4OIRA

Crystal structure of thermus thermophilus rna polymerase transcription initiation complex soaked with ge23077 and rifamycin sv
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
231
structure length
231
Chain Sequence
b'SKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQAAAVA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase subunit alpha
publication title GE23077 binds to the RNA polymerase 'i' and 'i+1' sites and prevents the binding of initiating nucleotides.
pubmed rcsb
source organism Thermus thermophilus
molecule tags Transcription, transferase/antibiotic
total genus 49
structure length 231
sequence length 231
chains with identical sequence B
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2014-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01000 RNA_pol_A_bac RNA polymerase Rpb3/RpoA insert domain
A PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.12 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 DNA-directed RNA polymerase, insert domain 4oirA02
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 4oirA01
4LK0A 4YFXA 4AYBL 3M4OK 4XSXA 5IYCC 4KN4A 2NVYK 4BBSK 4A3KK 4A3MC 4A3IC 2E2JC 5IYDK 3GTQC 3M3YC 2O5JA 3S17C 2Y0SL 4G7HA 4A3BK 4OIPA 3PO3C 2YU9K 5M3FK 3K7AC 2NVQK 1Y1VK 4G7OA 3GTKK 4KN7A 3S2DK 3S2HC 4AYBD 2R93C 2WB1L 4BY1C 4LK1A 2BE5A 4XSZA 5IP9C 2NVXK 4BY7C 3GTPC 2Y0SD 1K83K 2R93K 4C2MC 4BBRK 3HOXK 1I6HK 5C3EK 3HOZK 1SFOK 1TWCK 4BXXK 4QJVA 4A3DC 1TWHK 3H0GK 4A93K 4QIWL 4A3LC 2JA8C 3S1QK 3GTMC 1Y1WK 4JK1A 4OINA 4C3IC 3FKIC 2NVTC 3HOUC 4YFKA 1WCMK 4G7ZA 5M5WK 4A3JK 3GTLK 1R9TC 2PPBA 3RZOK 3S1MK 3S1NK 1TWAC 5IP7C 3HOVC 1I50C 4QIWD 3GTGK 5C44K 5M3MK 2PMZL 2R7ZC 4Q5SA 5FLMK 3CQZC 3GTLC 4Y7NK 3GTJK 4MEXA 1HQMA 2NVYC 4A3KC 2VUMC 4C3HK 3S1RK 2E2HK 4MQ9A 1IW7A 5IYBC 3HOYC 3I4MK 2YU9C 4Y52C 1Y1VC 2WAQL 4C3JK 3S2DC 1ZYRA 3S16C 5IYCK 2O5IA 2R92C 2E2JK 4A3IK 3RZDK 2JA6K 3GTQK 2WB1D 3M3YK 4Q4ZA 4A3GC 3HOWC 3WODA 4GZYA 3EQLA 4BBRC 1TWGK 4A3EC 2JA5K 3PO3K 5C3EC 3HOZC 2WAQD 1TWFC 3DXJA 3I4NC 2A6EA 3H0GC 4A3FC 4KMUA 5C4JK 2PA8L 5FJ8K 1I3QC 4LJZA 4BY1K 5IP9K 4YG2A 4QJVB 4BY7K 3S14C 1WCMC 5D4DA 3S15C 4X6AC 4A3JC 3RZOC 2JA7C 5TMCA 5C4XK 3H3VL 3GTOK 2A6HA 3M4OC 4BBSC 4A3DK 5IYDC 1YNNA 4A3LK 5C44C 2JA8K 4XLPA 3GTMK 5FLMC 2A69A 4Y7NC 4A3BC 4OIOA 3PO2K 2E2IK 4C3IK 5M5YK 2NVTK 4A3CK 2PMZD 2NVQC 1R9TK 4OIQA 4C3HC 3GTKC 3H3VD 2B63K 1BDFA 3S1RC 1SMYA 4MEYA 1TWAK 3HKZL 