4XLPA

Crystal structure of t.aquaticus transcription initiation complex containing upstream fork promoter
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
227
structure length
227
Chain Sequence
KAPVFTATTQGDHYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLDPKMASTTLILRAEGPKEVRAGDFTPSADVEIMNPDLHIATLEEGGKLYMEVRVDRGVGYVPAERHGIKDRINAIPVDAIFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVAILKEHLNYFANPEASLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase subunit alpha
publication title Structure of a bacterial RNA polymerase holoenzyme open promoter complex.
pubmed doi rcsb
source organism Thermus aquaticus
molecule tags Transcription/dna
total genus 40
structure length 227
sequence length 227
chains with identical sequence B, G, H
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2015-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01000 RNA_pol_A_bac RNA polymerase Rpb3/RpoA insert domain
A PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain
A PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.12 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 DNA-directed RNA polymerase, insert domain 4xlpA02
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 4xlpA01
4A3DK 4LJZA 2B63C 5D4DA 3GTMK 1Y1WK 5FJ8K 4BBRK 4Y7NK 2R93K 3HOWK 4Y52K 1TWGC 3GTKC 3HOZK 1XPPA 1WCMK 4BY1K 4G7OA 3WODA 3EQLA 4OIOA 5C4JC 2VUMK 2E2JC 3S1MC 4MQ9A 2WAQL 2R7ZK 5IP7K 3GTQK 4A3MC 3H0GC 1R9TC 3HOVK 4ZH4A 3I4MK 3S1QK 2NVQC 4XSZA 4LK0A 2CW0A 4GZYA 3DXJA 2WB1L 4C3HK 5M3FK 4BY7K 4OIRA 3HOYK 3GTGC 3PO2K 5TMCA 5IYDK 4A3FC 3GTOC 3S2HK 4A3BC 4BXXK 5IYBC 1I3QK 4A3LC 3S2DK 3GTPC 4LK1A 2JA6C 5IP9C 2JA7C 3CQZK 5FLMC 2E2IC 2NVYK 4AYBD 4A3KC 1K83K 4A3EK 3H3VL 3S15K 4C3IK 2E2HK 3K7AC 4X6AC 4A93C 4C2MK 1BDFA 4A3IC 1TWAK 3S14K 5IYCC 3S16C 1I6HK 4JK1A 1SFOC 4QJVB 3GTJK 1TWCC 2PMZL 3GTLK 4A3GK 2R92C 4BBSC 3RZDK 5C4XC 4YG2A 3HOUC 4C3JK 2A6HA 4A3DC 3M3YK 5C3EC 3RZOK 1TWFC 5M5WK 1Y1WC 4MEXA 4Y7NC 4BBRC 1Y1VC 3FKIC 3HKZL 4A3JK 3I4NK 2NVTK 3HOWC 3M4OK 1I6VA 2Y0SL 4NOIA 4YFNA 3HOZC 2JA5K 3S1NK 4QIWD 3PO3C 2PA8L 4YFXA 2O5IA 2VUMC 4XSXA 4KMUA 2R7ZC 4OIQA 2BE5A 3I4MC 5TMFA 5M3MK 3S1QC 3GTGK 3S17K 4A3FK 2YU9C 2NVXK 2JA8C 3GTOK 3S1RK 1I50K 3HOXK 1TWHK 2JA6K 5C44C 3HOYC 4Q4ZA 3PO2C 5IYDC 2E2IK 3S2HC 2A68A 2B63K 1ZYRA 1I3QC 1IW7A 4G7HA 2WAQD 3S2DC 4A3CC 4KN7A 4X6AK 3CQZC 1TWGK 2NVYC 3GTKK 1K83C 1SMYA 4C3IC 2E2HC 3GTMC 4C2MC 2WB1D 1TWAC 