4OIRA

Crystal structure of thermus thermophilus rna polymerase transcription initiation complex soaked with ge23077 and rifamycin sv
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
231
structure length
231
Chain Sequence
SKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQAAAVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription, transferase/antibiotic
molecule keywords DNA-directed RNA polymerase subunit alpha
publication title GE23077 binds to the RNA polymerase 'i' and 'i+1' sites and prevents the binding of initiating nucleotides.
pubmed rcsb
source organism Thermus thermophilus
total genus 49
structure length 231
sequence length 231
chains with identical sequence B
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2014-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01000 RNA_pol_A_bac RNA polymerase Rpb3/RpoA insert domain
A PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.12 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 DNA-directed RNA polymerase, insert domain 4oirA02
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 4oirA01
3S1NC 4Y52K 4OINA 3GTMK 4KMUA 1BDFA 5D4DA 3HOWC 3HOVK 2R7ZC 1SFOK 3I4NC 1TWHC 4GZYA 2NVYK 4C2MK 4G7OA 2WB1L 1Y1VK 2WAQL 1WCMK 5C44C 4A3JC 4QIWD 3S16C 3HOXK 5M3FK 4A3GK 4KN4A 4A93C 4JK1A 3S1NK 3S2DC 5C4JC 4MEXA 3GTQC 2R7ZK 2WB1D 3S1MC 1HQMA 2WAQD 4YG2A 1TWGC 3I4MC 3S1QC 1TWHK 2JA6K 3I4NK 3H3VD 3GTLC 5C44K 4A3JK 3S16K 4MEYA 2NVXC 4YFXA 1TWCC 4Y7NC 3GTKC 3S17C 3RZOC 4A3LC 4A93K 1R9TC 2BE5A 3GTPC 4A3BC 4BY7C 3S2DK 2E2HC 4A3CC 5IYDC 5C4JK 3GTQK 3S1MK 5M5YK 4KN7A 4QJVA 4OIPA 1TWGK 5FJ8K 4G7HA 3S1QK 5IP9C 5TMFA 2R93C 2O5JA 3GTLK 4A3KC 3HKZD 1I6VA 3K7AC 4BY1C 5IYCC 2NVTC 1TWCK 5M5XK 4Y7NK 2NVXK 1SMYA 3HOZC 3HOYC 3PO3C 4A3LK 1R9TK 4A3BK 3GTPK 4BY7K 1I50C 2E2HK 4A3CK 5IYDK 3H3VL 1TWAC 4LK1A 3GTGC 2A68A 3H0GC 1YNNA 4QJVB 2JA8C 5IP9K 2R93K 2PA8D 3S17K 4BXXC 4A3KK 4C3JC 3GTJC 3HOWK 3K7AK 4BY1K 5IYCK 2NVTK 3DXJA 3HOZK 3HOYK 3PO3K 4XLPA 1I50K 5M5WK 4BBRC 1XPPA 4LJZA 3GTGK 3H0GK 3HKZL 1K83C 2JA8K 1I3QC 2VUMC 2E2IC 2A6HA 2CW0A 4LLGA 4A3MC 4C3JK 4ZH4A 2YU9C 5IYBC 3RZDC 3I4MK 1YNJA 4NOIA 4A3IC 1I6HC 4XLNA 4BBRK 4A3EC 5FLMC 3S2HC 3S15C 4MQ9A 2PA8L 3RZOK 1K83K 3FKIC 2B63C 4BBSC 5C3EC 1I3QK 2E2IK 2VUMK 3S14K 2O5IA 2JA7C 4OIOA 2Y0SL 3RZDK 2YU9K 3GTOC 5M3MK 3S1RC 4A3IK 3GTKK 1I6HK 5IP7C 4Q4ZA 4A3EK 5FLMK 4C3HC 3S15K 3WODA 3PO2C 3HOUC 4XSZA 3FKIK 