4XLNA

Crystal structure of t. aquaticus transcription initiation complex containing bubble promoter and rna
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
227
structure length
227
Chain Sequence
KAPVFTATTQGDHYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLDPKMASTTLILRAEGPKEVRAGDFTPSADVEIMNPDLHIATLEEGGKLYMEVRVDRGVGYVPAERHGIKDRINAIPVDAIFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVAILKEHLNYFANPEASLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna/rna
molecule keywords DNA-directed RNA polymerase subunit alpha
publication title Structure of a bacterial RNA polymerase holoenzyme open promoter complex.
pubmed doi rcsb
source organism Thermus aquaticus
total genus 41
structure length 227
sequence length 227
chains with identical sequence B, G, H
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2015-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01000 RNA_pol_A_bac RNA polymerase Rpb3/RpoA insert domain
A PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain
A PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.12 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 DNA-directed RNA polymerase, insert domain 4xlnA02
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 4xlnA01
2YU9C 2JA7C 2YU9K 1BDFA 3H3VD 4C3HC 1Y1WK 2B63K 3S1QC 4BBSC 2O5IA 4BBSK 5M3FK 4OIPA 4A3DC 3H0GC 5M5YK 3H0GK 4A3DK 4OIRA 1SMYA 4KN4A 4LLGA 4G7ZA 4A3IC 4BY1C 3M4OC 2NVYK 4YG2A 4A3IK 4A3JK 4BY1K 3M4OK 4G7HA 3CQZC 4MQ9A 3CQZK 4MEXA 5C4JK 1IW7A 2O5JA 2PA8L 5C4XC 4QIWL 5IP9C 5C4XK 5IP9K 3S15C 3S15K 3GTOC 3GTOK 1Y1VC 3GTKC 1Y1VK 3GTKK 3GTGC 4NOIA 5IYBC 4XSZA 2E2HC 5IYBK 2E2HK 4A3CC 3GTGK 4A3CK 2JA6C 2JA6K 4A3EC 4A3EK 2WAQD 4AYBD 2A68A 1TWHC 2R93C 1TWHK 5M3MK 4A3LC 3RZDC 2JA7K 3RZDK 4A3LK 2R93K 1I50C 3FKIC 1HQMA 3FKIK 3HOUC 4C3HK 3HOUK 4A3GC 3S1QK 4A3GK 2E2JC 2E2IC 2E2JK 5FLMC 4C2MC 3GTJC 5TMFA 2JA5C 3S17C 2JA8C 1XPPA 4C2MK 2BE5A 2WB1D 3GTJK 2JA5K 2JA8K 3S17K 4A3BC 2R7ZC 3HOWC 3HOWK 4BXXC 4A3BK 4BXXK 5C44C 2PMZL 3DXJA 3HOZC 3HOZK 1SFOC 3GTMC 1SFOK 3EQLA 5IP7C 3GTMK 5IP7K 2PA8D 3HOXC 3HOXK 4Q5SA 3I4MC 3PO2C 3I4MK 1K83C 3PO2K 1K83K 4Q4ZA 3HKZL 3M3YK 4YFNA 3K7AC 5IYDC 3HOYC 4XSXA 3K7AK 5TMCA 3HOYK 5IYDK 4OIOA 2VUMC 1YNJA 4YFKA 4BY7C 4JK1A 4OIQA 4G7OA 5M5WK 2VUMK 4BY7K 4GZYA 4C3JC 1I6VA 5C4JC 4A3JC 3M3YC 2A6HA 3GTLC 1TWCC 2R92C 3S1MC 4X6AC 1TWCK 1I50K 2Y0SL 2R92K 3GTLK 3S1MK 4X6AK 4BBRC 4BBRK 2E2IK 2NVXC 5FLMK 