3S14C 1I6HC 2R93C 4Y52C 5C4JK 2E2JK 3S1MK 1WCMC 3GTJC 4BY1C 4KN4A 4XLNA 3GTLC 5C3EK 3H0GK 4A3MK 1R9TK 4G7ZA 1TWFK 3RZDC 4AYBL 2NVQK 4C3JC 1Y1VK 3FKIK 1YNJA 4OINA 3H3VD 5IP7C 3GTQC 3M3YC 4MEYA 3RZOC 3HOVC 3PO3K 4YFKA 3I4NC 5M5YK 4A3JC 4A3BK 2NVTC 4XLPA 4C3HC 3M4OC 5IYBK 4BY7C 3GTPK 4A3LK 2PMZD 2JA5C 3S1NC 5IP9K 2JA7K 2O5JA 5FLMK 5M5XK 2PPBA 4LLGA 4A3KK 4Q5SA 4BXXC 4OIPA 2A6EA 3K7AK 4A93K 4A3IK 2YU9K 5IYCK 2JA8K 3S16K 1SFOK 2A69A 4A3EC 3S15C 5C44K 3HKZD 1TWCK 3S17C 2R92K 2NVXC 4BBSK 2Y0SD 4QIWL 1HQMA 5C4XK 4A3CK 3S1RC 1I50C 2PA8D 1TWHC 1YNNA 3HOXC 3HOUK 4QJVA 4A3GC
chains in the Genus database with same CATH superfamily
4LJZA 1ZQ1C 1INNA 3T00A 5FJ8K 1J6WA 3HOWK 4Y52K 4BLBA 4KMDA 3ADAC 4BY1K 3WODA 3EQLA 4OIOA 4GT9A 2VUMK 2E2JC 3GDZA 3AD8C 2R7ZK 1TWFA 1VJEA 3DXJA 4C3HK 5M3FK 4BY7K 2FQOA 2GAGC 3HOYK 1L0WA 4A3BC 4LK1A 1XZQA 4LQYA 3CAGA 2JA7C 3CQZK 2R7ZA 3OEPA 2NVYK 1F9NA 4C2MK 4WFAS 3GEEA 1SFOC 2ZJQS 3AQOA 1TWCC 4BBSC 4YG2A 2V6TA 3CQZA 1ISEA 3M3YK 2NVYA 1F7UA 5TJ3A 5M5WK 1Y1WC 4MEXA 3HKZL 4GFQA 1I6VA 1X31C 4P5BA 2P5MA 4YFXA 2O5IA 4BKWA 4PAAA 4OIQA 3GTQA 1IE0A 2JA8C 3V4GA 1JOEA 4KASA 3JSTA 1J6VA 1VH2A 1XZPA 1ZYRA 1I3QC 3S2DC 1HI9A 4A3CC 4X6AK 2ZFZA 1G51A 1K83C 1O2BA 4Y52C 2E2JK 1DCHA 4BY1C 3GTLC 2GSOA 3OPFA 5C3EK 3RZDC 5EGEA 3LAPA 1Y1VK 4GTLA 2ZUEA 3PO3K 1O25A 3ERED 1WQFA 4A3BK 2NVTC 4C3HC 4KATA 4BY7C 3S1NC 2JA7K 2O5JA 1PJ6A 4Q5SA 4OIPA 2D6FC 1SFOK 3OREA 3HKZD 1TWCK 2XCRB 1B4AA 1XXCA 2NVXC 4PABA 4BBSK 1HQMA 3S1RC 3L4KA 2JA7A 5CJ9A 1F93A 5E68A 5D4DA 3GTMK 1Y1WK 1TWGA 3FOEA 1JQWA 1TWCA 3BP8C 5C4JC 3AH5A 4RMFA 4M1XA 4A3MC 3A8JA 3HOVK 4ZH4A 3TTGA 1Y1WA 2NVQC 5DM6S 4LK0A 4GZYA 3MMLB 4OIRA 5DM7S 1I3QK 3S2DK 3N3YA 1YX2A 4A3KC 1K83K 5JVHS 4X6AC 4WJ3M 4JK1A 3GTLK 1J98A 3QX3A 4A3GK 2R92C 1I3QA 3RZDK 5C4XC 1C0AA 1USOA 5HQHA 3HOUC 1DD5A 4A3DC 1GE9A 1K83A 5C3EC 4Y7NC 4BBRC 1Y1VC 1WOPA 2NVTK 1ZXOA 4NOIA 3HOZC 3S1NK 2PA8L 3PO3C 3GTLA 4KMHA 1EFWA 4G0VA 4U67S 1WQGA 2GAHC 3S0XA 1F7VA 2VUMA 4AH6A 4KMUA 1BJTA 1AB4A 3S1QC 1VGXA 3GTGK 2NVXK 3GTOK 1XZQB 3S1RK 2JA6K 3NUHA 3PO2C 4KAWX 2E2IK 3G4CA 4G7HA 1IW7A 1BGWA 4FM9A 1JVIA 1ZVUA 2CFAA 4C3IC 3GTMC 1J6XA 3SZYA 4G0UA 5C4JK 3LYWA 1V5VA 3A8KA 3GTJC 1IL2A 5JFEA 4P5AA 2ZJRS 4A3MK 4AYBL 2NVQK 4KDDA 4C3JC 1WOOA 5HL7S 3FKIK 4OINA 3T02A 3RZOC 3HOVC 1O28A 3I4NC 5M5YK 4A3JC 3AQPA 3SZZA 4XLPA 3M4OC 2JA5C 3TFIA 1ZBSA 4A3KK 4FZBA 4KMAA 2YU9K 3TFJA 5C44K 3S17C 1XZPB 2R92K 5C4XK 1I50C 2PA8D 3HOUK 2W7VA 4QJVA 