4XLPA

Crystal structure of t.aquaticus transcription initiation complex containing upstream fork promoter
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
227
structure length
227
Chain Sequence
KAPVFTATTQGDHYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLDPKMASTTLILRAEGPKEVRAGDFTPSADVEIMNPDLHIATLEEGGKLYMEVRVDRGVGYVPAERHGIKDRINAIPVDAIFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVAILKEHLNYFANPEASLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a bacterial RNA polymerase holoenzyme open promoter complex.
pubmed doi rcsb
source organism Thermus aquaticus
molecule tags Transcription/dna
molecule keywords DNA-directed RNA polymerase subunit alpha
total genus 40
structure length 227
sequence length 227
chains with identical sequence B, G, H
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2015-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01000 RNA_pol_A_bac RNA polymerase Rpb3/RpoA insert domain
A PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain
A PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.12 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 DNA-directed RNA polymerase, insert domain 4xlpA02
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 4xlpA01
3S17K 3H0GC 3GTMK 5M5WK 5C4XK 4YFXA 2JA5C 3HKZL 4C3HK 4A3CC 4KMUA 3GTLC 5IYCC 2PMZD 4LLGA 2JA8K 3M3YK 4A3JC 1Y1WC 3S16K 3HOUC 2VUMK 2BE5A 1YNNA 4BBSC 4KN4A 4C3HC 4G7ZA 2R7ZC 2WB1L 2R7ZK 5C4XC 3PO2K 3FKIK 2E2HC 5IYCK 2R92K 2JA7C 4C3JK 1R9TK 1WCMC 4A3FK 3S1MK 3HKZD 4Q4ZA 3M4OK 3GTMC 4A3LC 3GTOC 1Y1VK 2Y0SL 4YFNA 3S2HK 3S2HC 5IYDC 4A3KK 4Y52K 1I50C 4A3EK 2E2JK 4A3FC 4OIPA 4C3JC 5FJ8K 5C3EC 1XPPA 2R92C 4YG2A 4AYBL 3GTKK 3S15C 2WAQL 4A3IK 3RZOK 4Y7NK 3GTQK 1I6HK 3PO2C 3CQZK 1K83K 3HOZK 1BDFA 2A68A 3S1RC 2VUMC 3HOUK 3S16C 2NVYC 2O5IA 2NVYK 3S2DC 3HOWC 3H3VD 1TWFK 3GTLK 2NVXC 4MQ9A 4BXXC 5IP7C 4QIWD 5TMFA 1Y1WK 3WODA 2YU9K 2JA8C 4OIRA 2NVTK 4OINA 4OIQA 4C2MC 5IP9K 4A3GC 2B63K 1TWCK 2JA5K 3CQZC 4LK1A 4A3KC 1SFOC 1IW7A 4A93K 2JA6K 3S1NC 2PMZL 1TWGC 5C3EK 4BBRC 1TWCC 4MEYA 2E2IC 3GTPC 1R9TC 3S1MC 1WCMK 4BBRK 4C3IC 2E2IK 2JA7K 2R93K 5C4JC 3DXJA 5IYDK 4OIOA 2JA6C 1SFOK 3GTOK 2O5JA 5IP7K 4BXXK 2WB1D 3GTGC 4Q5SA 5M3FK 2NVQK 4A3BK 4X6AK 4KN7A 4XLNA 4A3DK 1TWFC 4BY7C 2NVTC 3S2DK 3RZDC 3S1RK 4A3CK 4LK0A 2A69A 4G7OA 1SMYA 3GTJC 3HOYK 4XSZA 3H0GK 4A3IC 3RZOC 4XLPA 3RZDK 4BY7K 4QIWL 1TWHC 2R93C 4YFKA 1K83C 2E2JC 1I50K 5M3MK 