4XLNA

Crystal structure of t. aquaticus transcription initiation complex containing bubble promoter and rna
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
227
structure length
227
Chain Sequence
KAPVFTATTQGDHYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLDPKMASTTLILRAEGPKEVRAGDFTPSADVEIMNPDLHIATLEEGGKLYMEVRVDRGVGYVPAERHGIKDRINAIPVDAIFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVAILKEHLNYFANPEASLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase subunit alpha
publication title Structure of a bacterial RNA polymerase holoenzyme open promoter complex.
pubmed doi rcsb
source organism Thermus aquaticus
molecule tags Transcription/dna/rna
total genus 41
structure length 227
sequence length 227
chains with identical sequence B, G, H
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2015-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01000 RNA_pol_A_bac RNA polymerase Rpb3/RpoA insert domain
A PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain
A PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.12 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 DNA-directed RNA polymerase, insert domain 4xlnA02
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 4xlnA01
5IP7C 5IP9C 2JA7C 3M4OK 5IYBC 4A3BK 4XSZA 2NVQC 4YG2A 4Y52C 1IW7A 4KMUA 1I6VA 3S2HC 3K7AC 1TWHK 1XPPA 2YU9K 3GTLK 3S1RC 4A93C 3GTJK 3S16C 3S1NK 4A3DK 3I4MK 4BY7K 3S17K 5C4XC 4LK0A 4YFXA 3EQLA 1R9TC 3GTOC 2NVTK 4A3GC 2PMZL 5FLMK 5C44K 5M5WK 1TWAC 2Y0SL 1TWFK 4A3FK 2E2JC 1I50K 3GTPK 1I3QC 3S14K 2PPBA 1I6HC 1TWGC 3HOUK 1ZYRA 3HOYC 3H0GC 2B63K 5FJ8K 3HOWC 4QIWL 2WB1D 4LJZA 2VUMK 3S1MC 4MQ9A 3RZOC 4BY1C 2NVYC 4Q5SA 4A3IK 3H3VD 3HOVC 4QJVA 4KN4A 4G7ZA 4AYBD 4OIPA 4QJVB 3GTKK 3S1QC 3I4NC 2R7ZK 3HKZD 4BXXC 3S2DC 4C3IC 4G7HA 4G7OA 5IYCC 1Y1VC 2R93C 5IYBK 5M5XK 3RZDK 2JA7K 4OINA 2A68A 5C3EC 2WAQD 1K83C 3GTQK 3K7AK 4X6AK 4Y52K 3S1RK 5M3MK 3S16K 2NVXC 1SMYA 3GTOK 5TMFA 3CQZC 3PO3C 4YFNA 2E2HC 4BBRC 3M3YC 2O5JA 2BE5A 4LK1A 2JA8C 4A3JC 3HOXC 1Y1WK 5C4JC 2E2JK 1I3QK 3HOZC 1I6HK 1TWGK 4BBSK 1YNJA 4A3KC 3HOYK 2A69A 2R92C 4Y7NK 3WODA 3H0GK 3GTMC 2R93K 4BY7C 4A3CK 2PA8D 3GTJC 1TWCK 4BY1K 2NVYK 2JA5C 4C3JK 3HOVK 4MEXA 4A3EC 3H3VL 5IP7K 5IP9K 3S1QK 2E2IC 2JA6C 4C3HC 4OIOA 4MEYA 3GTGC 4AYBL 4C3IK 2NVQK 1I50C 3I4NK 4A3MC 5D4DA 3S2HK 4A93K 2A6HA 3DXJA 4QIWD 4A3LC 5C3EK 1SFOC 4JK1A 5C4XK 1R9TK 4C2MC 2O5IA 3S15C 3PO2C 5M5YK 2NVXK 4A3GK 