4XLPA

Crystal structure of t.aquaticus transcription initiation complex containing upstream fork promoter
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
227
structure length
227
Chain Sequence
KAPVFTATTQGDHYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLDPKMASTTLILRAEGPKEVRAGDFTPSADVEIMNPDLHIATLEEGGKLYMEVRVDRGVGYVPAERHGIKDRINAIPVDAIFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVAILKEHLNYFANPEASLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a bacterial RNA polymerase holoenzyme open promoter complex.
pubmed doi rcsb
source organism Thermus aquaticus
molecule tags Transcription/dna
molecule keywords DNA-directed RNA polymerase subunit alpha
total genus 40
structure length 227
sequence length 227
chains with identical sequence B, G, H
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2015-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01000 RNA_pol_A_bac RNA polymerase Rpb3/RpoA insert domain
A PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain
A PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.12 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 DNA-directed RNA polymerase, insert domain 4xlpA02
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 4xlpA01
4KN7A 4A3KK 2VUMK 3M3YK 4A3GC 2JA7C 2NVYK 4A3KC 4A3GK 4YG2A 3HKZD 2JA8K 2PMZL 3GTKC 4GZYA 4NOIA 4C3HC 5C3EK 4A3FK 4Y7NK 4AYBL 4C3HK 1IW7A 3S16C 2BE5A 5IYDC 3S2HK 2VUMC 3M3YC 1R9TC 1TWCK 4OIQA 3HOYC 4OIPA 2E2IC 2NVQC 3RZDK 2E2IK 4BBSC 5FLMK 3RZOK 4LK0A 2NVXK 1Y1VK 3GTLC 3GTKK 3PO3K 4BBSK 3M4OK 5FLMC 3RZOC 5C4XC 2NVTC 1SFOK 2WAQL 4OIRA 3M4OC 4YFKA 3I4NC 5IP9K 3S17K 4A3LK 1Y1WC 2R93K 4A3EC 5IP9C 3S17C 2CW0A 3I4NK 3S2DK 4Y52K 4AYBD 4QIWD 4C2MC 4Y52C 4BY1C 3FKIK 2NVQK 1TWHC 4G7HA 3GTQC 4QJVB 3FKIC 4C2MK 2NVYC 2JA7K 3K7AC 3GTLK 4A3BC 2A69A 3HOUC 3GTMK 3HOWK 3S1NK 2E2HK 1SFOC 4BXXC 1K83C 4XLNA 4XLPA 4Q5SA 4A3DC 5M3MK 4BXXK 3S2DC 3GTPK 4C3JK 4A3DK 4BY1K 4C3IK 5M3FK 5IYDK 1TWFC 1I6VA 3PO2C 5C44C 5IYCK 2A68A 2WAQD 3RZDC 4QJVA 3EQLA 2E2HC 1WCMK 2A6EA 2NVXC 2PMZD 3S1RK 4X6AC 4C3IC 1ZYRA 4YFNA 4A3LC 4OIOA 4KMUA 1I50C 4A93K 3S1MC 1YNJA 1I3QK 4A93C 1TWHK 3GTQK 2R7ZK 4A3JC 1TWAK 2JA5K 4JK1A 4OINA 3I4MC 2E2JK 1BDFA 3DXJA 5TMFA 2R93C 3HOWC 1TWGK 3HOXK 4A3IC 1I50K 3GTPC 3CQZC 1TWGC 3HOXC 3PO2K 4LJZA 2JA8C 1YNNA 3H0GC 4LK1A 3GTMC 5C44K 4A3BK 5IYBC 3S14K 3HOVC 4A3CC 2JA6K 5D4DA 4Y7NC 3S1RC 3GTJC 2JA6C 3GTGK 4A3IK 4A3CK 4X6AK 