 4BY7K 3S2DC 3GTJC 2ZJQS 3RZDC 3H3VL 1XXAA 4BY1C 4A3MC 3GTPC 1PJ6A 4WFNS 1I3QK 1L0WA 5CHPA 1IE0A 1ZYRA 2YU9C 2E2IC 3FKIK 2O5IA 4AYBL 4YFXA 4C3JC 1DCPA 3N0BA 3NUHA 1EFWA 3HKZL 4GTBA 3S15C 2O5JA 4WJ4A 3K7AK 4M1XA 2E2HA 2JA6C 4G7ZA 4A3KC 3M3YK 3S1QK 3AD7C 1WOSA 2JA7A 3G4CA 3GTQK 3V4GA 4KN4A 1WSVA 1G51A 3GTOC 4Q5SA 3PIPS 1XXCA 4BXXC 3HOVK 4C2MC 1SFOK 3CQZK 4J3NA 2VUMK 3A8KA 4QIWD 2PA8L 2L5NA 4WF9S 1XZQA 1TWFA 3T01A 3S1RK 1IW7A 1WCMC 1USOA 2WB1L 2B63A 4YFKA 1HQMA 1K83K 1I50A 4KC6A 1EK8A 1PJ7A 4A93K 4G0WA 2GSUA 1I6HK 1O2AA 1VH2A 1ZXOA 1WCMK 3GTMC 5IYCC 3H0GK 4GTDA 3VA7A 3BP8C 1O26A 3QX3A 4A3JC 4XSZA 4QJVB 3OREA 4GTCA 4BLAA 3IPJA 5C4JC 1XZPB 5L46A 1EI6A 2NVYA 3HOZK 4A3FC 1IL2A 2NVQK 4KN7A 2GAHC 1BDFA 1GE9A 1EH1A 2R7ZA 2A6EA 1WQHA 5TMFA 4A3EC 5C4JK 1WQFA 4Y52C 4Q4ZA 4A3DK 4A3FK 1O2BA 2A6HA 3AH5A 2GSOA 3GTGA 5TMCA 2FQOA 4KARA 3S1NC 4PABA 2JA5A 4KM8A 5IYBK 3GTLA 4GT9A 4G0UA 3LAJA 1R9TA 2E2HC 2L3UA 5DM7S 3CF5S 4G0VA 3HOWC 2P5MA 4A3LK 3MMLB 4X6AK 4XCHA 2EBBA 2JA7C 1DCHA 4XLPA 4LK1A 4BLBA 1JQWA 3PIOS 4A3IK 4WJ3M 1O27A 1SMYA 1TWGK 3TFIA 2PMZL 4A3CC 3BP3A 1TWCK 3TFJA 3AQPA 2PHCB 3AD9C 2R93K 1TWFC 3HOUC 1F7VA 4BKWA 2Y0SL 3PO2C 4LOWA 5C44C 4IOCS 4LR2A 1V5VA 2B63C 2R92K 2PMZD 3EQLA 1TWAA 3BUEA 2RH6A 1YNJA 1VLOA 2NVXC 1I50C 3GEHA 3FOFA 3N0CA 3HOUK 3S2DK 3GTJK 3RZDK 1ZBSA 2XCQA 3TTGA 3H3VD 4BY1K 4A3MK 3GTPK 4KASA 4MQ9A 5M5YK 3HOXC 3S1MC 4GTEA 2YU9K 3GTKA 2E2IK 4LLGA 3CAGA 2NVXK 1YCLA 2NVTC 1DD5A 2NVYC 5IP9C 4AYBD 4C3JK 2V6TA 1TWHA 2ZJPS 3S15K 1WOOA 3HKZD 2E2JC 1Y1VA 4KAWX 1FEUA 5IYDC 1UV7A 2R7ZC 4RMFA 2JA6K 1Y1WA 1IBAA 4A3KK 4KDDA 1RU0A 3JSTA 1J6VA 2WAQL 4BBRC 2NVTK 4KMHA 2KXYA 5IP7C 1IQ0A 2ZUEA 3I4NC 1X31C 3GTGC 4FZBA 2A68A 3I4MC 4GTFA 3GTOK 5IOSA 3S17C 4PAAA 2JA5C 4BXXK 2JH3A 4GTLA 4C2MK 3LAPA 3GTLC 3GEIA 4QJVA 3DLLS 1R9TC 3OPFA 4BBSC 4P9SA 2PA8D 1WIHA 5TJ3A 3LPXA 1XZPA 3GIRA 1I3QA 5E68A 4WFBS 3RZOC 5HL7S 5JFEA 5C4XC 2WB1D 3FKIA 1XXBA 4LJZA 4OIQA 3GSIA 2ZUFA 4KM9A 3GTMK 4KMDA 5IYCK 4KB2A 4GFQA 