3HOXC 3S17C 4GZYA 3K7AC 5IYBC 3GTPK 3S1QC 3EQLA 4C3IK 1I3QK 1I3QC 5IP9C 3I4NK 1TWHK 5M5XK 3I4MK 3S1NK 3FKIC 3K7AK 2A6EA 4QJVA 2YU9C 4A93C 5IYBK 3HOXK 1ZYRA 4XSXA 3HOYC 4LJZA 1HQMA 2B63C 2PA8L 2NVXK 2A6HA 4C2MK 4A3GK 4BBSK 4A3MC 4ZH4A 2E2HK 3HOVC 3S14C 5M5YK 4G7HA 2Y0SD 5D4DA 4MEXA 4A3DC 3GTJK 4BY1C 4BY1K 4X6AC 3GTGK 3HOWK 3GTQC 1I6HC 4Y7NC 2WAQD 3HOVK 3S14K 5TMCA 5C4JK 3M3YC 4JK1A 4A3MK 5FLMK 3I4NC 4A3JK 3GTKC 1I6VA 3HOZC 2PA8D 2NVQC 4A3BC 1YNJA 1TWGK 3S1QK 2PPBA 1TWAK 5C44K 1TWAC 5C44C 3S15K 1Y1VC 2CW0A 4NOIA 3M4OC 3I4MC 4A3LK 4AYBD 3PO3K 4QJVB 3PO3C 4A3EC 3H3VL 5FLMC 4Y52C
chains in the Genus database with same CATH superfamily
3H0GC 1ZQ1C 4YFXA 2JA5C 3M3YK 4WFAS 3S16K 4GTAA 2BE5A 1YNNA 4GTFA 4BBSC 3GEHA 5IOQA 1PJ5A 1WIHA 2R92K 2JA7C 4GT9A 4C3JK 4A3FK 4Q4ZA 3M4OK 1Y1VK 3GTOC 5IOSA 4LR2A 1J6WA 4A3EK 4A3FC 4OIPA 5FJ8K 3GTKK 2R92C 4A3IK 4Y7NK 2JA7A 1F9NA 1XZQA 3PO2C 1BDFA 3S16C 2NVYK 3BUEA 3V4GA 5JVHS 3FKIA 4IOCS 4OIRA 4OINA 2CFAB 4KM9A 3CQZC 4A3KC 1J98A 1SFOC 2CFAA 2RGRA 3S1NC 1TWGC 5C3EK 3S1MC 3FOFA 4BLBA 1ZVUA 1BGWA 4KC6A 2JA5A 4J3NA 4BXXK 2WB1D 4A3BK 4BY7C 2NVTC 2XCRB 5EGHA 1WOOA 2KWAA 3IPJA 4LK0A 2ZJPS 2GAGC 3HOYK 1B4BA 4KDDA 4XLPA 3GDZA 1EI6A 2YU9A 2E2JC 3HOXC 3S17C 4GTDA 1YCLA 3N3YA 1IE0A 1I3QK 2PHCB 2Y3PA 1I3QC 1I50A 3I4NK 3FKIC 2A6EA 3HOXK 4XSXA 1HQMA 2A6HA 1O25A 3L4KA 4A3MC 1IS1A 1VGXA 5M5YK 5D4DA 4MEXA 1KQ4A 3HOWK 4Y7NC 3A8KA 4P5AA 4A3MK 3GTKC 3T00A 4A3BC 2L3UA 1YNJA 2PPBA 4NOIA 4A3LK 1XXCA 3PO3K 1UV7A 4Y52C 1DD5A 3S17K 1O2BA 3BP8C 4GFQA 3T01A 5TJ3A 4KAWX 2ZUFA 3GSIA 4G0WA 3GTLC 5IYCC 3LYWA 3N0BA 4KMAA 5DM7S 3HOUC 2VUMK 1IBAA 4KN4A 4G7ZA 5C4XC 1J6VA 1I3QA 1AB4A 3FKIK 5IYCK 3SZZA 3S1MK 2R93A 3SZYA 3HKZD 3GTMC 2Y0SL 1I50C 2E2JK 1XZQB 2R92A 1VH2A 4WILA 3CQZK 3OREA 3GEIA 3S1RC 2A68A 5HQHA 2NVYC 4WFNS 1TWFK 3GTLK 1EK8A 1Y1WK 3GTPA 3WODA 2YU9K 2JA8C 4OIQA 1IL2A 2V6UA 2NVYA 2FQTA 4C45A 2JA6K 4G0VA 4PAAA 2PMZL 4WCES 1TWCA 3TTGA 4BBRC 1TWGA 4BBRK 1R9TC 4U67S 3AD8C 3DXJA 2JA6C 1GE9A 1BS2A 2O5JA 3L4JA 1IQ0A 1XXBA 5M3FK 4A3DK 1K83A 1WQHA 2A69A 1SMYA 3GTJC 4P5BA 3H0GK 3RZOC 3RZDK 2R93C 4YFKA 1F7VA 4GZYA 5IYBC 3FOEA 4DDQA 4GTEA 1VRQC 1VLOA 4KMHA 3I4MK 5IOTA 5IYBK 2YU9C 4ILDA 5CHPA 4PABA 1EQRA 3G4CA 1O2AA 2B63C 2NVXK 2L5NA 4A3GK 2ZJQS 3CF5S 3S14C 3NUHA 3MMLB 2Y0SD 1C0AA 1TWAA 4X6AC 3GTGK 3GTQA 3S14K 2EBBA 5TMCA 2KXYA 3LAJA 1TWGK 5C44K 1YX2A 5C44C 3S15K 1USMA 4AYBD 2KPUA 4WJ4A 5M5WK 3H0GA 5C4XK 1WQGA 1WQFA 3ERED 4A3CC 