2A6HA

Crystal structure of the t. thermophilus rna polymerase holoenzyme in complex with antibiotic sterptolydigin
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
229
structure length
229
Chain Sequence
MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords DNA-directed RNA polymerase alpha chain
publication title Structural basis of transcription inhibition by antibiotic streptolydigin.
pubmed doi rcsb
total genus 42
structure length 229
sequence length 229
chains with identical sequence B, K, L
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2005-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01000 RNA_pol_A_bac RNA polymerase Rpb3/RpoA insert domain
A PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain
A PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.12 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 DNA-directed RNA polymerase, insert domain 2a6hA02
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 2a6hA01
3RZDC 1I3QC 2PA8L 3S14C 1I6HC 1K83C 2NVQC 3PO2K 3H0GK 3I4MC 4GZYA 3HOUK 1HQMA 5IP7C 3S1QK 4BY1C 3S15K 5TMFA 4Y7NC 2O5IA 4LK1A 3S1RC 4A3KK 3GTGK 2NVYK 4A93K 4BY7C 4Q5SA 2PMZL 1TWGK 3M3YC 1I50K 1IW7A 4C2MK 4XSXA 4QJVB 4A3JK 3HOVK 2JA7K 5FLMK 3RZDK 2E2JK 1YNJA 4BBSC 3GTJK 4A3MC 5FJ8K 4QJVA 3GTQC 5IYBC 1K83K 3S16K 1I6HK 3I4MK 1YNNA 4A3LC 2R92K 4XLPA 5IP7K 2VUMC 2PA8D 3CQZC 5C3EC 4YFKA 2B63K 4BY1K 4BXXC 2R7ZC 4Y7NK 4JK1A 3RZOC 2E2HK 3S2HK 2NVTK 2Y0SL 4BY7K 5IYCC 5D4DA 1TWFK 3S1MC 2JA6K 4C3HC 4YG2A 3FKIC 4AYBD 2R93C 5M5WK 2WAQL 3HOZK 4MQ9A 3M3YK 2E2IC 4BBRC 3S17C 3S2DC 4BBSK 4X6AK 4LJZA 2PMZD 4A3MK 4ZH4A 5IYBK 1TWCK 3HOXK 1SFOC 3GTPK 3I4NC 3PO3K 4A3GC 1SMYA 5C4JC 3GTKC 5C4XK 5M5XK 4YFXA 4YFNA 2VUMK 4A3FC 3CQZK 3S1NK 3HKZL 4A3DC 1I3QK 3WODA 2YU9C 4KN7A 2R7ZK 4OIRA 3RZOK 3S14K 5IYCK 2A6EA 2NVQK 4OINA 3S1MK 1Y1WC 2R93K 3FKIK 3EQLA 5IP9C 1TWAC 4Y52K 2E2IK 3S17K 3S2DK 4KMUA 5TMCA 3HOYC 3GTOC 2WB1L 3S1RK 3S16C 4C3IC 4A3EC 4G7HA 1Y1VC 3GTLC 5M3FK 1WCMC 3I4NK 5C4JK 2O5JA 1XPPA 1BDFA 2A6HA 3H0GC 4A3DK 4OIPA 2NVXC 3HOUC 3H3VL 3HOWC 4G7OA 3GTQK 4LLGA 5C44C 4KN4A 3S1QC 4A3LK 4A3KC 3HKZD 2BE5A 3GTGC 2CW0A 2NVYC 3K7AC 4A3IC 2JA5C 2JA8C 4A93C 4QIWL 5C3EK 4BXXK 1I50C 2PPBA 3GTOK 4A3JC 4G7ZA 3HOVC 3M4OC 1ZYRA 1Y1VK 5FLMC 4C3IK 1WCMK 2E2JC 4A3EK 3GTLK 4C3HK 3GTJC 4C3JC 4LK0A 4OIQA 5IYDC 3GTMC 4XSZA 2WB1D 4MEYA 3DXJA 1TWHC 4BBRK 2NVXK 2Y0SD 4XLNA 2R92C 