2O5IA

Crystal structure of the t. thermophilus rna polymerase elongation complex
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
229
structure length
229
Chain Sequence
MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for transcription elongation by bacterial RNA polymerase.
pubmed doi rcsb
molecule tags Transferase/dna-rna hybrid
molecule keywords 5'-D(P*CP*CP*CP*TP*GP*TP*CP*TP*GP*GP*CP*GP*TP*TP*CP*GP*CP*GP
total genus 39
structure length 229
sequence length 229
chains with identical sequence B, K, L
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2006-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01000 RNA_pol_A_bac RNA polymerase Rpb3/RpoA insert domain
A PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain
A PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.12 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 DNA-directed RNA polymerase, insert domain 2o5iA02
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 2o5iA01
5FJ8K 2A6EA 3GTMC 3HKZD 3H0GK 3RZDK 1WCMK 3S1QK 4A3BK 2JA6K 2JA5C 4MEXA 1TWHK 3K7AC 3HOVC 4C3HK 3HOWK 5IYCC 4G7HA 3HOYK 1Y1WC 5C4XK 4XSXA 3HKZL 3FKIC 4KMUA 4A3EK 3S17K 5IYBC 2PPBA 4A3CK 2NVQC 1I50C 4BBSK 5TMFA 2B63K 4OIOA 3HOZK 4OINA 3PO3C 1K83K 1TWFK 3S2DK 3S16C 4BBRK 4QJVB 1YNNA 2A68A 2WB1D 3GTJK 1R9TK 2YU9K 1I6HC 5M3FK 2E2HK 5C44K 3M3YK 1I3QK 2PA8L 4X6AK 1I6VA 1I3QC 3M3YC 1SFOC 4G7ZA 2E2HC 1I6HK 3GTJC 2YU9C 3GTGK 2O5IA 5M3MK 4A3FC 2JA7C 3I4NC 5IYDC 3S2DC 1K83C 4ZH4A 4XLNA 4A3IC 3HOZC 5M5WK 5M5XK 3PO3K 5TMCA 4BBSC 1I50K 2NVQK 3S17C 4A3CC 4XSZA 5C4XC 1Y1WK 5IYCK 4C3HC 3EQLA 4MQ9A 4C3IC 1SMYA 4Y7NC 2JA6C 5M5YK 4A3DK 4YFNA 2BE5A 2PMZD 3RZDC 2E2JC 3S1MK 5FLMC 4A3GC 2E2IC 3I4MK 4YFKA 1TWCC 4OIQA 5IP9K 4JK1A 1HQMA 2WAQL 2NVYC 4QJVA 5IYDK 3GTKK 2PMZL 4OIRA 4A93K 1Y1VC 2NVXC 3S1RK 3RZOK 4Q5SA 3HOUK 1ZYRA 5C3EC 4G7OA 4A3LC 3S1NC 4AYBD 2R7ZC 2CW0A 4C2MK 5C4JC 3GTQK 3GTPK 2VUMK 4BY1K 3HOXC 4A3MC 1XPPA 3S14C 3S15K 5C4JK 2R7ZK 4KN4A 4BY7C 4BXXK 5C3EK 3HOUC 2R92C 2Y0SD 5D4DA 4YG2A 2NVTC 3RZOC 3S2HC 4A93C 1TWGK 5IP7K 3GTKC 4LLGA 2NVYK 1BDFA 4A3KC 5IP9C 1TWCK 3I4MC 3H3VL 4OIPA 4Y52K 3S1MC 2E2JK 4A3DC 1TWAK 4Y7NK 3M4OC 4C3IK 4A3JK 3GTLC 4LJZA 3CQZC 4C3JK 3PO2K 3H3VD 2R93K 2JA8K 3GTOK 3GTOC 4YFXA 2JA8C 2WB1L 2R93C 4C3JC 3PO2C 3CQZK 1IW7A 3GTLK 4MEYA 4A3IK 3M4OK 1TWAC 4A3JC 4LK1A 2PA8D 3I4NK 4A3FK 2JA7K 4Y52C 3GTGC 3DXJA 1SFOK 4QIWD 4A3KK 