2A6HA

Crystal structure of the t. thermophilus rna polymerase holoenzyme in complex with antibiotic sterptolydigin
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
229
structure length
229
Chain Sequence
MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of transcription inhibition by antibiotic streptolydigin.
pubmed doi rcsb
molecule tags Transferase
molecule keywords DNA-directed RNA polymerase alpha chain
total genus 42
structure length 229
sequence length 229
chains with identical sequence B, K, L
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2005-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01000 RNA_pol_A_bac RNA polymerase Rpb3/RpoA insert domain
A PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain
A PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.12 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 DNA-directed RNA polymerase, insert domain 2a6hA02
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 2a6hA01
3CQZC 5C4XK 4AYBL 2E2HC 4A3LC 3GTMC 3GTPK 5FJ8K 4BY7K 1HQMA 2YU9K 1R9TC 5TMCA 5IP7K 4QJVB 3HOWK 3HOYK 1YNNA 3GTQC 4A3BC 3S2DK 2E2IK 1I3QK 1K83C 3I4MK 3K7AC 4MEYA 4C3JC 1TWHC 1I50C 4XSZA 3S1QK 2Y0SD 3I4NC 3S16K 5IP9C 4MQ9A 4AYBD 3M3YK 4OIQA 2WB1D 4NOIA 3H0GC 4G7ZA 2NVQC 4C3HK 4BBSK 4KN7A 2JA6C 1TWAK 1SFOC 4OINA 4A3MC 4Y52C 2R7ZK 4A3IC 1IW7A 3GTJC 1WCMC 5C44K 3RZOK 4QIWL 4BBRC 4A3CC 1Y1VK 2JA7K 3S14K 3GTKC 3RZDC 3GTLC 3HOUC 2PA8D 4BXXC 4C3IK 4A3EK 3S15K 4A3DK 2JA8K 5IYCC 2B63C 5D4DA 4C2MC 5C3EK 3PO3K 1TWFC 3HOXC 1Y1WC 4Q4ZA 4GZYA 2NVYC 2PPBA 4X6AK 1TWCK 2WAQD 5IYDK 3PO2K 4Y7NC 2E2JK 3S2HK 4A93K 2E2HK 4KN4A 4OIRA 4YG2A 2JA5C 3H3VD 3HOZK 2YU9C 3HOWC 3HOYC 5C4JK 4LJZA 4Q5SA 2R93C 4A3FK 2NVTK 3M4OK 5M5WK 1TWGK 4A3JK 2VUMK 4A3GK 3FKIK 4LLGA 3S1QC 3S17K 2A69A 2O5IA 2PMZD 4XLNA 2WB1L 3HKZD 2R92C 5IYBK 1BDFA 3HOVK 3GTOC 4MEXA 3GTGK 4C3HC 2NVQK 3H3VL 5FLMC 4KMUA 4BY1K 4YFNA 3WODA 2E2IC 5M3FK 2R7ZC 4A3MK 4A3IK 3DXJA 4A3KK 3S1RK 1I50K 3CQZK 3GTPC 1Y1VC 2CW0A 4BY7C 3GTMK 1I6HK 3S15C 3HOUK 4A3DC 4BXXK 3S1MK 2JA8C 5IYCK 2B63K 3GTQK 1SFOK 3S1NK 1K83K 2A6HA 3K7AK 5C3EC 4C2MK 4C3JK 1TWFK 3RZOC 5M3MK 3GTJK 3HOXK 2NVXK 5C4XC 3I4NK 5M5XK 4A3LK 3S16C 2NVYK 3RZDK 3M3YC 1YNJA 3GTLK 5IP7C 1R9TK 3H0GK 2BE5A 2JA6K 5IYDC 3S2DC 4YFKA 4Y7NK 1I3QC 2O5JA 4A3BK 3I4MC 4Y52K 4QJVA 4YFXA 4OIPA 1TWHK 5C44C 4BBRK 4OIOA 4XSXA 4A3CK 3S14C 2Y0SL 5TMFA 4ZH4A 4XLPA 4X6AC 