4A3BC 3HOWK 4Y52C 4A3CC 1R9TC 4AYBL 5C44K 2B63C 1SFOK 2WAQD 4Q4ZA 4A3GK 3GTKK 4NOIA 3S2HC 2E2HC 4OIOA 2NVTC 4A3IK 3K7AK 2JA5K 1TWFC 4A3FK 2JA6C 3H3VD 3PO2C 2JA8K 2YU9K 1I6VA 3HOZC 3M4OK 4MEXA 1Y1WK 4QIWD 3S15C 4X6AC 4C3JK 5M5YK 5IP9K 5IYDK 3PO3C 1TWAK 1TWCC 3HOXC 2A69A 3GTPC 3GTMK 2A68A 1TWHK 5M3MK 1TWGC 5C4XC 3HOYK 4C2MC 4A3BK 4A3CK 1R9TK 2JA7C 3S1NC
chains in the Genus database with same CATH superfamily
2RGRA 3TFHA 1K83C 2V6SA 5HL7S 1Y1WA 1HQMA 3OPFA 3GEIA 1EQRA 2O5IA 3S1RC 3GTGK 2NVYK 2D6FC 4BY7C 4KARA 3M3YC 1I50K 4XSXA 2JA7K 4BKWA 2ZUEA 2GSUA 1I6HK 4QJVA 5IYBC 2XCOA 1SFOA 1WOPA 4A3LC 4XLPA 3HXAA 1WQGA 1O26A 1XXCA 1XZPA 4KASA 5C3EC 3CF5S 4YFKA 4Y7NK 1YX2A 2NVTK 3SZYA 3IPJA 4C3HC 3OREA 4YG2A 3FKIC 4AYBD 2R93C 5M5WK 3HOZK 3G4CA 2E2IC 4BBSK 4P9SA 4LJZA 2R92A 3GTPK 3I4NC 1R9TA 2B63A 3BP3A 3GTKC 5C4XK 3G4AA 1DCPA 1WOOA 3CQZK 3S1NK 1O2FB 1O28A 3HKZL 3WODA 2YU9C 3H0GA 4OIRA 3S14K 2A6EA 2NVQK 4OINA 3S1MK 3A8JA 3LPXA 5IP9C 3BUEA 2KXYA 1TWGA 3S0XA 2O5JA 3FOFA 1K83A 2A6HA 3AD8C 3H3VL 4LLGA 3S1QC 4A3KC 2BE5A 4KB2A 3GEEA 1TWFA 1F7VA 2L3UA 3N3YA 4A3EK 5FLMC 3AD9C 3GTJC 4XSZA 3CAGA 1TWCA 1TWHC 3NUHA 4XLNA 4GTCA 1SFOK 1I3QA 3S2HC 2E2HC 3K7AK 4A3FK 2JA6C 1I6VA 1VJEA 2R93A 3FKIA 2E2IA 4GTBA 4C3JK 4DDQA 1R9TK 3RZDC 1EFWA 3N0BA 3PO2K 3GTQA 1XZQA 3H0GK 3LAJA 1O27A 2RH6A 3V4GA 2XCQA 4BY1C 3S15K 5TMFA 4KATA 4A93K 1WQHA 1TWGK 1XXAA 1J6XA 4C2MK 1F7UA 4A3JK 1JVIA 1YNJA 2P8TA 1INNA 4KB4A 4A3MC 5FJ8K 1K83K 1JOEA 1USMA 2FQOA 1YNNA 5HL8A 2VUMC 2V6UA 2PA8D 4BXXC 1IBAA 5E68A 2R7ZC 4JK1A 3RZOC 4BY7K 5IYCC 1TWFK 3M3YK 2WAQL 1VH2A 4MQ9A 3GTJA 2FQTA 1TWAA 4BBRC 3S17C 3S2DC 1L0WA 4WJ3M 2L5NA 1TWHA 3GEHA 2PMZD 4J3NA 4ZH4A 5IYBK 1TWCK 3PO3K 5L46A 5C4JC 5M5XK 1O25A 1PJ5A 5JVHS 1WQFA 1I3QK 1F9NA 4WFNS 2R93K 3FKIK 4KMHA 3ADAC 4FM9A 2E2IK 3SZZA 3S16C 4G7HA 1Y1VC 3I4NK 1WCMC 4IOAS 1FEUA 4AH6A 1XPPA 4KM9A 5JVOA 4WFAS 2NVXC 2P5MA 3HOWC 3GTQK 3AD7C 5C44C 4KN4A 1O29A 3GTGC 2NVYC 4WFBS 4A3IC 2JA5C 2JA8C 3N0CA 3T02A 5IOTA 1I50C 4G7ZA 3M4OC 1ZYRA 3TTGA 4P5BA 4GTAA 1VRQC 5IYDC 3GTMC 2GSNA 2WB1D 4WCES 3DXJA 3AQPA 1GE9A 4A3BC 4A3CC 3VA7A 4KMDA 2VUMA 2WAQD 4A3GK 1AB4A 4WILA 2R7ZA 4OIOA 2NVTC 3AH5A 1IQ0A 2PHCB 1ISEA 3HOZC 2GAGC 2ZJQS 1Y1WK 5M5YK 1TWAK 1XZPB 2A69A 3GTPC 4LR2A 1B4AA 1RU0A 1TWHK 5CHPA 5M3MK 5C4XC 2KPUA 2CFAA 3HOYK 1J6WA 3S1NC 1ZXOA 4IOCS 1VGXA 2PA8L 3S14C 3GIRA 2NVQC 3I4MC 4GZYA 3A8KA 3HOUK 5IP7C 5CJ9A 1O24A 4Q5SA 2PMZL 