2O5JA 5IP7C 1YNJA 1TWGC 4X6AC 4LK0A 2NVTK 2R92K 3S2HK 5C44C 4BXXC 3WODA 4QIWL 1R9TC 4BY7K 4Q4ZA 4BBRC 3S16K 1TWFC 3S15C 3S14K 3HOXK 2B63C 4BY1C 4A3MK 2VUMC 4A3GK 4XLPA 2A69A 4C2MC 5IYBK 3GTPC 4A3EC 3GTQC 3FKIK 4AYBL 3HOYC 3S1NK 4A3LK 4GZYA 2A6HA 3HOWC 1TWHC 3S1RC 1Y1VK 3K7AK 2WAQD 2JA5K 2NVXK 3HOVK 4A3BC 1WCMC 3H0GC 3S1QC 4NOIA 3GTMK 4KN7A 2E2IK 5FLMK 2Y0SL
chains in the Genus database with same CATH superfamily
3JSTA 4ILDA 5FJ8K 1B4AA 4A3BK 2ZUEA 2KWAA 2JA5C 3MMLB 1TWHK 3HOWK 4C3HK 4IOCS 4GTEA 4LOWA 4KAWX 4A3EK 2PPBA 2P5MA 3TFIA 5DM7S 3G4AA 3S16C 2A68A 1YCLA 5IOTA 1I6HC 1PJ5A 4KMAA 2JA7A 2P8TA 1O25A 2PA8L 2PHCB 4AH6A 4G7ZA 1I6HK 1BJTA 3GTGK 2O5IA 3I4NC 4G0VA 4XLNA 4G0WA 3A8KA 3GTLA 1VLOA 3AH5A 3HXAA 4C3HC 3N3YA 4YFNA 2E2JC 2E2IC 5IP9K 4OIQA 2NVYC 4QJVA 4WFNS 2PMZL 3V4GA 4A93K 4Q5SA 1ZYRA 5C3EC 1UV7A 2JA5A 2R7ZC 1EK8A 3L4JA 2E2IA 1O27A 2KXYA 3AQPA 2R7ZK 2NVXA 5C3EK 2R92C 4BLBA 4A93C 1C0AA 2RH6A 5IOSA 5IP7K 2E2HA 1WQGA 2NVYK 4LLGA 1I3QA 5IP9C 1VJEA 4Y52K 2E2JK 1WOSA 4A3JK 3GTGA 3PO2K 2R93K 4YFXA 4C3JC 3CQZK 1IW7A 1TWFA 3GTLK 1EH1A 3I4NK 3GTGC 4C45A 1WQHA 3DXJA 2ZJQS 1B4BA 5L46A 3GEEA 2NVTK 4KM8A 3GEIA 4LR2A 3S16K 3S15C 3S14K 4A3MK 4KASA 4XLPA 3GTPC 4A3EC 1DCOA 4A3LK 3HOWC 1TWHC 2JA5K 2WAQD 4A3BC 1L0WA 4NOIA 3L4KA 5CHPA 4KN7A 4A3GK 1ZBSA 5JVGS 2A6EA 1KQ4A 3HKZD 1USMA 3A8IA 4BKWA 3K7AC 2ZJRS 1HI9A 3AQOA 3GTQA 5IYCC 4G7HA 3HOYK 4XSXA 3FKIC 4KMUA 4A3CK 2NVQC 1K83K 1TWFK 3S2DK 4P5BA 2GSOA 1XXAA 4GTFA 1F7VA 1WIHA 3GDZA 5EGHA 1I6VA 1ZXOA 1RU0A 3AD8C 3M3YC 4WFAS 2B63A 1EQRA 5M5WK 4A3IC 3HOZC 1I50K 1WOPA 1XXCA 3IPJA 4XSZA 5C4XC 1O26A 4KDDA 3EQLA 2Y3PA 1G51A 2JA6C 2L3UA 3S1MK 3RZDC 1DD5A 3N0BA 5FLMC 4JK1A 2WAQL 3FHZA 2NVXC 3S1RK 1EFWA 4G7OA 2JA6A 4AYBD 3GTQK 4C2MK 2ZFZA 2VUMK 4J3NA 5C4JK 2ZUFA 4IOAS 1PJ6A 1Y1VA 2GAHC 3BP3A 4BXXK 3S2HC 4WILA 1TWGK 1INNA 1XZQB 1ZQ1C 1BDFA 4A3KC 3T00A 1IBAA 1TWCK 1WOOA 3I4MC 4XCHA 1IL2A 3SZYA 4A3DC 4Y7NK 2YU9A 2GSUA 2JA8K 3GTOK 3GSIA 5HQHA 3PIPS 3M4OK 1TWAC 4LK1A 1O28A 3OPFA 3ERED 1VH2A 4A3FK 2JA7K 4DDQA 1I50A 1SFOK 4QIWD 1WSRA 4LK0A 1EI6A 1SFOA 1F7UA 5C44C 4BY7K 1XZQA 2KPUA 1O29A 3HOXK 4BY1C 3FOEA 1Y1WA 2A69A 3BUEA 5JVOA 1F9NA 3S1NK 1FEUA 4GZYA 2A6HA 1JQWA 1Y1VK 5IOQA 1WCMC 1AB4A 3GTMK 5IYDC 3H0GK 3S1QK 5EGEA 4MEXA 3HOVC 3H0GA 1Y1WC 1DCHA 3S17K 5IYBC 3GEHA 2FQOA 4GT9A 4BBSK 5TMFA 2B63K 5IORA 2R7ZA 3PO3C 3LPXA 4BBRK 2YU9K 4M1XA 3GTJK 1R9TK 1TWAA 5M3FK 2E2HK 3TFJA 