4XLPA

Crystal structure of t.aquaticus transcription initiation complex containing upstream fork promoter
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
227
structure length
227
Chain Sequence
KAPVFTATTQGDHYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLDPKMASTTLILRAEGPKEVRAGDFTPSADVEIMNPDLHIATLEEGGKLYMEVRVDRGVGYVPAERHGIKDRINAIPVDAIFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVAILKEHLNYFANPEASLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna
molecule keywords DNA-directed RNA polymerase subunit alpha
publication title Structure of a bacterial RNA polymerase holoenzyme open promoter complex.
pubmed doi rcsb
source organism Thermus aquaticus
total genus 40
structure length 227
sequence length 227
chains with identical sequence B, G, H
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2015-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01000 RNA_pol_A_bac RNA polymerase Rpb3/RpoA insert domain
A PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain
A PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.12 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 DNA-directed RNA polymerase, insert domain 4xlpA02
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 4xlpA01
4A3LC 2E2HK 4MEXA 4BBRK 4LK0A 4X6AC 1I6HK 1SFOC 1I6VA 4YFXA 2R93K 2NVTC 3S17K 2JA8C 1YNNA 2R92C 3H3VD 4X6AK 4KN4A 4A3CC 4Y7NK 5IYBC 5M3MK 1TWCC 4QIWD 3H0GC 3HOYC 2NVTK 1TWGC 3M3YK 3S15C 4QJVA 2WB1D 4A3IC 4A3CK 3GTGK 3HOVC 2A68A 5IYBK 4C3JC 4NOIA 3GTKC 1TWCK 3H0GK 4A3KC 3HOYK 3H3VL 3EQLA 1ZYRA 3S15K 2A6EA 4A3IK 1Y1WK 4QIWL 3HOVK 3RZOC 4C3JK 4OIRA 5C4XC 3GTKK 4C3HC 4A3KK 2A6HA 3HOZC 1XPPA 3GTJK 4KN7A 1R9TC 3WODA 3HOXK 3RZOK 5C4XK 4A3BC 3CQZC 4C3HK 4A3FK 4XSZA 2E2JC 4A3LK 3HOZK 3GTLC 1I3QC 2BE5A 3S16C 3S2DC 2CW0A 1SFOK 1R9TK 4C2MC 4BY1C 4A3JC 5IP9C 3CQZK 4A3BK 2E2JK 5M5YK 2JA8K 4OIQA 3GTLK 1I3QK 2R92K 5C4JC 4AYBD 4QJVB 4A3JK 5IP9K 5D4DA 3S1RC 1HQMA 1I6HC 5TMFA 1TWGK 2R7ZC 4LLGA 5C44C 2JA7C 3HOWC 1Y1VC 2YU9C 2Y0SD 3K7AC 2A69A 4YFKA 3S14C 4XLPA 4KMUA 2O5JA 3S1RK 3FKIC 5IP7C 2R7ZK 5TMCA 5C44K 4Y52C 2JA7K 3HOWK 3HKZL 4AYBL 3I4NC 1Y1VK 3GTQC 2YU9K 5IYDC 5FLMC 4Q4ZA 3GTMC 3S1MC 4A3DC 3I4MC 3S14K 4LK1A 4OINA 3S2HC 4BBSC 3RZDC 2JA5C 2NVQC 3S1QC 4Q5SA 3M4OC 5IP7K 2Y0SL 3GTQK 2PA8D 4GZYA 2WAQD 4A3DK 5M3FK 4A3EC 3GTMK 2VUMC 3S2HK 4BBSK 3RZDK 3S1QK 1I50C 2NVQK 3M4OK 4A3MC 3S16K 2B63C 3S2DK 4G7OA 1IW7A 3PO3C 2PPBA 3HKZD 