5C4JC 5IP9K 5M5YK 2R93K 4BBSC 3M4OC 1TWAC 4LK1A 3PO2C 1ZYRA 3FKIC 3S17C 2PMZL 3HKZL 4A93C 1WCMK 4LK0A 4JK1A 1Y1WK 2JA7C 4QIWD 3GTGC 4C3IC 3GTOK 3GTKK 2A6EA 4A3EC 1TWCC 4BY1C 1SMYA 1I6VA 4A3FC 2NVTC 2PA8L 4A3JC 2A68A 4A3KC 4A3GC 3S1RC 2E2JC 3PO3C 3S2HC 5IYBC 4G7OA 2R92K 3HOZC 1I6HC 2JA5K 3HOVC 3S1MC 1XPPA 3EQLA 5FLMK 4G7HA 3S1NC 1TWGC 2VUMC 2WAQL 2NVXC
chains in the Genus database with same CATH superfamily
4AYBL 4A3LC 4GTLA 2GSNA 2W7VA 1R9TC 3HOWK 3HOYK 2ZUFA 4PAAA 2JA7A 5JVGS 1RU0A 4C3JC 4XSZA 2WB1D 3H0GC 4C3HK 1TWAK 2JA6C 4A3IC 2PHCB 3DLLS 5C44K 4QIWL 1XZPB 4A3CC 4LQYA 1I3QA 3S14K 3HOUC 3GSIA 4BXXC 4DDQA 5IYCC 1FEUA 2R93A 3CAGA 3LAJA 3PO3K 1TWFC 1XXCA 2NVYC 1UV7A 2E2HK 4KN4A 1G51A 1AB4A 1KQ4A 4KASA 1DD5A 1O27A 2EBBA 3AD8C 2R93C 4KAWX 1O25A 2GAHC 1ISEA 3S1QC 1TWGA 2VUMA 3A8KA 1BDFA 4MEXA 4WFNS 4KMUA 3JSTA 4YFNA 1SFOA 4P5AA 1I50K 1O2BA 2ZJRS 1Y1VC 1I6HK 3S15C 3GTGA 2JA8C 3NUHA 3GTQK 1VH2A 1SFOK 1O24A 2A6HA 4WFAS 3K7AK 5M3MK 3HOXK 3GTJK 4C45A 3SZYA 3MMLB 3I4NK 4A3LK 3S16C 2L3UA 3RZDK 3GTLK 1R9TK 2BE5A 5IYDC 2O5JA 4QJVA 2JH3A 3OREA 3FHZA 4FM9A 3M4OC 1TWAC 3BP3A 2PMZL 4A93C 1TWHA 4LK0A 4J3NA 1Y1WK 3GTOK 3FKIA 4GTBA 1X31C 3PO3C 1WOSA 5IYBC 2JA5K 3EQLA 5FLMK 4G7HA 1F7UA 3G4CA 1TWGC 2VUMC 1DCOA 1J6VA 3GIRA 5IOSA 5C4XK 2E2HC 5IP7K 3S2DK 1I3QK 1K83C 3ADAC 4G0WA 3S1QK 1WQHA 3GEEA 5IP9C 4MQ9A 3M3YK 1TWAA 4NOIA 4G7ZA 1WSVA 2NVYA 4BBSK 2R7ZA 4GTEA 1WQFA 4Y52C 1IW7A 1JOEA 3RZOK 1Y1VK 1YX2A 4C3IK 3S15K 2PA8D 2JA8K 3AD7C 3VA7A 3HOXC 1XXBA 1EFWA 4Q4ZA 1DCHA 3ERED 4X6AK 5IOTA 3BUEA 1WIHA 5IYDK 3PO2K 1BJTA 4KARA 1Y1VA 4PABA 2E2JK 3TTGA 3H3VD 1XZPA 3HOZK 3OEPA 4IOAS 3BP8C 4LJZA 4Q5SA 4A3FK 3M4OK 5M5WK 4A3JK 1BGWA 1O2FB 4WJ3M 2CFAB 4LLGA 3GTKA 2O5IA 1YCLA 2PMZD 3HKZD 2V6UA 3GTOC 1HI9A 4WILA 2E2IC 5M3FK 2FQTA 1WSRA 2R7ZC 4A3MK 3HXAA 2CW0A 1IQ0A 2B63K 2Y3PA 4ILDA 4C2MK 4C3JK 3GTQA 5C4XC 2NVXA 1IL2A 5JVHS 5IP7C 3H0GK 2JA6K 3GTLA 3S2DC 1I3QC 3GEIA 4YFXA 3N3YA 5HL7S 4OIPA 3GTJA 5C44C 4M1XA 4WF9S 4A3CK 3S14C 5IP9K 4ZH4A 1B4BA 2XCQA 5CJ9A 3H0GA 4BBSC 1DCPA 1ZYRA 1J98A 3FKIC 3S17C 1ZVUA 3HKZL 1O26A 4JK1A 4C3IC 2A6EA 3QX3A 2ZUEA 1SMYA 2NVTC 3GTPA 2PA8L 2A68A 4A3GC 3G4AA 4LR2A 1IE0A 3CQZA 2KWAA 2R92K 3HOVC 5DM6S 3S1MC 4KATA 3GTOA 4BLAA 4RMFA 3CQZC 1F9NA 3GTMC 3GTPK 5FJ8K 3N0BA 4BY7K 1HQMA 1JVIA 3LPXA 1YNNA 1BS2A 1I50C 3V4GA 1WOPA 4OIQA 1O29A 5TJ3A 1SFOC 4OINA 4KMDA 4A3MC 2R7ZK 4IO9S 3GTJC 3PIOS 4BBRC 3TFHA 