4XLPA

Crystal structure of t.aquaticus transcription initiation complex containing upstream fork promoter
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
227
structure length
227
Chain Sequence
KAPVFTATTQGDHYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLDPKMASTTLILRAEGPKEVRAGDFTPSADVEIMNPDLHIATLEEGGKLYMEVRVDRGVGYVPAERHGIKDRINAIPVDAIFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVAILKEHLNYFANPEASLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase subunit alpha
publication title Structure of a bacterial RNA polymerase holoenzyme open promoter complex.
pubmed doi rcsb
source organism Thermus aquaticus
molecule tags Transcription/dna
total genus 40
structure length 227
sequence length 227
chains with identical sequence B, G, H
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2015-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01000 RNA_pol_A_bac RNA polymerase Rpb3/RpoA insert domain
A PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain
A PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.12 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 DNA-directed RNA polymerase, insert domain 4xlpA02
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 4xlpA01
2PA8D 4C3HK 2R7ZC 4A3IK 3HOWC 4BY7C 3HOXC 1WCMC 3HKZD 2WB1L 4BY1C 4QIWD 5IYDK 4Y52K 1I50C 4KMUA 4KN7A 4OIOA 3M4OC 5IYBC 4A93C 5C3EK 5IP7K 2A6HA 3K7AK 3S2HK 4A3LC 5C44K 4XSZA 3S1MK 4G7HA 3HKZL 4QIWL 3I4NK 5C4XC 1R9TK 4MEYA 5TMCA 1I6HK 4BBRC 2JA6K 5C4JC 1TWAK 4OINA 3GTOC 4A3CC 5M5XK 2JA5K 1TWFC 4BBSC 4MQ9A 2YU9C 2NVXK 4BXXK 4Y7NC 3M3YK 4C3JC 3HOYC 1Y1VC 5M3MK 5M5YK 1TWCK 3GTQK 4C3IC 3GTGC 3S17K 2R93K 4C3HC 3CQZK 4AYBL 4A3IC 3RZOC 4A3MK 4Q5SA 2R92K 5IYDC 4Y52C 2WAQL 3DXJA 3GTLK 4Q4ZA 5IP7C 5C3EC 3S16C 4KN4A 5M3FK 1HQMA 5C44C 3PO3C 2Y0SD 4YG2A 3S1MC 3PO2K 3I4NC 4MEXA 5FLMK 4A3BK 3S1NK 1I6HC 2CW0A 2BE5A 2JA6C 2PA8L 1TWAC 3S1RK 3GTKK 3HOVK 4A3GK 4XLNA 2JA5C 2NVXC 1SMYA 2Y0SL 2O5JA 2NVQK 4BXXC 2E2HK 3H0GK 3M3YC 4LLGA 3S14K 4A3JK 4LK1A 3S17C 3CQZC 4A3MC 1Y1WC 2R92C 2JA7C 4C3IK 3GTJK 1TWHC 4ZH4A 3GTLC 1XPPA 3S2DK 4G7OA 3RZDK 2E2IK 5D4DA 1SFOK 5FLMC 3S2HC 4QJVA 4C2MK 3K7AC 3S1RC 4A3GC 3GTKC 4JK1A 3HOXK 4A3FK 4OIQA 4BY7K 5IP9K 2NVYK 4A3DK 2A6EA 2PMZD 2O5IA 1ZYRA 1R9TC 1K83K 4A93K 1I3QK 2NVQC 2JA8K 4NOIA 1BDFA 3H0GC 5TMFA 2E2HC 4OIRA 4A3JC 3S14C 3GTMK 4A3EK 5IYCK 3GTPK 4XLPA 2PMZL 3GTJC 2PPBA 4BBRK 5C4JK 3I4MK 3GTQC 1TWCC 4GZYA 