4NOIA 2A6EA 4KN7A 2VUMC 4LLGA 2E2HK 1TWAK 3PO3K 1WCMC 3M3YK 3FKIC 2JA8K 4XLPA 2CW0A 4A3IC 5IYDC 3GTKC 5C4JK 4A3BC 3M4OC 3HOZK 1HQMA 4A3DC 3GTLC 3RZDC 2YU9C 1TWHC 4A3KK 2R92K 3HOWK 1YNNA 3S1MK 3S1NC 4X6AC 3GTQC 2PMZD 3I4MC 3S17C 2WB1L 3GTMK 3RZOK 2NVTC 4YFKA 2Y0SD 5FLMC 2JA5K 5C44C 2PA8L 5M3FK 1TWFC 4A3EK 4BXXK 4A3FC 3S2DK 3GTPC 5IYCK 1Y1VK 1Y1WC 3S14C 4C3HK 2E2IK 3HKZL 4OIQA 4Q4ZA 3HOUC 2JA6K 3GTGK 1K83K 4A3MK 4BBSC 2B63C 4A3LK 2WAQL 1SFOK 4Y7NC 4C2MK 3CQZK 3S15K 4BBRK 3PO2K 4XSXA 4A3CC 1TWCC 4OIRA 4GZYA 3HOXK 4A3JK 4C3JC 1WCMK 4XLNA 5TMCA 3FKIK 4ZH4A 1BDFA 2R7ZC 5IYDK
chains in the Genus database with same CATH superfamily
5IP7C 4KMHA 3CF5S 4YG2A 1ISEA 3S1RC 3S16C 3I4MK 3S17K 2ZJRS 3GTOC 3TFHA 2JA6A 1VGXA 2GSUA 4A3GC 3AQPA 2NVXA 3BUEA 3GTPK 2E2HA 1USMA 2B63K 3TFJA 2WB1D 4LJZA 4WJ3M 2VUMK 2L5NA 4G0UA 4Q5SA 4BY1C 3H3VD 3GSIA 2V6SA 1TWHA 4AYBD 4QJVB 3GTJA 3S1QC 2FQTA 3HKZD 4BXXC 2JA5A 2GSOA 1JOEA 1Y1VC 4FZBA 4OINA 2A68A 5C3EC 3S1RK 1WQFA 3S16K 1WOOA 3LPXA 1SMYA 4WCES 1YCLA 3GTOK 3CQZC 3PIOS 4YFNA 2EBBA 1WQGA 3M3YC 1AB4A 4KATA 5JFEA 3HOZC 5L46A 4BBSK 1F9NA 4Y7NK 4A3CK 1XZPB 2PA8D 3L4JA 1WSVA 4BY1K 4MEXA 1VRQC 2L3UA 4KASA 4A3EC 5IP9K 3S1QK 2JA6C 3CAGA 1F7VA 1I50C 3OPFA 3S2HK 3NUHA 2RGRA 4A3LC 2RH6A 4QIWD 5C3EK 3GTPA 4JK1A 5C4XK 1R9TK 3S15C 1I3QA 4LLGA 3M3YK 3AD9C 2CFAB 4A3IC 4LOWA 3M4OC 3HOZK 1HQMA 4A3DC 3HOWK 3PIPS 3RZDC 1TWHC 2YU9C 4WFNS 4J3NA 3GTQC 2WB1L 1GE9A 5FLMC 5C44C 1BS2A 4KM9A 5IOQA 4A3EK 5CJ9A 3LAJA 2JA6K 3HKZL 3HOUC 4IO9S 5E68A 4A3LK 4FM9A 1ZBSA 3S15K 1TWCC 1WQHA 4A3JK 4C3JC 4XLNA 2R92A 4ZH4A 1BDFA 3HXAA 4A3IK 3M4OK 5IYBC 2FQOA 1ZVUA 4A3DK 1I6VA 2YU9K 3K7AC 1TWHK 3VA7A 4BY7K 4A93C 3GTJK 2V6TA 4O2DA 1Y1VA 2E2IA 5FLMK 5C44K 5M5WK 1J6VA 2KXYA 1TWAC 2XCRB 1VLOA 1SFOA 3CQZA 1I3QC 2PPBA 4KC6A 3HOUK 1F93A 3HOYC 5FJ8K 3BP3A 4QIWL 5HL7S 3T00A 4MQ9A 3RZOC 4LR2A 3HOVC 1B4AA 2GAGC 5IOSA 4KN4A 3T01A 1EI6A 4OIPA 3I4NC 3S2DC 1ZXOA 2R93C 1IE0A 5M5XK 5IYBK 3FOFA 1K83C 3K7AK 1O26A 3ERED 4GTDA 1I50A 3PO3C 3GEHA 2O5JA 2ZFZA 1IL2A 3HOXC 1BJTA 5C4JC 2GAHC 1I3QK 4WF9S 1YNJA 3HOYK 1B4BA 2R92C 3GTMC 2R7ZA 1YX2A 3Q3QA 2YU9A 3HOVK 4LQYA 3GTQA 5IP7K 2KWAA 2E2IC 5JVOA 3I4NK 4OIOA 2W7VA 4A3MC 1SFOC 4C2MC 1L0WA 3GEEA 3PO2C 4A3GK 1USOA 4NOIA 3PO3K 4G0VA 4P9SA 1WOSA 1V5VA 4IOCS 5IYDC 3GTKC 1TWCA 3N0CA 5C4JK 2R92K 4KDDA 1YNNA 3S1NC 4X6AC 4KB4A 3GTMK 1JVIA 1IBAA 2PHCB 3S0XA 4A3FC 4BXXK 1INNA 1Y1VK 1Y1WC 2E2IK 4A3MK 1TWAA 4BLAA 1SFOK 4C2MK 