4A3GC 4A3DK 2B63C 2KPUA 3HXAA 4KB4A 1WORA 1FEUA 5EGHA 4BBRK 4Y7NK 2R93K 3N0BA 3GTKC 3HOZK 1XPPA 1WCMK 3GSIA 2R92A 4KM9A 2PHCB 3S1MC 1O2FB 4MQ9A 3TFHA 5IP7K 3H0GC 1R9TC 3S1QK 4WILA 1Y1VA 3BUEA 3GTGC 3PO2K 5TMCA 3GTOC 4BXXK 5IYBC 2ZJPS 4A3LC 4WF9S 2JA6C 4GTEA 3FHZA 5FLMC 2E2IC 4A3EK 4AYBD 3S15K 3H3VL 4C3IK 4A93C 1BDFA 1KQ4A 5IYCC 3S16C 4GTAA 1SFOA 5CHPA 3GTJK 2PMZL 3GEHA 3N0CA 4C3JK 4WFBS 4BLAA 3RZOK 3GTMA 2KXYA 3I4NK 3FKIC 1WSVA 4A3JK 4J3NA 3M4OK 2JA5K 4XCHA 3GTJA 3LPXA 2JH3A 1IBAA 4XSXA 1PJ5A 2BE5A 3I4MC 3GIRA 3S17K 3PIOS 4A3FK 2YU9C 4KM8A 1I50K 2JA5A 2ZUFA 5C44C 4Q4ZA 3BP3A 5IYDC 3S2HC 2A68A 2B63K 4C45A 4KN7A 1EH1A 5IOQA 3GTKK 1SMYA 2E2HC 2V6UA 1TWAC 3S14C 1I6HC 2R93C 1XXBA 5L46A 1I50A 2Y3PA 3S1MK 2P8TA 1WCMC 4XLNA 3H0GK 1R9TK 2B63A 4G7ZA 1TWFK 3GEIA 3H3VD 5IP7C 1DCPA 3GTKA 3VA7A 4YFKA 5IYBK 4A3LK 2PMZD 4IOCS 5FLMK 5M5XK 2PPBA 3AD9C 4LLGA 3H0GA 1R9TA 4BXXC 4DDQA 2A6EA 4A93K 2KWAA 5IYCK 3S16K 3IPJA 4A3EC 3S15C 5IORA 3AD7C 3GTGA 2NVXA 3GTOA 4QIWL 1RU0A 2CFAB 2JA6A 3HOXC 1TWHC 1YNNA 2E2IA 1DCOA 1EK8A 1O27A 5JVOA 1WSRA 3PIPS 1TWGC 1WIHA 4G7OA 2WAQL 2GSNA 3L4JA 3GTQK 2XCQA 4P9SA 3I4MK 4XSZA 3FKIA 2CW0A 2WB1L 1UV7A 1IQ0A 1USMA 3CF5S 5IYDK 4A3FC 3S2HK 4ILDA 3GTPC 1VRQC 5IP9C 2L5NA 2E2HK 3K7AC 4GTDA 4GTFA 4A3IC 1TWAK 2YU9A 3S14K 1I6HK 3A8IA 4QJVB 1BS2A 2EBBA 4LOWA 2L3UA 2FQTA 2A6HA 4IOAS 2KQ1A 1WOSA 1TWFC 2E2HA 1TWAA 2R93A 3HOWC 2Y0SL 4YFNA 1WCMA 4QIWD 3T01A 2RH6A 2VUMC 2XCOA 3Q3QA 2R7ZC 5TMFA 4KC6A 5M3MK 5IOSA 4LR2A 1TWHK 3HOXK 3HOYC 2RGRA 1O2AA 1PJ7A 4WFNS 2WAQD 1WQHA 3CQZC 1TWGK 2NVYC 4GTCA 4WJ4A 4G0WA 1O26A 4C2MC 2WB1D 5JVGS 2GSUA 2V6SA 3G4AA 5IOTA 3FOFA 1TWHA 1IS1A 4KN4A 1B4BA 3LAJA 4WCES 1O24A 5HL8A 1YNJA 3GTQC 3M3YC 1EQRA 4MEYA 4KARA 4O2DA 1EI6A 1VLOA 3GTPK 5IP9K 4KB2A 3K7AK 4A3IK 2JA8K 1XXAA 2A69A 1O29A 2Y0SD 1YCLA 3GTPA 4A3CK 3DLLS 4IO9S 4GTBA
chains in the Genus database with same CATH topology
4A3DK 4LJZA 2B63C 5D4DA 3GTMK 1Y1WK 5FJ8K 4BBRK 4Y7NK 2R93K 3HOWK 4Y52K 1TWGC 3GTKC 3HOZK 1XPPA 1WCMK 4BY1K 4G7OA 3WODA 3EQLA 4OIOA 5C4JC 2VUMK 2E2JC 3S1MC 4MQ9A 2WAQL 2R7ZK 5IP7K 3GTQK 4A3MC 3H0GC 1R9TC 3HOVK 4ZH4A 3I4MK 3S1QK 2NVQC 4XSZA 4LK0A 2CW0A 4GZYA 3DXJA 2WB1L 4C3HK 5M3FK 4BY7K 4OIRA 3HOYK 3GTGC 3PO2K 5TMCA 5IYDK 4A3FC 3GTOC 3S2HK 4A3BC 4BXXK 5IYBC 1I3QK 4A3LC 3S2DK 3GTPC 4LK1A 2JA6C 5IP9C 2JA7C 3CQZK 5FLMC 2E2IC 2NVYK 4AYBD 4A3KC 1K83K 4A3EK 3H3VL 3S15K 4C3IK 2E2HK 3K7AC 4X6AC 4A93C 4C2MK 1BDFA 4A3IC 1TWAK 