3S1QK 1YNJA 2R93C 4A3KK 4OIPA 3S15K 4BBSK 3WODA 2E2JK 2B63K 4X6AK 5FJ8K 1TWGK 1SFOC 3FKIK 4QJVB 2NVTK 3HOYK 3GTGK 2A69A 2VUMK 4XSXA 3RZOK 4C2MC 4A3FC 3HOUK 5IP9C 2NVYC 3PO2C 4A3DC 1IW7A 3HOZK 2A68A 4G7ZA 1K83C 2R7ZK 1I3QC 2JA8C 4A3BC 3S1NC 3GTMC 3HOWK 1WCMK 3S16K 4YFXA 3HOVC 4LJZA 4BY1K 3PO3K 4A3EC 5IYCC 1I50K 3GTPC 3M4OK 5M5WK 5IYBK 4LK0A 4A3LK 4AYBD 3I4MC 3S1QC 3S15C 4A3KC 3H3VD 2E2JC 2B63C 4X6AC 2WAQD 5C4XK 1TWGC 1YNNA 3EQLA 3FKIC 2NVTC 4YFNA 3GTOK 4A3CK 2WB1D 3S2DC 1TWFK 2VUMC 2YU9K 3RZDC 2E2IC 1I6VA 4YFKA 3HOUC 4Y7NK 4C3JK 1Y1WK 2JA7K 1Y1VK 3H3VL 1TWHK 3HOZC
chains in the Genus database with same CATH superfamily
4C3HK 4KM8A 3HOWC 1IQ0A 1WCMC 4QIWD 5IYDK 5HL7S 4KMUA 4IO9S 3G4AA 5IYBC 3PIPS 3K7AK 3GTOA 5C44K 3S1MK 4G7HA 3N0BA 4MEYA 1WSRA 1Y1WA 2JA6K 1O24A 3GTOC 1O29A 3AD9C 2NVXK 1O25A 1WOOA 5JFEA 1FEUA 1TWCK 3GTGC 3FOFA 3CQZK 4AYBL 1WOPA 3GIRA 3GTLK 5CJ9A 4Q4ZA 3T00A 1EH1A 3H0GA 4KN4A 2JA5A 2Y0SD 4P9SA 1RU0A 3GTQA 2CW0A 2BE5A 2PA8L 3OREA 1TWAC 3HOVK 2R93A 4XLNA 2JA5C 2O5JA 1SFOA 4G0WA 4BXXC 2E2HK 3M3YC 3S14K 3S17C 1WQFA 4FM9A 1O27A 3N3YA 1F93A 1F7UA 3LPXA 3A8JA 3BUEA 1PJ5A 4QJVA 3K7AC 3S1RC 3HOXK 3GTKC 4XCHA 1PJ7A 3L4JA 4KMHA 2JA8K 2NVQC 4NOIA 3GTMK 3Q3QA 4WFAS 3ADAC 4A3EK 5IYCK 3GTPK 3L4KA 3GTJC 2PPBA 3I4MK 1XXCA 1TWCC 3S1QK 3JSTA 3S15K 4BBSK 3WODA 2E2JK 2B63K 4X6AK 1DCPA 4WJ4A 3A8KA 1K83A 4XSXA 3TFIA 1B4AA 4A3DC 2NVYC 3GDZA 3HOZK 1K83C 3LAJA 3HOWK 1WCMK 3HOVC 4LJZA 3DLLS 2YU9A 2D6FC 5IYBK 3FKIA 2FQOA 4PABA 5L46A 1TWGC 1YNNA 3FKIC 4YFNA 3GTOK 2R7ZA 2WB1D 3LYWA 2VUMC 4RMFA 1I6VA 3HOUC 1Y1WK 3H3VL 1VLOA 4KARA 1I50A 3FHZA 2R7ZC 3HOXC 1VGXA 5EGEA 1HI9A 1I50C 4OIOA 3M4OC 4KATA 1AB4A 2XCQA 1F7VA 4A3LC 1IS1A 1KQ4A 4XSZA 4QIWL 5C4XC 2R92A 1Y1VA 1TWHA 2Y3PA 1TWAK 5IORA 4OINA 2JA5K 4WJ3M 4BBSC 4KMDA 1ZBSA 4BXXK 4GTAA 4C3JC 3M3YK 1Y1VC 1IE0A 3GTQK 3S17K 2R93K 1WQHA 4A3IC 1J98A 4KASA 1ZXOA 1J6WA 3T01A 2V6TA 4KMAA 1EQRA 5M3FK 2ZUFA 3I4NC 4G0VA 4BLAA 4A3BK 1I6HC 3S1RK 3GTKK 4KC6A 3ERED 1O28A 1SMYA 4LQYA 2Y0SL 3OEPA 2RH6A 2NVQK 5EGHA 3BP8C 3A8IA 3GEHA 1Y1WC 4GTBA 3GTJK 4ZH4A 1I3QA 4ILDA 3CF5S 4G7OA 4U67S 4IOAS 1DCOA 4AH6A 4A3GC 4JK1A 3AQPA 1F9NA 5HQHA 4OIQA 4A3DK 2NVYK 5DM6S 2PMZD 1ZYRA 1J6XA 1K83K 5TMFA 3H0GC 2CFAA 4LOWA 5JVHS 1JVIA 4XLPA 1IL2A 2E2IA 4BBRK 5C4JK 3GTQC 1YNJA 2R93C 2RGRA 5FJ8K 1TWGK 1SFOC 4KM9A 3FKIK 2XCOA 2VUMK 4C2MC 4KDDA 3HOUK 4O2DA 3PIOS 1BS2A 1IW7A 3QX3A 2R7ZK 4A3BC 3S16K 4WCES 2PHCB 1TWFA 5E68A 4FZBA 