2NVXK 3GTPC 3GTPK 3GTQC 1I3QC 3GTQK 1I3QK 1R9TC 4C3IC 3S2DC 4C3IK 1R9TK 2R7ZK 3S2DK 4A3KK 3S1NC 5C44K 3S1NK 2PMZD 1I6HC 2NVTC 4QJVB 4Y7NC 4A93C 4Y7NK 3RZOC 4A93K 3RZOK 4XLNA 4A3FC 4A3FK 4QIWD 5M5XK 2A6EA 4LK1A 3S2HC 3S2HK 1ZYRA 2WAQL 4AYBL 4QJVA 3H3VL 4KN7A 1Y1WC 2B63C 1YNNA 5D4DA 4MEYA 4LK0A 3HOVC 4A3MC 4Y52C 3S14C 4C3JK 4A3MK 4KMUA 3HOVK 3S14K 4Y52K 5IYCC 2WB1L 2NVYC 2Y0SD 5IYCK 1WCMC 1WCMK 4OINA 5FJ8K 1TWGC 5C3EC 1TWGK 5C3EK 4XLPA 2PPBA 3I4NC 3I4NK 3PO3C 4LJZA 3PO3K 1TWFC 2NVQC 3S16C 1TWFK 4ZH4A 2CW0A 2NVQK 3S1RC 3S16K 4YFXA 3S1RK 3WODA 2NVTK 1I6HK 1TWAC 1TWAK 2A69A 4A3KC 3HKZD
chains in the Genus database with same CATH superfamily
1BDFA 3H3VD 3FKIA 1I50A 1Y1WK 4GFQA 5M3FK 2E2IA 4KARA 1J98A 3H0GC 2V6UA 1WQFA 1G51A 3H0GK 4KC6A 4BY1C 2KXYA 3M4OC 2RH6A 3OEPA 2ZUFA 4BY1K 3M4OK 2JH3A 3FOEA 4NOIA 4XSZA 1L0WA 3BP8C 2P8TA 1VJEA 1O26A 2D6FC 2A68A 2JA7K 4G0VA 2V6TA 1WQGA 3CAGA 1HQMA 5HL7S 1F7VA 2ZFZA 4U67S 3GTJC 2JA5C 3GTJK 2JA5K 3HOWC 1VRQC 3HOWK 5E68A 1EH1A 4P5BA 1VH2A 3DXJA 3GTMC 3GTMK 1C0AA 4Q5SA 1USMA 4Q4ZA 2GSNA 1WOOA 2GSOA 5IYDC 3HOYC 3N0BA 3HOYK 5IYDK 1USOA 4G7OA 2VUMC 1Y1WA 2VUMK 1J6XA 3VA7A 3FOFA 2GAGC 4A3JC 3M3YC 2A6HA 4A3JK 3M3YK 2Y0SL 3FHZA 5DM6S 1B4AA 2NVXC 5FLMK 2NVXK 2GSUA 3GTQC 4GTFA 3GTQK 1R9TC 1R9TK 2R7ZK 3GEEA 3S1NC 5C44K 3S1NK 2PMZD 2XCRB 2Y3PA 4KMDA 4A3FC 4A3FK 1KQ4A 3TFJA 1TWAA 4LK1A 3S2HC 3S2HK 2JA7A 1YCLA 4RMFA 4KAWX 4C3JK 2NVYA 5HL8A 1WCMC 1WCMK 3CQZA 1TWGC 1TWGK 3LPXA 2CFAA 4XLPA 2ZUEA 3I4NC 3I4NK 4LJZA 1TWFC 2NVQC 1TWFK 3G4AA 4ZH4A 3TTGA 2NVQK 3LYWA 2A69A 4WF9S 4A3KC 4A3KK 3AH5A 3MMLB 1V5VA 3BUEA 3S0XA 2B63K 1RU0A 3BP3A 4KMHA 5HQHA 4G7ZA 4KN4A 2CFAB 1J6VA 4YG2A 2R7ZA 3ERED 4MQ9A 1SFOA 5L46A 1IW7A 2PA8L 3G4CA 5IP9C 1XXBA 5IP9K 1O2BA 1WOSA 3GTKC 1UV7A 3GTKK 3GTGC 3GTGK 2E2HC 2E2HK 4A3CC 4A3CK 4BLAA 4KATA 4A3EC 4A3EK 1WOPA 1TWHC 2R93C 1TWHK 3CF5S 5M3MK 3RZDC 1TWCA 3RZDK 2R93K 2R92A 4WFBS 2ZJQS 4O2DA 1DCOA 5TMFA 2JA8C 2JA8K 2BE5A 3GIRA 4WILA 4A3BC 4LR2A 4A3BK 1F93A 3SZYA 4WCES 3I4MC 3PO2C 1K83C 3I4MK 1K83K 1F7UA 3PO2K 4YFNA 2B63A 4YFKA 5M5WK 4OIQA 1XZQB 5C4JC 1GE9A 5C4JK 3GTLC 3GTLK 4LQYA 5JVGS 3PIPS 4BBRC 4BBRK 3DLLS 3GSIA 4DDQA 3GTPC 3GTPK 1I3QC 1I3QK 3S2DC 1IL2A 3S2DK 1I6HC 2NVTC 5JVHS 4GT9A 3H3VL 4PAAA 1XXCA 3A8KA 3OPFA 5D4DA 4MEYA 4LK0A 3HOVC 1DCHA 1VGXA 3H0GA 4GTBA 3HOVK 5IYCC 2NVYC 5IYCK 3GEIA 2FQOA 4G0UA 1O29A 5C3EC 5C3EK 2V6SA 2ZJRS 2PPBA 1IE0A 3PO3C 4IOAS 3PO3K 2XCOA 4G0WA 1JQWA 1EFWA 