2A6HA

Crystal structure of the t. thermophilus rna polymerase holoenzyme in complex with antibiotic sterptolydigin
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
229
structure length
229
Chain Sequence
MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of transcription inhibition by antibiotic streptolydigin.
pubmed doi rcsb
molecule tags Transferase
molecule keywords DNA-directed RNA polymerase alpha chain
total genus 42
structure length 229
sequence length 229
chains with identical sequence B, K, L
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2005-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01000 RNA_pol_A_bac RNA polymerase Rpb3/RpoA insert domain
A PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain
A PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.12 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 DNA-directed RNA polymerase, insert domain 2a6hA02
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 2a6hA01
4JK1A 3HOWK 2VUMK 5TMCA 5M3FK 3K7AC 5IP7C 5IYDC 4A3EC 2JA8K 3EQLA 2WAQL 1Y1WC 4AYBD 1Y1VC 3H0GC 2WB1D 2R7ZK 5C4JK 2NVXK 2JA7C 5FLMK 4XLNA 4QIWL 3I4NC 3HOZC 1YNJA 2NVYK 4Q5SA 3H3VD 1SFOK 3S1QK 4BY1C 3GTJC 3GTPC 3S16K 4Y7NK 2YU9K 2WAQD 4C3HK 3GTJK 1BDFA 3M3YK 3PO2K 2E2IK 1YNNA 2CW0A 5C44C 3GTLC 4KN4A 2JA5C 3PO3C 4Y52C 3RZOK 3CQZK 4YFXA 2JA6C 2O5JA 4QJVA 3HOVC 3S2HC 2JA5K 4BBSK 2R7ZC 3GTQC 3HOVK 4G7OA 2Y0SL 5C4XC 3FKIK 4A3IK 3S2HK 1Y1WK 1ZYRA 3HOUC 1TWFC 1HQMA 3FKIC 2JA8C 3GTMC 5M3MK 1K83K 1R9TK 3GTOK 2NVYC 5M5XK 4A3CK 4A3BK 3H0GK 4LK0A 4BY7K 1SFOC 2BE5A 3S1MK 4A3FC 4LLGA 3PO2C 2PPBA 4Y7NC 5C44K 3PO3K 5C3EK 3RZDK 4BY1K 1I50C 3DXJA 2B63K 2A6HA 4MEXA 4LJZA 4AYBL 5IP9K 2VUMC 4G7HA 1Y1VK 2WB1L 2NVQK 3GTKK 4C3IC 3M4OK 4XLPA 5M5YK 2E2JK 2JA7K 3GTKC 3K7AK 2A68A 1WCMK 3I4MK 1I6VA 4A3MK 2E2HK 3H3VL 3HOYC 5IP7K 5C4JC 4OIPA 2E2HC 1TWAK 4A3JC 1I6HC 4A3KK 5IYBK 3S1NK 5TMFA 4OINA 4BXXC 4MEYA 3S1NC 4A3BC 4A3CC 3HKZL 4X6AC 4A3JK 2NVTK 3S15K 1I6HK 1XPPA 3S17K 4NOIA 4A3GK 1TWCC 4OIQA 1TWHC 4A3FK 3S14K 2PA8D 4C2MK 2B63C 3GTGK 1TWGC 2Y0SD 5C3EC 3RZDC 4A3LK 4ZH4A 5C4XK 2PMZL 5IP9C 4Y52K 4YG2A 3S2DK 2E2IC 2JA6K 3I4NK 2NVQC 4A3IC 1SMYA 4LK1A 1I3QC 1IW7A 4GZYA 1TWFK 3GTLK 3GTQK 5IYCC 3HOXC 3S1RC 3GTMK 4YFKA 4KMUA 4XSXA 1K83C 4BBRC 1R9TC 2YU9C 4C3JC 4A3DC 4BY7C 2R93C 3HOZK 4BBRK 4A3DK 4A93K 3S1QC 4C3JK 2PMZD 4OIOA 5FLMC 3S1MC 4Q4ZA 3GTOC 3S14C 4A93C 4C3HC 