3CQZK 3PO2K 4WFAS 4KAWX 5HQHA 4OIRA 3TFIA 2R7ZC 5IYDK 3OEPA 2NVQC 4Y52C 1PJ6A 5IOTA 2GSNA 3S1NK 1XZQA 4YFXA 3EQLA 4GTFA 3GTGA 2R93A 2PMZL 1K83A 4BKWA 1DCPA 2Y0SL 3LAPA 4A3FK 2E2JC 1I50K 1C0AA 4RMFA 1ZYRA 4GTEA 1WCMA 4KMAA 3QX3A 3SZYA 3S1MC 3T02A 5JVGS 4G7ZA 3GTLA 3GTMA 1EK8A 2R7ZK 3AQOA 4G7OA 4G7HA 5IYCC 3RZDK 4Y52K 3GTQK 4U67S 1TWFA 1WIHA 5IORA 3TTGA 4KB2A 4BBRC 1O27A 1UV7A 1XXAA 5JVHS 2E2JK 4IOAS 3WODA 1KQ4A 3GTKA 1TWCK 1WOPA 1O24A 4WILA 1EQRA 4C3JK 1F7UA 4C3HC 1RU0A 3GTGC 4GTAA 1O25A 4A93K 2A6HA 2ZUFA 1Y1WA 4GTCA 2VUMC 1TWGA 3N0BA 1TWAK 1WCMC 1BGWA 4GTLA 3H0GA 4WJ4A 4XLPA 4P5AA 2XCQA 4A3BC 2NVYA 3GTLC 4ILDA 2PMZD 3RZOK 4GT9A 2NVTC 4YFKA 3AD7C 5HL8A 2Y0SD 3AH5A 2ZUEA 1TWFC 3G4AA 3S2DK 1VJEA 2Y3PA 2R93K 3S14C 4C3HK 3GTGK 1J6XA 1K83K 4BBSC 4Y7NC 3OREA 4KMDA 4PABA 4A3CC 4GZYA 1JQWA 1X31C 3HOXK 1WCMK 2JH3A 1PJ5A 1ZQ1C 1WORA 1J6WA 2ZJPS 5IP9C 2JA7C 4A3BK 3ADAC 4XSZA 2ZJQS 1IW7A 4KMUA 5DM7S 3S2HC 1XPPA 3GTLK 5CHPA 1EH1A 3BP8C 3GEIA 5C4XC 4LK0A 1R9TC 2NVTK 1J98A 1XZQB 1DCOA 1O2BA 1TWFK 1O29A 3S14K 1I6HC 4BLBA 1TWGC 3N3YA 3H0GC 3LYWA 3HOWC 3FKIA 2KQ1A 1IS1A 3L4KA 2NVYC 4QJVA 3FHZA 3GTKK 4C3IC 2JA7K 3GIRA 4X6AK 2WAQD 5M3MK 2NVXC 5TMFA 2E2HC 1XXBA 3GDZA 1FEUA 4PAAA 2BE5A 4LK1A 2JA8C 2B63A 4A3JC 1Y1WK 5EGHA 3A8IA 2VUMA 1I6HK 1TWGK 1DD5A 4A3KC 2A69A 1XZPA 3H0GK 4G0WA 1IQ0A 4BY7C 3GTJC 2NVYK 2JA5C 3IPJA 1O28A 3H3VL 4XCHA 1O2AA 2V6UA 1XXCA 4MEYA 4WFBS 4AYBL 4C3IK 3V4GA 2NVQK 3GTOA 5D4DA 1DCHA 1VH2A 3DXJA 3FOEA 2O5IA 5M5YK 2P5MA 2NVXK 4P5BA 1O2FB 2A6EA 4KN7A 2E2HK 2CFAA 5EGEA 3FKIC 2JA8K 2CW0A 4GFQA 3JSTA 4A3KK 3A8KA 1G51A 3S1MK 3I4MC 1PJ7A 3S17C 2JA7A 3MMLB 3AD8C 4M1XA 2JA5K 2D6FC 2PA8L 3DLLS 1HI9A 4DDQA 3SZZA 5M3FK 2XCOA 1R9TA 3GTPC 3G4CA 5TJ3A 5IYCK 4OIQA 4Q4ZA 1EFWA 2B63C 2WAQL 4GTBA 4KM8A 4KARA 4BBRK 4AH6A 4XSXA 5DM6S 3A8JA 2P8TA 1WSRA 4C45A 2KPUA 5TMCA 3FKIK
chains in the Genus database with same CATH topology
5IP7C 5IP9C 2JA7C 3M4OK 5IYBC 4A3BK 4XSZA 2NVQC 4YG2A 4Y52C 1IW7A 4KMUA 1I6VA 3S2HC 3K7AC 1TWHK 1XPPA 2YU9K 3GTLK 3S1RC 4A93C 3GTJK 3S16C 3S1NK 4A3DK 3I4MK 4BY7K 3S17K 5C4XC 4LK0A 4YFXA 3EQLA 1R9TC 3GTOC 2NVTK 4A3GC 2PMZL 5FLMK 5C44K 5M5WK 1TWAC 2Y0SL 1TWFK 4A3FK 2E2JC 1I50K 3GTPK 1I3QC 3S14K 2PPBA 1I6HC 1TWGC 3HOUK 1ZYRA 3HOYC 3H0GC 2B63K 5FJ8K 3HOWC 4QIWL 2WB1D 4LJZA 2VUMK 3S1MC 4MQ9A 3RZOC 4BY1C 2NVYC 4Q5SA 4A3IK 3H3VD 3HOVC 4QJVA 4KN4A 4G7ZA 4AYBD 4OIPA 4QJVB 3GTKK 3S1QC 3I4NC 2R7ZK 3HKZD 4BXXC 3S2DC 4C3IC 4G7HA 