1WOPA 4A3JK 2CFAB 4IO9S 3GTQA 2V6UA 4OINA 5JVOA 3PO3C 1F7UA 5IOQA 1TWAC 4A3GC 1SFOA 4G7HA 3CQZA 4C3HC 1VJEA 2VUMA 4A3EK 3S2HC 2JA8C 5FJ8K 1HI9A 1IS1A 5M3MK 4Y52K 4ILDA 1ZVUA 3GTKC 2V6SA 3S0XA 3S1NK 4A3GK 3S14C 1I6VA 1K83A 1TWHC 1Y1VC 1WCMA 3H0GA 2E2HK 1Y1WC 4DDQA 3HOWK 5M3FK 3M4OC 4YFNA 4C45A 4Y7NC 2JA7K 4WFAS 4C3IC 1F93A 4KATA 1TWHK 4MEYA 3LYWA 1F9NA 5FLMC 1EQRA 2D6FC 3HXAA 3M4OK 1O2FB 2W7VA 4P5AA 4Y7NK 1XPPA 4A3CK 1O24A 4C3IK 5C3EC 3G4AA 1TWFK 3PO2K 1I3QC 2Y0SD 5C44K 4KMUA 4U67S 5IORA 3FKIC 2B63K 5C3EK 1I50K 5M5WK 3AD8C 1KQ4A 5D4DA 3K7AC 1C0AA 1AB4A 4A3BC 2ZFZA 3M3YC 2CW0A 3WODA 4NOIA 3S1QC 3HOXK 5HL8A 3S1MK 5HQHA 3AQOA 2BE5A 2XCOA 3GTQC 2XCRB 1J6XA 1JVIA 2NVYK 5IP9K 3SZYA 5EGHA 4IOAS 2E2JK 2ZJRS 4KMAA 3TFHA 4YG2A 1BJTA 4A3BK 5IYDK 1TWGA 3HOVC 2R7ZK 1SFOC 1ZQ1C 1TWCA 4QIWL 3CQZC 2VUMC 4KB4A 4BBRK 2R93A 4LQYA 2WAQD 3FHZA 2PPBA 3S1RC 1WSRA 1ISEA 2Y3PA 5IP7K 5JVHS 1PJ5A 3N3YA 3I4NK 3GTGK 3I4MK 5M5XK 1WQGA 3S17K 2R92A 2JA5K 2P8TA 2GSNA 3ERED 1K83C 3GTLK 3GTJA 5IOTA 4A93C 1I6HC 2CFAA 1R9TK 4BBSK 3H0GC 3GDZA 3GTPA 3OEPA 5DM6S
chains in the Genus database with same CATH topology
2R93K 5M3MK 4Y52K 1TWFC 3HOUC 3RZOK 2Y0SL 3PO2C 3GTQK 5C4XK 4KN4A 3GTKC 5C44C 3S1NK 4A3GK 3S14C 3GTOC 4Q5SA 1I6VA 2A69A 2B63C 2PMZD 3EQLA 2R92K 3HOZC 1YNJA 1TWHC 2NVQC 2NVXC 1I50C 4BXXC 1Y1VC 3HOVK 4C2MC 1SFOK 3HOUK 3S2DK 3GTJK 3RZDK 3CQZK 2E2HK 3H3VD 3DXJA 2VUMK 1Y1WC 4BY1K 4QIWD 2PA8L 4A3MK 3HOWK 3GTPK 5M3FK 4MQ9A 3M4OC 5M5YK 3HOXC 4YFNA 3S1MC 3S1RK 1IW7A 4Y7NC 4A3DC 2JA7K 3M3YK 4C3IC 2YU9K 1WCMC 2WB1L 4LLGA 1TWHK 2E2IK 4MEYA 2NVXK 3PO3K 2NVTC 2NVYC 4LK0A 5IP9C 4AYBD 4YFKA 1TWAK 1HQMA 4C3JK 5FLMC 1K83K 3S15K 4JK1A 3HKZD 2E2JC 3M4OK 5IYDC 5IYBC 4G7OA 4A93K 4Y7NK 1XPPA 4C3HK 4A3CK 1I6HK 4MEXA 2R7ZC 3HOYC 3GTMC 5IYCC 1WCMK 5C3EC 3H0GK 4C3IK 4A3KK 2JA6K 2JA8K 3S2HK 2WAQL 4BBRC 1TWFK 2NVTK 4A3LC 4X6AC 4A3JC 4XSZA 4QJVB 3PO2K 1I3QC 2Y0SD 3GTKK 5IP7C 5C44K 4KMUA 5C4JC 3S14K 3I4NC 3GTGC 2A68A 1YNNA 3FKIC 3I4MC 3GTOK 