1I3QK 4X6AK 5TJ3A 1I3QC 1USOA 1J6WA 1BS2A 1DCPA 3DLLS 2E2HC 1WQFA 3GTJC 2YU9C 1VRQC 4PABA 5M3MK 4WJ3M 2V6UA 4ZH4A 3PO3K 5M5XK 4RMFA 4BBSC 4IO9S 4KMHA 1X31C 1JOEA 4KMDA 3S17C 1Y1WK 1GE9A 4MQ9A 4C3IC 1SMYA 5DM6S 5M5YK 2BE5A 5IYDK 1HQMA 3S0XA 5JVHS 3FKIA 3Q3QA 3GTKK 1Y1VC 3RZOK 4LQYA 3HOUK 1XXBA 3S1NC 4WJ4A 1TWCA 4GTLA 4BY1K 3HOXC 4KATA 2XCRB 1WORA 2XCOA 3N0CA 4BY7C 3NUHA 3HOUC 1J6VA 2Y0SD 5D4DA 4YG2A 3RZOC 3GTJA 2FQTA 2V6SA 4BLAA 3GTKC 2E2IK 2D6FC 4WF9S 1XZPB 1IS1A 3H3VL 1O2AA 4KM9A 2GSNA 1TWAK 3M4OC 4C3IK 5HL7S 3GTOC 2JA8C 1ZVUA 2WB1L 1TWGA 3GIRA 3LYWA 1J98A 1J6XA 2ZJPS 2CFAA 4GTBA 4U67S 4A3KK 4KB4A 3BP8C 4X6AC 1TWGC 3S2HK 4BXXC 4QIWL 5HL8A 1R9TC 3OREA 4Q4ZA 3GTMA 4BBRC 1XZPA 3CAGA 5CJ9A 1F93A 2B63C 4FZBA 2VUMC 2V6TA 4C2MC 4KB2A 3GTQC 4AYBL 5IYBK 3G4CA 3HOVK 3S1RC 2NVXK 2R92A 4WCES 4P9SA 3H0GC 3S1QC 4GTAA 2VUMA 5FLMK 2NVYA 3GTMC 3RZDK 1WCMK 3PIOS 2JA6K 3GTPA 5C4XK 3HKZL 3LAPA 3TFHA 1I50C 4OIOA 3HOZK 4OINA 2JH3A 2RGRA 1O2BA 4QJVB 1YNNA 2WB1D 1K83A 5C44K 3M3YK 5E68A 3QX3A 4WFBS 1SFOC 4A3FC 2JA7C 3S2DC 3AD7C 3LAJA 1K83C 3GTOA 5TMCA 2NVQK 1V5VA 4A3CC 5IYCK 4Y7NC 4A3DK 2PMZD 2GAGC 3TTGA 4A3GC 3I4MK 4YFKA 1TWCC 4FM9A 4KC6A 4OIRA 4A3LC 1WSVA 3GTPK 2CW0A 5C4JC 3FOFA 2W7VA 4A3MC 1XPPA 3S14C 3S15K 1BGWA 4KN4A 4P5AA 3AD9C 4O2DA 1TWHA 2NVTC 1JVIA 3A8JA 2L5NA 1ISEA 1O24A 4OIPA 1PJ7A 3S1MC 1VGXA 3OEPA 3GTLC 4LJZA 3CQZC 4C3JK 3H3VD 3T01A 4GTCA 2R93C 3T02A 3PO2C 4MEYA 4A3IK 4A3JC 1R9TA 2PA8D 4Y52C 3ADAC 2KQ1A 5JFEA 1IE0A 2EBBA 4GTDA 2O5JA 5IP7C 1YNJA 2R93A 2R92K 3WODA 3CQZA 1O2FB 1TWFC 4KARA 1IQ0A 4PAAA 3CF5S 1WCMA 3SZZA 2XCQA 3FKIK 3GTKA 3HOYC 4GFQA 3K7AK 4G0UA 1YX2A 3VA7A 2CFAB 2Y0SL
chains in the Genus database with same CATH topology
5FJ8K 2A6EA 3GTMC 3HKZD 3H0GK 3RZDK 1WCMK 3S1QK 4A3BK 2JA6K 2JA5C 4MEXA 1TWHK 3K7AC 3HOVC 4C3HK 3HOWK 5IYCC 4G7HA 3HOYK 1Y1WC 5C4XK 4XSXA 3HKZL 3FKIC 4KMUA 4A3EK 3S17K 5IYBC 2PPBA 4A3CK 2NVQC 1I50C 4BBSK 5TMFA 2B63K 4OIOA 3HOZK 4OINA 3PO3C 1K83K 1TWFK 3S2DK 3S16C 4BBRK 4QJVB 1YNNA 2A68A 2WB1D 3GTJK 1R9TK 2YU9K 1I6HC 5M3FK 2E2HK 5C44K 3M3YK 1I3QK 2PA8L 4X6AK 1I6VA 1I3QC 3M3YC 1SFOC 4G7ZA 2E2HC 1I6HK 3GTJC 2YU9C 3GTGK 2O5IA 5M3MK 4A3FC 2JA7C 3I4NC 5IYDC 3S2DC 1K83C 4ZH4A 4XLNA 4A3IC 3HOZC 5M5WK 5M5XK 3PO3K 5TMCA 4BBSC 1I50K 2NVQK 3S17C 4A3CC 4XSZA 5C4XC 1Y1WK 5IYCK 4C3HC 3EQLA 4MQ9A 4C3IC 1SMYA 4Y7NC 2JA6C 5M5YK 4A3DK 4YFNA 2BE5A 2PMZD 3RZDC 2E2JC 3S1MK 5FLMC 4A3GC 