1I50K 3M4OK 1WOSA 1V5VA 3AD8C 4AYBD 5TJ3A 4A3LK 1VH2A 4J3NA 5JVGS 4A3KC 5C4XK 2P8TA 3EQLA 3LAPA 1ZVUA 4GTDA 4P5AA 4C3JK 3N0CA 1Y1VK 1TWHK 2PA8D 4A3IK 1ZQ1C 3HKZD 2WB1L 4BY1C 2NVXA 2CFAB 3GEIA 1UV7A 5JVOA 3S2HK 1DD5A 2KPUA 3I4NK 1USOA 2JA7A 1I6HK 4BBRC 5C4JC 3VA7A 4IOCS 3TTGA 2YU9C 1WQGA 4WFNS 4Y7NC 4WFBS 5M5YK 4C3IC 5IOTA 4P5BA 1C0AA 1WORA 4Y52C 2WAQL 4BLBA 1R9TA 1XZQA 1YX2A 2E2HA 5IP7C 5C3EC 1VRQC 3S16C 1HQMA 4KB4A 4YG2A 1USMA 5DM7S 4MEXA 3S1NK 2GAHC 4A3GK 1DCHA 1EI6A 3BP3A 3H0GK 4LLGA 3AH5A 3CAGA 4A3MC 1ISEA 2R92C 1TWHC 1O2AA 1XPPA 3S2DK 4KAWX 3RZDK 3SZYA 2E2IK 5D4DA 1SFOK 3GTPA 1GE9A 5FLMC 3S2HC 2W7VA 4C2MK 3T02A 4BY7K 2B63A 4A93K 3NUHA 1JOEA 1BDFA 4OIRA 4A3JC 3S0XA 2L3UA 2PMZL 1G51A 4BKWA 2ZJPS 3AQOA 4A3KK 4OIPA 1XZQB 4G0UA 3HOYK 4GTLA 4M1XA 4GTFA 3TFHA 1O26A 3RZOK 4A3FC 5IP9C 1INNA 2GSUA 1I3QC 2ZJRS 3S1NC 4YFXA 5IOQA 4BY1K 3PO3K 4DDQA 5M5WK 2GSOA 4LK0A 1BGWA 3GTGA 1XXAA 1YCLA 3GEEA 3MMLB 2L5NA 2NVTC 1J6VA 2EBBA 3S2DC 3FOEA 3RZDC 1JQWA 2YU9K 2ZUEA 2E2IC 4YFKA 4Y7NK 2JA7K 1EFWA 4C3IK 4C45A 4BY7C 1TWAA 2KQ1A 4GT9A 4Y52K 4PAAA 4KN7A 4A93C 5C3EK 5IP7K 2A6HA 2P5MA 3OPFA 3HKZL 1R9TK 1B4BA 5TMCA 2GSNA 1XZPA 4A3CC 5M5XK 1TWFC 4MQ9A 4LR2A 3HOYC 5M3MK 3HXAA 4C3HC 3RZOC 3GTKA 1WSVA 4Q5SA 3TFJA 5IYDC 4A3MK 2R92K 3DXJA 5HL8A 2JA6A 5C44C 3PO3C 3S1MC 3PO2K 1O2FB 3SZZA 4WF9S 5FLMK 3GTJA 2ZJQS 1EK8A 2JA6C 1TWCA 1X31C 3CQZA 2KWAA 2NVXC 4A3JK 4LK1A 5CHPA 3GTLA 3CQZC 1VJEA 2NVYA 2JA7C 3GTLC 4A3FK 5IP9K 2A6EA 2O5IA 2ZFZA 1XZPB 1R9TC 1TWGA 1I3QK 3G4CA 2E2HC 2JH3A 3S14C 2V6UA 2VUMA 3AD7C 4GZYA 1XXBA 2GAGC 4QJVB 2NVTK 1IBAA 3IPJA 3GTGK 2A69A 5IOSA 3GTMA 2XCRB 3V4GA 3PO2C 1O2BA 4GTEA 2A68A 4G7ZA 2JA8C 4KB2A 3GTMC 4A3EC 5IYCC 1L0WA 3GTPC 1WIHA 4GFQA 1BJTA 2KXYA 3I4MC 2FQTA 3S1QC 3S15C 3H3VD 2E2JC 2B63C 4X6AC 2WAQD 4WILA 4GTCA 4A3CK 1TWFK 1PJ6A 3GSIA 1WCMA 2V6SA 3HOZC
chains in the Genus database with same CATH topology
2PA8D 4C3HK 2R7ZC 4A3IK 3HOWC 4BY7C 3HOXC 1WCMC 3HKZD 2WB1L 4BY1C 4QIWD 5IYDK 4Y52K 1I50C 4KMUA 4KN7A 4OIOA 3M4OC 5IYBC 4A93C 5C3EK 5IP7K 2A6HA 3K7AK 3S2HK 4A3LC 5C44K 4XSZA 3S1MK 4G7HA 3HKZL 4QIWL 3I4NK 5C4XC 1R9TK 4MEYA 5TMCA 1I6HK 4BBRC 2JA6K 5C4JC 1TWAK 4OINA 3GTOC 4A3CC 5M5XK 2JA5K 1TWFC 4BBSC 4MQ9A 2YU9C 2NVXK 4BXXK 4Y7NC 3M3YK 4C3JC 3HOYC 1Y1VC 5M3MK 5M5YK 1TWCK 3GTQK 4C3IC 3GTGC 3S17K 2R93K 4C3HC 3CQZK 4AYBL 4A3IC 3RZOC 4A3MK 4Q5SA 2R92K 5IYDC 4Y52C 2WAQL 3DXJA 3GTLK 4Q4ZA 5IP7C 5C3EC 3S16C 4KN4A 5M3FK 1HQMA 5C44C 3PO3C 2Y0SD 4YG2A 3S1MC 3PO2K 3I4NC 4MEXA 5FLMK 4A3BK 3S1NK 1I6HC 2CW0A 2BE5A 2JA6C 2PA8L 1TWAC 3S1RK 3GTKK 3HOVK 4A3GK 4XLNA 2JA5C 2NVXC 1SMYA 2Y0SL 2O5JA 2NVQK 4BXXC 2E2HK 3H0GK 3M3YC 4LLGA 3S14K 4A3JK 4LK1A 3S17C 3CQZC 4A3MC 1Y1WC 2R92C 2JA7C 4C3IK 3GTJK 1TWHC 4ZH4A 3GTLC 1XPPA 3S2DK 4G7OA 3RZDK 2E2IK 5D4DA 1SFOK 5FLMC 3S2HC 4QJVA 4C2MK 3K7AC 3S1RC 4A3GC 3GTKC 4JK1A 3HOXK 4A3FK 4OIQA 4BY7K 5IP9K 2NVYK 4A3DK 2A6EA 2PMZD 2O5IA 1ZYRA 1R9TC 1K83K 4A93K 1I3QK 2NVQC 2JA8K 4NOIA 1BDFA 3H0GC 5TMFA 2E2HC 4OIRA 4A3JC 3S14C 3GTMK 4A3EK 5IYCK 3GTPK 4XLPA 2PMZL 3GTJC 2PPBA 4BBRK 5C4JK 3I4MK 3GTQC 1TWCC 4GZYA 3S1QK 1YNJA 2R93C 4A3KK 4OIPA 3S15K 4BBSK 3WODA 2E2JK 2B63K 4X6AK 5FJ8K 1TWGK 1SFOC 3FKIK 4QJVB 2NVTK 3HOYK 3GTGK 2A69A 2VUMK 4XSXA 3RZOK 4C2MC 4A3FC 3HOUK 5IP9C 2NVYC 3PO2C 4A3DC 1IW7A 3HOZK 2A68A 4G7ZA 1K83C 2R7ZK 1I3QC 2JA8C 4A3BC 3S1NC 3GTMC 3HOWK 1WCMK 3S16K 4YFXA 3HOVC 4LJZA 4BY1K 3PO3K 4A3EC 5IYCC 1I50K 3GTPC 3M4OK 5M5WK 5IYBK 4LK0A 4A3LK 4AYBD 3I4MC 3S1QC 3S15C 4A3KC 3H3VD 2E2JC 2B63C 4X6AC 2WAQD 5C4XK 1TWGC 1YNNA 3EQLA 3FKIC 2NVTC 4YFNA 3GTOK 4A3CK 2WB1D 3S2DC 1TWFK 2VUMC 2YU9K 3RZDC 2E2IC 1I6VA 4YFKA 3HOUC 4Y7NK 4C3JK 1Y1WK 2JA7K 1Y1VK 3H3VL 1TWHK 3HOZC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PA8 D;  4C3H K;  2R7Z C;  4A3I K;  3HOW C;  4BY7 C;  3HOX C;  1WCM C;  3HKZ D;  2WB1 L;  4BY1 C;  4QIW D;  5IYD K;  4Y52 K;  1I50 C;  4KMU A;  4KN7 A;  4OIO A;  3M4O C;  5IYB C;  4A93 C;  5C3E K;  5IP7 K;  2A6H A;  3K7A K;  3S2H K;  4A3L C;  5C44 K;  4XSZ A;  3S1M K;  4G7H A;  3HKZ L;  4QIW L;  3I4N K;  5C4X C;  1R9T K;  4MEY A;  5TMC A;  1I6H K;  4BBR C;  2JA6 K;  5C4J C;  1TWA K;  4OIN A;  3GTO C;  4A3C C;  5M5X K;  2JA5 K;  1TWF C;  4BBS C;  4MQ9 A;  2YU9 C;  2NVX K;  4BXX K;  4Y7N C;  3M3Y K;  4C3J C;  3HOY C;  1Y1V C;  5M3M K;  5M5Y K;  1TWC K;  3GTQ K;  4C3I C;  3GTG C;  3S17 K;  2R93 K;  4C3H C;  3CQZ K;  4AYB L;  4A3I C;  3RZO C;  4A3M K;  4Q5S A;  2R92 K;  5IYD C;  4Y52 C;  2WAQ L;  3DXJ A;  3GTL K;  4Q4Z A;  5IP7 C;  5C3E C;  3S16 C;  4KN4 A;  5M3F K;  1HQM A;  5C44 C;  3PO3 C;  2Y0S D;  4YG2 A;  3S1M C;  3PO2 K;  3I4N C;  4MEX A;  5FLM K;  4A3B K;  3S1N K;  1I6H C;  2CW0 A;  2BE5 A;  2JA6 C;  2PA8 L;  1TWA C;  3S1R K;  3GTK K;  3HOV K;  4A3G K;  4XLN A;  2JA5 C;  2NVX C;  1SMY A;  2Y0S L;  2O5J A;  2NVQ K;  4BXX C;  2E2H K;  3H0G K;  3M3Y C;  4LLG A;  3S14 K;  4A3J K;  4LK1 A;  3S17 C;  3CQZ C;  4A3M C;  1Y1W C;  2R92 C;  2JA7 C;  4C3I K;  3GTJ K;  1TWH C;  4ZH4 A;  3GTL C;  1XPP A;  3S2D K;  4G7O A;  3RZD K;  2E2I K;  5D4D A;  1SFO K;  5FLM C;  3S2H C;  4QJV A;  4C2M K;  3K7A C;  3S1R C;  4A3G C;  3GTK C;  4JK1 A;  3HOX K;  4A3F K;  4OIQ A;  4BY7 K;  5IP9 K;  2NVY K;  4A3D K;  2A6E A;  2PMZ D;  2O5I A;  1ZYR A;  1R9T C;  1K83 K;  4A93 K;  1I3Q K;  2NVQ C;  2JA8 K;  4NOI A;  1BDF A;  3H0G C;  5TMF A;  2E2H C;  4OIR A;  4A3J C;  3S14 C;  3GTM K;  4A3E K;  5IYC K;  3GTP K;  4XLP A;  2PMZ L;  3GTJ C;  2PPB A;  4BBR K;  5C4J K;  3I4M K;  3GTQ C;  1TWC C;  4GZY A;  3S1Q K;  1YNJ A;  2R93 C;  4A3K K;  4OIP A;  3S15 K;  4BBS K;  3WOD A;  2E2J K;  2B63 K;  4X6A K;  5FJ8 K;  1TWG K;  1SFO C;  3FKI K;  4QJV B;  2NVT K;  3HOY K;  3GTG K;  2A69 A;  2VUM K;  4XSX A;  3RZO K;  4C2M C;  4A3F C;  3HOU K;  5IP9 C;  2NVY C;  3PO2 C;  4A3D C;  1IW7 A;  3HOZ K;  2A68 A;  4G7Z A;  1K83 C;  2R7Z K;  1I3Q C;  2JA8 C;  4A3B C;  3S1N C;  3GTM C;  3HOW K;  1WCM K;  3S16 K;  4YFX A;  3HOV C;  4LJZ A;  4BY1 K;  3PO3 K;  4A3E C;  5IYC C;  1I50 K;  3GTP C;  3M4O K;  5M5W K;  5IYB K;  4LK0 A;  4A3L K;  4AYB D;  3I4M C;  3S1Q C;  3S15 C;  4A3K C;  3H3V D;  2E2J C;  2B63 C;  4X6A C;  2WAQ D;  5C4X K;  1TWG C;  1YNN A;  3EQL A;  3FKI C;  2NVT C;  4YFN A;  3GTO K;  4A3C K;  2WB1 D;  3S2D C;  1TWF K;  2VUM C;  2YU9 K;  3RZD C;  2E2I C;  1I6V A;  4YFK A;  3HOU C;  4Y7N K;  4C3J K;  1Y1W K;  2JA7 K;  1Y1V K;  3H3V L;  1TWH K;  3HOZ C; 
#chains in the Genus database with same CATH topology
 4C3H K;  4KM8 A;  3HOW C;  1IQ0 A;  1WCM C;  4QIW D;  5IYD K;  5HL7 S;  4KMU A;  4IO9 S;  3G4A A;  5IYB C;  3PIP S;  3K7A K;  3GTO A;  5C44 K;  3S1M K;  4G7H A;  3N0B A;  4MEY A;  1WSR A;  1Y1W A;  2JA6 K;  1O24 A;  3GTO C;  1O29 A;  3AD9 C;  2NVX K;  1O25 A;  1WOO A;  5JFE A;  1FEU A;  1TWC K;  3GTG C;  3FOF A;  3CQZ K;  4AYB L;  1WOP A;  3GIR A;  3GTL K;  5CJ9 A;  4Q4Z A;  3T00 A;  1EH1 A;  3H0G A;  4KN4 A;  2JA5 A;  2Y0S D;  4P9S A;  1RU0 A;  3GTQ A;  2CW0 A;  2BE5 A;  2PA8 L;  3ORE A;  1TWA C;  3HOV K;  2R93 A;  4XLN A;  2JA5 C;  2O5J A;  1SFO A;  4G0W A;  4BXX C;  2E2H K;  3M3Y C;  3S14 K;  3S17 C;  1WQF A;  4FM9 A;  1O27 A;  3N3Y A;  1F93 A;  1F7U A;  3LPX A;  3A8J A;  3BUE A;  1PJ5 A;  4QJV A;  3K7A C;  3S1R C;  3HOX K;  3GTK C;  4XCH A;  1PJ7 A;  3L4J A;  4KMH A;  2JA8 K;  2NVQ C;  4NOI A;  3GTM K;  3Q3Q A;  4WFA S;  3ADA C;  4A3E K;  5IYC K;  