1TWFK 3S2HC 3GTGC 2PA8D 5M5XK 3S1QC 4BY7C 5M5WK 4XSXA 3GTJK 3HOYK 4MQ9A 4A3MK 5C4JC 2WB1D 2O5JA 3HKZL 5IYCC 5C3EC 4Q4ZA 2B63C 1WCMC 3PO3C 1TWAC 2A6HA 2JA5C 3S15C 3H3VD 5M5YK 4A3JK 2B63K 3H3VL 4YFXA 3HOVK 2NVTK 3S14C 5FJ8K 4BBRC 2YU9K 2R92K 4LLGA 1R9TK 1TWCC 4A3EK 5TMCA 4BBRK 1I6HC 3S1QK 4BY7K 1HQMA 1I3QC 3S1MK 2PA8L 4QIWL 4A3MC 5C4JK 5IP7K 2R7ZC 3CQZK 1Y1VC 2Y0SD 4KN4A 3WODA 5IP7C 2WB1L 2Y0SL 3K7AK 4XSZA 2E2JC 1XPPA 2O5IA 5C4XK 3I4MK 3S15K 3GTOC 3S1NC 3HOUK 3H0GK 1Y1WK 1SMYA 2YU9C 4G7ZA 2R92C 4A3FC 3GTOK 4G7OA 1K83K 4MEXA 5IYBK 3HOZK 3S16K 4MEYA 3HOZC 1I6HK 2PPBA 4ZH4A 4C3JC
chains in the Genus database with same CATH superfamily
4A3KK 4KM8A 2VUMK 5E68A 1INNA 5DM7S 4KAWX 4GT9A 1O28A 2JA8K 1DCOA 1O2FB 2PMZL 3GTKC 4NOIA 4Y7NK 4C3HK 1IQ0A 1TWAA 5JFEA 1R9TC 3HOYC 4OIPA 2JA6A 1DCHA 5FLMK 3RZOK 4KATA 3GTLC 4BBSK 2NVYA 4OIRA 3CQZA 3I4NK 2XCRB 3DLLS 5HL8A 1TWHC 4P9SA 2YU9A 4C2MK 1BS2A 2JA7K 3K7AC 1PJ7A 5TJ3A 3TFIA 1TWFA 4A3BC 3HOUC 3S1NK 3HOWK 2XCOA 4BXXC 1K83C 1IBAA 3OPFA 4A3DC 3S2DC 5EGEA 3PO2C 2RGRA 3LYWA 4WILA 1O2BA 2E2HC 4QJVA 3EQLA 1WCMK 2NVXC 2PMZD 4KDDA 1J6VA 2GSNA 4C3IC 1DCPA 3SZZA 1VJEA 4KMUA 1Y1VA 3T01A 3S1MC 4A93C 3GTOA 2R7ZK 2JA5K 2VUMA 1WQFA 2R93C 4GTEA 2L3UA 5CHPA 1XZPA 3HOXC 5IOSA 4LOWA 4KB2A 2PHCB 4A3BK 1YNNA 5C44K 2W7VA 4ILDA 1DD5A 3A8IA 5D4DA 4DDQA 2JA6C 4A3CK 1TWFK 5M5XK 3GTGC 1PJ6A 4J3NA 3S1QC 4BY7C 5C4JC 3HKZL 4WJ3M 4O2DA 4GTBA 1R9TA 3PO3C 2A6HA 3S15C 1J6WA 2NVTK 2R92K 3PIPS 1ZBSA 4A3EK 2ZUEA 1O25A 3S1MK 3IPJA 2R93A 2Y0SL 1Y1WK 3S14K 4G7ZA 3GTQA 4A3FC 1L0WA 1UV7A 1I6HK 2KWAA 3M3YK 2NVYK 4WFNS 4LR2A 4A3GK 3HKZD 1TWGA 2GAHC 4GZYA 4C3HC 4AYBL 1IW7A 1WSVA 2XCQA 3RZDK 4BBSC 4LK0A 3T02A 1Y1VK 3PO3K 1EFWA 5C4XC 5CJ9A 2NVTC 5IORA 3QX3A 4KMAA 3M4OC 4YFKA 3G4CA 4KASA 2JA7A 5IP9C 3S17C 2CW0A 4G0UA 4WFAS 1BGWA 4BY1C 3GTMA 4G7HA 3GTQC 3FKIC 2GSUA 4C45A 3GSIA 3GTLK 4KM9A 1KQ4A 3S0XA 1SFOC 1C0AA 4XLNA 1EK8A 2E2IA 1VLOA 5M3MK 3GTPK 4C3JK 1J98A 5IOQA 3S1RK 1WIHA 3FOFA 2V6UA 1HI9A 4M1XA 3TFHA 4A3LC 1I50C 1O27A 4WFBS 4A93K 1TWHK 4KC6A 1TWAK 4WF9S 1G51A 1USOA 2KQ1A 3DXJA 5TMFA 3JSTA 1WSRA 3HOXK 4A3IC 1TWGC 3PO2K 1B4BA 4LJZA 5IYBC 2D6FC 3HOVC 4A3CC 2JA6K 3BP3A 1IL2A 4X6AK 3GTLA 3S2HC 3GTJK 1ZXOA 3LPXA 1IS1A 1XXBA 5EGHA 4GTCA 4G0VA 1X31C 1WCMC 4A3JK 4FM9A 3H3VL 5M5YK 2B63K 3BUEA 2YU9K 3L4KA 4BBRK 3S1QK 4BY7K 1VH2A 2PA8L 2Y3PA 4A3MC 1JQWA 3L4JA 2R7ZC 3CQZK 3WODA 5IP7C 1XPPA 3LAJA 4FZBA 3FKIA 3HOZK 4G7OA 4MEXA 3S16C 2PPBA 