4C2MK 4BY1K 2VUMK 2JA6C 5IYCC 4BY7C 3PO2C 1I50K 4OIOA 2NVYC 4A3MK 4LJZA 4A93C 2PMZD 2PA8L 2WAQL 2B63K 5M5WK 5C4JK 3PO3K 1SMYA 1K83C 4OIPA 4C3IC 4Y7NC 2JA6K 4G7HA 3GTPC 5C3EC 4MQ9A 5IYCK 3PO2K 1TWHC 1TWFC 2E2IC 2NVYK 4XSXA 4G7ZA 4BY7K 4A93K 3GTOC 1BDFA 3M3YC 3K7AK 1K83K 4C3IK 5M5XK 3GTGC 3GTPK 4MEYA 5C3EK 4YG2A 3FKIK 1TWHK 3S1NC 1TWFK 1WCMC 4YFNA 2PMZL 2E2IK 4Y52K 3GTOK 3I4NK 5FLMK 1YNJA 3S1MK 5IYDK 1Y1WC 4A3GC 3I4MK 2NVXC 3HOUC 4BXXC 1TWAC 3S1NK 2JA5K 1WCMK 2O5IA 3DXJA 2E2HC 4BBRC 3GTJC 4A3EK 4ZH4A 4A3GK 5FJ8K 2NVXK 3HOXC 3HOUK 4XLNA 2R93C 4JK1A 1TWAK 4BXXK 4A3FC 2WB1L 3S17C
chains in the Genus database with same CATH superfamily
4BBRK 4X6AC 1EQRA 4YFXA 1TWHA 4X6AK 3GTOA 1B4BA 2Y3PA 4Y7NK 2GSOA 5CJ9A 3CF5S 5M3MK 3JSTA 1O25A 3S15C 2WB1D 3IPJA 4WJ3M 3HOVC 1J6VA 4C3JC 4A3KC 3H3VL 3S15K 1J98A 2A6EA 1ZVUA 1Y1WK 3GTJA 3HOVK 4C45A 4C3JK 3TFHA 2ZFZA 4A3KK 2R93A 1YX2A 3HOZC 1XPPA 4KM8A 1WQHA 5CHPA 1R9TC 4G0WA 3WODA 1WOOA 2E2JC 4A3LK 3HOZK 1I3QC 3S2DC 2CW0A 2R92A 1VRQC 1R9TK 4IOCS 5IP9C 4GTAA 2V6SA 1TWCA 2E2JK 1I3QK 5IOTA 2KXYA 5DM7S 1F7VA 4QJVB 5IP9K 5C44C 2JH3A 3HOWC 1DCHA 2YU9C 2Y0SD 3K7AC 1AB4A 4YFKA 3S14C 1RU0A 2CFAB 1C0AA 3N0CA 5C44K 4Y52C 3HOWK 3HKZL 1XZQB 3I4NC 2YU9K 3GTMC 3S14K 3GTQA 3I4MC 1IS1A 3S1QC 4LR2A 2PA8D 4GZYA 2WAQD 4KATA 5M3FK 3GTMK 1PJ7A 3S1QK 3S16K 4G7OA 3OREA 4C2MK 2GSNA 4G0VA 2ZJPS 5IYCC 1YCLA 1BS2A 4KMDA 4KB2A 2PMZD 3FOEA 5M5WK 5C4JK 1ZBSA 1K83C 3GTPC 5C3EC 1J6WA 5IYCK 1TWFC 3FHZA 3M3YC 1K83K 4LOWA 4MEYA 5C3EK 3GTPK 1TWFK 3S1MK 3LPXA 2NVXC 4BXXC 4WFNS 2JA5K 2E2HC 4P5AA 4A3EK 2NVXK 4XLNA 1VLOA 4BXXK 3S17C 2E2HK 1EI6A 2NVYA 3ADAC 1JQWA 5HL8A 1IBAA 1SFOC 1I6VA 3SZYA 3S17K 1O27A 1XXAA 3H3VD 4A3CC 1WIHA 3V4GA 5IYBC 2GSUA 4KM9A 3CAGA 3H0GC 5IOQA 1TWGC 1O2AA 4QJVA 1WCMA 4O2DA 4A3CK 3GTGK 5IYBK 1Y1WA 4NOIA 3GTKC 3H0GK 5JVHS 1TWAA 1JOEA 2ZUFA 3HXAA 2GAGC 3PIPS 4RMFA 3GTKK 3BP8C 2A6HA 4FM9A 1XZPA 2P5MA 3HOXK 3CQZC 1ZXOA 4XSZA 3T02A 3GTLC 2BE5A 1XXBA 1VGXA 3CQZK 5JVOA 4G0UA 3GTLK 4DDQA 2RH6A 1DCOA 5EGEA 5D4DA 1HQMA 2R7ZC 4M1XA 1Y1VC 4PAAA 2A69A 1VJEA 2L5NA 4KMUA 2O5JA 3BP3A 3FKIC 2R7ZK 5TMCA 1Y1VK 3MMLB 1BJTA 3TFJA 5IYDC 4A3DC 3A8KA 1O24A 3LAPA 4BBSC 3RZDC 4Q5SA 3M4OC 1IQ0A 4KAWX 4A3DK 1O29A 3RZDK 4BBSK 1I50C 3M4OK 4GTFA 1USOA 3S2DK 3N3YA 2W7VA 4BKWA 4BY7C 4KMAA 3PO2C 1I50K 4OIOA 4AH6A 5JFEA 4LJZA 4A93C 3G4AA 2JA7A 4U67S 3AD9C 1V5VA 4BY7K 3PO2K 1TWHC 4G7ZA 4A93K 3GTOC 2ZJQS 3K7AK 3GIRA 5M5XK 4KMHA 1EH1A 1XZPB 