5CJ9A 2YU9C 2YU9K 4WJ3M 5JVOA 4C3HC 3S1QC 4BBSC 4BBSK 1O2FB 4OIPA 4A3DC 4A3DK 3GTJA 2JA5A 1EI6A 4OIRA 3N0CA 4LLGA 1AB4A 4P9SA 4G7HA 3NUHA 1EK8A 1ZXOA 3GTMA 2O5JA 2P5MA 3S15C 1PJ5A 3S15K 3GTOC 3GTOK 1Y1VC 1Y1VK 1INNA 5IYBC 4KDDA 5IYBK 2VUMA 2JA6C 2JA6K 3L4KA 5IORA 5IOSA 4AYBD 4XCHA 3LAPA 2EBBA 4A3LC 1WORA 4A3LK 1I50C 3FKIC 3FKIK 3HOUC 3HOUK 4A3GC 4A3GK 2E2JC 2E2IC 4AH6A 2E2JK 1O24A 1BGWA 3TFIA 4C2MC 2NVXA 4C2MK 1XPPA 3S17C 3S17K 1IBAA 2WB1D 1JVIA 3GTQA 1R9TA 2XCQA 3L4JA 4BXXC 4BXXK 1WIHA 2PHCB 2PMZL 3HOZC 3Q3QA 3HOZK 3HOXC 3ADAC 3HOXK 5EGEA 4KM8A 1J6WA 3N3YA 1YX2A 4XSXA 4FZBA 4OIOA 4WFNS 1BS2A 4GZYA 3A8JA 4KM9A 1JOEA 1I6VA 3S1MC 3S1MK 2ZJPS 1WCMA 1O25A 1XZQA 3V4GA 1TWGA 3GDZA 4C3IC 4C3IK 1TWFA 2GAHC 1IQ0A 3PIOS 4QJVB 4A93C 4A93K 4PABA 5EGHA 4QIWD 3AD7C 4IOCS 1ZYRA 4AYBL 4GTDA 4BKWA 3AQPA 4KN7A 1Y1WC 1O28A 3AD9C 4Y52C 4M1XA 4Y52K 2WB1L 2Y0SD 3SZZA 1WQHA 4WFAS 1ZQ1C 5FJ8K 3AQOA 4J3NA 1F9NA 1BJTA 3S1RC 3S1RK 1I6HK 3WODA 2NVTK 3GTKA 3GTGA 2E2HA 1TWAC 1WSRA 1TWAK 4GTEA 3HKZD 1TWHA 3TFHA 2JA7C 2R93A 5DM7S 1XXAA 2O5IA 3GEHA 5M5YK 4KASA 1SMYA 4A3IC 1XZPA 1ISEA 4A3IK 2NVYK 5JFEA 4P5AA 1DCPA 3CQZC 3CQZK 4MEXA 4BLBA 1ZVUA 5C4XC 4QIWL 5C4XK 1K83A 3A8IA 3HXAA 5CHPA 2RGRA 4KB4A 3T02A 1B4BA 2WAQD 3QX3A 3GTLA 1XZPB 4C3HK 3S1QK 5TJ3A 1O27A 5FLMC 3GTPA 1PJ7A 4IO9S 1I3QA 2KQ1A 2R7ZC 4GTCA 3IPJA 5C44C 1EQRA 2W7VA 1SFOC 4LOWA 1SFOK 3EQLA 5IP7C 5IP7K 2PA8D 5IOQA 1DD5A 2KPUA 1X31C 3HKZL 3LAJA 3K7AC 3K7AK 5TMCA 4BY7C 1YNJA 4BY7K 4JK1A 4C45A 1IS1A 4GTAA 4C3JC 4X6AC 1TWCC 2R92C 1TWCK 2KWAA 2R92K 1I50K 4X6AK 3AD8C 2E2IK 1HI9A 5IOTA 4Y7NC 4Y7NK 3RZOC 3RZOK 4XLNA 1ZBSA 4KB2A 2L3UA 5M5XK 2A6EA 4KMAA 2WAQL 1PJ6A 2YU9A 4QJVA 1VLOA 2B63C 1YNNA 4ILDA 3T00A 3S14C 4A3MC 3S14K 4A3MK 4KMUA 4GTLA 4OINA 3JSTA 1FEUA 1O2AA 4FM9A 3S16C 4WJ4A 3S16K 2CW0A 3GTOA 2FQTA 4YFXA 3T01A 1Y1VA 2L5NA 3OREA 2JA6A 1WSVA
chains in the Genus database with same CATH topology
2YU9C 2JA7C 2YU9K 1BDFA 3H3VD 4C3HC 1Y1WK 2B63K 3S1QC 4BBSC 2O5IA 4BBSK 5M3FK 4OIPA 4A3DC 3H0GC 5M5YK 3H0GK 4A3DK 4OIRA 1SMYA 4KN4A 4LLGA 4G7ZA 4A3IC 4BY1C 3M4OC 2NVYK 4YG2A 4A3IK 4A3JK 4BY1K 3M4OK 4G7HA 3CQZC 4MQ9A 3CQZK 4MEXA 5C4JK 1IW7A 2O5JA 2PA8L 5C4XC 4QIWL 5IP9C 5C4XK 5IP9K 3S15C 3S15K 3GTOC 3GTOK 1Y1VC 3GTKC 1Y1VK 3GTKK 3GTGC 4NOIA 5IYBC 4XSZA 2E2HC 5IYBK 2E2HK 4A3CC 3GTGK 4A3CK 2JA6C 2JA6K 4A3EC 4A3EK 2WAQD 4AYBD 2A68A 1TWHC 2R93C 1TWHK 5M3MK 4A3LC 3RZDC 2JA7K 3RZDK 4A3LK 2R93K 1I50C 3FKIC 1HQMA 