2O5IA

Crystal structure of the t. thermophilus rna polymerase elongation complex
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
229
structure length
229
Chain Sequence
MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(P*CP*CP*CP*TP*GP*TP*CP*TP*GP*GP*CP*GP*TP*TP*CP*GP*CP*GP
publication title Structural basis for transcription elongation by bacterial RNA polymerase.
pubmed doi rcsb
molecule tags Transferase/dna-rna hybrid
total genus 39
structure length 229
sequence length 229
chains with identical sequence B, K, L
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2006-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01000 RNA_pol_A_bac RNA polymerase Rpb3/RpoA insert domain
A PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain
A PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.12 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 DNA-directed RNA polymerase, insert domain 2o5iA02
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 2o5iA01
4A3CK 3S17C 3HKZD 2NVTC 3S2DC 3PO2K 5M3MK 2E2HC 4QJVA 3GTPC 5C4JC 3H0GK 4BY7K 4MEXA 3GTKK 3M3YK 2YU9K 1YNNA 4BY1K 4C3HC 5C3EC 3GTJC 3GTMK 4OIPA 4X6AK 3HOXC 3HOVC 1BDFA 2JA7K 4KN4A 3RZDC 5IP7K 1TWAK 3S1NK 4KMUA 4BBSK 1K83C 4A3KC 3I4NK 3S14K 3GTLC 3RZOC 4A3BC 1Y1WK 1ZYRA 4A3DK 1SFOC 5FLMC 1I50K 2R93K 2E2IK 2B63C 4A3GK 5IP9C 3S1MC 2VUMK 5IYBK 1TWFK 4XLNA 4A3EC 4XSXA 4LK1A 2JA6K 3FKIC 4GZYA 4A3FC 3HOZC 4MQ9A 2JA8C 1WCMK 4G7OA 4C3JK 3PO3C 1I6HC 1XPPA 4Y7NK 2Y0SL 3GTQK 1R9TK 3K7AC 4C3IC 3M4OC 4G7HA 2WB1L 5C4XK 2Y0SD 2R7ZK 1YNJA 3CQZK 4OIOA 4YFKA 1TWGC 4A3MK 5C44K 4YFXA 2NVXK 3HOWK 5IYCC 3H0GC 4A3CC 5M5YK 4NOIA 3PO2C 3S1NC 2O5IA 4BY7C 3S15C 3S1QK 4A3LK 3I4MC 3GTOK 1I6VA 3GTKC 2YU9C 5D4DA 2NVQC 2R92K 4X6AC 3GTMC 1SMYA 4C2MK 1TWCK 4LK0A 5M3FK 5IP7C 2NVYK 3HOUK 3I4NC 3S2HK 3S14C 2PMZL 2CW0A 1I50C 2E2IC 3GTGK 3S16C 3GTJK 1TWFC 2JA6C 3HOXK 3HOVK 2VUMC 2PMZD 2JA5C 4OINA 4BXXK 1WCMC 3S1RC 4Y7NC 3GTQC 1R9TC 4QJVB 4BBRK 4A3IK 2E2JC 4XSZA 1TWHK 2WB1D 2JA5K 5C4XC 1I3QK 2R7ZC 4A3EK 3FKIK 3HOYK 2O5JA 4A3MC 3M3YC 3WODA 2NVXC 4BY1C 3HOWC 4A3JK 1I6HK 5IYDK 4C3IK 3M4OK 3DXJA 2JA7C 3S1QC 4A3LC 1Y1VK 3GTOC 4BBSC 1TWAC 2PPBA 5M5XK 4Y52K 3H3VL 4A93K 2BE5A 4C2MC 