4XSZA 3RZOC 2R92C 5IYCK 3M3YC 4G7ZA 3S16C 1TWCK 3GTPK 2R92K 3S17C 4C2MC 3S2DC 2A69A 3CQZC 4BBSC 5FJ8K 3HOUK 2A6EA 4MQ9A 1TWGK 5D4DA 4A3EK 4KN7A 5IYDK 4OIRA 3WODA 3S1RK 3HOWC 4YFNA 3HKZD 1I3QK 2R93K 2NVXC 3HOYK 2NVTC 4QJVB 5IYBC 1WCMC 4BXXK 4A3KC 2PA8L 4A3MC 2O5IA 4A3GC 3GTGC 4X6AK 5M5WK 1TWAC 1TWHK 4A3LC 2E2JC 4QIWD 1I50K 3S15C 3M4OC 3I4MC 3HOXK 4C3IK
chains in the Genus database with same CATH superfamily
4JK1A 5IP7C 5IYDC 4WFAS 1ISEA 2WAQL 2RH6A 1GE9A 2JA7C 4KC6A 4XLNA 1B4BA 3I4NC 2R7ZA 3HOZC 1YNJA 1Y1VA 4XCHA 4O2DA 3GTPC 3S16K 1IE0A 2YU9K 2E2IK 1X31C 2D6FC 2JA5C 1BGWA 1ZQ1C 2EBBA 3SZYA 4BBSK 2JA5K 4QJVA 3S2HC 2R7ZC 3S2HK 2W7VA 2V6UA 3FKIK 1TWFC 1HQMA 1XZPB 4P9SA 5M3MK 2NVYC 1WOSA 1XXBA 2L3UA 2CFAA 3BUEA 1SFOC 1WQHA 4LLGA 2Y3PA 2PPBA 1O2FB 5C44K 3PO3K 3RZDK 4GTLA 3DXJA 4P5AA 5IOTA 3AH5A 2P8TA 5IP9K 3M4OK 5DM7S 3G4CA 4GT9A 4XLPA 5IORA 2A68A 2XCOA 3I4MK 1B4AA 3HOYC 4A3KK 3GTKA 1TWAK 1XXCA 4BXXC 3GEIA 3S1NC 1I6HK 1O2BA 5HL8A 2V6TA 1TWGC 5C3EC 5C4XK 5IOQA 2ZJQS 2FQOA 4GZYA 1TWFK 3GTQK 3GTMA 4LR2A 1WIHA 1I50A 4KMUA 1K83C 2JA6A 4WFBS 3L4JA 4C3HC 4XSZA 1VJEA 3ERED 3M3YC 3S16C 3GTPK 1TWCK 2JH3A 5HQHA 3FKIA 4C2MC 3S2DC 2A69A 4WCES 4GTEA 1KQ4A 3CQZC 5FJ8K 2A6EA 1TWGK 4A3EK 4KN7A 3FHZA 3S1RK 2R93A 4KMAA 3FOEA 3A8JA 3AD8C 2R93K 3HOYK 1F9NA 3L4KA 4GFQA 1WSVA 2PA8L 4DDQA 1USMA 4X6AK 5M5WK 2B63A 4QIWD 1VRQC 3K7AC 4KASA 3SZZA 1ZBSA 3A8IA 1F7UA 3EQLA 1PJ6A 2NVYA 4AYBD 1TWFA 1AB4A 4LOWA 1L0WA 2NVXK 1WSRA 2NVYK 4Q5SA 3CF5S 3H3VD 1WCMA 4Y7NK 4FZBA 1WOOA 3AQPA 3GTJA 3GTQA 2KPUA 1RU0A 5C44C 3PO3C 4P5BA 3RZOK 4KM8A 4YFXA 3HOVC 1EQRA 3HOVK 2Y0SL 1Y1WK 3HOUC 3GTMC 4IO9S 5M5XK 3H0GK 3JSTA 3S1MK 1TWGA 3TFJA 3LAPA 5C3EK 2A6HA 4LJZA 1YX2A 4G7HA 2NVQK 3N3YA 3NUHA 2JA7K 3GTKC 4GTCA 1WCMK 4WF9S 1JQWA 3H3VL 5IP7K 2E2HC 1I6HC 3S1NK 5IYBK 1BJTA 2NVTK 4NOIA 1IQ0A 1XZPA 4OIQA 1IL2A 1VH2A 2B63C 1WORA 2Y0SD 3AQOA 4IOCS 4WJ4A 4A3LK 3FOFA 3LYWA 5IP9C 4YG2A 2ZUEA 2E2IC 2NVQC 1Y1WA 4BKWA 4YFKA 4BBRC 1C0AA 4FM9A 4BBRK 4C3JK 2PMZD 3S1MC 2KXYA 1F7VA 4Q4ZA 3S14C 3CQZA 4IOAS 1K83A 1XZQA 4WFNS 3S17C 3G4AA 4BBSC 2ZUFA 4KDDA 4MQ9A 4GTBA 2ZJPS 4KM9A 5IYDK 3PIPS 2NVXA 3A8KA 4YFNA 2GSUA 1I3QK 2NVTC 4QJVB 4KATA 5IYBC 1WCMC 3AD9C 3AD7C 4WILA 1TWAC 4A3LC 2KWAA 2E2JC 3OPFA 2YU9A 1JOEA 1DCHA 2VUMK 5TMCA 3HOWK 5M3FK 2GAHC 4U67S 2JA8K 1O24A 3H0GC 1UV7A 2WB1D 2R7ZK 5C4JK 4QIWL 1TWAA 3MMLB 3S1QK 1TWCA 4C3HK 5JVGS 4WJ3M 3M3YK 2CW0A 3TTGA 