2O5IA

Crystal structure of the t. thermophilus rna polymerase elongation complex
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
229
structure length
229
Chain Sequence
MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna-rna hybrid
molecule keywords 5'-D(P*CP*CP*CP*TP*GP*TP*CP*TP*GP*GP*CP*GP*TP*TP*CP*GP*CP*GP
publication title Structural basis for transcription elongation by bacterial RNA polymerase.
pubmed doi rcsb
total genus 39
structure length 229
sequence length 229
chains with identical sequence B, K, L
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2006-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01000 RNA_pol_A_bac RNA polymerase Rpb3/RpoA insert domain
A PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain
A PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.12 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 DNA-directed RNA polymerase, insert domain 2o5iA02
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 2o5iA01
2NVQK 5C44K 2B63C 5C4JK 2VUMK 2JA8K 5IP9C 4ZH4A 5IYCC 4A3JC 3HOYC 1TWCC 4AYBL 3PO2C 3S1QK 4C3IK 4A3FK 5M3FK 3S2DK 3S2HC 5M3MK 4C3HC 5IYBC 4Q4ZA 3GTQC 4MQ9A 1R9TC 3S1NK 5FJ8K 3RZOK 4A3IK 2NVYC 2YU9C 3M4OC 2JA7C 2R92K 4LK0A 3M3YC 2NVTK 3GTKK 2E2JC 4G7ZA 4KN7A 4NOIA 4A3MK 5M5XK 3H0GC 3GTLK 3H3VL 4XLPA 1Y1WC 2E2HC 3GTJC 2O5IA 4BXXC 4Y7NK 4BY7K 4QJVA 4XSXA 3S1MC 2JA5K 2Y0SD 3S15C 4BBRC 1WCMK 4XSZA 2WAQL 2WB1L 3GTMC 4A3DC 3CQZK 3HOXC 3I4MK 3I4NK 3FKIK 4C3JC 2NVXK 3EQLA 5C3EC 4A3CC 4JK1A 2R93K 4A3LC 5M5YK 1SFOC 4MEYA 3HOWK 1YNNA 3GTOC 4Y52K 1K83C 3RZDC 5TMFA 3GTPC 3HOUC 4BBSC 4MEXA 5D4DA 4A3BK 2PA8L 4OIRA 2B63K 2A6EA 5IP9K 5IYCK 4A3JK 5M5WK 1TWCK 4YG2A 5IYDC 3S14C 3HOYK 4Y52C 3HKZD 2JA6C 3GTGC 1BDFA 4A93C 3S17C 4C2MC 3S2HK 4X6AC 4C3HK 5IYBK 1YNJA 4A3GC 1TWFC 1R9TK 3GTQK 3S1RC 1TWAC 1IW7A 3WODA 5TMCA 2NVYK 2YU9K 4AYBD 2JA7K 3M4OK 1I50C 4BY1C 3HOVK 2E2JK 1HQMA 3H0GK 1Y1WK 2E2HK 3GTJK 3PO3C 4BXXK 1TWGC 3K7AC 1I3QC 1TWHC 3HOVC 4G7OA 5IP7C 1Y1VC 4Q5SA 4QIWL 4BBRK 3S15K 3S1MK 4G7HA 3GTMK 5C4XC 3HOXK 4YFKA 3GTLC 4C3JK 5C3EK 2R7ZC 4A3CK 3HOZC 2WAQD 3S16C 2PMZL 2WB1D 4A3LK 1SFOK 2A68A 4A3KC 5FLMC 2E2IC 1K83K 3GTOK 1I6HC 3RZDK 3HKZL 3GTPK 3HOUK 4A3EC 3RZOC 1ZYRA 3DXJA 2O5JA 2R93C 2NVQC 5C44C 5C4JC 2VUMC 3S14K 4XLNA 2BE5A 4OIOA 2JA8C 2JA6K 3GTGK 3M3YK 3S1QC 3S17K 2PA8D 4A93K 4C2MK 4C3IC 4A3FC 4X6AK 4A3GK 3S2DC 1TWFK 3S1RK 1TWAK 2A69A 