2PMZD 3GTLA 2JA8K 1Y1WC 2E2IA 1DCOA 4KB4A 2R7ZC 4C3HC 2R7ZK 3PO2K 4P9SA 3TFJA 1TWFA 1R9TK 1WCMC 5JVGS 4KB2A 4A3LC 1V5VA 3S2HK 4YFNA 3GTMA 3S2HC 2D6FC 1X31C 5IORA 2XCOA 4C3JC 1XPPA 3HXAA 4BKWA 2NVXA 5JVOA 3S15C 2WAQL 3RZOK 1INNA 3GTQK 1K83K 1F7UA 4GTBA 3T02A 2O5IA 4WJ3M 3S2DC 4GTLA 4MQ9A 4AH6A 4G0UA 5TMFA 1O24A 2NVTK 4A3GC 3JSTA 2B63K 4LK1A 1IW7A 4A93K 3PIOS 4KM8A 3CAGA 2E2IC 1TWCC 3GTPK 3GTPC 2E2IK 1Y1WA 3ADAC 4C3IC 1JOEA 1RU0A 5IYDK 4OIOA 4KATA 1WORA 1SFOK 4LQYA 5IP7K 5JFEA 3GTGC 4X6AK 3QX3A 2GSUA 1TWFC 3RZDC 3S1RK 4G7OA 4XSZA 1DCPA 1WOPA 3GTGA 1WCMA 1K83C 1I50K 5M3MK 1DCHA 3AQPA 4IOAS 2GSNA 1TWHK 5M5XK 1ZXOA 1ZBSA 3PIPS 1F93A 3GTOA 1O28A 2PA8L 4C2MK 4ZH4A 1O27A 4G7HA 3TFIA 3AD7C 4A3DC 1ISEA 4RMFA 4GTCA 2ZJRS 1PJ7A 1J6XA 5CJ9A 3GTQC 1R9TA 2WAQD 1USOA 5EGEA 5C4JK 3M3YC 5FLMK 3I4NC 1I6VA 3HOZC 5E68A 2PA8D 2V6TA 1TWAK 3AQOA 1TWAC 1Y1VC 2CW0A 3M4OC 3VA7A 4QJVB 5FLMC 1WSVA 2ZFZA 3GIRA 3GTJA 3GTMK 1BJTA 3HKZL 1L0WA 2E2HA 4C3HK 4WF9S 4KMUA 4LLGA 1WSRA 1WOSA 4LOWA 4KMDA 2WB1L 4M1XA 2P8TA 2E2HC 1TWHA 1B4AA 1O26A 2RH6A 2B63A 5IYDC 2R7ZA 4A3KK 4Y52K 2KQ1A 5C3EC 4AYBL 4YG2A 4FM9A 1JQWA 2GAHC 1I6HK 3GEEA 2ZUEA 3HOZK 3A8IA 1O29A 2VUMC 3HOUK 2JH3A 3CQZA 3HOWC 3H3VD 1SFOA 4IO9S 2NVXC 5L46A 4BXXC 2XCQA 1JVIA 5IP7C 4QIWD 3LAPA 3Q3QA 3G4AA 4C2MC 5IP9K 2VUMA 1TWCK 2JA5K 3AH5A 3H3VL 1Y1VA 3N0CA 4MEYA 1FEUA 1WCMK 2JA7K 2R93K 1XZPA 3AD9C 5C4JC 3S0XA 3FHZA 2JA6A 3GTKA 3GTOK 4O2DA 1XZPB 4Q5SA 2NVQK 2W7VA 4KN7A 4XLNA 3DLLS 1VJEA 3S2DK 4A3CK 3LPXA 1XXAA 4KASA 4A3IC 2GSOA 4WFBS 4BY7K 4QIWL 1TWHC 4BLAA 3TFHA 1PJ6A 5HL8A 2V6SA 5HL7S 3BP3A 3K7AC 3S1QC 3EQLA 4C3IK 3A8JA 4FZBA 2P5MA 5IP9C 4XCHA 3S1NK 3K7AK 4QJVA 4A93C 1ZYRA 3HOYC 4LJZA 4BBSK 2E2HK 5DM6S 3HOVC 3OPFA 3GTJK 4BY1C 4BY1K 1I6HC 3HOVK 1EH1A 4KARA 4JK1A 1EFWA 4A3JK 2NVQC 3S1QK 2FQOA 1O2FB 3I4MC 3OEPA 3PO3C 1G51A 4A3EC 1HI9A 4A3JC
chains in the Genus database with same CATH topology
3S17K 3H0GC 3GTMK 5M5WK 5C4XK 4YFXA 2JA5C 3HKZL 4C3HK 4A3CC 4KMUA 3GTLC 5IYCC 2PMZD 4LLGA 2JA8K 3M3YK 4A3JC 1Y1WC 3S16K 3HOUC 2VUMK 2BE5A 1YNNA 4BBSC 4KN4A 4C3HC 4G7ZA 2R7ZC 2WB1L 2R7ZK 5C4XC 3PO2K 3FKIK 2E2HC 5IYCK 2R92K 2JA7C 4C3JK 1R9TK 1WCMC 4A3FK 3S1MK 3HKZD 4Q4ZA 3M4OK 3GTMC 4A3LC 3GTOC 1Y1VK 2Y0SL 4YFNA 3S2HK 3S2HC 5IYDC 4A3KK 4Y52K 1I50C 4A3EK 2E2JK 4A3FC 4OIPA 4C3JC 5FJ8K 5C3EC 1XPPA 2R92C 4YG2A 4AYBL 3GTKK 3S15C 2WAQL 4A3IK 3RZOK 4Y7NK 3GTQK 1I6HK 3PO2C 3CQZK 1K83K 3HOZK 1BDFA 2A68A 3S1RC 2VUMC 3HOUK 