3GIRA 4U67S 3H0GA 5JVGS 1VRQC 3GTPA 4YG2A 4KB4A 3OREA 3CAGA 1EI6A 4P5BA 4LQYA 2ZUFA 5IYDC 3S2HK 1WCMA 2VUMC 2B63A 1TWCK 4OIQA 2NVQC 2E2IK 2GAGC 2NVXK 3GTKK 3OEPA 1F7VA 5FLMC 3RZOC 3FOEA 3M4OK 3GTJA 3I4NC 4GTAA 2R7ZA 4A3EC 1F9NA 4IO9S 4AYBD 4C2MC 4Y52C 3SZYA 1Y1WA 1JOEA 4QJVB 2NVYC 2A69A 4XLPA 4Q5SA 4A3DK 1B4AA 4KMHA 5C44C 1I50A 5IYCK 2ZFZA 2A68A 3RZDC 3NUHA 3AD8C 4GTLA 3BP8C 3ERED 1ZYRA 4YFNA 1O26A 4OIOA 1WOPA 1YNJA 1J6XA 3LAPA 3GTQK 1PJ5A 4JK1A 1BDFA 3CF5S 3HOWC 1ZVUA 1I3QA 2KPUA 1TWGK 1I50K 3GTPC 2ZJQS 2JA8C 4LK1A 3H0GC 4IOAS 2P8TA 3AQPA 4G0WA 4C3JC 3GTGK 3HXAA 2L5NA 1YX2A 2PA8D 5M5WK 4XSXA 3HOYK 2O5JA 1F93A 5IYCC 5C3EC 4RMFA 2B63C 2JA5C 1XXCA 3H3VD 3HOVK 4WCES 3TTGA 2ZJPS 3S14C 4BBRC 1R9TK 1WOOA 3GTKA 1I6HC 3AD7C 1O29A 3GEEA 4QIWL 5C4JK 5IP7K 1SFOA 2WB1L 3K7AK 2ZJRS 5C4XK 3GTGA 3S15K 4IOCS 5HQHA 2R92C 3GTOK 1K83K 1JVIA 2V6TA 1WQHA 5DM6S 4KN7A 4A3GC 2JA7C 4A3KC 3V4GA 3GEHA 4GFQA 4A3FK 1EQRA 3AH5A 5IOTA 2BE5A 4BLAA 2JA5A 3M3YC 4P5AA 2EBBA 1FEUA 2E2IC 1K83A 1BJTA 1O2AA 1SFOK 2WAQL 5IP9K 3S17K 2R93K 4A3LK 1Y1WC 4Y52K 3N0CA 3S2DK 2E2HA 4QIWD 3FKIK 2NVQK 2CFAB 2R92A 3GEIA 1WOSA 2FQOA 3GTMK 1WORA 2GSOA 2JH3A 3AD9C 2E2HK 3PIOS 1ZQ1C 1V5VA 3TFJA 3Q3QA 4BXXK 4GTDA 4BY1K 2KXYA 4C3IK 5M3FK 5IYDK 1TWFC 1I6VA 1ISEA 1EH1A 1YCLA 3MMLB 2WAQD 1F7UA 1GE9A 2A6EA 1AB4A 4BLBA 1IE0A 4X6AC 3G4AA 3FHZA 2NVXA 4KARA 1WQGA 4XCHA 1I3QK 1XXAA 4KMDA 4AH6A 4A3JC 1TWCA 4OINA 3I4MC 2FQTA 1XZQB 2E2JK 5JVOA 1VGXA 4WJ4A 3CQZC 4GTFA 5JVHS 3GTMC 3N0BA 1USMA 3ADAC 3AQOA 4Y7NC 3S1RC 1O24A 3GTJC 4A3IK 1XZQA 2RH6A 3A8KA 4MQ9A 4A3MK 2WB1D 4Q4ZA 1TWAC 4BKWA 3VA7A 4YFXA 4PABA 1RU0A 5FJ8K 4LLGA 1TWCC 4PAAA 5TMCA 5L46A 1HQMA 1I3QC 1XZPB 1Y1VC 5HL7S 2Y0SD 4KN4A 5C3EK 3A8JA 4XSZA 2E2JC 3I4MK 2O5IA 3GTOC 3S1NC 3GDZA 3HOUK 3H0GK 1SMYA 2V6SA 2YU9C 1TWHA 2P5MA 3S16K 5IYBK 3N3YA 4MEYA 3HOZC 3T00A 4ZH4A 2CFAA
chains in the Genus database with same CATH topology
4KN7A 4A3KK 2VUMK 3M3YK 4A3GC 2JA7C 2NVYK 4A3KC 4A3GK 4YG2A 3HKZD 2JA8K 2PMZL 3GTKC 4GZYA 4NOIA 4C3HC 5C3EK 4A3FK 4Y7NK 4AYBL 4C3HK 1IW7A 3S16C 2BE5A 5IYDC 3S2HK 2VUMC 3M3YC 1R9TC 1TWCK 4OIQA 3HOYC 4OIPA 2E2IC 2NVQC 3RZDK 2E2IK 4BBSC 5FLMK 3RZOK 4LK0A 2NVXK 1Y1VK 3GTLC 3GTKK 3PO3K 4BBSK 3M4OK 5FLMC 3RZOC 5C4XC 2NVTC 1SFOK 2WAQL 4OIRA 3M4OC 4YFKA 3I4NC 5IP9K 3S17K 4A3LK 1Y1WC 2R93K 4A3EC 5IP9C 3S17C 2CW0A 3I4NK 3S2DK 4Y52K 4AYBD 4QIWD 4C2MC 4Y52C 4BY1C 3FKIK 2NVQK 1TWHC 4G7HA 3GTQC 4QJVB 3FKIC 4C2MK 2NVYC 2JA7K 3K7AC 3GTLK 4A3BC 2A69A 3HOUC 3GTMK 3HOWK 3S1NK 2E2HK 1SFOC 4BXXC 1K83C 4XLNA 4XLPA 4Q5SA 4A3DC 5M3MK 4BXXK 3S2DC 3GTPK 4C3JK 4A3DK 4BY1K 4C3IK 5M3FK 5IYDK 1TWFC 1I6VA 3PO2C 5C44C 5IYCK 2A68A 2WAQD 3RZDC 4QJVA 3EQLA 2E2HC 1WCMK 2A6EA 2NVXC 2PMZD 3S1RK 4X6AC 4C3IC 1ZYRA 4YFNA 4A3LC 4OIOA 4KMUA 1I50C 4A93K 3S1MC 1YNJA 1I3QK 4A93C 1TWHK 3GTQK 2R7ZK 4A3JC 1TWAK 2JA5K 4JK1A 4OINA 3I4MC 2E2JK 1BDFA 3DXJA 5TMFA 2R93C 3HOWC 1TWGK 3HOXK 4A3IC 1I50K 3GTPC 3CQZC 1TWGC 3HOXC 3PO2K 4LJZA 2JA8C 1YNNA 3H0GC 4LK1A 3GTMC 5C44K 4A3BK 5IYBC 3S14K 3HOVC 4A3CC 2JA6K 5D4DA 4Y7NC 3S1RC 3GTJC 2JA6C 3GTGK 4A3IK 4A3CK 4X6AK 1TWFK 3S2HC 3GTGC 2PA8D 5M5XK 3S1QC 4BY7C 5M5WK 4XSXA 3GTJK 3HOYK 4MQ9A 4A3MK 5C4JC 2WB1D 2O5JA 3HKZL 5IYCC 5C3EC 4Q4ZA 2B63C 1WCMC 3PO3C 1TWAC 2A6HA 2JA5C 3S15C 3H3VD 5M5YK 4A3JK 2B63K 3H3VL 4YFXA 3HOVK 2NVTK 3S14C 5FJ8K 4BBRC 2YU9K 2R92K 4LLGA 1R9TK 1TWCC 4A3EK 5TMCA 4BBRK 1I6HC 3S1QK 4BY7K 1HQMA 1I3QC 3S1MK 2PA8L 4QIWL 4A3MC 5C4JK 5IP7K 2R7ZC 3CQZK 1Y1VC 2Y0SD 4KN4A 3WODA 5IP7C 2WB1L 2Y0SL 3K7AK 4XSZA 2E2JC 1XPPA 2O5IA 5C4XK 3I4MK 3S15K 3GTOC 3S1NC 3HOUK 3H0GK 1Y1WK 1SMYA 2YU9C 4G7ZA 2R92C 4A3FC 3GTOK 4G7OA 1K83K 4MEXA 5IYBK 3HOZK 3S16K 4MEYA 3HOZC 1I6HK 2PPBA 4ZH4A 4C3JC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KN7 A;  4A3K K;  2VUM K;  3M3Y K;  4A3G C;  2JA7 C;  2NVY K;  4A3K C;  4A3G K;  4YG2 A;  3HKZ D;  2JA8 K;  2PMZ L;  3GTK C;  4GZY A;  4NOI A;  4C3H C;  5C3E K;  4A3F K;  4Y7N K;  4AYB L;  4C3H K;  1IW7 A;  3S16 C;  2BE5 A;  5IYD C;  3S2H K;  2VUM C;  3M3Y C;  1R9T C;  1TWC K;  4OIQ A;  3HOY C;  4OIP A;  2E2I C;  2NVQ C;  3RZD K;  2E2I K;  4BBS C;  5FLM K;  3RZO K;  4LK0 A;  2NVX K;  1Y1V K;  3GTL C;  3GTK K;  3PO3 K;  4BBS K;  3M4O K;  5FLM C;  3RZO C;  5C4X C;  2NVT C;  1SFO K;  2WAQ L;  4OIR A;  3M4O C;  4YFK A;  3I4N C;  5IP9 K;  3S17 K;  4A3L K;  1Y1W C;  2R93 K;  4A3E C;  5IP9 C;  3S17 C;  2CW0 A;  3I4N K;  3S2D K;  4Y52 K;  4AYB D;  4QIW D;  4C2M C;  4Y52 C;  4BY1 C;  3FKI K;  2NVQ K;  1TWH C;  4G7H A;  3GTQ C;  4QJV B;  3FKI C;  4C2M K;  2NVY C;  2JA7 K;  3K7A C;  3GTL K;  4A3B C;  2A69 A;  3HOU C;  3GTM K;  3HOW K;  3S1N K;  2E2H K;  1SFO C;  4BXX C;  1K83 C;  4XLN A;  4XLP A;  4Q5S A;  4A3D C;  5M3M K;  4BXX K;  3S2D C;  3GTP K;  4C3J K;  4A3D K;  4BY1 K;  4C3I K;  5M3F K;  5IYD K;  1TWF C;  1I6V A;  3PO2 C;  5C44 C;  5IYC K;  2A68 A;  2WAQ D;  3RZD C;  4QJV A;  3EQL A;  2E2H C;  1WCM K;  