3S1NC 1I50K 4BY1K 4A3IC 2R92C 2Y0SL 2NVTC 4YFXA 3H3VD 2CW0A 4LJZA 4OINA 4OIQA 3GTKC 4A3DK 4A3MC 3PO3K 1TWGK 4LK1A 1I3QK 1TWHK 3K7AK 4BY7C 4Y7NC 1Y1VK 4QJVB 4KMUA 5IP7K 2JA5C 5C4XK 1WCMC 4YFNA 4KN4A 3CQZC 4QIWD 3I4MC 1SMYA 3FKIC 2A6HA 3I4NC 4GZYA 2R7ZK 4BBSK 3HOZK 2NVXC 3S16K 1XPPA 4A3KK 1I6VA 5FLMK 2E2IK 1I6HK 3HOWC 4A3EK 5IYDK 4OIPA 2PPBA 4A3BC 3PO2K 2PMZD 4LLGA
chains in the Genus database with same CATH superfamily
1O25A 2KXYA 5IOQA 1AB4A 5C4JK 1TWCC 4P5AA 2GSOA 3S2HC 3BUEA 4A3IK 3M3YC 2NVTK 4P5BA 5JVOA 1JQWA 3G4AA 3H3VL 1F7VA 3GEEA 4LQYA 3GTLK 3GTJC 4XSXA 2P5MA 2Y0SD 3AQOA 4BBRC 4XSZA 3V4GA 5EGHA 1ZBSA 4PAAA 4C3JC 1B4BA 2JA5A 5M5YK 1BS2A 4BLBA 1SFOC 1EH1A 3GTOC 3PIOS 3RZDC 1WOSA 4OIRA 2B63K 1XXAA 1XZPB 4A3JK 1DCHA 5IYDC 3PO2K 3GTGC 3S17C 4C2MC 4XCHA 3GTQK 3JSTA 3S1RC 1WSRA 1TWAC 3NUHA 2YU9K 4U67S 4AYBD 2JA7K 4BY1C 1WQHA 1O2FB 1YX2A 1UV7A 4GTAA 1IS1A 2L5NA 1BGWA 4IO9S 2E2HK 2D6FC 4QIWL 3GEIA 2RH6A 2NVYA 4G7HA 3BP8C 1J98A 3N0CA 1O24A 3GTLC 1VRQC 1V5VA 1IE0A 4KMAA 2WAQD 2PMZL 4A3LK 2NVXA 2L3UA 4KM8A 4BLAA 3N3YA 3HOUK 5EGEA 1ZYRA 2NVQC 2PHCB 2VUMC 3S14K 4XLNA 2BE5A 4OIOA 2W7VA 4Y52K 4A93K 3GTPA 1WIHA 2ZUEA 2KWAA 4FZBA 1RU0A 2A69A 3S1NC 4O2DA 4BKWA 2Y0SL 4YFXA 3H3VD 4AH6A 3GTKC 1VLOA 3PO3K 1TWFA 2CFAB 3GEHA 1WSVA 4BY7C 5IP7K 3AH5A 2JA5C 4YFNA 3CAGA 3I4MC 3I4NC 2R7ZK 2ZJQS 3TFIA 1XPPA 4PABA 1J6VA 5FLMK 3BP3A 1I6HK 3HOWC 3VA7A 3GTOA 4A3BC 5JVGS 4LLGA 1XXBA 2JA8K 5IYCC 4AYBL 4A3FK 1JOEA 3GTGA 3MMLB 5M3FK 1USMA 5M3MK 5IYBC 1R9TC 3ADAC 4KM9A 4WFNS 2ZJPS 2NVYC 2R92K 2Y3PA 2E2JC 5M5XK 3H0GC 1BJTA 4Y7NK 3S1MC 1HI9A 1O2AA 4WJ3M 1WCMK 5TJ3A 2WAQL 1EQRA 3GTMC 2KPUA 2FQOA 4J3NA 3HOXC 3GTLA 3OREA 4KB2A 4JK1A 2R93K 3AD9C 1IQ0A 1O26A 4MEYA 3GTPC 5D4DA 3SZYA 1FEUA 4KASA 5IP9K 3HOYK 5M5WK 4YG2A 2VUMA 4WFBS 4GTLA 1BDFA 4C3HK 3S0XA 4A3GC 1TWFC 4C45A 5TMCA 3M4OK 4GTBA 1I50C 1WOOA 2XCOA 3GTKA 1Y1WK 4BXXK 3GTQA 1TWGC 1I3QC 4G7OA 2GAGC 3S15K 2JA7A 4IOAS 1O28A 5C3EK 4A3CK 2WB1D 1XZQA 2A68A 3CF5S 4A3KC 1K83K 5L46A 4KC6A 3SZZA 2O5JA 2R93C 5C4JC 2JA6K 1ZVUA 2V6TA 1ZXOA 4X6AK 3FOFA 1B4AA 1R9TA 1GE9A 4A3IC 4G0UA 1VJEA 2NVTC 1DCOA 1F7UA 4OIQA 3H0GA 3HOVK 3K7AK 1TWHK 2V6UA 1C0AA 1J6XA 1Y1VK 3A8IA 5C4XK 3GTMA 4BBSK 4GZYA 1PJ7A 3HOZK 3S16K 1JVIA 2ZUFA 4WJ4A 2E2IK 4A3EK 5HL7S 4OIPA 3RZOK 4RMFA 2PPBA 1DCPA 3OEPA 2R7ZA 5C44K 2B63C 2GSUA 3Q3QA 4ZH4A 4A3JC 3S1QK 3PO2C 4M1XA 4C3IK 5DM7S 3S2DK 3GTQC 4MQ9A 4G0VA 2YU9C 2JA7C 