1USMA 3RZDC 3GTLC 4A3EK 2B63C 5D4DA 4C2MC 1EK8A 1VGXA 2ZFZA 3GEHA 2CFAA 1TWCK 2WAQD 2KXYA 3S2HK 4A93K 4GTDA 4YG2A 3TFJA 2YU9C 1C0AA 2GSUA 2P8TA 3FKIK 3S17K 1O28A 2A69A 2L5NA 5IYBK 1ZQ1C 2NVQK 5FLMC 1O2AA 2JA5A 5EGHA 3IPJA 2KPUA 1EI6A 1V5VA 2FQOA 1I50A 4A3DC 3S1MK 4U67S 1K83K 5C3EC 1VJEA 3TFIA 2V6SA 4KMHA 5M5XK 1R9TA 1XZQA 3M3YC 4GT9A 3LAPA 4WJ4A 1IBAA 4YFKA 4KM9A 4Y7NK 1WORA 4KDDA 4Y52K 3A8JA 5DM7S 1WCMA 4OIOA 4XSXA 1XXAA 2Y0SL 4WCES 3L4KA 5C4JC 5M5YK 2GAGC 4LK1A 1TWCA 5EGEA 3LYWA 4FZBA 3AD9C 1J6XA 5HQHA 3GTGC 4A3EC 4BY1C 1EH1A 4GTFA 4A3KC 3S1RC 2E2HA 2E2JC 2ZJQS 1XZQB 5E68A 4G7OA 3HOZC 3AQPA 3S1NC 4KB2A 2WAQL 3T02A 4GTCA 2GSOA 2NVXC 1INNA 3AH5A 4O2DA 2YU9K 5TMCA 2XCOA 4QJVB 3GTQC 4A3BC 2E2IK 3I4MK 3K7AC 4MEYA 5IORA 1TWHC 1IS1A 2Y0SD 3FOFA 3I4NC 2V6TA 3S16K 4AYBD 2D6FC 2NVQC 1WOOA 4KN7A 4WFBS 1F93A 1TWFA 3Q3QA 1L0WA 4LOWA 2P5MA 1WCMC 3T00A 1USOA 2B63A 2JA7K 1VRQC 3GTKC 4A3DK 4KMAA 5C3EK 3L4JA 2JA6A 1Y1WC 4GZYA 4GFQA 1PJ7A 2PPBA 4P9SA 1B4AA 4Y7NC 3T01A 4GTAA 1Y1WA 4OIRA 2JA5C 4P5BA 3GDZA 3HOWC 3HOYC 5C4JK 2NVTK 3GTMA 1TWGK 5L46A 2VUMK 3A8IA 4A3GK 4G0VA 4XLNA 2WB1L 2R92C 1VLOA 3HOVK 3GTGK 4C3HC 3H3VL 2ZJPS 4BY1K 3WODA 2RGRA 2YU9A 4XCHA 1J6WA 4A3IK 3DXJA 3N0CA 4A3KK 2XCRB 1PJ5A 3AQOA 3S1RK 1ZXOA 3CQZK 4BKWA 4G0UA 3GTPC 3GTMK 4BY7C 3OPFA 3HOUK 4BXXK 4KM8A 1K83A 5IYCK 3S1NK 5JVOA 1JQWA 1TWFK 3RZOC 2NVXK 2NVYK 4BLBA 1YNJA 1F7VA 1ZBSA 4A3BK 3I4MC 1TWHK 1EQRA 4BBRK 5TMFA 4XLPA 4X6AC 2R93K 5IOQA 3PO2C 2KQ1A 5CHPA 1GE9A 1WCMK 4AH6A 2RH6A 3FOEA 2JA7C 4QIWD 5HL8A 3GTKK 1TWCC 4A3FC 1I6VA 1WQGA 4A3JC 3CF5S 3PIPS 3S2HC 2E2IA 4KC6A 3SZZA 1I6HC 4KB4A 1XPPA 2R92A 5JFEA 4IOCS 1PJ6A 3S0XA
chains in the Genus database with same CATH topology
3CQZC 5C4XK 4AYBL 2E2HC 4A3LC 3GTMC 3GTPK 5FJ8K 4BY7K 1HQMA 2YU9K 1R9TC 5TMCA 5IP7K 4QJVB 3HOWK 3HOYK 1YNNA 3GTQC 4A3BC 3S2DK 2E2IK 1I3QK 1K83C 3I4MK 3K7AC 4MEYA 4C3JC 1TWHC 1I50C 4XSZA 3S1QK 2Y0SD 3I4NC 3S16K 5IP9C 4MQ9A 4AYBD 3M3YK 4OIQA 2WB1D 4NOIA 3H0GC 4G7ZA 2NVQC 4C3HK 4BBSK 4KN7A 2JA6C 1TWAK 1SFOC 4OINA 4A3MC 4Y52C 2R7ZK 4A3IC 1IW7A 3GTJC 1WCMC 5C44K 3RZOK 4QIWL 4BBRC 4A3CC 1Y1VK 2JA7K 3S14K 3GTKC 3RZDC 3GTLC 3HOUC 2PA8D 4BXXC 4C3IK 4A3EK 3S15K 4A3DK 2JA8K 5IYCC 2B63C 5D4DA 4C2MC 5C3EK 3PO3K 1TWFC 3HOXC 1Y1WC 4Q4ZA 4GZYA 2NVYC 2PPBA 4X6AK 1TWCK 2WAQD 5IYDK 3PO2K 4Y7NC 2E2JK 3S2HK 4A93K 2E2HK 4KN4A 4OIRA 4YG2A 2JA5C 3H3VD 3HOZK 2YU9C 3HOWC 3HOYC 5C4JK 4LJZA 4Q5SA 