5IP7K 2NVXC 1I50K 4A3MK 1YNJA 1K83C 4LLGA 3S17K 3CQZK 3HOXC 1I6HC 3K7AK 2JA6C 3RZDC 1SFOC 2VUMK 1TWCC 4BXXC 4A93C 3S2HK 1TWHC 3HKZD 4YFNA 1TWGC 3S1QC 2JA5C 5IYBK 3HOYK 1I6VA 1Y1WC 3GTPK 2CW0A 4ZH4A 4Y52K 4C2MK 3S1MC 3S16K 5C4JC 2R92K 3S1NC 2PA8D 4A3GK 3HOWK 3GTGC 3GTJC 4OIRA 5TMFA 4A3EK 5C4XC 3GTOC 4NOIA 3FKIK 3HOUK 1TWFK 3I4NK 4A3FK 1I3QK 2E2HC 2A68A 4XLNA 3PO2C 2E2IC 3I4MC 1XPPA 5M5XK 4A3CC 3HOVK 3S14K 3S15K 4X6AK 2JA7K 2R7ZK 2B63C 4C3JC
chains in the Genus database with same CATH superfamily
3L4JA 4XSXA 4KN4A 4P5AA 4A3KK 3GEHA 3S17C 1PJ5A 4A3BK 4OIPA 5EGEA 3K7AC 1WQGA 4AYBD 2R93C 2WB1L 3OPFA 4XSZA 4KMDA 2Y0SD 2KXYA 4BXXK 4A93K 1JOEA 2JA5A 4RMFA 4C3IC 4YFKA 4A3JK 1R9TC 1O25A 1X31C 4KDDA 1J6XA 1USMA 3GTGK 3GTJK 2R7ZC 4Q5SA 2GSUA 4WJ4A 1HQMA 4U67S 3GTMA 3HOYC 3NUHA 1IS1A 1Y1VC 1BJTA 3S2DC 2GSNA 1DCHA 2FQOA 1ZXOA 5TJ3A 1GE9A 2R92C 1TWAA 4A3IK 3RZDK 3GTQK 3M3YK 3V4GA 1TWGK 3EQLA 3CQZA 4BKWA 4WF9S 5C3EC 1O2BA 3H0GC 3PIPS 5FJ8K 1I3QC 4QJVB 1WCMC 3S15C 3AD7C 3HXAA 3RZOC 5TMCA 1ISEA 3GTOK 4BBSC 2KQ1A 1YNNA 4A3LK 2JA8K 5FLMC 4PABA 2NVTK 4A3CK 2PMZD 4OIQA 3GTKC 1TWFA 2B63K 4MEYA 5DM7S 2P8TA 3LAJA 4LLGA 3HOXC 3GTLA 1I6HC 3LPXA 3LAPA 4KB2A 4KM8A 3S2HK 1EI6A 3HKZD 3S1QC 1VH2A 2JA5C 1Y1WC 1WORA 3GTPK 4ZH4A 3AD8C 3S16K 1YX2A 4GTBA 2PA8D 4A3GK 2Y3PA 3FKIK 2E2HC 4XLNA 3PO2C 3S14K 3I4MC 3HOVK 4X6AK 1O2AA 5HL7S 1USOA 2NVYK 4DDQA 2L5NA 5IYDK 4G0VA 1O26A 3GTGA 4G7HA 3PO3C 1WQHA 2NVQK 3A8JA 4G7OA 4KN7A 4BY1C 5DM6S 4LK1A 2BE5A 5IP9C 2NVXK 1K83K 4C2MC 4BBRK 4G0UA 3HOZK 1SFOK 1TWCK 4QJVA 4A3DC 1PJ7A 5JVGS 1TWGA 1DD5A 4JK1A 1O24A 4GTAA 2JH3A 4G7ZA 1WOPA 3S0XA 3GEEA 5IP7C 5E68A 1I50C 4QIWD 2ZJPS 3QX3A 2PMZL 4Y7NK 3GTLC 2ZUEA 3GTOA 4A3KC 1L0WA 2VUMC 4C3HK 1IW7A 2D6FC 4Y52C 4P5BA 3T02A 2WAQL 4C3JK 1ZYRA 2B63A 3SZYA 1XXBA 3BUEA 3OEPA 3WODA 4IOCS 4A3EC 1B4BA 4KMAA 3DXJA 2R93K 5C4JK 2PA8L 5EGHA 2XCRB 3AH5A 5CJ9A 3GTPA 4A3JC 2JA7C 1B4AA 1XZQB 4WFAS 1DCOA 3A8KA 3H3VL 3M4OC 1F7UA 1WOOA 2A69A 4KARA 4OIOA 2E2IK 4C3IK 3FKIA 2XCOA 1R9TK 5HL8A 1IQ0A 4A3MK 1YNJA 4KC6A 1ZBSA 3GSIA 4M1XA 3RZDC 2NVYA 4C45A 1TWHC 4GTFA 1TWGC 3N0BA 2GAGC 4BLBA 3HOYK 1I6VA 2V6SA 1VJEA 2GAHC 3S1MC 2ZUFA 3G4CA 1EK8A 2R92K 3S1NC 2NVXA 5TMFA 3GTOC 4NOIA 2W7VA 3HOUK 1SFOA 1TWCA 1I3QK 2A68A 3S15K 1J6WA 2ZJQS 4A3CC 2B63C 4LK0A 4AYBL 1WOSA 5IYCC 4BBSK 2E2JC 1WSVA 2Y0SL 4BLAA 3N0CA 4FM9A 2YU9K 5M3FK 4KMHA 3GTKK 1EQRA 1BGWA 3S2HC 4BY7C 3GTPC 4KASA 4LOWA 3HOXK 1EFWA 