4OIRA

Crystal structure of thermus thermophilus rna polymerase transcription initiation complex soaked with ge23077 and rifamycin sv
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
231
structure length
231
Chain Sequence
SKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQAAAVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title GE23077 binds to the RNA polymerase 'i' and 'i+1' sites and prevents the binding of initiating nucleotides.
pubmed rcsb
source organism Thermus thermophilus
molecule tags Transcription, transferase/antibiotic
molecule keywords DNA-directed RNA polymerase subunit alpha
total genus 49
structure length 231
sequence length 231
chains with identical sequence B
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2014-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01000 RNA_pol_A_bac RNA polymerase Rpb3/RpoA insert domain
A PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.12 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 DNA-directed RNA polymerase, insert domain 4oirA02
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 4oirA01
3FKIK 3HOYC 5C4JC 2YU9C 1IW7A 1R9TK 4BXXK 1YNNA 3HKZD 3GTPC 2NVYK 3GTQK 3GTOK 2PMZL 4YFNA 3S1RK 2JA5C 3PO3C 3S2DK 3DXJA 5C4XC 4X6AC 4GZYA 2JA6K 1I6HK 1TWAC 2R93C 4BBSC 3I4NC 3CQZK 5IP9K 2VUMK 3S1NC 4XSZA 4AYBD 1TWHK 1I3QC 3S14K 3GTKC 4C3HK 2E2IK 4A3GC 2B63K 3HOYK 4QIWD 4A3CK 3HOWK 3HOXC 4LLGA 3GTJK 3S14C 3S15K 3PO2C 4A3MK 2CW0A 3GTMC 4AYBL 3M4OC 1YNJA 4MEXA 4YG2A 3GTLC 1SFOK 4BY1K 1Y1WK 4C2MK 2E2JK 5TMCA 5C3EK 4X6AK 3S2HK 4A3LK 1K83C 3S1RC 3PO3K 5TMFA 1SFOC 2O5IA 4A3DC 3GTLK 3H0GC 3FKIC 2NVQK 1TWGK 5C4JK 4OINA 2VUMC 3GTGK 1BDFA 4Y52C 4A3EC 5M3MK 3HOUC 4BBSK 2PA8L 3RZOC 1TWGC 1I50C 2R7ZC 3RZDK 4A3BK 2JA6C 4OIOA 4OIPA 5C44C 1I6HC 3HOWC 3GTJC 1XPPA 4A3IK 4C3IK 4A3CC 4G7HA 2BE5A 1Y1WC 2E2JC 4G7OA 4JK1A 1R9TC 4A3KK 3H3VL 1K83K 3S1NK 4A3IC 3K7AK 3HKZL 2WAQD 3HOVC 4A3JC 5IP7C 5IYBK 5M5YK 2R93K 3K7AC 3HOUK 1WCMC 4Y7NC 4NOIA 2PA8D 3HOZC 3M3YK 4BBRK 4YFKA 3H0GK 4BXXC 5FLMK 5D4DA 2NVYC 3GTQC 1I3QK 1TWCK 2JA7K 4Y7NK 2E2HK 4C3IC 3GTPK 1WCMK 2B63C 3H3VD 4BY1C 2WB1D 4C2MC 3S1QK 2A68A 1ZYRA 5IYDK 3RZOK 4OIQA 3EQLA 2NVQC 2NVTC 4A93C 4XSXA 5M5WK 4G7ZA 5C4XK 4A3FK 3HOXK 4A3GK 2JA8C 5C44K 5FLMC 2JA7C 1SMYA 2NVTK 4A93K 1I6VA 3S17C 3S16K 1Y1VC 5IYCK 5M5XK 3CQZC 5IP9C 4A3JK 3I4NK 3M4OK 4A3MC 4YFXA 3GTGC 3PO2K 4A3EK 4Y52K 5IYDC 3S1MC 3S17K 