1WQGA 3GTLC 3V4GA 2JA6C 2O5JA 1USOA 3QX3A 4G0UA 2JA5A 3GTQC 4G7OA 2VUMA 3HXAA 2JA8C 4G0WA 1R9TK 3GTOK 1WQFA 2BE5A 4RMFA 4A3FC 3VA7A 3PO2C 2PHCB 4Y7NC 4ILDA 3H0GA 4BY1K 1I50C 4MEXA 5TJ3A 4AYBL 2VUMC 4BLAA 3IPJA 1XZQB 1HI9A 3GTKK 4C3IC 2E2IA 5DM6S 1IBAA 3GSIA 3S0XA 1I6VA 4A3MK 2E2HK 3GDZA 1XXAA 3GTLA 5TMFA 4A3JK 4A3BC 4A3CC 1YCLA 1XPPA 1ZVUA 3S17K 2E2HA 3CAGA 3N0CA 4A3FK 3S14K 4C2MK 3T01A 4Y52K 1WOPA 4ZH4A 2PMZL 1BS2A 3S2DK 1O28A 4KMDA 2ZJRS 2CFAB 4LK1A 5IYCC 3HOXC 1J6VA 3S1RC 5IYCK 4XSXA 3HOXK 2R92A 2R93C 4C3JC 2XCRB 4BY7C 1JVIA 2KQ1A 4OIOA 5FLMC 1INNA 4A93C 1SFOK 2FQTA 1R9TA 5EGEA 1ZXOA 1PJ7A 1J98A 1EFWA 1EI6A 4M1XA 4C45A 2GSOA 4KARA 3TFIA 2V6SA 3WODA 3DLLS 5JVHS 2L5NA 4GTDA 5CJ9A 3GTGA 1PJ5A 3GTPA 4A3KC 4AH6A 3T00A 4A3MC 4A3GC 3LPXA 1O27A 1I50K 4GTAA 2RGRA 3M4OC 4PAAA 3ADAC 4GTFA 1EK8A 4A3EC 1FEUA 1Y1WC 3BP8C 1Y1VC 5FLMK 1DCOA 4KB4A 2XCQA 5EGHA 1G51A 4BY1C 3GTJC 2WAQD 1I3QA 3GTJK 1BDFA 3PO2K 1YNNA 4KN4A 4Y52C 3CQZK 1O26A 1DD5A 1VGXA 5C4XC 4A3IK 1TWHA 3GEHA 1ZYRA 3I4NK 3FKIC 1K83K 4A3CK 4A3BK 4KMHA 4LK0A 4BY7K 4G0VA 1DCPA 5L46A 5IOSA 2B63K 3GIRA 2WB1L 1Y1VK 2ZFZA 5M5YK 2E2JK 3GTOA 3K7AK 5CHPA 3OREA 3N0BA 4KAWX 4OIPA 5C4JC 4A3JC 4KB2A 3BP3A 1IS1A 4OINA 3HKZL 4MEYA 5JFEA 3OEPA 4X6AC 3S15K 1V5VA 4A3GK 2GSNA 1J6XA 1TWCC 1TWHC 2PA8D 3GTGK 2JA7A 1EH1A 3RZDC 3Q3QA 2JA6K 4A3IC 1SMYA 1I3QC 1IW7A 3GTLK 4J3NA 3GTMK 4A3DC 1R9TC 2YU9C 5JVOA 3HOZK 4A3DK 4A93K 3S1QC 4BLBA 1SFOA 3GTOC 3RZOC 2R92C 4G7ZA 3LAJA 2R92K 4PABA 1O2AA 3HOUK 5E68A 5D4DA 4OIRA 3HOWC 1VLOA 5HL7S 3HKZD 2NVXC 3GEEA 2GAGC 4BXXK 4LQYA 1J6WA 2O5IA 3PIOS 1F93A 3GTGC 3T02A 3TFHA 1O25A 1TWHK 2P5MA 3S15C 3I4MC 1O29A 4C3IK
chains in the Genus database with same CATH topology
4JK1A 3HOWK 2VUMK 5TMCA 5M3FK 3K7AC 5IP7C 5IYDC 4A3EC 2JA8K 3EQLA 2WAQL 1Y1WC 4AYBD 1Y1VC 3H0GC 2WB1D 2R7ZK 5C4JK 2NVXK 2JA7C 5FLMK 4XLNA 4QIWL 3I4NC 3HOZC 1YNJA 2NVYK 4Q5SA 3H3VD 1SFOK 3S1QK 4BY1C 3GTJC 3GTPC 3S16K 4Y7NK 2YU9K 2WAQD 4C3HK 3GTJK 1BDFA 3M3YK 3PO2K 2E2IK 1YNNA 2CW0A 5C44C 3GTLC 4KN4A 2JA5C 3PO3C 4Y52C 3RZOK 3CQZK 4YFXA 2JA6C 2O5JA 4QJVA 3HOVC 3S2HC 2JA5K 4BBSK 2R7ZC 3GTQC 3HOVK 4G7OA 2Y0SL 5C4XC 3FKIK 4A3IK 3S2HK 1Y1WK 1ZYRA 3HOUC 1TWFC 1HQMA 3FKIC 2JA8C 3GTMC 5M3MK 1K83K 1R9TK 3GTOK 2NVYC 5M5XK 4A3CK 4A3BK 3H0GK 4LK0A 4BY7K 1SFOC 2BE5A 3S1MK 4A3FC 4LLGA 3PO2C 2PPBA 4Y7NC 5C44K 3PO3K 5C3EK 3RZDK 4BY1K 1I50C 3DXJA 2B63K 2A6HA 4MEXA 4LJZA 4AYBL 5IP9K 2VUMC 