1I50A 1F9NA 4KDDA 3QX3A 1INNA 4A3MK 2ZJRS 4KB4A 4XLPA 2E2HC 2O5IA 4LR2A 1TWGA 1I3QA 4KAWX 1VGXA 3FHZA 1IL2A 2WB1L 3CQZK 3FKIK 2P8TA 1EFWA 3GIRA 2NVXK 3EQLA 3L4JA 3N0BA 4A3LC 5IORA 1WCMA 5TMFA 1XXCA 3HOUC 4BBSC 1WQGA 2A6EA 2R93A 1TWCK 3S14C 2RGRA 4Y52C 3HKZD 4A93C 2KQ1A 3S2HK 1YNJA 3WODA 1XZPA 3AQPA 4GT9A 4KMDA 3PO3C 3GTJK 5IP7C 2GAHC 1O2BA 4BBRK 1WQFA 1G51A 4YFKA 4C3JK 1ISEA 2R7ZC 3T02A 1SFOK 3T00A 5FLMC 3TFHA 4GTFA 3GTOK 1I6HC 3RZDK 5CJ9A 3A8KA 1EK8A 4LOWA 2B63A 4GTEA 2JA8C 4ILDA 1K83A 3GTGK 3S17K 2PA8D 4C2MK 4A3FC 4P9SA 4FM9A 3S1RK 3IPJA 1TWAK 4GTCA 3A8JA 4WFAS 2ZFZA 4BY1K 2R92C 2YU9A 2JA6A 4OINA 4LJZA 4DDQA 4A3DK 1WORA 4LK1A 4Y7NC 2E2HA 4KMUA 3GDZA 2EBBA 1WCMC 4KN4A 1IBAA 1EI6A 3TTGA 1SMYA 2CFAA 1TWHA 5IOSA 1Y1VA 1I6VA 1ZQ1C 3HKZL 3LAJA 2NVQK 2VUMK 5IP9C 2E2IA 3HOYC 1WOPA 5HL8A 4C3HC 4Q4ZA 3S1NK 5FJ8K 3LPXA 3M4OC 4WF9S 4LK0A 1VH2A 5JFEA 1PJ6A 3GTKK 4G7ZA 4KN7A 4NOIA 1X31C 4KATA 1Y1WC 4GFQA 4BY7K 4BXXC 1L0WA 4QJVA 2JA5K 3S15C 4A3DC 2JH3A 3I4MK 3I4NK 5C3EC 4A3CC 3HOWK 1YNNA 1K83C 3CQZA 2GSNA 4MEXA 3FKIA 4A3BK 1KQ4A 2PA8L 4GTDA 3TFJA 5IYCK 2JA6C 4X6AC 2FQTA 5IYBK 1R9TK 3DLLS 1IW7A 2NVYK 1TWCA 2R92A 2E2JK 1HQMA 3H0GK 3HOVC 3K7AC 1TWHC 3S1MK 1PJ5A 1Y1VC 4Q5SA 1XZQB 5IOTA 3GTMK 5C4XC 3HOXK 5DM6S 1USOA 5E68A 3LAPA 3ERED 3GTJA 4IOCS 3HOZC 3S16C 2XCRB 3AD7C 2E2IC 3GTPK 4A3EC 2V6SA 3RZOC 3DXJA 3HXAA 5HQHA 5C44C 1O27A 1SFOA 3PIPS 1YCLA 3M3YK 3S1QC 4C3IC 3GSIA 4A3GK 3S2DC 1TWFK 4KMHA 5CHPA 1DD5A 1I50K 5JVHS 1F93A 3LYWA 2CW0A 3FOEA 1J6WA 4A3MC 1TWGK 4QJVB 1I3QK 1TWAA 1Y1WA 3AD8C 3T01A 3CQZC 4QIWD 2XCQA 3FKIC 2A6HA 4G0WA 2NVXC 4KARA 4A3KK 1O29A 4WILA 5IYDK 3OPFA 3G4CA 4WCES 3L4KA 2PMZD
chains in the Genus database with same CATH topology
2NVQK 5C44K 2B63C 5C4JK 2VUMK 2JA8K 5IP9C 4ZH4A 5IYCC 4A3JC 3HOYC 1TWCC 4AYBL 3PO2C 3S1QK 4C3IK 4A3FK 5M3FK 3S2DK 3S2HC 5M3MK 4C3HC 5IYBC 4Q4ZA 3GTQC 4MQ9A 1R9TC 3S1NK 5FJ8K 3RZOK 4A3IK 2NVYC 2YU9C 3M4OC 2JA7C 2R92K 4LK0A 3M3YC 2NVTK 3GTKK 2E2JC 4G7ZA 4KN7A 4NOIA 4A3MK 5M5XK 3H0GC 3GTLK 3H3VL 4XLPA 1Y1WC 2E2HC 3GTJC 2O5IA 4BXXC 4Y7NK 4BY7K 4QJVA 4XSXA 3S1MC 2JA5K 2Y0SD 3S15C 4BBRC 1WCMK 4XSZA 2WAQL 2WB1L 3GTMC 4A3DC 3CQZK 3HOXC 3I4MK 3I4NK 3FKIK 4C3JC 2NVXK 3EQLA 5C3EC 4A3CC 4JK1A 2R93K 4A3LC 5M5YK 1SFOC 4MEYA 3HOWK 1YNNA 3GTOC 4Y52K 1K83C 3RZDC 5TMFA 3GTPC 3HOUC 4BBSC 4MEXA 5D4DA 4A3BK 2PA8L 4OIRA 2B63K 2A6EA 5IP9K 5IYCK 4A3JK 5M5WK 1TWCK 4YG2A 5IYDC 3S14C 