2NVXC 4KN7A 4LJZA 4KMUA 5C3EC 2R92C 1TWCC 3S2HC 4A3LC 2E2HC 3GTOC 4LK1A 4XLPA 2NVXK 3S1MK 2YU9K 4Q4ZA 4QJVA 4QIWL 3M3YC 3HOZK 3GTMK 1TWFC 4KN4A 4C3JK 5M3FK 2PPBA 3S16C 1I50K 2R7ZK 5IYCC 1Y1VK 4MEYA 4MQ9A 1TWAK 5IP7K 5FJ8K 4XLNA 3S15C 1TWFK 2JA8K 2A69A 4LK0A 4A3FC 4BY7C 4Q5SA 2O5JA 2Y0SL 4A3DK 4A3KC 4C3HC 2E2IC 2WB1L 3GTKK 2A6HA 4BBRC 1TWHC 2R92K 4BY7K 2WAQL 2PMZD 4QJVB 4OIRA 3I4MC 2A6EA 3RZDC 4A3BC 3WODA 3HOVK 5IYBC 3S1QC 4ZH4A 4C3JC 1HQMA 3S2DC 2Y0SD 3I4MK 2JA5K
chains in the Genus database with same CATH superfamily
5EGEA 5HQHA 4BXXK 3HKZD 4GTDA 4KM9A 1TWHA 4YFNA 3GEHA 5C4XC 5IOQA 1G51A 4KC6A 3CQZK 2VUMK 4AYBD 5EGHA 1K83A 2D6FC 4GTCA 3HOXC 5DM6S 4LLGA 3GTJK 2R93A 4U67S 3CQZA 3GDZA 1YNJA 4PAAA 3GTLC 1BGWA 5TMCA 3PIOS 4A3LK 3PO3K 1JVIA 1SFOC 2O5IA 2ZJRS 3FKIC 2NVQK 1EI6A 3GTGK 1BDFA 4GTLA 4BBSK 2R7ZC 4KASA 3AQPA 5C44C 4LR2A 4C3IK 2GSNA 4A3IC 4GTBA 3GSIA 4WILA 4A3JC 4GFQA 3LYWA 3N3YA 2GAGC 1XZQB 1RU0A 4NOIA 4BBRK 1F9NA 5FLMK 3A8KA 2KXYA 3GTPK 1TWCK 2E2HK 4C3IC 1Y1WA 1EFWA 4BY1C 1DD5A 2R7ZA 1ZYRA 3AD8C 1USOA 3EQLA 4G7ZA 5C4XK 1FEUA 1O2BA 5C44K 2JA7C 4C45A 2NVTK 1B4AA 3S17C 3S16K 3LAPA 3I4NK 5IORA 3PO2K 4YFXA 2NVYA 3GTQA 3S1MC 4KN7A 1USMA 2JA6A 3GTOC 3FHZA 1EH1A 1X31C 1TWFC 3MMLB 1WSVA 5M3FK 4GTEA 1I50K 1ZXOA 1F7UA 4MQ9A 3ADAC 5IP7K 4XLNA 2JA8K 4WJ4A 3GTJA 2JH3A 2NVXA 2Y0SL 4A3DK 2WB1L 1R9TA 1O24A 1ISEA 3AD9C 4IOAS 4QJVB 1UV7A 4KMHA 3I4MK 2JA5K 2YU9C 3GTPC 4P5AA 4J3NA 3PO3C 3BUEA 3S2DK 1TWAC 4KAWX 5E68A 4GT9A 3TFIA 5HL7S 1O25A 3GTMA 4IOCS 4XSZA 1TWHK 3S14K 1O2AA 4A3GC 2KQ1A 4QIWD 3HOWK 3S14C 3S15K 5DM7S 2RH6A 3DLLS 2ZUFA 3PO2C 2CW0A 4AYBL 3M4OC 4P5BA 3VA7A 3N0BA 2PHCB 1Y1WK 1K83C 3GEIA 2JA5A 3GTLK 5C4JK 4WFNS 4Y52C 3GIRA 3HOUC 2PA8L 1TWGC 2ZUEA 2JA6C 1I6HC 4G0UA 3G4CA 2CFAB 3GTJC 3N0CA 1O27A 3L4JA 5IOTA 2E2JC 1R9TC 3H0GA 1J98A 1IBAA 3GTPA 2WAQD 3HOVC 3TFJA 3HOUK 4Y7NC 2PA8D 2V6SA 4YFKA 1PJ6A 5D4DA 1I3QK 1F93A 1WCMK 1WOOA 3H3VD 5HL8A 2XCOA 2A68A 4WF9S 3GEEA 5CJ9A 1GE9A 2NVTC 2R92A 4XSXA 3SZYA 2JA8C 5L46A 4KATA 1I6VA 4IO9S 1V5VA 4A3JK 4BLAA 2KWAA 4A3EK 5IYDC 3S17K 4KMUA 1EQRA 5C3EC 1TWCC 3S2HC 5TJ3A 1VRQC 4XLPA 3S1MK 2YU9K 4Q4ZA 4QJVA 3HOZK 4KMDA 1WQHA 3AH5A 4KN4A 3GTMK 2V6UA 1WQFA 1EK8A 5IYCC 1Y1VK 5CHPA 4MEYA 1TWAK 2E2IA 2ZJQS 3PIPS 4BY7C 3AQOA 4GTAA 1TWHC 1J6VA 2R92K 2PMZD 1HI9A 3RZDC 3WODA 4KARA 1HQMA 2FQOA 2Y0SD 1VJEA 3FKIK 1IW7A 1R9TK 1YNNA 2NVYK 3GTQK 3GTOK 1O28A 2L3UA 1WORA 3S1RK 5IOSA 3DXJA 