4G7OA 5IYCC 1Y1VC 2R93C 5IYBK 5M5XK 3RZDK 2JA7K 4OINA 2A68A 5C3EC 2WAQD 1K83C 3GTQK 3K7AK 4X6AK 4Y52K 3S1RK 5M3MK 3S16K 2NVXC 1SMYA 3GTOK 5TMFA 3CQZC 3PO3C 4YFNA 2E2HC 4BBRC 3M3YC 2O5JA 2BE5A 4LK1A 2JA8C 4A3JC 3HOXC 1Y1WK 5C4JC 2E2JK 1I3QK 3HOZC 1I6HK 1TWGK 4BBSK 1YNJA 4A3KC 3HOYK 2A69A 2R92C 4Y7NK 3WODA 3H0GK 3GTMC 2R93K 4BY7C 4A3CK 2PA8D 3GTJC 1TWCK 4BY1K 2NVYK 2JA5C 4C3JK 3HOVK 4MEXA 4A3EC 3H3VL 5IP7K 5IP9K 3S1QK 2E2IC 2JA6C 4C3HC 4OIOA 4MEYA 3GTGC 4AYBL 4C3IK 2NVQK 1I50C 3I4NK 4A3MC 5D4DA 3S2HK 4A93K 2A6HA 3DXJA 4QIWD 4A3LC 5C3EK 1SFOC 4JK1A 5C4XK 1R9TK 4C2MC 2O5IA 3S15C 3PO2C 5M5YK 2NVXK 4A3GK 4NOIA 2A6EA 4KN7A 2VUMC 4LLGA 2E2HK 1TWAK 3PO3K 1WCMC 3M3YK 3FKIC 2JA8K 4XLPA 2CW0A 4A3IC 5IYDC 3GTKC 5C4JK 4A3BC 3M4OC 3HOZK 1HQMA 4A3DC 3GTLC 3RZDC 2YU9C 1TWHC 4A3KK 2R92K 3HOWK 1YNNA 3S1MK 3S1NC 4X6AC 3GTQC 2PMZD 3I4MC 3S17C 2WB1L 3GTMK 3RZOK 2NVTC 4YFKA 2Y0SD 5FLMC 2JA5K 5C44C 2PA8L 5M3FK 1TWFC 4A3EK 4BXXK 4A3FC 3S2DK 3GTPC 5IYCK 1Y1VK 1Y1WC 3S14C 4C3HK 2E2IK 3HKZL 4OIQA 4Q4ZA 3HOUC 2JA6K 3GTGK 1K83K 4A3MK 4BBSC 2B63C 4A3LK 2WAQL 1SFOK 4Y7NC 4C2MK 3CQZK 3S15K 4BBRK 3PO2K 4XSXA 4A3CC 1TWCC 4OIRA 4GZYA 3HOXK 4A3JK 4C3JC 1WCMK 4XLNA 5TMCA 3FKIK 4ZH4A 1BDFA 2R7ZC 5IYDK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IP7 C;  5IP9 C;  2JA7 C;  3M4O K;  5IYB C;  4A3B K;  4XSZ A;  2NVQ C;  4YG2 A;  4Y52 C;  1IW7 A;  4KMU A;  1I6V A;  3S2H C;  3K7A C;  1TWH K;  1XPP A;  2YU9 K;  3GTL K;  3S1R C;  4A93 C;  3GTJ K;  3S16 C;  3S1N K;  4A3D K;  3I4M K;  4BY7 K;  3S17 K;  5C4X C;  4LK0 A;  4YFX A;  3EQL A;  1R9T C;  3GTO C;  2NVT K;  4A3G C;  2PMZ L;  5FLM K;  5C44 K;  5M5W K;  1TWA C;  2Y0S L;  1TWF K;  4A3F K;  2E2J C;  1I50 K;  3GTP K;  1I3Q C;  3S14 K;  2PPB A;  1I6H C;  1TWG C;  3HOU K;  1ZYR A;  3HOY C;  3H0G C;  2B63 K;  5FJ8 K;  3HOW C;  4QIW L;  2WB1 D;  4LJZ A;  2VUM K;  3S1M C;  4MQ9 A;  3RZO C;  4BY1 C;  2NVY C;  4Q5S A;  4A3I K;  3H3V D;  3HOV C;  4QJV A;  4KN4 A;  4G7Z A;  4AYB D;  4OIP A;  4QJV B;  3GTK K;  3S1Q C;  3I4N C;  2R7Z K;  3HKZ D;  4BXX C;  3S2D C;  4C3I C;  4G7H A;  4G7O A;  5IYC C;  1Y1V C;  2R93 C;  5IYB K;  5M5X K;  3RZD K;  2JA7 K;  4OIN A;  2A68 A;  5C3E C;  2WAQ D;  1K83 C;  3GTQ K;  3K7A K;  4X6A K;  4Y52 K;  3S1R K;  5M3M K;  3S16 K;  2NVX C;  1SMY A;  3GTO K;  5TMF A;  3CQZ C;  3PO3 C;  4YFN A;  2E2H C;  4BBR C;  3M3Y C;  2O5J A;  2BE5 A;  4LK1 A;  2JA8 C;  4A3J C;  3HOX C;  1Y1W K;  