2B63K 4BBSK 4YFNA 5C3EK 2Y0SD 2A6EA 2NVQC 2R92C 1TWAK 2A69A 2JA7K 3GTOK 3S1RK 3CQZC 4A3DC 2PMZL 5IP7K 4BXXK 3GTJK 4C3HK 1Y1WC 2JA6C 5C4XC 3M3YC 4OIQA 4A3FC 3PO2K 4AYBD 1ZYRA 3HOUK 2JA5C 4X6AC 2NVQK 2R92K 2PMZD 2E2JC 4Q5SA 4C3IC 3CQZK 4A3DK 4XSXA 4A3MK 1TWFC 5TMCA 3M4OC 5C4XK 1Y1WK 5IYBK 3M3YK 4Y52C 3GTMC 4A3FK 4OIRA 3EQLA 4LK0A 3HOVC 2JA5K 1IW7A 4X6AK 4G7ZA 1SFOC 4YFKA 2PPBA 3S2HK 2NVYC 2E2JK 4C2MC 4C3IK 3S14C 1Y1VC 4A3GC 1WCMC 3HOXC 4AYBL 1TWFK 3M4OK 4QIWL
chains in the Genus database with same CATH superfamily
3S1NC 2R7ZC 1EI6A 1SFOK 4G7OA 2WB1L 3S14K 4A3GK 5C44C 3S16C 4FM9A 1IBAA 4WFNS 4JK1A 3GTQC 1VLOA 4YG2A 3I4NK 1TWHK 3GTLC 1EFWA 2JA5A 1WOPA 4Y7NC 4GFQA 4A93K 3TFJA 2BE5A 3GTPC 2XCRB 4KATA 1WQGA 4P5BA 4QJVA 1TWGK 1IS1A 4G7HA 2EBBA 5TMFA 3S1QK 3GTMA 2O5JA 5IYCC 3G4CA 3HOZC 4A3BK 1Y1VA 4A3CK 4GTEA 5IYDK 4LK1A 3H0GC 2PA8D 4BXXC 4A3KK 3GTJC 3G4AA 3K7AK 1YCLA 3DXJA 3HOYK 3PO3K 3SZYA 4O2DA 3GTGK 4GTFA 1ZXOA 4FZBA 4A3MC 2CW0A 1DD5A 4C3JK 4ZH4A 1WQFA 3V4GA 1INNA 4A3EC 4KDDA 1TWCA 3GTKA 3RZOK 3T01A 3BP8C 2VUMK 2E2IK 2VUMA 2E2HA 4IOAS 4OIOA 3QX3A 5M3MK 2P8TA 2R93A 5IP7C 1PJ6A 3S15K 4WJ3M 3HOUC 5C3EK 3VA7A 1I50A 2Y0SD 2ZJQS 2A69A 3GTOK 2KQ1A 3S1RK 4C3HK 3M3YC 4OIQA 1ZYRA 2JA5C 4AH6A 2V6TA 2R92K 5EGEA 1WORA 2PMZD 1JQWA 5CHPA 3AD7C 1I3QA 3M4OC 4LR2A 4G0WA 2YU9A 3GTMC 4A3FK 4OIRA 3NUHA 2KPUA 3EQLA 4LK0A 3HOVC 3FHZA 4X6AK 4C2MC 4C3IK 1Y1VC 3FKIA 3LAJA 1B4BA 4KARA 4AYBL 1TWFK 2JA7A 3S0XA 4KM8A 4KM9A 4OINA 4KASA 1BDFA 3CAGA 2NVYK 4GZYA 2ZFZA 1WCMK 5M3FK 4A3JC 4QIWD 3HOXK 5IORA 2L3UA 5C4JC 1ZBSA 4MEXA 3S1MC 2WAQD 2JA6K 2JA6A 3BUEA 3N3YA 3TFIA 4BLBA 4YFXA 1TWCC 3GTKC 3S17C 3RZOC 4ILDA 2FQOA 3S2DK 2E2HC 3Q3QA 5IOSA 4KN7A 5M5YK 4OIPA 2R93C 4GTAA 5M5XK 4BY1C 2NVXK 1SFOA 3GIRA 4P5AA 4A3LK 1R9TK 4BY7K 1R9TA 1I50C 3H3VL 4XCHA 2GAHC 5IP9K 3MMLB 3A8KA 4GTDA 2NVTK 3ERED 3JSTA 1TWHA 4XLPA 4WILA 4BKWA 4BBRC 4LJZA 1WSRA 2W7VA 3AH5A 2JA8K 1I3QC 2A6HA 1XXBA 1JOEA 1PJ7A 2YU9C 3RZDC 3I4MK 1TWGA 1I6HC 5FLMC 4U67S 1O27A 1K83K 3FKIC 1K83A 4BBSC 3GEIA 2JA7C 1WIHA 1XZQB 4A3IK 1XXAA 2RH6A 1BJTA 4KC6A 5L46A 3WODA 3PO2C 2B63K 4YFNA 2NVQC 3OPFA 3GTGA 2KXYA 1WOSA 4A3DC 2JA6C 4DDQA 4AYBD 1ISEA 1AB4A 2GAGC 2E2JC 5TJ3A 1DCPA 4C45A 3CQZK 4XSXA 3CQZA 2E2IA 5C4XK 1Y1WK 4KB4A 2GSNA 2ZJPS 2KWAA 1SFOC 3S2HK 2PHCB 3S14C 1JVIA 4A3GC 4BLAA 1L0WA 3GSIA 1G51A 3AQPA 2FQTA 4Y52K 3GTOA 4KMUA 5D4DA 3A8IA 3I4NC 1TWHC 4PAAA 1IE0A 4KN4A 4A93C 2R92A 4IO9S 