3S14K 5IYCC 3S16C 1I6HK 4JK1A 1SFOC 4QJVB 3GTJK 1TWCC 2PMZL 3GTLK 4A3GK 2R92C 4BBSC 3RZDK 5C4XC 4YG2A 3HOUC 4C3JK 2A6HA 4A3DC 3M3YK 5C3EC 3RZOK 1TWFC 5M5WK 1Y1WC 4MEXA 4Y7NC 4BBRC 1Y1VC 3FKIC 3HKZL 4A3JK 3I4NK 2NVTK 3HOWC 3M4OK 1I6VA 2Y0SL 4NOIA 4YFNA 3HOZC 2JA5K 3S1NK 4QIWD 3PO3C 2PA8L 4YFXA 2O5IA 2VUMC 4XSXA 4KMUA 2R7ZC 4OIQA 2BE5A 3I4MC 5TMFA 5M3MK 3S1QC 3GTGK 3S17K 4A3FK 2YU9C 2NVXK 2JA8C 3GTOK 3S1RK 1I50K 3HOXK 1TWHK 2JA6K 5C44C 3HOYC 4Q4ZA 3PO2C 5IYDC 2E2IK 3S2HC 2A68A 2B63K 1ZYRA 1I3QC 1IW7A 4G7HA 2WAQD 3S2DC 4A3CC 4KN7A 4X6AK 3CQZC 1TWGK 2NVYC 3GTKK 1K83C 1SMYA 4C3IC 2E2HC 3GTMC 4C2MC 2WB1D 1TWAC 3S14C 1I6HC 2R93C 4Y52C 5C4JK 2E2JK 3S1MK 1WCMC 3GTJC 4BY1C 4KN4A 4XLNA 3GTLC 5C3EK 3H0GK 4A3MK 1R9TK 4G7ZA 1TWFK 3RZDC 4AYBL 2NVQK 4C3JC 1Y1VK 3FKIK 1YNJA 4OINA 3H3VD 5IP7C 3GTQC 3M3YC 4MEYA 3RZOC 3HOVC 3PO3K 4YFKA 3I4NC 5M5YK 4A3JC 4A3BK 2NVTC 4XLPA 4C3HC 3M4OC 5IYBK 4BY7C 3GTPK 4A3LK 2PMZD 2JA5C 3S1NC 5IP9K 2JA7K 2O5JA 5FLMK 5M5XK 2PPBA 4LLGA 4A3KK 4Q5SA 4BXXC 4OIPA 2A6EA 3K7AK 4A93K 4A3IK 2YU9K 5IYCK 2JA8K 3S16K 1SFOK 2A69A 4A3EC 3S15C 5C44K 3HKZD 1TWCK 3S17C 2R92K 2NVXC 4BBSK 2Y0SD 4QIWL 1HQMA 5C4XK 4A3CK 3S1RC 1I50C 2PA8D 1TWHC 1YNNA 3HOXC 3HOUK 4QJVA 4A3GC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A3D K;  4LJZ A;  2B63 C;  5D4D A;  3GTM K;  1Y1W K;  5FJ8 K;  4BBR K;  4Y7N K;  2R93 K;  3HOW K;  4Y52 K;  1TWG C;  3GTK C;  3HOZ K;  1XPP A;  1WCM K;  4BY1 K;  4G7O A;  3WOD A;  3EQL A;  4OIO A;  5C4J C;  2VUM K;  2E2J C;  3S1M C;  4MQ9 A;  2WAQ L;  2R7Z K;  5IP7 K;  3GTQ K;  4A3M C;  3H0G C;  1R9T C;  3HOV K;  4ZH4 A;  3I4M K;  3S1Q K;  2NVQ C;  4XSZ A;  4LK0 A;  2CW0 A;  4GZY A;  3DXJ A;  2WB1 L;  4C3H K;  5M3F K;  4BY7 K;  4OIR A;  3HOY K;  3GTG C;  3PO2 K;  5TMC A;  5IYD K;  4A3F C;  3GTO C;  3S2H K;  4A3B C;  4BXX K;  5IYB C;  1I3Q K;  4A3L C;  3S2D K;  3GTP C;  4LK1 A;  2JA6 C;  5IP9 C;  2JA7 C;  3CQZ K;  5FLM C;  2E2I C;  2NVY K;  4AYB D;  4A3K C;  1K83 K;  4A3E K;  3H3V L;  3S15 K;  4C3I K;  2E2H K;  3K7A C;  4X6A C;  4A93 C;  4C2M K;  1BDF A;  4A3I C;  1TWA K;  3S14 K;  5IYC C;  3S16 C;  1I6H K;  4JK1 A;  1SFO C;  4QJV B;  3GTJ K;  1TWC C;  2PMZ L;  3GTL K;  4A3G K;  2R92 C;  4BBS C;  3RZD K;  5C4X C;  4YG2 A;  3HOU C;  4C3J K;  2A6H A;  4A3D C;  3M3Y K;  5C3E C;  3RZO K;  1TWF C;  5M5W K;  1Y1W C;  4MEX A;  4Y7N C;  4BBR C;  1Y1V C;  3FKI C;  3HKZ L;  4A3J K;  3I4N K;  2NVT K;  3HOW C;  3M4O