4OIRA

Crystal structure of thermus thermophilus rna polymerase transcription initiation complex soaked with ge23077 and rifamycin sv
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
231
structure length
231
Chain Sequence
SKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQAAAVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase subunit alpha
publication title GE23077 binds to the RNA polymerase 'i' and 'i+1' sites and prevents the binding of initiating nucleotides.
pubmed rcsb
source organism Thermus thermophilus
molecule tags Transcription, transferase/antibiotic
total genus 49
structure length 231
sequence length 231
chains with identical sequence B
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2014-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01000 RNA_pol_A_bac RNA polymerase Rpb3/RpoA insert domain
A PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.12 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 DNA-directed RNA polymerase, insert domain 4oirA02
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 4oirA01
2BE5A 2A6HA 4A93C 4XSXA 4A3IC 1Y1WK 1I3QC 5IYBK 3S17C 1TWFC 1I6HK 4MEXA 3M4OC 3K7AC 4C3JC 2NVQC 4BXXC 1YNNA 2NVXC 2E2HC 2NVYK 3EQLA 4KN4A 4LLGA 3H0GK 3GTKC 3S1MC 4G7OA 3GTPK 4YFKA 4BBRC 3M3YC 4A3GC 1K83C 3S15C 4A3CC 4X6AC 3GTLC 4G7ZA 1I6VA 2O5IA 2WAQL 4A3FK 4A3KK 4QJVB 3I4MC 4OINA 5TMCA 2JA6C 3H3VD 3S1QC 3S2DC 5M5WK 3HOZK 4AYBD 3HKZD 3S1NC 1I3QK 1TWCC 1R9TC 2E2JC 3S17K 2JA8C 5C3EC 4QIWL 2R7ZC 1I50K 3S14C 1TWGK 4A3JK 1WCMC 3GTMC 4XLNA 2R93C 2PPBA 4BBSK 3CQZC 2JA5C 4C3HK 1XPPA 2YU9C 2Y0SD 3RZDK 4C2MK 3S2HC 3RZOC 3DXJA 3FKIC 3S16C 1K83K 4A3EC 4GZYA 4NOIA 3S1RC 3GTOK 1TWAC 3GTQK 3WODA 2WB1D 4KMUA 5IP7C 3HOXC 3GTGK 3HOVK 1YNJA 1TWHC 2A69A 2JA6K 2CW0A 4QJVA 3HOYK 4LK1A 5C4JC 4Y52C 4BY7C 2JA7C 3PO2K 3S14K 1WCMK 5IYDK 5M5YK 4A3DC 4A3MK 2R92C 5C44C 5D4DA 5C4XK 3HOUK 2WAQD 3HOWC 2JA5K 4A3LK 4A3BC 3RZOK 4XSZA 1Y1VK 5FJ8K 4A93K 2VUMC 4BY1C 4A3IK 3PO3C 1TWFK 5IYCC 4YG2A 3K7AK 2NVTC 4C3JK 5M3FK 2NVQK 3M4OK 4BXXK 4JK1A 2E2HK 2NVXK 1IW7A 4OIQA 1HQMA 4YFNA 3GTKK 5FLMC 3S1MK 4BBRK 3M3YK 2E2IC 4BY7K 4OIPA 4A3GK 4OIOA 2B63C 3S15K 4Y7NC 4A3CK 3GTJC 4X6AK 3GTLK 5IP9C 1SFOC 2O5JA 3I4MK 3S1QK 3S2DK 1Y1WC 3I4NC 3PO3K 3S1NK 1I6HC 1TWCK 1R9TK 2E2JK 2JA8K 5C3EK 2NVTK 2R7ZK 2PA8L 2NVYC 4MQ9A 5M3MK 3GTMK 2R93K 3H0GC 3CQZK 4Q5SA 3GTPC 2PMZL 2YU9K 4MEYA 1SMYA 3S2HK 3S16K 