4OIRA

Crystal structure of thermus thermophilus rna polymerase transcription initiation complex soaked with ge23077 and rifamycin sv
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
231
structure length
231
Chain Sequence
SKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQAAAVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase subunit alpha
publication title GE23077 binds to the RNA polymerase 'i' and 'i+1' sites and prevents the binding of initiating nucleotides.
pubmed rcsb
source organism Thermus thermophilus
molecule tags Transcription, transferase/antibiotic
total genus 49
structure length 231
sequence length 231
chains with identical sequence B
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2014-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01000 RNA_pol_A_bac RNA polymerase Rpb3/RpoA insert domain
A PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.12 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 DNA-directed RNA polymerase, insert domain 4oirA02
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 4oirA01
2YU9C 3M3YK 1TWCC 3HOWK 4A3IK 1ZYRA 4A3DK 3RZOC 1K83K 4C2MK 4A3BC 3PO2C 3RZDK 4A3LK 4BXXC 3HOUK 2PA8L 2NVQK 1TWAK 2NVTC 2A69A 1Y1WK 4C3JC 4A3EC 4Y7NK 2YU9K 3S1QK 1TWCK 2R93K 2CW0A 3HOXC 1XPPA 3S14K 5FLMC 2NVYC 2JA8K 2E2IK 4YG2A 2PMZL 5IYBC 2R92C 4YFNA 2PMZD 4OIQA 2JA6C 5M3FK 1Y1VK 3GTOK 3HOVK 2O5IA 1R9TC 4OIOA 2B63K 4X6AK 3HKZD 3K7AC 3GTJC 5C44K 3GTPK 4A3MC 2R92K 4JK1A 4C3HC 4A3FC 5C4JK 1WCMK 5C3EC 4G7HA 4BY7C 1I50C 3WODA 2JA5K 1IW7A 2JA7C 4YFXA 1TWFC 4YFKA 3GTKC 3S1NC 3S2DC 3S1RK 1SFOK 1I6VA 4KN4A 4A3MK 2VUMK 3GTGC 2R7ZK 4ZH4A 3GTLC 4KMUA 3S16K 4QJVA 5FJ8K 3S15K 1I3QK 3GTMC 3H3VD 5IYCK 4A3JC 3H0GC 4LLGA 3PO3C 3RZOK 3I4MC 4A3BK 3PO2K 4BBRC 2BE5A 4BXXK 2A6EA 3GTGK 3DXJA 4LJZA 3EQLA 4MEXA 2NVTK 4Y52C 3S1MC 2WB1D 5IP7C 3GTQC 4G7OA 2E2JC 3HKZL 4C3JK 4A3EK 3HOXK 5FLMK 2NVYK 3HOYC 1TWGC 5C4XC 5IYBK 3M4OC 2JA6K 1YNJA 4XLNA 4Q5SA 2E2HC 2NVXC 1R9TK 5TMFA 4GZYA 4A3GC 5IYDC 3S2HC 2O5JA 1YNNA 3K7AK 3GTJK 4A3KC 1TWHC 4A3CC 4A93C 2A68A 5IP9C 4C3HK 4A3FK 5D4DA 4AYBL 3H3VL 5C3EK 4AYBD 4BY1C 3HOZC 1I50K 5M5XK 4A3GK 4BY7K 3I4NC 4G7ZA 3CQZC 2VUMC 2JA7K 4BBSC 1I6HC 3GTKK 1TWFK 3S1NK 4OIPA 3S2DK 3M3YC 4A3IC 4A3DC 4QJVB 1K83C 4C2MC 3RZDC 3GTLK 3S17C 4A3LC 2WB1L 3HOUC 2WAQL 2Y0SL 3GTMK 2WAQD 2Y0SD 2NVQC 4A3JK 3I4NK 1TWAC 1Y1WC 3H0GK 4Y7NC 4MEYA 3S1QC 3PO3K 4C3IC 