4G7HA 1Y1VK 2WB1L 2NVQK 3GTKK 4C3IC 3M4OK 4XLPA 5M5YK 2E2JK 2JA7K 3GTKC 3K7AK 2A68A 1WCMK 3I4MK 1I6VA 4A3MK 2E2HK 3H3VL 3HOYC 5IP7K 5C4JC 4OIPA 2E2HC 1TWAK 4A3JC 1I6HC 4A3KK 5IYBK 3S1NK 5TMFA 4OINA 4BXXC 4MEYA 3S1NC 4A3BC 4A3CC 3HKZL 4X6AC 4A3JK 2NVTK 3S15K 1I6HK 1XPPA 3S17K 4NOIA 4A3GK 1TWCC 4OIQA 1TWHC 4A3FK 3S14K 2PA8D 4C2MK 2B63C 3GTGK 1TWGC 2Y0SD 5C3EC 3RZDC 4A3LK 4ZH4A 5C4XK 2PMZL 5IP9C 4Y52K 4YG2A 3S2DK 2E2IC 2JA6K 3I4NK 2NVQC 4A3IC 1SMYA 4LK1A 1I3QC 1IW7A 4GZYA 1TWFK 3GTLK 3GTQK 5IYCC 3HOXC 3S1RC 3GTMK 4YFKA 4KMUA 4XSXA 1K83C 4BBRC 1R9TC 2YU9C 4C3JC 4A3DC 4BY7C 2R93C 3HOZK 4BBRK 4A3DK 4A93K 3S1QC 4C3JK 2PMZD 4OIOA 5FLMC 3S1MC 4Q4ZA 3GTOC 3S14C 4A93C 4C3HC 4XSZA 3RZOC 2R92C 5IYCK 3M3YC 4G7ZA 3S16C 1TWCK 3GTPK 2R92K 3S17C 4C2MC 3S2DC 2A69A 3CQZC 4BBSC 5FJ8K 3HOUK 2A6EA 4MQ9A 1TWGK 5D4DA 4A3EK 4KN7A 5IYDK 4OIRA 3WODA 3S1RK 3HOWC 4YFNA 3HKZD 1I3QK 2R93K 2NVXC 3HOYK 2NVTC 4QJVB 5IYBC 1WCMC 4BXXK 4A3KC 2PA8L 4A3MC 2O5IA 4A3GC 3GTGC 4X6AK 5M5WK 1TWAC 1TWHK 4A3LC 2E2JC 4QIWD 1I50K 3S15C 3M4OC 3I4MC 3HOXK 4C3IK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JK1 A;  3HOW K;  2VUM K;  5TMC A;  5M3F K;  3K7A C;  5IP7 C;  5IYD C;  4A3E C;  2JA8 K;  3EQL A;  2WAQ L;  1Y1W C;  4AYB D;  1Y1V C;  3H0G C;  2WB1 D;  2R7Z K;  5C4J K;  2NVX K;  2JA7 C;  5FLM K;  4XLN A;  4QIW L;  3I4N C;  3HOZ C;  1YNJ A;  2NVY K;  4Q5S A;  3H3V D;  1SFO K;  3S1Q K;  4BY1 C;  3GTJ C;  3GTP C;  3S16 K;  4Y7N K;  2YU9 K;  2WAQ D;  4C3H K;  3GTJ K;  1BDF A;  3M3Y K;  3PO2 K;  2E2I K;  1YNN A;  2CW0 A;  5C44 C;  3GTL C;  4KN4 A;  2JA5 C;  3PO3 C;  4Y52 C;  3RZO K;  3CQZ K;  4YFX A;  2JA6 C;  2O5J A;  4QJV A;  3HOV C;  3S2H C;  2JA5 K;  4BBS K;  2R7Z C;  3GTQ C;  3HOV K;  4G7O A;  2Y0S L;  5C4X C;  3FKI K;  4A3I K;  3S2H K;  1Y1W K;  1ZYR A;  3HOU C;  1TWF C;  1HQM A;  3FKI C;  2JA8 C;  3GTM C;  5M3M K;  1K83 K;  1R9T K;  3GTO K;  2NVY C;  5M5X K;  4A3C K;  4A3B K;  3H0G K;  4LK0 A;  4BY7 K;  1SFO C;  2BE5 A;  3S1M K;  4A3F C;  4LLG A;  3PO2 C;  2PPB A;  4Y7N C;  5C44 K;  3PO3 K;  5C3E K;  3RZD K;  4BY1 K;  1I50 C;  3DXJ A;  2B63 K;  2A6H A;  4MEX A;  4LJZ A;  4AYB L;  5IP9 K;  2VUM C;  4G7H A;  1Y1V K;  2WB1 L;  2NVQ K;  3GTK K;  4C3I C;  3M4O K;  4XLP A;  5M5Y K;  2E2J K;  2JA7 K;  3GTK C;  3K7A K;  2A68 A;  1WCM K;  3I4M K;  1I6V A;  4A3M K;  2E2H K;  3H3V L;  3HOY C;  5IP7 K;  5C4J C;  4OIP A;  2E2H C;  