3S1NK 1XZPB 4WCES 2R7ZK 1BGWA 2WB1D 1HQMA 3I4MC 1TWGC 3S1QC 3H3VD 1VJEA 4PABA 5C44K 3S16K 3AD8C 4A3BC 1F93A 5IOQA 4A3CC 5IYDC 2ZUEA 1O2FB 3GTQK 1TWFA 1WOOA 3FOFA 1VH2A 2P5MA 3GTLK 3GTLA 4A3KC 5IOTA 1I6VA 3K7AC 1J6XA 4Y7NK 1SMYA 3PIOS 3HOYC 3PO3C 2NVYA 1C0AA 5JVGS 3GTPK 1WCMA 2RGRA 3GTGC 3OEPA 2A68A 1YNNA 3CF5S 1O26A 3L4JA 4C3JC 3HOWK 1O25A 5IYCK 3GEEA 4KMAA 3HOZK 5DM6S 1XPPA 3H0GK 3HKZL 3LPXA 4G0VA 2VUMC 2E2IC 1J6WA 1HI9A 4J3NA 3GEHA 1XZQA 5CJ9A 3S2HC 3S15C 3A8JA 4MQ9A 2NVXA 4GTCA 3T00A 5C3EC 1B4AA 2O5IA 4RMFA 5HL7S 2Y0SL 3AD9C 3GTOC 3S1RC 4KAWX 4Q4ZA 4A3EK 4C3HC 1VGXA 4WFAS 2GSUA 4XSZA 2A6EA 2R92C 1TWAK 3LYWA 1TWAA 2PMZL 1USOA 5IP7K 2XCQA 4A3FC 3HOUK 4X6AC 2CFAB 1UV7A 4Q5SA 4C3IC 3LAPA 1TWFC 5TMCA 3ADAC 1O2BA 3OREA 4M1XA 5IYBK 3M3YK 5JVHS 2JA5K 1IW7A 4G7ZA 3TTGA 2PPBA 2NVYC 1EQRA 1WCMC 3HOXC 1FEUA 2B63A 1X31C 1J98A 3M4OK 1DCOA 4QIWL 5JFEA 3GTMK 3AQOA 4WFBS 1XZPA 5DM7S 3HOWC 3HOVK 4C2MK 3HXAA 1Y1VK 2WAQL 4GTBA 1O29A 3S2DC 5HQHA 4IOCS 1Y1WA 3BP3A 3N0BA 1EH1A 4A3JK 5JVOA 4MEYA 2NVXC 3GDZA 4G0UA 4A3LC 4WF9S 1O2AA 1R9TC 4BY7C 1ZVUA 3N0CA 5C4JK 4LOWA 1EK8A 4GTLA 3S1MK 5FJ8K 5IP9C 1PJ5A 4GT9A 1USMA 3HKZD 1O28A 2NVTC 4P9SA 1TWCK 5E68A 3GTKK 3S17K 2GSOA 4WJ4A 2E2HK 1TWAC 2JH3A 1BS2A 4KMHA 4QJVB 2JA8C 2R93K 2L5NA 3T02A 3TFHA 4BY1K 2R7ZA 2Y3PA 1VRQC 1I50K 5M5WK 5HL8A 3DLLS 4KB2A 3FOEA 1IL2A 1GE9A 1K83C 4LLGA 1IQ0A 3GTQA 5IYBC 1V5VA 1RU0A 1YNJA 4NOIA 4A3IC 2V6UA 4XLNA 4BBRK 2PA8L 1DCHA 2B63C 1I3QK 3GTPA 4KMDA 5EGHA 4LQYA 1XXCA 2YU9K 3RZDK 1J6VA 3SZZA 1I6HK 5FLMK 1O24A 3FKIK 4BBSK 2CFAA 2JA7K 2XCOA 3H0GA 3PIPS 3CQZC 4BXXK 3GTJK 3GTJA 1Y1WC 5C4XC 2ZJRS 2V6SA 3IPJA 3PO2K 1F7UA 3L4KA 2NVQK 1F7VA 4A3DK 4A3MK 1WSVA 4Y52C 1WQHA 1F9NA 2ZUFA 4YFKA 1KQ4A 1ZQ1C 2E2JK 2D6FC 1YX2A
chains in the Genus database with same CATH topology
3S1NC 4Y52K 4OINA 3GTMK 4KMUA 1BDFA 5D4DA 3HOWC 3HOVK 2R7ZC 1SFOK 3I4NC 1TWHC 4GZYA 2NVYK 4C2MK 4G7OA 2WB1L 1Y1VK 2WAQL 1WCMK 5C44C 4A3JC 4QIWD 3S16C 3HOXK 5M3FK 4A3GK 4KN4A 4A93C 4JK1A 3S1NK 3S2DC 5C4JC 4MEXA 3GTQC 2R7ZK 2WB1D 3S1MC 1HQMA 2WAQD 4YG2A 1TWGC 3I4MC 3S1QC 1TWHK 2JA6K 3I4NK 3H3VD 3GTLC 5C44K 4A3JK 3S16K 4MEYA 2NVXC 4YFXA 1TWCC 4Y7NC 3GTKC 3S17C 3RZOC 4A3LC 4A93K 1R9TC 2BE5A 3GTPC 4A3BC 4BY7C 3S2DK 2E2HC 4A3CC 5IYDC 5C4JK 3GTQK 3S1MK 5M5YK 4KN7A 4QJVA 4OIPA 1TWGK 5FJ8K 4G7HA 3S1QK 5IP9C 5TMFA 2R93C 2O5JA 3GTLK 4A3KC 3HKZD 1I6VA 3K7AC 4BY1C 5IYCC 2NVTC 1TWCK 5M5XK 4Y7NK 2NVXK 1SMYA 