2A6E A;  2NVX C;  2PMZ D;  3S1R K;  4X6A C;  4C3I C;  1ZYR A;  4YFN A;  4A3L C;  4OIO A;  4KMU A;  1I50 C;  4A93 K;  3S1M C;  1YNJ A;  1I3Q K;  4A93 C;  1TWH K;  3GTQ K;  2R7Z K;  4A3J C;  1TWA K;  2JA5 K;  4JK1 A;  4OIN A;  3I4M C;  2E2J K;  1BDF A;  3DXJ A;  5TMF A;  2R93 C;  3HOW C;  1TWG K;  3HOX K;  4A3I C;  1I50 K;  3GTP C;  3CQZ C;  1TWG C;  3HOX C;  3PO2 K;  4LJZ A;  2JA8 C;  1YNN A;  3H0G C;  4LK1 A;  3GTM C;  5C44 K;  4A3B K;  5IYB C;  3S14 K;  3HOV C;  4A3C C;  2JA6 K;  5D4D A;  4Y7N C;  3S1R C;  3GTJ C;  2JA6 C;  3GTG K;  4A3I K;  4A3C K;  4X6A K;  1TWF K;  3S2H C;  3GTG C;  2PA8 D;  5M5X K;  3S1Q C;  4BY7 C;  5M5W K;  4XSX A;  3GTJ K;  3HOY K;  4MQ9 A;  4A3M K;  5C4J C;  2WB1 D;  2O5J A;  3HKZ L;  5IYC C;  5C3E C;  4Q4Z A;  2B63 C;  1WCM C;  3PO3 C;  1TWA C;  2A6H A;  2JA5 C;  3S15 C;  3H3V D;  5M5Y K;  4A3J K;  2B63 K;  3H3V L;  4YFX A;  3HOV K;  2NVT K;  3S14 C;  5FJ8 K;  4BBR C;  2YU9 K;  2R92 K;  4LLG A;  1R9T K;  1TWC C;  4A3E K;  5TMC A;  4BBR K;  1I6H C;  3S1Q K;  4BY7 K;  1HQM A;  1I3Q C;  3S1M K;  2PA8 L;  4QIW L;  4A3M C;  5C4J K;  5IP7 K;  2R7Z C;  3CQZ K;  1Y1V C;  2Y0S D;  4KN4 A;  3WOD A;  5IP7 C;  2WB1 L;  2Y0S L;  3K7A K;  4XSZ A;  2E2J C;  1XPP A;  2O5I A;  5C4X K;  3I4M K;  3S15 K;  3GTO C;  3S1N C;  3HOU K;  3H0G K;  1Y1W K;  1SMY A;  2YU9 C;  4G7Z A;  2R92 C;  4A3F C;  3GTO K;  4G7O A;  1K83 K;  4MEX A;  5IYB K;  3HOZ K;  3S16 K;  4MEY A;  3HOZ C;  1I6H K;  2PPB A;  4ZH4 A;  4C3J C; 
#chains in the Genus database with same CATH topology
 4A3K K;  4KM8 A;  2VUM K;  5E68 A;  1INN A;  5DM7 S;  4KAW X;  4GT9 A;  1O28 A;  2JA8 K;  1DCO A;  1O2F B;  2PMZ L;  3GTK C;  4NOI A;  4Y7N K;  4C3H K;  1IQ0 A;  1TWA A;  5JFE A;  1R9T C;  3HOY C;  4OIP A;  2JA6 A;  1DCH A;  5FLM K;  3RZO K;  4KAT A;  3GTL C;  4BBS K;  2NVY A;  4OIR A;  3CQZ A;  3I4N K;  2XCR B;  3DLL S;  5HL8 A;  1TWH C;  4P9S A;  2YU9 A;  4C2M K;  1BS2 A;  2JA7 K;  3K7A C;  1PJ7 A;  5TJ3 A;  3TFI A;  1TWF A;  4A3B C;  3HOU C;  3S1N K;  3HOW K;  2XCO A;  4BXX C;  1K83 C;  1IBA A;  3OPF A;  4A3D C;  3S2D C;  5EGE A;  3PO2 C;  2RGR A;  3LYW A;  4WIL A;  1O2B A;  2E2H C;  4QJV A;  3EQL A;  1WCM K;  2NVX C;  2PMZ D;  4KDD A;  1J6V A;  2GSN A;  4C3I C;  1DCP A;  3SZZ A;  1VJE A;  4KMU A;  1Y1V A;  3T01 A;  3S1M C;  4A93 C;  3GTO A;  2R7Z K;  2JA5 K;  2VUM A;  1WQF A;  2R93 C;  4GTE A;  2L3U A;  5CHP A;  1XZP A;  3HOX C;  5IOS A;  4LOW