1I6HK 4WCES 1VRQC 1IBAA 3S1QK 3GTMC 1Y1WK 4OINA 3FKIC 3MMLB 1G51A 3FOFA 3GTLK 3GIRA 3Q3QA 2R93A 4WILA 1TWAC 3G4AA 3HOVC 1INNA 5C44K 5M3MK 3CQZC 4WFNS 3GTJA 4P9SA 4MEXA 2NVYC 3T00A 2GSOA 3S1RK 2E2HK 4PAAA 4KB4A 5IYBC 3I4MK 2E2IA 1WQFA 1R9TA 4ILDA 4O2DA 2O5IA 4GTLA 3ADAC 1F7VA 4LR2A 2JA6K 4Q4ZA 3HOWC 4GZYA 3GTQA 4BBRC 1ZQ1C 3PO3K 2PHCB 1HI9A 3AD9C 3HOZC 3FHZA 1TWFC 3I4NC 2A6EA 4A3FC 4BY1K 5IP9K 4YG2A 1BS2A 2CFAB 4GFQA 5D4DA 4WFBS 5C4XK 1O2FB 2A6HA 1XZPB 4A3DK 4XCHA 4XLPA 4Y7NC 4A3BC 3N3YA 3GDZA 4LQYA 3CAGA 5M5YK 4C3HC 4KATA 1SMYA 5HQHA 3HKZL 1I3QA 5IP7K 1I50K 3S17K 2ZJRS 2FQTA 3OREA 3K7AK 2VUMK 1F9NA 1WSRA 4BXXC 4A93C 4YFNA 3PIOS 1FEUA 3SZZA 4Y52K 2YU9A 4GTEA 1WIHA 3GTKA 5C4JC 1O27A 3DLLS 1F93A 4GT9A 3GTGC 3GTJC 2KWAA 4A3EK 1AB4A 2E2IC 1XPPA 1Y1WA 1IL2A 5IOSA 2JA7K 1EH1A 2R7ZK 4YFXA 3M4OK 3BP8C 4A3MC 4A3IC 3GTQC 3M3YC 2O5JA 2V6TA 1IE0A 3A8IA 3ERED 2KPUA 1Y1VK 3S2DK 2E2HA 3TFIA 1J6VA 3TTGA 1K83A 2XCQA 5C3EK 3T01A 2CFAA 5CHPA 3H0GK 1TWHK 2JA6A 4QIWL 4A3LC 2JA8C 3HOUC 1WCMK 2NVTC 1UV7A 1XZPA 5M5WK 1XXAA 3RZOK 4J3NA 2PPBA 3S1MK 5JVHS 3S1NK 1J98A 1VGXA 5FLMK 3TFJA 4KAWX 3FOEA 1O29A 3JSTA 4WJ3M 1DCPA 4MQ9A 1JQWA 2YU9C 2P5MA 4IOAS 4AH6A 3LYWA 3S16C 5IYCK 1RU0A 2E2JK 2WB1D 1I50A 4A3GC 2V6UA 2JA5K 4GTDA 1XZQA 2WAQD 1ZVUA 2VUMA 4KMUA 4LJZA 2RH6A 1YCLA 3L4KA 4BY7K 3S14C 4X6AC 1XXCA 5L46A 1JVIA 2ZFZA 1KQ4A 3CF5S 4KM9A 5IYDC 3BP3A 4FZBA 5JVOA 5C44C 3GTMK 2L3UA 3PO2K 1VLOA 5IOTA 2NVQC 3H3VD 3IPJA 1BDFA 3S1RC 1TWAK 2NVXC 5IORA 3VA7A 1K83C 3CQZK 5JFEA 2JA7A 2R7ZA 4G0WA 2RGRA 1O28A 2EBBA 2JA6C 1SFOC 1TWCC 3GEIA 5IOQA 4IO9S 5IYBK 2CW0A 3AQPA 4C2MK 1Y1VA 1V5VA 2R92A 3HOWK 4OIRA 5C4XC 1PJ6A 1TWFK 3AQOA 3I4NK 4A3FK 3TFHA 3H0GA 1TWHA 4GTCA 5M5XK 1WCMA 1C0AA 4C3JC
chains in the Genus database with same CATH topology
4LK0A 4YFXA 4AYBL 3M4OK 4XSXA 5IYCC 4KN4A 2NVYK 4BBSK 4A3KK 4A3MC 4A3IC 2E2JC 5IYDK 3GTQC 3M3YC 2O5JA 3S17C 2Y0SL 4G7HA 4A3BK 4OIPA 3PO3C 2YU9K 5M3FK 3K7AC 2NVQK 1Y1VK 4G7OA 3GTKK 4KN7A 3S2DK 3S2HC 4AYBD 2R93C 2WB1L 4BY1C 4LK1A 2BE5A 4XSZA 5IP9C 2NVXK 4BY7C 3GTPC 2Y0SD 1K83K 2R93K 4C2MC 4BBRK 3HOXK 1I6HK 5C3EK 3HOZK 1SFOK 1TWCK 4BXXK 4QJVA 4A3DC 1TWHK 3H0GK 4A93K 4QIWL 4A3LC 2JA8C 3S1QK 3GTMC 1Y1WK 4JK1A 4OINA 4C3IC 3FKIC 2NVTC 3HOUC 4YFKA 1WCMK 4G7ZA 5M5WK 4A3JK 3GTLK 1R9TC 2PPBA 3RZOK 3S1MK 3S1NK 1TWAC 5IP7C 3HOVC 1I50C 4QIWD 3GTGK 5C44K 5M3MK 2PMZL 2R7ZC 4Q5SA 5FLMK 3CQZC 3GTLC 4Y7NK 3GTJK 4MEXA 1HQMA 