K;  1I6V A;  2Y0S L;  4NOI A;  4YFN A;  3HOZ C;  2JA5 K;  3S1N K;  4QIW D;  3PO3 C;  2PA8 L;  4YFX A;  2O5I A;  2VUM C;  4XSX A;  4KMU A;  2R7Z C;  4OIQ A;  2BE5 A;  3I4M C;  5TMF A;  5M3M K;  3S1Q C;  3GTG K;  3S17 K;  4A3F K;  2YU9 C;  2NVX K;  2JA8 C;  3GTO K;  3S1R K;  1I50 K;  3HOX K;  1TWH K;  2JA6 K;  5C44 C;  3HOY C;  4Q4Z A;  3PO2 C;  5IYD C;  2E2I K;  3S2H C;  2A68 A;  2B63 K;  1ZYR A;  1I3Q C;  1IW7 A;  4G7H A;  2WAQ D;  3S2D C;  4A3C C;  4KN7 A;  4X6A K;  3CQZ C;  1TWG K;  2NVY C;  3GTK K;  1K83 C;  1SMY A;  4C3I C;  2E2H C;  3GTM C;  4C2M C;  2WB1 D;  1TWA C;  3S14 C;  1I6H C;  2R93 C;  4Y52 C;  5C4J K;  2E2J K;  3S1M K;  1WCM C;  3GTJ C;  4BY1 C;  4KN4 A;  4XLN A;  3GTL C;  5C3E K;  3H0G K;  4A3M K;  1R9T K;  4G7Z A;  1TWF K;  3RZD C;  4AYB L;  2NVQ K;  4C3J C;  1Y1V K;  3FKI K;  1YNJ A;  4OIN A;  3H3V D;  5IP7 C;  3GTQ C;  3M3Y C;  4MEY A;  3RZO C;  3HOV C;  3PO3 K;  4YFK A;  3I4N C;  5M5Y K;  4A3J C;  4A3B K;  2NVT C;  4XLP A;  4C3H C;  3M4O C;  5IYB K;  4BY7 C;  3GTP K;  4A3L K;  2PMZ D;  2JA5 C;  3S1N C;  5IP9 K;  2JA7 K;  2O5J A;  5FLM K;  5M5X K;  2PPB A;  4LLG A;  4A3K K;  4Q5S A;  4BXX C;  4OIP A;  2A6E A;  3K7A K;  4A93 K;  4A3I K;  2YU9 K;  5IYC K;  2JA8 K;  3S16 K;  1SFO K;  2A69 A;  4A3E C;  3S15 C;  5C44 K;  3HKZ D;  1TWC K;  3S17 C;  2R92 K;  2NVX C;  4BBS K;  2Y0S D;  4QIW L;  1HQM A;  5C4X K;  4A3C K;  3S1R C;  1I50 C;  2PA8 D;  1TWH C;  1YNN A;  3HOX C;  3HOU K;  4QJV A;  4A3G C; 
#chains in the Genus database with same CATH topology
 4LJZ A;  1ZQ1 C;  1INN A;  3T00 A;  5FJ8 K;  1J6W A;  3HOW K;  4Y52 K;  4BLB A;  4KMD A;  3ADA C;  4BY1 K;  3WOD A;  3EQL A;  4OIO A;  4GT9 A;  2VUM K;  2E2J C;  3GDZ A;  3AD8 C;  2R7Z K;  1TWF A;  1VJE A;  3DXJ A;  4C3H K;  5M3F K;  4BY7 K;  2FQO A;  2GAG C;  3HOY K;  1L0W A;  4A3B C;  4LK1 A;  1XZQ A;  4LQY A;  3CAG A;  2JA7 C;  3CQZ K;  2R7Z A;  3OEP A;  2NVY K;  1F9N A;  4C2M K;  4WFA S;  3GEE A;  1SFO C;  2ZJQ S;  3AQO A;  1TWC C;  4BBS C;  4YG2 A;  2V6T A;  3CQZ A;  1ISE A;  3M3Y K;  2NVY A;  1F7U A;  5TJ3 A;  5M5W K;  1Y1W C;  4MEX A;  3HKZ L;  4GFQ A;  1I6V A;  1X31 C;  4P5B A;  2P5M A;  4YFX A;  2O5I A;  4BKW A;  4PAA A;  4OIQ A;  3GTQ A;  1IE0 A;  2JA8 C;  3V4G A;  1JOE A;  4KAS A;  3JST A;  1J6V A;  1VH2 A;  1XZP A;  1ZYR A;  1I3Q C;  3S2D C;  1HI9 A;  4A3C C;  4X6A K;  2ZFZ A;  1G51 A;  1K83 C;  1O2B A;  4Y52 C;  2E2J K;  1DCH A;  4BY1 C;  