3HOYK 4Y52C 3HKZD 2JA6C 3GTGC 1BDFA 4A93C 3S17C 4C2MC 3S2HK 4X6AC 4C3HK 5IYBK 1YNJA 4A3GC 1TWFC 1R9TK 3GTQK 3S1RC 1TWAC 1IW7A 3WODA 5TMCA 2NVYK 2YU9K 4AYBD 2JA7K 3M4OK 1I50C 4BY1C 3HOVK 2E2JK 1HQMA 3H0GK 1Y1WK 2E2HK 3GTJK 3PO3C 4BXXK 1TWGC 3K7AC 1I3QC 1TWHC 3HOVC 4G7OA 5IP7C 1Y1VC 4Q5SA 4QIWL 4BBRK 3S15K 3S1MK 4G7HA 3GTMK 5C4XC 3HOXK 4YFKA 3GTLC 4C3JK 5C3EK 2R7ZC 4A3CK 3HOZC 2WAQD 3S16C 2PMZL 2WB1D 4A3LK 1SFOK 2A68A 4A3KC 5FLMC 2E2IC 1K83K 3GTOK 1I6HC 3RZDK 3HKZL 3GTPK 3HOUK 4A3EC 3RZOC 1ZYRA 3DXJA 2O5JA 2R93C 2NVQC 5C44C 5C4JC 2VUMC 3S14K 4XLNA 2BE5A 4OIOA 2JA8C 2JA6K 3GTGK 3M3YK 3S1QC 3S17K 2PA8D 4A93K 4C2MK 4C3IC 4A3FC 4X6AK 4A3GK 3S2DC 1TWFK 3S1RK 1TWAK 2A69A 3S1NC 1I50K 4BY1K 4A3IC 2R92C 2Y0SL 2NVTC 4YFXA 3H3VD 2CW0A 4LJZA 4OINA 4OIQA 3GTKC 4A3DK 4A3MC 3PO3K 1TWGK 4LK1A 1I3QK 1TWHK 3K7AK 4BY7C 4Y7NC 1Y1VK 4QJVB 4KMUA 5IP7K 2JA5C 5C4XK 1WCMC 4YFNA 4KN4A 3CQZC 4QIWD 3I4MC 1SMYA 3FKIC 2A6HA 3I4NC 4GZYA 2R7ZK 4BBSK 3HOZK 2NVXC 3S16K 1XPPA 4A3KK 1I6VA 5FLMK 2E2IK 1I6HK 3HOWC 4A3EK 5IYDK 4OIPA 2PPBA 4A3BC 3PO2K 2PMZD 4LLGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NVQ K;  5C44 K;  2B63 C;  5C4J K;  2VUM K;  2JA8 K;  5IP9 C;  4ZH4 A;  5IYC C;  4A3J C;  3HOY C;  1TWC C;  4AYB L;  3PO2 C;  3S1Q K;  4C3I K;  4A3F K;  5M3F K;  3S2D K;  3S2H C;  5M3M K;  4C3H C;  5IYB C;  4Q4Z A;  3GTQ C;  4MQ9 A;  1R9T C;  3S1N K;  5FJ8 K;  3RZO K;  4A3I K;  2NVY C;  2YU9 C;  3M4O C;  2JA7 C;  2R92 K;  4LK0 A;  3M3Y C;  2NVT K;  3GTK K;  2E2J C;  4G7Z A;  4KN7 A;  4NOI A;  4A3M K;  5M5X K;  3H0G C;  3GTL K;  3H3V L;  4XLP A;  1Y1W C;  2E2H C;  3GTJ C;  2O5I A;  4BXX C;  4Y7N K;  4BY7 K;  4QJV A;  4XSX A;  3S1M C;  2JA5 K;  2Y0S D;  3S15 C;  4BBR C;  1WCM K;  4XSZ A;  2WAQ L;  2WB1 L;  3GTM C;  4A3D C;  3CQZ K;  3HOX C;  3I4M K;  3I4N K;  3FKI K;  4C3J C;  2NVX K;  3EQL A;  5C3E C;  4A3C C;  4JK1 A;  2R93 K;  4A3L C;  5M5Y K;  1SFO C;  4MEY A;  3HOW K;  1YNN A;  3GTO C;  4Y52 K;  1K83 C;  3RZD C;  5TMF A;  3GTP C;  3HOU C;  4BBS C;  4MEX A;  5D4D A;  4A3B K;  2PA8 L;  4OIR A;  2B63 K;  2A6E A;  5IP9 K;  5IYC K;  4A3J K;  5M5W K;  1TWC K;  4YG2 A;  5IYD C;  3S14 C;  3HOY K;  4Y52 C;  3HKZ D;  2JA6 C;  3GTG C;  1BDF A;  4A93 C;  3S17 C;  4C2M C;  3S2H K;  4X6A C;  4C3H K;  5IYB K;  1YNJ A;  4A3G C;  1TWF C;  1R9T K;  3GTQ K;  3S1R C;  1TWA C;  1IW7 A;  3WOD A;  5TMC A;  2NVY K;  2YU9 K;  4AYB D;  2JA7 