3I4MK 4Q4ZA 2R93C 3S14C 2PPBA 4BBRK 2JA8C 5M5YK 2E2IC 4QIWL 4OINA 5TMCA 4QIWD 4LK0A 3S17K 3S1MK 4NOIA 4Y52K 3GTQK 4XSZA 5IP7K 2PA8D 1Y1VC 4KN7A 3GTOC 3HOVC 2E2JK 3FKIC 2B63C 4LK1A 4X6AC 3HOYK 1TWGK 5C4XK 4C3IK 5M5WK 4XLPA 5C44C 3GTPC 3M4OK 2E2HK 2NVXK 1BDFA 2A6HA 5C4JC 3S2HK 5IYDK 1WCMC 3FKIK 4A3KK 2JA5C 1TWHK 4XSXA 4A3CK 3HOWC 4A93K 5IP9K 1SFOC 1SMYA 3S1RC 4MQ9A 5M3MK 4BY1K 3HOZK 1HQMA 2R7ZC 4OIRA 3CQZK 3S16C 4BBSK 3S15C 1I6HK 1I3QC 5IYCC
chains in the Genus database with same CATH superfamily
3HOWK 4A3IK 4C2MK 4A3BC 2PA8L 3FOEA 1Y1WK 4A3EC 3S14K 2JA8K 3T01A 2PMZD 3CAGA 3HOVK 1R9TC 2B63K 2L3UA 3GTJC 3GTPK 4A3MC 4KDDA 3GTJA 1XXCA 4KM9A 3A8KA 3WODA 4U67S 1IW7A 1I3QA 2PHCB 1FEUA 4GTCA 1XXBA 3L4JA 4J3NA 4GTLA 3GTLC 1VJEA 4KMUA 4KB2A 3H3VD 1X31C 1F9NA 3H0GC 4KMHA 4A3BK 4G0VA 2NVYA 1XXAA 3GTGK 3EQLA 4KAWX 1AB4A 2WB1D 5IP7C 3GTQC 3AD9C 4FM9A 4A3EK 1PJ6A 1WQGA 3N3YA 1R9TK 1J6WA 3TFIA 5TMFA 5IYDC 1USMA 3G4AA 1I50A 3LAJA 3GTJK 2Y3PA 5EGEA 3JSTA 1TWFA 4WILA 5D4DA 4AYBD 2VUMC 2VUMA 3LYWA 3ADAC 4QJVB 4WF9S 3GTLK 3S17C 3GSIA 3HOUC 2WAQL 2NVQC 1GE9A 3H0GK 3S1QC 4BLAA 4C3IC 3T02A 2R93C 1VRQC 5IOQA 2E2IC 5TMCA 4LK0A 3GTQK 5IP7K 2PA8D 1Y1VC 2ZJQS 3GTOC 1HI9A 1KQ4A 4GTDA 2V6UA 1Y1VA 3GTOA 5C44C 4KASA 1DCPA 4RMFA 2A6HA 5IYDK 1WCMC 3FKIK 2JA5C 3CQZA 3HOWC 1B4BA 5L46A 1SMYA 1WORA 2R7ZC 4OIRA 2VUMK 3S16C 3PIOS 1EQRA 1Y1WA 2CFAA 2ZJPS 3HOUK 1IE0A 2NVQK 5HQHA 1ZXOA 4C3JC 2YU9K 1O25A 3S1QK 2R93K 2B63A 1XPPA 5FLMC 2E2IK 3GTPA 4AH6A 2JA6C 1B4AA 5M3FK 1Y1VK 3GTOK 1INNA 1JQWA 2RGRA 1O27A 5C44K 4JK1A 4A3FC 1F7UA 1WCMK 4BLBA 5C3EC 4G7HA 4BY7C 2JA5K 4KMAA 2P8TA 4C45A 4PAAA 4YFXA 4YFKA 3S2DC 4KN4A 3GTGC 2KPUA 1ZQ1C 4BKWA 2R7ZK 1O2FB 3S16K 3GTGA 3GTMC 4A3JC 3PO3C 1L0WA 3AD7C 2ZUEA 1YCLA 2A6EA 2XCQA 3DXJA 4MEXA 1XZQA 1V5VA 3OPFA 2ZUFA 4P9SA 3S1MC 2FQTA 4GTBA 4C3JK 1R9TA 4O2DA 2W7VA 3PIPS 5FLMK 3HOYC 1TWGC 2GSOA 3BP3A 2JA6K 2E2HC 1USOA 5E68A 4GZYA 2GSNA 3S2HC 2O5JA 2E2HA 1YNNA 5JVOA 3OEPA 5IOTA 1WSVA 2GAGC 4A3FK 1O2AA 5C3EK 4BY7K 4M1XA 1WQHA 3GTLA 4G7ZA 4BBSC 3S2DK 3H0GA 4A3DC 1WSRA 1K83C 2P5MA 3GTMK 1RU0A 4A3JK 2Y0SD 3I4NK 3GIRA 1TWAC 3GTQA 3PO3K 4Y7NC 4MEYA 1WOPA 1BGWA 1TWAA 4P5BA 3IPJA 4QIWL 5IOSA 3S1MK 4NOIA 3T00A 4XSZA 1EH1A 3SZZA 3FKIC 4DDQA 3S0XA 3HXAA 3HOYK 1TWGK 3FKIA 4XLPA 3A8JA 4KC6A 1ZBSA 2E2HK 5HL8A 5C4JC 3S2HK 1J6XA 4XSXA 1BJTA 1WOSA 5M3MK 3OREA 3G4CA 4BBSK 5IYCC 2YU9C 3AH5A 2YU9A 4A3DK 3RZOC 1K83K 1EK8A 2R93A 3PO2C 