3HOZC 3HOYC 3PO3C 4A3LK 1R9TK 4A3BK 3GTPK 4BY7K 1I50C 2E2HK 4A3CK 5IYDK 3H3VL 1TWAC 4LK1A 3GTGC 2A68A 3H0GC 1YNNA 4QJVB 2JA8C 5IP9K 2R93K 2PA8D 3S17K 4BXXC 4A3KK 4C3JC 3GTJC 3HOWK 3K7AK 4BY1K 5IYCK 2NVTK 3DXJA 3HOZK 3HOYK 3PO3K 4XLPA 1I50K 5M5WK 4BBRC 1XPPA 4LJZA 3GTGK 3H0GK 3HKZL 1K83C 2JA8K 1I3QC 2VUMC 2E2IC 2A6HA 2CW0A 4LLGA 4A3MC 4C3JK 4ZH4A 2YU9C 5IYBC 3RZDC 3I4MK 1YNJA 4NOIA 4A3IC 1I6HC 4XLNA 4BBRK 4A3EC 5FLMC 3S2HC 3S15C 4MQ9A 2PA8L 3RZOK 1K83K 3FKIC 2B63C 4BBSC 5C3EC 1I3QK 2E2IK 2VUMK 3S14K 2O5IA 2JA7C 4OIOA 2Y0SL 3RZDK 2YU9K 3GTOC 5M3MK 3S1RC 4A3IK 3GTKK 1I6HK 5IP7C 4Q4ZA 4A3EK 5FLMK 4C3HC 3S15K 3WODA 3PO2C 3HOUC 4XSZA 3FKIK 2B63K 4BBSK 4YFNA 5C3EK 2Y0SD 2A6EA 2NVQC 2R92C 1TWAK 2A69A 2JA7K 3GTOK 3S1RK 3CQZC 4A3DC 2PMZL 5IP7K 4BXXK 3GTJK 4C3HK 1Y1WC 2JA6C 5C4XC 3M3YC 4OIQA 4A3FC 3PO2K 4AYBD 1ZYRA 3HOUK 2JA5C 4X6AC 2NVQK 2R92K 2PMZD 2E2JC 4Q5SA 4C3IC 3CQZK 4A3DK 4XSXA 4A3MK 1TWFC 5TMCA 3M4OC 5C4XK 1Y1WK 5IYBK 3M3YK 4Y52C 3GTMC 4A3FK 4OIRA 3EQLA 4LK0A 3HOVC 2JA5K 1IW7A 4X6AK 4G7ZA 1SFOC 4YFKA 2PPBA 3S2HK 2NVYC 2E2JK 4C2MC 4C3IK 3S14C 1Y1VC 4A3GC 1WCMC 3HOXC 4AYBL 1TWFK 3M4OK 4QIWL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S1N C;  4Y52 K;  4OIN A;  3GTM K;  4KMU A;  1BDF A;  5D4D A;  3HOW C;  3HOV K;  2R7Z C;  1SFO K;  3I4N C;  1TWH C;  4GZY A;  2NVY K;  4C2M K;  4G7O A;  2WB1 L;  1Y1V K;  2WAQ L;  1WCM K;  5C44 C;  4A3J C;  4QIW D;  3S16 C;  3HOX K;  5M3F K;  4A3G K;  4KN4 A;  4A93 C;  4JK1 A;  3S1N K;  3S2D C;  5C4J C;  4MEX A;  3GTQ C;  2R7Z K;  2WB1 D;  3S1M C;  1HQM A;  2WAQ D;  4YG2 A;  1TWG C;  3I4M C;  3S1Q C;  1TWH K;  2JA6 K;  3I4N K;  3H3V D;  3GTL C;  5C44 K;  4A3J K;  3S16 K;  4MEY A;  2NVX C;  4YFX A;  1TWC C;  4Y7N C;  3GTK C;  3S17 C;  3RZO C;  4A3L C;  4A93 K;  1R9T C;  2BE5 A;  3GTP C;  4A3B C;  4BY7 C;  3S2D K;  2E2H C;  4A3C C;  5IYD C;  5C4J K;  3GTQ K;  3S1M K;  5M5Y K;  4KN7 A;  4QJV A;  4OIP A;  1TWG K;  5FJ8 K;  4G7H A;  3S1Q K;  5IP9 C;  5TMF A;  2R93 C;  2O5J A;  3GTL K;  4A3K C;  3HKZ D;  1I6V A;  3K7A C;  4BY1 C;  5IYC C;  2NVT C;  1TWC K;  5M5X K;  4Y7N K;  2NVX K;  1SMY A;  3HOZ C;  3HOY C;  3PO3 C;  4A3L K;  1R9T K;  4A3B K;  3GTP K;  4BY7 K;  1I50 C;  2E2H K;  4A3C K;  5IYD K;  3H3V L;  1TWA C;  4LK1 A;  3GTG C;  2A68 A;  3H0G C;  1YNN A;  4QJV B;  2JA8 C;  5IP9 K;  2R93 K;  2PA8 D;  3S17 K;  4BXX C;  4A3K K;  4C3J C;  3GTJ C;  3HOW K;  3K7A K;  4BY1 