K;  3M4O K;  1I50 C;  4BY1 C;  3HOV K;  2E2J K;  1HQM A;  3H0G K;  1Y1W K;  2E2H K;  3GTJ K;  3PO3 C;  4BXX K;  1TWG C;  3K7A C;  1I3Q C;  1TWH C;  3HOV C;  4G7O A;  5IP7 C;  1Y1V C;  4Q5S A;  4QIW L;  4BBR K;  3S15 K;  3S1M K;  4G7H A;  3GTM K;  5C4X C;  3HOX K;  4YFK A;  3GTL C;  4C3J K;  5C3E K;  2R7Z C;  4A3C K;  3HOZ C;  2WAQ D;  3S16 C;  2PMZ L;  2WB1 D;  4A3L K;  1SFO K;  2A68 A;  4A3K C;  5FLM C;  2E2I C;  1K83 K;  3GTO K;  1I6H C;  3RZD K;  3HKZ L;  3GTP K;  3HOU K;  4A3E C;  3RZO C;  1ZYR A;  3DXJ A;  2O5J A;  2R93 C;  2NVQ C;  5C44 C;  5C4J C;  2VUM C;  3S14 K;  4XLN A;  2BE5 A;  4OIO A;  2JA8 C;  2JA6 K;  3GTG K;  3M3Y K;  3S1Q C;  3S17 K;  2PA8 D;  4A93 K;  4C2M K;  4C3I C;  4A3F C;  4X6A K;  4A3G K;  3S2D C;  1TWF K;  3S1R K;  1TWA K;  2A69 A;  3S1N C;  1I50 K;  4BY1 K;  4A3I C;  2R92 C;  2Y0S L;  2NVT C;  4YFX A;  3H3V D;  2CW0 A;  4LJZ A;  4OIN A;  4OIQ A;  3GTK C;  4A3D K;  4A3M C;  3PO3 K;  1TWG K;  4LK1 A;  1I3Q K;  1TWH K;  3K7A K;  4BY7 C;  4Y7N C;  1Y1V K;  4QJV B;  4KMU A;  5IP7 K;  2JA5 C;  5C4X K;  1WCM C;  4YFN A;  4KN4 A;  3CQZ C;  4QIW D;  3I4M C;  1SMY A;  3FKI C;  2A6H A;  3I4N C;  4GZY A;  2R7Z K;  4BBS K;  3HOZ K;  2NVX C;  3S16 K;  1XPP A;  4A3K K;  1I6V A;  5FLM K;  2E2I K;  1I6H K;  3HOW C;  4A3E K;  5IYD K;  4OIP A;  2PPB A;  4A3B C;  3PO2 K;  2PMZ D;  4LLG A; 
#chains in the Genus database with same CATH topology
 1O25 A;  2KXY A;  5IOQ A;  1AB4 A;  5C4J K;  1TWC C;  4P5A A;  2GSO A;  3S2H C;  3BUE A;  4A3I K;  3M3Y C;  2NVT K;  4P5B A;  5JVO A;  1JQW A;  3G4A A;  3H3V L;  1F7V A;  3GEE A;  4LQY A;  3GTL K;  3GTJ C;  4XSX A;  2P5M A;  2Y0S D;  3AQO A;  4BBR C;  4XSZ A;  3V4G A;  5EGH A;  1ZBS A;  4PAA A;  4C3J C;  1B4B A;  2JA5 A;  5M5Y K;  1BS2 A;  4BLB A;  1SFO C;  1EH1 A;  3GTO C;  3PIO S;  3RZD C;  1WOS A;  4OIR A;  2B63 K;  1XXA A;  1XZP B;  4A3J K;  1DCH A;  5IYD C;  3PO2 K;  3GTG C;  3S17 C;  4C2M C;  4XCH A;  3GTQ K;  3JST A;  3S1R C;  1WSR A;  1TWA C;  3NUH A;  2YU9 K;  4U67 S;  4AYB D;  2JA7 K;  4BY1 C;  1WQH A;  1O2F B;  1YX2 A;  1UV7 A;  4GTA A;  1IS1 A;  2L5N A;  1BGW A;  4IO9 S;  2E2H K;  2D6F C;  4QIW L;  3GEI A;  2RH6 A;  2NVY A;  4G7H A;  3BP8 C;  1J98 A;  3N0C A;  1O24 A;  3GTL C;  1VRQ C;  1V5V A;  1IE0 A;  4KMA A;  2WAQ D;  2PMZ L;  4A3L K;  2NVX A;  2L3U A;  4KM8 A;  4BLA A;  3N3Y A;  3HOU K;  5EGE A;  1ZYR A;  2NVQ C;  2PHC