4BXXC 5JVHS 4GFQA 2E2IA 1TWAK 2NVTC 4Y7NK 1WIHA 1TWCK 3ERED 2CW0A 3HOXC 4IOCS 4YG2A 2PMZL 5IYBC 1ISEA 4OIQA 1DCHA 2O5IA 5JVGS 1XZPB 1JVIA 1WCMA 3VA7A 1IQ0A 3K7AC 2JA5A 1IL2A 2R92K 5C4JK 1O29A 2R7ZA 2JA7C 4LOWA 4ILDA 3GTKC 1PJ7A 1I6VA 3GTKA 4ZH4A 3GEEA 4QJVA 2KWAA 3BP8C 5FJ8K 5IYCK 4IOAS 4WJ4A 3RZOK 1J98A 3PO2K 5DM6S 2BE5A 1VLOA 4BXXK 1UV7A 4LJZA 2XCOA 2L5NA 2NVTK 2JA6A 3LAPA 4G7OA 3HKZL 3CF5S 3HOXK 5IYBK 1JOEA 1XZQB 3M4OC 1YNJA 4XLNA 4Q5SA 2NVXC 5DM7S 2V6TA 1C0AA 2XCRB 2GSUA 4LR2A 3K7AK 4A3KC 4A93C 4AYBL 4BY1C 4A3GK 5M5XK 4FZBA 3I4NC 2JA7K 1I6HC 3GTMA 3GTKK 4OIPA 3M3YC 5JFEA 3RZDC 4A3LC 2WAQD 1BS2A 1TWGA 5M5YK 4WCES 3AQOA 1IBAA 4X6AC 1ZVUA 3TFHA 5CHPA 3M4OK 2NVXK 4KM8A 3LPXA 2KXYA 4G0WA 4A3KK 3N0BA 4PABA 4A93K 1SFOC 3S1RC 1DCOA 2FQOA 1SFOA 4XCHA 4BY1K 1K83A 1EFWA 3FHZA 3S15C 1I6HK 1I3QC 3M3YK 1TWCC 1ZYRA 3SZYA 1TWCA 3RZDK 3BUEA 1F7VA 4A3LK 2A69A 1J6VA 2RH6A 2NVYC 4WJ3M 2R92C 4YFNA 3GEIA 2R92A 2KQ1A 4WFAS 4OIOA 3TTGA 5EGHA 4X6AK 3HKZD 4WFBS 3GDZA 4C3HC 1PJ5A 1I50C 2V6SA 1SFOK 1TWFC 3S1NC 3S1RK 3Q3QA 4A3MK 4G0UA 2D6FC 3S15K 1I3QK 4KARA 3DLLS 2CFAB 3A8IA 1F93A 1DD5A 4LLGA 3I4MC 1EI6A 4BBRC 3QX3A 2JH3A 5HL7S 1WQFA 1G51A 4Y52C 5CJ9A 2E2JC 2ZFZA 2NVYK 5C4XC 1WOOA 3V4GA 1O26A 4GT9A 4A3GC 3FOFA 1YX2A 3MMLB 3GEHA 1TWHC 2JA7A 4A3CC 2A68A 5IP9C 4C3HK 1TWHA 3AQPA 3H3VL 4IO9S 3HOZC 1I50K 1VGXA 3CQZC 1O28A 1TWFK 3S1NK 4GTAA 4KB4A 4KATA 5IORA 4A3IC 5TJ3A 1O2BA 4C2MC 4WFNS 1VH2A 2WB1L 4P5AA 2Y0SL 4GTEA 4LQYA 1Y1WC 1O24A 2EBBA 1IS1A 3I4MK 4Q4ZA 4BBRK 3S14C 2PPBA 2JA8C 4OINA 3NUHA 4QIWD 3S17K 4Y52K 2NVXA 2E2JK 4KN7A 3HOVC 2GAHC 2B63C 4LK1A 5C4XK 4C3IK 1XZPA 5M5WK 3GTPC 3L4KA 1BDFA 4GTFA 3AD8C 1TWHK 4A3CK 5IP9K 2ZJRS 3N0CA 4MQ9A 3HOZK 1HQMA 3CQZK 4KMDA 3TFJA
chains in the Genus database with same CATH topology
2YU9C 3M3YK 1TWCC 3HOWK 4A3IK 1ZYRA 4A3DK 3RZOC 1K83K 4C2MK 4A3BC 3PO2C 3RZDK 4A3LK 4BXXC 3HOUK 2PA8L 2NVQK 1TWAK 2NVTC 2A69A 1Y1WK 4C3JC 4A3EC 4Y7NK 2YU9K 3S1QK 1TWCK 2R93K 2CW0A 3HOXC 1XPPA 3S14K 5FLMC 2NVYC 2JA8K 2E2IK 4YG2A 2PMZL 5IYBC 2R92C 4YFNA 2PMZD 4OIQA 2JA6C 5M3FK 1Y1VK 3GTOK 3HOVK 2O5IA 1R9TC 4OIOA 2B63K 4X6AK 3HKZD 3K7AC 3GTJC 5C44K 3GTPK 4A3MC 2R92K 4JK1A 4C3HC 4A3FC 5C4JK 1WCMK 5C3EC 4G7HA 4BY7C 1I50C 3WODA 2JA5K 1IW7A 2JA7C 4YFXA 1TWFC 4YFKA 3GTKC 3S1NC 3S2DC 3S1RK 1SFOK 1I6VA 4KN4A 4A3MK 2VUMK 3GTGC 2R7ZK 4ZH4A 3GTLC 4KMUA 3S16K 4QJVA 5FJ8K 3S15K 1I3QK 3GTMC 3H3VD 5IYCK 4A3JC 3H0GC 4LLGA 