1TWA K;  4A3J C;  1I6H C;  4A3K K;  5IYB K;  3S1N K;  5TMF A;  4OIN A;  4BXX C;  4MEY A;  3S1N C;  4A3B C;  4A3C C;  3HKZ L;  4X6A C;  4A3J K;  2NVT K;  3S15 K;  1I6H K;  1XPP A;  3S17 K;  4NOI A;  4A3G K;  1TWC C;  4OIQ A;  1TWH C;  4A3F K;  3S14 K;  2PA8 D;  4C2M K;  2B63 C;  3GTG K;  1TWG C;  2Y0S D;  5C3E C;  3RZD C;  4A3L K;  4ZH4 A;  5C4X K;  2PMZ L;  5IP9 C;  4Y52 K;  4YG2 A;  3S2D K;  2E2I C;  2JA6 K;  3I4N K;  2NVQ C;  4A3I C;  1SMY A;  4LK1 A;  1I3Q C;  1IW7 A;  4GZY A;  1TWF K;  3GTL K;  3GTQ K;  5IYC C;  3HOX C;  3S1R C;  3GTM K;  4YFK A;  4KMU A;  4XSX A;  1K83 C;  4BBR C;  1R9T C;  2YU9 C;  4C3J C;  4A3D C;  4BY7 C;  2R93 C;  3HOZ K;  4BBR K;  4A3D K;  4A93 K;  3S1Q C;  4C3J K;  2PMZ D;  4OIO A;  5FLM C;  3S1M C;  4Q4Z A;  3GTO C;  3S14 C;  4A93 C;  4C3H C;  4XSZ A;  3RZO C;  2R92 C;  5IYC K;  3M3Y C;  4G7Z A;  3S16 C;  1TWC K;  3GTP K;  2R92 K;  3S17 C;  4C2M C;  3S2D C;  2A69 A;  3CQZ C;  4BBS C;  5FJ8 K;  3HOU K;  2A6E A;  4MQ9 A;  1TWG K;  5D4D A;  4A3E K;  4KN7 A;  5IYD K;  4OIR A;  3WOD A;  3S1R K;  3HOW C;  4YFN A;  3HKZ D;  1I3Q K;  2R93 K;  2NVX C;  3HOY K;  2NVT C;  4QJV B;  5IYB C;  1WCM C;  4BXX K;  4A3K C;  2PA8 L;  4A3M C;  2O5I A;  4A3G C;  3GTG C;  4X6A K;  5M5W K;  1TWA C;  1TWH K;  4A3L C;  2E2J C;  4QIW D;  1I50 K;  3S15 C;  3M4O C;  3I4M C;  3HOX K;  4C3I K; 
#chains in the Genus database with same CATH topology
 4JK1 A;  5IP7 C;  5IYD C;  4WFA S;  1ISE A;  2WAQ L;  2RH6 A;  1GE9 A;  2JA7 C;  4KC6 A;  4XLN A;  1B4B A;  3I4N C;  2R7Z A;  3HOZ C;  1YNJ A;  1Y1V A;  4XCH A;  4O2D A;  3GTP C;  3S16 K;  1IE0 A;  2YU9 K;  2E2I K;  1X31 C;  2D6F C;  2JA5 C;  1BGW A;  1ZQ1 C;  2EBB A;  3SZY A;  4BBS K;  2JA5 K;  4QJV A;  3S2H C;  2R7Z C;  3S2H K;  2W7V A;  2V6U A;  3FKI K;  1TWF C;  1HQM A;  1XZP B;  4P9S A;  5M3M K;  2NVY C;  1WOS A;  1XXB A;  2L3U A;  2CFA A;  3BUE A;  1SFO C;  1WQH A;  4LLG A;  2Y3P A;  2PPB A;  1O2F B;  5C44 K;  3PO3 K;  3RZD K;  4GTL A;  3DXJ A;  4P5A A;  5IOT A;  3AH5 A;  2P8T A;  5IP9 K;  3M4O K;  5DM7 S;  3G4C A;  4GT9 A;  4XLP A;  5IOR A;  2A68 A;  2XCO A;  3I4M K;  1B4A A;  3HOY C;  4A3K K;  3GTK A;  1TWA K;  1XXC A;  4BXX C;  3GEI A;  3S1N C;  1I6H K;  1O2B A;  5HL8 A;  2V6T A;  1TWG C;  5C3E C;  5C4X K;  5IOQ A;  2ZJQ S;  2FQO A;  4GZY A;  1TWF K;  3GTQ K;  3GTM A;  4LR2 A;  1WIH A;  1I50 A;  4KMU A;  1K83 C;  2JA6 A;  4WFB S;  