B;  2VUM C;  3S14 K;  4XLN A;  2BE5 A;  4OIO A;  2W7V A;  4Y52 K;  4A93 K;  3GTP A;  1WIH A;  2ZUE A;  2KWA A;  4FZB A;  1RU0 A;  2A69 A;  3S1N C;  4O2D A;  4BKW A;  2Y0S L;  4YFX A;  3H3V D;  4AH6 A;  3GTK C;  1VLO A;  3PO3 K;  1TWF A;  2CFA B;  3GEH A;  1WSV A;  4BY7 C;  5IP7 K;  3AH5 A;  2JA5 C;  4YFN A;  3CAG A;  3I4M C;  3I4N C;  2R7Z K;  2ZJQ S;  3TFI A;  1XPP A;  4PAB A;  1J6V A;  5FLM K;  3BP3 A;  1I6H K;  3HOW C;  3VA7 A;  3GTO A;  4A3B C;  5JVG S;  4LLG A;  1XXB A;  2JA8 K;  5IYC C;  4AYB L;  4A3F K;  1JOE A;  3GTG A;  3MML B;  5M3F K;  1USM A;  5M3M K;  5IYB C;  1R9T C;  3ADA C;  4KM9 A;  4WFN S;  2ZJP S;  2NVY C;  2R92 K;  2Y3P A;  2E2J C;  5M5X K;  3H0G C;  1BJT A;  4Y7N K;  3S1M C;  1HI9 A;  1O2A A;  4WJ3 M;  1WCM K;  5TJ3 A;  2WAQ L;  1EQR A;  3GTM C;  2KPU A;  2FQO A;  4J3N A;  3HOX C;  3GTL A;  3ORE A;  4KB2 A;  4JK1 A;  2R93 K;  3AD9 C;  1IQ0 A;  1O26 A;  4MEY A;  3GTP C;  5D4D A;  3SZY A;  1FEU A;  4KAS A;  5IP9 K;  3HOY K;  5M5W K;  4YG2 A;  2VUM A;  4WFB S;  4GTL A;  1BDF A;  4C3H K;  3S0X A;  4A3G C;  1TWF C;  4C45 A;  5TMC A;  3M4O K;  4GTB A;  1I50 C;  1WOO A;  2XCO A;  3GTK A;  1Y1W K;  4BXX K;  3GTQ A;  1TWG C;  1I3Q C;  4G7O A;  2GAG C;  3S15 K;  2JA7 A;  4IOA S;  1O28 A;  5C3E K;  4A3C K;  2WB1 D;  1XZQ A;  2A68 A;  3CF5 S;  4A3K C;  1K83 K;  5L46 A;  4KC6 A;  3SZZ A;  2O5J A;  2R93 C;  5C4J C;  2JA6 K;  1ZVU A;  2V6T A;  1ZXO A;  4X6A K;  3FOF A;  1B4A A;  1R9T A;  1GE9 A;  4A3I C;  4G0U A;  1VJE A;  2NVT C;  1DCO A;  1F7U A;  4OIQ A;  3H0G A;  3HOV K;  3K7A K;  1TWH K;  2V6U A;  1C0A A;  1J6X A;  1Y1V K;  3A8I A;  5C4X K;  3GTM A;  4BBS K;  4GZY A;  1PJ7 A;  3HOZ K;  3S16 K;  1JVI A;  2ZUF A;  4WJ4 A;  2E2I K;  4A3E K;  5HL7 S;  4OIP A;  3RZO K;  4RMF A;  2PPB A;  1DCP A;  3OEP A;  2R7Z A;  5C44 K;  2B63 C;  2GSU A;  3Q3Q A;  4ZH4 A;  4A3J C;  3S1Q K;  3PO2 C;  4M1X A;  4C3I K;  5DM7 S;  3S2D K;  3GTQ C;  4MQ9 A;  4G0V A;  2YU9 C;  2JA7 C;  1I50 A;  1F9N A;  4KDD A;  3QX3 A;  1INN A;  4A3M K;  2ZJR S;  4KB4 A;  4XLP A;  2E2H C;  2O5I A;  4LR2 A;  1TWG A;  1I3Q A;  4KAW X;  1VGX A;  3FHZ A;  1IL2 A;  2WB1 L;  3CQZ K;  3FKI K;  2P8T A;  1EFW A;  3GIR A;  2NVX K;  3EQL A;  3L4J A;  3N0B A;  4A3L C;  5IOR A;  1WCM A;  5TMF A;  1XXC A;  3HOU C;  4BBS C;  1WQG A;  2A6E A;  2R93 A;  1TWC K;  3S14 C;  2RGR A;  4Y52 C;  3HKZ D;  4A93 C;  2KQ1 A;  3S2H K;  1YNJ A;  3WOD A;  1XZP A;  3AQP A;  4GT9 A;  4KMD A;  3PO3 C;  3GTJ K;  5IP7 C;  2GAH C;  1O2B A;  4BBR K;  1WQF A;  1G51 A;  4YFK A;  4C3J K;  1ISE A;  2R7Z C;  3T02 A;  1SFO K;  3T00 A;  5FLM C;  3TFH A;  4GTF A;  3GTO K;  1I6H C;  3RZD K;  5CJ9 A;  3A8K A;  1EK8 A;  4LOW A;  2B63 A;  4GTE A;  2JA8 C;  4ILD A;  1K83 A;  3GTG K;  3S17 K;  2PA8 D;  4C2M K;  4A3F C;  4P9S A;  4FM9 A;  3S1R K;  3IPJ A;  1TWA K;  4GTC A;  3A8J A;  4WFA S;  2ZFZ A;  4BY1 K;  2R92 C;  2YU9 A;  2JA6 A;  4OIN A;  4LJZ A;  4DDQ A;  4A3D K;  1WOR A;  4LK1 A;  4Y7N C;  2E2H A;  4KMU A;  3GDZ A;  2EBB A;  1WCM C;  4KN4 A;  1IBA A;  1EI6 A;  3TTG A;  1SMY A;  2CFA A;  1TWH A;  5IOS A;  1Y1V A;  1I6V A;  1ZQ1 C;  3HKZ L;  3LAJ A;  2NVQ K;  2VUM K;  5IP9 C;  2E2I A;  3HOY C;  1WOP A;  5HL8 A;  4C3H C;  4Q4Z A;  3S1N K;  5FJ8 K;  3LPX A;  3M4O C;  4WF9 S;  4LK0 A;  1VH2 A;  5JFE A;  1PJ6 A;  3GTK K;  4G7Z A;  4KN7 A;  4NOI A;  1X31 C;  4KAT A;  1Y1W C;  4GFQ A;  4BY7 K;  4BXX C;  1L0W A;  4QJV A;  2JA5 K;  3S15 C;  4A3D C;  2JH3 A;  3I4M K;  3I4N K;  5C3E C;  4A3C C;  3HOW K;  1YNN A;  1K83 C;  3CQZ A;  2GSN A;  4MEX A;  3FKI A;  4A3B K;  1KQ4 A;  2PA8 L;  4GTD A;  3TFJ A;  5IYC K;  2JA6 C;  4X6A C;  2FQT A;  5IYB K;  1R9T K;  3DLL S;  1IW7 A;  2NVY K;  1TWC A;  2R92 A;  2E2J K;  1HQM A;  3H0G K;  3HOV C;  3K7A C;  1TWH C;  3S1M K;  1PJ5 A;  1Y1V C;  4Q5S A;  1XZQ B;  5IOT A;  3GTM K;  5C4X C;  3HOX K;  5DM6 S;  1USO A;  5E68 A;  3LAP A;  3ERE D;  3GTJ A;  4IOC S;  3HOZ C;  3S16 C;  2XCR B;  3AD7 C;  2E2I C;  3GTP K;  4A3E C;  2V6S A;  3RZO C;  3DXJ A;  3HXA A;  5HQH A;  5C44 C;  1O27 A;  1SFO A;  3PIP S;  1YCL A;  3M3Y K;  3S1Q C;  4C3I C;  3GSI A;  4A3G K;  3S2D C;  1TWF K;  4KMH A;  5CHP A;  1DD5 A;  1I50 K;  5JVH S;  1F93 A;  3LYW A;  2CW0 A;  3FOE A;  1J6W A;  4A3M C;  1TWG K;  4QJV B;  1I3Q K;  1TWA A;  1Y1W A;  3AD8 C;  3T01 A;  3CQZ C;  4QIW D;  2XCQ A;  3FKI C;  2A6H A;  4G0W A;  2NVX C;  4KAR A;  4A3K K;  1O29 A;  4WIL A;  5IYD K;  3OPF A;  3G4C A;  4WCE S;  3L4K A;  2PMZ D; 
#chains in the Genus database with same CATH homology