5C4J C;  2E2J K;  1I3Q K;  3HOZ C;  1I6H K;  1TWG K;  4BBS K;  1YNJ A;  4A3K C;  3HOY K;  2A69 A;  2R92 C;  4Y7N K;  3WOD A;  3H0G K;  3GTM C;  2R93 K;  4BY7 C;  4A3C K;  2PA8 D;  3GTJ C;  1TWC K;  4BY1 K;  2NVY K;  2JA5 C;  4C3J K;  3HOV K;  4MEX A;  4A3E C;  3H3V L;  5IP7 K;  5IP9 K;  3S1Q K;  2E2I C;  2JA6 C;  4C3H C;  4OIO A;  4MEY A;  3GTG C;  4AYB L;  4C3I K;  2NVQ K;  1I50 C;  3I4N K;  4A3M C;  5D4D A;  3S2H K;  4A93 K;  2A6H A;  3DXJ A;  4QIW D;  4A3L C;  5C3E K;  1SFO C;  4JK1 A;  5C4X K;  1R9T K;  4C2M C;  2O5I A;  3S15 C;  3PO2 C;  5M5Y K;  2NVX K;  4A3G K;  4NOI A;  2A6E A;  4KN7 A;  2VUM C;  4LLG A;  2E2H K;  1TWA K;  3PO3 K;  1WCM C;  3M3Y K;  3FKI C;  2JA8 K;  4XLP A;  2CW0 A;  4A3I C;  5IYD C;  3GTK C;  5C4J K;  4A3B C;  3M4O C;  3HOZ K;  1HQM A;  4A3D C;  3GTL C;  3RZD C;  2YU9 C;  1TWH C;  4A3K K;  2R92 K;  3HOW K;  1YNN A;  3S1M K;  3S1N C;  4X6A C;  3GTQ C;  2PMZ D;  3I4M C;  3S17 C;  2WB1 L;  3GTM K;  3RZO K;  2NVT C;  4YFK A;  2Y0S D;  5FLM C;  2JA5 K;  5C44 C;  2PA8 L;  5M3F K;  1TWF C;  4A3E K;  4BXX K;  4A3F C;  3S2D K;  3GTP C;  5IYC K;  1Y1V K;  1Y1W C;  3S14 C;  4C3H K;  2E2I K;  3HKZ L;  4OIQ A;  4Q4Z A;  3HOU C;  2JA6 K;  3GTG K;  1K83 K;  4A3M K;  4BBS C;  2B63 C;  4A3L K;  2WAQ L;  1SFO K;  4Y7N C;  4C2M K;  3CQZ K;  3S15 K;  4BBR K;  3PO2 K;  4XSX A;  4A3C C;  1TWC C;  4OIR A;  4GZY A;  3HOX K;  4A3J K;  4C3J C;  1WCM K;  4XLN A;  5TMC A;  3FKI K;  4ZH4 A;  1BDF A;  2R7Z C;  5IYD K; 
#chains in the Genus database with same CATH topology
 5IP7 C;  4KMH A;  3CF5 S;  4YG2 A;  1ISE A;  3S1R C;  3S16 C;  3I4M K;  3S17 K;  2ZJR S;  3GTO C;  3TFH A;  2JA6 A;  1VGX A;  2GSU A;  4A3G C;  3AQP A;  2NVX A;  3BUE A;  3GTP K;  2E2H A;  1USM A;  2B63 K;  3TFJ A;  2WB1 D;  4LJZ A;  4WJ3 M;  2VUM K;  2L5N A;  4G0U A;  4Q5S A;  4BY1 C;  3H3V D;  3GSI A;  2V6S A;  1TWH A;  4AYB D;  4QJV B;  3GTJ A;  3S1Q C;  2FQT A;  3HKZ D;  4BXX C;  2JA5 A;  2GSO A;  1JOE A;  1Y1V C;  4FZB A;  4OIN A;  2A68 A;  5C3E C;  3S1R K;  1WQF A;  3S16 K;  1WOO A;  3LPX A;  1SMY A;  4WCE S;  1YCL A;  3GTO K;  3CQZ C;  3PIO S;  4YFN A;  2EBB A;  1WQG A;  3M3Y C;  1AB4 A;  4KAT A;  5JFE A;  3HOZ C;  5L46 A;  4BBS K;  1F9N A;  4Y7N K;  4A3C K;  1XZP B;  2PA8 D;  3L4J A;  1WSV A;  4BY1 K;  4MEX A;  1VRQ C;  2L3U A;  4KAS A;  4A3E C;  5IP9 K;  3S1Q K;  2JA6 C;  3CAG A;  1F7V A;  1I50 C;  3OPF A;  3S2H K;  3NUH A;  2RGR A;  4A3L