2NVYC 4A3KC 2VUMC 4C3HK 3S1RK 2E2HK 4MQ9A 1IW7A 5IYBC 3HOYC 3I4MK 2YU9C 4Y52C 1Y1VC 2WAQL 4C3JK 3S2DC 1ZYRA 3S16C 5IYCK 2O5IA 2R92C 2E2JK 4A3IK 3RZDK 2JA6K 3GTQK 2WB1D 3M3YK 4Q4ZA 4A3GC 3HOWC 3WODA 4GZYA 3EQLA 4BBRC 1TWGK 4A3EC 2JA5K 3PO3K 5C3EC 3HOZC 2WAQD 1TWFC 3DXJA 3I4NC 2A6EA 3H0GC 4A3FC 4KMUA 5C4JK 2PA8L 5FJ8K 1I3QC 4LJZA 4BY1K 5IP9K 4YG2A 4QJVB 4BY7K 3S14C 1WCMC 5D4DA 3S15C 4X6AC 4A3JC 3RZOC 2JA7C 5TMCA 5C4XK 3H3VL 3GTOK 2A6HA 3M4OC 4BBSC 4A3DK 5IYDC 1YNNA 4A3LK 5C44C 2JA8K 4XLPA 3GTMK 5FLMC 2A69A 4Y7NC 4A3BC 4OIOA 3PO2K 2E2IK 4C3IK 5M5YK 2NVTK 4A3CK 2PMZD 2NVQC 1R9TK 4OIQA 4C3HC 3GTKC 3H3VD 2B63K 1BDFA 3S1RC 1SMYA 4MEYA 1TWAK 3HKZL 5IP7K 2NVXC 1I50K 4A3MK 1YNJA 1K83C 4LLGA 3S17K 3CQZK 3HOXC 1I6HC 3K7AK 2JA6C 3RZDC 1SFOC 2VUMK 1TWCC 4BXXC 4A93C 3S2HK 1TWHC 3HKZD 4YFNA 1TWGC 3S1QC 2JA5C 5IYBK 3HOYK 1I6VA 1Y1WC 3GTPK 2CW0A 4ZH4A 4Y52K 4C2MK 3S1MC 3S16K 5C4JC 2R92K 3S1NC 2PA8D 4A3GK 3HOWK 3GTGC 3GTJC 4OIRA 5TMFA 4A3EK 5C4XC 3GTOC 4NOIA 3FKIK 3HOUK 1TWFK 3I4NK 4A3FK 1I3QK 2E2HC 2A68A 4XLNA 3PO2C 2E2IC 3I4MC 1XPPA 5M5XK 4A3CC 3HOVK 3S14K 3S15K 4X6AK 2JA7K 2R7ZK 2B63C 4C3JC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LK0 A;  4YFX A;  4AYB L;  3M4O K;  4XSX A;  5IYC C;  4KN4 A;  2NVY K;  4BBS K;  4A3K K;  4A3M C;  4A3I C;  2E2J C;  5IYD K;  3GTQ C;  3M3Y C;  2O5J A;  3S17 C;  2Y0S L;  4G7H A;  4A3B K;  4OIP A;  3PO3 C;  2YU9 K;  5M3F K;  3K7A C;  2NVQ K;  1Y1V K;  4G7O A;  3GTK K;  4KN7 A;  3S2D K;  3S2H C;  4AYB D;  2R93 C;  2WB1 L;  4BY1 C;  4LK1 A;  2BE5 A;  4XSZ A;  5IP9 C;  2NVX K;  4BY7 C;  3GTP C;  2Y0S D;  1K83 K;  2R93 K;  4C2M C;  4BBR K;  3HOX K;  1I6H K;  5C3E K;  3HOZ K;  1SFO K;  1TWC K;  4BXX K;  4QJV A;  4A3D C;  1TWH K;  3H0G K;  4A93 K;  4QIW L;  4A3L C;  2JA8 C;  3S1Q K;  3GTM C;  1Y1W K;  4JK1 A;  4OIN A;  4C3I C;  3FKI C;  2NVT C;  3HOU C;  4YFK A;  1WCM K;  4G7Z A;  5M5W K;  4A3J K;  3GTL K;  1R9T C;  2PPB A;  3RZO K;  3S1M K;  3S1N K;  1TWA C;  5IP7 C;  3HOV C;  1I50 C;  4QIW D;  3GTG K;  5C44 K;  5M3M K;  2PMZ L;  2R7Z C;  4Q5S A;  5FLM K;  3CQZ C;  3GTL C;  4Y7N K;  3GTJ K;  4MEX A;  1HQM A;  2NVY C;  4A3K C;  2VUM C;  4C3H K;  3S1R K;  2E2H K;  4MQ9 A;  1IW7 A;  5IYB C;  3HOY C;  3I4M K;  2YU9 C;  4Y52 C;  1Y1V C;  2WAQ L;  4C3J K;  3S2D C;  1ZYR A;  3S16 C;  5IYC K;  2O5I A;  2R92 C;  2E2J K;  4A3I K;  3RZD K;  2JA6 K;  3GTQ K;  2WB1 D;  3M3Y K;  4Q4Z A;  4A3G