3FKIK 3HOUC 4C3HK 3HOUK 4A3GC 3S1QK 4A3GK 2E2JC 2E2IC 2E2JK 5FLMC 4C2MC 3GTJC 5TMFA 2JA5C 3S17C 2JA8C 1XPPA 4C2MK 2BE5A 2WB1D 3GTJK 2JA5K 2JA8K 3S17K 4A3BC 2R7ZC 3HOWC 3HOWK 4BXXC 4A3BK 4BXXK 5C44C 2PMZL 3DXJA 3HOZC 3HOZK 1SFOC 3GTMC 1SFOK 3EQLA 5IP7C 3GTMK 5IP7K 2PA8D 3HOXC 3HOXK 4Q5SA 3I4MC 3PO2C 3I4MK 1K83C 3PO2K 1K83K 4Q4ZA 3HKZL 3M3YK 4YFNA 3K7AC 5IYDC 3HOYC 4XSXA 3K7AK 5TMCA 3HOYK 5IYDK 4OIOA 2VUMC 1YNJA 4YFKA 4BY7C 4JK1A 4OIQA 4G7OA 5M5WK 2VUMK 4BY7K 4GZYA 4C3JC 1I6VA 5C4JC 4A3JC 3M3YC 2A6HA 3GTLC 1TWCC 2R92C 3S1MC 4X6AC 1TWCK 1I50K 2Y0SL 2R92K 3GTLK 3S1MK 4X6AK 4BBRC 4BBRK 2E2IK 2NVXC 5FLMK 2NVXK 3GTPC 3GTPK 3GTQC 1I3QC 3GTQK 1I3QK 1R9TC 4C3IC 3S2DC 4C3IK 1R9TK 2R7ZK 3S2DK 4A3KK 3S1NC 5C44K 3S1NK 2PMZD 1I6HC 2NVTC 4QJVB 4Y7NC 4A93C 4Y7NK 3RZOC 4A93K 3RZOK 4XLNA 4A3FC 4A3FK 4QIWD 5M5XK 2A6EA 4LK1A 3S2HC 3S2HK 1ZYRA 2WAQL 4AYBL 4QJVA 3H3VL 4KN7A 1Y1WC 2B63C 1YNNA 5D4DA 4MEYA 4LK0A 3HOVC 4A3MC 4Y52C 3S14C 4C3JK 4A3MK 4KMUA 3HOVK 3S14K 4Y52K 5IYCC 2WB1L 2NVYC 2Y0SD 5IYCK 1WCMC 1WCMK 4OINA 5FJ8K 1TWGC 5C3EC 1TWGK 5C3EK 4XLPA 2PPBA 3I4NC 3I4NK 3PO3C 4LJZA 3PO3K 1TWFC 2NVQC 3S16C 1TWFK 4ZH4A 2CW0A 2NVQK 3S1RC 3S16K 4YFXA 3S1RK 3WODA 2NVTK 1I6HK 1TWAC 1TWAK 2A69A 4A3KC 3HKZD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YU9 C;  2JA7 C;  2YU9 K;  1BDF A;  3H3V D;  4C3H C;  1Y1W K;  2B63 K;  3S1Q C;  4BBS C;  2O5I A;  4BBS K;  5M3F K;  4OIP A;  4A3D C;  3H0G C;  5M5Y K;  3H0G K;  4A3D K;  4OIR A;  1SMY A;  4KN4 A;  4LLG A;  4G7Z A;  4A3I C;  4BY1 C;  3M4O C;  2NVY K;  4YG2 A;  4A3I K;  4A3J K;  4BY1 K;  3M4O K;  4G7H A;  3CQZ C;  4MQ9 A;  3CQZ K;  4MEX A;  5C4J K;  1IW7 A;  2O5J A;  2PA8 L;  5C4X C;  4QIW L;  5IP9 C;  5C4X K;  5IP9 K;  3S15 C;  3S15 K;  3GTO C;  3GTO K;  1Y1V C;  3GTK C;  1Y1V K;  3GTK K;  3GTG C;  4NOI A;  5IYB C;  4XSZ A;  2E2H C;  5IYB K;  2E2H K;  4A3C C;  3GTG K;  4A3C K;  2JA6 C;  2JA6 K;  4A3E C;  4A3E K;  2WAQ D;  4AYB D;  2A68 A;  1TWH C;  2R93 C;  1TWH K;  5M3M K;  4A3L C;  3RZD C;  2JA7 K;  3RZD K;  4A3L K;  2R93 K;  1I50 C;  3FKI C;  1HQM A;  3FKI K;  3HOU C;  4C3H K;  3HOU K;  4A3G C;  3S1Q K;  4A3G K;  2E2J C;  2E2I C;  2E2J K;  5FLM C;  4C2M C;  3GTJ C;  5TMF A;  2JA5 C;  3S17 C;  2JA8 C;  1XPP A;  4C2M K;  2BE5 A;  2WB1 D;  3GTJ K;  2JA5 K;  2JA8 K;  3S17 K;  4A3B C;  2R7Z C;  3HOW C;  3HOW K;  4BXX C;  4A3B K;  4BXX K;  5C44 C;  2PMZ L;  3DXJ A;  3HOZ C;  3HOZ K;  1SFO C;  3GTM