1WSRA 2B63A 4X6AC 1WIHA 2R93C 3I4NC 4KM8A 3GTOA 1I3QC 2CFAA 2B63K 1IS1A 3T01A 3GTLA 3A8IA 1XZPA 4KB2A 3V4GA 3FOFA 4MEXA 1SFOK 4BY1K 2P5MA 1O29A 5C3EK 3S2HK 4WFAS 3TTGA 3JSTA 4A3DC 3AD7C 4A3EC 3T02A 1IL2A 5JVOA 3RZOC 1I50C 4A3BK 4RMFA 5JVHS 3HOWC 1XPPA 4XCHA 3CF5S 4A3IK 4A3CC 3BP8C 4A3KK 2JA7A 4GTFA 1XXBA 3HKZL 1DCOA 1C0AA 5M5YK 2L5NA 3OPFA 1YX2A 1WCMC 1J6XA 3M3YK 3H0GK 4KMAA 2JA7K 1XZPB 1SFOA 3OEPA 1I50A 2WB1D 1Y1VA 3LPXA 2RGRA 1ZVUA 1TWGA 3GTGA 1KQ4A 2NVQC 3FOEA 5M5WK 5JFEA 4A3FK 2FQTA 2XCQA 3HOXK 4A3GK 5FLMC 4A93K 1PJ7A 5M5XK 3CQZC 1O26A 4A3MC 4Y52K 4PABA 2XCRB 1AB4A 1ZBSA 1TWFA 4LK1A 3GTKA 4QIWL 3M3YC 2VUMA 4WFBS 2PPBA 3S16C 2R7ZK 4KB4A 1IQ0A 3LAJA 5FJ8K 3S15C 4LK0A 4Q5SA 1VGXA 1L0WA 4A3KC 1VH2A 2ZFZA 1INNA 1O2FB 4A3BC 3HOVK 5IYBC 3S1QC 4ZH4A 3OREA 3T00A 3HOYC 5C4JC 1DCHA 4BKWA 2PMZL 2GSOA 2JA5C 1WOSA 4GZYA 2JA6K 1I6HK 4G0VA 1JQWA 4BBSC 3FKIA 2KPUA 5IP9K 3ERED 3S1NC 3GTKC 2EBBA 4C3HK 2E2IK 4A3CK 3HXAA 3HOYK 3CAGA 3TFHA 4WCES 2V6TA 4A3MK 3GTMC 2GAHC 4YG2A 1JOEA 2E2JK 4C2MK 4X6AK 3S1RC 5TMFA 1BS2A 3L4KA 3H0GC 1TWGK 4OINA 2VUMC 5M3MK 4P9SA 1XXCA 1B4BA 1XZQA 4DDQA 3RZDK 4OIOA 4OIPA 1DCPA 4G7HA 2BE5A 1Y1WC 4G7OA 4JK1A 3H3VL 1K83K 3S1NK 2E2HA 3K7AK 1BJTA 3A8JA 3NUHA 4WJ3M 3SZZA 1J6WA 5IP7C 4BLBA 5IYBK 2R93K 3K7AC 2W7VA 1XXAA 4AH6A 3HOZC 4O2DA 4BXXC 2ZJPS 2NVYC 3GTQC 4Y7NK 2B63C 4C2MC 1TWAA 1ZQ1C 3S1QK 5IYDK 3RZOK 4LQYA 4KDDA 4OIQA 3Q3QA 4ILDA 4A93C 1I3QA 3S0XA 4FM9A 4FZBA 1SMYA 1PJ5A 3G4AA 1WQGA 1Y1VC 5IYCK 5IP9C 3M4OK 3GTGC 4LOWA 2Y3PA 2NVXC 4LJZA 2R92C 1F7VA 4A3LC 2E2HC 2NVXK 4M1XA 1YCLA 1WOPA 1TWCA 4C3JK 1WCMA 1TWFK 2A69A 4A3FC 2O5JA 2YU9A 4C3HC 3BP3A 2E2IC 3GTKK 2A6HA 4BBRC 5JVGS 4G0WA 4BY7K 2WAQL 4OIRA 3I4MC 3QX3A 2A6EA 1IE0A 1VLOA 2P8TA 3IPJA 4C3JC 2GSUA 3S2DC
chains in the Genus database with same CATH topology
3FKIK 3HOYC 5C4JC 2YU9C 1IW7A 1R9TK 4BXXK 1YNNA 3HKZD 3GTPC 2NVYK 3GTQK 3GTOK 2PMZL 4YFNA 3S1RK 2JA5C 3PO3C 3S2DK 3DXJA 5C4XC 4X6AC 4GZYA 2JA6K 1I6HK 1TWAC 2R93C 4BBSC 3I4NC 3CQZK 5IP9K 2VUMK 3S1NC 4XSZA 4AYBD 1TWHK 1I3QC 3S14K 3GTKC 4C3HK 2E2IK 4A3GC 2B63K 3HOYK 4QIWD 4A3CK 3HOWK 3HOXC 4LLGA 3GTJK 3S14C 3S15K 3PO2C 4A3MK 2CW0A 3GTMC 4AYBL 3M4OC 1YNJA 4MEXA 4YG2A 3GTLC 1SFOK 4BY1K 1Y1WK 4C2MK 2E2JK 5TMCA 5C3EK 4X6AK 3S2HK 4A3LK 1K83C 3S1RC 3PO3K 5TMFA 1SFOC 2O5IA 4A3DC 3GTLK 3H0GC 3FKIC 2NVQK 1TWGK 5C4JK 4OINA 2VUMC 3GTGK 1BDFA 4Y52C 4A3EC 5M3MK 3HOUC 4BBSK 2PA8L 3RZOC 1TWGC 1I50C 2R7ZC 