3FKIK 4A3EK 3S1RK 1TWAK 5IP9K 4QIWD 5IP7K 3HOXK 4LJZA 4A3KC 4OIRA 1TWHK 3HOZC 5C4JK 3I4NK 4C3IC 2WB1L 5TMFA 4Y52K 1I50C 4KN7A 1BDFA 2JA7K 1TWGC 4A3JC 4BBSC 4A3DK 4C3HC 2R92K 5C44K 4Q4ZA 3RZDC 4C2MC 3HOWK 1ZYRA 4A3BK 4LK0A 2VUMK 4BY1K 3GTOC 5IYBC 4G7HA 3GTQC 3HOVC 5IYCK 2A6EA 3GTGC 2A68A 2PA8D 4XLPA 3HOYC 3H3VL 5M5XK 4AYBL 3HKZL 5FLMK 2PMZD 4C3IK 2E2IK 3PO2C 5IYDC 2B63K 4Y7NK 3GTJK 4A3MC 4ZH4A 4YFXA 3HOUC 5C4XC 1SFOK 2Y0SL 4A3FC 4A3LC 1Y1VC
chains in the Genus database with same CATH superfamily
4XSXA 1I3QC 3S17C 2L3UA 1O25A 2NVYK 3H0GK 3GTKC 4G7OA 4A3GC 3T00A 1V5VA 1K83C 4A3CC 4X6AC 2RGRA 3GTLC 2O5IA 3HXAA 4A3KK 2JA6C 3S2DC 1YCLA 4GTFA 3FOEA 5HL8A 1L0WA 1IBAA 4QIWL 2R7ZC 1I50K 4GFQA 1TWGK 4BBSK 4XLNA 1XXBA 2B63A 1XPPA 2YU9C 3RZDK 3S2HC 1SFOA 3TFHA 1O2FB 3LAJA 3GTOK 3AH5A 3WODA 2WB1D 5IP7C 1O24A 3HOXC 1ZQ1C 3AD7C 3VA7A 1BJTA 5E68A 1VGXA 1ISEA 2CFAB 5C4JC 1WOSA 4GTBA 2ZUEA 4Y52C 2Y3PA 3S14K 4KM9A 3OPFA 4A3MK 2R92C 5C44C 2JA5K 3BUEA 1YX2A 1Y1VK 5FJ8K 2VUMC 4BY1C 4A3IK 3K7AK 4J3NA 4KB2A 4BXXK 4JK1A 1O2AA 2CFAA 3N0CA 3S1MK 1O27A 3G4CA 3TFIA 3S15K 3GTJC 5IP9C 2O5JA 3I4MK 4FM9A 3GTGA 3I4NC 1I6HC 1WQGA 4PAAA 2PA8L 1WCMA 2JH3A 3CQZK 3LAPA 3GTMA 3GTPC 4MEYA 2V6TA 4GT9A 4A3EK 1WOPA 3Q3QA 1TWAK 4QIWD 4LJZA 4OIRA 3LPXA 1TWHA 1G51A 3GEEA 4G0WA 1BDFA 2JA7K 4IO9S 4C3HC 5CJ9A 5HL7S 5L46A 1F7UA 3GTLA 1ZYRA 4LK0A 5IYBC 4BLBA 4RMFA 2A6EA 3TFJA 2R7ZA 1ZBSA 4C3IK 3PO2C 2YU9A 5EGEA 3HOUC 5C4XC 4A3FC 3A8IA 3BP3A 4WJ4A 1Y1WK 2KPUA 3M4OC 1USMA 1J6XA 3M3YC 2R92A 1JVIA 4GTDA 1I6VA 1PJ6A 4A3LK 4QJVB 4OINA 3H3VD 3HOZK 4AYBD 1I3QK 3S1NC 3S17K 1R9TC 2E2JC 2JA8C 2ZFZA 1WCMC 3GTMC 2PPBA 2W7VA 3GTJA 2Y0SD 3RZOC 1K83K 3FHZA 3OEPA 4GZYA 4NOIA 3L4JA 3AQPA 3GTQK 3GTOA 4KMUA 3S0XA 1TWHC 3GEIA 3V4GA 2JA6K 4QJVA 4WCES 1ZXOA 3MMLB 4GTCA 4ILDA 3AD9C 4XCHA 4BY7C 3GTPA 1IS1A 5DM6S 5JFEA 1VJEA 4A3DC 2WAQD 4A3BC 4XSZA 1WQFA 4A93K 3PO3C 2XCRB 1TWFK 5IYCC 4YG2A 1DCPA 5M3FK 4C3JK 2NVQK 2NVXK 2E2HK 1IW7A 5FLMC 4BBRK 2E2IC 3CF5S 2GSNA 1XZQB 2GSOA 1EFWA 3S1QK 4WFBS 1TWCK 5C3EK 2NVYC 5M3MK 3DLLS 3AD8C 3N3YA 2R93K 3H0GC 2KXYA 1O29A 4KB4A 2XCOA 1SMYA 3S16K 3FKIK 3S1RK 1XZQA 1USOA 4GTEA 5IP9K 5IORA 1TWAA 4A3KC 5IOSA 3I4NK 3T01A 1I50C 4KN7A 1TWGC 4BBSC 4BKWA 5HQHA 4KDDA 4Q4ZA 3RZDC 1J6VA 3HOWK 4LQYA 3GTOC 1JQWA 3A8JA 3BP8C 1R9TA 4KC6A 3H3VL 3LYWA 4AYBL 2B63K 4Y7NK 2P5MA 4A3MC 4ZH4A 1SFOK 2ZUFA 4WF9S 2JA5C 2Y0SL 1WOOA 1Y1VC 4A3IC 2P8TA 5IYBK 1F93A 5TJ3A 