3L4J A;  4C3H C;  4XSZ A;  1VJE A;  3ERE D;  3M3Y C;  3S16 C;  3GTP K;  1TWC K;  2JH3 A;  5HQH A;  3FKI A;  4C2M C;  3S2D C;  2A69 A;  4WCE S;  4GTE A;  1KQ4 A;  3CQZ C;  5FJ8 K;  2A6E A;  1TWG K;  4A3E K;  4KN7 A;  3FHZ A;  3S1R K;  2R93 A;  4KMA A;  3FOE A;  3A8J A;  3AD8 C;  2R93 K;  3HOY K;  1F9N A;  3L4K A;  4GFQ A;  1WSV A;  2PA8 L;  4DDQ A;  1USM A;  4X6A K;  5M5W K;  2B63 A;  4QIW D;  1VRQ C;  3K7A C;  4KAS A;  3SZZ A;  1ZBS A;  3A8I A;  1F7U A;  3EQL A;  1PJ6 A;  2NVY A;  4AYB D;  1TWF A;  1AB4 A;  4LOW A;  1L0W A;  2NVX K;  1WSR A;  2NVY K;  4Q5S A;  3CF5 S;  3H3V D;  1WCM A;  4Y7N K;  4FZB A;  1WOO A;  3AQP A;  3GTJ A;  3GTQ A;  2KPU A;  1RU0 A;  5C44 C;  3PO3 C;  4P5B A;  3RZO K;  4KM8 A;  4YFX A;  3HOV C;  1EQR A;  3HOV K;  2Y0S L;  1Y1W K;  3HOU C;  3GTM C;  4IO9 S;  5M5X K;  3H0G K;  3JST A;  3S1M K;  1TWG A;  3TFJ A;  3LAP A;  5C3E K;  2A6H A;  4LJZ A;  1YX2 A;  4G7H A;  2NVQ K;  3N3Y A;  3NUH A;  2JA7 K;  3GTK C;  4GTC A;  1WCM K;  4WF9 S;  1JQW A;  3H3V L;  5IP7 K;  2E2H C;  1I6H C;  3S1N K;  5IYB K;  1BJT A;  2NVT K;  4NOI A;  1IQ0 A;  1XZP A;  4OIQ A;  1IL2 A;  1VH2 A;  2B63 C;  1WOR A;  2Y0S D;  3AQO A;  4IOC S;  4WJ4 A;  4A3L K;  3FOF A;  3LYW A;  5IP9 C;  4YG2 A;  2ZUE A;  2E2I C;  2NVQ C;  1Y1W A;  4BKW A;  4YFK A;  4BBR C;  1C0A A;  4FM9 A;  4BBR K;  4C3J K;  2PMZ D;  3S1M C;  2KXY A;  1F7V A;  4Q4Z A;  3S14 C;  3CQZ A;  4IOA S;  1K83 A;  1XZQ A;  4WFN S;  3S17 C;  3G4A A;  4BBS C;  2ZUF A;  4KDD A;  4MQ9 A;  4GTB A;  2ZJP S;  4KM9 A;  5IYD K;  3PIP S;  2NVX A;  3A8K A;  4YFN A;  2GSU A;  1I3Q K;  2NVT C;  4QJV B;  4KAT A;  5IYB C;  1WCM C;  3AD9 C;  3AD7 C;  4WIL A;  1TWA C;  4A3L C;  2KWA A;  2E2J C;  3OPF A;  2YU9 A;  1JOE A;  1DCH A;  2VUM K;  5TMC A;  3HOW K;  5M3F K;  2GAH C;  4U67 S;  2JA8 K;  1O24 A;  3H0G C;  1UV7 A;  2WB1 D;  2R7Z K;  5C4J K;  4QIW L;  1TWA A;  3MML B;  3S1Q K;  1TWC A;  4C3H K;  5JVG S;  4WJ3 M;  3M3Y K;  2CW0 A;  3TTG A;  1WQG A;  3GTL C;  3V4G A;  2JA6 C;  2O5J A;  1USO A;  3QX3 A;  4G0U A;  2JA5 A;  3GTQ C;  4G7O A;  2VUM A;  3HXA A;  2JA8 C;  4G0W A;  1R9T K;  3GTO K;  1WQF A;  2BE5 A;  4RMF A;  4A3F C;  3VA7 A;  3PO2 C;  2PHC B;  4Y7N C;  4ILD A;  3H0G A;  4BY1 K;  1I50 C;  4MEX A;  5TJ3 A;  4AYB L;  2VUM C;  4BLA A;  3IPJ A;  1XZQ B;  1HI9 A;  3GTK K;  4C3I C;  2E2I A;  5DM6 S;  1IBA A;  3GSI A;  3S0X A;  1I6V A;  4A3M K;  