4GT9A 1PJ6A 1TWHK 2XCOA 4YFNA 3OEPA 4Y52K 3GTOK 2JA5A 3I4NK 4GTEA 4A3GC 2PHCB 3S0XA 3I4MK 3QX3A 3HOUC 3T00A 2VUMA 2NVXA 3AQOA 3GTJC 2B63A 4ZH4A 4A3GK 5FJ8K 3HOUK 2R93C 4JK1A 2JA6A 4A3FC 2WB1L 3A8IA 3L4KA 1ZQ1C 2R93K 2NVTC 2JA8C 2E2IA 1F7UA 1YNNA 2R92C 4KN4A 3LAJA 1TWCC 2XCQA 4P9SA 2NVTK 3GTGA 3M3YK 1J6XA 4WILA 4GTCA 4IOAS 1O28A 1ISEA 1TWCK 1G51A 3GTKA 4QIWL 3RZOC 4OIRA 5C4XC 5EGHA 3GDZA 4WCES 5E68A 3RZOK 2L3UA 2P8TA 5C4XK 3CQZA 3LYWA 2KQ1A 1SFOK 1EK8A 1VH2A 4BY1C 4A3JC 1WSVA 3GEEA 3TTGA 4P5BA 3T01A 3TFIA 4FZBA 4A3JK 3S1RC 2EBBA 1I6HC 5TMFA 1TWGK 4LLGA 2R7ZA 3S1RK 5IP7C 4AYBL 5FLMC 4Q4ZA 2ZJRS 1IE0A 1R9TA 4OINA 3S2HC 3NUHA 3L4JA 5IP7K 2NVQC 3SZZA 1I3QA 4KC6A 4BLAA 5L46A 3BUEA 3S2HK 2NVQK 4A3MC 1I50A 4KARA 1IW7A 2PPBA 3HKZD 1INNA 2NVYC 4A3MK 3GSIA 1SMYA 4Y7NC 4BLBA 1WORA 2YU9A 3AQPA 2NVYK 4GTLA 2RGRA 4GTBA 4WFBS 3GTMA 1X31C 4YG2A 3FKIK 3S1NC 3N0BA 1WCMC 4J3NA 4WF9S 5IYDK 1Y1WC 1WSRA 1TWAC 3S1NK 1WCMK 2O5IA 2FQTA 3OPFA 5DM6S 3G4CA 1TWAK 4WJ4A 4A3LC 4MEXA 4LK0A 1K83A 5HQHA 1FEUA 3GTPA 1WQGA 5HL7S 1WOSA 4LQYA 1TWFA 1BGWA 1O2BA 1F9NA 4PABA 3PIOS 2GAHC 4GFQA 4QIWD 3HOYC 1UV7A 1F93A 4A3IC 3GEIA 2A68A 3HOYK 3EQLA 1ZYRA 4A3IK 2E2HA 4WFAS 2XCRB 4C3HC 3AD8C 3GTJK 4KN7A 1SFOA 4A3BC 4C3HK 4A3FK 1PJ5A 3S16C 4ILDA 4GTDA 3A8JA 4C2MC 4A3BK 4KB4A 5M5YK 2JA8K 4OIQA 3H0GA 2R92K 1TWGA 5C4JC 3AD7C 4AYBD 3VA7A 5TJ3A 2JA7C 1WQFA 1O26A 1JVIA 4XLPA 1O2FB 1USMA 1XXCA 2JA7K 1HI9A 2V6UA 3GTQC 3S1MC 2FQOA 1KQ4A 4LK1A 2JA5C 2Y0SL 3GTQK 3GTLA 3ERED 5IORA 1IL2A 4A3EC 2VUMC 2B63C 1DD5A 3PO3C 3Q3QA 2ZUEA 4BY1K 4XCHA 2VUMK 2JA6C 3AH5A 2D6FC 4KDDA 2KWAA 2PA8L 2WAQL 2B63K 3PO3K 2V6TA 1Y1VA 4OIPA 4C3IC 2JA6K 4G7HA 1B4AA 4MQ9A 3GEHA 1I6HK 2E2IC 4XSXA 3FKIA 2KPUA 3DLLS 1BDFA 4C3IK 3GTGC 4KASA 2PMZL 2E2IK 4IO9S 1DCPA 1WOPA 1YNJA 5IOSA 5FLMK 5JVGS 3FOFA 1GE9A 3DXJA 2CFAA 4BBRC 1EFWA 3HOXC 1L0WA 1XZQA
chains in the Genus database with same CATH topology
4A3LC 2E2HK 4MEXA 4BBRK 4LK0A 4X6AC 1I6HK 1SFOC 1I6VA 4YFXA 2R93K 2NVTC 3S17K 2JA8C 1YNNA 2R92C 3H3VD 4X6AK 4KN4A 4A3CC 4Y7NK 5IYBC 5M3MK 1TWCC 4QIWD 3H0GC 3HOYC 2NVTK 1TWGC 3M3YK 3S15C 4QJVA 2WB1D 4A3IC 4A3CK 3GTGK 3HOVC 2A68A 5IYBK 4C3JC 4NOIA 3GTKC 1TWCK 3H0GK 4A3KC 3HOYK 3H3VL 3EQLA 1ZYRA 3S15K 2A6EA 4A3IK 1Y1WK 4QIWL 3HOVK 3RZOC 4C3JK 4OIRA 5C4XC 3GTKK 4C3HC 4A3KK 2A6HA 3HOZC 1XPPA 3GTJK 4KN7A 1R9TC 3WODA 3HOXK 3RZOK 5C4XK 4A3BC 3CQZC 4C3HK 4A3FK 4XSZA 2E2JC 4A3LK 3HOZK 3GTLC 1I3QC 2BE5A 3S16C 3S2DC 2CW0A 