2E2IC 3I4MK 4YFKA 1TWCC 4OIQA 5IP9K 4JK1A 1HQMA 2WAQL 2NVYC 4QJVA 5IYDK 3GTKK 2PMZL 4OIRA 4A93K 1Y1VC 2NVXC 3S1RK 3RZOK 4Q5SA 3HOUK 1ZYRA 5C3EC 4G7OA 4A3LC 3S1NC 4AYBD 2R7ZC 2CW0A 4C2MK 5C4JC 3GTQK 3GTPK 2VUMK 4BY1K 3HOXC 4A3MC 1XPPA 3S14C 3S15K 5C4JK 2R7ZK 4KN4A 4BY7C 4BXXK 5C3EK 3HOUC 2R92C 2Y0SD 5D4DA 4YG2A 2NVTC 3RZOC 3S2HC 4A93C 1TWGK 5IP7K 3GTKC 4LLGA 2NVYK 1BDFA 4A3KC 5IP9C 1TWCK 3I4MC 3H3VL 4OIPA 4Y52K 3S1MC 2E2JK 4A3DC 1TWAK 4Y7NK 3M4OC 4C3IK 4A3JK 3GTLC 4LJZA 3CQZC 4C3JK 3PO2K 3H3VD 2R93K 2JA8K 3GTOK 3GTOC 4YFXA 2JA8C 2WB1L 2R93C 4C3JC 3PO2C 3CQZK 1IW7A 3GTLK 4MEYA 4A3IK 3M4OK 1TWAC 4A3JC 4LK1A 2PA8D 3I4NK 4A3FK 2JA7K 4Y52C 3GTGC 3DXJA 1SFOK 4QIWD 4A3KK 2O5JA 5IP7C 1YNJA 1TWGC 4X6AC 4LK0A 2NVTK 2R92K 3S2HK 5C44C 4BXXC 3WODA 4QIWL 1R9TC 4BY7K 4Q4ZA 4BBRC 3S16K 1TWFC 3S15C 3S14K 3HOXK 2B63C 4BY1C 4A3MK 2VUMC 4A3GK 4XLPA 2A69A 4C2MC 5IYBK 3GTPC 4A3EC 3GTQC 3FKIK 4AYBL 3HOYC 3S1NK 4A3LK 4GZYA 2A6HA 3HOWC 1TWHC 3S1RC 1Y1VK 3K7AK 2WAQD 2JA5K 2NVXK 3HOVK 4A3BC 1WCMC 3H0GC 3S1QC 4NOIA 3GTMK 4KN7A 2E2IK 5FLMK 2Y0SL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FJ8 K;  2A6E A;  3GTM C;  3HKZ D;  3H0G K;  3RZD K;  1WCM K;  3S1Q K;  4A3B K;  2JA6 K;  2JA5 C;  4MEX A;  1TWH K;  3K7A C;  3HOV C;  4C3H K;  3HOW K;  5IYC C;  4G7H A;  3HOY K;  1Y1W C;  5C4X K;  4XSX A;  3HKZ L;  3FKI C;  4KMU A;  4A3E K;  3S17 K;  5IYB C;  2PPB A;  4A3C K;  2NVQ C;  1I50 C;  4BBS K;  5TMF A;  2B63 K;  4OIO A;  3HOZ K;  4OIN A;  3PO3 C;  1K83 K;  1TWF K;  3S2D K;  3S16 C;  4BBR K;  4QJV B;  1YNN A;  2A68 A;  2WB1 D;  3GTJ K;  1R9T K;  2YU9 K;  1I6H C;  5M3F K;  2E2H K;  5C44 K;  3M3Y K;  1I3Q K;  2PA8 L;  4X6A K;  1I6V A;  1I3Q C;  3M3Y C;  1SFO C;  4G7Z A;  2E2H C;  1I6H K;  3GTJ C;  2YU9 C;  3GTG K;  2O5I A;  5M3M K;  4A3F C;  2JA7 C;  3I4N C;  5IYD C;  3S2D C;  1K83 C;  4ZH4 A;  4XLN A;  4A3I C;  3HOZ C;  5M5W K;  5M5X K;  3PO3 K;  5TMC A;  4BBS C;  1I50 K;  2NVQ K;  3S17 C;  4A3C C;  4XSZ A;  5C4X C;  1Y1W K;  5IYC K;  4C3H C;  3EQL A;  4MQ9 A;  4C3I C;  1SMY A;  4Y7N C;  2JA6 C;  5M5Y K;  4A3D K;  4YFN A;  2BE5 A;  2PMZ D;  3RZD C;  2E2J C;  3S1M K;  5FLM C;  4A3G C;  2E2I C;  3I4M K;  4YFK A;  1TWC C;  4OIQ A;  5IP9 K;  4JK1 A;  1HQM A;  2WAQ L;  2NVY C;  4QJV A;  5IYD K;  3GTK K;  2PMZ L;  4OIR A;  4A93 K;  1Y1V C;  2NVX C;  3S1R K;  3RZO K;  4Q5S A;  3HOU K;  1ZYR A;  5C3E C;  4G7O A;  4A3L C;  