2E2H K;  3GDZ A;  1XXA A;  3GTL A;  5TMF A;  4A3J K;  4A3B C;  4A3C C;  1YCL A;  1XPP A;  1ZVU A;  3S17 K;  2E2H A;  3CAG A;  3N0C A;  4A3F K;  3S14 K;  4C2M K;  3T01 A;  4Y52 K;  1WOP A;  4ZH4 A;  2PMZ L;  1BS2 A;  3S2D K;  1O28 A;  4KMD A;  2ZJR S;  2CFA B;  4LK1 A;  5IYC C;  3HOX C;  1J6V A;  3S1R C;  5IYC K;  4XSX A;  3HOX K;  2R92 A;  2R93 C;  4C3J C;  2XCR B;  4BY7 C;  1JVI A;  2KQ1 A;  4OIO A;  5FLM C;  1INN A;  4A93 C;  1SFO K;  2FQT A;  1R9T A;  5EGE A;  1ZXO A;  1PJ7 A;  1J98 A;  1EFW A;  1EI6 A;  4M1X A;  4C45 A;  2GSO A;  4KAR A;  3TFI A;  2V6S A;  3WOD A;  3DLL S;  5JVH S;  2L5N A;  4GTD A;  5CJ9 A;  3GTG A;  1PJ5 A;  3GTP A;  4A3K C;  4AH6 A;  3T00 A;  4A3M C;  4A3G C;  3LPX A;  1O27 A;  1I50 K;  4GTA A;  2RGR A;  3M4O C;  4PAA A;  3ADA C;  4GTF A;  1EK8 A;  4A3E C;  1FEU A;  1Y1W C;  3BP8 C;  1Y1V C;  5FLM K;  1DCO A;  4KB4 A;  2XCQ A;  5EGH A;  1G51 A;  4BY1 C;  3GTJ C;  2WAQ D;  1I3Q A;  3GTJ K;  1BDF A;  3PO2 K;  1YNN A;  4KN4 A;  4Y52 C;  3CQZ K;  1O26 A;  1DD5 A;  1VGX A;  5C4X C;  4A3I K;  1TWH A;  3GEH A;  1ZYR A;  3I4N K;  3FKI C;  1K83 K;  4A3C K;  4A3B K;  4KMH A;  4LK0 A;  4BY7 K;  4G0V A;  1DCP A;  5L46 A;  5IOS A;  2B63 K;  3GIR A;  2WB1 L;  1Y1V K;  2ZFZ A;  5M5Y K;  2E2J K;  3GTO A;  3K7A K;  5CHP A;  3ORE A;  3N0B A;  4KAW X;  4OIP A;  5C4J C;  4A3J C;  4KB2 A;  3BP3 A;  1IS1 A;  4OIN A;  3HKZ L;  4MEY A;  5JFE A;  3OEP A;  4X6A C;  3S15 K;  1V5V A;  4A3G K;  2GSN A;  1J6X A;  1TWC C;  1TWH C;  2PA8 D;  3GTG K;  2JA7 A;  1EH1 A;  3RZD C;  3Q3Q A;  2JA6 K;  4A3I C;  1SMY A;  1I3Q C;  1IW7 A;  3GTL K;  4J3N A;  3GTM K;  4A3D C;  1R9T C;  2YU9 C;  5JVO A;  3HOZ K;  4A3D K;  4A93 K;  3S1Q C;  4BLB A;  1SFO A;  3GTO C;  3RZO C;  2R92 C;  4G7Z A;  3LAJ A;  2R92 K;  4PAB A;  1O2A A;  3HOU K;  5E68 A;  5D4D A;  4OIR A;  3HOW C;  1VLO A;  5HL7 S;  3HKZ D;  2NVX C;  3GEE A;  2GAG C;  4BXX K;  4LQY A;  1J6W A;  2O5I A;  3PIO S;  1F93 A;  3GTG C;  3T02 A;  3TFH A;  1O25 A;  1TWH K;  2P5M A;  3S15 C;  3I4M C;  1O29 A;  4C3I K; 
#chains in the Genus database with same CATH homology