3RZDK 4A3BK 2JA6C 4OIOA 4OIPA 5C44C 1I6HC 3HOWC 3GTJC 1XPPA 4A3IK 4C3IK 4A3CC 4G7HA 2BE5A 1Y1WC 2E2JC 4G7OA 4JK1A 1R9TC 4A3KK 3H3VL 1K83K 3S1NK 4A3IC 3K7AK 3HKZL 2WAQD 3HOVC 4A3JC 5IP7C 5IYBK 5M5YK 2R93K 3K7AC 3HOUK 1WCMC 4Y7NC 4NOIA 2PA8D 3HOZC 3M3YK 4BBRK 4YFKA 3H0GK 4BXXC 5FLMK 5D4DA 2NVYC 3GTQC 1I3QK 1TWCK 2JA7K 4Y7NK 2E2HK 4C3IC 3GTPK 1WCMK 2B63C 3H3VD 4BY1C 2WB1D 4C2MC 3S1QK 2A68A 1ZYRA 5IYDK 3RZOK 4OIQA 3EQLA 2NVQC 2NVTC 4A93C 4XSXA 5M5WK 4G7ZA 5C4XK 4A3FK 3HOXK 4A3GK 2JA8C 5C44K 5FLMC 2JA7C 1SMYA 2NVTK 4A93K 1I6VA 3S17C 3S16K 1Y1VC 5IYCK 5M5XK 3CQZC 5IP9C 4A3JK 3I4NK 3M4OK 4A3MC 4YFXA 3GTGC 3PO2K 4A3EK 4Y52K 5IYDC 3S1MC 3S17K 2NVXC 4KN7A 4LJZA 4KMUA 5C3EC 2R92C 1TWCC 3S2HC 4A3LC 2E2HC 3GTOC 4LK1A 4XLPA 2NVXK 3S1MK 2YU9K 4Q4ZA 4QJVA 4QIWL 3M3YC 3HOZK 3GTMK 1TWFC 4KN4A 4C3JK 5M3FK 2PPBA 3S16C 1I50K 2R7ZK 5IYCC 1Y1VK 4MEYA 4MQ9A 1TWAK 5IP7K 5FJ8K 4XLNA 3S15C 1TWFK 2JA8K 2A69A 4LK0A 4A3FC 4BY7C 4Q5SA 2O5JA 2Y0SL 4A3DK 4A3KC 4C3HC 2E2IC 2WB1L 3GTKK 2A6HA 4BBRC 1TWHC 2R92K 4BY7K 2WAQL 2PMZD 4QJVB 4OIRA 3I4MC 2A6EA 3RZDC 4A3BC 3WODA 3HOVK 5IYBC 3S1QC 4ZH4A 4C3JC 1HQMA 3S2DC 2Y0SD 3I4MK 2JA5K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FKI K;  3HOY C;  5C4J C;  2YU9 C;  1IW7 A;  1R9T K;  4BXX K;  1YNN A;  3HKZ D;  3GTP C;  2NVY K;  3GTQ K;  3GTO K;  2PMZ L;  4YFN A;  3S1R K;  2JA5 C;  3PO3 C;  3S2D K;  3DXJ A;  5C4X C;  4X6A C;  4GZY A;  2JA6 K;  1I6H K;  1TWA C;  2R93 C;  4BBS C;  3I4N C;  3CQZ K;  5IP9 K;  2VUM K;  3S1N C;  4XSZ A;  4AYB D;  1TWH K;  1I3Q C;  3S14 K;  3GTK C;  4C3H K;  2E2I K;  4A3G C;  2B63 K;  3HOY K;  4QIW D;  4A3C K;  3HOW K;  3HOX C;  4LLG A;  3GTJ K;  3S14 C;  3S15 K;  3PO2 C;  4A3M K;  2CW0 A;  3GTM C;  4AYB L;  3M4O C;  1YNJ A;  4MEX A;  4YG2 A;  3GTL C;  1SFO K;  4BY1 K;  1Y1W K;  4C2M K;  2E2J K;  5TMC A;  5C3E K;  4X6A K;  3S2H K;  4A3L K;  1K83 C;  3S1R C;  3PO3 K;  5TMF A;  1SFO C;  2O5I A;  4A3D C;  3GTL K;  3H0G C;  3FKI C;  2NVQ K;  1TWG K;  5C4J K;  4OIN A;  2VUM C;  3GTG K;  1BDF A;  4Y52 C;  4A3E C;  5M3M K;  3HOU C;  4BBS K;  2PA8 L;  3RZO C;  1TWG C;  1I50 C;  2R7Z C;  3RZD K;  4A3B K;  2JA6 C;  4OIO A;  4OIP A;  5C44 C;  1I6H C;  3HOW C;  3GTJ C;  1XPP A;  4A3I K;  4C3I K;  4A3C C;  4G7H A;  2BE5 A;  1Y1W C;  2E2J C;  4G7O A;  4JK1 A;  1R9T C;  4A3K K;  3H3V L;  1K83 K;  3S1N K;  4A3I C;  3K7A K;  3HKZ L;  2WAQ D;  3HOV C;  4A3J C;  5IP7 C;  5IYB K;  