3PO3C 3RZOK 3I4MC 4A3BK 3PO2K 4BBRC 2BE5A 4BXXK 2A6EA 3GTGK 3DXJA 4LJZA 3EQLA 4MEXA 2NVTK 4Y52C 3S1MC 2WB1D 5IP7C 3GTQC 4G7OA 2E2JC 3HKZL 4C3JK 4A3EK 3HOXK 5FLMK 2NVYK 3HOYC 1TWGC 5C4XC 5IYBK 3M4OC 2JA6K 1YNJA 4XLNA 4Q5SA 2E2HC 2NVXC 1R9TK 5TMFA 4GZYA 4A3GC 5IYDC 3S2HC 2O5JA 1YNNA 3K7AK 3GTJK 4A3KC 1TWHC 4A3CC 4A93C 2A68A 5IP9C 4C3HK 4A3FK 5D4DA 4AYBL 3H3VL 5C3EK 4AYBD 4BY1C 3HOZC 1I50K 5M5XK 4A3GK 4BY7K 3I4NC 4G7ZA 3CQZC 2VUMC 2JA7K 4BBSC 1I6HC 3GTKK 1TWFK 3S1NK 4OIPA 3S2DK 3M3YC 4A3IC 4A3DC 4QJVB 1K83C 4C2MC 3RZDC 3GTLK 3S17C 4A3LC 2WB1L 3HOUC 2WAQL 2Y0SL 3GTMK 2WAQD 2Y0SD 2NVQC 4A3JK 3I4NK 1TWAC 1Y1WC 3H0GK 4Y7NC 4MEYA 3S1QC 3PO3K 4C3IC 3I4MK 4Q4ZA 2R93C 3S14C 2PPBA 4BBRK 2JA8C 5M5YK 2E2IC 4QIWL 4OINA 5TMCA 4QIWD 4LK0A 3S17K 3S1MK 4NOIA 4Y52K 3GTQK 4XSZA 5IP7K 2PA8D 1Y1VC 4KN7A 3GTOC 3HOVC 2E2JK 3FKIC 2B63C 4LK1A 4X6AC 3HOYK 1TWGK 5C4XK 4C3IK 5M5WK 4XLPA 5C44C 3GTPC 3M4OK 2E2HK 2NVXK 1BDFA 2A6HA 5C4JC 3S2HK 5IYDK 1WCMC 3FKIK 4A3KK 2JA5C 1TWHK 4XSXA 4A3CK 3HOWC 4A93K 5IP9K 1SFOC 1SMYA 3S1RC 4MQ9A 5M3MK 4BY1K 3HOZK 1HQMA 2R7ZC 4OIRA 3CQZK 3S16C 4BBSK 3S15C 1I6HK 1I3QC 5IYCC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YU9 C;  3M3Y K;  1TWC C;  3HOW K;  4A3I K;  1ZYR A;  4A3D K;  3RZO C;  1K83 K;  4C2M K;  4A3B C;  3PO2 C;  3RZD K;  4A3L K;  4BXX C;  3HOU K;  2PA8 L;  2NVQ K;  1TWA K;  2NVT C;  2A69 A;  1Y1W K;  4C3J C;  4A3E C;  4Y7N K;  2YU9 K;  3S1Q K;  1TWC K;  2R93 K;  2CW0 A;  3HOX C;  1XPP A;  3S14 K;  5FLM C;  2NVY C;  2JA8 K;  2E2I K;  4YG2 A;  2PMZ L;  5IYB C;  2R92 C;  4YFN A;  2PMZ D;  4OIQ A;  2JA6 C;  5M3F K;  1Y1V K;  3GTO K;  3HOV K;  2O5I A;  1R9T C;  4OIO A;  2B63 K;  4X6A K;  3HKZ D;  3K7A C;  3GTJ C;  5C44 K;  3GTP K;  4A3M C;  2R92 K;  4JK1 A;  4C3H C;  4A3F C;  5C4J K;  1WCM K;  5C3E C;  4G7H A;  4BY7 C;  1I50 C;  3WOD A;  2JA5 K;  1IW7 A;  2JA7 C;  4YFX A;  1TWF C;  4YFK A;  3GTK C;  3S1N C;  3S2D C;  3S1R K;  1SFO K;  1I6V A;  4KN4 A;  4A3M K;  2VUM K;  3GTG C;  2R7Z K;  4ZH4 A;  3GTL C;  4KMU A;  3S16 K;  4QJV A;  5FJ8 K;  3S15 K;  1I3Q K;  3GTM C;  3H3V D;  5IYC K;  4A3J C;  3H0G C;  4LLG A;  3PO3 C;  3RZO K;  3I4M C;  4A3B K;  3PO2 K;  4BBR C;  2BE5 A;  4BXX K;  2A6E A;  3GTG K;  3DXJ A;  4LJZ A;  3EQL A;  4MEX A;  2NVT K;  4Y52 C;  3S1M C;  2WB1 D;  5IP7 C;  3GTQ C;  4G7O A;  2E2J C;  3HKZ L;  4C3J K;  4A3E K;  3HOX K;  5FLM K;  2NVY K;  3HOY C;  1TWG C;  5C4X