1Y1WA 1ZVUA 3K7AC 4BXXC 1YNNA 4KN4A 4LLGA 3A8KA 1B4BA 5IOQA 3S1MC 4WFAS 4YFKA 1EI6A 2FQTA 3S15C 4G7ZA 2WAQL 4A3FK 3I4MC 4LR2A 1EH1A 1AB4A 4A3JK 2E2IA 3CQZC 3PIPS 4C2MK 3DXJA 2GAGC 4A3EC 2V6UA 1TWAC 3HOVK 1DCHA 2KQ1A 3GTGK 1YNJA 4KM8A 2A69A 3ERED 3HOYK 3GDZA 4LK1A 2NVYA 1F9NA 2GSUA 3H0GA 2FQOA 2JA7C 1WCMK 1VRQC 5IYDK 4O2DA 3NUHA 5DM7S 3RZOK 3AQOA 2NVTC 1TWFA 1WQHA 1PJ7A 1WSVA 4AH6A 1I50A 4OIQA 1TWGA 4YFNA 3GTKK 3GSIA 4G0VA 4BY7K 4OIPA 4A3GK 1EK8A 4A3CK 4X6AK 1KQ4A 3GTLK 4WILA 1UV7A 3S2DK 1Y1WC 3PO3K 4C45A 1TWCA 2R7ZK 4MQ9A 5JVHS 4LOWA 1VLOA 3JSTA 2YU9K 1EQRA 3S2HK 2JA5A 4BLAA 1O28A 1Y1VA 1BS2A 5IP7K 3HOXK 2ZJRS 2PHCB 3HOZC 1XZPB 4FZBA 5C4JK 4KARA 2RH6A 4Y52K 1JOEA 1J98A 4DDQA 4G0UA 5C44K 2R92K 1WIHA 4M1XA 4PABA 2VUMK 4BY1K 3GTQC 2A68A 4XLPA 1RU0A 1IL2A 4P9SA 1X31C 1XZPA 2PMZD 3L4KA 3CQZA 2GAHC 4P5BA 3GTJK 5JVGS 1FEUA 2BE5A 2A6HA 4A93C 5CHPA 1C0AA 1TWFC 1I6HK 4MEXA 4KMHA 4C3JC 2NVQC 3CAGA 2NVXC 2E2HC 3EQLA 3ADAC 2JA7A 3GTPK 4BBRC 4GTLA 3TTGA 1IE0A 3PIOS 3S1QC 5TMCA 1INNA 5M5WK 1F7VA 3QX3A 4IOAS 4KASA 3HKZD 4WFNS 1TWCC 5C3EC 3GIRA 3S14C 2R93C 4IOCS 4P5AA 4C3HK 3S16C 3FKIC 1GE9A 3S1RC 1DCOA 2CW0A 2V6SA 4KMAA 1WSRA 3PO2K 5M5YK 5C4XK 5D4DA 3HOUK 4KATA 3HOWC 2EBBA 2KWAA 3SZZA 1HI9A 1WORA 1O2BA 3M4OK 1I3QA 1PJ5A 1HQMA 3OREA 1DD5A 3GTKA 1O26A 3N0BA 2XCQA 1J6WA 3M3YK 4OIOA 2B63C 4Y7NC 1IQ0A 1K83A 1SFOC 3G4AA 3GTQA 4U67S 2JA6A 3S1NK 1R9TK 2E2JK 2JA8K 2NVTK 3SZYA 3GTMK 1XXAA 5EGHA 4Q5SA 2PMZL 3GEHA 2ZJPS 1BGWA 2D6FC 4KMDA 2L5NA 4KAWX 1TWHK 1VH2A 2NVXA 2E2HA 3FOFA 4C3IC 5IOTA 1B4AA 2WB1L 5TMFA 4A3JC 2ZJQS 4A3DK 5JVOA 4C2MC 4WJ3M 4GTAA 4A3BK 4G7HA 2VUMA 3HOVC 5IYCK 3GTGC 1XXCA 2PA8D 3IPJA 3T02A 3HOYC 5M5XK 3HKZL 5FLMK 2R93A 2E2IK 5IYDC 3FKIA 4YFXA 4A3LC
chains in the Genus database with same CATH topology
2BE5A 2A6HA 4A93C 4XSXA 4A3IC 1Y1WK 1I3QC 5IYBK 3S17C 1TWFC 1I6HK 4MEXA 3M4OC 3K7AC 4C3JC 2NVQC 4BXXC 1YNNA 2NVXC 2E2HC 2NVYK 3EQLA 4KN4A 4LLGA 3H0GK 3GTKC 3S1MC 4G7OA 3GTPK 4YFKA 4BBRC 3M3YC 4A3GC 1K83C 3S15C 4A3CC 4X6AC 3GTLC 4G7ZA 1I6VA 2O5IA 2WAQL 4A3FK 4A3KK 4QJVB 3I4MC 4OINA 5TMCA 2JA6C 3H3VD 3S1QC 3S2DC 5M5WK 3HOZK 4AYBD 3HKZD 3S1NC 1I3QK 1TWCC 1R9TC 2E2JC 3S17K 2JA8C 5C3EC 4QIWL 2R7ZC 1I50K 3S14C 1TWGK 4A3JK 1WCMC 3GTMC 4XLNA 2R93C 2PPBA 4BBSK 3CQZC 2JA5C 4C3HK 1XPPA 2YU9C 2Y0SD 3RZDK 4C2MK 3S2HC 3RZOC 3DXJA 3FKIC 3S16C 1K83K 4A3EC 4GZYA 4NOIA 3S1RC 3GTOK 1TWAC 3GTQK 3WODA 2WB1D 4KMUA 5IP7C 3HOXC 