1Y1VA 1WCMA 3LAPA 3HOVK 1G51A 3RZDK 2E2JK 4BLBA 2NVXA 4WJ4A 4IO9S 3GTKA 2R92K 1ZVUA 1JQWA 2NVYA 2B63K 2JA5A 4GTDA 4BY1K 2YU9A 3TFIA 3GTMA 5JFEA 3TFJA 4X6AK 1DD5A 1HI9A 4A3MK 4O2DA 3HOXK 1SFOC 5HQHA 4WF9S 4RMFA 1SMYA 2XCRB 3BP8C 1J98A 2VUMK 3LYWA 4A3FC 4A3DC 2KQ1A 2R7ZK 3RZOK 5IYCK 4GTEA 3EQLA 3FOEA 1C0AA 4U67S 3PIOS 5TJ3A 1WOSA 3JSTA 3S17K 3GTPA 3S2DK 5TMCA 3GTOC 2WB1L 3S1RK 3MMLB 4C3IC 4LOWA 1IL2A 3GTLC 5M3FK 1PJ6A 5C4JK 1PJ7A 5DM6S 1EH1A 3DLLS 1BDFA 3H0GC 1O2BA 2ZUFA 4OIPA 3T01A 4G7OA 2GAHC 5EGHA 4A3LK 3AQOA 5IOSA 4A93C 2CW0A 2E2HA 5C3EK 4GTLA 2JA6A 4KDDA 2PPBA 1J6VA 4A3JC 3S16K 1Y1VK 3GDZA 1WCMK 1XZQB 4C3HK 1ZBSA 1EK8A 4KMAA 2NVXK 4XCHA 3HOWK 4Y52C 5C44K 1IE0A 3GTKK 2JA8K 4A3IK 2JA5K 1TWFC 3FHZA 2YU9K 4KAWX 1WSVA 4KM8A 4G0WA 3M4OK 4QIWD 5IP9K 5IYDK 3PO3C 3T00A 1TWCC 3GTMK 2A68A 1F93A 1WIHA 4A3BK 4A3CK 2JA7C 1I3QC 2W7VA 4GFQA 5IORA 1I6HC 1EI6A 3GSIA 1UV7A 1BGWA 3Q3QA 1ZQ1C 1O2AA 3S1QK 3ERED 4P5AA 4Y7NC 4A3KK 4LK1A 3GTOA 3GTLA 1IW7A 4QJVB 5FLMK 4FZBA 4BBSC 4KC6A 3GTJK 3GTQC 2JH3A 3I4MK 4PAAA 2ZFZA 1X31C 5IP7K 3CQZC 1USOA 4G0UA 3S2HK 2E2HK 2Y0SL 5D4DA 2JA6K 3S1MC 4GTFA 4G0VA 5JVGS 1XXBA 4A3GC 1BS2A 2EBBA 4YFXA 4YFNA 2ZJPS 1YCLA 4KN7A 5EGEA 4C45A 1VLOA 1Y1WC 1V5VA 1TWAC 4ILDA 3GTGA 4KMUA 3HOYC 3OEPA 4A3EC 1I50A 2ZJRS 2JA7A 4GT9A 2GSOA 4A3DK 3HOUC 5DM7S 2Y3PA 4LQYA 1B4BA 3QX3A 2CFAB 3HKZD 3A8IA 2KWAA 4QIWL 3K7AC 1BJTA 4BXXK 3L4KA 3L4JA 3GTOK 3HOVC 4C3IK 4BLAA 3GTLK 2V6TA 2E2JC 4C3JC 1IS1A 4LK0A 4OIQA 4M1XA 4PABA 4MEYA 4BBRK 3PIPS 2Y0SD 1WORA 1WSRA 1KQ4A 2R92C 1R9TC 4AYBL 2B63C 4Q4ZA 3CQZA 4NOIA 3H3VD 3PO2C 1DCHA 4MEXA 4X6AC 3S15C 1DCOA 3HOXC 1TWGC 4C2MC 4Y52K 5IOQA
chains in the Genus database with same CATH topology
3RZDC 1I3QC 2PA8L 3S14C 1I6HC 1K83C 2NVQC 3PO2K 3H0GK 3I4MC 4GZYA 3HOUK 1HQMA 5IP7C 3S1QK 4BY1C 3S15K 5TMFA 4Y7NC 2O5IA 4LK1A 3S1RC 4A3KK 3GTGK 2NVYK 4A93K 4BY7C 4Q5SA 2PMZL 1TWGK 3M3YC 1I50K 1IW7A 4C2MK 4XSXA 4QJVB 4A3JK 3HOVK 2JA7K 5FLMK 3RZDK 2E2JK 1YNJA 4BBSC 3GTJK 4A3MC 5FJ8K 4QJVA 3GTQC 5IYBC 1K83K 3S16K 1I6HK 3I4MK 1YNNA 4A3LC 2R92K 4XLPA 5IP7K 2VUMC 2PA8D 3CQZC 5C3EC 4YFKA 2B63K 4BY1K 4BXXC 2R7ZC 4Y7NK 4JK1A 3RZOC 2E2HK 3S2HK 2NVTK 2Y0SL 4BY7K 5IYCC 5D4DA 1TWFK 3S1MC 2JA6K 4C3HC 4YG2A 3FKIC 4AYBD 2R93C 5M5WK 2WAQL 3HOZK 4MQ9A 3M3YK 2E2IC 4BBRC 3S17C 3S2DC 4BBSK 4X6AK 4LJZA 2PMZD 4A3MK 4ZH4A 5IYBK 1TWCK 3HOXK 1SFOC 3GTPK 3I4NC 3PO3K 4A3GC 1SMYA 5C4JC 3GTKC 5C4XK 