2B63K 3HOYK 3HOZK 3S17C 5C3EK 2JA5C 4A3FC 2NVQK 4OIOA 4KN7A 4ZH4A 1I50K 1BDFA 5M5WK 4BXXK 1Y1VK 4A3IC 4C2MK 3S16C 4XSXA 1TWGC 5D4DA 4XLNA 3K7AC 3GTLC 2A6EA 1Y1WK 4QJVA 4A3EC 5TMFA 1R9TC 1TWCC 4A3BC 4BBSC 5C4JK 2PA8D 3M3YC 2CW0A 3WODA 4NOIA 3S1QC 4GZYA 2R93C 3HOXK 3S1MK 4Y52C 4Q4ZA 4A3DK 4BY7C 2BE5A 4OIPA 3RZOC 4A3FK 2A6HA 3GTQC 5C4XC 2WB1D 5TMCA 3S16K 3S1NC 2NVYK 4LJZA 5IP9K 5FLMK 2R92C 4OIQA 2E2JK 4A3BK 4YG2A 5IYDK 5IYBK 4OIRA 3HOVC 4BY7K 2R7ZK 1SFOC 5IYCK 3S2DC 3GTJC 3RZDC 3H3VL 3GTMK 4QIWL 3CQZC 2E2HC 2VUMC 4BY1C 4BBRK 4A3MC 3HOWC 2WAQD 3GTPC 4A3LK 4A3JK 4X6AK 1I3QK 2PPBA 3S1RC 2JA7C 5IP7K 1ZYRA 2YU9C 3I4NK 2E2IC 3GTGK 4OINA 4XLPA 3FKIK 5M5XK 3I4MK 3PO3C 2O5IA 4AYBL 3S17K 2JA5K 4YFXA 4LK1A 4C3JC 1TWAC 3HKZL 1K83C 4A3IK 3S15C 1SMYA 4A3GC 2O5JA 1TWGK 4G7HA 3K7AK 2PMZL 3GTLK 4A93C 4C3HC 4A3CC 1I6HC 4A3EK 1R9TK 2JA6C 1TWCK 3S2HC 4BBSK 3H0GC 4G7ZA 4A3KC 2JA8C 5FJ8K 3S1QK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R93 K;  5M3M K;  4Y52 K;  1TWF C;  3HOU C;  3RZO K;  2Y0S L;  3PO2 C;  3GTQ K;  5C4X K;  4KN4 A;  3GTK C;  5C44 C;  3S1N K;  4A3G K;  3S14 C;  3GTO C;  4Q5S A;  1I6V A;  2A69 A;  2B63 C;  2PMZ D;  3EQL A;  2R92 K;  3HOZ C;  1YNJ A;  1TWH C;  2NVQ C;  2NVX C;  1I50 C;  4BXX C;  1Y1V C;  3HOV K;  4C2M C;  1SFO K;  3HOU K;  3S2D K;  3GTJ K;  3RZD K;  3CQZ K;  2E2H K;  3H3V D;  3DXJ A;  2VUM K;  1Y1W C;  4BY1 K;  4QIW D;  2PA8 L;  4A3M K;  3HOW K;  3GTP K;  5M3F K;  4MQ9 A;  3M4O C;  5M5Y K;  3HOX C;  4YFN A;  3S1M C;  3S1R K;  1IW7 A;  4Y7N C;  4A3D C;  2JA7 K;  3M3Y K;  4C3I C;  2YU9 K;  1WCM C;  2WB1 L;  4LLG A;  1TWH K;  2E2I K;  4MEY A;  2NVX K;  3PO3 K;  2NVT C;  2NVY C;  4LK0 A;  5IP9 C;  4AYB D;  4YFK A;  1TWA K;  1HQM A;  4C3J K;  5FLM C;  1K83 K;  3S15 K;  4JK1 A;  3HKZ D;  2E2J C;  3M4O K;  5IYD C;  5IYB C;  4G7O A;  4A93 K;  4Y7N K;  1XPP A;  4C3H K;  4A3C K;  1I6H K;  4MEX A;  2R7Z C;  3HOY C;  3GTM C;  5IYC C;  1WCM K;  5C3E C;  3H0G K;  4C3I K;  4A3K