A;  4KB2 A;  2PHC B;  4A3B K;  1YNN A;  5C44 K;  2W7V A;  4ILD A;  1DD5 A;  3A8I A;  5D4D A;  4DDQ A;  2JA6 C;  4A3C K;  1TWF K;  5M5X K;  3GTG C;  1PJ6 A;  4J3N A;  3S1Q C;  4BY7 C;  5C4J C;  3HKZ L;  4WJ3 M;  4O2D A;  4GTB A;  1R9T A;  3PO3 C;  2A6H A;  3S15 C;  1J6W A;  2NVT K;  2R92 K;  3PIP S;  1ZBS A;  4A3E K;  2ZUE A;  1O25 A;  3S1M K;  3IPJ A;  2R93 A;  2Y0S L;  1Y1W K;  3S14 K;  4G7Z A;  3GTQ A;  4A3F C;  1L0W A;  1UV7 A;  1I6H K;  2KWA A;  3M3Y K;  2NVY K;  4WFN S;  4LR2 A;  4A3G K;  3HKZ D;  1TWG A;  2GAH C;  4GZY A;  4C3H C;  4AYB L;  1IW7 A;  1WSV A;  2XCQ A;  3RZD K;  4BBS C;  4LK0 A;  3T02 A;  1Y1V K;  3PO3 K;  1EFW A;  5C4X C;  5CJ9 A;  2NVT C;  5IOR A;  3QX3 A;  4KMA A;  3M4O C;  4YFK A;  3G4C A;  4KAS A;  2JA7 A;  5IP9 C;  3S17 C;  2CW0 A;  4G0U A;  4WFA S;  1BGW A;  4BY1 C;  3GTM A;  4G7H A;  3GTQ C;  3FKI C;  2GSU A;  4C45 A;  3GSI A;  3GTL K;  4KM9 A;  1KQ4 A;  3S0X A;  1SFO C;  1C0A A;  4XLN A;  1EK8 A;  2E2I A;  1VLO A;  5M3M K;  3GTP K;  4C3J K;  1J98 A;  5IOQ A;  3S1R K;  1WIH A;  3FOF A;  2V6U A;  1HI9 A;  4M1X A;  3TFH A;  4A3L C;  1I50 C;  1O27 A;  4WFB S;  4A93 K;  1TWH K;  4KC6 A;  1TWA K;  4WF9 S;  1G51 A;  1USO A;  2KQ1 A;  3DXJ A;  5TMF A;  3JST A;  1WSR A;  3HOX K;  4A3I C;  1TWG C;  3PO2 K;  1B4B A;  4LJZ A;  5IYB C;  2D6F C;  3HOV C;  4A3C C;  2JA6 K;  3BP3 A;  1IL2 A;  4X6A K;  3GTL A;  3S2H C;  3GTJ K;  1ZXO A;  3LPX A;  1IS1 A;  1XXB A;  5EGH A;  4GTC A;  4G0V A;  1X31 C;  1WCM C;  4A3J K;  4FM9 A;  3H3V L;  5M5Y K;  2B63 K;  3BUE A;  2YU9 K;  3L4K A;  4BBR K;  3S1Q K;  4BY7 K;  1VH2 A;  2PA8 L;  2Y3P A;  4A3M C;  1JQW A;  3L4J A;  2R7Z C;  3CQZ K;  3WOD A;  5IP7 C;  1XPP A;  3LAJ A;  4FZB A;  3FKI A;  3HOZ K;  4G7O A;  4MEX A;  3S16 C;  2PPB A;  3GIR A;  4U67 S;  3H0G A;  5JVG S;  1VRQ C;  3GTP A;  4YG2 A;  4KB4 A;  3ORE A;  3CAG A;  1EI6 A;  4P5B A;  4LQY A;  2ZUF A;  5IYD C;  3S2H K;  1WCM A;  2VUM C;  2B63 A;  1TWC K;  4OIQ A;  2NVQ C;  2E2I K;  2GAG C;  2NVX K;  3GTK K;  3OEP A;  1F7V A;  5FLM C;  3RZO C;  3FOE A;  3M4O K;  3GTJ A;  3I4N C;  4GTA A;  2R7Z A;  4A3E C;  1F9N A;  4IO9 S;  4AYB D;  4C2M C;  4Y52 C;  3SZY A;  1Y1W A;  1JOE A;  4QJV B;  2NVY C;  2A69 A;  4XLP A;  4Q5S A;  4A3D K;  1B4A A;  4KMH A;  5C44 C;  1I50 A;  5IYC K;  2ZFZ A;  2A68 A;  3RZD C;  3NUH A;  3AD8 C;  4GTL A;  3BP8 C;  3ERE D;  1ZYR A;  4YFN A;  1O26 A;  4OIO A;  1WOP A;  1YNJ A;  1J6X A;  