2R93C 4A3FK 2NVTK 3M4OK 5M5WK 1TWGK 4A3JK 2VUMK 4A3GK 3FKIK 4LLGA 3S1QC 3S17K 2A69A 2O5IA 2PMZD 4XLNA 2WB1L 3HKZD 2R92C 5IYBK 1BDFA 3HOVK 3GTOC 4MEXA 3GTGK 4C3HC 2NVQK 3H3VL 5FLMC 4KMUA 4BY1K 4YFNA 3WODA 2E2IC 5M3FK 2R7ZC 4A3MK 4A3IK 3DXJA 4A3KK 3S1RK 1I50K 3CQZK 3GTPC 1Y1VC 2CW0A 4BY7C 3GTMK 1I6HK 3S15C 3HOUK 4A3DC 4BXXK 3S1MK 2JA8C 5IYCK 2B63K 3GTQK 1SFOK 3S1NK 1K83K 2A6HA 3K7AK 5C3EC 4C2MK 4C3JK 1TWFK 3RZOC 5M3MK 3GTJK 3HOXK 2NVXK 5C4XC 3I4NK 5M5XK 4A3LK 3S16C 2NVYK 3RZDK 3M3YC 1YNJA 3GTLK 5IP7C 1R9TK 3H0GK 2BE5A 2JA6K 5IYDC 3S2DC 4YFKA 4Y7NK 1I3QC 2O5JA 4A3BK 3I4MC 4Y52K 4QJVA 4YFXA 4OIPA 1TWHK 5C44C 4BBRK 4OIOA 4XSXA 4A3CK 3S14C 2Y0SL 5TMFA 4ZH4A 4XLPA 4X6AC 5C4JC 5IP9K 5M5YK 2R93K 4BBSC 3M4OC 1TWAC 4LK1A 3PO2C 1ZYRA 3FKIC 3S17C 2PMZL 3HKZL 4A93C 1WCMK 4LK0A 4JK1A 1Y1WK 2JA7C 4QIWD 3GTGC 4C3IC 3GTOK 3GTKK 2A6EA 4A3EC 1TWCC 4BY1C 1SMYA 1I6VA 4A3FC 2NVTC 2PA8L 4A3JC 2A68A 4A3KC 4A3GC 3S1RC 2E2JC 3PO3C 3S2HC 5IYBC 4G7OA 2R92K 3HOZC 1I6HC 2JA5K 3HOVC 3S1MC 1XPPA 3EQLA 5FLMK 4G7HA 3S1NC 1TWGC 2VUMC 2WAQL 2NVXC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CQZ C;  5C4X K;  4AYB L;  2E2H C;  4A3L C;  3GTM C;  3GTP K;  5FJ8 K;  4BY7 K;  1HQM A;  2YU9 K;  1R9T C;  5TMC A;  5IP7 K;  4QJV B;  3HOW K;  3HOY K;  1YNN A;  3GTQ C;  4A3B C;  3S2D K;  2E2I K;  1I3Q K;  1K83 C;  3I4M K;  3K7A C;  4MEY A;  4C3J C;  1TWH C;  1I50 C;  4XSZ A;  3S1Q K;  2Y0S D;  3I4N C;  3S16 K;  5IP9 C;  4MQ9 A;  4AYB D;  3M3Y K;  4OIQ A;  2WB1 D;  4NOI A;  3H0G C;  4G7Z A;  2NVQ C;  4C3H K;  4BBS K;  4KN7 A;  2JA6 C;  1TWA K;  1SFO C;  4OIN A;  4A3M C;  4Y52 C;  2R7Z K;  4A3I C;  1IW7 A;  3GTJ C;  1WCM C;  5C44 K;  3RZO K;  4QIW L;  4BBR C;  4A3C C;  1Y1V K;  2JA7 K;  3S14 K;  3GTK C;  3RZD C;  3GTL C;  3HOU C;  2PA8 D;  4BXX C;  4C3I K;  4A3E K;  3S15 K;  4A3D K;  2JA8 K;  5IYC C;  2B63 C;  5D4D A;  4C2M C;  5C3E K;  3PO3 K;  1TWF C;  3HOX C;  1Y1W C;  4Q4Z A;  4GZY A;  2NVY C;  2PPB A;  4X6A K;  1TWC K;  2WAQ D;  5IYD K;  3PO2 K;  4Y7N C;  2E2J K;  3S2H K;  4A93 K;  2E2H K;  4KN4 A;  4OIR A;  4YG2 A;  2JA5 C;  3H3V D;  3HOZ K;  2YU9 C;  3HOW C;  3HOY C;  5C4J K;  4LJZ A;  4Q5S A;  2R93 C;  4A3F K;  2NVT K;  3M4O K;  5M5W K;  1TWG K;  4A3J K;  2VUM K;  4A3G K;  3FKI K;  4LLG A;  3S1Q C;  3S17 K;  2A69 A;  2O5I A;  2PMZ D;  4XLN A;  2WB1 L;  3HKZ D;  2R92 C;  5IYB K;  1BDF A;  3HOV K;  3GTO C;  4MEX A;  