K;  5IYC K;  2NVT K;  3DXJ A;  3HOZ K;  3HOY K;  3PO3 K;  4XLP A;  1I50 K;  5M5W K;  4BBR C;  1XPP A;  4LJZ A;  3GTG K;  3H0G K;  3HKZ L;  1K83 C;  2JA8 K;  1I3Q C;  2VUM C;  2E2I C;  2A6H A;  2CW0 A;  4LLG A;  4A3M C;  4C3J K;  4ZH4 A;  2YU9 C;  5IYB C;  3RZD C;  3I4M K;  1YNJ A;  4NOI A;  4A3I C;  1I6H C;  4XLN A;  4BBR K;  4A3E C;  5FLM C;  3S2H C;  3S15 C;  4MQ9 A;  2PA8 L;  3RZO K;  1K83 K;  3FKI C;  2B63 C;  4BBS C;  5C3E C;  1I3Q K;  2E2I K;  2VUM K;  3S14 K;  2O5I A;  2JA7 C;  4OIO A;  2Y0S L;  3RZD K;  2YU9 K;  3GTO C;  5M3M K;  3S1R C;  4A3I K;  3GTK K;  1I6H K;  5IP7 C;  4Q4Z A;  4A3E K;  5FLM K;  4C3H C;  3S15 K;  3WOD A;  3PO2 C;  3HOU C;  4XSZ A;  3FKI K;  2B63 K;  4BBS K;  4YFN A;  5C3E K;  2Y0S D;  2A6E A;  2NVQ C;  2R92 C;  1TWA K;  2A69 A;  2JA7 K;  3GTO K;  3S1R K;  3CQZ C;  4A3D C;  2PMZ L;  5IP7 K;  4BXX K;  3GTJ K;  4C3H K;  1Y1W C;  2JA6 C;  5C4X C;  3M3Y C;  4OIQ A;  4A3F C;  3PO2 K;  4AYB D;  1ZYR A;  3HOU K;  2JA5 C;  4X6A C;  2NVQ K;  2R92 K;  2PMZ D;  2E2J C;  4Q5S A;  4C3I C;  3CQZ K;  4A3D K;  4XSX A;  4A3M K;  1TWF C;  5TMC A;  3M4O C;  5C4X K;  1Y1W K;  5IYB K;  3M3Y K;  4Y52 C;  3GTM C;  4A3F K;  4OIR A;  3EQL A;  4LK0 A;  3HOV C;  2JA5 K;  1IW7 A;  4X6A K;  4G7Z A;  1SFO C;  4YFK A;  2PPB A;  3S2H K;  2NVY C;  2E2J K;  4C2M C;  4C3I K;  3S14 C;  1Y1V C;  4A3G C;  1WCM C;  3HOX C;  4AYB L;  1TWF K;  3M4O K;  4QIW L; 
#chains in the Genus database with same CATH topology
 3S1N C;  2R7Z C;  1EI6 A;  1SFO K;  4G7O A;  2WB1 L;  3S14 K;  4A3G K;  5C44 C;  3S16 C;  4FM9 A;  1IBA A;  4WFN S;  4JK1 A;  3GTQ C;  1VLO A;  4YG2 A;  3I4N K;  1TWH K;  3GTL C;  1EFW A;  2JA5 A;  1WOP A;  4Y7N C;  4GFQ A;  4A93 K;  3TFJ A;  2BE5 A;  3GTP C;  2XCR B;  4KAT A;  1WQG A;  4P5B A;  4QJV A;  1TWG K;  1IS1 A;  4G7H A;  2EBB A;  5TMF A;  3S1Q K;  3GTM A;  2O5J A;  5IYC C;  3G4C A;  3HOZ C;  4A3B K;  1Y1V A;  4A3C K;  4GTE A;  5IYD K;  4LK1 A;  3H0G C;  2PA8 D;  4BXX C;  4A3K K;  3GTJ C;  3G4A A;  3K7A K;  1YCL A;  3DXJ A;  3HOY K;  3PO3 K;  3SZY A;  4O2D A;  3GTG K;  4GTF A;  1ZXO A;  4FZB A;  4A3M C;  2CW0 A;  1DD5 A;  4C3J K;  4ZH4 A;  1WQF A;  3V4G A;  1INN A;  4A3E C;  4KDD A;  1TWC A;  3GTK A;  3RZO K;  3T01 A;  3BP8 C;  2VUM K;  2E2I K;  2VUM A;  2E2H A;  4IOA S;  4OIO A;  3QX3 A;  5M3M K;  2P8T A;  2R93 A;  5IP7 C;  1PJ6 A;  3S15 K;  4WJ3 M;  3HOU C;  5C3E K;  3VA7 A;  1I50 A;  