C;  2RH6 A;  4QIW D;  5C3E K;  3GTP A;  4JK1 A;  5C4X K;  1R9T K;  3S15 C;  1I3Q A;  4LLG A;  3M3Y K;  3AD9 C;  2CFA B;  4A3I C;  4LOW A;  3M4O C;  3HOZ K;  1HQM A;  4A3D C;  3HOW K;  3PIP S;  3RZD C;  1TWH C;  2YU9 C;  4WFN S;  4J3N A;  3GTQ C;  2WB1 L;  1GE9 A;  5FLM C;  5C44 C;  1BS2 A;  4KM9 A;  5IOQ A;  4A3E K;  5CJ9 A;  3LAJ A;  2JA6 K;  3HKZ L;  3HOU C;  4IO9 S;  5E68 A;  4A3L K;  4FM9 A;  1ZBS A;  3S15 K;  1TWC C;  1WQH A;  4A3J K;  4C3J C;  4XLN A;  2R92 A;  4ZH4 A;  1BDF A;  3HXA A;  4A3I K;  3M4O K;  5IYB C;  2FQO A;  1ZVU A;  4A3D K;  1I6V A;  2YU9 K;  3K7A C;  1TWH K;  3VA7 A;  4BY7 K;  4A93 C;  3GTJ K;  2V6T A;  4O2D A;  1Y1V A;  2E2I A;  5FLM K;  5C44 K;  5M5W K;  1J6V A;  2KXY A;  1TWA C;  2XCR B;  1VLO A;  1SFO A;  3CQZ A;  1I3Q C;  2PPB A;  4KC6 A;  3HOU K;  1F93 A;  3HOY C;  5FJ8 K;  3BP3 A;  4QIW L;  5HL7 S;  3T00 A;  4MQ9 A;  3RZO C;  4LR2 A;  3HOV C;  1B4A A;  2GAG C;  5IOS A;  4KN4 A;  3T01 A;  1EI6 A;  4OIP A;  3I4N C;  3S2D C;  1ZXO A;  2R93 C;  1IE0 A;  5M5X K;  5IYB K;  3FOF A;  1K83 C;  3K7A K;  1O26 A;  3ERE D;  4GTD A;  1I50 A;  3PO3 C;  3GEH A;  2O5J A;  2ZFZ A;  1IL2 A;  3HOX C;  1BJT A;  5C4J C;  2GAH C;  1I3Q K;  4WF9 S;  1YNJ A;  3HOY K;  1B4B A;  2R92 C;  3GTM C;  2R7Z A;  1YX2 A;  3Q3Q A;  2YU9 A;  3HOV K;  4LQY A;  3GTQ A;  5IP7 K;  2KWA A;  2E2I C;  5JVO A;  3I4N K;  4OIO A;  2W7V A;  4A3M C;  1SFO C;  4C2M C;  1L0W A;  3GEE A;  3PO2 C;  4A3G K;  1USO A;  4NOI A;  3PO3 K;  4G0V A;  4P9S A;  1WOS A;  1V5V A;  4IOC S;  5IYD C;  3GTK C;  1TWC A;  3N0C A;  5C4J K;  2R92 K;  4KDD A;  1YNN A;  3S1N C;  4X6A C;  4KB4 A;  3GTM K;  1JVI A;  1IBA A;  2PHC B;  3S0X A;  4A3F C;  4BXX K;  1INN A;  1Y1V K;  1Y1W C;  2E2I K;  4A3M K;  1TWA A;  4BLA A;  1SFO K;  4C2M K;  3CQZ K;  3PO2 K;  4WFA S;  4KAW X;  5HQH A;  4OIR A;  3TFI A;  2R7Z C;  5IYD K;  3OEP A;  2NVQ C;  4Y52 C;  1PJ6 A;  5IOT A;  2GSN A;  3S1N K;  1XZQ A;  4YFX A;  3EQL A;  4GTF A;  3GTG A;  2R93 A;  2PMZ L;  1K83 A;  4BKW A;  1DCP A;  2Y0S L;  3LAP A;  4A3F K;  2E2J C;  1I50 K;  1C0A A;  4RMF A;  1ZYR A;  4GTE A;  1WCM A;  4KMA A;  3QX3 A;  3SZY A;  3S1M C;  3T02 A;  5JVG S;  4G7Z A;  3GTL A;  3GTM A;  1EK8 A;  2R7Z K;  3AQO A;  4G7O A;  4G7H A;  5IYC C;  3RZD K;  4Y52 K;  3GTQ K;  4U67 S;  1TWF A;  1WIH A;  5IOR A;  3TTG A;  4KB2 A;  4BBR C;  1O27 A;  1UV7 A;  1XXA A;  5JVH S;  2E2J K;  4IOA S;  3WOD A;  1KQ4 A;  3GTK A;  