3S16C 2NVYC 2O5IA 2NVYK 3S2DC 3HOWC 3H3VD 1TWFK 3GTLK 2NVXC 4MQ9A 4BXXC 5IP7C 4QIWD 5TMFA 1Y1WK 3WODA 2YU9K 2JA8C 4OIRA 2NVTK 4OINA 4OIQA 4C2MC 5IP9K 4A3GC 2B63K 1TWCK 2JA5K 3CQZC 4LK1A 4A3KC 1SFOC 1IW7A 4A93K 2JA6K 3S1NC 2PMZL 1TWGC 5C3EK 4BBRC 1TWCC 4MEYA 2E2IC 3GTPC 1R9TC 3S1MC 1WCMK 4BBRK 4C3IC 2E2IK 2JA7K 2R93K 5C4JC 3DXJA 5IYDK 4OIOA 2JA6C 1SFOK 3GTOK 2O5JA 5IP7K 4BXXK 2WB1D 3GTGC 4Q5SA 5M3FK 2NVQK 4A3BK 4X6AK 4KN7A 4XLNA 4A3DK 1TWFC 4BY7C 2NVTC 3S2DK 3RZDC 3S1RK 4A3CK 4LK0A 2A69A 4G7OA 1SMYA 3GTJC 3HOYK 4XSZA 3H0GK 4A3IC 3RZOC 4XLPA 3RZDK 4BY7K 4QIWL 1TWHC 2R93C 4YFKA 1K83C 2E2JC 1I50K 5M3MK 3HOXC 3S17C 4GZYA 3K7AC 5IYBC 3GTPK 3S1QC 3EQLA 4C3IK 1I3QK 1I3QC 5IP9C 3I4NK 1TWHK 5M5XK 3I4MK 3S1NK 3FKIC 3K7AK 2A6EA 4QJVA 2YU9C 4A93C 5IYBK 3HOXK 1ZYRA 4XSXA 3HOYC 4LJZA 1HQMA 2B63C 2PA8L 2NVXK 2A6HA 4C2MK 4A3GK 4BBSK 4A3MC 4ZH4A 2E2HK 3HOVC 3S14C 5M5YK 4G7HA 2Y0SD 5D4DA 4MEXA 4A3DC 3GTJK 4BY1C 4BY1K 4X6AC 3GTGK 3HOWK 3GTQC 1I6HC 4Y7NC 2WAQD 3HOVK 3S14K 5TMCA 5C4JK 3M3YC 4JK1A 4A3MK 5FLMK 3I4NC 4A3JK 3GTKC 1I6VA 3HOZC 2PA8D 2NVQC 4A3BC 1YNJA 1TWGK 3S1QK 2PPBA 1TWAK 5C44K 1TWAC 5C44C 3S15K 1Y1VC 2CW0A 4NOIA 3M4OC 3I4MC 4A3LK 4AYBD 3PO3K 4QJVB 3PO3C 4A3EC 3H3VL 5FLMC 4Y52C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S17 K;  3H0G C;  3GTM K;  5M5W K;  5C4X K;  4YFX A;  2JA5 C;  3HKZ L;  4C3H K;  4A3C C;  4KMU A;  3GTL C;  5IYC C;  2PMZ D;  4LLG A;  2JA8 K;  3M3Y K;  4A3J C;  1Y1W C;  3S16 K;  3HOU C;  2VUM K;  2BE5 A;  1YNN A;  4BBS C;  4KN4 A;  4C3H C;  4G7Z A;  2R7Z C;  2WB1 L;  2R7Z K;  5C4X C;  3PO2 K;  3FKI K;  2E2H C;  5IYC K;  2R92 K;  2JA7 C;  4C3J K;  1R9T K;  1WCM C;  4A3F K;  3S1M K;  3HKZ D;  4Q4Z A;  3M4O K;  3GTM C;  4A3L C;  3GTO C;  1Y1V K;  2Y0S L;  4YFN A;  3S2H K;  3S2H C;  5IYD C;  4A3K K;  4Y52 K;  1I50 C;  4A3E K;  2E2J K;  4A3F C;  4OIP A;  4C3J C;  5FJ8 K;  5C3E C;  1XPP A;  2R92 C;  4YG2 A;  4AYB L;  3GTK K;  3S15 C;  2WAQ L;  4A3I K;  3RZO K;  4Y7N K;  3GTQ K;  1I6H K;  3PO2 C;  3CQZ K;  1K83 K;  3HOZ K;  1BDF A;  2A68 A;  3S1R C;  2VUM C;  3HOU K;  3S16 C;  2NVY C;  2O5I A;  2NVY K;  3S2D C;  3HOW C;  3H3V D;  1TWF K;  3GTL K;  2NVX C;  4MQ9 A;  4BXX C;  5IP7 C;  4QIW D;  5TMF A;  1Y1W K;  3WOD A;  2YU9 K;  2JA8 C;  4OIR A;  2NVT K;  4OIN A;  4OIQ A;  4C2M C;  5IP9 K;  4A3G C;  2B63 K;  1TWC K;  2JA5 K;  3CQZ C;  4LK1 A;  4A3K C;  1SFO C;  1IW7 A;  4A93 K;  2JA6 K;  3S1N C;  2PMZ L;  