3GTL C;  2GSO A;  3OPF A;  5C3E K;  3RZD C;  5EGE A;  3LAP A;  1Y1V K;  4GTL A;  2ZUE A;  3PO3 K;  1O25 A;  3ERE D;  1WQF A;  4A3B K;  2NVT C;  4C3H C;  4KAT A;  4BY7 C;  3S1N C;  2JA7 K;  2O5J A;  1PJ6 A;  4Q5S A;  4OIP A;  2D6F C;  1SFO K;  3ORE A;  3HKZ D;  1TWC K;  2XCR B;  1B4A A;  1XXC A;  2NVX C;  4PAB A;  4BBS K;  1HQM A;  3S1R C;  3L4K A;  2JA7 A;  5CJ9 A;  1F93 A;  5E68 A;  5D4D A;  3GTM K;  1Y1W K;  1TWG A;  3FOE A;  1JQW A;  1TWC A;  3BP8 C;  5C4J C;  3AH5 A;  4RMF A;  4M1X A;  4A3M C;  3A8J A;  3HOV K;  4ZH4 A;  3TTG A;  1Y1W A;  2NVQ C;  5DM6 S;  4LK0 A;  4GZY A;  3MML B;  4OIR A;  5DM7 S;  1I3Q K;  3S2D K;  3N3Y A;  1YX2 A;  4A3K C;  1K83 K;  5JVH S;  4X6A C;  4WJ3 M;  4JK1 A;  3GTL K;  1J98 A;  3QX3 A;  4A3G K;  2R92 C;  1I3Q A;  3RZD K;  5C4X C;  1C0A A;  1USO A;  5HQH A;  3HOU C;  1DD5 A;  4A3D C;  1GE9 A;  1K83 A;  5C3E C;  4Y7N C;  4BBR C;  1Y1V C;  1WOP A;  2NVT K;  1ZXO A;  4NOI A;  3HOZ C;  3S1N K;  2PA8 L;  3PO3 C;  3GTL A;  4KMH A;  1EFW A;  4G0V A;  4U67 S;  1WQG A;  2GAH C;  3S0X A;  1F7V A;  2VUM A;  4AH6 A;  4KMU A;  1BJT A;  1AB4 A;  3S1Q C;  1VGX A;  3GTG K;  2NVX K;  3GTO K;  1XZQ B;  3S1R K;  2JA6 K;  3NUH A;  3PO2 C;  4KAW X;  2E2I K;  3G4C A;  4G7H A;  1IW7 A;  1BGW A;  4FM9 A;  1JVI A;  1ZVU A;  2CFA A;  4C3I C;  3GTM C;  1J6X A;  3SZY A;  4G0U A;  5C4J K;  3LYW A;  1V5V A;  3A8K A;  3GTJ C;  1IL2 A;  5JFE A;  4P5A A;  2ZJR S;  4A3M K;  4AYB L;  2NVQ K;  4KDD A;  4C3J C;  1WOO A;  5HL7 S;  3FKI K;  4OIN A;  3T02 A;  3RZO C;  3HOV C;  1O28 A;  3I4N C;  5M5Y K;  4A3J C;  3AQP A;  3SZZ A;  4XLP A;  3M4O C;  2JA5 C;  3TFI A;  1ZBS A;  4A3K K;  4FZB A;  4KMA A;  2YU9 K;  3TFJ A;  5C44 K;  3S17 C;  1XZP B;  2R92 K;  5C4X K;  1I50 C;  2PA8 D;  3HOU K;  2W7V A;  4QJV A;  4A3G C;  4A3D K;  2B63 C;  2KPU A;  3HXA A;  4KB4 A;  1WOR A;  1FEU A;  5EGH A;  4BBR K;  4Y7N K;  2R93 K;  3N0B A;  3GTK C;  3HOZ K;  1XPP A;  1WCM K;  3GSI A;  2R92 A;  4KM9 A;  2PHC B;  3S1M C;  1O2F B;  4MQ9 A;  3TFH A;  5IP7 K;  3H0G C;  1R9T C;  3S1Q K;  4WIL A;  1Y1V A;  3BUE A;  3GTG C;  3PO2 K;  5TMC A;  3GTO C;  4BXX K;  5IYB C;  2ZJP S;  4A3L C;  4WF9 S;  2JA6 C;  4GTE A;  3FHZ A;  5FLM C;  2E2I C;  4A3E K;  4AYB D;  3S15 K;  3H3V L;  4C3I K;  4A93 C;  1BDF A;  1KQ4 A;  5IYC C;  3S16 C;  4GTA A;  1SFO A;  5CHP A;  3GTJ K;  2PMZ L;  3GEH A;  3N0C A;  4C3J K;  4WFB S;  4BLA A;  3RZO K;  3GTM A;  2KXY A;  