C;  5IYB K;  3M4O C;  2JA6 K;  1YNJ A;  4XLN A;  4Q5S A;  2E2H C;  2NVX C;  1R9T K;  5TMF A;  4GZY A;  4A3G C;  5IYD C;  3S2H C;  2O5J A;  1YNN A;  3K7A K;  3GTJ K;  4A3K C;  1TWH C;  4A3C C;  4A93 C;  2A68 A;  5IP9 C;  4C3H K;  4A3F K;  5D4D A;  4AYB L;  3H3V L;  5C3E K;  4AYB D;  4BY1 C;  3HOZ C;  1I50 K;  5M5X K;  4A3G K;  4BY7 K;  3I4N C;  4G7Z A;  3CQZ C;  2VUM C;  2JA7 K;  4BBS C;  1I6H C;  3GTK K;  1TWF K;  3S1N K;  4OIP A;  3S2D K;  3M3Y C;  4A3I C;  4A3D C;  4QJV B;  1K83 C;  4C2M C;  3RZD C;  3GTL K;  3S17 C;  4A3L C;  2WB1 L;  3HOU C;  2WAQ L;  2Y0S L;  3GTM K;  2WAQ D;  2Y0S D;  2NVQ C;  4A3J K;  3I4N K;  1TWA C;  1Y1W C;  3H0G K;  4Y7N C;  4MEY A;  3S1Q C;  3PO3 K;  4C3I C;  3I4M K;  4Q4Z A;  2R93 C;  3S14 C;  2PPB A;  4BBR K;  2JA8 C;  5M5Y K;  2E2I C;  4QIW L;  4OIN A;  5TMC A;  4QIW D;  4LK0 A;  3S17 K;  3S1M K;  4NOI A;  4Y52 K;  3GTQ K;  4XSZ A;  5IP7 K;  2PA8 D;  1Y1V C;  4KN7 A;  3GTO C;  3HOV C;  2E2J K;  3FKI C;  2B63 C;  4LK1 A;  4X6A C;  3HOY K;  1TWG K;  5C4X K;  4C3I K;  5M5W K;  4XLP A;  5C44 C;  3GTP C;  3M4O K;  2E2H K;  2NVX K;  1BDF A;  2A6H A;  5C4J C;  3S2H K;  5IYD K;  1WCM C;  3FKI K;  4A3K K;  2JA5 C;  1TWH K;  4XSX A;  4A3C K;  3HOW C;  4A93 K;  5IP9 K;  1SFO C;  1SMY A;  3S1R C;  4MQ9 A;  5M3M K;  4BY1 K;  3HOZ K;  1HQM A;  2R7Z C;  4OIR A;  3CQZ K;  3S16 C;  4BBS K;  3S15 C;  1I6H K;  1I3Q C;  5IYC C; 
#chains in the Genus database with same CATH topology
 3HOW K;  4A3I K;  4C2M K;  4A3B C;  2PA8 L;  3FOE A;  1Y1W K;  4A3E C;  3S14 K;  2JA8 K;  3T01 A;  2PMZ D;  3CAG A;  3HOV K;  1R9T C;  2B63 K;  2L3U A;  3GTJ C;  3GTP K;  4A3M C;  4KDD A;  3GTJ A;  1XXC A;  4KM9 A;  3A8K A;  3WOD A;  4U67 S;  1IW7 A;  1I3Q A;  2PHC B;  1FEU A;  4GTC A;  1XXB A;  3L4J A;  4J3N A;  4GTL A;  3GTL C;  1VJE A;  4KMU A;  4KB2 A;  3H3V D;  1X31 C;  1F9N A;  3H0G C;  4KMH A;  4A3B K;  4G0V A;  2NVY A;  1XXA A;  3GTG K;  3EQL A;  4KAW X;  1AB4 A;  2WB1 D;  5IP7 C;  3GTQ C;  3AD9 C;  4FM9 A;  4A3E K;  1PJ6 A;  1WQG A;  3N3Y A;  1R9T K;  1J6W A;  3TFI A;  5TMF A;  5IYD C;  1USM A;  3G4A A;  1I50 A;  3LAJ A;  3GTJ K;  2Y3P A;  5EGE A;  3JST A;  1TWF A;  4WIL A;  5D4D A;  4AYB D;  2VUM C;  2VUM A;  3LYW A;  3ADA C;  4QJV B;  4WF9 S;  3GTL K;  3S17 C;  3GSI A;  3HOU C;  2WAQ L;  2NVQ C;  1GE9 A;  3H0G K;  3S1Q C;  4BLA A;  4C3I C;  3T02 A;  2R93 C;  1VRQ C;  5IOQ A;  2E2I C;  5TMC A;  