K;  2JA6 K;  2JA8 K;  3S2H K;  2WAQ L;  4BBR C;  1TWF K;  2NVT K;  4A3L C;  4X6A C;  4A3J C;  4XSZ A;  4QJV B;  3PO2 K;  1I3Q C;  2Y0S D;  3GTK K;  5IP7 C;  5C44 K;  4KMU A;  5C4J C;  3S14 K;  3I4N C;  3GTG C;  2A68 A;  1YNN A;  3FKI C;  3I4M C;  3GTO K;  2B63 K;  3HOY K;  3HOZ K;  3S17 C;  5C3E K;  2JA5 C;  4A3F C;  2NVQ K;  4OIO A;  4KN7 A;  4ZH4 A;  1I50 K;  1BDF A;  5M5W K;  4BXX K;  1Y1V K;  4A3I C;  4C2M K;  3S16 C;  4XSX A;  1TWG C;  5D4D A;  4XLN A;  3K7A C;  3GTL C;  2A6E A;  1Y1W K;  4QJV A;  4A3E C;  5TMF A;  1R9T C;  1TWC C;  4A3B C;  4BBS C;  5C4J K;  2PA8 D;  3M3Y C;  2CW0 A;  3WOD A;  4NOI A;  3S1Q C;  4GZY A;  2R93 C;  3HOX K;  3S1M K;  4Y52 C;  4Q4Z A;  4A3D K;  4BY7 C;  2BE5 A;  4OIP A;  3RZO C;  4A3F K;  2A6H A;  3GTQ C;  5C4X C;  2WB1 D;  5TMC A;  3S16 K;  3S1N C;  2NVY K;  4LJZ A;  5IP9 K;  5FLM K;  2R92 C;  4OIQ A;  2E2J K;  4A3B K;  4YG2 A;  5IYD K;  5IYB K;  4OIR A;  3HOV C;  4BY7 K;  2R7Z K;  1SFO C;  5IYC K;  3S2D C;  3GTJ C;  3RZD C;  3H3V L;  3GTM K;  4QIW L;  3CQZ C;  2E2H C;  2VUM C;  4BY1 C;  4BBR K;  4A3M C;  3HOW C;  2WAQ D;  3GTP C;  4A3L K;  4A3J K;  4X6A K;  1I3Q K;  2PPB A;  3S1R C;  2JA7 C;  5IP7 K;  1ZYR A;  2YU9 C;  3I4N K;  2E2I C;  3GTG K;  4OIN A;  4XLP A;  3FKI K;  5M5X K;  3I4M K;  3PO3 C;  2O5I A;  4AYB L;  3S17 K;  2JA5 K;  4YFX A;  4LK1 A;  4C3J C;  1TWA C;  3HKZ L;  1K83 C;  4A3I K;  3S15 C;  1SMY A;  4A3G C;  2O5J A;  1TWG K;  4G7H A;  3K7A K;  2PMZ L;  3GTL K;  4A93 C;  4C3H C;  4A3C C;  1I6H C;  4A3E K;  1R9T K;  2JA6 C;  1TWC K;  3S2H C;  4BBS K;  3H0G C;  4G7Z A;  4A3K C;  2JA8 C;  5FJ8 K;  3S1Q K; 
#chains in the Genus database with same CATH topology