3I4N K;  3FKI C;  1WSV A;  4A3J K;  4J3N A;  3M4O K;  2JA5 K;  4XCH A;  3GTJ A;  3LPX A;  2JH3 A;  1IBA A;  4XSX A;  1PJ5 A;  2BE5 A;  3I4M C;  3GIR A;  3S17 K;  3PIO S;  4A3F K;  2YU9 C;  4KM8 A;  1I50 K;  2JA5 A;  2ZUF A;  5C44 C;  4Q4Z A;  3BP3 A;  5IYD C;  3S2H C;  2A68 A;  2B63 K;  4C45 A;  4KN7 A;  1EH1 A;  5IOQ A;  3GTK K;  1SMY A;  2E2H C;  2V6U A;  1TWA C;  3S14 C;  1I6H C;  2R93 C;  1XXB A;  5L46 A;  1I50 A;  2Y3P A;  3S1M K;  2P8T A;  1WCM C;  4XLN A;  3H0G K;  1R9T K;  2B63 A;  4G7Z A;  1TWF K;  3GEI A;  3H3V D;  5IP7 C;  1DCP A;  3GTK A;  3VA7 A;  4YFK A;  5IYB K;  4A3L K;  2PMZ D;  4IOC S;  5FLM K;  5M5X K;  2PPB A;  3AD9 C;  4LLG A;  3H0G A;  1R9T A;  4BXX C;  4DDQ A;  2A6E A;  4A93 K;  2KWA A;  5IYC K;  3S16 K;  3IPJ A;  4A3E C;  3S15 C;  5IOR A;  3AD7 C;  3GTG A;  2NVX A;  3GTO A;  4QIW L;  1RU0 A;  2CFA B;  2JA6 A;  3HOX C;  1TWH C;  1YNN A;  2E2I A;  1DCO A;  1EK8 A;  1O27 A;  5JVO A;  1WSR A;  3PIP S;  1TWG C;  1WIH A;  4G7O A;  2WAQ L;  2GSN A;  3L4J A;  3GTQ K;  2XCQ A;  4P9S A;  3I4M K;  4XSZ A;  3FKI A;  2CW0 A;  2WB1 L;  1UV7 A;  1IQ0 A;  1USM A;  3CF5 S;  5IYD K;  4A3F C;  3S2H K;  4ILD A;  3GTP C;  1VRQ C;  5IP9 C;  2L5N A;  2E2H K;  3K7A C;  4GTD A;  4GTF A;  4A3I C;  1TWA K;  2YU9 A;  3S14 K;  1I6H K;  3A8I A;  4QJV B;  1BS2 A;  2EBB A;  4LOW A;  2L3U A;  2FQT A;  2A6H A;  4IOA S;  2KQ1 A;  1WOS A;  1TWF C;  2E2H A;  1TWA A;  2R93 A;  3HOW C;  2Y0S L;  4YFN A;  1WCM A;  4QIW D;  3T01 A;  2RH6 A;  2VUM C;  2XCO A;  3Q3Q A;  2R7Z C;  5TMF A;  4KC6 A;  5M3M K;  5IOS A;  4LR2 A;  1TWH K;  3HOX K;  3HOY C;  2RGR A;  1O2A A;  1PJ7 A;  4WFN S;  2WAQ D;  1WQH A;  3CQZ C;  1TWG K;  2NVY C;  4GTC A;  4WJ4 A;  4G0W A;  1O26 A;  4C2M C;  2WB1 D;  5JVG S;  2GSU A;  2V6S A;  3G4A A;  5IOT A;  3FOF A;  1TWH A;  1IS1 A;  4KN4 A;  1B4B A;  3LAJ A;  4WCE S;  1O24 A;  5HL8 A;  1YNJ A;  3GTQ C;  3M3Y C;  1EQR A;  4MEY A;  4KAR A;  4O2D A;  1EI6 A;  1VLO A;  3GTP K;  5IP9 K;  4KB2 A;  3K7A K;  4A3I K;  2JA8 K;  1XXA A;  2A69 A;  1O29 A;  2Y0S D;  1YCL A;  3GTP A;  4A3C K;  3DLL S;  4IO9 S;  4GTB A; 
#chains in the Genus database with same CATH homology