C;  3HOW C;  3WOD A;  4GZY A;  3EQL A;  4BBR C;  1TWG K;  4A3E C;  2JA5 K;  3PO3 K;  5C3E C;  3HOZ C;  2WAQ D;  1TWF C;  3DXJ A;  3I4N C;  2A6E A;  3H0G C;  4A3F C;  4KMU A;  5C4J K;  2PA8 L;  5FJ8 K;  1I3Q C;  4LJZ A;  4BY1 K;  5IP9 K;  4YG2 A;  4QJV B;  4BY7 K;  3S14 C;  1WCM C;  5D4D A;  3S15 C;  4X6A C;  4A3J C;  3RZO C;  2JA7 C;  5TMC A;  5C4X K;  3H3V L;  3GTO K;  2A6H A;  3M4O C;  4BBS C;  4A3D K;  5IYD C;  1YNN A;  4A3L K;  5C44 C;  2JA8 K;  4XLP A;  3GTM K;  5FLM C;  2A69 A;  4Y7N C;  4A3B C;  4OIO A;  3PO2 K;  2E2I K;  4C3I K;  5M5Y K;  2NVT K;  4A3C K;  2PMZ D;  2NVQ C;  1R9T K;  4OIQ A;  4C3H C;  3GTK C;  3H3V D;  2B63 K;  1BDF A;  3S1R C;  1SMY A;  4MEY A;  1TWA K;  3HKZ L;  5IP7 K;  2NVX C;  1I50 K;  4A3M K;  1YNJ A;  1K83 C;  4LLG A;  3S17 K;  3CQZ K;  3HOX C;  1I6H C;  3K7A K;  2JA6 C;  3RZD C;  1SFO C;  2VUM K;  1TWC C;  4BXX C;  4A93 C;  3S2H K;  1TWH C;  3HKZ D;  4YFN A;  1TWG C;  3S1Q C;  2JA5 C;  5IYB K;  3HOY K;  1I6V A;  1Y1W C;  3GTP K;  2CW0 A;  4ZH4 A;  4Y52 K;  4C2M K;  3S1M C;  3S16 K;  5C4J C;  2R92 K;  3S1N C;  2PA8 D;  4A3G K;  3HOW K;  3GTG C;  3GTJ C;  4OIR A;  5TMF A;  4A3E K;  5C4X C;  3GTO C;  4NOI A;  3FKI K;  3HOU K;  1TWF K;  3I4N K;  4A3F K;  1I3Q K;  2E2H C;  2A68 A;  4XLN A;  3PO2 C;  2E2I C;  3I4M C;  1XPP A;  5M5X K;  4A3C C;  3HOV K;  3S14 K;  3S15 K;  4X6A K;  2JA7 K;  2R7Z K;  2B63 C;  4C3J C; 
#chains in the Genus database with same CATH topology
 3L4J A;  4XSX A;  4KN4 A;  4P5A A;  4A3K K;  3GEH A;  3S17 C;  1PJ5 A;  4A3B K;  4OIP A;  5EGE A;  3K7A C;  1WQG A;  4AYB D;  2R93 C;  2WB1 L;  3OPF A;  4XSZ A;  4KMD A;  2Y0S D;  2KXY A;  4BXX K;  4A93 K;  1JOE A;  2JA5 A;  4RMF A;  4C3I C;  4YFK A;  4A3J K;  1R9T C;  1O25 A;  1X31 C;  4KDD A;  1J6X A;  1USM A;  3GTG K;  3GTJ K;  2R7Z C;  4Q5S A;  2GSU A;  4WJ4 A;  1HQM A;  4U67 S;  3GTM A;  3HOY C;  3NUH A;  1IS1 A;  1Y1V C;  1BJT A;  3S2D C;  2GSN A;  1DCH A;  2FQO A;  1ZXO A;  5TJ3 A;  1GE9 A;  2R92 C;  1TWA A;  4A3I K;  3RZD K;  3GTQ K;  3M3Y K;  3V4G A;  1TWG K;  3EQL A;  3CQZ A;  4BKW A;  4WF9 S;  5C3E C;  1O2B A;  3H0G C;  3PIP S;  5FJ8 K;  1I3Q C;  4QJV B;  1WCM C;  3S15 C;  3AD7 C;  3HXA A;  3RZO C;  5TMC A;  1ISE A;  3GTO K;  4BBS C;  2KQ1 A;  1YNN A;  4A3L K;  2JA8 K;  5FLM C;  4PAB A;  2NVT K;  4A3C K;  2PMZ D;  4OIQ A;  3GTK C;  1TWF A;  2B63 K;  4MEY A;  5DM7 S;  2P8T A;  3LAJ A;  4LLG