3GTP K;  3L4K A;  3GTJ C;  2PPB A;  3I4M K;  1XXC A;  1TWC C;  3S1Q K;  3JST A;  3S15 K;  4BBS K;  3WOD A;  2E2J K;  2B63 K;  4X6A K;  1DCP A;  4WJ4 A;  3A8K A;  1K83 A;  4XSX A;  3TFI A;  1B4A A;  4A3D C;  2NVY C;  3GDZ A;  3HOZ K;  1K83 C;  3LAJ A;  3HOW K;  1WCM K;  3HOV C;  4LJZ A;  3DLL S;  2YU9 A;  2D6F C;  5IYB K;  3FKI A;  2FQO A;  4PAB A;  5L46 A;  1TWG C;  1YNN A;  3FKI C;  4YFN A;  3GTO K;  2R7Z A;  2WB1 D;  3LYW A;  2VUM C;  4RMF A;  1I6V A;  3HOU C;  1Y1W K;  3H3V L;  1VLO A;  4KAR A;  1I50 A;  3FHZ A;  2R7Z C;  3HOX C;  1VGX A;  5EGE A;  1HI9 A;  1I50 C;  4OIO A;  3M4O C;  4KAT A;  1AB4 A;  2XCQ A;  1F7V A;  4A3L C;  1IS1 A;  1KQ4 A;  4XSZ A;  4QIW L;  5C4X C;  2R92 A;  1Y1V A;  1TWH A;  2Y3P A;  1TWA K;  5IOR A;  4OIN A;  2JA5 K;  4WJ3 M;  4BBS C;  4KMD A;  1ZBS A;  4BXX K;  4GTA A;  4C3J C;  3M3Y K;  1Y1V C;  1IE0 A;  3GTQ K;  3S17 K;  2R93 K;  1WQH A;  4A3I C;  1J98 A;  4KAS A;  1ZXO A;  1J6W A;  3T01 A;  2V6T A;  4KMA A;  1EQR A;  5M3F K;  2ZUF A;  3I4N C;  4G0V A;  4BLA A;  4A3B K;  1I6H C;  3S1R K;  3GTK K;  4KC6 A;  3ERE D;  1O28 A;  1SMY A;  4LQY A;  2Y0S L;  3OEP A;  2RH6 A;  2NVQ K;  5EGH A;  3BP8 C;  3A8I A;  3GEH A;  1Y1W C;  4GTB A;  3GTJ K;  4ZH4 A;  1I3Q A;  4ILD A;  3CF5 S;  4G7O A;  4U67 S;  4IOA S;  1DCO A;  4AH6 A;  4A3G C;  4JK1 A;  3AQP A;  1F9N A;  5HQH A;  4OIQ A;  4A3D K;  2NVY K;  5DM6 S;  2PMZ D;  1ZYR A;  1J6X A;  1K83 K;  5TMF A;  3H0G C;  2CFA A;  4LOW A;  5JVH S;  1JVI A;  4XLP A;  1IL2 A;  2E2I A;  4BBR K;  5C4J K;  3GTQ C;  1YNJ A;  2R93 C;  2RGR A;  5FJ8 K;  1TWG K;  1SFO C;  4KM9 A;  3FKI K;  2XCO A;  2VUM K;  4C2M C;  4KDD A;  3HOU K;  4O2D A;  3PIO S;  1BS2 A;  1IW7 A;  3QX3 A;  2R7Z K;  4A3B C;  3S16 K;  4WCE S;  2PHC B;  1TWF A;  5E68 A;  4FZB A;  1I50 K;  3M4O K;  1WOS A;  1V5V A;  3AD8 C;  4AYB D;  5TJ3 A;  4A3L K;  1VH2 A;  4J3N A;  5JVG S;  4A3K C;  5C4X K;  2P8T A;  3EQL A;  3LAP A;  1ZVU A;  4GTD A;  4P5A A;  4C3J K;  3N0C A;  1Y1V K;  1TWH K;  2PA8 D;  4A3I K;  1ZQ1 C;  3HKZ D;  2WB1 L;  4BY1 C;  2NVX A;  2CFA B;  3GEI A;  1UV7 A;  5JVO A;  3S2H K;  1DD5 A;  2KPU A;  3I4N K;  1USO A;  2JA7 A;  1I6H K;  4BBR C;  5C4J C;  3VA7 A;  4IOC S;  3TTG A;  2YU9 C;  1WQG A;  4WFN S;  4Y7N C;  4WFB S;  5M5Y K;  4C3I C;  5IOT A;  4P5B A;  1C0A A;  1WOR A;  4Y52 C;  2WAQ L;  4BLB A;  1R9T A;  1XZQ A;  1YX2 A;  2E2H A;  5IP7 C;  5C3E C;  1VRQ C;  3S16 C;  1HQM A;  