 4A3D K;  4LJZ A;  2B63 C;  5D4D A;  3GTM K;  1Y1W K;  5FJ8 K;  4BBR K;  4Y7N K;  2R93 K;  3HOW K;  4Y52 K;  1TWG C;  3GTK C;  3HOZ K;  1XPP A;  1WCM K;  4BY1 K;  4G7O A;  3WOD A;  3EQL A;  4OIO A;  5C4J C;  2VUM K;  2E2J C;  3S1M C;  4MQ9 A;  2WAQ L;  2R7Z K;  5IP7 K;  3GTQ K;  4A3M C;  3H0G C;  1R9T C;  3HOV K;  4ZH4 A;  3I4M K;  3S1Q K;  2NVQ C;  4XSZ A;  4LK0 A;  2CW0 A;  4GZY A;  3DXJ A;  2WB1 L;  4C3H K;  5M3F K;  4BY7 K;  4OIR A;  3HOY K;  3GTG C;  3PO2 K;  5TMC A;  5IYD K;  4A3F C;  3GTO C;  3S2H K;  4A3B C;  4BXX K;  5IYB C;  1I3Q K;  4A3L C;  3S2D K;  3GTP C;  4LK1 A;  2JA6 C;  5IP9 C;  2JA7 C;  3CQZ K;  5FLM C;  2E2I C;  2NVY K;  4AYB D;  4A3K C;  1K83 K;  4A3E K;  3H3V L;  3S15 K;  4C3I K;  2E2H K;  3K7A C;  4X6A C;  4A93 C;  4C2M K;  1BDF A;  4A3I C;  1TWA K;  3S14 K;  5IYC C;  3S16 C;  1I6H K;  4JK1 A;  1SFO C;  4QJV B;  3GTJ K;  1TWC C;  2PMZ L;  3GTL K;  4A3G K;  2R92 C;  4BBS C;  3RZD K;  5C4X C;  4YG2 A;  3HOU C;  4C3J K;  2A6H A;  4A3D C;  3M3Y K;  5C3E C;  3RZO K;  1TWF C;  5M5W K;  1Y1W C;  4MEX A;  4Y7N C;  4BBR C;  1Y1V C;  3FKI C;  3HKZ L;  4A3J K;  3I4N K;  2NVT K;  3HOW C;  3M4O K;  1I6V A;  2Y0S L;  4NOI A;  4YFN A;  3HOZ C;  2JA5 K;  3S1N K;  4QIW D;  3PO3 C;  2PA8 L;  4YFX A;  2O5I A;  2VUM C;  4XSX A;  4KMU A;  2R7Z C;  4OIQ A;  2BE5 A;  3I4M C;  5TMF A;  5M3M K;  3S1Q C;  3GTG K;  3S17 K;  4A3F K;  2YU9 C;  2NVX K;  2JA8 C;  3GTO K;  3S1R K;  1I50 K;  3HOX K;  1TWH K;  2JA6 K;  5C44 C;  3HOY C;  4Q4Z A;  3PO2 C;  5IYD C;  2E2I K;  3S2H C;  2A68 A;  2B63 K;  1ZYR A;  1I3Q C;  1IW7 A;  4G7H A;  2WAQ D;  3S2D C;  4A3C C;  4KN7 A;  4X6A K;  3CQZ C;  1TWG K;  2NVY C;  3GTK K;  1K83 C;  1SMY A;  4C3I C;  2E2H C;  3GTM C;  4C2M C;  2WB1 D;  1TWA C;  3S14 C;  1I6H C;  2R93 C;  4Y52 C;  5C4J K;  2E2J K;  3S1M K;  1WCM C;  3GTJ C;  4BY1 C;  4KN4 A;  4XLN A;  3GTL C;  5C3E K;  3H0G K;  4A3M K;  1R9T K;  4G7Z A;  1TWF K;  3RZD C;  4AYB L;  2NVQ K;  4C3J C;  1Y1V K;  3FKI K;  1YNJ A;  4OIN A;  3H3V D;  5IP7 C;  3GTQ C;  3M3Y C;  4MEY A;  3RZO C;  3HOV C;  3PO3 K;  4YFK A;  3I4N C;  5M5Y K;  4A3J C;  4A3B K;  2NVT C;  4XLP A;  4C3H C;  3M4O C;  5IYB K;  4BY7 C;  3GTP K;  4A3L K;  2PMZ D;  2JA5 C;  3S1N C;  5IP9 K;  2JA7 K;  2O5J A;  5FLM K;  5M5X K;  2PPB A;  4LLG A;  4A3K K;  4Q5S A;  4BXX C;  4OIP A;  2A6E A;  3K7A K;  4A93 K;  4A3I K;  2YU9 K;  5IYC K;  2JA8 K;  3S16 K;  1SFO K;  2A69 A;  4A3E C;  3S15 C;  5C44 K;  3HKZ D;  1TWC K;  3S17 C;  2R92 K;  2NVX C;  4BBS K;  2Y0S D;  4QIW L;  1HQM A;  5C4X K;  4A3C K;  3S1R C;  1I50 C;  2PA8 D;  1TWH C;  1YNN A;  3HOX C;  3HOU K;  4QJV A;  4A3G C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...