1TWG C;  5C3E K;  4BBR C;  1TWC C;  4MEY A;  2E2I C;  3GTP C;  1R9T C;  3S1M C;  1WCM K;  4BBR K;  4C3I C;  2E2I K;  2JA7 K;  2R93 K;  5C4J C;  3DXJ A;  5IYD K;  4OIO A;  2JA6 C;  1SFO K;  3GTO K;  2O5J A;  5IP7 K;  4BXX K;  2WB1 D;  3GTG C;  4Q5S A;  5M3F K;  2NVQ K;  4A3B K;  4X6A K;  4KN7 A;  4XLN A;  4A3D K;  1TWF C;  4BY7 C;  2NVT C;  3S2D K;  3RZD C;  3S1R K;  4A3C K;  4LK0 A;  2A69 A;  4G7O A;  1SMY A;  3GTJ C;  3HOY K;  4XSZ A;  3H0G K;  4A3I C;  3RZO C;  4XLP A;  3RZD K;  4BY7 K;  4QIW L;  1TWH C;  2R93 C;  4YFK A;  1K83 C;  2E2J C;  1I50 K;  5M3M K;  3HOX C;  3S17 C;  4GZY A;  3K7A C;  5IYB C;  3GTP K;  3S1Q C;  3EQL A;  4C3I K;  1I3Q K;  1I3Q C;  5IP9 C;  3I4N K;  1TWH K;  5M5X K;  3I4M K;  3S1N K;  3FKI C;  3K7A K;  2A6E A;  4QJV A;  2YU9 C;  4A93 C;  5IYB K;  3HOX K;  1ZYR A;  4XSX A;  3HOY C;  4LJZ A;  1HQM A;  2B63 C;  2PA8 L;  2NVX K;  2A6H A;  4C2M K;  4A3G K;  4BBS K;  4A3M C;  4ZH4 A;  2E2H K;  3HOV C;  3S14 C;  5M5Y K;  4G7H A;  2Y0S D;  5D4D A;  4MEX A;  4A3D C;  3GTJ K;  4BY1 C;  4BY1 K;  4X6A C;  3GTG K;  3HOW K;  3GTQ C;  1I6H C;  4Y7N C;  2WAQ D;  3HOV K;  3S14 K;  5TMC A;  5C4J K;  3M3Y C;  4JK1 A;  4A3M K;  5FLM K;  3I4N C;  4A3J K;  3GTK C;  1I6V A;  3HOZ C;  2PA8 D;  2NVQ C;  4A3B C;  1YNJ A;  1TWG K;  3S1Q K;  2PPB A;  1TWA K;  5C44 K;  1TWA C;  5C44 C;  3S15 K;  1Y1V C;  2CW0 A;  4NOI A;  3M4O C;  3I4M C;  4A3L K;  4AYB D;  3PO3 K;  4QJV B;  3PO3 C;  4A3E C;  3H3V L;  5FLM C;  4Y52 C; 
#chains in the Genus database with same CATH topology
 3H0G C;  1ZQ1 C;  4YFX A;  2JA5 C;  3M3Y K;  4WFA S;  3S16 K;  4GTA A;  2BE5 A;  1YNN A;  4GTF A;  4BBS C;  3GEH A;  5IOQ A;  1PJ5 A;  1WIH A;  2R92 K;  2JA7 C;  4GT9 A;  4C3J K;  4A3F K;  4Q4Z A;  3M4O K;  1Y1V K;  3GTO C;  5IOS A;  4LR2 A;  1J6W A;  4A3E K;  4A3F C;  4OIP A;  5FJ8 K;  3GTK K;  2R92 C;  4A3I K;  4Y7N K;  2JA7 A;  1F9N A;  1XZQ A;  3PO2 C;  1BDF A;  3S16 C;  2NVY K;  3BUE A;  3V4G A;  5JVH S;  3FKI A;  4IOC S;  4OIR A;  4OIN A;  2CFA B;  4KM9 A;  3CQZ C;  4A3K C;  1J98 A;  1SFO C;  2CFA A;  2RGR A;  3S1N C;  1TWG C;  5C3E K;  3S1M C;  3FOF A;  4BLB A;  1ZVU A;  1BGW A;  4KC6 A;  2JA5 A;  4J3N A;  4BXX K;  2WB1 D;  4A3B K;  4BY7 C;  2NVT C;  2XCR B;  5EGH A;  1WOO A;  2KWA A;  3IPJ A;  4LK0 A;  2ZJP S;  2GAG C;  3HOY K;  1B4B A;  4KDD A;  4XLP A;  3GDZ A;  1EI6 A;  2YU9 A;  2E2J C;  3HOX C;  3S17 C;  4GTD A;  1YCL A;  3N3Y A;  