1TWC K;  1WOP A;  1O24 A;  4WIL A;  1EQR A;  4C3J K;  1F7U A;  4C3H C;  1RU0 A;  3GTG C;  4GTA A;  1O25 A;  4A93 K;  2A6H A;  2ZUF A;  1Y1W A;  4GTC A;  2VUM C;  1TWG A;  3N0B A;  1TWA K;  1WCM C;  1BGW A;  4GTL A;  3H0G A;  4WJ4 A;  4XLP A;  4P5A A;  2XCQ A;  4A3B C;  2NVY A;  3GTL C;  4ILD A;  2PMZ D;  3RZO K;  4GT9 A;  2NVT C;  4YFK A;  3AD7 C;  5HL8 A;  2Y0S D;  3AH5 A;  2ZUE A;  1TWF C;  3G4A A;  3S2D K;  1VJE A;  2Y3P A;  2R93 K;  3S14 C;  4C3H K;  3GTG K;  1J6X A;  1K83 K;  4BBS C;  4Y7N C;  3ORE A;  4KMD A;  4PAB A;  4A3C C;  4GZY A;  1JQW A;  1X31 C;  3HOX K;  1WCM K;  2JH3 A;  1PJ5 A;  1ZQ1 C;  1WOR A;  1J6W A;  2ZJP S;  5IP9 C;  2JA7 C;  4A3B K;  3ADA C;  4XSZ A;  2ZJQ S;  1IW7 A;  4KMU A;  5DM7 S;  3S2H C;  1XPP A;  3GTL K;  5CHP A;  1EH1 A;  3BP8 C;  3GEI A;  5C4X C;  4LK0 A;  1R9T C;  2NVT K;  1J98 A;  1XZQ B;  1DCO A;  1O2B A;  1TWF K;  1O29 A;  3S14 K;  1I6H C;  4BLB A;  1TWG C;  3N3Y A;  3H0G C;  3LYW A;  3HOW C;  3FKI A;  2KQ1 A;  1IS1 A;  3L4K A;  2NVY C;  4QJV A;  3FHZ A;  3GTK K;  4C3I C;  2JA7 K;  3GIR A;  4X6A K;  2WAQ D;  5M3M K;  2NVX C;  5TMF A;  2E2H C;  1XXB A;  3GDZ A;  1FEU A;  4PAA A;  2BE5 A;  4LK1 A;  2JA8 C;  2B63 A;  4A3J C;  1Y1W K;  5EGH A;  3A8I A;  2VUM A;  1I6H K;  1TWG K;  1DD5 A;  4A3K C;  2A69 A;  1XZP A;  3H0G K;  4G0W A;  1IQ0 A;  4BY7 C;  3GTJ C;  2NVY K;  2JA5 C;  3IPJ A;  1O28 A;  3H3V L;  4XCH A;  1O2A A;  2V6U A;  1XXC A;  4MEY A;  4WFB S;  4AYB L;  4C3I K;  3V4G A;  2NVQ K;  3GTO A;  5D4D A;  1DCH A;  1VH2 A;  3DXJ A;  3FOE A;  2O5I A;  5M5Y K;  2P5M A;  2NVX K;  4P5B A;  1O2F B;  2A6E A;  4KN7 A;  2E2H K;  2CFA A;  5EGE A;  3FKI C;  2JA8 K;  2CW0 A;  4GFQ A;  3JST A;  4A3K K;  3A8K A;  1G51 A;  3S1M K;  3I4M C;  1PJ7 A;  3S17 C;  2JA7 A;  3MML B;  3AD8 C;  4M1X A;  2JA5 K;  2D6F C;  2PA8 L;  3DLL S;  1HI9 A;  4DDQ A;  3SZZ A;  5M3F K;  2XCO A;  1R9T A;  3GTP C;  3G4C A;  5TJ3 A;  5IYC K;  4OIQ A;  4Q4Z A;  1EFW A;  2B63 C;  2WAQ L;  4GTB A;  4KM8 A;  4KAR A;  4BBR K;  4AH6 A;  4XSX A;  5DM6 S;  3A8J A;  2P8T A;  1WSR A;  4C45 A;  2KPU A;  5TMC A;  3FKI K; 
#chains in the Genus database with same CATH homology