4LK0 A;  3GTQ K;  5IP7 K;  2PA8 D;  1Y1V C;  2ZJQ S;  3GTO C;  1HI9 A;  1KQ4 A;  4GTD A;  2V6U A;  1Y1V A;  3GTO A;  5C44 C;  4KAS A;  1DCP A;  4RMF A;  2A6H A;  5IYD K;  1WCM C;  3FKI K;  2JA5 C;  3CQZ A;  3HOW C;  1B4B A;  5L46 A;  1SMY A;  1WOR A;  2R7Z C;  4OIR A;  2VUM K;  3S16 C;  3PIO S;  1EQR A;  1Y1W A;  2CFA A;  2ZJP S;  3HOU K;  1IE0 A;  2NVQ K;  5HQH A;  1ZXO A;  4C3J C;  2YU9 K;  1O25 A;  3S1Q K;  2R93 K;  2B63 A;  1XPP A;  5FLM C;  2E2I K;  3GTP A;  4AH6 A;  2JA6 C;  1B4A A;  5M3F K;  1Y1V K;  3GTO K;  1INN A;  1JQW A;  2RGR A;  1O27 A;  5C44 K;  4JK1 A;  4A3F C;  1F7U A;  1WCM K;  4BLB A;  5C3E C;  4G7H A;  4BY7 C;  2JA5 K;  4KMA A;  2P8T A;  4C45 A;  4PAA A;  4YFX A;  4YFK A;  3S2D C;  4KN4 A;  3GTG C;  2KPU A;  1ZQ1 C;  4BKW A;  2R7Z K;  1O2F B;  3S16 K;  3GTG A;  3GTM C;  4A3J C;  3PO3 C;  1L0W A;  3AD7 C;  2ZUE A;  1YCL A;  2A6E A;  2XCQ A;  3DXJ A;  4MEX A;  1XZQ A;  1V5V A;  3OPF A;  2ZUF A;  4P9S A;  3S1M C;  2FQT A;  4GTB A;  4C3J K;  1R9T A;  4O2D A;  2W7V A;  3PIP S;  5FLM K;  3HOY C;  1TWG C;  2GSO A;  3BP3 A;  2JA6 K;  2E2H C;  1USO A;  5E68 A;  4GZY A;  2GSN A;  3S2H C;  2O5J A;  2E2H A;  1YNN A;  5JVO A;  3OEP A;  5IOT A;  1WSV A;  2GAG C;  4A3F K;  1O2A A;  5C3E K;  4BY7 K;  4M1X A;  1WQH A;  3GTL A;  4G7Z A;  4BBS C;  3S2D K;  3H0G A;  4A3D C;  1WSR A;  1K83 C;  2P5M A;  3GTM K;  1RU0 A;  4A3J K;  2Y0S D;  3I4N K;  3GIR A;  1TWA C;  3GTQ A;  3PO3 K;  4Y7N C;  4MEY A;  1WOP A;  1BGW A;  1TWA A;  4P5B A;  3IPJ A;  4QIW L;  5IOS A;  3S1M K;  4NOI A;  3T00 A;  4XSZ A;  1EH1 A;  3SZZ A;  3FKI C;  4DDQ A;  3S0X A;  3HXA A;  3HOY K;  1TWG K;  3FKI A;  4XLP A;  3A8J A;  4KC6 A;  1ZBS A;  2E2H K;  5HL8 A;  5C4J C;  3S2H K;  1J6X A;  4XSX A;  1BJT A;  1WOS A;  5M3M K;  3ORE A;  3G4C A;  4BBS K;  5IYC C;  2YU9 C;  3AH5 A;  2YU9 A;  4A3D K;  3RZO C;  1K83 K;  1EK8 A;  2R93 A;  3PO2 C;  4BXX C;  5JVH S;  4GFQ A;  2E2I A;  1TWA K;  2NVT C;  4Y7N K;  1WIH A;  1TWC K;  3ERE D;  2CW0 A;  3HOX C;  4IOC S;  4YG2 A;  2PMZ L;  5IYB C;  1ISE A;  4OIQ A;  1DCH A;  2O5I A;  5JVG S;  1XZP B;  1JVI A;  1WCM A;  3VA7 A;  1IQ0 A;  3K7A C;  2JA5 A;  1IL2 A;  2R92 K;  5C4J K;  1O29 A;  2R7Z A;  2JA7 C;  4LOW A;  4ILD A;  3GTK C;  1PJ7 A;  1I6V A;  3GTK A;  4ZH4 A;  3GEE A;  4QJV A;  2KWA A;  3BP8 C;  5FJ8 K;  5IYC K;  4IOA S;  4WJ4 A;  3RZO K;  1J98 A;  3PO2 K;  5DM6 S;  2BE5 A;  1VLO A;  