3GTGK 3HOVK 1YNJA 1TWHC 2A69A 2JA6K 2CW0A 4QJVA 3HOYK 4LK1A 5C4JC 4Y52C 4BY7C 2JA7C 3PO2K 3S14K 1WCMK 5IYDK 5M5YK 4A3DC 4A3MK 2R92C 5C44C 5D4DA 5C4XK 3HOUK 2WAQD 3HOWC 2JA5K 4A3LK 4A3BC 3RZOK 4XSZA 1Y1VK 5FJ8K 4A93K 2VUMC 4BY1C 4A3IK 3PO3C 1TWFK 5IYCC 4YG2A 3K7AK 2NVTC 4C3JK 5M3FK 2NVQK 3M4OK 4BXXK 4JK1A 2E2HK 2NVXK 1IW7A 4OIQA 1HQMA 4YFNA 3GTKK 5FLMC 3S1MK 4BBRK 3M3YK 2E2IC 4BY7K 4OIPA 4A3GK 4OIOA 2B63C 3S15K 4Y7NC 4A3CK 3GTJC 4X6AK 3GTLK 5IP9C 1SFOC 2O5JA 3I4MK 3S1QK 3S2DK 1Y1WC 3I4NC 3PO3K 3S1NK 1I6HC 1TWCK 1R9TK 2E2JK 2JA8K 5C3EK 2NVTK 2R7ZK 2PA8L 2NVYC 4MQ9A 5M3MK 3GTMK 2R93K 3H0GC 3CQZK 4Q5SA 3GTPC 2PMZL 2YU9K 4MEYA 1SMYA 3S2HK 3S16K 3FKIK 4A3EK 3S1RK 1TWAK 5IP9K 4QIWD 5IP7K 3HOXK 4LJZA 4A3KC 4OIRA 1TWHK 3HOZC 5C4JK 3I4NK 4C3IC 2WB1L 5TMFA 4Y52K 1I50C 4KN7A 1BDFA 2JA7K 1TWGC 4A3JC 4BBSC 4A3DK 4C3HC 2R92K 5C44K 4Q4ZA 3RZDC 4C2MC 3HOWK 1ZYRA 4A3BK 4LK0A 2VUMK 4BY1K 3GTOC 5IYBC 4G7HA 3GTQC 3HOVC 5IYCK 2A6EA 3GTGC 2A68A 2PA8D 4XLPA 3HOYC 3H3VL 5M5XK 4AYBL 3HKZL 5FLMK 2PMZD 4C3IK 2E2IK 3PO2C 5IYDC 2B63K 4Y7NK 3GTJK 4A3MC 4ZH4A 4YFXA 3HOUC 5C4XC 1SFOK 2Y0SL 4A3FC 4A3LC 1Y1VC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BE5 A;  2A6H A;  4A93 C;  4XSX A;  4A3I C;  1Y1W K;  1I3Q C;  5IYB K;  3S17 C;  1TWF C;  1I6H K;  4MEX A;  3M4O C;  3K7A C;  4C3J C;  2NVQ C;  4BXX C;  1YNN A;  2NVX C;  2E2H C;  2NVY K;  3EQL A;  4KN4 A;  4LLG A;  3H0G K;  3GTK C;  3S1M C;  4G7O A;  3GTP K;  4YFK A;  4BBR C;  3M3Y C;  4A3G C;  1K83 C;  3S15 C;  4A3C C;  4X6A C;  3GTL C;  4G7Z A;  1I6V A;  2O5I A;  2WAQ L;  4A3F K;  4A3K K;  4QJV B;  3I4M C;  4OIN A;  5TMC A;  2JA6 C;  3H3V D;  3S1Q C;  3S2D C;  5M5W K;  3HOZ K;  4AYB D;  3HKZ D;  3S1N C;  1I3Q K;  1TWC C;  1R9T C;  2E2J C;  3S17 K;  2JA8 C;  5C3E C;  4QIW L;  2R7Z C;  1I50 K;  3S14 C;  1TWG K;  4A3J K;  1WCM C;  3GTM C;  4XLN A;  2R93 C;  2PPB A;  4BBS K;  3CQZ C;  2JA5 C;  4C3H K;  1XPP A;  2YU9 C;  2Y0S D;  3RZD K;  4C2M K;  3S2H C;  3RZO C;  3DXJ A;  3FKI C;  3S16 C;  1K83 K;  4A3E C;  4GZY A;  4NOI A;  3S1R C;  3GTO K;  1TWA C;  3GTQ K;  3WOD A;  2WB1 D;  4KMU A;  5IP7 C;  3HOX C;  3GTG K;  3HOV K;  1YNJ A;  1TWH C;  2A69 A;  2JA6 K;  2CW0 A;  4QJV A;  3HOY K;  4LK1 A;  5C4J C;  4Y52 C;  4BY7 C;  2JA7 C;  3PO2 K;  3S14 K;  1WCM K;  5IYD K;  5M5Y K;  4A3D C;  4A3M K;  2R92 C;  5C44 C;  5D4D A;  5C4X K;  3HOU K;  2WAQ D;  3HOW C;  2JA5 K;  4A3L K;  4A3B