1IE0 A;  1I3Q K;  2PHC B;  2Y3P A;  1I3Q C;  1I50 A;  3I4N K;  3FKI C;  2A6E A;  3HOX K;  4XSX A;  1HQM A;  2A6H A;  1O25 A;  3L4K A;  4A3M C;  1IS1 A;  1VGX A;  5M5Y K;  5D4D A;  4MEX A;  1KQ4 A;  3HOW K;  4Y7N C;  3A8K A;  4P5A A;  4A3M K;  3GTK C;  3T00 A;  4A3B C;  2L3U A;  1YNJ A;  2PPB A;  4NOI A;  4A3L K;  1XXC A;  3PO3 K;  1UV7 A;  4Y52 C;  1DD5 A;  3S17 K;  1O2B A;  3BP8 C;  4GFQ A;  3T01 A;  5TJ3 A;  4KAW X;  2ZUF A;  3GSI A;  4G0W A;  3GTL C;  5IYC C;  3LYW A;  3N0B A;  4KMA A;  5DM7 S;  3HOU C;  2VUM K;  1IBA A;  4KN4 A;  4G7Z A;  5C4X C;  1J6V A;  1I3Q A;  1AB4 A;  3FKI K;  5IYC K;  3SZZ A;  3S1M K;  2R93 A;  3SZY A;  3HKZ D;  3GTM C;  2Y0S L;  1I50 C;  2E2J K;  1XZQ B;  2R92 A;  1VH2 A;  4WIL A;  3CQZ K;  3ORE A;  3GEI A;  3S1R C;  2A68 A;  5HQH A;  2NVY C;  4WFN S;  1TWF K;  3GTL K;  1EK8 A;  1Y1W K;  3GTP A;  3WOD A;  2YU9 K;  2JA8 C;  4OIQ A;  1IL2 A;  2V6U A;  2NVY A;  2FQT A;  4C45 A;  2JA6 K;  4G0V A;  4PAA A;  2PMZ L;  4WCE S;  1TWC A;  3TTG A;  4BBR C;  1TWG A;  4BBR K;  1R9T C;  4U67 S;  3AD8 C;  3DXJ A;  2JA6 C;  1GE9 A;  1BS2 A;  2O5J A;  3L4J A;  1IQ0 A;  1XXB A;  5M3F K;  4A3D K;  1K83 A;  1WQH A;  2A69 A;  1SMY A;  3GTJ C;  4P5B A;  3H0G K;  3RZO C;  3RZD K;  2R93 C;  4YFK A;  1F7V A;  4GZY A;  5IYB C;  3FOE A;  4DDQ A;  4GTE A;  1VRQ C;  1VLO A;  4KMH A;  3I4M K;  5IOT A;  5IYB K;  2YU9 C;  4ILD A;  5CHP A;  4PAB A;  1EQR A;  3G4C A;  1O2A A;  2B63 C;  2NVX K;  2L5N A;  4A3G K;  2ZJQ S;  3CF5 S;  3S14 C;  3NUH A;  3MML B;  2Y0S D;  1C0A A;  1TWA A;  4X6A C;  3GTG K;  3GTQ A;  3S14 K;  2EBB A;  5TMC A;  2KXY A;  3LAJ A;  1TWG K;  5C44 K;  1YX2 A;  5C44 C;  3S15 K;  1USM A;  4AYB D;  2KPU A;  4WJ4 A;  5M5W K;  3H0G A;  5C4X K;  1WQG A;  1WQF A;  3ERE D;  4A3C C;  2PMZ D;  3GTL A;  2JA8 K;  1Y1W C;  2E2I A;  1DCO A;  4KB4 A;  2R7Z C;  4C3H C;  2R7Z K;  3PO2 K;  4P9S A;  3TFJ A;  1TWF A;  1R9T K;  1WCM C;  5JVG S;  4KB2 A;  4A3L C;  1V5V A;  3S2H K;  4YFN A;  3GTM A;  3S2H C;  2D6F C;  1X31 C;  5IOR A;  2XCO A;  4C3J C;  1XPP A;  3HXA A;  4BKW A;  2NVX A;  5JVO A;  3S15 C;  2WAQ L;  3RZO K;  1INN A;  3GTQ K;  1K83 K;  1F7U A;  4GTB A;  3T02 A;  2O5I A;  4WJ3 M;  3S2D C;  4GTL A;  4MQ9 A;  4AH6 A;  4G0U A;  5TMF A;  1O24 A;  2NVT K;  4A3G C;  3JST A;  2B63 K;  4LK1 A;  1IW7 A;  4A93 K;  3PIO S;  4KM8 A;  3CAG A;  2E2I C;  1TWC C;  3GTP K;  3GTP C;  2E2I K;  1Y1W A;  3ADA C;  4C3I C;  1JOE A;  