3GTG K;  4C3H C;  2NVQ K;  3H3V L;  5FLM C;  4KMU A;  4BY1 K;  4YFN A;  3WOD A;  2E2I C;  5M3F K;  2R7Z C;  4A3M K;  4A3I K;  3DXJ A;  4A3K K;  3S1R K;  1I50 K;  3CQZ K;  3GTP C;  1Y1V C;  2CW0 A;  4BY7 C;  3GTM K;  1I6H K;  3S15 C;  3HOU K;  4A3D C;  4BXX K;  3S1M K;  2JA8 C;  5IYC K;  2B63 K;  3GTQ K;  1SFO K;  3S1N K;  1K83 K;  2A6H A;  3K7A K;  5C3E C;  4C2M K;  4C3J K;  1TWF K;  3RZO C;  5M3M K;  3GTJ K;  3HOX K;  2NVX K;  5C4X C;  3I4N K;  5M5X K;  4A3L K;  3S16 C;  2NVY K;  3RZD K;  3M3Y C;  1YNJ A;  3GTL K;  5IP7 C;  1R9T K;  3H0G K;  2BE5 A;  2JA6 K;  5IYD C;  3S2D C;  4YFK A;  4Y7N K;  1I3Q C;  2O5J A;  4A3B K;  3I4M C;  4Y52 K;  4QJV A;  4YFX A;  4OIP A;  1TWH K;  5C44 C;  4BBR K;  4OIO A;  4XSX A;  4A3C K;  3S14 C;  2Y0S L;  5TMF A;  4ZH4 A;  4XLP A;  4X6A C;  5C4J C;  5IP9 K;  5M5Y K;  2R93 K;  4BBS C;  3M4O C;  1TWA C;  4LK1 A;  3PO2 C;  1ZYR A;  3FKI C;  3S17 C;  2PMZ L;  3HKZ L;  4A93 C;  1WCM K;  4LK0 A;  4JK1 A;  1Y1W K;  2JA7 C;  4QIW D;  3GTG C;  4C3I C;  3GTO K;  3GTK K;  2A6E A;  4A3E C;  1TWC C;  4BY1 C;  1SMY A;  1I6V A;  4A3F C;  2NVT C;  2PA8 L;  4A3J C;  2A68 A;  4A3K C;  4A3G C;  3S1R C;  2E2J C;  3PO3 C;  3S2H C;  5IYB C;  4G7O A;  2R92 K;  3HOZ C;  1I6H C;  2JA5 K;  3HOV C;  3S1M C;  1XPP A;  3EQL A;  5FLM K;  4G7H A;  3S1N C;  1TWG C;  2VUM C;  2WAQ L;  2NVX C; 
#chains in the Genus database with same CATH topology
 4AYB L;  4A3L C;  4GTL A;  2GSN A;  2W7V A;  1R9T C;  3HOW K;  3HOY K;  2ZUF A;  4PAA A;  2JA7 A;  5JVG S;  1RU0 A;  4C3J C;  4XSZ A;  2WB1 D;  3H0G C;  4C3H K;  1TWA K;  2JA6 C;  4A3I C;  2PHC B;  3DLL S;  5C44 K;  4QIW L;  1XZP B;  4A3C C;  4LQY A;  1I3Q A;  3S14 K;  3HOU C;  3GSI A;  4BXX C;  4DDQ A;  5IYC C;  1FEU A;  2R93 A;  3CAG A;  3LAJ A;  3PO3 K;  1TWF C;  1XXC A;  2NVY C;  1UV7 A;  2E2H K;  4KN4 A;  1G51 A;  1AB4 A;  1KQ4 A;  4KAS A;  1DD5 A;  1O27 A;  2EBB A;  3AD8 C;  2R93 C;  4KAW X;  1O25 A;  2GAH C;  1ISE A;  3S1Q C;  1TWG A;  2VUM A;  3A8K A;  1BDF A;  4MEX A;  4WFN S;  4KMU A;  3JST A;  4YFN A;  1SFO A;  4P5A A;  1I50 K;  1O2B A;  2ZJR S;  1Y1V C;  1I6H K;  3S15 C;  3GTG A;  2JA8 C;  3NUH A;  3GTQ K;  1VH2 A;  1SFO K;  1O24 A;  2A6H A;  4WFA S;  3K7A K;  5M3M K;  3HOX K;  3GTJ K;  4C45 A;  3SZY A;  3MML B;  3I4N K;  4A3L K;  3S16 C;  2L3U A;  3RZD K;  3GTL K;  1R9T K;  2BE5 A;  5IYD C;  2O5J A;  4QJV A;  2JH3 A;  3ORE A;  