C;  3RZO K;  4XSZ A;  1Y1V K;  5FJ8 K;  4A93 K;  2VUM C;  4BY1 C;  4A3I K;  3PO3 C;  1TWF K;  5IYC C;  4YG2 A;  3K7A K;  2NVT C;  4C3J K;  5M3F K;  2NVQ K;  3M4O K;  4BXX K;  4JK1 A;  2E2H K;  2NVX K;  1IW7 A;  4OIQ A;  1HQM A;  4YFN A;  3GTK K;  5FLM C;  3S1M K;  4BBR K;  3M3Y K;  2E2I C;  4BY7 K;  4OIP A;  4A3G K;  4OIO A;  2B63 C;  3S15 K;  4Y7N C;  4A3C K;  3GTJ C;  4X6A K;  3GTL K;  5IP9 C;  1SFO C;  2O5J A;  3I4M K;  3S1Q K;  3S2D K;  1Y1W C;  3I4N C;  3PO3 K;  3S1N K;  1I6H C;  1TWC K;  1R9T K;  2E2J K;  2JA8 K;  5C3E K;  2NVT K;  2R7Z K;  2PA8 L;  2NVY C;  4MQ9 A;  5M3M K;  3GTM K;  2R93 K;  3H0G C;  3CQZ K;  4Q5S A;  3GTP C;  2PMZ L;  2YU9 K;  4MEY A;  1SMY A;  3S2H K;  3S16 K;  3FKI K;  4A3E K;  3S1R K;  1TWA K;  5IP9 K;  4QIW D;  5IP7 K;  3HOX K;  4LJZ A;  4A3K C;  4OIR A;  1TWH K;  3HOZ C;  5C4J K;  3I4N K;  4C3I C;  2WB1 L;  5TMF A;  4Y52 K;  1I50 C;  4KN7 A;  1BDF A;  2JA7 K;  1TWG C;  4A3J C;  4BBS C;  4A3D K;  4C3H C;  2R92 K;  5C44 K;  4Q4Z A;  3RZD C;  4C2M C;  3HOW K;  1ZYR A;  4A3B K;  4LK0 A;  2VUM K;  4BY1 K;  3GTO C;  5IYB C;  4G7H A;  3GTQ C;  3HOV C;  5IYC K;  2A6E A;  3GTG C;  2A68 A;  2PA8 D;  4XLP A;  3HOY C;  3H3V L;  5M5X K;  4AYB L;  3HKZ L;  5FLM K;  2PMZ D;  4C3I K;  2E2I K;  3PO2 C;  5IYD C;  2B63 K;  4Y7N K;  3GTJ K;  4A3M C;  4ZH4 A;  4YFX A;  3HOU C;  5C4X C;  1SFO K;  2Y0S L;  4A3F C;  4A3L C;  1Y1V C; 
#chains in the Genus database with same CATH topology
 4XSX A;  1I3Q C;  3S17 C;  2L3U A;  1O25 A;  2NVY K;  3H0G K;  3GTK C;  4G7O A;  4A3G C;  3T00 A;  1V5V A;  1K83 C;  4A3C C;  4X6A C;  2RGR A;  3GTL C;  2O5I A;  3HXA A;  4A3K K;  2JA6 C;  3S2D C;  1YCL A;  4GTF A;  3FOE A;  5HL8 A;  1L0W A;  1IBA A;  4QIW L;  2R7Z C;  1I50 K;  4GFQ A;  1TWG K;  4BBS K;  4XLN A;  1XXB A;  2B63 A;  1XPP A;  2YU9 C;  3RZD K;  3S2H C;  1SFO A;  3TFH A;  1O2F B;  3LAJ A;  3GTO K;  3AH5 A;  3WOD A;  2WB1 D;  5IP7 C;  1O24 A;  3HOX C;  1ZQ1 C;  3AD7 C;  3VA7 A;  1BJT A;  5E68 A;  1VGX A;  1ISE A;  2CFA B;  5C4J C;  1WOS A;  4GTB A;  2ZUE A;  4Y52 C;  2Y3P A;  3S14 K;  4KM9 A;  3OPF A;  4A3M K;  2R92 C;  5C44 C;  2JA5 K;  3BUE A;  1YX2 A;  1Y1V K;  5FJ8 K;  2VUM C;  4BY1 C;  4A3I K;  3K7A K;  4J3N A;  4KB2 A;  4BXX K;  4JK1 A;  1O2A A;  2CFA A;  3N0C A;  3S1M K;  1O27 A;  3G4C A;  3TFI A;  3S15 K;  3GTJ C;  5IP9 C;  2O5J A;  3I4M K;  4FM9 A;  3GTG A;  3I4N C;  1I6H C;  1WQG A;  