1RU0 A;  5IYD K;  4OIO A;  4KAT A;  1WOR A;  1SFO K;  4LQY A;  5IP7 K;  5JFE A;  3GTG C;  4X6A K;  3QX3 A;  2GSU A;  1TWF C;  3RZD C;  3S1R K;  4G7O A;  4XSZ A;  1DCP A;  1WOP A;  3GTG A;  1WCM A;  1K83 C;  1I50 K;  5M3M K;  1DCH A;  3AQP A;  4IOA S;  2GSN A;  1TWH K;  5M5X K;  1ZXO A;  1ZBS A;  3PIP S;  1F93 A;  3GTO A;  1O28 A;  2PA8 L;  4C2M K;  4ZH4 A;  1O27 A;  4G7H A;  3TFI A;  3AD7 C;  4A3D C;  1ISE A;  4RMF A;  4GTC A;  2ZJR S;  1PJ7 A;  1J6X A;  5CJ9 A;  3GTQ C;  1R9T A;  2WAQ D;  1USO A;  5EGE A;  5C4J K;  3M3Y C;  5FLM K;  3I4N C;  1I6V A;  3HOZ C;  5E68 A;  2PA8 D;  2V6T A;  1TWA K;  3AQO A;  1TWA C;  1Y1V C;  2CW0 A;  3M4O C;  3VA7 A;  4QJV B;  5FLM C;  1WSV A;  2ZFZ A;  3GIR A;  3GTJ A;  3GTM K;  1BJT A;  3HKZ L;  1L0W A;  2E2H A;  4C3H K;  4WF9 S;  4KMU A;  4LLG A;  1WSR A;  1WOS A;  4LOW A;  4KMD A;  2WB1 L;  4M1X A;  2P8T A;  2E2H C;  1TWH A;  1B4A A;  1O26 A;  2RH6 A;  2B63 A;  5IYD C;  2R7Z A;  4A3K K;  4Y52 K;  2KQ1 A;  5C3E C;  4AYB L;  4YG2 A;  4FM9 A;  1JQW A;  2GAH C;  1I6H K;  3GEE A;  2ZUE A;  3HOZ K;  3A8I A;  1O29 A;  2VUM C;  3HOU K;  2JH3 A;  3CQZ A;  3HOW C;  3H3V D;  1SFO A;  4IO9 S;  2NVX C;  5L46 A;  4BXX C;  2XCQ A;  1JVI A;  5IP7 C;  4QIW D;  3LAP A;  3Q3Q A;  3G4A A;  4C2M C;  5IP9 K;  2VUM A;  1TWC K;  2JA5 K;  3AH5 A;  3H3V L;  1Y1V A;  3N0C A;  4MEY A;  1FEU A;  1WCM K;  2JA7 K;  2R93 K;  1XZP A;  3AD9 C;  5C4J C;  3S0X A;  3FHZ A;  2JA6 A;  3GTK A;  3GTO K;  4O2D A;  1XZP B;  4Q5S A;  2NVQ K;  2W7V A;  4KN7 A;  4XLN A;  3DLL S;  1VJE A;  3S2D K;  4A3C K;  3LPX A;  1XXA A;  4KAS A;  4A3I C;  2GSO A;  4WFB S;  4BY7 K;  4QIW L;  1TWH C;  4BLA A;  3TFH A;  1PJ6 A;  5HL8 A;  2V6S A;  5HL7 S;  3BP3 A;  3K7A C;  3S1Q C;  3EQL A;  4C3I K;  3A8J A;  4FZB A;  2P5M A;  5IP9 C;  4XCH A;  3S1N K;  3K7A K;  4QJV A;  4A93 C;  1ZYR A;  3HOY C;  4LJZ A;  4BBS K;  2E2H K;  5DM6 S;  3HOV C;  3OPF A;  3GTJ K;  4BY1 C;  4BY1 K;  1I6H C;  3HOV K;  1EH1 A;  4KAR A;  4JK1 A;  1EFW A;  4A3J K;  2NVQ C;  3S1Q K;  2FQO A;  1O2F B;  3I4M C;  3OEP A;  3PO3 C;  1G51 A;  4A3E C;  1HI9 A;  4A3J C; 
#chains in the Genus database with same CATH homology