5M5Y K;  2R93 K;  3K7A C;  3HOU K;  1WCM C;  4Y7N C;  4NOI A;  2PA8 D;  3HOZ C;  3M3Y K;  4BBR K;  4YFK A;  3H0G K;  4BXX C;  5FLM K;  5D4D A;  2NVY C;  3GTQ C;  1I3Q K;  1TWC K;  2JA7 K;  4Y7N K;  2E2H K;  4C3I C;  3GTP K;  1WCM K;  2B63 C;  3H3V D;  4BY1 C;  2WB1 D;  4C2M C;  3S1Q K;  2A68 A;  1ZYR A;  5IYD K;  3RZO K;  4OIQ A;  3EQL A;  2NVQ C;  2NVT C;  4A93 C;  4XSX A;  5M5W K;  4G7Z A;  5C4X K;  4A3F K;  3HOX K;  4A3G K;  2JA8 C;  5C44 K;  5FLM C;  2JA7 C;  1SMY A;  2NVT K;  4A93 K;  1I6V A;  3S17 C;  3S16 K;  1Y1V C;  5IYC K;  5M5X K;  3CQZ C;  5IP9 C;  4A3J K;  3I4N K;  3M4O K;  4A3M C;  4YFX A;  3GTG C;  3PO2 K;  4A3E K;  4Y52 K;  5IYD C;  3S1M C;  3S17 K;  2NVX C;  4KN7 A;  4LJZ A;  4KMU A;  5C3E C;  2R92 C;  1TWC C;  3S2H C;  4A3L C;  2E2H C;  3GTO C;  4LK1 A;  4XLP A;  2NVX K;  3S1M K;  2YU9 K;  4Q4Z A;  4QJV A;  4QIW L;  3M3Y C;  3HOZ K;  3GTM K;  1TWF C;  4KN4 A;  4C3J K;  5M3F K;  2PPB A;  3S16 C;  1I50 K;  2R7Z K;  5IYC C;  1Y1V K;  4MEY A;  4MQ9 A;  1TWA K;  5IP7 K;  5FJ8 K;  4XLN A;  3S15 C;  1TWF K;  2JA8 K;  2A69 A;  4LK0 A;  4A3F C;  4BY7 C;  4Q5S A;  2O5J A;  2Y0S L;  4A3D K;  4A3K C;  4C3H C;  2E2I C;  2WB1 L;  3GTK K;  2A6H A;  4BBR C;  1TWH C;  2R92 K;  4BY7 K;  2WAQ L;  2PMZ D;  4QJV B;  4OIR A;  3I4M C;  2A6E A;  3RZD C;  4A3B C;  3WOD A;  3HOV K;  5IYB C;  3S1Q C;  4ZH4 A;  4C3J C;  1HQM A;  3S2D C;  2Y0S D;  3I4M K;  2JA5 K; 
#chains in the Genus database with same CATH topology
 5EGE A;  5HQH A;  4BXX K;  3HKZ D;  4GTD A;  4KM9 A;  1TWH A;  4YFN A;  3GEH A;  5C4X C;  5IOQ A;  1G51 A;  4KC6 A;  3CQZ K;  2VUM K;  4AYB D;  5EGH A;  1K83 A;  2D6F C;  4GTC A;  3HOX C;  5DM6 S;  4LLG A;  3GTJ K;  2R93 A;  4U67 S;  3CQZ A;  3GDZ A;  1YNJ A;  4PAA A;  3GTL C;  1BGW A;  5TMC A;  3PIO S;  4A3L K;  3PO3 K;  1JVI A;  1SFO C;  2O5I A;  2ZJR S;  3FKI C;  2NVQ K;  1EI6 A;  3GTG K;  1BDF A;  4GTL A;  4BBS K;  2R7Z C;  4KAS A;  3AQP A;  5C44 C;  4LR2 A;  4C3I K;  2GSN A;  4A3I C;  4GTB A;  3GSI A;  4WIL A;  4A3J C;  4GFQ A;  3LYW A;  3N3Y A;  2GAG C;  1XZQ B;  1RU0 A;  4NOI A;  4BBR K;  1F9N A;  5FLM K;  3A8K A;  2KXY A;  3GTP K;  1TWC K;  2E2H K;  4C3I C;  1Y1W A;  1EFW A;  4BY1 C;  1DD5 A;  2R7Z A;  1ZYR A;  3AD8 C;  1USO A;  3EQL A;  4G7Z A;  5C4X K;  1FEU A;  1O2B A;  5C44 K;  2JA7 C;  4C45 A;  2NVT K;  1B4A A;  3S17 C;  3S16 K;  3LAP A;  3I4N K;  5IOR A;  3PO2 K;  4YFX A;  2NVY