 1BGW A;  3RZO K;  2YU9 A;  2E2I A;  1XZQ B;  5C4X K;  2NVX A;  3T02 A;  2A69 A;  2RGR A;  3HOZ C;  1BS2 A;  2NVQ C;  3Q3Q A;  4WIL A;  3GEE A;  4AH6 A;  2JA6 A;  2KPU A;  4P5B A;  3DXJ A;  2FQT A;  3A8I A;  3L4J A;  1J98 A;  1INN A;  4A3D C;  4WCE S;  5CJ9 A;  3ADA C;  3PO3 K;  3GTO A;  1O29 A;  4GTA A;  4LK0 A;  1JOE A;  1TWA K;  4JK1 A;  4FM9 A;  1J6W A;  1O25 A;  5IYB C;  4G7O A;  2GAG C;  1O28 A;  4C3H K;  4MEX A;  3HOY C;  3S2H K;  2JA8 K;  1VGX A;  3T00 A;  4A3L C;  4X6A C;  1USM A;  3GTK K;  3A8J A;  3S14 K;  4O2D A;  1YNN A;  5EGE A;  1B4A A;  3HOY K;  4OIO A;  4ZH4 A;  1Y1V K;  4A3I C;  3FOE A;  3S16 C;  4XSX A;  1TWG C;  4XLN A;  1YX2 A;  3L4K A;  3GTM A;  1Y1W K;  1TWC C;  4GZY A;  2KWA A;  2R93 C;  4BY7 C;  4OIP A;  1B4B A;  1WOR A;  1VRQ C;  3S16 K;  1DCO A;  3SZZ A;  5FLM K;  2R92 C;  5JVG S;  2KQ1 A;  4OIR A;  4BY7 K;  3S2D C;  3GTJ C;  2ZJQ S;  3RZD C;  3H3V L;  1XXA A;  4BY1 C;  4A3M C;  3GTP C;  1PJ6 A;  4WFN S;  1I3Q K;  1L0W A;  5CHP A;  1IE0 A;  1ZYR A;  2YU9 C;  2E2I C;  3FKI K;  2O5I A;  4AYB L;  4YFX A;  4C3J C;  1DCP A;  3N0B A;  3NUH A;  1EFW A;  3HKZ L;  4GTB A;  3S15 C;  2O5J A;  4WJ4 A;  3K7A K;  4M1X A;  2E2H A;  2JA6 C;  4G7Z A;  4A3K C;  3M3Y K;  3S1Q K;  3AD7 C;  1WOS A;  2JA7 A;  3G4C A;  3GTQ K;  3V4G A;  4KN4 A;  1WSV A;  1G51 A;  3GTO C;  4Q5S A;  3PIP S;  1XXC A;  4BXX C;  3HOV K;  4C2M C;  1SFO K;  3CQZ K;  4J3N A;  2VUM K;  3A8K A;  4QIW D;  2PA8 L;  2L5N A;  4WF9 S;  1XZQ A;  1TWF A;  3T01 A;  3S1R K;  1IW7 A;  1WCM C;  1USO A;  2WB1 L;  2B63 A;  4YFK A;  1HQM A;  1K83 K;  1I50 A;  4KC6 A;  1EK8 A;  1PJ7 A;  4A93 K;  4G0W A;  2GSU A;  1I6H K;  1O2A A;  1VH2 A;  1ZXO A;  1WCM K;  3GTM C;  5IYC C;  3H0G K;  4GTD A;  3VA7 A;  3BP8 C;  1O26 A;  3QX3 A;  4A3J C;  4XSZ A;  4QJV B;  3ORE A;  4GTC A;  4BLA A;  3IPJ A;  5C4J C;  1XZP B;  5L46 A;  1EI6 A;  2NVY A;  3HOZ K;  4A3F C;  1IL2 A;  2NVQ K;  4KN7 A;  2GAH C;  1BDF A;  1GE9 A;  1EH1 A;  2R7Z A;  2A6E A;  1WQH A;  5TMF A;  4A3E C;  5C4J K;  1WQF A;  4Y52 C;  4Q4Z A;  4A3D K;  4A3F K;  1O2B A;  2A6H A;  3AH5 A;  2GSO A;  3GTG A;  5TMC A;  2FQO A;  4KAR A;  3S1N C;  4PAB A;  2JA5 A;  4KM8 A;  5IYB K;  3GTL A;  4GT9 A;  4G0U A;  3LAJ A;  1R9T A;  2E2H C;  2L3U A;  