3LAP A;  3GTQ K;  1PJ5 A;  4JK1 A;  1BDF A;  3CF5 S;  3HOW C;  1ZVU A;  1I3Q A;  2KPU A;  1TWG K;  1I50 K;  3GTP C;  2ZJQ S;  2JA8 C;  4LK1 A;  3H0G C;  4IOA S;  2P8T A;  3AQP A;  4G0W A;  4C3J C;  3GTG K;  3HXA A;  2L5N A;  1YX2 A;  2PA8 D;  5M5W K;  4XSX A;  3HOY K;  2O5J A;  1F93 A;  5IYC C;  5C3E C;  4RMF A;  2B63 C;  2JA5 C;  1XXC A;  3H3V D;  3HOV K;  4WCE S;  3TTG A;  2ZJP S;  3S14 C;  4BBR C;  1R9T K;  1WOO A;  3GTK A;  1I6H C;  3AD7 C;  1O29 A;  3GEE A;  4QIW L;  5C4J K;  5IP7 K;  1SFO A;  2WB1 L;  3K7A K;  2ZJR S;  5C4X K;  3GTG A;  3S15 K;  4IOC S;  5HQH A;  2R92 C;  3GTO K;  1K83 K;  1JVI A;  2V6T A;  1WQH A;  5DM6 S;  4KN7 A;  4A3G C;  2JA7 C;  4A3K C;  3V4G A;  3GEH A;  4GFQ A;  4A3F K;  1EQR A;  3AH5 A;  5IOT A;  2BE5 A;  4BLA A;  2JA5 A;  3M3Y C;  4P5A A;  2EBB A;  1FEU A;  2E2I C;  1K83 A;  1BJT A;  1O2A A;  1SFO K;  2WAQ L;  5IP9 K;  3S17 K;  2R93 K;  4A3L K;  1Y1W C;  4Y52 K;  3N0C A;  3S2D K;  2E2H A;  4QIW D;  3FKI K;  2NVQ K;  2CFA B;  2R92 A;  3GEI A;  1WOS A;  2FQO A;  3GTM K;  1WOR A;  2GSO A;  2JH3 A;  3AD9 C;  2E2H K;  3PIO S;  1ZQ1 C;  1V5V A;  3TFJ A;  3Q3Q A;  4BXX K;  4GTD A;  4BY1 K;  2KXY A;  4C3I K;  5M3F K;  5IYD K;  1TWF C;  1I6V A;  1ISE A;  1EH1 A;  1YCL A;  3MML B;  2WAQ D;  1F7U A;  1GE9 A;  2A6E A;  1AB4 A;  4BLB A;  1IE0 A;  4X6A C;  3G4A A;  3FHZ A;  2NVX A;  4KAR A;  1WQG A;  4XCH A;  1I3Q K;  1XXA A;  4KMD A;  4AH6 A;  4A3J C;  1TWC A;  4OIN A;  3I4M C;  2FQT A;  1XZQ B;  2E2J K;  5JVO A;  1VGX A;  4WJ4 A;  3CQZ C;  4GTF A;  5JVH S;  3GTM C;  3N0B A;  1USM A;  3ADA C;  3AQO A;  4Y7N C;  3S1R C;  1O24 A;  3GTJ C;  4A3I K;  1XZQ A;  2RH6 A;  3A8K A;  4MQ9 A;  4A3M K;  2WB1 D;  4Q4Z A;  1TWA C;  4BKW A;  3VA7 A;  4YFX A;  4PAB A;  1RU0 A;  5FJ8 K;  4LLG A;  1TWC C;  4PAA A;  5TMC A;  5L46 A;  1HQM A;  1I3Q C;  1XZP B;  1Y1V C;  5HL7 S;  2Y0S D;  4KN4 A;  5C3E K;  3A8J A;  4XSZ A;  2E2J C;  3I4M K;  2O5I A;  3GTO C;  3S1N C;  3GDZ A;  3HOU K;  3H0G K;  1SMY A;  2V6S A;  2YU9 C;  1TWH A;  2P5M A;  3S16 K;  5IYB K;  3N3Y A;  4MEY A;  3HOZ C;  3T00 A;  4ZH4 A;  2CFA A; 
#chains in the Genus database with same CATH homology