 4JK1 A;  3HOW K;  2VUM K;  5TMC A;  5M3F K;  3K7A C;  5IP7 C;  5IYD C;  4A3E C;  2JA8 K;  3EQL A;  2WAQ L;  1Y1W C;  4AYB D;  1Y1V C;  3H0G C;  2WB1 D;  2R7Z K;  5C4J K;  2NVX K;  2JA7 C;  5FLM K;  4XLN A;  4QIW L;  3I4N C;  3HOZ C;  1YNJ A;  2NVY K;  4Q5S A;  3H3V D;  1SFO K;  3S1Q K;  4BY1 C;  3GTJ C;  3GTP C;  3S16 K;  4Y7N K;  2YU9 K;  2WAQ D;  4C3H K;  3GTJ K;  1BDF A;  3M3Y K;  3PO2 K;  2E2I K;  1YNN A;  2CW0 A;  5C44 C;  3GTL C;  4KN4 A;  2JA5 C;  3PO3 C;  4Y52 C;  3RZO K;  3CQZ K;  4YFX A;  2JA6 C;  2O5J A;  4QJV A;  3HOV C;  3S2H C;  2JA5 K;  4BBS K;  2R7Z C;  3GTQ C;  3HOV K;  4G7O A;  2Y0S L;  5C4X C;  3FKI K;  4A3I K;  3S2H K;  1Y1W K;  1ZYR A;  3HOU C;  1TWF C;  1HQM A;  3FKI C;  2JA8 C;  3GTM C;  5M3M K;  1K83 K;  1R9T K;  3GTO K;  2NVY C;  5M5X K;  4A3C K;  4A3B K;  3H0G K;  4LK0 A;  4BY7 K;  1SFO C;  2BE5 A;  3S1M K;  4A3F C;  4LLG A;  3PO2 C;  2PPB A;  4Y7N C;  5C44 K;  3PO3 K;  5C3E K;  3RZD K;  4BY1 K;  1I50 C;  3DXJ A;  2B63 K;  2A6H A;  4MEX A;  4LJZ A;  4AYB L;  5IP9 K;  2VUM C;  4G7H A;  1Y1V K;  2WB1 L;  2NVQ K;  3GTK K;  4C3I C;  3M4O K;  4XLP A;  5M5Y K;  2E2J K;  2JA7 K;  3GTK C;  3K7A K;  2A68 A;  1WCM K;  3I4M K;  1I6V A;  4A3M K;  2E2H K;  3H3V L;  3HOY C;  5IP7 K;  5C4J C;  4OIP A;  2E2H C;  1TWA K;  4A3J C;  1I6H C;  4A3K K;  5IYB K;  3S1N K;  5TMF A;  4OIN A;  4BXX C;  4MEY A;  3S1N C;  4A3B C;  4A3C C;  3HKZ L;  4X6A C;  4A3J K;  2NVT K;  3S15 K;  1I6H K;  1XPP A;  3S17 K;  4NOI A;  4A3G K;  1TWC C;  4OIQ A;  1TWH C;  4A3F K;  3S14 K;  2PA8 D;  4C2M K;  2B63 C;  3GTG K;  1TWG C;  2Y0S D;  5C3E C;  3RZD C;  4A3L K;  4ZH4 A;  5C4X K;  2PMZ L;  5IP9 C;  4Y52 K;  4YG2 A;  3S2D K;  2E2I C;  2JA6 K;  3I4N K;  2NVQ C;  4A3I C;  1SMY A;  4LK1 A;  1I3Q C;  1IW7 A;  4GZY A;  1TWF K;  3GTL K;  3GTQ K;  5IYC C;  3HOX C;  3S1R C;  3GTM K;  4YFK A;  4KMU A;  4XSX A;  1K83 C;  4BBR C;  1R9T C;  2YU9 C;  4C3J C;  4A3D C;  4BY7 C;  2R93 C;  3HOZ K;  4BBR K;  4A3D K;  4A93 K;  3S1Q C;  4C3J K;  2PMZ D;  4OIO A;  5FLM C;  3S1M C;  4Q4Z A;  3GTO C;  3S14 C;  4A93 C;  4C3H C;  4XSZ A;  3RZO C;  2R92 C;  5IYC K;  3M3Y C;  4G7Z A;  3S16 C;  1TWC K;  3GTP K;  2R92 K;  3S17 C;  4C2M C;  3S2D C;  2A69 A;  3CQZ C;  4BBS C;  5FJ8 K;  3HOU K;  2A6E A;  4MQ9 A;  1TWG K;  5D4D A;  4A3E K;  4KN7 A;  5IYD K;  4OIR A;  3WOD A;  3S1R K;  3HOW C;  4YFN A;  3HKZ D;  1I3Q K;  2R93 K;  2NVX C;  3HOY K;  2NVT C;  4QJV B;  5IYB C;  1WCM C;  4BXX K;  4A3K C;  2PA8 L;  4A3M C;  2O5I A;  4A3G C;  3GTG C;  4X6A K;  5M5W K;  1TWA C;  1TWH K;  4A3L C;  2E2J C;  4QIW D;  1I50 K;  3S15 C;  3M4O C;  3I4M C;  3HOX K;  4C3I K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...