C;  1SFO K;  3EQL A;  5IP7 C;  3GTM K;  5IP7 K;  2PA8 D;  3HOX C;  3HOX K;  4Q5S A;  3I4M C;  3PO2 C;  3I4M K;  1K83 C;  3PO2 K;  1K83 K;  4Q4Z A;  3HKZ L;  3M3Y K;  4YFN A;  3K7A C;  5IYD C;  3HOY C;  4XSX A;  3K7A K;  5TMC A;  3HOY K;  5IYD K;  4OIO A;  2VUM C;  1YNJ A;  4YFK A;  4BY7 C;  4JK1 A;  4OIQ A;  4G7O A;  5M5W K;  2VUM K;  4BY7 K;  4GZY A;  4C3J C;  1I6V A;  5C4J C;  4A3J C;  3M3Y C;  2A6H A;  3GTL C;  1TWC C;  2R92 C;  3S1M C;  4X6A C;  1TWC K;  1I50 K;  2Y0S L;  2R92 K;  3GTL K;  3S1M K;  4X6A K;  4BBR C;  4BBR K;  2E2I K;  2NVX C;  5FLM K;  2NVX K;  3GTP C;  3GTP K;  3GTQ C;  1I3Q C;  3GTQ K;  1I3Q K;  1R9T C;  4C3I C;  3S2D C;  4C3I K;  1R9T K;  2R7Z K;  3S2D K;  4A3K K;  3S1N C;  5C44 K;  3S1N K;  2PMZ D;  1I6H C;  2NVT C;  4QJV B;  4Y7N C;  4A93 C;  4Y7N K;  3RZO C;  4A93 K;  3RZO K;  4XLN A;  4A3F C;  4A3F K;  4QIW D;  5M5X K;  2A6E A;  4LK1 A;  3S2H C;  3S2H K;  1ZYR A;  2WAQ L;  4AYB L;  4QJV A;  3H3V L;  4KN7 A;  1Y1W C;  2B63 C;  1YNN A;  5D4D A;  4MEY A;  4LK0 A;  3HOV C;  4A3M C;  4Y52 C;  3S14 C;  4C3J K;  4A3M K;  4KMU A;  3HOV K;  3S14 K;  4Y52 K;  5IYC C;  2WB1 L;  2NVY C;  2Y0S D;  5IYC K;  1WCM C;  1WCM K;  4OIN A;  5FJ8 K;  1TWG C;  5C3E C;  1TWG K;  5C3E K;  4XLP A;  2PPB A;  3I4N C;  3I4N K;  3PO3 C;  4LJZ A;  3PO3 K;  1TWF C;  2NVQ C;  3S16 C;  1TWF K;  4ZH4 A;  2CW0 A;  2NVQ K;  3S1R C;  3S16 K;  4YFX A;  3S1R K;  3WOD A;  2NVT K;  1I6H K;  1TWA C;  1TWA K;  2A69 A;  4A3K C;  3HKZ D; 
#chains in the Genus database with same CATH topology
 1BDF A;  3H3V D;  3FKI A;  1I50 A;  1Y1W K;  4GFQ A;  5M3F K;  2E2I A;  4KAR A;  1J98 A;  3H0G C;  2V6U A;  1WQF A;  1G51 A;  3H0G K;  4KC6 A;  4BY1 C;  2KXY A;  3M4O C;  2RH6 A;  3OEP A;  2ZUF A;  4BY1 K;  3M4O K;  2JH3 A;  3FOE A;  4NOI A;  4XSZ A;  1L0W A;  3BP8 C;  2P8T A;  1VJE A;  1O26 A;  2D6F C;  2A68 A;  2JA7 K;  4G0V A;  2V6T A;  1WQG A;  3CAG A;  1HQM A;  5HL7 S;  1F7V A;  2ZFZ A;  4U67 S;  3GTJ C;  2JA5 C;  3GTJ K;  2JA5 K;  3HOW C;  1VRQ C;  3HOW K;  5E68 A;  1EH1 A;  4P5B A;  1VH2 A;  3DXJ A;  3GTM C;  3GTM K;  1C0A A;  4Q5S A;  1USM A;  4Q4Z A;  2GSN A;  1WOO A;  2GSO A;  5IYD C;  3HOY C;  3N0B A;  3HOY K;  5IYD K;  1USO A;  4G7O A;  2VUM C;  1Y1W A;  2VUM K;  1J6X A;  3VA7 A;  3FOF A;  2GAG C;  4A3J C;  3M3Y C;  2A6H A;  4A3J K;  3M3Y K;  2Y0S L;  3FHZ A;  5DM6 S;  1B4A A;  2NVX C;  5FLM K;  2NVX K;  2GSU A;  3GTQ C;  4GTF A;  