4PAA A;  2PA8 L;  1WCM A;  2JH3 A;  3CQZ K;  3LAP A;  3GTM A;  3GTP C;  4MEY A;  2V6T A;  4GT9 A;  4A3E K;  1WOP A;  3Q3Q A;  1TWA K;  4QIW D;  4LJZ A;  4OIR A;  3LPX A;  1TWH A;  1G51 A;  3GEE A;  4G0W A;  1BDF A;  2JA7 K;  4IO9 S;  4C3H C;  5CJ9 A;  5HL7 S;  5L46 A;  1F7U A;  3GTL A;  1ZYR A;  4LK0 A;  5IYB C;  4BLB A;  4RMF A;  2A6E A;  3TFJ A;  2R7Z A;  1ZBS A;  4C3I K;  3PO2 C;  2YU9 A;  5EGE A;  3HOU C;  5C4X C;  4A3F C;  3A8I A;  3BP3 A;  4WJ4 A;  1Y1W K;  2KPU A;  3M4O C;  1USM A;  1J6X A;  3M3Y C;  2R92 A;  1JVI A;  4GTD A;  1I6V A;  1PJ6 A;  4A3L K;  4QJV B;  4OIN A;  3H3V D;  3HOZ K;  4AYB D;  1I3Q K;  3S1N C;  3S17 K;  1R9T C;  2E2J C;  2JA8 C;  2ZFZ A;  1WCM C;  3GTM C;  2PPB A;  2W7V A;  3GTJ A;  2Y0S D;  3RZO C;  1K83 K;  3FHZ A;  3OEP A;  4GZY A;  4NOI A;  3L4J A;  3AQP A;  3GTQ K;  3GTO A;  4KMU A;  3S0X A;  1TWH C;  3GEI A;  3V4G A;  2JA6 K;  4QJV A;  4WCE S;  1ZXO A;  3MML B;  4GTC A;  4ILD A;  3AD9 C;  4XCH A;  4BY7 C;  3GTP A;  1IS1 A;  5DM6 S;  5JFE A;  1VJE A;  4A3D C;  2WAQ D;  4A3B C;  4XSZ A;  1WQF A;  4A93 K;  3PO3 C;  2XCR B;  1TWF K;  5IYC C;  4YG2 A;  1DCP A;  5M3F K;  4C3J K;  2NVQ K;  2NVX K;  2E2H K;  1IW7 A;  5FLM C;  4BBR K;  2E2I C;  3CF5 S;  2GSN A;  1XZQ B;  2GSO A;  1EFW A;  3S1Q K;  4WFB S;  1TWC K;  5C3E K;  2NVY C;  5M3M K;  3DLL S;  3AD8 C;  3N3Y A;  2R93 K;  3H0G C;  2KXY A;  1O29 A;  4KB4 A;  2XCO A;  1SMY A;  3S16 K;  3FKI K;  3S1R K;  1XZQ A;  1USO A;  4GTE A;  5IP9 K;  5IOR A;  1TWA A;  4A3K C;  5IOS A;  3I4N K;  3T01 A;  1I50 C;  4KN7 A;  1TWG C;  4BBS C;  4BKW A;  5HQH A;  4KDD A;  4Q4Z A;  3RZD C;  1J6V A;  3HOW K;  4LQY A;  3GTO C;  1JQW A;  3A8J A;  3BP8 C;  1R9T A;  4KC6 A;  3H3V L;  3LYW A;  4AYB L;  2B63 K;  4Y7N K;  2P5M A;  4A3M C;  4ZH4 A;  1SFO K;  2ZUF A;  4WF9 S;  2JA5 C;  2Y0S L;  1WOO A;  1Y1V C;  4A3I C;  2P8T A;  5IYB K;  1F93 A;  5TJ3 A;  1Y1W A;  1ZVU A;  3K7A C;  4BXX C;  1YNN A;  4KN4 A;  4LLG A;  3A8K A;  1B4B A;  5IOQ A;  3S1M C;  4WFA S;  4YFK A;  1EI6 A;  2FQT A;  3S15 C;  4G7Z A;  2WAQ L;  4A3F K;  3I4M C;  4LR2 A;  1EH1 A;  1AB4 A;  4A3J K;  2E2I A;  3CQZ C;  3PIP S;  4C2M K;  3DXJ A;  2GAG C;  4A3E C;  2V6U A;  1TWA C;  3HOV K;  1DCH A;  2KQ1 A;  3GTG K;  1YNJ A;  4KM8 A;  2A69 A;  3ERE D;  3HOY K;  3GDZ A;  4LK1 A;  2NVY A;  1F9N A;  2GSU A;  3H0G A;  2FQO A;  2JA7 C;  1WCM K;  1VRQ C;  5IYD K;  4O2D A;  3NUH A;  