2Y0S D;  2ZJQ S;  2A69 A;  3GTO K;  2KQ1 A;  3S1R K;  4C3H K;  3M3Y C;  4OIQ A;  1ZYR A;  2JA5 C;  4AH6 A;  2V6T A;  2R92 K;  5EGE A;  1WOR A;  2PMZ D;  1JQW A;  5CHP A;  3AD7 C;  1I3Q A;  3M4O C;  4LR2 A;  4G0W A;  2YU9 A;  3GTM C;  4A3F K;  4OIR A;  3NUH A;  2KPU A;  3EQL A;  4LK0 A;  3HOV C;  3FHZ A;  4X6A K;  4C2M C;  4C3I K;  1Y1V C;  3FKI A;  3LAJ A;  1B4B A;  4KAR A;  4AYB L;  1TWF K;  2JA7 A;  3S0X A;  4KM8 A;  4KM9 A;  4OIN A;  4KAS A;  1BDF A;  3CAG A;  2NVY K;  4GZY A;  2ZFZ A;  1WCM K;  5M3F K;  4A3J C;  4QIW D;  3HOX K;  5IOR A;  2L3U A;  5C4J C;  1ZBS A;  4MEX A;  3S1M C;  2WAQ D;  2JA6 K;  2JA6 A;  3BUE A;  3N3Y A;  3TFI A;  4BLB A;  4YFX A;  1TWC C;  3GTK C;  3S17 C;  3RZO C;  4ILD A;  2FQO A;  3S2D K;  2E2H C;  3Q3Q A;  5IOS A;  4KN7 A;  5M5Y K;  4OIP A;  2R93 C;  4GTA A;  5M5X K;  4BY1 C;  2NVX K;  1SFO A;  3GIR A;  4P5A A;  4A3L K;  1R9T K;  4BY7 K;  1R9T A;  1I50 C;  3H3V L;  4XCH A;  2GAH C;  5IP9 K;  3MML B;  3A8K A;  4GTD A;  2NVT K;  3ERE D;  3JST A;  1TWH A;  4XLP A;  4WIL A;  4BKW A;  4BBR C;  4LJZ A;  1WSR A;  2W7V A;  3AH5 A;  2JA8 K;  1I3Q C;  2A6H A;  1XXB A;  1JOE A;  1PJ7 A;  2YU9 C;  3RZD C;  3I4M K;  1TWG A;  1I6H C;  5FLM C;  4U67 S;  1O27 A;  1K83 K;  3FKI C;  1K83 A;  4BBS C;  3GEI A;  2JA7 C;  1WIH A;  1XZQ B;  4A3I K;  1XXA A;  2RH6 A;  1BJT A;  4KC6 A;  5L46 A;  3WOD A;  3PO2 C;  2B63 K;  4YFN A;  2NVQ C;  3OPF A;  3GTG A;  2KXY A;  1WOS A;  4A3D C;  2JA6 C;  4DDQ A;  4AYB D;  1ISE A;  1AB4 A;  2GAG C;  2E2J C;  5TJ3 A;  1DCP A;  4C45 A;  3CQZ K;  4XSX A;  3CQZ A;  2E2I A;  5C4X K;  1Y1W K;  4KB4 A;  2GSN A;  2ZJP S;  2KWA A;  1SFO C;  3S2H K;  2PHC B;  3S14 C;  1JVI A;  4A3G C;  4BLA A;  1L0W A;  3GSI A;  1G51 A;  3AQP A;  2FQT A;  4Y52 K;  3GTO A;  4KMU A;  5D4D A;  3A8I A;  3I4N C;  1TWH C;  4PAA A;  1IE0 A;  4KN4 A;  4A93 C;  2R92 A;  4IO9 S;  3S1N K;  1XZP B;  4WCE S;  2R7Z K;  1BGW A;  2WB1 D;  1HQM A;  3I4M C;  1TWG C;  3S1Q C;  3H3V D;  1VJE A;  4PAB A;  5C44 K;  3S16 K;  3AD8 C;  4A3B C;  1F93 A;  5IOQ A;  4A3C C;  5IYD C;  2ZUE A;  1O2F B;  3GTQ K;  1TWF A;  1WOO A;  3FOF A;  1VH2 A;  2P5M A;  3GTL K;  3GTL A;  4A3K C;  5IOT A;  1I6V A;  3K7A C;  1J6X A;  4Y7N K;  1SMY A;  3PIO S;  3HOY C;  3PO3 C;  2NVY A;  1C0A A;  5JVG S;  3GTP K;  1WCM A;  2RGR A;  3GTG C;  3OEP A;  2A68 A;  1YNN A;  3CF5 S;  1O26 A;  3L4J A;  4C3J C;  3HOW K;  1O25 A;  5IYC