A;  3GTQ A;  3S1M C;  4KN7 A;  1USM A;  2JA6 A;  3GTO C;  3FHZ A;  1EH1 A;  1X31 C;  1TWF C;  3MML B;  1WSV A;  5M3F K;  4GTE A;  1I50 K;  1ZXO A;  1F7U A;  4MQ9 A;  3ADA C;  5IP7 K;  4XLN A;  2JA8 K;  4WJ4 A;  3GTJ A;  2JH3 A;  2NVX A;  2Y0S L;  4A3D K;  2WB1 L;  1R9T A;  1O24 A;  1ISE A;  3AD9 C;  4IOA S;  4QJV B;  1UV7 A;  4KMH A;  3I4M K;  2JA5 K;  2YU9 C;  3GTP C;  4P5A A;  4J3N A;  3PO3 C;  3BUE A;  3S2D K;  1TWA C;  4KAW X;  5E68 A;  4GT9 A;  3TFI A;  5HL7 S;  1O25 A;  3GTM A;  4IOC S;  4XSZ A;  1TWH K;  3S14 K;  1O2A A;  4A3G C;  2KQ1 A;  4QIW D;  3HOW K;  3S14 C;  3S15 K;  5DM7 S;  2RH6 A;  3DLL S;  2ZUF A;  3PO2 C;  2CW0 A;  4AYB L;  3M4O C;  4P5B A;  3VA7 A;  3N0B A;  2PHC B;  1Y1W K;  1K83 C;  3GEI A;  2JA5 A;  3GTL K;  5C4J K;  4WFN S;  4Y52 C;  3GIR A;  3HOU C;  2PA8 L;  1TWG C;  2ZUE A;  2JA6 C;  1I6H C;  4G0U A;  3G4C A;  2CFA B;  3GTJ C;  3N0C A;  1O27 A;  3L4J A;  5IOT A;  2E2J C;  1R9T C;  3H0G A;  1J98 A;  1IBA A;  3GTP A;  2WAQ D;  3HOV C;  3TFJ A;  3HOU K;  4Y7N C;  2PA8 D;  2V6S A;  4YFK A;  1PJ6 A;  5D4D A;  1I3Q K;  1F93 A;  1WCM K;  1WOO A;  3H3V D;  5HL8 A;  2XCO A;  2A68 A;  4WF9 S;  3GEE A;  5CJ9 A;  1GE9 A;  2NVT C;  2R92 A;  4XSX A;  3SZY A;  2JA8 C;  5L46 A;  4KAT A;  1I6V A;  4IO9 S;  1V5V A;  4A3J K;  4BLA A;  2KWA A;  4A3E K;  5IYD C;  3S17 K;  4KMU A;  1EQR A;  5C3E C;  1TWC C;  3S2H C;  5TJ3 A;  1VRQ C;  4XLP A;  3S1M K;  2YU9 K;  4Q4Z A;  4QJV A;  3HOZ K;  4KMD A;  1WQH A;  3AH5 A;  4KN4 A;  3GTM K;  2V6U A;  1WQF A;  1EK8 A;  5IYC C;  1Y1V K;  5CHP A;  4MEY A;  1TWA K;  2E2I A;  2ZJQ S;  3PIP S;  4BY7 C;  3AQO A;  4GTA A;  1TWH C;  1J6V A;  2R92 K;  2PMZ D;  1HI9 A;  3RZD C;  3WOD A;  4KAR A;  1HQM A;  2FQO A;  2Y0S D;  1VJE A;  3FKI K;  1IW7 A;  1R9T K;  1YNN A;  2NVY K;  3GTQ K;  3GTO K;  1O28 A;  2L3U A;  1WOR A;  3S1R K;  5IOS A;  3DXJ A;  1WSR A;  2B63 A;  4X6A C;  1WIH A;  2R93 C;  3I4N C;  4KM8 A;  3GTO A;  1I3Q C;  2CFA A;  2B63 K;  1IS1 A;  3T01 A;  3GTL A;  3A8I A;  1XZP A;  4KB2 A;  3V4G A;  3FOF A;  4MEX A;  1SFO K;  4BY1 K;  2P5M A;  1O29 A;  5C3E K;  3S2H K;  4WFA S;  3TTG A;  3JST A;  4A3D C;  3AD7 C;  4A3E C;  3T02 A;  1IL2 A;  5JVO A;  3RZO C;  1I50 C;  4A3B K;  4RMF A;  5JVH S;  3HOW C;  1XPP A;  4XCH A;  3CF5 S;  4A3I K;  4A3C C;  3BP8 C;  4A3K K;  2JA7 A;  4GTF A;  1XXB A;  3HKZ L;  1DCO A;  1C0A A;  5M5Y K;  2L5N A;  3OPF A;  1YX2 A;  1WCM