 4KN7 A;  4A3K K;  2VUM K;  3M3Y K;  4A3G C;  2JA7 C;  2NVY K;  4A3K C;  4A3G K;  4YG2 A;  3HKZ D;  2JA8 K;  2PMZ L;  3GTK C;  4GZY A;  4NOI A;  4C3H C;  5C3E K;  4A3F K;  4Y7N K;  4AYB L;  4C3H K;  1IW7 A;  3S16 C;  2BE5 A;  5IYD C;  3S2H K;  2VUM C;  3M3Y C;  1R9T C;  1TWC K;  4OIQ A;  3HOY C;  4OIP A;  2E2I C;  2NVQ C;  3RZD K;  2E2I K;  4BBS C;  5FLM K;  3RZO K;  4LK0 A;  2NVX K;  1Y1V K;  3GTL C;  3GTK K;  3PO3 K;  4BBS K;  3M4O K;  5FLM C;  3RZO C;  5C4X C;  2NVT C;  1SFO K;  2WAQ L;  4OIR A;  3M4O C;  4YFK A;  3I4N C;  5IP9 K;  3S17 K;  4A3L K;  1Y1W C;  2R93 K;  4A3E C;  5IP9 C;  3S17 C;  2CW0 A;  3I4N K;  3S2D K;  4Y52 K;  4AYB D;  4QIW D;  4C2M C;  4Y52 C;  4BY1 C;  3FKI K;  2NVQ K;  1TWH C;  4G7H A;  3GTQ C;  4QJV B;  3FKI C;  4C2M K;  2NVY C;  2JA7 K;  3K7A C;  3GTL K;  4A3B C;  2A69 A;  3HOU C;  3GTM K;  3HOW K;  3S1N K;  2E2H K;  1SFO C;  4BXX C;  1K83 C;  4XLN A;  4XLP A;  4Q5S A;  4A3D C;  5M3M K;  4BXX K;  3S2D C;  3GTP K;  4C3J K;  4A3D K;  4BY1 K;  4C3I K;  5M3F K;  5IYD K;  1TWF C;  1I6V A;  3PO2 C;  5C44 C;  5IYC K;  2A68 A;  2WAQ D;  3RZD C;  4QJV A;  3EQL A;  2E2H C;  1WCM K;  2A6E A;  2NVX C;  2PMZ D;  3S1R K;  4X6A C;  4C3I C;  1ZYR A;  4YFN A;  4A3L C;  4OIO A;  4KMU A;  1I50 C;  4A93 K;  3S1M C;  1YNJ A;  1I3Q K;  4A93 C;  1TWH K;  3GTQ K;  2R7Z K;  4A3J C;  1TWA K;  2JA5 K;  4JK1 A;  4OIN A;  3I4M C;  2E2J K;  1BDF A;  3DXJ A;  5TMF A;  2R93 C;  3HOW C;  1TWG K;  3HOX K;  4A3I C;  1I50 K;  3GTP C;  3CQZ C;  1TWG C;  3HOX C;  3PO2 K;  4LJZ A;  2JA8 C;  1YNN A;  3H0G C;  4LK1 A;  3GTM C;  5C44 K;  4A3B K;  5IYB C;  3S14 K;  3HOV C;  4A3C C;  2JA6 K;  5D4D A;  4Y7N C;  3S1R C;  3GTJ C;  2JA6 C;  3GTG K;  4A3I K;  4A3C K;  4X6A K;  1TWF K;  3S2H C;  3GTG C;  2PA8 D;  5M5X K;  3S1Q C;  4BY7 C;  5M5W K;  4XSX A;  3GTJ K;  3HOY K;  4MQ9 A;  4A3M K;  5C4J C;  2WB1 D;  2O5J A;  3HKZ L;  5IYC C;  5C3E C;  4Q4Z A;  2B63 C;  1WCM C;  3PO3 C;  1TWA C;  2A6H A;  2JA5 C;  3S15 C;  3H3V D;  5M5Y K;  4A3J K;  2B63 K;  3H3V L;  4YFX A;  3HOV K;  2NVT K;  3S14 C;  5FJ8 K;  4BBR C;  2YU9 K;  2R92 K;  4LLG A;  1R9T K;  1TWC C;  4A3E K;  5TMC A;  4BBR K;  1I6H C;  3S1Q K;  4BY7 K;  1HQM A;  1I3Q C;  3S1M K;  2PA8 L;  4QIW L;  4A3M C;  5C4J K;  5IP7 K;  2R7Z C;  3CQZ K;  1Y1V C;  2Y0S D;  4KN4 A;  3WOD A;  5IP7 C;  2WB1 L;  2Y0S L;  3K7A K;  4XSZ A;  2E2J C;  1XPP A;  2O5I A;  5C4X K;  3I4M K;  3S15 K;  3GTO C;  3S1N C;  3HOU K;  3H0G K;  1Y1W K;  1SMY A;  2YU9 C;  4G7Z A;  2R92 C;  4A3F C;  3GTO K;  4G7O A;  1K83 K;  4MEX A;  5IYB K;  3HOZ K;  3S16 K;  4MEY A;  3HOZ C;  1I6H K;  2PPB A;  4ZH4 A;  4C3J C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...