5M5XK 4YFXA 4YFNA 2VUMK 4A3FC 3CQZK 3S1NK 3HKZL 4A3DC 1I3QK 3WODA 2YU9C 4KN7A 2R7ZK 4OIRA 3RZOK 3S14K 5IYCK 2A6EA 2NVQK 4OINA 3S1MK 1Y1WC 2R93K 3FKIK 3EQLA 5IP9C 1TWAC 4Y52K 2E2IK 3S17K 3S2DK 4KMUA 5TMCA 3HOYC 3GTOC 2WB1L 3S1RK 3S16C 4C3IC 4A3EC 4G7HA 1Y1VC 3GTLC 5M3FK 1WCMC 3I4NK 5C4JK 2O5JA 1XPPA 1BDFA 2A6HA 3H0GC 4A3DK 4OIPA 2NVXC 3HOUC 3H3VL 3HOWC 4G7OA 3GTQK 4LLGA 5C44C 4KN4A 3S1QC 4A3LK 4A3KC 3HKZD 2BE5A 3GTGC 2CW0A 2NVYC 3K7AC 4A3IC 2JA5C 2JA8C 4A93C 4QIWL 5C3EK 4BXXK 1I50C 2PPBA 3GTOK 4A3JC 4G7ZA 3HOVC 3M4OC 1ZYRA 1Y1VK 5FLMC 4C3IK 1WCMK 2E2JC 4A3EK 3GTLK 4C3HK 3GTJC 4C3JC 4LK0A 4OIQA 5IYDC 3GTMC 4XSZA 2WB1D 4MEYA 3DXJA 1TWHC 4BBRK 2NVXK 2Y0SD 4XLNA 2R92C 4A3BC 3HOWK 4Y52C 4A3CC 1R9TC 4AYBL 5C44K 2B63C 1SFOK 2WAQD 4Q4ZA 4A3GK 3GTKK 4NOIA 3S2HC 2E2HC 4OIOA 2NVTC 4A3IK 3K7AK 2JA5K 1TWFC 4A3FK 2JA6C 3H3VD 3PO2C 2JA8K 2YU9K 1I6VA 3HOZC 3M4OK 4MEXA 1Y1WK 4QIWD 3S15C 4X6AC 4C3JK 5M5YK 5IP9K 5IYDK 3PO3C 1TWAK 1TWCC 3HOXC 2A69A 3GTPC 3GTMK 2A68A 1TWHK 5M3MK 1TWGC 5C4XC 3HOYK 4C2MC 4A3BK 4A3CK 1R9TK 2JA7C 3S1NC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RZD C;  1I3Q C;  2PA8 L;  3S14 C;  1I6H C;  1K83 C;  2NVQ C;  3PO2 K;  3H0G K;  3I4M C;  4GZY A;  3HOU K;  1HQM A;  5IP7 C;  3S1Q K;  4BY1 C;  3S15 K;  5TMF A;  4Y7N C;  2O5I A;  4LK1 A;  3S1R C;  4A3K K;  3GTG K;  2NVY K;  4A93 K;  4BY7 C;  4Q5S A;  2PMZ L;  1TWG K;  3M3Y C;  1I50 K;  1IW7 A;  4C2M K;  4XSX A;  4QJV B;  4A3J K;  3HOV K;  2JA7 K;  5FLM K;  3RZD K;  2E2J K;  1YNJ A;  4BBS C;  3GTJ K;  4A3M C;  5FJ8 K;  4QJV A;  3GTQ C;  5IYB C;  1K83 K;  3S16 K;  1I6H K;  3I4M K;  1YNN A;  4A3L C;  2R92 K;  4XLP A;  5IP7 K;  2VUM C;  2PA8 D;  3CQZ C;  5C3E C;  4YFK A;  2B63 K;  4BY1 K;  4BXX C;  2R7Z C;  4Y7N K;  4JK1 A;  3RZO C;  2E2H K;  3S2H K;  2NVT K;  2Y0S L;  4BY7 K;  5IYC C;  5D4D A;  1TWF K;  3S1M C;  2JA6 K;  4C3H C;  4YG2 A;  3FKI C;  4AYB D;  2R93 C;  5M5W K;  2WAQ L;  3HOZ K;  4MQ9 A;  3M3Y K;  2E2I C;  4BBR C;  3S17 C;  3S2D C;  4BBS K;  4X6A K;  4LJZ A;  2PMZ D;  4A3M K;  4ZH4 A;  5IYB K;  1TWC K;  3HOX K;  1SFO C;  3GTP K;  3I4N C;  3PO3 K;  4A3G C;  1SMY A;  5C4J C;  3GTK C;  5C4X K;  5M5X K;  4YFX A;  4YFN A;  2VUM K;  4A3F C;  3CQZ K;  3S1N K;  3HKZ L;  4A3D C;  1I3Q K;  3WOD A;  2YU9 C;  4KN7 A;  2R7Z K;  4OIR A;  3RZO K;  3S14 K;  5IYC K;  2A6E A;  2NVQ K;  4OIN A;  3S1M K;  1Y1W C;  2R93 K;  3FKI K;  