4BXX K;  1UV7 A;  4LJZ A;  2XCO A;  2L5N A;  2NVT K;  2JA6 A;  3LAP A;  4G7O A;  3HKZ L;  3CF5 S;  3HOX K;  5IYB K;  1JOE A;  1XZQ B;  3M4O C;  1YNJ A;  4XLN A;  4Q5S A;  2NVX C;  5DM7 S;  2V6T A;  1C0A A;  2XCR B;  2GSU A;  4LR2 A;  3K7A K;  4A3K C;  4A93 C;  4AYB L;  4BY1 C;  4A3G K;  5M5X K;  4FZB A;  3I4N C;  2JA7 K;  1I6H C;  3GTM A;  3GTK K;  4OIP A;  3M3Y C;  5JFE A;  3RZD C;  4A3L C;  2WAQ D;  1BS2 A;  1TWG A;  5M5Y K;  4WCE S;  3AQO A;  1IBA A;  4X6A C;  1ZVU A;  3TFH A;  5CHP A;  3M4O K;  2NVX K;  4KM8 A;  3LPX A;  2KXY A;  4G0W A;  4A3K K;  3N0B A;  4PAB A;  4A93 K;  1SFO C;  3S1R C;  1DCO A;  2FQO A;  1SFO A;  4XCH A;  4BY1 K;  1K83 A;  1EFW A;  3FHZ A;  3S15 C;  1I6H K;  1I3Q C;  3M3Y K;  1TWC C;  1ZYR A;  3SZY A;  1TWC A;  3RZD K;  3BUE A;  1F7V A;  4A3L K;  2A69 A;  1J6V A;  2RH6 A;  2NVY C;  4WJ3 M;  2R92 C;  4YFN A;  3GEI A;  2R92 A;  2KQ1 A;  4WFA S;  4OIO A;  3TTG A;  5EGH A;  4X6A K;  3HKZ D;  4WFB S;  3GDZ A;  4C3H C;  1PJ5 A;  1I50 C;  2V6S A;  1SFO K;  1TWF C;  3S1N C;  3S1R K;  3Q3Q A;  4A3M K;  4G0U A;  2D6F C;  3S15 K;  1I3Q K;  4KAR A;  3DLL S;  2CFA B;  3A8I A;  1F93 A;  1DD5 A;  4LLG A;  3I4M C;  1EI6 A;  4BBR C;  3QX3 A;  2JH3 A;  5HL7 S;  1WQF A;  1G51 A;  4Y52 C;  5CJ9 A;  2E2J C;  2ZFZ A;  2NVY K;  5C4X C;  1WOO A;  3V4G A;  1O26 A;  4GT9 A;  4A3G C;  3FOF A;  1YX2 A;  3MML B;  3GEH A;  1TWH C;  2JA7 A;  4A3C C;  2A68 A;  5IP9 C;  4C3H K;  1TWH A;  3AQP A;  3H3V L;  4IO9 S;  3HOZ C;  1I50 K;  1VGX A;  3CQZ C;  1O28 A;  1TWF K;  3S1N K;  4GTA A;  4KB4 A;  4KAT A;  5IOR A;  4A3I C;  5TJ3 A;  1O2B A;  4C2M C;  4WFN S;  1VH2 A;  2WB1 L;  4P5A A;  2Y0S L;  4GTE A;  4LQY A;  1Y1W C;  1O24 A;  2EBB A;  1IS1 A;  3I4M K;  4Q4Z A;  4BBR K;  3S14 C;  2PPB A;  2JA8 C;  4OIN A;  3NUH A;  4QIW D;  3S17 K;  4Y52 K;  2NVX A;  2E2J K;  4KN7 A;  3HOV C;  2GAH C;  2B63 C;  4LK1 A;  5C4X K;  4C3I K;  1XZP A;  5M5W K;  3GTP C;  3L4K A;  1BDF A;  4GTF A;  3AD8 C;  1TWH K;  4A3C K;  5IP9 K;  2ZJR S;  3N0C A;  4MQ9 A;  3HOZ K;  1HQM A;  3CQZ K;  4KMD A;  3TFJ A; 
#chains in the Genus database with same CATH homology