3GTQ K;  1R9T C;  1R9T K;  2R7Z K;  3GEE A;  3S1N C;  5C44 K;  3S1N K;  2PMZ D;  2XCR B;  2Y3P A;  4KMD A;  4A3F C;  4A3F K;  1KQ4 A;  3TFJ A;  1TWA A;  4LK1 A;  3S2H C;  3S2H K;  2JA7 A;  1YCL A;  4RMF A;  4KAW X;  4C3J K;  2NVY A;  5HL8 A;  1WCM C;  1WCM K;  3CQZ A;  1TWG C;  1TWG K;  3LPX A;  2CFA A;  4XLP A;  2ZUE A;  3I4N C;  3I4N K;  4LJZ A;  1TWF C;  2NVQ C;  1TWF K;  3G4A A;  4ZH4 A;  3TTG A;  2NVQ K;  3LYW A;  2A69 A;  4WF9 S;  4A3K C;  4A3K K;  3AH5 A;  3MML B;  1V5V A;  3BUE A;  3S0X A;  2B63 K;  1RU0 A;  3BP3 A;  4KMH A;  5HQH A;  4G7Z A;  4KN4 A;  2CFA B;  1J6V A;  4YG2 A;  2R7Z A;  3ERE D;  4MQ9 A;  1SFO A;  5L46 A;  1IW7 A;  2PA8 L;  3G4C A;  5IP9 C;  1XXB A;  5IP9 K;  1O2B A;  1WOS A;  3GTK C;  1UV7 A;  3GTK K;  3GTG C;  3GTG K;  2E2H C;  2E2H K;  4A3C C;  4A3C K;  4BLA A;  4KAT A;  4A3E C;  4A3E K;  1WOP A;  1TWH C;  2R93 C;  1TWH K;  3CF5 S;  5M3M K;  3RZD C;  1TWC A;  3RZD K;  2R93 K;  2R92 A;  4WFB S;  2ZJQ S;  4O2D A;  1DCO A;  5TMF A;  2JA8 C;  2JA8 K;  2BE5 A;  3GIR A;  4WIL A;  4A3B C;  4LR2 A;  4A3B K;  1F93 A;  3SZY A;  4WCE S;  3I4M C;  3PO2 C;  1K83 C;  3I4M K;  1K83 K;  1F7U A;  3PO2 K;  4YFN A;  2B63 A;  4YFK A;  5M5W K;  4OIQ A;  1XZQ B;  5C4J C;  1GE9 A;  5C4J K;  3GTL C;  3GTL K;  4LQY A;  5JVG S;  3PIP S;  4BBR C;  4BBR K;  3DLL S;  3GSI A;  4DDQ A;  3GTP C;  3GTP K;  1I3Q C;  1I3Q K;  3S2D C;  1IL2 A;  3S2D K;  1I6H C;  2NVT C;  5JVH S;  4GT9 A;  3H3V L;  4PAA A;  1XXC A;  3A8K A;  3OPF A;  5D4D A;  4MEY A;  4LK0 A;  3HOV C;  1DCH A;  1VGX A;  3H0G A;  4GTB A;  3HOV K;  5IYC C;  2NVY C;  5IYC K;  3GEI A;  2FQO A;  4G0U A;  1O29 A;  5C3E C;  5C3E K;  2V6S A;  2ZJR S;  2PPB A;  1IE0 A;  3PO3 C;  4IOA S;  3PO3 K;  2XCO A;  4G0W A;  1JQW A;  1EFW A;  5CJ9 A;  2YU9 C;  2YU9 K;  4WJ3 M;  5JVO A;  4C3H C;  3S1Q C;  4BBS C;  4BBS K;  1O2F B;  4OIP A;  4A3D C;  4A3D K;  3GTJ A;  2JA5 A;  1EI6 A;  4OIR A;  3N0C A;  4LLG A;  1AB4 A;  4P9S A;  4G7H A;  3NUH A;  1EK8 A;  1ZXO A;  3GTM A;  2O5J A;  2P5M A;  3S15 C;  1PJ5 A;  3S15 K;  3GTO C;  3GTO K;  1Y1V C;  1Y1V K;  1INN A;  5IYB C;  4KDD A;  5IYB K;  2VUM A;  2JA6 C;  2JA6 K;  3L4K A;  5IOR A;  5IOS A;  4AYB D;  4XCH A;  3LAP A;  2EBB A;  4A3L C;  1WOR A;  4A3L K;  1I50 C;  3FKI C;  3FKI K;  3HOU C;  3HOU K;  4A3G C;  4A3G K;  2E2J C;  2E2I C;  4AH6 A;  2E2J K;  1O24 A;  1BGW A;  3TFI A;  4C2M C;  2NVX A;  4C2M K;  1XPP A;  3S17 C;  3S17 