3EQL A;  5IP9 C;  1TWA C;  4Y52 K;  2E2I K;  3S17 K;  3S2D K;  4KMU A;  5TMC A;  3HOY C;  3GTO C;  2WB1 L;  3S1R K;  3S16 C;  4C3I C;  4A3E C;  4G7H A;  1Y1V C;  3GTL C;  5M3F K;  1WCM C;  3I4N K;  5C4J K;  2O5J A;  1XPP A;  1BDF A;  2A6H A;  3H0G C;  4A3D K;  4OIP A;  2NVX C;  3HOU C;  3H3V L;  3HOW C;  4G7O A;  3GTQ K;  4LLG A;  5C44 C;  4KN4 A;  3S1Q C;  4A3L K;  4A3K C;  3HKZ D;  2BE5 A;  3GTG C;  2CW0 A;  2NVY C;  3K7A C;  4A3I C;  2JA5 C;  2JA8 C;  4A93 C;  4QIW L;  5C3E K;  4BXX K;  1I50 C;  2PPB A;  3GTO K;  4A3J C;  4G7Z A;  3HOV C;  3M4O C;  1ZYR A;  1Y1V K;  5FLM C;  4C3I K;  1WCM K;  2E2J C;  4A3E K;  3GTL K;  4C3H K;  3GTJ C;  4C3J C;  4LK0 A;  4OIQ A;  5IYD C;  3GTM C;  4XSZ A;  2WB1 D;  4MEY A;  3DXJ A;  1TWH C;  4BBR K;  2NVX K;  2Y0S D;  4XLN A;  2R92 C;  4A3B C;  3HOW K;  4Y52 C;  4A3C C;  1R9T C;  4AYB L;  5C44 K;  2B63 C;  1SFO K;  2WAQ D;  4Q4Z A;  4A3G K;  3GTK K;  4NOI A;  3S2H C;  2E2H C;  4OIO A;  2NVT C;  4A3I K;  3K7A K;  2JA5 K;  1TWF C;  4A3F K;  2JA6 C;  3H3V D;  3PO2 C;  2JA8 K;  2YU9 K;  1I6V A;  3HOZ C;  3M4O K;  4MEX A;  1Y1W K;  4QIW D;  3S15 C;  4X6A C;  4C3J K;  5M5Y K;  5IP9 K;  5IYD K;  3PO3 C;  1TWA K;  1TWC C;  3HOX C;  2A69 A;  3GTP C;  3GTM K;  2A68 A;  1TWH K;  5M3M K;  1TWG C;  5C4X C;  3HOY K;  4C2M C;  4A3B K;  4A3C K;  1R9T K;  2JA7 C;  3S1N C; 
#chains in the Genus database with same CATH topology
 2RGR A;  3TFH A;  1K83 C;  2V6S A;  5HL7 S;  1Y1W A;  1HQM A;  3OPF A;  3GEI A;  1EQR A;  2O5I A;  3S1R C;  3GTG K;  2NVY K;  2D6F C;  4BY7 C;  4KAR A;  3M3Y C;  1I50 K;  4XSX A;  2JA7 K;  4BKW A;  2ZUE A;  2GSU A;  1I6H K;  4QJV A;  5IYB C;  2XCO A;  1SFO A;  1WOP A;  4A3L C;  4XLP A;  3HXA A;  1WQG A;  1O26 A;  1XXC A;  1XZP A;  4KAS A;  5C3E C;  3CF5 S;  4YFK A;  4Y7N K;  1YX2 A;  2NVT K;  3SZY A;  3IPJ A;  4C3H C;  3ORE A;  4YG2 A;  3FKI C;  4AYB D;  2R93 C;  5M5W K;  3HOZ K;  3G4C A;  2E2I C;  4BBS K;  4P9S A;  4LJZ A;  2R92 A;  3GTP K;  3I4N C;  1R9T A;  2B63 A;  3BP3 A;  3GTK C;  5C4X K;  3G4A A;  1DCP A;  1WOO A;  3CQZ K;  3S1N K;  1O2F B;  1O28 A;  3HKZ L;  3WOD A;  2YU9 C;  3H0G A;  4OIR A;  3S14 K;  2A6E A;  2NVQ K;  4OIN A;  3S1M K;  3A8J A;  3LPX A;  5IP9 C;  3BUE A;  2KXY A;  1TWG A;  3S0X A;  2O5J A;  3FOF A;  1K83 A;  2A6H A;  3AD8 C;  3H3V L;  4LLG A;  3S1Q C;  4A3K C;  2BE5 A;  4KB2 A;  3GEE A;  1TWF A;  1F7V A;  2L3U A;  