3S1N C;  4AYB D;  2R7Z C;  2CW0 A;  4C2M K;  5C4J C;  3GTQ K;  3GTP K;  2VUM K;  4BY1 K;  3HOX C;  4A3M C;  1XPP A;  3S14 C;  3S15 K;  5C4J K;  2R7Z K;  4KN4 A;  4BY7 C;  4BXX K;  5C3E K;  3HOU C;  2R92 C;  2Y0S D;  5D4D A;  4YG2 A;  2NVT C;  3RZO C;  3S2H C;  4A93 C;  1TWG K;  5IP7 K;  3GTK C;  4LLG A;  2NVY K;  1BDF A;  4A3K C;  5IP9 C;  1TWC K;  3I4M C;  3H3V L;  4OIP A;  4Y52 K;  3S1M C;  2E2J K;  4A3D C;  1TWA K;  4Y7N K;  3M4O C;  4C3I K;  4A3J K;  3GTL C;  4LJZ A;  3CQZ C;  4C3J K;  3PO2 K;  3H3V D;  2R93 K;  2JA8 K;  3GTO K;  3GTO C;  4YFX A;  2JA8 C;  2WB1 L;  2R93 C;  4C3J C;  3PO2 C;  3CQZ K;  1IW7 A;  3GTL K;  4MEY A;  4A3I K;  3M4O K;  1TWA C;  4A3J C;  4LK1 A;  2PA8 D;  3I4N K;  4A3F K;  2JA7 K;  4Y52 C;  3GTG C;  3DXJ A;  1SFO K;  4QIW D;  4A3K K;  2O5J A;  5IP7 C;  1YNJ A;  1TWG C;  4X6A C;  4LK0 A;  2NVT K;  2R92 K;  3S2H K;  5C44 C;  4BXX C;  3WOD A;  4QIW L;  1R9T C;  4BY7 K;  4Q4Z A;  4BBR C;  3S16 K;  1TWF C;  3S15 C;  3S14 K;  3HOX K;  2B63 C;  4BY1 C;  4A3M K;  2VUM C;  4A3G K;  4XLP A;  2A69 A;  4C2M C;  5IYB K;  3GTP C;  4A3E C;  3GTQ C;  3FKI K;  4AYB L;  3HOY C;  3S1N K;  4A3L K;  4GZY A;  2A6H A;  3HOW C;  1TWH C;  3S1R C;  1Y1V K;  3K7A K;  2WAQ D;  2JA5 K;  2NVX K;  3HOV K;  4A3B C;  1WCM C;  3H0G C;  3S1Q C;  4NOI A;  3GTM K;  4KN7 A;  2E2I K;  5FLM K;  2Y0S L; 
#chains in the Genus database with same CATH topology
 3JST A;  4ILD A;  5FJ8 K;  1B4A A;  4A3B K;  2ZUE A;  2KWA A;  2JA5 C;  3MML B;  1TWH K;  3HOW K;  4C3H K;  4IOC S;  4GTE A;  4LOW A;  4KAW X;  4A3E K;  2PPB A;  2P5M A;  3TFI A;  5DM7 S;  3G4A A;  3S16 C;  2A68 A;  1YCL A;  5IOT A;  1I6H C;  1PJ5 A;  4KMA A;  2JA7 A;  2P8T A;  1O25 A;  2PA8 L;  2PHC B;  4AH6 A;  4G7Z A;  1I6H K;  1BJT A;  3GTG K;  2O5I A;  3I4N C;  4G0V A;  4XLN A;  4G0W A;  3A8K A;  3GTL A;  1VLO A;  3AH5 A;  3HXA A;  4C3H C;  3N3Y A;  4YFN A;  2E2J C;  2E2I C;  5IP9 K;  4OIQ A;  2NVY C;  4QJV A;  4WFN S;  2PMZ L;  3V4G A;  4A93 K;  4Q5S A;  1ZYR A;  5C3E C;  1UV7 A;  2JA5 A;  2R7Z C;  1EK8 A;  3L4J A;  2E2I A;  1O27 A;  2KXY A;  3AQP A;  2R7Z K;  2NVX A;  5C3E K;  2R92 C;  4BLB A;  4A93 C;  1C0A A;  2RH6 A;  5IOS A;  5IP7 K;  2E2H A;  1WQG A;  2NVY K;  4LLG A;  1I3Q A;  5IP9 C;  1VJE A;  4Y52 K;  2E2J K;  1WOS A;  4A3J K;  3GTG A;  3PO2 K;  2R93 K;  4YFX A;  4C3J C;  3CQZ K;  1IW7 A;  1TWF A;  3GTL K;  1EH1 A;  3I4N K;  