A;  3HOX C;  3GTL A;  1I6H C;  3LPX A;  3LAP A;  4KB2 A;  4KM8 A;  3S2H K;  1EI6 A;  3HKZ D;  3S1Q C;  1VH2 A;  2JA5 C;  1Y1W C;  1WOR A;  3GTP K;  4ZH4 A;  3AD8 C;  3S16 K;  1YX2 A;  4GTB A;  2PA8 D;  4A3G K;  2Y3P A;  3FKI K;  2E2H C;  4XLN A;  3PO2 C;  3S14 K;  3I4M C;  3HOV K;  4X6A K;  1O2A A;  5HL7 S;  1USO A;  2NVY K;  4DDQ A;  2L5N A;  5IYD K;  4G0V A;  1O26 A;  3GTG A;  4G7H A;  3PO3 C;  1WQH A;  2NVQ K;  3A8J A;  4G7O A;  4KN7 A;  4BY1 C;  5DM6 S;  4LK1 A;  2BE5 A;  5IP9 C;  2NVX K;  1K83 K;  4C2M C;  4BBR K;  4G0U A;  3HOZ K;  1SFO K;  1TWC K;  4QJV A;  4A3D C;  1PJ7 A;  5JVG S;  1TWG A;  1DD5 A;  4JK1 A;  1O24 A;  4GTA A;  2JH3 A;  4G7Z A;  1WOP A;  3S0X A;  3GEE A;  5IP7 C;  5E68 A;  1I50 C;  4QIW D;  2ZJP S;  3QX3 A;  2PMZ L;  4Y7N K;  3GTL C;  2ZUE A;  3GTO A;  4A3K C;  1L0W A;  2VUM C;  4C3H K;  1IW7 A;  2D6F C;  4Y52 C;  4P5B A;  3T02 A;  2WAQ L;  4C3J K;  1ZYR A;  2B63 A;  3SZY A;  1XXB A;  3BUE A;  3OEP A;  3WOD A;  4IOC S;  4A3E C;  1B4B A;  4KMA A;  3DXJ A;  2R93 K;  5C4J K;  2PA8 L;  5EGH A;  2XCR B;  3AH5 A;  5CJ9 A;  3GTP A;  4A3J C;  2JA7 C;  1B4A A;  1XZQ B;  4WFA S;  1DCO A;  3A8K A;  3H3V L;  3M4O C;  1F7U A;  1WOO A;  2A69 A;  4KAR A;  4OIO A;  2E2I K;  4C3I K;  3FKI A;  2XCO A;  1R9T K;  5HL8 A;  1IQ0 A;  4A3M K;  1YNJ A;  4KC6 A;  1ZBS A;  3GSI A;  4M1X A;  3RZD C;  2NVY A;  4C45 A;  1TWH C;  4GTF A;  1TWG C;  3N0B A;  2GAG C;  4BLB A;  3HOY K;  1I6V A;  2V6S A;  1VJE A;  2GAH C;  3S1M C;  2ZUF A;  3G4C A;  1EK8 A;  2R92 K;  3S1N C;  2NVX A;  5TMF A;  3GTO C;  4NOI A;  2W7V A;  3HOU K;  1SFO A;  1TWC A;  1I3Q K;  2A68 A;  3S15 K;  1J6W A;  2ZJQ S;  4A3C C;  2B63 C;  4LK0 A;  4AYB L;  1WOS A;  5IYC C;  4BBS K;  2E2J C;  1WSV A;  2Y0S L;  4BLA A;  3N0C A;  4FM9 A;  2YU9 K;  5M3F K;  4KMH A;  3GTK K;  1EQR A;  1BGW A;  3S2H C;  4BY7 C;  3GTP C;  4KAS A;  4LOW A;  3HOX K;  1EFW A;  1I6H K;  4WCE S;  1VRQ C;  1IBA A;  3S1Q K;  3GTM C;  1Y1W K;  4OIN A;  3FKI C;  3MML B;  1G51 A;  3FOF A;  3GTL K;  3GIR A;  3Q3Q A;  2R93 A;  4WIL A;  1TWA C;  3G4A A;  3HOV C;  1INN A;  5C44 K;  5M3M K;  3CQZ C;  4WFN S;  3GTJ A;  4P9S A;  4MEX A;  2NVY C;  3T00 A;  2GSO A;  3S1R K;  2E2H K;  4PAA A;  4KB4 A;  5IYB C;  3I4M K;  2E2I A;  1WQF A;  1R9T A;  4ILD A;  4O2D A;  2O5I A;  4GTL A;  3ADA C;  1F7V A;  4LR2 A;  2JA6 K;  4Q4Z A;  3HOW C;  4GZY A;  3GTQ A;  4BBR C;  1ZQ1 C;  3PO3 K;  