3N3Y A;  4A3E K;  5FLM C;  3AD9 C;  3GTJ C;  4XSZ A;  3CAG A;  1TWC A;  1TWH C;  3NUH A;  4XLN A;  4GTC A;  1SFO K;  1I3Q A;  3S2H C;  2E2H C;  3K7A K;  4A3F K;  2JA6 C;  1I6V A;  1VJE A;  2R93 A;  3FKI A;  2E2I A;  4GTB A;  4C3J K;  4DDQ A;  1R9T K;  3RZD C;  1EFW A;  3N0B A;  3PO2 K;  3GTQ A;  1XZQ A;  3H0G K;  3LAJ A;  1O27 A;  2RH6 A;  3V4G A;  2XCQ A;  4BY1 C;  3S15 K;  5TMF A;  4KAT A;  4A93 K;  1WQH A;  1TWG K;  1XXA A;  1J6X A;  4C2M K;  1F7U A;  4A3J K;  1JVI A;  1YNJ A;  2P8T A;  1INN A;  4KB4 A;  4A3M C;  5FJ8 K;  1K83 K;  1JOE A;  1USM A;  2FQO A;  1YNN A;  5HL8 A;  2VUM C;  2V6U A;  2PA8 D;  4BXX C;  1IBA A;  5E68 A;  2R7Z C;  4JK1 A;  3RZO C;  4BY7 K;  5IYC C;  1TWF K;  3M3Y K;  2WAQ L;  1VH2 A;  4MQ9 A;  3GTJ A;  2FQT A;  1TWA A;  4BBR C;  3S17 C;  3S2D C;  1L0W A;  4WJ3 M;  2L5N A;  1TWH A;  3GEH A;  2PMZ D;  4J3N A;  4ZH4 A;  5IYB K;  1TWC K;  3PO3 K;  5L46 A;  5C4J C;  5M5X K;  1O25 A;  1PJ5 A;  5JVH S;  1WQF A;  1I3Q K;  1F9N A;  4WFN S;  2R93 K;  3FKI K;  4KMH A;  3ADA C;  4FM9 A;  2E2I K;  3SZZ A;  3S16 C;  4G7H A;  1Y1V C;  3I4N K;  1WCM C;  4IOA S;  1FEU A;  4AH6 A;  1XPP A;  4KM9 A;  5JVO A;  4WFA S;  2NVX C;  2P5M A;  3HOW C;  3GTQ K;  3AD7 C;  5C44 C;  4KN4 A;  1O29 A;  3GTG C;  2NVY C;  4WFB S;  4A3I C;  2JA5 C;  2JA8 C;  3N0C A;  3T02 A;  5IOT A;  1I50 C;  4G7Z A;  3M4O C;  1ZYR A;  3TTG A;  4P5B A;  4GTA A;  1VRQ C;  5IYD C;  3GTM C;  2GSN A;  2WB1 D;  4WCE S;  3DXJ A;  3AQP A;  1GE9 A;  4A3B C;  4A3C C;  3VA7 A;  4KMD A;  2VUM A;  2WAQ D;  4A3G K;  1AB4 A;  4WIL A;  2R7Z A;  4OIO A;  2NVT C;  3AH5 A;  1IQ0 A;  2PHC B;  1ISE A;  3HOZ C;  2GAG C;  2ZJQ S;  1Y1W K;  5M5Y K;  1TWA K;  1XZP B;  2A69 A;  3GTP C;  4LR2 A;  1B4A A;  1RU0 A;  1TWH K;  5CHP A;  5M3M K;  5C4X C;  2KPU A;  2CFA A;  3HOY K;  1J6W A;  3S1N C;  1ZXO A;  4IOC S;  1VGX A;  2PA8 L;  3S14 C;  3GIR A;  2NVQ C;  3I4M C;  4GZY A;  3A8K A;  3HOU K;  5IP7 C;  5CJ9 A;  1O24 A;  4Q5S A;  2PMZ L;  1Y1V A;  1WCM A;  3LAP A;  3HOV K;  1G51 A;  3RZD K;  2E2J K;  4BLB A;  2NVX A;  4WJ4 A;  4IO9 S;  3GTK A;  2R92 K;  1ZVU A;  1JQW A;  2NVY A;  2B63 K;  2JA5 A;  4GTD A;  4BY1 K;  2YU9 A;  3TFI A;  3GTM A;  5JFE A;  3TFJ A;  4X6A K;  1DD5 A;  1HI9 A;  4A3M K;  4O2D A;  3HOX K;  1SFO C;  5HQH A;  4WF9 S;  4RMF A;  1SMY A;  2XCR B;  3BP8 C;  1J98 A;  2VUM K;  3LYW A;  4A3F C;  4A3D C;  2KQ1 A;  2R7Z K;  