5DM7 S;  3RZO K;  3AQO A;  2NVT C;  1TWF A;  1WQH A;  1PJ7 A;  1WSV A;  4AH6 A;  1I50 A;  4OIQ A;  1TWG A;  4YFN A;  3GTK K;  3GSI A;  4G0V A;  4BY7 K;  4OIP A;  4A3G K;  1EK8 A;  4A3C K;  4X6A K;  1KQ4 A;  3GTL K;  4WIL A;  1UV7 A;  3S2D K;  1Y1W C;  3PO3 K;  4C45 A;  1TWC A;  2R7Z K;  4MQ9 A;  5JVH S;  4LOW A;  1VLO A;  3JST A;  2YU9 K;  1EQR A;  3S2H K;  2JA5 A;  4BLA A;  1O28 A;  1Y1V A;  1BS2 A;  5IP7 K;  3HOX K;  2ZJR S;  2PHC B;  3HOZ C;  1XZP B;  4FZB A;  5C4J K;  4KAR A;  2RH6 A;  4Y52 K;  1JOE A;  1J98 A;  4DDQ A;  4G0U A;  5C44 K;  2R92 K;  1WIH A;  4M1X A;  4PAB A;  2VUM K;  4BY1 K;  3GTQ C;  2A68 A;  4XLP A;  1RU0 A;  1IL2 A;  4P9S A;  1X31 C;  1XZP A;  2PMZ D;  3L4K A;  3CQZ A;  2GAH C;  4P5B A;  3GTJ K;  5JVG S;  1FEU A;  2BE5 A;  2A6H A;  4A93 C;  5CHP A;  1C0A A;  1TWF C;  1I6H K;  4MEX A;  4KMH A;  4C3J C;  2NVQ C;  3CAG A;  2NVX C;  2E2H C;  3EQL A;  3ADA C;  2JA7 A;  3GTP K;  4BBR C;  4GTL A;  3TTG A;  1IE0 A;  3PIO S;  3S1Q C;  5TMC A;  1INN A;  5M5W K;  1F7V A;  3QX3 A;  4IOA S;  4KAS A;  3HKZ D;  4WFN S;  1TWC C;  5C3E C;  3GIR A;  3S14 C;  2R93 C;  4IOC S;  4P5A A;  4C3H K;  3S16 C;  3FKI C;  1GE9 A;  3S1R C;  1DCO A;  2CW0 A;  2V6S A;  4KMA A;  1WSR A;  3PO2 K;  5M5Y K;  5C4X K;  5D4D A;  3HOU K;  4KAT A;  3HOW C;  2EBB A;  2KWA A;  3SZZ A;  1HI9 A;  1WOR A;  1O2B A;  3M4O K;  1I3Q A;  1PJ5 A;  1HQM A;  3ORE A;  1DD5 A;  3GTK A;  1O26 A;  3N0B A;  2XCQ A;  1J6W A;  3M3Y K;  4OIO A;  2B63 C;  4Y7N C;  1IQ0 A;  1K83 A;  1SFO C;  3G4A A;  3GTQ A;  4U67 S;  2JA6 A;  3S1N K;  1R9T K;  2E2J K;  2JA8 K;  2NVT K;  3SZY A;  3GTM K;  1XXA A;  5EGH A;  4Q5S A;  2PMZ L;  3GEH A;  2ZJP S;  1BGW A;  2D6F C;  4KMD A;  2L5N A;  4KAW X;  1TWH K;  1VH2 A;  2NVX A;  2E2H A;  3FOF A;  4C3I C;  5IOT A;  1B4A A;  2WB1 L;  5TMF A;  4A3J C;  2ZJQ S;  4A3D K;  5JVO A;  4C2M C;  4WJ3 M;  4GTA A;  4A3B K;  4G7H A;  2VUM A;  3HOV C;  5IYC K;  3GTG C;  1XXC A;  2PA8 D;  3IPJ A;  3T02 A;  3HOY C;  5M5X K;  3HKZ L;  5FLM K;  2R93 A;  2E2I K;  5IYD C;  3FKI A;  4YFX A;  4A3L C; 
#chains in the Genus database with same CATH homology