C;  1J6X A;  3M3Y K;  3H0G K;  4KMA A;  2JA7 K;  1XZP B;  1SFO A;  3OEP A;  1I50 A;  2WB1 D;  1Y1V A;  3LPX A;  2RGR A;  1ZVU A;  1TWG A;  3GTG A;  1KQ4 A;  2NVQ C;  3FOE A;  5M5W K;  5JFE A;  4A3F K;  2FQT A;  2XCQ A;  3HOX K;  4A3G K;  5FLM C;  4A93 K;  1PJ7 A;  5M5X K;  3CQZ C;  1O26 A;  4A3M C;  4Y52 K;  4PAB A;  2XCR B;  1AB4 A;  1ZBS A;  1TWF A;  4LK1 A;  3GTK A;  4QIW L;  3M3Y C;  2VUM A;  4WFB S;  2PPB A;  3S16 C;  2R7Z K;  4KB4 A;  1IQ0 A;  3LAJ A;  5FJ8 K;  3S15 C;  4LK0 A;  4Q5S A;  1VGX A;  1L0W A;  4A3K C;  1VH2 A;  2ZFZ A;  1INN A;  1O2F B;  4A3B C;  3HOV K;  5IYB C;  3S1Q C;  4ZH4 A;  3ORE A;  3T00 A;  3HOY C;  5C4J C;  1DCH A;  4BKW A;  2PMZ L;  2GSO A;  2JA5 C;  1WOS A;  4GZY A;  2JA6 K;  1I6H K;  4G0V A;  1JQW A;  4BBS C;  3FKI A;  2KPU A;  5IP9 K;  3ERE D;  3S1N C;  3GTK C;  2EBB A;  4C3H K;  2E2I K;  4A3C K;  3HXA A;  3HOY K;  3CAG A;  3TFH A;  4WCE S;  2V6T A;  4A3M K;  3GTM C;  2GAH C;  4YG2 A;  1JOE A;  2E2J K;  4C2M K;  4X6A K;  3S1R C;  5TMF A;  1BS2 A;  3L4K A;  3H0G C;  1TWG K;  4OIN A;  2VUM C;  5M3M K;  4P9S A;  1XXC A;  1B4B A;  1XZQ A;  4DDQ A;  3RZD K;  4OIO A;  4OIP A;  1DCP A;  4G7H A;  2BE5 A;  1Y1W C;  4G7O A;  4JK1 A;  3H3V L;  1K83 K;  3S1N K;  2E2H A;  3K7A K;  1BJT A;  3A8J A;  3NUH A;  4WJ3 M;  3SZZ A;  1J6W A;  5IP7 C;  4BLB A;  5IYB K;  2R93 K;  3K7A C;  2W7V A;  1XXA A;  4AH6 A;  3HOZ C;  4O2D A;  4BXX C;  2ZJP S;  2NVY C;  3GTQ C;  4Y7N K;  2B63 C;  4C2M C;  1TWA A;  1ZQ1 C;  3S1Q K;  5IYD K;  3RZO K;  4LQY A;  4KDD A;  4OIQ A;  3Q3Q A;  4ILD A;  4A93 C;  1I3Q A;  3S0X A;  4FM9 A;  4FZB A;  1SMY A;  1PJ5 A;  3G4A A;  1WQG A;  1Y1V C;  5IYC K;  5IP9 C;  3M4O K;  3GTG C;  4LOW A;  2Y3P A;  2NVX C;  4LJZ A;  2R92 C;  1F7V A;  4A3L C;  2E2H C;  2NVX K;  4M1X A;  1YCL A;  1WOP A;  1TWC A;  4C3J K;  1WCM A;  1TWF K;  2A69 A;  4A3F C;  2O5J A;  2YU9 A;  4C3H C;  3BP3 A;  2E2I C;  3GTK K;  2A6H A;  4BBR C;  5JVG S;  4G0W A;  4BY7 K;  2WAQ L;  4OIR A;  3I4M C;  3QX3 A;  2A6E A;  1IE0 A;  1VLO A;  2P8T A;  3IPJ A;  4C3J C;  2GSU A;  3S2D C; 
#chains in the Genus database with same CATH homology