 2NVQ K;  5C44 K;  2B63 C;  5C4J K;  2VUM K;  2JA8 K;  5IP9 C;  4ZH4 A;  5IYC C;  4A3J C;  3HOY C;  1TWC C;  4AYB L;  3PO2 C;  3S1Q K;  4C3I K;  4A3F K;  5M3F K;  3S2D K;  3S2H C;  5M3M K;  4C3H C;  5IYB C;  4Q4Z A;  3GTQ C;  4MQ9 A;  1R9T C;  3S1N K;  5FJ8 K;  3RZO K;  4A3I K;  2NVY C;  2YU9 C;  3M4O C;  2JA7 C;  2R92 K;  4LK0 A;  3M3Y C;  2NVT K;  3GTK K;  2E2J C;  4G7Z A;  4KN7 A;  4NOI A;  4A3M K;  5M5X K;  3H0G C;  3GTL K;  3H3V L;  4XLP A;  1Y1W C;  2E2H C;  3GTJ C;  2O5I A;  4BXX C;  4Y7N K;  4BY7 K;  4QJV A;  4XSX A;  3S1M C;  2JA5 K;  2Y0S D;  3S15 C;  4BBR C;  1WCM K;  4XSZ A;  2WAQ L;  2WB1 L;  3GTM C;  4A3D C;  3CQZ K;  3HOX C;  3I4M K;  3I4N K;  3FKI K;  4C3J C;  2NVX K;  3EQL A;  5C3E C;  4A3C C;  4JK1 A;  2R93 K;  4A3L C;  5M5Y K;  1SFO C;  4MEY A;  3HOW K;  1YNN A;  3GTO C;  4Y52 K;  1K83 C;  3RZD C;  5TMF A;  3GTP C;  3HOU C;  4BBS C;  4MEX A;  5D4D A;  4A3B K;  2PA8 L;  4OIR A;  2B63 K;  2A6E A;  5IP9 K;  5IYC K;  4A3J K;  5M5W K;  1TWC K;  4YG2 A;  5IYD C;  3S14 C;  3HOY K;  4Y52 C;  3HKZ D;  2JA6 C;  3GTG C;  1BDF A;  4A93 C;  3S17 C;  4C2M C;  3S2H K;  4X6A C;  4C3H K;  5IYB K;  1YNJ A;  4A3G C;  1TWF C;  1R9T K;  3GTQ K;  3S1R C;  1TWA C;  1IW7 A;  3WOD A;  5TMC A;  2NVY K;  2YU9 K;  4AYB D;  2JA7 K;  3M4O K;  1I50 C;  4BY1 C;  3HOV K;  2E2J K;  1HQM A;  3H0G K;  1Y1W K;  2E2H K;  3GTJ K;  3PO3 C;  4BXX K;  1TWG C;  3K7A C;  1I3Q C;  1TWH C;  3HOV C;  4G7O A;  5IP7 C;  1Y1V C;  4Q5S A;  4QIW L;  4BBR K;  3S15 K;  3S1M K;  4G7H A;  3GTM K;  5C4X C;  3HOX K;  4YFK A;  3GTL C;  4C3J K;  5C3E K;  2R7Z C;  4A3C K;  3HOZ C;  2WAQ D;  3S16 C;  2PMZ L;  2WB1 D;  4A3L K;  1SFO K;  2A68 A;  4A3K C;  5FLM C;  2E2I C;  1K83 K;  3GTO K;  1I6H C;  3RZD K;  3HKZ L;  3GTP K;  3HOU K;  4A3E C;  3RZO C;  1ZYR A;  3DXJ A;  2O5J A;  2R93 C;  2NVQ C;  5C44 C;  5C4J C;  2VUM C;  3S14 K;  4XLN A;  2BE5 A;  4OIO A;  2JA8 C;  2JA6 K;  3GTG K;  3M3Y K;  3S1Q C;  3S17 K;  2PA8 D;  4A93 K;  4C2M K;  4C3I C;  4A3F C;  4X6A K;  4A3G K;  3S2D C;  1TWF K;  3S1R K;  1TWA K;  2A69 A;  3S1N C;  1I50 K;  4BY1 K;  4A3I C;  2R92 C;  2Y0S L;  2NVT C;  4YFX A;  3H3V D;  2CW0 A;  4LJZ A;  4OIN A;  4OIQ A;  3GTK C;  4A3D K;  4A3M C;  3PO3 K;  1TWG K;  4LK1 A;  1I3Q K;  1TWH K;  3K7A K;  4BY7 C;  4Y7N C;  1Y1V K;  4QJV B;  4KMU A;  5IP7 K;  2JA5 C;  5C4X K;  1WCM C;  4YFN A;  4KN4 A;  3CQZ C;  4QIW D;  3I4M C;  1SMY A;  3FKI C;  2A6H A;  3I4N C;  4GZY A;  2R7Z K;  4BBS K;  3HOZ K;  2NVX C;  3S16 K;  1XPP A;  4A3K K;  1I6V A;  5FLM K;  2E2I K;  1I6H K;  3HOW C;  4A3E K;  5IYD K;  4OIP A;  2PPB A;  4A3B C;  3PO2 K;  2PMZ D;  4LLG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...