5DM7 S;  3CF5 S;  4G0V A;  3HOW C;  2P5M A;  4A3L K;  3MML B;  4X6A K;  4XCH A;  2EBB A;  2JA7 C;  1DCH A;  4XLP A;  4LK1 A;  4BLB A;  1JQW A;  3PIO S;  4A3I K;  4WJ3 M;  1O27 A;  1SMY A;  1TWG K;  3TFI A;  2PMZ L;  4A3C C;  3BP3 A;  1TWC K;  3TFJ A;  3AQP A;  2PHC B;  3AD9 C;  2R93 K;  1TWF C;  3HOU C;  1F7V A;  4BKW A;  2Y0S L;  3PO2 C;  4LOW A;  5C44 C;  4IOC S;  4LR2 A;  1V5V A;  2B63 C;  2R92 K;  2PMZ D;  3EQL A;  1TWA A;  3BUE A;  2RH6 A;  1YNJ A;  1VLO A;  2NVX C;  1I50 C;  3GEH A;  3FOF A;  3N0C A;  3HOU K;  3S2D K;  3GTJ K;  3RZD K;  1ZBS A;  2XCQ A;  3TTG A;  3H3V D;  4BY1 K;  4A3M K;  3GTP K;  4KAS A;  4MQ9 A;  5M5Y K;  3HOX C;  3S1M C;  4GTE A;  2YU9 K;  3GTK A;  2E2I K;  4LLG A;  3CAG A;  2NVX K;  1YCL A;  2NVT C;  1DD5 A;  2NVY C;  5IP9 C;  4AYB D;  4C3J K;  2V6T A;  1TWH A;  2ZJP S;  3S15 K;  1WOO A;  3HKZ D;  2E2J C;  1Y1V A;  4KAW X;  1FEU A;  5IYD C;  1UV7 A;  2R7Z C;  4RMF A;  2JA6 K;  1Y1W A;  1IBA A;  4A3K K;  4KDD A;  1RU0 A;  3JST A;  1J6V A;  2WAQ L;  4BBR C;  2NVT K;  4KMH A;  2KXY A;  5IP7 C;  1IQ0 A;  2ZUE A;  3I4N C;  1X31 C;  3GTG C;  4FZB A;  2A68 A;  3I4M C;  4GTF A;  3GTO K;  5IOS A;  3S17 C;  4PAA A;  2JA5 C;  4BXX K;  2JH3 A;  4GTL A;  4C2M K;  3LAP A;  3GTL C;  3GEI A;  4QJV A;  3DLL S;  1R9T C;  3OPF A;  4BBS C;  4P9S A;  2PA8 D;  1WIH A;  5TJ3 A;  3LPX A;  1XZP A;  3GIR A;  1I3Q A;  5E68 A;  4WFB S;  3RZO C;  5HL7 S;  5JFE A;  5C4X C;  2WB1 D;  3FKI A;  1XXB A;  4LJZ A;  4OIQ A;  3GSI A;  2ZUF A;  4KM9 A;  3GTM K;  4KMD A;  5IYC K;  4KB2 A;  4GFQ A;  1WOP A;  4A3J K;  2CFA B;  4IO9 S;  3GTQ A;  2V6U A;  4OIN A;  5JVO A;  3PO3 C;  1F7U A;  5IOQ A;  1TWA C;  4A3G C;  1SFO A;  4G7H A;  3CQZ A;  4C3H C;  1VJE A;  2VUM A;  4A3E K;  3S2H C;  2JA8 C;  5FJ8 K;  1HI9 A;  1IS1 A;  5M3M K;  4Y52 K;  4ILD A;  1ZVU A;  3GTK C;  2V6S A;  3S0X A;  3S1N K;  4A3G K;  3S14 C;  1I6V A;  1K83 A;  1TWH C;  1Y1V C;  1WCM A;  3H0G A;  2E2H K;  1Y1W C;  4DDQ A;  3HOW