K;  3GEE A;  4KMA A;  3HOZ K;  5DM6 S;  1XPP A;  3H0G K;  3HKZ L;  3LPX A;  4G0V A;  2VUM C;  2E2I C;  1J6W A;  1HI9 A;  4J3N A;  3GEH A;  1XZQ A;  5CJ9 A;  3S2H C;  3S15 C;  3A8J A;  4MQ9 A;  2NVX A;  4GTC A;  3T00 A;  5C3E C;  1B4A A;  2O5I A;  4RMF A;  5HL7 S;  2Y0S L;  3AD9 C;  3GTO C;  3S1R C;  4KAW X;  4Q4Z A;  4A3E K;  4C3H C;  1VGX A;  4WFA S;  2GSU A;  4XSZ A;  2A6E A;  2R92 C;  1TWA K;  3LYW A;  1TWA A;  2PMZ L;  1USO A;  5IP7 K;  2XCQ A;  4A3F C;  3HOU K;  4X6A C;  2CFA B;  1UV7 A;  4Q5S A;  4C3I C;  3LAP A;  1TWF C;  5TMC A;  3ADA C;  1O2B A;  3ORE A;  4M1X A;  5IYB K;  3M3Y K;  5JVH S;  2JA5 K;  1IW7 A;  4G7Z A;  3TTG A;  2PPB A;  2NVY C;  1EQR A;  1WCM C;  3HOX C;  1FEU A;  2B63 A;  1X31 C;  1J98 A;  3M4O K;  1DCO A;  4QIW L;  5JFE A;  3GTM K;  3AQO A;  4WFB S;  1XZP A;  5DM7 S;  3HOW C;  3HOV K;  4C2M K;  3HXA A;  1Y1V K;  2WAQ L;  4GTB A;  1O29 A;  3S2D C;  5HQH A;  4IOC S;  1Y1W A;  3BP3 A;  3N0B A;  1EH1 A;  4A3J K;  5JVO A;  4MEY A;  2NVX C;  3GDZ A;  4G0U A;  4A3L C;  4WF9 S;  1O2A A;  1R9T C;  4BY7 C;  1ZVU A;  3N0C A;  5C4J K;  4LOW A;  1EK8 A;  4GTL A;  3S1M K;  5FJ8 K;  5IP9 C;  1PJ5 A;  4GT9 A;  1USM A;  3HKZ D;  1O28 A;  2NVT C;  4P9S A;  1TWC K;  5E68 A;  3GTK K;  3S17 K;  2GSO A;  4WJ4 A;  2E2H K;  1TWA C;  2JH3 A;  1BS2 A;  4KMH A;  4QJV B;  2JA8 C;  2R93 K;  2L5N A;  3T02 A;  3TFH A;  4BY1 K;  2R7Z A;  2Y3P A;  1VRQ C;  1I50 K;  5M5W K;  5HL8 A;  3DLL S;  4KB2 A;  3FOE A;  1IL2 A;  1GE9 A;  1K83 C;  4LLG A;  1IQ0 A;  3GTQ A;  5IYB C;  1V5V A;  1RU0 A;  1YNJ A;  4NOI A;  4A3I C;  2V6U A;  4XLN A;  4BBR K;  2PA8 L;  1DCH A;  2B63 C;  1I3Q K;  3GTP A;  4KMD A;  5EGH A;  4LQY A;  1XXC A;  2YU9 K;  3RZD K;  1J6V A;  3SZZ A;  1I6H K;  5FLM K;  1O24 A;  3FKI K;  4BBS K;  2CFA A;  2JA7 K;  2XCO A;  3H0G A;  3PIP S;  3CQZ C;  4BXX K;  3GTJ K;  3GTJ A;  1Y1W C;  5C4X C;  2ZJR S;  2V6S A;  3IPJ A;  3PO2 K;  1F7U A;  3L4K A;  2NVQ K;  1F7V A;  4A3D K;  4A3M K;  1WSV A;  4Y52 C;  1WQH A;  1F9N A;  2ZUF A;  4YFK A;  1KQ4 A;  1ZQ1 C;  2E2J K;  2D6F C;  1YX2 A; 
#chains in the Genus database with same CATH homology