1SFOK 1R9TK 4C2MC 4BY1C 4A3JC 5IP9C 3CQZK 4A3BK 2E2JK 5M5YK 2JA8K 4OIQA 3GTLK 1I3QK 2R92K 5C4JC 4AYBD 4QJVB 4A3JK 5IP9K 5D4DA 3S1RC 1HQMA 1I6HC 5TMFA 1TWGK 2R7ZC 4LLGA 5C44C 2JA7C 3HOWC 1Y1VC 2YU9C 2Y0SD 3K7AC 2A69A 4YFKA 3S14C 4XLPA 4KMUA 2O5JA 3S1RK 3FKIC 5IP7C 2R7ZK 5TMCA 5C44K 4Y52C 2JA7K 3HOWK 3HKZL 4AYBL 3I4NC 1Y1VK 3GTQC 2YU9K 5IYDC 5FLMC 4Q4ZA 3GTMC 3S1MC 4A3DC 3I4MC 3S14K 4LK1A 4OINA 3S2HC 4BBSC 3RZDC 2JA5C 2NVQC 3S1QC 4Q5SA 3M4OC 5IP7K 2Y0SL 3GTQK 2PA8D 4GZYA 2WAQD 4A3DK 5M3FK 4A3EC 3GTMK 2VUMC 3S2HK 4BBSK 3RZDK 3S1QK 1I50C 2NVQK 3M4OK 4A3MC 3S16K 2B63C 3S2DK 4G7OA 1IW7A 3PO3C 2PPBA 3HKZD 4C2MK 4BY1K 2VUMK 2JA6C 5IYCC 4BY7C 3PO2C 1I50K 4OIOA 2NVYC 4A3MK 4LJZA 4A93C 2PMZD 2PA8L 2WAQL 2B63K 5M5WK 5C4JK 3PO3K 1SMYA 1K83C 4OIPA 4C3IC 4Y7NC 2JA6K 4G7HA 3GTPC 5C3EC 4MQ9A 5IYCK 3PO2K 1TWHC 1TWFC 2E2IC 2NVYK 4XSXA 4G7ZA 4BY7K 4A93K 3GTOC 1BDFA 3M3YC 3K7AK 1K83K 4C3IK 5M5XK 3GTGC 3GTPK 4MEYA 5C3EK 4YG2A 3FKIK 1TWHK 3S1NC 1TWFK 1WCMC 4YFNA 2PMZL 2E2IK 4Y52K 3GTOK 3I4NK 5FLMK 1YNJA 3S1MK 5IYDK 1Y1WC 4A3GC 3I4MK 2NVXC 3HOUC 4BXXC 1TWAC 3S1NK 2JA5K 1WCMK 2O5IA 3DXJA 2E2HC 4BBRC 3GTJC 4A3EK 4ZH4A 4A3GK 5FJ8K 2NVXK 3HOXC 3HOUK 4XLNA 2R93C 4JK1A 1TWAK 4BXXK 4A3FC 2WB1L 3S17C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A3L C;  2E2H K;  4MEX A;  4BBR K;  4LK0 A;  4X6A C;  1I6H K;  1SFO C;  1I6V A;  4YFX A;  2R93 K;  2NVT C;  3S17 K;  2JA8 C;  1YNN A;  2R92 C;  3H3V D;  4X6A K;  4KN4 A;  4A3C C;  4Y7N K;  5IYB C;  5M3M K;  1TWC C;  4QIW D;  3H0G C;  3HOY C;  2NVT K;  1TWG C;  3M3Y K;  3S15 C;  4QJV A;  2WB1 D;  4A3I C;  4A3C K;  3GTG K;  3HOV C;  2A68 A;  5IYB K;  4C3J C;  4NOI A;  3GTK C;  1TWC K;  3H0G K;  4A3K C;  3HOY K;  3H3V L;  3EQL A;  1ZYR A;  3S15 K;  2A6E A;  4A3I K;  1Y1W K;  4QIW L;  3HOV K;  3RZO C;  4C3J K;  4OIR A;  5C4X C;  3GTK K;  4C3H C;  4A3K K;  2A6H A;  3HOZ C;  1XPP A;  3GTJ K;  4KN7 A;  1R9T C;  3WOD A;  3HOX K;  3RZO K;  5C4X K;  4A3B C;  3CQZ C;  4C3H K;  4A3F K;  4XSZ A;  2E2J C;  4A3L K;  3HOZ K;  3GTL C;  1I3Q C;  2BE5 A;  3S16 C;  3S2D C;  2CW0 A;  1SFO K;  1R9T K;  4C2M C;  4BY1 C;  4A3J C;  5IP9 C;  3CQZ K;  4A3B K;  2E2J K;  5M5Y K;  2JA8 K;  4OIQ A;  3GTL K;  1I3Q K;  2R92 K;  5C4J C;  4AYB D;  4QJV B;  4A3J K;  5IP9 K;  5D4D A;  3S1R C;  1HQM A;  1I6H C;  5TMF A;  1TWG K;  2R7Z C;  4LLG A;  5C44 C;  2JA7 C;  3HOW C;  1Y1V C;  2YU9 C;  2Y0S D;  3K7A C;  2A69 A;  4YFK A;  3S14 