3RZO K;  5IYC K;  4GTE A;  3EQL A;  3FOE A;  1C0A A;  4U67 S;  3PIO S;  5TJ3 A;  1WOS A;  3JST A;  3S17 K;  3GTP A;  3S2D K;  5TMC A;  3GTO C;  2WB1 L;  3S1R K;  3MML B;  4C3I C;  4LOW A;  1IL2 A;  3GTL C;  5M3F K;  1PJ6 A;  5C4J K;  1PJ7 A;  5DM6 S;  1EH1 A;  3DLL S;  1BDF A;  3H0G C;  1O2B A;  2ZUF A;  4OIP A;  3T01 A;  4G7O A;  2GAH C;  5EGH A;  4A3L K;  3AQO A;  5IOS A;  4A93 C;  2CW0 A;  2E2H A;  5C3E K;  4GTL A;  2JA6 A;  4KDD A;  2PPB A;  1J6V A;  4A3J C;  3S16 K;  1Y1V K;  3GDZ A;  1WCM K;  1XZQ B;  4C3H K;  1ZBS A;  1EK8 A;  4KMA A;  2NVX K;  4XCH A;  3HOW K;  4Y52 C;  5C44 K;  1IE0 A;  3GTK K;  2JA8 K;  4A3I K;  2JA5 K;  1TWF C;  3FHZ A;  2YU9 K;  4KAW X;  1WSV A;  4KM8 A;  4G0W A;  3M4O K;  4QIW D;  5IP9 K;  5IYD K;  3PO3 C;  3T00 A;  1TWC C;  3GTM K;  2A68 A;  1F93 A;  1WIH A;  4A3B K;  4A3C K;  2JA7 C;  1I3Q C;  2W7V A;  4GFQ A;  5IOR A;  1I6H C;  1EI6 A;  3GSI A;  1UV7 A;  1BGW A;  3Q3Q A;  1ZQ1 C;  1O2A A;  3S1Q K;  3ERE D;  4P5A A;  4Y7N C;  4A3K K;  4LK1 A;  3GTO A;  3GTL A;  1IW7 A;  4QJV B;  5FLM K;  4FZB A;  4BBS C;  4KC6 A;  3GTJ K;  3GTQ C;  2JH3 A;  3I4M K;  4PAA A;  2ZFZ A;  1X31 C;  5IP7 K;  3CQZ C;  1USO A;  4G0U A;  3S2H K;  2E2H K;  2Y0S L;  5D4D A;  2JA6 K;  3S1M C;  4GTF A;  4G0V A;  5JVG S;  1XXB A;  4A3G C;  1BS2 A;  2EBB A;  4YFX A;  4YFN A;  2ZJP S;  1YCL A;  4KN7 A;  5EGE A;  4C45 A;  1VLO A;  1Y1W C;  1V5V A;  1TWA C;  4ILD A;  3GTG A;  4KMU A;  3HOY C;  3OEP A;  4A3E C;  1I50 A;  2ZJR S;  2JA7 A;  4GT9 A;  2GSO A;  4A3D K;  3HOU C;  5DM7 S;  2Y3P A;  4LQY A;  1B4B A;  3QX3 A;  2CFA B;  3HKZ D;  3A8I A;  2KWA A;  4QIW L;  3K7A C;  1BJT A;  4BXX K;  3L4K A;  3L4J A;  3GTO K;  3HOV C;  4C3I K;  4BLA A;  3GTL K;  2V6T A;  2E2J C;  4C3J C;  1IS1 A;  4LK0 A;  4OIQ A;  4M1X A;  4PAB A;  4MEY A;  4BBR K;  3PIP S;  2Y0S D;  1WOR A;  1WSR A;  1KQ4 A;  2R92 C;  1R9T C;  4AYB L;  2B63 C;  4Q4Z A;  3CQZ A;  4NOI A;  3H3V D;  3PO2 C;  1DCH A;  4MEX A;  4X6A C;  3S15 C;  1DCO A;  3HOX C;  1TWG C;  4C2M C;  4Y52 K;  5IOQ A; 
#chains in the Genus database with same CATH homology