 3S17 K;  3H0G C;  3GTM K;  5M5W K;  5C4X K;  4YFX A;  2JA5 C;  3HKZ L;  4C3H K;  4A3C C;  4KMU A;  3GTL C;  5IYC C;  2PMZ D;  4LLG A;  2JA8 K;  3M3Y K;  4A3J C;  1Y1W C;  3S16 K;  3HOU C;  2VUM K;  2BE5 A;  1YNN A;  4BBS C;  4KN4 A;  4C3H C;  4G7Z A;  2R7Z C;  2WB1 L;  2R7Z K;  5C4X C;  3PO2 K;  3FKI K;  2E2H C;  5IYC K;  2R92 K;  2JA7 C;  4C3J K;  1R9T K;  1WCM C;  4A3F K;  3S1M K;  3HKZ D;  4Q4Z A;  3M4O K;  3GTM C;  4A3L C;  3GTO C;  1Y1V K;  2Y0S L;  4YFN A;  3S2H K;  3S2H C;  5IYD C;  4A3K K;  4Y52 K;  1I50 C;  4A3E K;  2E2J K;  4A3F C;  4OIP A;  4C3J C;  5FJ8 K;  5C3E C;  1XPP A;  2R92 C;  4YG2 A;  4AYB L;  3GTK K;  3S15 C;  2WAQ L;  4A3I K;  3RZO K;  4Y7N K;  3GTQ K;  1I6H K;  3PO2 C;  3CQZ K;  1K83 K;  3HOZ K;  1BDF A;  2A68 A;  3S1R C;  2VUM C;  3HOU K;  3S16 C;  2NVY C;  2O5I A;  2NVY K;  3S2D C;  3HOW C;  3H3V D;  1TWF K;  3GTL K;  2NVX C;  4MQ9 A;  4BXX C;  5IP7 C;  4QIW D;  5TMF A;  1Y1W K;  3WOD A;  2YU9 K;  2JA8 C;  4OIR A;  2NVT K;  4OIN A;  4OIQ A;  4C2M C;  5IP9 K;  4A3G C;  2B63 K;  1TWC K;  2JA5 K;  3CQZ C;  4LK1 A;  4A3K C;  1SFO C;  1IW7 A;  4A93 K;  2JA6 K;  3S1N C;  2PMZ L;  1TWG C;  5C3E K;  4BBR C;  1TWC C;  4MEY A;  2E2I C;  3GTP C;  1R9T C;  3S1M C;  1WCM K;  4BBR K;  4C3I C;  2E2I K;  2JA7 K;  2R93 K;  5C4J C;  3DXJ A;  5IYD K;  4OIO A;  2JA6 C;  1SFO K;  3GTO K;  2O5J A;  5IP7 K;  4BXX K;  2WB1 D;  3GTG C;  4Q5S A;  5M3F K;  2NVQ K;  4A3B K;  4X6A K;  4KN7 A;  4XLN A;  4A3D K;  1TWF C;  4BY7 C;  2NVT C;  3S2D K;  3RZD C;  3S1R K;  4A3C K;  4LK0 A;  2A69 A;  4G7O A;  1SMY A;  3GTJ C;  3HOY K;  4XSZ A;  3H0G K;  4A3I C;  3RZO C;  4XLP A;  3RZD K;  4BY7 K;  4QIW L;  1TWH C;  2R93 C;  4YFK A;  1K83 C;  2E2J C;  1I50 K;  5M3M K;  3HOX C;  3S17 C;  4GZY A;  3K7A C;  5IYB C;  3GTP K;  3S1Q C;  3EQL A;  4C3I K;  1I3Q K;  1I3Q C;  5IP9 C;  3I4N K;  1TWH K;  5M5X K;  3I4M K;  3S1N K;  3FKI C;  3K7A K;  2A6E A;  4QJV A;  2YU9 C;  4A93 C;  5IYB K;  3HOX K;  1ZYR A;  4XSX A;  3HOY C;  4LJZ A;  1HQM A;  2B63 C;  2PA8 L;  2NVX K;  2A6H A;  4C2M K;  4A3G K;  4BBS K;  4A3M C;  4ZH4 A;  2E2H K;  3HOV C;  3S14 C;  5M5Y K;  4G7H A;  2Y0S D;  5D4D A;  4MEX A;  4A3D C;  3GTJ K;  4BY1 C;  4BY1 K;  4X6A C;  3GTG K;  3HOW K;  3GTQ C;  1I6H C;  4Y7N C;  2WAQ D;  3HOV K;  3S14 K;  5TMC A;  5C4J K;  3M3Y C;  4JK1 A;  4A3M K;  5FLM K;  3I4N C;  4A3J K;  3GTK C;  1I6V A;  3HOZ C;  2PA8 D;  2NVQ C;  4A3B C;  1YNJ A;  1TWG K;  3S1Q K;  2PPB A;  1TWA K;  5C44 K;  1TWA C;  5C44 C;  3S15 K;  1Y1V C;  2CW0 A;  4NOI A;  3M4O C;  3I4M C;  4A3L K;  4AYB D;  3PO3 K;  4QJV B;  3PO3 C;  4A3E C;  3H3V L;  5FLM C;  4Y52 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...