K;  1IBA A;  2WB1 D;  1JVI A;  3GTQ A;  1R9T A;  2XCQ A;  3L4J A;  4BXX C;  4BXX K;  1WIH A;  2PHC B;  2PMZ L;  3HOZ C;  3Q3Q A;  3HOZ K;  3HOX C;  3ADA C;  3HOX K;  5EGE A;  4KM8 A;  1J6W A;  3N3Y A;  1YX2 A;  4XSX A;  4FZB A;  4OIO A;  4WFN S;  1BS2 A;  4GZY A;  3A8J A;  4KM9 A;  1JOE A;  1I6V A;  3S1M C;  3S1M K;  2ZJP S;  1WCM A;  1O25 A;  1XZQ A;  3V4G A;  1TWG A;  3GDZ A;  4C3I C;  4C3I K;  1TWF A;  2GAH C;  1IQ0 A;  3PIO S;  4QJV B;  4A93 C;  4A93 K;  4PAB A;  5EGH A;  4QIW D;  3AD7 C;  4IOC S;  1ZYR A;  4AYB L;  4GTD A;  4BKW A;  3AQP A;  4KN7 A;  1Y1W C;  1O28 A;  3AD9 C;  4Y52 C;  4M1X A;  4Y52 K;  2WB1 L;  2Y0S D;  3SZZ A;  1WQH A;  4WFA S;  1ZQ1 C;  5FJ8 K;  3AQO A;  4J3N A;  1F9N A;  1BJT A;  3S1R C;  3S1R K;  1I6H K;  3WOD A;  2NVT K;  3GTK A;  3GTG A;  2E2H A;  1TWA C;  1WSR A;  1TWA K;  4GTE A;  3HKZ D;  1TWH A;  3TFH A;  2JA7 C;  2R93 A;  5DM7 S;  1XXA A;  2O5I A;  3GEH A;  5M5Y K;  4KAS A;  1SMY A;  4A3I C;  1XZP A;  1ISE A;  4A3I K;  2NVY K;  5JFE A;  4P5A A;  1DCP A;  3CQZ C;  3CQZ K;  4MEX A;  4BLB A;  1ZVU A;  5C4X C;  4QIW L;  5C4X K;  1K83 A;  3A8I A;  3HXA A;  5CHP A;  2RGR A;  4KB4 A;  3T02 A;  1B4B A;  2WAQ D;  3QX3 A;  3GTL A;  1XZP B;  4C3H K;  3S1Q K;  5TJ3 A;  1O27 A;  5FLM C;  3GTP A;  1PJ7 A;  4IO9 S;  1I3Q A;  2KQ1 A;  2R7Z C;  4GTC A;  3IPJ A;  5C44 C;  1EQR A;  2W7V A;  1SFO C;  4LOW A;  1SFO K;  3EQL A;  5IP7 C;  5IP7 K;  2PA8 D;  5IOQ A;  1DD5 A;  2KPU A;  1X31 C;  3HKZ L;  3LAJ A;  3K7A C;  3K7A K;  5TMC A;  4BY7 C;  1YNJ A;  4BY7 K;  4JK1 A;  4C45 A;  1IS1 A;  4GTA A;  4C3J C;  4X6A C;  1TWC C;  2R92 C;  1TWC K;  2KWA A;  2R92 K;  1I50 K;  4X6A K;  3AD8 C;  2E2I K;  1HI9 A;  5IOT A;  4Y7N C;  4Y7N K;  3RZO C;  3RZO K;  4XLN A;  1ZBS A;  4KB2 A;  2L3U A;  5M5X K;  2A6E A;  4KMA A;  2WAQ L;  1PJ6 A;  2YU9 A;  4QJV A;  1VLO A;  2B63 C;  1YNN A;  4ILD A;  3T00 A;  3S14 C;  4A3M C;  3S14 K;  4A3M K;  4KMU A;  4GTL A;  4OIN A;  3JST A;  1FEU A;  1O2A A;  4FM9 A;  3S16 C;  4WJ4 A;  3S16 K;  2CW0 A;  3GTO A;  2FQT A;  4YFX A;  3T01 A;  1Y1V A;  2L5N A;  3ORE A;  2JA6 A;  1WSV A; 
#chains in the Genus database with same CATH homology