 3RZD C;  1I3Q C;  2PA8 L;  3S14 C;  1I6H C;  1K83 C;  2NVQ C;  3PO2 K;  3H0G K;  3I4M C;  4GZY A;  3HOU K;  1HQM A;  5IP7 C;  3S1Q K;  4BY1 C;  3S15 K;  5TMF A;  4Y7N C;  2O5I A;  4LK1 A;  3S1R C;  4A3K K;  3GTG K;  2NVY K;  4A93 K;  4BY7 C;  4Q5S A;  2PMZ L;  1TWG K;  3M3Y C;  1I50 K;  1IW7 A;  4C2M K;  4XSX A;  4QJV B;  4A3J K;  3HOV K;  2JA7 K;  5FLM K;  3RZD K;  2E2J K;  1YNJ A;  4BBS C;  3GTJ K;  4A3M C;  5FJ8 K;  4QJV A;  3GTQ C;  5IYB C;  1K83 K;  3S16 K;  1I6H K;  3I4M K;  1YNN A;  4A3L C;  2R92 K;  4XLP A;  5IP7 K;  2VUM C;  2PA8 D;  3CQZ C;  5C3E C;  4YFK A;  2B63 K;  4BY1 K;  4BXX C;  2R7Z C;  4Y7N K;  4JK1 A;  3RZO C;  2E2H K;  3S2H K;  2NVT K;  2Y0S L;  4BY7 K;  5IYC C;  5D4D A;  1TWF K;  3S1M C;  2JA6 K;  4C3H C;  4YG2 A;  3FKI C;  4AYB D;  2R93 C;  5M5W K;  2WAQ L;  3HOZ K;  4MQ9 A;  3M3Y K;  2E2I C;  4BBR C;  3S17 C;  3S2D C;  4BBS K;  4X6A K;  4LJZ A;  2PMZ D;  4A3M K;  4ZH4 A;  5IYB K;  1TWC K;  3HOX K;  1SFO C;  3GTP K;  3I4N C;  3PO3 K;  4A3G C;  1SMY A;  5C4J C;  3GTK C;  5C4X K;  5M5X K;  4YFX A;  4YFN A;  2VUM K;  4A3F C;  3CQZ K;  3S1N K;  3HKZ L;  4A3D C;  1I3Q K;  3WOD A;  2YU9 C;  4KN7 A;  2R7Z K;  4OIR A;  3RZO K;  3S14 K;  5IYC K;  2A6E A;  2NVQ K;  4OIN A;  3S1M K;  1Y1W C;  2R93 K;  3FKI K;  3EQL A;  5IP9 C;  1TWA C;  4Y52 K;  2E2I K;  3S17 K;  3S2D K;  4KMU A;  5TMC A;  3HOY C;  3GTO C;  2WB1 L;  3S1R K;  3S16 C;  4C3I C;  4A3E C;  4G7H A;  1Y1V C;  3GTL C;  5M3F K;  1WCM C;  3I4N K;  5C4J K;  2O5J A;  1XPP A;  1BDF A;  2A6H A;  3H0G C;  4A3D K;  4OIP A;  2NVX C;  3HOU C;  3H3V L;  3HOW C;  4G7O A;  3GTQ K;  4LLG A;  5C44 C;  4KN4 A;  3S1Q C;  4A3L K;  4A3K C;  3HKZ D;  2BE5 A;  3GTG C;  2CW0 A;  2NVY C;  3K7A C;  4A3I C;  2JA5 C;  2JA8 C;  4A93 C;  4QIW L;  5C3E K;  4BXX K;  1I50 C;  2PPB A;  3GTO K;  4A3J C;  4G7Z A;  3HOV C;  3M4O C;  1ZYR A;  1Y1V K;  5FLM C;  4C3I K;  1WCM K;  2E2J C;  4A3E K;  3GTL K;  4C3H K;  3GTJ C;  4C3J C;  4LK0 A;  4OIQ A;  5IYD C;  3GTM C;  4XSZ A;  2WB1 D;  4MEY A;  3DXJ A;  1TWH C;  4BBR K;  2NVX K;  2Y0S D;  4XLN A;  2R92 C;  4A3B C;  3HOW K;  4Y52 C;  4A3C C;  1R9T C;  4AYB L;  5C44 K;  2B63 C;  1SFO K;  2WAQ D;  4Q4Z A;  4A3G K;  3GTK K;  4NOI A;  3S2H C;  2E2H C;  4OIO A;  2NVT C;  4A3I K;  3K7A K;  2JA5 K;  1TWF C;  4A3F K;  2JA6 C;  3H3V D;  3PO2 C;  2JA8 K;  2YU9 K;  1I6V A;  3HOZ C;  3M4O K;  4MEX A;  1Y1W K;  4QIW D;  3S15 C;  4X6A C;  4C3J K;  5M5Y K;  5IP9 K;  5IYD K;  3PO3 C;  1TWA K;  1TWC C;  3HOX C;  2A69 A;  3GTP C;  3GTM K;  2A68 A;  1TWH K;  5M3M K;  1TWG C;  5C4X C;  3HOY K;  4C2M C;  4A3B K;  4A3C K;  1R9T K;  2JA7 C;  3S1N C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...