4KB4 A;  4YG2 A;  1USM A;  5DM7 S;  4MEX A;  3S1N K;  2GAH C;  4A3G K;  1DCH A;  1EI6 A;  3BP3 A;  3H0G K;  4LLG A;  3AH5 A;  3CAG A;  4A3M C;  1ISE A;  2R92 C;  1TWH C;  1O2A A;  1XPP A;  3S2D K;  4KAW X;  3RZD K;  3SZY A;  2E2I K;  5D4D A;  1SFO K;  3GTP A;  1GE9 A;  5FLM C;  3S2H C;  2W7V A;  4C2M K;  3T02 A;  4BY7 K;  2B63 A;  4A93 K;  3NUH A;  1JOE A;  1BDF A;  4OIR A;  4A3J C;  3S0X A;  2L3U A;  2PMZ L;  1G51 A;  4BKW A;  2ZJP S;  3AQO A;  4A3K K;  4OIP A;  1XZQ B;  4G0U A;  3HOY K;  4GTL A;  4M1X A;  4GTF A;  3TFH A;  1O26 A;  3RZO K;  4A3F C;  5IP9 C;  1INN A;  2GSU A;  1I3Q C;  2ZJR S;  3S1N C;  4YFX A;  5IOQ A;  4BY1 K;  3PO3 K;  4DDQ A;  5M5W K;  2GSO A;  4LK0 A;  1BGW A;  3GTG A;  1XXA A;  1YCL A;  3GEE A;  3MML B;  2L5N A;  2NVT C;  1J6V A;  2EBB A;  3S2D C;  3FOE A;  3RZD C;  1JQW A;  2YU9 K;  2ZUE A;  2E2I C;  4YFK A;  4Y7N K;  2JA7 K;  1EFW A;  4C3I K;  4C45 A;  4BY7 C;  1TWA A;  2KQ1 A;  4GT9 A;  4Y52 K;  4PAA A;  4KN7 A;  4A93 C;  5C3E K;  5IP7 K;  2A6H A;  2P5M A;  3OPF A;  3HKZ L;  1R9T K;  1B4B A;  5TMC A;  2GSN A;  1XZP A;  4A3C C;  5M5X K;  1TWF C;  4MQ9 A;  4LR2 A;  3HOY C;  5M3M K;  3HXA A;  4C3H C;  3RZO C;  3GTK A;  1WSV A;  4Q5S A;  3TFJ A;  5IYD C;  4A3M K;  2R92 K;  3DXJ A;  5HL8 A;  2JA6 A;  5C44 C;  3PO3 C;  3S1M C;  3PO2 K;  1O2F B;  3SZZ A;  4WF9 S;  5FLM K;  3GTJ A;  2ZJQ S;  1EK8 A;  2JA6 C;  1TWC A;  1X31 C;  3CQZ A;  2KWA A;  2NVX C;  4A3J K;  4LK1 A;  5CHP A;  3GTL A;  3CQZ C;  1VJE A;  2NVY A;  2JA7 C;  3GTL C;  4A3F K;  5IP9 K;  2A6E A;  2O5I A;  2ZFZ A;  1XZP B;  1R9T C;  1TWG A;  1I3Q K;  3G4C A;  2E2H C;  2JH3 A;  3S14 C;  2V6U A;  2VUM A;  3AD7 C;  4GZY A;  1XXB A;  2GAG C;  4QJV B;  2NVT K;  1IBA A;  3IPJ A;  3GTG K;  2A69 A;  5IOS A;  3GTM A;  2XCR B;  3V4G A;  3PO2 C;  1O2B A;  4GTE A;  2A68 A;  4G7Z A;  2JA8 C;  4KB2 A;  3GTM C;  4A3E C;  5IYC C;  1L0W A;  3GTP C;  1WIH A;  4GFQ A;  1BJT A;  2KXY A;  3I4M C;  2FQT A;  3S1Q C;  3S15 C;  3H3V D;  2E2J C;  2B63 C;  4X6A C;  2WAQ D;  4WIL A;  4GTC A;  4A3C K;  1TWF K;  1PJ6 A;  3GSI A;  1WCM A;  2V6S A;  3HOZ C; 
#chains in the Genus database with same CATH homology