 2YU9 C;  3M3Y K;  1TWC C;  3HOW K;  4A3I K;  1ZYR A;  4A3D K;  3RZO C;  1K83 K;  4C2M K;  4A3B C;  3PO2 C;  3RZD K;  4A3L K;  4BXX C;  3HOU K;  2PA8 L;  2NVQ K;  1TWA K;  2NVT C;  2A69 A;  1Y1W K;  4C3J C;  4A3E C;  4Y7N K;  2YU9 K;  3S1Q K;  1TWC K;  2R93 K;  2CW0 A;  3HOX C;  1XPP A;  3S14 K;  5FLM C;  2NVY C;  2JA8 K;  2E2I K;  4YG2 A;  2PMZ L;  5IYB C;  2R92 C;  4YFN A;  2PMZ D;  4OIQ A;  2JA6 C;  5M3F K;  1Y1V K;  3GTO K;  3HOV K;  2O5I A;  1R9T C;  4OIO A;  2B63 K;  4X6A K;  3HKZ D;  3K7A C;  3GTJ C;  5C44 K;  3GTP K;  4A3M C;  2R92 K;  4JK1 A;  4C3H C;  4A3F C;  5C4J K;  1WCM K;  5C3E C;  4G7H A;  4BY7 C;  1I50 C;  3WOD A;  2JA5 K;  1IW7 A;  2JA7 C;  4YFX A;  1TWF C;  4YFK A;  3GTK C;  3S1N C;  3S2D C;  3S1R K;  1SFO K;  1I6V A;  4KN4 A;  4A3M K;  2VUM K;  3GTG C;  2R7Z K;  4ZH4 A;  3GTL C;  4KMU A;  3S16 K;  4QJV A;  5FJ8 K;  3S15 K;  1I3Q K;  3GTM C;  3H3V D;  5IYC K;  4A3J C;  3H0G C;  4LLG A;  3PO3 C;  3RZO K;  3I4M C;  4A3B K;  3PO2 K;  4BBR C;  2BE5 A;  4BXX K;  2A6E A;  3GTG K;  3DXJ A;  4LJZ A;  3EQL A;  4MEX A;  2NVT K;  4Y52 C;  3S1M C;  2WB1 D;  5IP7 C;  3GTQ C;  4G7O A;  2E2J C;  3HKZ L;  4C3J K;  4A3E K;  3HOX K;  5FLM K;  2NVY K;  3HOY C;  1TWG C;  5C4X C;  5IYB K;  3M4O C;  2JA6 K;  1YNJ A;  4XLN A;  4Q5S A;  2E2H C;  2NVX C;  1R9T K;  5TMF A;  4GZY A;  4A3G C;  5IYD C;  3S2H C;  2O5J A;  1YNN A;  3K7A K;  3GTJ K;  4A3K C;  1TWH C;  4A3C C;  4A93 C;  2A68 A;  5IP9 C;  4C3H K;  4A3F K;  5D4D A;  4AYB L;  3H3V L;  5C3E K;  4AYB D;  4BY1 C;  3HOZ C;  1I50 K;  5M5X K;  4A3G K;  4BY7 K;  3I4N C;  4G7Z A;  3CQZ C;  2VUM C;  2JA7 K;  4BBS C;  1I6H C;  3GTK K;  1TWF K;  3S1N K;  4OIP A;  3S2D K;  3M3Y C;  4A3I C;  4A3D C;  4QJV B;  1K83 C;  4C2M C;  3RZD C;  3GTL K;  3S17 C;  4A3L C;  2WB1 L;  3HOU C;  2WAQ L;  2Y0S L;  3GTM K;  2WAQ D;  2Y0S D;  2NVQ C;  4A3J K;  3I4N K;  1TWA C;  1Y1W C;  3H0G K;  4Y7N C;  4MEY A;  3S1Q C;  3PO3 K;  4C3I C;  3I4M K;  4Q4Z A;  2R93 C;  3S14 C;  2PPB A;  4BBR K;  2JA8 C;  5M5Y K;  2E2I C;  4QIW L;  4OIN A;  5TMC A;  4QIW D;  4LK0 A;  3S17 K;  3S1M K;  4NOI A;  4Y52 K;  3GTQ K;  4XSZ A;  5IP7 K;  2PA8 D;  1Y1V C;  4KN7 A;  3GTO C;  3HOV C;  2E2J K;  3FKI C;  2B63 C;  4LK1 A;  4X6A C;  3HOY K;  1TWG K;  5C4X K;  4C3I K;  5M5W K;  4XLP A;  5C44 C;  3GTP C;  3M4O K;  2E2H K;  2NVX K;  1BDF A;  2A6H A;  5C4J C;  3S2H K;  5IYD K;  1WCM C;  3FKI K;  4A3K K;  2JA5 C;  1TWH K;  4XSX A;  4A3C K;  3HOW C;  4A93 K;  5IP9 K;  1SFO C;  1SMY A;  3S1R C;  4MQ9 A;  5M3M K;  4BY1 K;  3HOZ K;  1HQM A;  2R7Z C;  4OIR A;  3CQZ K;  3S16 C;  4BBS K;  3S15 C;  1I6H K;  1I3Q C;  5IYC C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...