 3FKI K;  3HOY C;  5C4J C;  2YU9 C;  1IW7 A;  1R9T K;  4BXX K;  1YNN A;  3HKZ D;  3GTP C;  2NVY K;  3GTQ K;  3GTO K;  2PMZ L;  4YFN A;  3S1R K;  2JA5 C;  3PO3 C;  3S2D K;  3DXJ A;  5C4X C;  4X6A C;  4GZY A;  2JA6 K;  1I6H K;  1TWA C;  2R93 C;  4BBS C;  3I4N C;  3CQZ K;  5IP9 K;  2VUM K;  3S1N C;  4XSZ A;  4AYB D;  1TWH K;  1I3Q C;  3S14 K;  3GTK C;  4C3H K;  2E2I K;  4A3G C;  2B63 K;  3HOY K;  4QIW D;  4A3C K;  3HOW K;  3HOX C;  4LLG A;  3GTJ K;  3S14 C;  3S15 K;  3PO2 C;  4A3M K;  2CW0 A;  3GTM C;  4AYB L;  3M4O C;  1YNJ A;  4MEX A;  4YG2 A;  3GTL C;  1SFO K;  4BY1 K;  1Y1W K;  4C2M K;  2E2J K;  5TMC A;  5C3E K;  4X6A K;  3S2H K;  4A3L K;  1K83 C;  3S1R C;  3PO3 K;  5TMF A;  1SFO C;  2O5I A;  4A3D C;  3GTL K;  3H0G C;  3FKI C;  2NVQ K;  1TWG K;  5C4J K;  4OIN A;  2VUM C;  3GTG K;  1BDF A;  4Y52 C;  4A3E C;  5M3M K;  3HOU C;  4BBS K;  2PA8 L;  3RZO C;  1TWG C;  1I50 C;  2R7Z C;  3RZD K;  4A3B K;  2JA6 C;  4OIO A;  4OIP A;  5C44 C;  1I6H C;  3HOW C;  3GTJ C;  1XPP A;  4A3I K;  4C3I K;  4A3C C;  4G7H A;  2BE5 A;  1Y1W C;  2E2J C;  4G7O A;  4JK1 A;  1R9T C;  4A3K K;  3H3V L;  1K83 K;  3S1N K;  4A3I C;  3K7A K;  3HKZ L;  2WAQ D;  3HOV C;  4A3J C;  5IP7 C;  5IYB K;  5M5Y K;  2R93 K;  3K7A C;  3HOU K;  1WCM C;  4Y7N C;  4NOI A;  2PA8 D;  3HOZ C;  3M3Y K;  4BBR K;  4YFK A;  3H0G K;  4BXX C;  5FLM K;  5D4D A;  2NVY C;  3GTQ C;  1I3Q K;  1TWC K;  2JA7 K;  4Y7N K;  2E2H K;  4C3I C;  3GTP K;  1WCM K;  2B63 C;  3H3V D;  4BY1 C;  2WB1 D;  4C2M C;  3S1Q K;  2A68 A;  1ZYR A;  5IYD K;  3RZO K;  4OIQ A;  3EQL A;  2NVQ C;  2NVT C;  4A93 C;  4XSX A;  5M5W K;  4G7Z A;  5C4X K;  4A3F K;  3HOX K;  4A3G K;  2JA8 C;  5C44 K;  5FLM C;  2JA7 C;  1SMY A;  2NVT K;  4A93 K;  1I6V A;  3S17 C;  3S16 K;  1Y1V C;  5IYC K;  5M5X K;  3CQZ C;  5IP9 C;  4A3J K;  3I4N K;  3M4O K;  4A3M C;  4YFX A;  3GTG C;  3PO2 K;  4A3E K;  4Y52 K;  5IYD C;  3S1M C;  3S17 K;  2NVX C;  4KN7 A;  4LJZ A;  4KMU A;  5C3E C;  2R92 C;  1TWC C;  3S2H C;  4A3L C;  2E2H C;  3GTO C;  4LK1 A;  4XLP A;  2NVX K;  3S1M K;  2YU9 K;  4Q4Z A;  4QJV A;  4QIW L;  3M3Y C;  3HOZ K;  3GTM K;  1TWF C;  4KN4 A;  4C3J K;  5M3F K;  2PPB A;  3S16 C;  1I50 K;  2R7Z K;  5IYC C;  1Y1V K;  4MEY A;  4MQ9 A;  1TWA K;  5IP7 K;  5FJ8 K;  4XLN A;  3S15 C;  1TWF K;  2JA8 K;  2A69 A;  4LK0 A;  4A3F C;  4BY7 C;  4Q5S A;  2O5J A;  2Y0S L;  4A3D K;  4A3K C;  4C3H C;  2E2I C;  2WB1 L;  3GTK K;  2A6H A;  4BBR C;  1TWH C;  2R92 K;  4BY7 K;  2WAQ L;  2PMZ D;  4QJV B;  4OIR A;  3I4M C;  2A6E A;  3RZD C;  4A3B C;  3WOD A;  3HOV K;  5IYB C;  3S1Q C;  4ZH4 A;  4C3J C;  1HQM A;  3S2D C;  2Y0S D;  3I4M K;  2JA5 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...