3GTG C;  4C45 A;  1WQH A;  3DXJ A;  2ZJQ S;  1B4B A;  5L46 A;  3GEE A;  2NVT K;  4KM8 A;  3GEI A;  4LR2 A;  3S16 K;  3S15 C;  3S14 K;  4A3M K;  4KAS A;  4XLP A;  3GTP C;  4A3E C;  1DCO A;  4A3L K;  3HOW C;  1TWH C;  2JA5 K;  2WAQ D;  4A3B C;  1L0W A;  4NOI A;  3L4K A;  5CHP A;  4KN7 A;  4A3G K;  1ZBS A;  5JVG S;  2A6E A;  1KQ4 A;  3HKZ D;  1USM A;  3A8I A;  4BKW A;  3K7A C;  2ZJR S;  1HI9 A;  3AQO A;  3GTQ A;  5IYC C;  4G7H A;  3HOY K;  4XSX A;  3FKI C;  4KMU A;  4A3C K;  2NVQ C;  1K83 K;  1TWF K;  3S2D K;  4P5B A;  2GSO A;  1XXA A;  4GTF A;  1F7V A;  1WIH A;  3GDZ A;  5EGH A;  1I6V A;  1ZXO A;  1RU0 A;  3AD8 C;  3M3Y C;  4WFA S;  2B63 A;  1EQR A;  5M5W K;  4A3I C;  3HOZ C;  1I50 K;  1WOP A;  1XXC A;  3IPJ A;  4XSZ A;  5C4X C;  1O26 A;  4KDD A;  3EQL A;  2Y3P A;  1G51 A;  2JA6 C;  2L3U A;  3S1M K;  3RZD C;  1DD5 A;  3N0B A;  5FLM C;  4JK1 A;  2WAQ L;  3FHZ A;  2NVX C;  3S1R K;  1EFW A;  4G7O A;  2JA6 A;  4AYB D;  3GTQ K;  4C2M K;  2ZFZ A;  2VUM K;  4J3N A;  5C4J K;  2ZUF A;  4IOA S;  1PJ6 A;  1Y1V A;  2GAH C;  3BP3 A;  4BXX K;  3S2H C;  4WIL A;  1TWG K;  1INN A;  1XZQ B;  1ZQ1 C;  1BDF A;  4A3K C;  3T00 A;  1IBA A;  1TWC K;  1WOO A;  3I4M C;  4XCH A;  1IL2 A;  3SZY A;  4A3D C;  4Y7N K;  2YU9 A;  2GSU A;  2JA8 K;  3GTO K;  3GSI A;  5HQH A;  3PIP S;  3M4O K;  1TWA C;  4LK1 A;  1O28 A;  3OPF A;  3ERE D;  1VH2 A;  4A3F K;  2JA7 K;  4DDQ A;  1I50 A;  1SFO K;  4QIW D;  1WSR A;  4LK0 A;  1EI6 A;  1SFO A;  1F7U A;  5C44 C;  4BY7 K;  1XZQ A;  2KPU A;  1O29 A;  3HOX K;  4BY1 C;  3FOE A;  1Y1W A;  2A69 A;  3BUE A;  5JVO A;  1F9N A;  3S1N K;  1FEU A;  4GZY A;  2A6H A;  1JQW A;  1Y1V K;  5IOQ A;  1WCM C;  1AB4 A;  3GTM K;  5IYD C;  3H0G K;  3S1Q K;  5EGE A;  4MEX A;  3HOV C;  3H0G A;  1Y1W C;  1DCH A;  3S17 K;  5IYB C;  3GEH A;  2FQO A;  4GT9 A;  4BBS K;  5TMF A;  2B63 K;  5IOR A;  2R7Z A;  3PO3 C;  3LPX A;  4BBR K;  2YU9 K;  4M1X A;  3GTJ K;  1R9T K;  1TWA A;  5M3F K;  2E2H K;  3TFJ A;  1I3Q K;  4X6A K;  5TJ3 A;  1I3Q C;  1USO A;  1J6W A;  1BS2 A;  1DCP A;  3DLL S;  2E2H C;  1WQF A;  3GTJ C;  2YU9 C;  1VRQ C;  4PAB A;  5M3M K;  4WJ3 M;  2V6U A;  4ZH4 A;  3PO3 K;  5M5X K;  4RMF A;  4BBS C;  4IO9 S;  4KMH A;  1X31 C;  1JOE A;  4KMD A;  3S17 C;  1Y1W K;  1GE9 A;  4MQ9 A;  4C3I C;  1SMY A;  5DM6 S;  5M5Y K;  2BE5 A;  5IYD K;  1HQM A;  3S0X A;  5JVH S;  3FKI A;  3Q3Q A;  3GTK K;  1Y1V C;  3RZO K;  