 2YU9 C;  2JA7 C;  2YU9 K;  1BDF A;  3H3V D;  4C3H C;  1Y1W K;  2B63 K;  3S1Q C;  4BBS C;  2O5I A;  4BBS K;  5M3F K;  4OIP A;  4A3D C;  3H0G C;  5M5Y K;  3H0G K;  4A3D K;  4OIR A;  1SMY A;  4KN4 A;  4LLG A;  4G7Z A;  4A3I C;  4BY1 C;  3M4O C;  2NVY K;  4YG2 A;  4A3I K;  4A3J K;  4BY1 K;  3M4O K;  4G7H A;  3CQZ C;  4MQ9 A;  3CQZ K;  4MEX A;  5C4J K;  1IW7 A;  2O5J A;  2PA8 L;  5C4X C;  4QIW L;  5IP9 C;  5C4X K;  5IP9 K;  3S15 C;  3S15 K;  3GTO C;  3GTO K;  1Y1V C;  3GTK C;  1Y1V K;  3GTK K;  3GTG C;  4NOI A;  5IYB C;  4XSZ A;  2E2H C;  5IYB K;  2E2H K;  4A3C C;  3GTG K;  4A3C K;  2JA6 C;  2JA6 K;  4A3E C;  4A3E K;  2WAQ D;  4AYB D;  2A68 A;  1TWH C;  2R93 C;  1TWH K;  5M3M K;  4A3L C;  3RZD C;  2JA7 K;  3RZD K;  4A3L K;  2R93 K;  1I50 C;  3FKI C;  1HQM A;  3FKI K;  3HOU C;  4C3H K;  3HOU K;  4A3G C;  3S1Q K;  4A3G K;  2E2J C;  2E2I C;  2E2J K;  5FLM C;  4C2M C;  3GTJ C;  5TMF A;  2JA5 C;  3S17 C;  2JA8 C;  1XPP A;  4C2M K;  2BE5 A;  2WB1 D;  3GTJ K;  2JA5 K;  2JA8 K;  3S17 K;  4A3B C;  2R7Z C;  3HOW C;  3HOW K;  4BXX C;  4A3B K;  4BXX K;  5C44 C;  2PMZ L;  3DXJ A;  3HOZ C;  3HOZ K;  1SFO C;  3GTM C;  1SFO K;  3EQL A;  5IP7 C;  3GTM K;  5IP7 K;  2PA8 D;  3HOX C;  3HOX K;  4Q5S A;  3I4M C;  3PO2 C;  3I4M K;  1K83 C;  3PO2 K;  1K83 K;  4Q4Z A;  3HKZ L;  3M3Y K;  4YFN A;  3K7A C;  5IYD C;  3HOY C;  4XSX A;  3K7A K;  5TMC A;  3HOY K;  5IYD K;  4OIO A;  2VUM C;  1YNJ A;  4YFK A;  4BY7 C;  4JK1 A;  4OIQ A;  4G7O A;  5M5W K;  2VUM K;  4BY7 K;  4GZY A;  4C3J C;  1I6V A;  5C4J C;  4A3J C;  3M3Y C;  2A6H A;  3GTL C;  1TWC C;  2R92 C;  3S1M C;  4X6A C;  1TWC K;  1I50 K;  2Y0S L;  2R92 K;  3GTL K;  3S1M K;  4X6A K;  4BBR C;  4BBR K;  2E2I K;  2NVX C;  5FLM K;  2NVX K;  3GTP C;  3GTP K;  3GTQ C;  1I3Q C;  3GTQ K;  1I3Q K;  1R9T C;  4C3I C;  3S2D C;  4C3I K;  1R9T K;  2R7Z K;  3S2D K;  4A3K K;  3S1N C;  5C44 K;  3S1N K;  2PMZ D;  1I6H C;  2NVT C;  4QJV B;  4Y7N C;  4A93 C;  4Y7N K;  3RZO C;  4A93 K;  3RZO K;  4XLN A;  4A3F C;  4A3F K;  4QIW D;  5M5X K;  2A6E A;  4LK1 A;  3S2H C;  3S2H K;  1ZYR A;  2WAQ L;  4AYB L;  4QJV A;  3H3V L;  4KN7 A;  1Y1W C;  2B63 C;  1YNN A;  5D4D A;  4MEY A;  4LK0 A;  3HOV C;  4A3M C;  4Y52 C;  3S14 C;  4C3J K;  4A3M K;  4KMU A;  3HOV K;  3S14 K;  4Y52 K;  5IYC C;  2WB1 L;  2NVY C;  2Y0S D;  5IYC K;  1WCM C;  1WCM K;  4OIN A;  5FJ8 K;  1TWG C;  5C3E C;  1TWG K;  5C3E K;  4XLP A;  2PPB A;  3I4N C;  3I4N K;  3PO3 C;  4LJZ A;  3PO3 K;  1TWF C;  2NVQ C;  3S16 C;  1TWF K;  4ZH4 A;  2CW0 A;  2NVQ K;  3S1R C;  3S16 K;  4YFX A;  3S1R K;  3WOD A;  2NVT K;  1I6H K;  1TWA C;  1TWA K;  2A69 A;  4A3K C;  3HKZ D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...