2PHC B;  1HI9 A;  3AD9 C;  3HOZ C;  3FHZ A;  1TWF C;  3I4N C;  2A6E A;  4A3F C;  4BY1 K;  5IP9 K;  4YG2 A;  1BS2 A;  2CFA B;  4GFQ A;  5D4D A;  4WFB S;  5C4X K;  1O2F B;  2A6H A;  1XZP B;  4A3D K;  4XCH A;  4XLP A;  4Y7N C;  4A3B C;  3N3Y A;  3GDZ A;  4LQY A;  3CAG A;  5M5Y K;  4C3H C;  4KAT A;  1SMY A;  5HQH A;  3HKZ L;  1I3Q A;  5IP7 K;  1I50 K;  3S17 K;  2ZJR S;  2FQT A;  3ORE A;  3K7A K;  2VUM K;  1F9N A;  1WSR A;  4BXX C;  4A93 C;  4YFN A;  3PIO S;  1FEU A;  3SZZ A;  4Y52 K;  2YU9 A;  4GTE A;  1WIH A;  3GTK A;  5C4J C;  1O27 A;  3DLL S;  1F93 A;  4GT9 A;  3GTG C;  3GTJ C;  2KWA A;  4A3E K;  1AB4 A;  2E2I C;  1XPP A;  1Y1W A;  1IL2 A;  5IOS A;  2JA7 K;  1EH1 A;  2R7Z K;  4YFX A;  3M4O K;  3BP8 C;  4A3M C;  4A3I C;  3GTQ C;  3M3Y C;  2O5J A;  2V6T A;  1IE0 A;  3A8I A;  3ERE D;  2KPU A;  1Y1V K;  3S2D K;  2E2H A;  3TFI A;  1J6V A;  3TTG A;  1K83 A;  2XCQ A;  5C3E K;  3T01 A;  2CFA A;  5CHP A;  3H0G K;  1TWH K;  2JA6 A;  4QIW L;  4A3L C;  2JA8 C;  3HOU C;  1WCM K;  2NVT C;  1UV7 A;  1XZP A;  5M5W K;  1XXA A;  3RZO K;  4J3N A;  2PPB A;  3S1M K;  5JVH S;  3S1N K;  1J98 A;  1VGX A;  5FLM K;  3TFJ A;  4KAW X;  3FOE A;  1O29 A;  3JST A;  4WJ3 M;  1DCP A;  4MQ9 A;  1JQW A;  2YU9 C;  2P5M A;  4IOA S;  4AH6 A;  3LYW A;  3S16 C;  5IYC K;  1RU0 A;  2E2J K;  2WB1 D;  1I50 A;  4A3G C;  2V6U A;  2JA5 K;  4GTD A;  1XZQ A;  2WAQ D;  1ZVU A;  2VUM A;  4KMU A;  4LJZ A;  2RH6 A;  1YCL A;  3L4K A;  4BY7 K;  3S14 C;  4X6A C;  1XXC A;  5L46 A;  1JVI A;  2ZFZ A;  1KQ4 A;  3CF5 S;  4KM9 A;  5IYD C;  3BP3 A;  4FZB A;  5JVO A;  5C44 C;  3GTM K;  2L3U A;  3PO2 K;  1VLO A;  5IOT A;  2NVQ C;  3H3V D;  3IPJ A;  1BDF A;  3S1R C;  1TWA K;  2NVX C;  5IOR A;  3VA7 A;  1K83 C;  3CQZ K;  5JFE A;  2JA7 A;  2R7Z A;  4G0W A;  2RGR A;  1O28 A;  2EBB A;  2JA6 C;  1SFO C;  1TWC C;  3GEI A;  5IOQ A;  4IO9 S;  5IYB K;  2CW0 A;  3AQP A;  4C2M K;  1Y1V A;  1V5V A;  2R92 A;  3HOW K;  4OIR A;  5C4X C;  1PJ6 A;  1TWF K;  3AQO A;  3I4N K;  4A3F K;  3TFH A;  3H0G A;  1TWH A;  4GTC A;  5M5X K;  1WCM A;  1C0A A;  4C3J C; 
#chains in the Genus database with same CATH homology