3FHZ A;  4FM9 A;  3M4O C;  1TWA C;  3BP3 A;  2PMZ L;  4A93 C;  1TWH A;  4LK0 A;  4J3N A;  1Y1W K;  3GTO K;  3FKI A;  4GTB A;  1X31 C;  3PO3 C;  1WOS A;  5IYB C;  2JA5 K;  3EQL A;  5FLM K;  4G7H A;  1F7U A;  3G4C A;  1TWG C;  2VUM C;  1DCO A;  1J6V A;  3GIR A;  5IOS A;  5C4X K;  2E2H C;  5IP7 K;  3S2D K;  1I3Q K;  1K83 C;  3ADA C;  4G0W A;  3S1Q K;  1WQH A;  3GEE A;  5IP9 C;  4MQ9 A;  3M3Y K;  1TWA A;  4NOI A;  4G7Z A;  1WSV A;  2NVY A;  4BBS K;  2R7Z A;  4GTE A;  1WQF A;  4Y52 C;  1IW7 A;  1JOE A;  3RZO K;  1Y1V K;  1YX2 A;  4C3I K;  3S15 K;  2PA8 D;  2JA8 K;  3AD7 C;  3VA7 A;  3HOX C;  1XXB A;  1EFW A;  4Q4Z A;  1DCH A;  3ERE D;  4X6A K;  5IOT A;  3BUE A;  1WIH A;  5IYD K;  3PO2 K;  1BJT A;  4KAR A;  1Y1V A;  4PAB A;  2E2J K;  3TTG A;  3H3V D;  1XZP A;  3HOZ K;  3OEP A;  4IOA S;  3BP8 C;  4LJZ A;  4Q5S A;  4A3F K;  3M4O K;  5M5W K;  4A3J K;  1BGW A;  1O2F B;  4WJ3 M;  2CFA B;  4LLG A;  3GTK A;  2O5I A;  1YCL A;  2PMZ D;  3HKZ D;  2V6U A;  3GTO C;  1HI9 A;  4WIL A;  2E2I C;  5M3F K;  2FQT A;  1WSR A;  2R7Z C;  4A3M K;  3HXA A;  2CW0 A;  1IQ0 A;  2B63 K;  2Y3P A;  4ILD A;  4C2M K;  4C3J K;  3GTQ A;  5C4X C;  2NVX A;  1IL2 A;  5JVH S;  5IP7 C;  3H0G K;  2JA6 K;  3GTL A;  3S2D C;  1I3Q C;  3GEI A;  4YFX A;  3N3Y A;  5HL7 S;  4OIP A;  3GTJ A;  5C44 C;  4M1X A;  4WF9 S;  4A3C K;  3S14 C;  5IP9 K;  4ZH4 A;  1B4B A;  2XCQ A;  5CJ9 A;  3H0G A;  4BBS C;  1DCP A;  1ZYR A;  1J98 A;  3FKI C;  3S17 C;  1ZVU A;  3HKZ L;  1O26 A;  4JK1 A;  4C3I C;  2A6E A;  3QX3 A;  2ZUE A;  1SMY A;  2NVT C;  3GTP A;  2PA8 L;  2A68 A;  4A3G C;  3G4A A;  4LR2 A;  1IE0 A;  3CQZ A;  2KWA A;  2R92 K;  3HOV C;  5DM6 S;  3S1M C;  4KAT A;  3GTO A;  4BLA A;  4RMF A;  3CQZ C;  1F9N A;  3GTM C;  3GTP K;  5FJ8 K;  3N0B A;  4BY7 K;  1HQM A;  1JVI A;  3LPX A;  1YNN A;  1BS2 A;  1I50 C;  3V4G A;  1WOP A;  4OIQ A;  1O29 A;  5TJ3 A;  1SFO C;  4OIN A;  4KMD A;  4A3M C;  2R7Z K;  4IO9 S;  3GTJ C;  3PIO S;  4BBR C;  3TFH A;  1USM A;  3RZD C;  3GTL C;  4A3E K;  2B63 C;  5D4D A;  4C2M C;  1EK8 A;  1VGX A;  2ZFZ A;  3GEH A;  2CFA A;  1TWC K;  2WAQ D;  2KXY A;  3S2H K;  4A93 K;  4GTD A;  4YG2 A;  3TFJ A;  2YU9 C;  1C0A A;  2GSU A;  2P8T A;  3FKI K;  3S17 K;  1O28 A;  2A69 A;  2L5N A;  5IYB K;  1ZQ1 C;  2NVQ K;  5FLM C;  1O2A A;  2JA5 A;  5EGH A;  3IPJ A;  2KPU A;  1EI6 A;  1V5V A;  2FQO A;  1I50 A;  4A3D C;  3S1M K;  4U67 S;  1K83 K;  