K;  5M3F K;  3M4O C;  4YFN A;  4C45 A;  4Y7N C;  2JA7 K;  4WFA S;  4C3I C;  1F93 A;  4KAT A;  1TWH K;  4MEY A;  3LYW A;  1F9N A;  5FLM C;  1EQR A;  2D6F C;  3HXA A;  3M4O K;  1O2F B;  2W7V A;  4P5A A;  4Y7N K;  1XPP A;  4A3C K;  1O24 A;  4C3I K;  5C3E C;  3G4A A;  1TWF K;  3PO2 K;  1I3Q C;  2Y0S D;  5C44 K;  4KMU A;  4U67 S;  5IOR A;  3FKI C;  2B63 K;  5C3E K;  1I50 K;  5M5W K;  3AD8 C;  1KQ4 A;  5D4D A;  3K7A C;  1C0A A;  1AB4 A;  4A3B C;  2ZFZ A;  3M3Y C;  2CW0 A;  3WOD A;  4NOI A;  3S1Q C;  3HOX K;  5HL8 A;  3S1M K;  5HQH A;  3AQO A;  2BE5 A;  2XCO A;  3GTQ C;  2XCR B;  1J6X A;  1JVI A;  2NVY K;  5IP9 K;  3SZY A;  5EGH A;  4IOA S;  2E2J K;  2ZJR S;  4KMA A;  3TFH A;  4YG2 A;  1BJT A;  4A3B K;  5IYD K;  1TWG A;  3HOV C;  2R7Z K;  1SFO C;  1ZQ1 C;  1TWC A;  4QIW L;  3CQZ C;  2VUM C;  4KB4 A;  4BBR K;  2R93 A;  4LQY A;  2WAQ D;  3FHZ A;  2PPB A;  3S1R C;  1WSR A;  1ISE A;  2Y3P A;  5IP7 K;  5JVH S;  1PJ5 A;  3N3Y A;  3I4N K;  3GTG K;  3I4M K;  5M5X K;  1WQG A;  3S17 K;  2R92 A;  2JA5 K;  2P8T A;  2GSN A;  3ERE D;  1K83 C;  3GTL K;  3GTJ A;  5IOT A;  4A93 C;  1I6H C;  2CFA A;  1R9T K;  4BBS K;  3H0G C;  3GDZ A;  3GTP A;  3OEP A;  5DM6 S; 
#chains in the Genus database with same CATH homology
 2R93 K;  5M3M K;  4Y52 K;  1TWF C;  3HOU C;  3RZO K;  2Y0S L;  3PO2 C;  3GTQ K;  5C4X K;  4KN4 A;  3GTK C;  5C44 C;  3S1N K;  4A3G K;  3S14 C;  3GTO C;  4Q5S A;  1I6V A;  2A69 A;  2B63 C;  2PMZ D;  3EQL A;  2R92 K;  3HOZ C;  1YNJ A;  1TWH C;  2NVQ C;  2NVX C;  1I50 C;  4BXX C;  1Y1V C;  3HOV K;  4C2M C;  1SFO K;  3HOU K;  3S2D K;  3GTJ K;  3RZD K;  3CQZ K;  2E2H K;  3H3V D;  3DXJ A;  2VUM K;  1Y1W C;  4BY1 K;  4QIW D;  2PA8 L;  4A3M K;  3HOW K;  3GTP K;  5M3F K;  4MQ9 A;  3M4O C;  5M5Y K;  3HOX C;  4YFN A;  3S1M C;  3S1R K;  1IW7 A;  4Y7N C;  4A3D C;  2JA7 K;  3M3Y K;  4C3I C;  2YU9 K;  1WCM C;  2WB1 L;  4LLG A;  1TWH K;  2E2I K;  4MEY A;  2NVX K;  3PO3 K;  2NVT C;  2NVY C;  4LK0 A;  5IP9 