 2BE5 A;  2A6H A;  4A93 C;  4XSX A;  4A3I C;  1Y1W K;  1I3Q C;  5IYB K;  3S17 C;  1TWF C;  1I6H K;  4MEX A;  3M4O C;  3K7A C;  4C3J C;  2NVQ C;  4BXX C;  1YNN A;  2NVX C;  2E2H C;  2NVY K;  3EQL A;  4KN4 A;  4LLG A;  3H0G K;  3GTK C;  3S1M C;  4G7O A;  3GTP K;  4YFK A;  4BBR C;  3M3Y C;  4A3G C;  1K83 C;  3S15 C;  4A3C C;  4X6A C;  3GTL C;  4G7Z A;  1I6V A;  2O5I A;  2WAQ L;  4A3F K;  4A3K K;  4QJV B;  3I4M C;  4OIN A;  5TMC A;  2JA6 C;  3H3V D;  3S1Q C;  3S2D C;  5M5W K;  3HOZ K;  4AYB D;  3HKZ D;  3S1N C;  1I3Q K;  1TWC C;  1R9T C;  2E2J C;  3S17 K;  2JA8 C;  5C3E C;  4QIW L;  2R7Z C;  1I50 K;  3S14 C;  1TWG K;  4A3J K;  1WCM C;  3GTM C;  4XLN A;  2R93 C;  2PPB A;  4BBS K;  3CQZ C;  2JA5 C;  4C3H K;  1XPP A;  2YU9 C;  2Y0S D;  3RZD K;  4C2M K;  3S2H C;  3RZO C;  3DXJ A;  3FKI C;  3S16 C;  1K83 K;  4A3E C;  4GZY A;  4NOI A;  3S1R C;  3GTO K;  1TWA C;  3GTQ K;  3WOD A;  2WB1 D;  4KMU A;  5IP7 C;  3HOX C;  3GTG K;  3HOV K;  1YNJ A;  1TWH C;  2A69 A;  2JA6 K;  2CW0 A;  4QJV A;  3HOY K;  4LK1 A;  5C4J C;  4Y52 C;  4BY7 C;  2JA7 C;  3PO2 K;  3S14 K;  1WCM K;  5IYD K;  5M5Y K;  4A3D C;  4A3M K;  2R92 C;  5C44 C;  5D4D A;  5C4X K;  3HOU K;  2WAQ D;  3HOW C;  2JA5 K;  4A3L K;  4A3B C;  3RZO K;  4XSZ A;  1Y1V K;  5FJ8 K;  4A93 K;  2VUM C;  4BY1 C;  4A3I K;  3PO3 C;  1TWF K;  5IYC C;  4YG2 A;  3K7A K;  2NVT C;  4C3J K;  5M3F K;  2NVQ K;  3M4O K;  4BXX K;  4JK1 A;  2E2H K;  2NVX K;  1IW7 A;  4OIQ A;  1HQM A;  4YFN A;  3GTK K;  5FLM C;  3S1M K;  4BBR K;  3M3Y K;  2E2I C;  4BY7 K;  4OIP A;  4A3G K;  4OIO A;  2B63 C;  3S15 K;  4Y7N C;  4A3C K;  3GTJ C;  4X6A K;  3GTL K;  5IP9 C;  1SFO C;  2O5J A;  3I4M K;  3S1Q K;  3S2D K;  1Y1W C;  3I4N C;  3PO3 K;  3S1N K;  1I6H C;  1TWC K;  1R9T K;  2E2J K;  2JA8 K;  5C3E K;  2NVT K;  2R7Z K;  2PA8 L;  2NVY C;  4MQ9 A;  5M3M K;  3GTM K;  2R93 K;  3H0G C;  3CQZ K;  4Q5S A;  3GTP C;  2PMZ L;  2YU9 K;  4MEY A;  1SMY A;  3S2H K;  3S16 K;  3FKI K;  4A3E K;  3S1R K;  1TWA K;  5IP9 K;  4QIW D;  5IP7 K;  3HOX K;  4LJZ A;  4A3K C;  4OIR A;  1TWH K;  3HOZ C;  5C4J K;  3I4N K;  4C3I C;  2WB1 L;  5TMF A;  4Y52 K;  1I50 C;  4KN7 A;  1BDF A;  2JA7 K;  1TWG C;  4A3J C;  4BBS C;  4A3D K;  4C3H C;  2R92 K;  5C44 K;  4Q4Z A;  3RZD C;  4C2M C;  3HOW K;  1ZYR A;  4A3B K;  4LK0 A;  2VUM K;  4BY1 K;  3GTO C;  5IYB C;  4G7H A;  3GTQ C;  3HOV C;  5IYC K;  2A6E A;  3GTG C;  2A68 A;  2PA8 D;  4XLP A;  3HOY C;  3H3V L;  5M5X K;  4AYB L;  3HKZ L;  5FLM K;  2PMZ D;  4C3I K;  2E2I K;  3PO2 C;  5IYD C;  2B63 K;  4Y7N K;  3GTJ K;  4A3M C;  4ZH4 A;  4YFX A;  3HOU C;  5C4X C;  1SFO K;  2Y0S L;  4A3F C;  4A3L C;  1Y1V C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...