4LQY A;  3HOU K;  1XXB A;  3S1N C;  4WJ4 A;  1TWC A;  4GTL A;  4BY1 K;  3HOX C;  4KAT A;  2XCR B;  1WOR A;  2XCO A;  3N0C A;  4BY7 C;  3NUH A;  3HOU C;  1J6V A;  2Y0S D;  5D4D A;  4YG2 A;  3RZO C;  3GTJ A;  2FQT A;  2V6S A;  4BLA A;  3GTK C;  2E2I K;  2D6F C;  4WF9 S;  1XZP B;  1IS1 A;  3H3V L;  1O2A A;  4KM9 A;  2GSN A;  1TWA K;  3M4O C;  4C3I K;  5HL7 S;  3GTO C;  2JA8 C;  1ZVU A;  2WB1 L;  1TWG A;  3GIR A;  3LYW A;  1J98 A;  1J6X A;  2ZJP S;  2CFA A;  4GTB A;  4U67 S;  4A3K K;  4KB4 A;  3BP8 C;  4X6A C;  1TWG C;  3S2H K;  4BXX C;  4QIW L;  5HL8 A;  1R9T C;  3ORE A;  4Q4Z A;  3GTM A;  4BBR C;  1XZP A;  3CAG A;  5CJ9 A;  1F93 A;  2B63 C;  4FZB A;  2VUM C;  2V6T A;  4C2M C;  4KB2 A;  3GTQ C;  4AYB L;  5IYB K;  3G4C A;  3HOV K;  3S1R C;  2NVX K;  2R92 A;  4WCE S;  4P9S A;  3H0G C;  3S1Q C;  4GTA A;  2VUM A;  5FLM K;  2NVY A;  3GTM C;  3RZD K;  1WCM K;  3PIO S;  2JA6 K;  3GTP A;  5C4X K;  3HKZ L;  3LAP A;  3TFH A;  1I50 C;  4OIO A;  3HOZ K;  4OIN A;  2JH3 A;  2RGR A;  1O2B A;  4QJV B;  1YNN A;  2WB1 D;  1K83 A;  5C44 K;  3M3Y K;  5E68 A;  3QX3 A;  4WFB S;  1SFO C;  4A3F C;  2JA7 C;  3S2D C;  3AD7 C;  3LAJ A;  1K83 C;  3GTO A;  5TMC A;  2NVQ K;  1V5V A;  4A3C C;  5IYC K;  4Y7N C;  4A3D K;  2PMZ D;  2GAG C;  3TTG A;  4A3G C;  3I4M K;  4YFK A;  1TWC C;  4FM9 A;  4KC6 A;  4OIR A;  4A3L C;  1WSV A;  3GTP K;  2CW0 A;  5C4J C;  3FOF A;  2W7V A;  4A3M C;  1XPP A;  3S14 C;  3S15 K;  1BGW A;  4KN4 A;  4P5A A;  3AD9 C;  4O2D A;  1TWH A;  2NVT C;  1JVI A;  3A8J A;  2L5N A;  1ISE A;  1O24 A;  4OIP A;  1PJ7 A;  3S1M C;  1VGX A;  3OEP A;  3GTL C;  4LJZ A;  3CQZ C;  4C3J K;  3H3V D;  3T01 A;  4GTC A;  2R93 C;  3T02 A;  3PO2 C;  4MEY A;  4A3I K;  4A3J C;  1R9T A;  2PA8 D;  4Y52 C;  3ADA C;  2KQ1 A;  5JFE A;  1IE0 A;  2EBB A;  4GTD A;  2O5J A;  5IP7 C;  1YNJ A;  2R93 A;  2R92 K;  3WOD A;  3CQZ A;  1O2F B;  1TWF C;  4KAR A;  1IQ0 A;  4PAA A;  3CF5 S;  1WCM A;  3SZZ A;  2XCQ A;  3FKI K;  3GTK A;  3HOY C;  4GFQ A;  3K7A K;  4G0U A;  1YX2 A;  3VA7 A;  2CFA B;  2Y0S L; 
#chains in the Genus database with same CATH homology