 3S1N C;  4Y52 K;  4OIN A;  3GTM K;  4KMU A;  1BDF A;  5D4D A;  3HOW C;  3HOV K;  2R7Z C;  1SFO K;  3I4N C;  1TWH C;  4GZY A;  2NVY K;  4C2M K;  4G7O A;  2WB1 L;  1Y1V K;  2WAQ L;  1WCM K;  5C44 C;  4A3J C;  4QIW D;  3S16 C;  3HOX K;  5M3F K;  4A3G K;  4KN4 A;  4A93 C;  4JK1 A;  3S1N K;  3S2D C;  5C4J C;  4MEX A;  3GTQ C;  2R7Z K;  2WB1 D;  3S1M C;  1HQM A;  2WAQ D;  4YG2 A;  1TWG C;  3I4M C;  3S1Q C;  1TWH K;  2JA6 K;  3I4N K;  3H3V D;  3GTL C;  5C44 K;  4A3J K;  3S16 K;  4MEY A;  2NVX C;  4YFX A;  1TWC C;  4Y7N C;  3GTK C;  3S17 C;  3RZO C;  4A3L C;  4A93 K;  1R9T C;  2BE5 A;  3GTP C;  4A3B C;  4BY7 C;  3S2D K;  2E2H C;  4A3C C;  5IYD C;  5C4J K;  3GTQ K;  3S1M K;  5M5Y K;  4KN7 A;  4QJV A;  4OIP A;  1TWG K;  5FJ8 K;  4G7H A;  3S1Q K;  5IP9 C;  5TMF A;  2R93 C;  2O5J A;  3GTL K;  4A3K C;  3HKZ D;  1I6V A;  3K7A C;  4BY1 C;  5IYC C;  2NVT C;  1TWC K;  5M5X K;  4Y7N K;  2NVX K;  1SMY A;  3HOZ C;  3HOY C;  3PO3 C;  4A3L K;  1R9T K;  4A3B K;  3GTP K;  4BY7 K;  1I50 C;  2E2H K;  4A3C K;  5IYD K;  3H3V L;  1TWA C;  4LK1 A;  3GTG C;  2A68 A;  3H0G C;  1YNN A;  4QJV B;  2JA8 C;  5IP9 K;  2R93 K;  2PA8 D;  3S17 K;  4BXX C;  4A3K K;  4C3J C;  3GTJ C;  3HOW K;  3K7A K;  4BY1 K;  5IYC K;  2NVT K;  3DXJ A;  3HOZ K;  3HOY K;  3PO3 K;  4XLP A;  1I50 K;  5M5W K;  4BBR C;  1XPP A;  4LJZ A;  3GTG K;  3H0G K;  3HKZ L;  1K83 C;  2JA8 K;  1I3Q C;  2VUM C;  2E2I C;  2A6H A;  2CW0 A;  4LLG A;  4A3M C;  4C3J K;  4ZH4 A;  2YU9 C;  5IYB C;  3RZD C;  3I4M K;  1YNJ A;  4NOI A;  4A3I C;  1I6H C;  4XLN A;  4BBR K;  4A3E C;  5FLM C;  3S2H C;  3S15 C;  4MQ9 A;  2PA8 L;  3RZO K;  1K83 K;  3FKI C;  2B63 C;  4BBS C;  5C3E C;  1I3Q K;  2E2I K;  2VUM K;  3S14 K;  2O5I A;  2JA7 C;  4OIO A;  2Y0S L;  3RZD K;  2YU9 K;  3GTO C;  5M3M K;  3S1R C;  4A3I K;  3GTK K;  1I6H K;  5IP7 C;  4Q4Z A;  4A3E K;  5FLM K;  4C3H C;  3S15 K;  3WOD A;  3PO2 C;  3HOU C;  4XSZ A;  3FKI K;  2B63 K;  4BBS K;  4YFN A;  5C3E K;  2Y0S D;  2A6E A;  2NVQ C;  2R92 C;  1TWA K;  2A69 A;  2JA7 K;  3GTO K;  3S1R K;  3CQZ C;  4A3D C;  2PMZ L;  5IP7 K;  4BXX K;  3GTJ K;  4C3H K;  1Y1W C;  2JA6 C;  5C4X C;  3M3Y C;  4OIQ A;  4A3F C;  3PO2 K;  4AYB D;  1ZYR A;  3HOU K;  2JA5 C;  4X6A C;  2NVQ K;  2R92 K;  2PMZ D;  2E2J C;  4Q5S A;  4C3I C;  3CQZ K;  4A3D K;  4XSX A;  4A3M K;  1TWF C;  5TMC A;  3M4O C;  5C4X K;  1Y1W K;  5IYB K;  3M3Y K;  4Y52 C;  3GTM C;  4A3F K;  4OIR A;  3EQL A;  4LK0 A;  3HOV C;  2JA5 K;  1IW7 A;  4X6A K;  4G7Z A;  1SFO C;  4YFK A;  2PPB A;  3S2H K;  2NVY C;  2E2J K;  4C2M C;  4C3I K;  3S14 C;  1Y1V C;  4A3G C;  1WCM C;  3HOX C;  4AYB L;  1TWF K;  3M4O K;  4QIW L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...