C;  4XLP A;  4KMU A;  2O5J A;  3S1R K;  3FKI C;  5IP7 C;  2R7Z K;  5TMC A;  5C44 K;  4Y52 C;  2JA7 K;  3HOW K;  3HKZ L;  4AYB L;  3I4N C;  1Y1V K;  3GTQ C;  2YU9 K;  5IYD C;  5FLM C;  4Q4Z A;  3GTM C;  3S1M C;  4A3D C;  3I4M C;  3S14 K;  4LK1 A;  4OIN A;  3S2H C;  4BBS C;  3RZD C;  2JA5 C;  2NVQ C;  3S1Q C;  4Q5S A;  3M4O C;  5IP7 K;  2Y0S L;  3GTQ K;  2PA8 D;  4GZY A;  2WAQ D;  4A3D K;  5M3F K;  4A3E C;  3GTM K;  2VUM C;  3S2H K;  4BBS K;  3RZD K;  3S1Q K;  1I50 C;  2NVQ K;  3M4O K;  4A3M C;  3S16 K;  2B63 C;  3S2D K;  4G7O A;  1IW7 A;  3PO3 C;  2PPB A;  3HKZ D;  4C2M K;  4BY1 K;  2VUM K;  2JA6 C;  5IYC C;  4BY7 C;  3PO2 C;  1I50 K;  4OIO A;  2NVY C;  4A3M K;  4LJZ A;  4A93 C;  2PMZ D;  2PA8 L;  2WAQ L;  2B63 K;  5M5W K;  5C4J K;  3PO3 K;  1SMY A;  1K83 C;  4OIP A;  4C3I C;  4Y7N C;  2JA6 K;  4G7H A;  3GTP C;  5C3E C;  4MQ9 A;  5IYC K;  3PO2 K;  1TWH C;  1TWF C;  2E2I C;  2NVY K;  4XSX A;  4G7Z A;  4BY7 K;  4A93 K;  3GTO C;  1BDF A;  3M3Y C;  3K7A K;  1K83 K;  4C3I K;  5M5X K;  3GTG C;  3GTP K;  4MEY A;  5C3E K;  4YG2 A;  3FKI K;  1TWH K;  3S1N C;  1TWF K;  1WCM C;  4YFN A;  2PMZ L;  2E2I K;  4Y52 K;  3GTO K;  3I4N K;  5FLM K;  1YNJ A;  3S1M K;  5IYD K;  1Y1W C;  4A3G C;  3I4M K;  2NVX C;  3HOU C;  4BXX C;  1TWA C;  3S1N K;  2JA5 K;  1WCM K;  2O5I A;  3DXJ A;  2E2H C;  4BBR C;  3GTJ C;  4A3E K;  4ZH4 A;  4A3G K;  5FJ8 K;  2NVX K;  3HOX C;  3HOU K;  4XLN A;  2R93 C;  4JK1 A;  1TWA K;  4BXX K;  4A3F C;  2WB1 L;  3S17 C; 
#chains in the Genus database with same CATH topology
 4BBR K;  4X6A C;  1EQR A;  4YFX A;  1TWH A;  4X6A K;  3GTO A;  1B4B A;  2Y3P A;  4Y7N K;  2GSO A;  5CJ9 A;  3CF5 S;  5M3M K;  3JST A;  1O25 A;  3S15 C;  2WB1 D;  3IPJ A;  4WJ3 M;  3HOV C;  1J6V A;  4C3J C;  4A3K C;  3H3V L;  3S15 K;  1J98 A;  2A6E A;  1ZVU A;  1Y1W K;  3GTJ A;  3HOV K;  4C45 A;  4C3J K;  3TFH A;  2ZFZ A;  4A3K K;  2R93 A;  1YX2 A;  3HOZ C;  1XPP A;  4KM8 A;  1WQH A;  5CHP A;  1R9T C;  4G0W A;  3WOD A;  1WOO A;  2E2J C;  4A3L K;  3HOZ K;  1I3Q C;  3S2D C;  2CW0 A;  2R92 A;  1VRQ C;  1R9T K;  4IOC S;  5IP9 C;  4GTA A;  2V6S A;  1TWC A;  2E2J K;  1I3Q K;  5IOT A;  2KXY A;  5DM7 S;  1F7V A;  4QJV B;  5IP9 K;  5C44 C;  2JH3 A;  3HOW C;  1DCH A;  2YU9 C;  2Y0S D;  3K7A C;  1AB4 A;  4YFK A;  3S14 C;  1RU0 A;  2CFA B;  1C0A A;  3N0C A;  5C44 K;  4Y52 C;  3HOW K;  3HKZ L;  1XZQ B;  3I4N C;  2YU9 K;  3GTM C;  3S14 K;  3GTQ A;  3I4M C;  