 5FJ8 K;  2A6E A;  3GTM C;  3HKZ D;  3H0G K;  3RZD K;  1WCM K;  3S1Q K;  4A3B K;  2JA6 K;  2JA5 C;  4MEX A;  1TWH K;  3K7A C;  3HOV C;  4C3H K;  3HOW K;  5IYC C;  4G7H A;  3HOY K;  1Y1W C;  5C4X K;  4XSX A;  3HKZ L;  3FKI C;  4KMU A;  4A3E K;  3S17 K;  5IYB C;  2PPB A;  4A3C K;  2NVQ C;  1I50 C;  4BBS K;  5TMF A;  2B63 K;  4OIO A;  3HOZ K;  4OIN A;  3PO3 C;  1K83 K;  1TWF K;  3S2D K;  3S16 C;  4BBR K;  4QJV B;  1YNN A;  2A68 A;  2WB1 D;  3GTJ K;  1R9T K;  2YU9 K;  1I6H C;  5M3F K;  2E2H K;  5C44 K;  3M3Y K;  1I3Q K;  2PA8 L;  4X6A K;  1I6V A;  1I3Q C;  3M3Y C;  1SFO C;  4G7Z A;  2E2H C;  1I6H K;  3GTJ C;  2YU9 C;  3GTG K;  2O5I A;  5M3M K;  4A3F C;  2JA7 C;  3I4N C;  5IYD C;  3S2D C;  1K83 C;  4ZH4 A;  4XLN A;  4A3I C;  3HOZ C;  5M5W K;  5M5X K;  3PO3 K;  5TMC A;  4BBS C;  1I50 K;  2NVQ K;  3S17 C;  4A3C C;  4XSZ A;  5C4X C;  1Y1W K;  5IYC K;  4C3H C;  3EQL A;  4MQ9 A;  4C3I C;  1SMY A;  4Y7N C;  2JA6 C;  5M5Y K;  4A3D K;  4YFN A;  2BE5 A;  2PMZ D;  3RZD C;  2E2J C;  3S1M K;  5FLM C;  4A3G C;  2E2I C;  3I4M K;  4YFK A;  1TWC C;  4OIQ A;  5IP9 K;  4JK1 A;  1HQM A;  2WAQ L;  2NVY C;  4QJV A;  5IYD K;  3GTK K;  2PMZ L;  4OIR A;  4A93 K;  1Y1V C;  2NVX C;  3S1R K;  3RZO K;  4Q5S A;  3HOU K;  1ZYR A;  5C3E C;  4G7O A;  4A3L C;  3S1N C;  4AYB D;  2R7Z C;  2CW0 A;  4C2M K;  5C4J C;  3GTQ K;  3GTP K;  2VUM K;  4BY1 K;  3HOX C;  4A3M C;  1XPP A;  3S14 C;  3S15 K;  5C4J K;  2R7Z K;  4KN4 A;  4BY7 C;  4BXX K;  5C3E K;  3HOU C;  2R92 C;  2Y0S D;  5D4D A;  4YG2 A;  2NVT C;  3RZO C;  3S2H C;  4A93 C;  1TWG K;  5IP7 K;  3GTK C;  4LLG A;  2NVY K;  1BDF A;  4A3K C;  5IP9 C;  1TWC K;  3I4M C;  3H3V L;  4OIP A;  4Y52 K;  3S1M C;  2E2J K;  4A3D C;  1TWA K;  4Y7N K;  3M4O C;  4C3I K;  4A3J K;  3GTL C;  4LJZ A;  3CQZ C;  4C3J K;  3PO2 K;  3H3V D;  2R93 K;  2JA8 K;  3GTO K;  3GTO C;  4YFX A;  2JA8 C;  2WB1 L;  2R93 C;  4C3J C;  3PO2 C;  3CQZ K;  1IW7 A;  3GTL K;  4MEY A;  4A3I K;  3M4O K;  1TWA C;  4A3J C;  4LK1 A;  2PA8 D;  3I4N K;  4A3F K;  2JA7 K;  4Y52 C;  3GTG C;  3DXJ A;  1SFO K;  4QIW D;  4A3K K;  2O5J A;  5IP7 C;  1YNJ A;  1TWG C;  4X6A C;  4LK0 A;  2NVT K;  2R92 K;  3S2H K;  5C44 C;  4BXX C;  3WOD A;  4QIW L;  1R9T C;  4BY7 K;  4Q4Z A;  4BBR C;  3S16 K;  1TWF C;  3S15 C;  3S14 K;  3HOX K;  2B63 C;  4BY1 C;  4A3M K;  2VUM C;  4A3G K;  4XLP A;  2A69 A;  4C2M C;  5IYB K;  3GTP C;  4A3E C;  3GTQ C;  3FKI K;  4AYB L;  3HOY C;  3S1N K;  4A3L K;  4GZY A;  2A6H A;  3HOW C;  1TWH C;  3S1R C;  1Y1V K;  3K7A K;  2WAQ D;  2JA5 K;  2NVX K;  3HOV K;  4A3B C;  1WCM C;  3H0G C;  3S1Q C;  4NOI A;  3GTM K;  4KN7 A;  2E2I K;  5FLM K;  2Y0S L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...