5C3E C;  1VJE A;  3TFI A;  2V6S A;  4KMH A;  5M5X K;  1R9T A;  1XZQ A;  3M3Y C;  4GT9 A;  3LAP A;  4WJ4 A;  1IBA A;  4YFK A;  4KM9 A;  4Y7N K;  1WOR A;  4KDD A;  4Y52 K;  3A8J A;  5DM7 S;  1WCM A;  4OIO A;  4XSX A;  1XXA A;  2Y0S L;  4WCE S;  3L4K A;  5C4J C;  5M5Y K;  2GAG C;  4LK1 A;  1TWC A;  5EGE A;  3LYW A;  4FZB A;  3AD9 C;  1J6X A;  5HQH A;  3GTG C;  4A3E C;  4BY1 C;  1EH1 A;  4GTF A;  4A3K C;  3S1R C;  2E2H A;  2E2J C;  2ZJQ S;  1XZQ B;  5E68 A;  4G7O A;  3HOZ C;  3AQP A;  3S1N C;  4KB2 A;  2WAQ L;  3T02 A;  4GTC A;  2GSO A;  2NVX C;  1INN A;  3AH5 A;  4O2D A;  2YU9 K;  5TMC A;  2XCO A;  4QJV B;  3GTQ C;  4A3B C;  2E2I K;  3I4M K;  3K7A C;  4MEY A;  5IOR A;  1TWH C;  1IS1 A;  2Y0S D;  3FOF A;  3I4N C;  2V6T A;  3S16 K;  4AYB D;  2D6F C;  2NVQ C;  1WOO A;  4KN7 A;  4WFB S;  1F93 A;  1TWF A;  3Q3Q A;  1L0W A;  4LOW A;  2P5M A;  1WCM C;  3T00 A;  1USO A;  2B63 A;  2JA7 K;  1VRQ C;  3GTK C;  4A3D K;  4KMA A;  5C3E K;  3L4J A;  2JA6 A;  1Y1W C;  4GZY A;  4GFQ A;  1PJ7 A;  2PPB A;  4P9S A;  1B4A A;  4Y7N C;  3T01 A;  4GTA A;  1Y1W A;  4OIR A;  2JA5 C;  4P5B A;  3GDZ A;  3HOW C;  3HOY C;  5C4J K;  2NVT K;  3GTM A;  1TWG K;  5L46 A;  2VUM K;  3A8I A;  4A3G K;  4G0V A;  4XLN A;  2WB1 L;  2R92 C;  1VLO A;  3HOV K;  3GTG K;  4C3H C;  3H3V L;  2ZJP S;  4BY1 K;  3WOD A;  2RGR A;  2YU9 A;  4XCH A;  1J6W A;  4A3I K;  3DXJ A;  3N0C A;  4A3K K;  2XCR B;  1PJ5 A;  3AQO A;  3S1R K;  1ZXO A;  3CQZ K;  4BKW A;  4G0U A;  3GTP C;  3GTM K;  4BY7 C;  3OPF A;  3HOU K;  4BXX K;  4KM8 A;  1K83 A;  5IYC K;  3S1N K;  5JVO A;  1JQW A;  1TWF K;  3RZO C;  2NVX K;  2NVY K;  4BLB A;  1YNJ A;  1F7V A;  1ZBS A;  4A3B K;  3I4M C;  1TWH K;  1EQR A;  4BBR K;  5TMF A;  4XLP A;  4X6A C;  2R93 K;  5IOQ A;  3PO2 C;  2KQ1 A;  5CHP A;  1GE9 A;  1WCM K;  4AH6 A;  2RH6 A;  3FOE A;  2JA7 C;  4QIW D;  5HL8 A;  3GTK K;  1TWC C;  4A3F C;  1I6V A;  1WQG A;  4A3J C;  3CF5 S;  3PIP S;  3S2H C;  2E2I A;  4KC6 A;  3SZZ A;  1I6H C;  4KB4 A;  1XPP A;  2R92 A;  5JFE A;  4IOC S;  1PJ6 A;  3S0X A; 
#chains in the Genus database with same CATH homology