1IS1 A;  3S1Q C;  4LR2 A;  2PA8 D;  4GZY A;  2WAQ D;  4KAT A;  5M3F K;  3GTM K;  1PJ7 A;  3S1Q K;  3S16 K;  4G7O A;  3ORE A;  4C2M K;  2GSN A;  4G0V A;  2ZJP S;  5IYC C;  1YCL A;  1BS2 A;  4KMD A;  4KB2 A;  2PMZ D;  3FOE A;  5M5W K;  5C4J K;  1ZBS A;  1K83 C;  3GTP C;  5C3E C;  1J6W A;  5IYC K;  1TWF C;  3FHZ A;  3M3Y C;  1K83 K;  4LOW A;  4MEY A;  5C3E K;  3GTP K;  1TWF K;  3S1M K;  3LPX A;  2NVX C;  4BXX C;  4WFN S;  2JA5 K;  2E2H C;  4P5A A;  4A3E K;  2NVX K;  4XLN A;  1VLO A;  4BXX K;  3S17 C;  2E2H K;  1EI6 A;  2NVY A;  3ADA C;  1JQW A;  5HL8 A;  1IBA A;  1SFO C;  1I6V A;  3SZY A;  3S17 K;  1O27 A;  1XXA A;  3H3V D;  4A3C C;  1WIH A;  3V4G A;  5IYB C;  2GSU A;  4KM9 A;  3CAG A;  3H0G C;  5IOQ A;  1TWG C;  1O2A A;  4QJV A;  1WCM A;  4O2D A;  4A3C K;  3GTG K;  5IYB K;  1Y1W A;  4NOI A;  3GTK C;  3H0G K;  5JVH S;  1TWA A;  1JOE A;  2ZUF A;  3HXA A;  2GAG C;  3PIP S;  4RMF A;  3GTK K;  3BP8 C;  2A6H A;  4FM9 A;  1XZP A;  2P5M A;  3HOX K;  3CQZ C;  1ZXO A;  4XSZ A;  3T02 A;  3GTL C;  2BE5 A;  1XXB A;  1VGX A;  3CQZ K;  5JVO A;  4G0U A;  3GTL K;  4DDQ A;  2RH6 A;  1DCO A;  5EGE A;  5D4D A;  1HQM A;  2R7Z C;  4M1X A;  1Y1V C;  4PAA A;  2A69 A;  1VJE A;  2L5N A;  4KMU A;  2O5J A;  3BP3 A;  3FKI C;  2R7Z K;  5TMC A;  1Y1V K;  3MML B;  1BJT A;  3TFJ A;  5IYD C;  4A3D C;  3A8K A;  1O24 A;  3LAP A;  4BBS C;  3RZD C;  4Q5S A;  3M4O C;  1IQ0 A;  4KAW X;  4A3D K;  1O29 A;  3RZD K;  4BBS K;  1I50 C;  3M4O K;  4GTF A;  1USO A;  3S2D K;  3N3Y A;  2W7V A;  4BKW A;  4BY7 C;  4KMA A;  3PO2 C;  1I50 K;  4OIO A;  4AH6 A;  5JFE A;  4LJZ A;  4A93 C;  3G4A A;  2JA7 A;  4U67 S;  3AD9 C;  1V5V A;  4BY7 K;  3PO2 K;  1TWH C;  4G7Z A;  4A93 K;  3GTO C;  2ZJQ S;  3K7A K;  3GIR A;  5M5X K;  4KMH A;  1EH1 A;  1XZP B;  4GT9 A;  1PJ6 A;  1TWH K;  2XCO A;  4YFN A;  3OEP A;  4Y52 K;  3GTO K;  2JA5 A;  3I4N K;  4GTE A;  4A3G C;  2PHC B;  3S0X A;  3I4M K;  3QX3 A;  3HOU C;  3T00 A;  2VUM A;  2NVX A;  3AQO A;  3GTJ C;  2B63 A;  4ZH4 A;  4A3G K;  5FJ8 K;  3HOU K;  2R93 C;  4JK1 A;  2JA6 A;  4A3F C;  2WB1 L;  3A8I A;  3L4K A;  1ZQ1 C;  2R93 K;  2NVT C;  2JA8 C;  2E2I A;  1F7U A;  1YNN A;  2R92 C;  4KN4 A;  3LAJ A;  1TWC C;  2XCQ A;  4P9S A;  2NVT K;  3GTG A;  3M3Y K;  1J6X A;  4WIL A;  4GTC A;  4IOA S;  1O28 A;  1ISE A;  1TWC K;  1G51 A;  3GTK A;  4QIW L;  3RZO C;  4OIR A;  5C4X C;  5EGH A;  3GDZ A;  4WCE S;  5E68 A;  3RZO K;  2L3U A;  2P8T A;  5C4X