C;  4AYB D;  4YFK A;  1TWA K;  1HQM A;  4C3J K;  5FLM C;  1K83 K;  3S15 K;  4JK1 A;  3HKZ D;  2E2J C;  3M4O K;  5IYD C;  5IYB C;  4G7O A;  4A93 K;  4Y7N K;  1XPP A;  4C3H K;  4A3C K;  1I6H K;  4MEX A;  2R7Z C;  3HOY C;  3GTM C;  5IYC C;  1WCM K;  5C3E C;  3H0G K;  4C3I K;  4A3K K;  2JA6 K;  2JA8 K;  3S2H K;  2WAQ L;  4BBR C;  1TWF K;  2NVT K;  4A3L C;  4X6A C;  4A3J C;  4XSZ A;  4QJV B;  3PO2 K;  1I3Q C;  2Y0S D;  3GTK K;  5IP7 C;  5C44 K;  4KMU A;  5C4J C;  3S14 K;  3I4N C;  3GTG C;  2A68 A;  1YNN A;  3FKI C;  3I4M C;  3GTO K;  2B63 K;  3HOY K;  3HOZ K;  3S17 C;  5C3E K;  2JA5 C;  4A3F C;  2NVQ K;  4OIO A;  4KN7 A;  4ZH4 A;  1I50 K;  1BDF A;  5M5W K;  4BXX K;  1Y1V K;  4A3I C;  4C2M K;  3S16 C;  4XSX A;  1TWG C;  5D4D A;  4XLN A;  3K7A C;  3GTL C;  2A6E A;  1Y1W K;  4QJV A;  4A3E C;  5TMF A;  1R9T C;  1TWC C;  4A3B C;  4BBS C;  5C4J K;  2PA8 D;  3M3Y C;  2CW0 A;  3WOD A;  4NOI A;  3S1Q C;  4GZY A;  2R93 C;  3HOX K;  3S1M K;  4Y52 C;  4Q4Z A;  4A3D K;  4BY7 C;  2BE5 A;  4OIP A;  3RZO C;  4A3F K;  2A6H A;  3GTQ C;  5C4X C;  2WB1 D;  5TMC A;  3S16 K;  3S1N C;  2NVY K;  4LJZ A;  5IP9 K;  5FLM K;  2R92 C;  4OIQ A;  2E2J K;  4A3B K;  4YG2 A;  5IYD K;  5IYB K;  4OIR A;  3HOV C;  4BY7 K;  2R7Z K;  1SFO C;  5IYC K;  3S2D C;  3GTJ C;  3RZD C;  3H3V L;  3GTM K;  4QIW L;  3CQZ C;  2E2H C;  2VUM C;  4BY1 C;  4BBR K;  4A3M C;  3HOW C;  2WAQ D;  3GTP C;  4A3L K;  4A3J K;  4X6A K;  1I3Q K;  2PPB A;  3S1R C;  2JA7 C;  5IP7 K;  1ZYR A;  2YU9 C;  3I4N K;  2E2I C;  3GTG K;  4OIN A;  4XLP A;  3FKI K;  5M5X K;  3I4M K;  3PO3 C;  2O5I A;  4AYB L;  3S17 K;  2JA5 K;  4YFX A;  4LK1 A;  4C3J C;  1TWA C;  3HKZ L;  1K83 C;  4A3I K;  3S15 C;  1SMY A;  4A3G C;  2O5J A;  1TWG K;  4G7H A;  3K7A K;  2PMZ L;  3GTL K;  4A93 C;  4C3H C;  4A3C C;  1I6H C;  4A3E K;  1R9T K;  2JA6 C;  1TWC K;  3S2H C;  4BBS K;  3H0G C;  4G7Z A;  4A3K C;  2JA8 C;  5FJ8 K;  3S1Q K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...