 4LK0 A;  4YFX A;  4AYB L;  3M4O K;  4XSX A;  5IYC C;  4KN4 A;  2NVY K;  4BBS K;  4A3K K;  4A3M C;  4A3I C;  2E2J C;  5IYD K;  3GTQ C;  3M3Y C;  2O5J A;  3S17 C;  2Y0S L;  4G7H A;  4A3B K;  4OIP A;  3PO3 C;  2YU9 K;  5M3F K;  3K7A C;  2NVQ K;  1Y1V K;  4G7O A;  3GTK K;  4KN7 A;  3S2D K;  3S2H C;  4AYB D;  2R93 C;  2WB1 L;  4BY1 C;  4LK1 A;  2BE5 A;  4XSZ A;  5IP9 C;  2NVX K;  4BY7 C;  3GTP C;  2Y0S D;  1K83 K;  2R93 K;  4C2M C;  4BBR K;  3HOX K;  1I6H K;  5C3E K;  3HOZ K;  1SFO K;  1TWC K;  4BXX K;  4QJV A;  4A3D C;  1TWH K;  3H0G K;  4A93 K;  4QIW L;  4A3L C;  2JA8 C;  3S1Q K;  3GTM C;  1Y1W K;  4JK1 A;  4OIN A;  4C3I C;  3FKI C;  2NVT C;  3HOU C;  4YFK A;  1WCM K;  4G7Z A;  5M5W K;  4A3J K;  3GTL K;  1R9T C;  2PPB A;  3RZO K;  3S1M K;  3S1N K;  1TWA C;  5IP7 C;  3HOV C;  1I50 C;  4QIW D;  3GTG K;  5C44 K;  5M3M K;  2PMZ L;  2R7Z C;  4Q5S A;  5FLM K;  3CQZ C;  3GTL C;  4Y7N K;  3GTJ K;  4MEX A;  1HQM A;  2NVY C;  4A3K C;  2VUM C;  4C3H K;  3S1R K;  2E2H K;  4MQ9 A;  1IW7 A;  5IYB C;  3HOY C;  3I4M K;  2YU9 C;  4Y52 C;  1Y1V C;  2WAQ L;  4C3J K;  3S2D C;  1ZYR A;  3S16 C;  5IYC K;  2O5I A;  2R92 C;  2E2J K;  4A3I K;  3RZD K;  2JA6 K;  3GTQ K;  2WB1 D;  3M3Y K;  4Q4Z A;  4A3G C;  3HOW C;  3WOD A;  4GZY A;  3EQL A;  4BBR C;  1TWG K;  4A3E C;  2JA5 K;  3PO3 K;  5C3E C;  3HOZ C;  2WAQ D;  1TWF C;  3DXJ A;  3I4N C;  2A6E A;  3H0G C;  4A3F C;  4KMU A;  5C4J K;  2PA8 L;  5FJ8 K;  1I3Q C;  4LJZ A;  4BY1 K;  5IP9 K;  4YG2 A;  4QJV B;  4BY7 K;  3S14 C;  1WCM C;  5D4D A;  3S15 C;  4X6A C;  4A3J C;  3RZO C;  2JA7 C;  5TMC A;  5C4X K;  3H3V L;  3GTO K;  2A6H A;  3M4O C;  4BBS C;  4A3D K;  5IYD C;  1YNN A;  4A3L K;  5C44 C;  2JA8 K;  4XLP A;  3GTM K;  5FLM C;  2A69 A;  4Y7N C;  4A3B C;  4OIO A;  3PO2 K;  2E2I K;  4C3I K;  5M5Y K;  2NVT K;  4A3C K;  2PMZ D;  2NVQ C;  1R9T K;  4OIQ A;  4C3H C;  3GTK C;  3H3V D;  2B63 K;  1BDF A;  3S1R C;  1SMY A;  4MEY A;  1TWA K;  3HKZ L;  5IP7 K;  2NVX C;  1I50 K;  4A3M K;  1YNJ A;  1K83 C;  4LLG A;  3S17 K;  3CQZ K;  3HOX C;  1I6H C;  3K7A K;  2JA6 C;  3RZD C;  1SFO C;  2VUM K;  1TWC C;  4BXX C;  4A93 C;  3S2H K;  1TWH C;  3HKZ D;  4YFN A;  1TWG C;  3S1Q C;  2JA5 C;  5IYB K;  3HOY K;  1I6V A;  1Y1W C;  3GTP K;  2CW0 A;  4ZH4 A;  4Y52 K;  4C2M K;  3S1M C;  3S16 K;  5C4J C;  2R92 K;  3S1N C;  2PA8 D;  4A3G K;  3HOW K;  3GTG C;  3GTJ C;  4OIR A;  5TMF A;  4A3E K;  5C4X C;  3GTO C;  4NOI A;  3FKI K;  3HOU K;  1TWF K;  3I4N K;  4A3F K;  1I3Q K;  2E2H C;  2A68 A;  4XLN A;  3PO2 C;  2E2I C;  3I4M C;  1XPP A;  5M5X K;  4A3C C;  3HOV K;  3S14 K;  3S15 K;  4X6A K;  2JA7 K;  2R7Z K;  2B63 C;  4C3J C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...