K;  3CQZ A;  3LYW A;  2KQ1 A;  1SFO K;  1EK8 A;  1VH2 A;  4BY1 C;  4A3J C;  1WSV A;  3GEE A;  3TTG A;  4P5B A;  3T01 A;  3TFI A;  4FZB A;  4A3J K;  3S1R C;  2EBB A;  1I6H C;  5TMF A;  1TWG K;  4LLG A;  2R7Z A;  3S1R K;  5IP7 C;  4AYB L;  5FLM C;  4Q4Z A;  2ZJR S;  1IE0 A;  1R9T A;  4OIN A;  3S2H C;  3NUH A;  3L4J A;  5IP7 K;  2NVQ C;  3SZZ A;  1I3Q A;  4KC6 A;  4BLA A;  5L46 A;  3BUE A;  3S2H K;  2NVQ K;  4A3M C;  1I50 A;  4KAR A;  1IW7 A;  2PPB A;  3HKZ D;  1INN A;  2NVY C;  4A3M K;  3GSI A;  1SMY A;  4Y7N C;  4BLB A;  1WOR A;  2YU9 A;  3AQP A;  2NVY K;  4GTL A;  2RGR A;  4GTB A;  4WFB S;  3GTM A;  1X31 C;  4YG2 A;  3FKI K;  3S1N C;  3N0B A;  1WCM C;  4J3N A;  4WF9 S;  5IYD K;  1Y1W C;  1WSR A;  1TWA C;  3S1N K;  1WCM K;  2O5I A;  2FQT A;  3OPF A;  5DM6 S;  3G4C A;  1TWA K;  4WJ4 A;  4A3L C;  4MEX A;  4LK0 A;  1K83 A;  5HQH A;  1FEU A;  3GTP A;  1WQG A;  5HL7 S;  1WOS A;  4LQY A;  1TWF A;  1BGW A;  1O2B A;  1F9N A;  4PAB A;  3PIO S;  2GAH C;  4GFQ A;  4QIW D;  3HOY C;  1UV7 A;  1F93 A;  4A3I C;  3GEI A;  2A68 A;  3HOY K;  3EQL A;  1ZYR A;  4A3I K;  2E2H A;  4WFA S;  2XCR B;  4C3H C;  3AD8 C;  3GTJ K;  4KN7 A;  1SFO A;  4A3B C;  4C3H K;  4A3F K;  1PJ5 A;  3S16 C;  4ILD A;  4GTD A;  3A8J A;  4C2M C;  4A3B K;  4KB4 A;  5M5Y K;  2JA8 K;  4OIQ A;  3H0G A;  2R92 K;  1TWG A;  5C4J C;  3AD7 C;  4AYB D;  3VA7 A;  5TJ3 A;  2JA7 C;  1WQF A;  1O26 A;  1JVI A;  4XLP A;  1O2F B;  1USM A;  1XXC A;  2JA7 K;  1HI9 A;  2V6U A;  3GTQ C;  3S1M C;  2FQO A;  1KQ4 A;  4LK1 A;  2JA5 C;  2Y0S L;  3GTQ K;  3GTL A;  3ERE D;  5IOR A;  1IL2 A;  4A3E C;  2VUM C;  2B63 C;  1DD5 A;  3PO3 C;  3Q3Q A;  2ZUE A;  4BY1 K;  4XCH A;  2VUM K;  2JA6 C;  3AH5 A;  2D6F C;  4KDD A;  2KWA A;  2PA8 L;  2WAQ L;  2B63 K;  3PO3 K;  2V6T A;  1Y1V A;  4OIP A;  4C3I C;  2JA6 K;  4G7H A;  1B4A A;  4MQ9 A;  3GEH A;  1I6H K;  2E2I C;  4XSX A;  3FKI A;  2KPU A;  3DLL S;  1BDF A;  4C3I K;  3GTG C;  4KAS A;  2PMZ L;  2E2I K;  4IO9 S;  1DCP A;  1WOP A;  1YNJ A;  5IOS A;  5FLM K;  5JVG S;  3FOF A;  1GE9 A;  3DXJ A;  2CFA A;  4BBR C;  1EFW A;  3HOX C;  1L0W A;  1XZQ A; 
#chains in the Genus database with same CATH homology