 3CQZ C;  5C4X K;  4AYB L;  2E2H C;  4A3L C;  3GTM C;  3GTP K;  5FJ8 K;  4BY7 K;  1HQM A;  2YU9 K;  1R9T C;  5TMC A;  5IP7 K;  4QJV B;  3HOW K;  3HOY K;  1YNN A;  3GTQ C;  4A3B C;  3S2D K;  2E2I K;  1I3Q K;  1K83 C;  3I4M K;  3K7A C;  4MEY A;  4C3J C;  1TWH C;  1I50 C;  4XSZ A;  3S1Q K;  2Y0S D;  3I4N C;  3S16 K;  5IP9 C;  4MQ9 A;  4AYB D;  3M3Y K;  4OIQ A;  2WB1 D;  4NOI A;  3H0G C;  4G7Z A;  2NVQ C;  4C3H K;  4BBS K;  4KN7 A;  2JA6 C;  1TWA K;  1SFO C;  4OIN A;  4A3M C;  4Y52 C;  2R7Z K;  4A3I C;  1IW7 A;  3GTJ C;  1WCM C;  5C44 K;  3RZO K;  4QIW L;  4BBR C;  4A3C C;  1Y1V K;  2JA7 K;  3S14 K;  3GTK C;  3RZD C;  3GTL C;  3HOU C;  2PA8 D;  4BXX C;  4C3I K;  4A3E K;  3S15 K;  4A3D K;  2JA8 K;  5IYC C;  2B63 C;  5D4D A;  4C2M C;  5C3E K;  3PO3 K;  1TWF C;  3HOX C;  1Y1W C;  4Q4Z A;  4GZY A;  2NVY C;  2PPB A;  4X6A K;  1TWC K;  2WAQ D;  5IYD K;  3PO2 K;  4Y7N C;  2E2J K;  3S2H K;  4A93 K;  2E2H K;  4KN4 A;  4OIR A;  4YG2 A;  2JA5 C;  3H3V D;  3HOZ K;  2YU9 C;  3HOW C;  3HOY C;  5C4J K;  4LJZ A;  4Q5S A;  2R93 C;  4A3F K;  2NVT K;  3M4O K;  5M5W K;  1TWG K;  4A3J K;  2VUM K;  4A3G K;  3FKI K;  4LLG A;  3S1Q C;  3S17 K;  2A69 A;  2O5I A;  2PMZ D;  4XLN A;  2WB1 L;  3HKZ D;  2R92 C;  5IYB K;  1BDF A;  3HOV K;  3GTO C;  4MEX A;  3GTG K;  4C3H C;  2NVQ K;  3H3V L;  5FLM C;  4KMU A;  4BY1 K;  4YFN A;  3WOD A;  2E2I C;  5M3F K;  2R7Z C;  4A3M K;  4A3I K;  3DXJ A;  4A3K K;  3S1R K;  1I50 K;  3CQZ K;  3GTP C;  1Y1V C;  2CW0 A;  4BY7 C;  3GTM K;  1I6H K;  3S15 C;  3HOU K;  4A3D C;  4BXX K;  3S1M K;  2JA8 C;  5IYC K;  2B63 K;  3GTQ K;  1SFO K;  3S1N K;  1K83 K;  2A6H A;  3K7A K;  5C3E C;  4C2M K;  4C3J K;  1TWF K;  3RZO C;  5M3M K;  3GTJ K;  3HOX K;  2NVX K;  5C4X C;  3I4N K;  5M5X K;  4A3L K;  3S16 C;  2NVY K;  3RZD K;  3M3Y C;  1YNJ A;  3GTL K;  5IP7 C;  1R9T K;  3H0G K;  2BE5 A;  2JA6 K;  5IYD C;  3S2D C;  4YFK A;  4Y7N K;  1I3Q C;  2O5J A;  4A3B K;  3I4M C;  4Y52 K;  4QJV A;  4YFX A;  4OIP A;  1TWH K;  5C44 C;  4BBR K;  4OIO A;  4XSX A;  4A3C K;  3S14 C;  2Y0S L;  5TMF A;  4ZH4 A;  4XLP A;  4X6A C;  5C4J C;  5IP9 K;  5M5Y K;  2R93 K;  4BBS C;  3M4O C;  1TWA C;  4LK1 A;  3PO2 C;  1ZYR A;  3FKI C;  3S17 C;  2PMZ L;  3HKZ L;  4A93 C;  1WCM K;  4LK0 A;  4JK1 A;  1Y1W K;  2JA7 C;  4QIW D;  3GTG C;  4C3I C;  3GTO K;  3GTK K;  2A6E A;  4A3E C;  1TWC C;  4BY1 C;  1SMY A;  1I6V A;  4A3F C;  2NVT C;  2PA8 L;  4A3J C;  2A68 A;  4A3K C;  4A3G C;  3S1R C;  2E2J C;  3PO3 C;  3S2H C;  5IYB C;  4G7O A;  2R92 K;  3HOZ C;  1I6H C;  2JA5 K;  3HOV C;  3S1M C;  1XPP A;  3EQL A;  5FLM K;  4G7H A;  3S1N C;  1TWG C;  2VUM C;  2WAQ L;  2NVX C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...