 2PA8 D;  4C3H K;  2R7Z C;  4A3I K;  3HOW C;  4BY7 C;  3HOX C;  1WCM C;  3HKZ D;  2WB1 L;  4BY1 C;  4QIW D;  5IYD K;  4Y52 K;  1I50 C;  4KMU A;  4KN7 A;  4OIO A;  3M4O C;  5IYB C;  4A93 C;  5C3E K;  5IP7 K;  2A6H A;  3K7A K;  3S2H K;  4A3L C;  5C44 K;  4XSZ A;  3S1M K;  4G7H A;  3HKZ L;  4QIW L;  3I4N K;  5C4X C;  1R9T K;  4MEY A;  5TMC A;  1I6H K;  4BBR C;  2JA6 K;  5C4J C;  1TWA K;  4OIN A;  3GTO C;  4A3C C;  5M5X K;  2JA5 K;  1TWF C;  4BBS C;  4MQ9 A;  2YU9 C;  2NVX K;  4BXX K;  4Y7N C;  3M3Y K;  4C3J C;  3HOY C;  1Y1V C;  5M3M K;  5M5Y K;  1TWC K;  3GTQ K;  4C3I C;  3GTG C;  3S17 K;  2R93 K;  4C3H C;  3CQZ K;  4AYB L;  4A3I C;  3RZO C;  4A3M K;  4Q5S A;  2R92 K;  5IYD C;  4Y52 C;  2WAQ L;  3DXJ A;  3GTL K;  4Q4Z A;  5IP7 C;  5C3E C;  3S16 C;  4KN4 A;  5M3F K;  1HQM A;  5C44 C;  3PO3 C;  2Y0S D;  4YG2 A;  3S1M C;  3PO2 K;  3I4N C;  4MEX A;  5FLM K;  4A3B K;  3S1N K;  1I6H C;  2CW0 A;  2BE5 A;  2JA6 C;  2PA8 L;  1TWA C;  3S1R K;  3GTK K;  3HOV K;  4A3G K;  4XLN A;  2JA5 C;  2NVX C;  1SMY A;  2Y0S L;  2O5J A;  2NVQ K;  4BXX C;  2E2H K;  3H0G K;  3M3Y C;  4LLG A;  3S14 K;  4A3J K;  4LK1 A;  3S17 C;  3CQZ C;  4A3M C;  1Y1W C;  2R92 C;  2JA7 C;  4C3I K;  3GTJ K;  1TWH C;  4ZH4 A;  3GTL C;  1XPP A;  3S2D K;  4G7O A;  3RZD K;  2E2I K;  5D4D A;  1SFO K;  5FLM C;  3S2H C;  4QJV A;  4C2M K;  3K7A C;  3S1R C;  4A3G C;  3GTK C;  4JK1 A;  3HOX K;  4A3F K;  4OIQ A;  4BY7 K;  5IP9 K;  2NVY K;  4A3D K;  2A6E A;  2PMZ D;  2O5I A;  1ZYR A;  1R9T C;  1K83 K;  4A93 K;  1I3Q K;  2NVQ C;  2JA8 K;  4NOI A;  1BDF A;  3H0G C;  5TMF A;  2E2H C;  4OIR A;  4A3J C;  3S14 C;  3GTM K;  4A3E K;  5IYC K;  3GTP K;  4XLP A;  2PMZ L;  3GTJ C;  2PPB A;  4BBR K;  5C4J K;  3I4M K;  3GTQ C;  1TWC C;  4GZY A;  3S1Q K;  1YNJ A;  2R93 C;  4A3K K;  4OIP A;  3S15 K;  4BBS K;  3WOD A;  2E2J K;  2B63 K;  4X6A K;  5FJ8 K;  1TWG K;  1SFO C;  3FKI K;  4QJV B;  2NVT K;  3HOY K;  3GTG K;  2A69 A;  2VUM K;  4XSX A;  3RZO K;  4C2M C;  4A3F C;  3HOU K;  5IP9 C;  2NVY C;  3PO2 C;  4A3D C;  1IW7 A;  3HOZ K;  2A68 A;  4G7Z A;  1K83 C;  2R7Z K;  1I3Q C;  2JA8 C;  4A3B C;  3S1N C;  3GTM C;  3HOW K;  1WCM K;  3S16 K;  4YFX A;  3HOV C;  4LJZ A;  4BY1 K;  3PO3 K;  4A3E C;  5IYC C;  1I50 K;  3GTP C;  3M4O K;  5M5W K;  5IYB K;  4LK0 A;  4A3L K;  4AYB D;  3I4M C;  3S1Q C;  3S15 C;  4A3K C;  3H3V D;  2E2J C;  2B63 C;  4X6A C;  2WAQ D;  5C4X K;  1TWG C;  1YNN A;  3EQL A;  3FKI C;  2NVT C;  4YFN A;  3GTO K;  4A3C K;  2WB1 D;  3S2D C;  1TWF K;  2VUM C;  2YU9 K;  3RZD C;  2E2I C;  1I6V A;  4YFK A;  3HOU C;  4Y7N K;  4C3J K;  1Y1W K;  2JA7 K;  1Y1V K;  3H3V L;  1TWH K;  3HOZ C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...