 5IP7 C;  5IP9 C;  2JA7 C;  3M4O K;  5IYB C;  4A3B K;  4XSZ A;  2NVQ C;  4YG2 A;  4Y52 C;  1IW7 A;  4KMU A;  1I6V A;  3S2H C;  3K7A C;  1TWH K;  1XPP A;  2YU9 K;  3GTL K;  3S1R C;  4A93 C;  3GTJ K;  3S16 C;  3S1N K;  4A3D K;  3I4M K;  4BY7 K;  3S17 K;  5C4X C;  4LK0 A;  4YFX A;  3EQL A;  1R9T C;  3GTO C;  2NVT K;  4A3G C;  2PMZ L;  5FLM K;  5C44 K;  5M5W K;  1TWA C;  2Y0S L;  1TWF K;  4A3F K;  2E2J C;  1I50 K;  3GTP K;  1I3Q C;  3S14 K;  2PPB A;  1I6H C;  1TWG C;  3HOU K;  1ZYR A;  3HOY C;  3H0G C;  2B63 K;  5FJ8 K;  3HOW C;  4QIW L;  2WB1 D;  4LJZ A;  2VUM K;  3S1M C;  4MQ9 A;  3RZO C;  4BY1 C;  2NVY C;  4Q5S A;  4A3I K;  3H3V D;  3HOV C;  4QJV A;  4KN4 A;  4G7Z A;  4AYB D;  4OIP A;  4QJV B;  3GTK K;  3S1Q C;  3I4N C;  2R7Z K;  3HKZ D;  4BXX C;  3S2D C;  4C3I C;  4G7H A;  4G7O A;  5IYC C;  1Y1V C;  2R93 C;  5IYB K;  5M5X K;  3RZD K;  2JA7 K;  4OIN A;  2A68 A;  5C3E C;  2WAQ D;  1K83 C;  3GTQ K;  3K7A K;  4X6A K;  4Y52 K;  3S1R K;  5M3M K;  3S16 K;  2NVX C;  1SMY A;  3GTO K;  5TMF A;  3CQZ C;  3PO3 C;  4YFN A;  2E2H C;  4BBR C;  3M3Y C;  2O5J A;  2BE5 A;  4LK1 A;  2JA8 C;  4A3J C;  3HOX C;  1Y1W K;  5C4J C;  2E2J K;  1I3Q K;  3HOZ C;  1I6H K;  1TWG K;  4BBS K;  1YNJ A;  4A3K C;  3HOY K;  2A69 A;  2R92 C;  4Y7N K;  3WOD A;  3H0G K;  3GTM C;  2R93 K;  4BY7 C;  4A3C K;  2PA8 D;  3GTJ C;  1TWC K;  4BY1 K;  2NVY K;  2JA5 C;  4C3J K;  3HOV K;  4MEX A;  4A3E C;  3H3V L;  5IP7 K;  5IP9 K;  3S1Q K;  2E2I C;  2JA6 C;  4C3H C;  4OIO A;  4MEY A;  3GTG C;  4AYB L;  4C3I K;  2NVQ K;  1I50 C;  3I4N K;  4A3M C;  5D4D A;  3S2H K;  4A93 K;  2A6H A;  3DXJ A;  4QIW D;  4A3L C;  5C3E K;  1SFO C;  4JK1 A;  5C4X K;  1R9T K;  4C2M C;  2O5I A;  3S15 C;  3PO2 C;  5M5Y K;  2NVX K;  4A3G K;  4NOI A;  2A6E A;  4KN7 A;  2VUM C;  4LLG A;  2E2H K;  1TWA K;  3PO3 K;  1WCM C;  3M3Y K;  3FKI C;  2JA8 K;  4XLP A;  2CW0 A;  4A3I C;  5IYD C;  3GTK C;  5C4J K;  4A3B C;  3M4O C;  3HOZ K;  1HQM A;  4A3D C;  3GTL C;  3RZD C;  2YU9 C;  1TWH C;  4A3K K;  2R92 K;  3HOW K;  1YNN A;  3S1M K;  3S1N C;  4X6A C;  3GTQ C;  2PMZ D;  3I4M C;  3S17 C;  2WB1 L;  3GTM K;  3RZO K;  2NVT C;  4YFK A;  2Y0S D;  5FLM C;  2JA5 K;  5C44 C;  2PA8 L;  5M3F K;  1TWF C;  4A3E K;  4BXX K;  4A3F C;  3S2D K;  3GTP C;  5IYC K;  1Y1V K;  1Y1W C;  3S14 C;  4C3H K;  2E2I K;  3HKZ L;  4OIQ A;  4Q4Z A;  3HOU C;  2JA6 K;  3GTG K;  1K83 K;  4A3M K;  4BBS C;  2B63 C;  4A3L K;  2WAQ L;  1SFO K;  4Y7N C;  4C2M K;  3CQZ K;  3S15 K;  4BBR K;  3PO2 K;  4XSX A;  4A3C C;  1TWC C;  4OIR A;  4GZY A;  3HOX K;  4A3J K;  4C3J C;  1WCM K;  4XLN A;  5TMC A;  3FKI K;  4ZH4 A;  1BDF A;  2R7Z C;  5IYD K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...