 4A3L C;  2E2H K;  4MEX A;  4BBR K;  4LK0 A;  4X6A C;  1I6H K;  1SFO C;  1I6V A;  4YFX A;  2R93 K;  2NVT C;  3S17 K;  2JA8 C;  1YNN A;  2R92 C;  3H3V D;  4X6A K;  4KN4 A;  4A3C C;  4Y7N K;  5IYB C;  5M3M K;  1TWC C;  4QIW D;  3H0G C;  3HOY C;  2NVT K;  1TWG C;  3M3Y K;  3S15 C;  4QJV A;  2WB1 D;  4A3I C;  4A3C K;  3GTG K;  3HOV C;  2A68 A;  5IYB K;  4C3J C;  4NOI A;  3GTK C;  1TWC K;  3H0G K;  4A3K C;  3HOY K;  3H3V L;  3EQL A;  1ZYR A;  3S15 K;  2A6E A;  4A3I K;  1Y1W K;  4QIW L;  3HOV K;  3RZO C;  4C3J K;  4OIR A;  5C4X C;  3GTK K;  4C3H C;  4A3K K;  2A6H A;  3HOZ C;  1XPP A;  3GTJ K;  4KN7 A;  1R9T C;  3WOD A;  3HOX K;  3RZO K;  5C4X K;  4A3B C;  3CQZ C;  4C3H K;  4A3F K;  4XSZ A;  2E2J C;  4A3L K;  3HOZ K;  3GTL C;  1I3Q C;  2BE5 A;  3S16 C;  3S2D C;  2CW0 A;  1SFO K;  1R9T K;  4C2M C;  4BY1 C;  4A3J C;  5IP9 C;  3CQZ K;  4A3B K;  2E2J K;  5M5Y K;  2JA8 K;  4OIQ A;  3GTL K;  1I3Q K;  2R92 K;  5C4J C;  4AYB D;  4QJV B;  4A3J K;  5IP9 K;  5D4D A;  3S1R C;  1HQM A;  1I6H C;  5TMF A;  1TWG K;  2R7Z C;  4LLG A;  5C44 C;  2JA7 C;  3HOW C;  1Y1V C;  2YU9 C;  2Y0S D;  3K7A C;  2A69 A;  4YFK A;  3S14 C;  4XLP A;  4KMU A;  2O5J A;  3S1R K;  3FKI C;  5IP7 C;  2R7Z K;  5TMC A;  5C44 K;  4Y52 C;  2JA7 K;  3HOW K;  3HKZ L;  4AYB L;  3I4N C;  1Y1V K;  3GTQ C;  2YU9 K;  5IYD C;  5FLM C;  4Q4Z A;  3GTM C;  3S1M C;  4A3D C;  3I4M C;  3S14 K;  4LK1 A;  4OIN A;  3S2H C;  4BBS C;  3RZD C;  2JA5 C;  2NVQ C;  3S1Q C;  4Q5S A;  3M4O C;  5IP7 K;  2Y0S L;  3GTQ K;  2PA8 D;  4GZY A;  2WAQ D;  4A3D K;  5M3F K;  4A3E C;  3GTM K;  2VUM C;  3S2H K;  4BBS K;  3RZD K;  3S1Q K;  1I50 C;  2NVQ K;  3M4O K;  4A3M C;  3S16 K;  2B63 C;  3S2D K;  4G7O A;  1IW7 A;  3PO3 C;  2PPB A;  3HKZ D;  4C2M K;  4BY1 K;  2VUM K;  2JA6 C;  5IYC C;  4BY7 C;  3PO2 C;  1I50 K;  4OIO A;  2NVY C;  4A3M K;  4LJZ A;  4A93 C;  2PMZ D;  2PA8 L;  2WAQ L;  2B63 K;  5M5W K;  5C4J K;  3PO3 K;  1SMY A;  1K83 C;  4OIP A;  4C3I C;  4Y7N C;  2JA6 K;  4G7H A;  3GTP C;  5C3E C;  4MQ9 A;  5IYC K;  3PO2 K;  1TWH C;  1TWF C;  2E2I C;  2NVY K;  4XSX A;  4G7Z A;  4BY7 K;  4A93 K;  3GTO C;  1BDF A;  3M3Y C;  3K7A K;  1K83 K;  4C3I K;  5M5X K;  3GTG C;  3GTP K;  4MEY A;  5C3E K;  4YG2 A;  3FKI K;  1TWH K;  3S1N C;  1TWF K;  1WCM C;  4YFN A;  2PMZ L;  2E2I K;  4Y52 K;  3GTO K;  3I4N K;  5FLM K;  1YNJ A;  3S1M K;  5IYD K;  1Y1W C;  4A3G C;  3I4M K;  2NVX C;  3HOU C;  4BXX C;  1TWA C;  3S1N K;  2JA5 K;  1WCM K;  2O5I A;  3DXJ A;  2E2H C;  4BBR C;  3GTJ C;  4A3E K;  4ZH4 A;  4A3G K;  5FJ8 K;  2NVX K;  3HOX C;  3HOU K;  4XLN A;  2R93 C;  4JK1 A;  1TWA K;  4BXX K;  4A3F C;  2WB1 L;  3S17 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...