1TWCC 5M5WK 1Y1WC 2NVTK 3S17K 3S2DK 4A3DC 2A6EA 2NVYC 4Q4ZA 2R93C 5C4JK 2E2HK 3HOUC 3GTPK 2PA8L 1HQMA 4A3GC 5IYBC 4C3HK 5C3EK 4LLGA 3H3VD 2WAQL 4AYBL 4G7ZA 3S15K 4C3JC 3I4MK 3RZDK 1IW7A 4MEYA 3GTGC 1K83K 4A3KK 2NVQK 5FJ8K 3GTLK 2PA8D 4LJZA 5TMCA 3RZOK 4A3BK 4BXXC 1SFOK 4AYBD 2WAQD 5FLMK 4QIWL 2B63K 5IP9K 4YFNA 4BBRC 3S1MK 3EQLA 3CQZC 4A3IC 1TWHC 4A3FK 3HOZK 2A69A 2JA8K 5C44C 3PO3K 5TMFA 3S16K 3K7AK 4A93C 1I3QC 2A68A 4QIWD 4YG2A 4OIRA 3HOYC 3S1RK 5IYDC 4A3JC 2R92C 3HKZL 4XLPA 4ZH4A 4OIQA 4Q5SA 1Y1VC 4KN7A 2E2JK 4JK1A 1TWGK 3S2HC 4Y52C 5IYCK 2A6HA
chains in the Genus database with same CATH superfamily
4A3CK 2ZJRS 5M3MK 2E2IA 4BKWA 3GDZA 3M3YK 2JA6A 4OIPA 1K83C 4A3KC 3I4NK 4DDQA 4A3BC 1ZYRA 2B63C 4M1XA 5IP9C 4GTEA 3DLLS 4GZYA 3HOZC 2JA8C 3PO3C 4Y7NK 1XPPA 4LQYA 4G7HA 1IS1A 1USOA 2WB1L 1XZQA 1TWCA 2XCQA 2Y0SD 2R7ZK 2R93A 4OIOA 5M5YK 3H0GC 3S1NC 2O5IA 3S1QK 4A3LK 3I4MC 1O27A 1R9TA 3GTKC 2YU9C 2NVQC 2R92K 1O2FB 5IP7C 2NVYK 4GTFA 4BLBA 2D6FC 3S14C 1WQGA 1ZXOA 1ISEA 2CW0A 5TJ3A 5CJ9A 5IOTA 1EFWA 2RGRA 3S16C 1WOPA 3BP3A 1TWFC 3GTJK 1O24A 3HOVK 2VUMC 2JA5C 4P5AA 4BBRK 1WORA 4IO9S 3LAJA 4A3IK 1O2BA 2KQ1A 2E2HA 3HXAA 4A3EK 2KWAA 2EBBA 3M3YC 2NVXC 3HOWC 1EI6A 1Y1VK 5CHPA 3GTOC 2PPBA 1DCOA 3GTLA 4Y52K 3SZYA 4Q4ZA 1X31C 3H3VD 3S15K 3BP8C 2ZUEA 1IW7A 1BS2A 4MEYA 3GTGC 1K83K 4KMAA 4WCES 4A3KK 4IOCS 5FJ8K 2PA8D 4LJZA 4A3BK 4BXXC 2B63K 5IP9K 1BJTA 4YFNA 3AD7C 1EQRA 3EQLA 3QX3A 4WFNS 4P5BA 4O2DA 5JVGS 3HOZK 2JA8K 3PO3K 1JVIA 4KMDA 4KC6A 4QIWD 4OIRA 1PJ5A 1HI9A 3HOYC 3AQPA 4A3JC 2R92C 4XLPA 4OIQA 1WIHA 4G0UA 4KN7A 2E2JK 4A93C 3H0GK 3S1NK 2NVTC 3S2DC 5EGEA 3GTPC 4KMHA 3GTKK 2YU9K 5IORA 3FOFA 3GTJC 3HOVC 4PABA 5IP7K 2ZFZA 3LPXA 1AB4A 3S14K 4GTCA 3RZOC 2KPUA 4A3DK 4KM9A 5FLMC 3N3YA 1WOSA 1WOOA 3S1MC 5IYBK 4KB4A 1TWFK 4XLNA 4A3EC 4LK1A 3T00A 3S0XA 2VUMK 4A3FC 2JA5K 4MQ9A 3GTMA 3K7AC 2JA7A 2P8TA 1TWAA 2FQOA 1IBAA 3AQOA 1Y1WA 1B4AA 2NVYA 1J6XA 1YNJA 2CFAB 4YFKA 1TWGC 2NVXK 3HOWK 3PO2C 1J6VA 4BY7C 3S15C 3GTOK 5D4DA 2GAGC 1IQ0A 1SMYA 4WJ4A 4WF9S 1C0AA 3VA7A 3CQZA 3AD8C 1I50C 4J3NA 3GTGK 2L3UA 2PMZD 4OINA 4BXXK 1WCMC 4KARA 5HL7S 3GTQC 1R9TC 1VRQC 1XXAA 1IE0A 2E2JC 4PAAA 4WFAS 1VJEA 1YX2A 2GSUA 4ILDA 4GTAA 3FKIK 2XCOA 3HOYK 2O5JA 1I6HK 4A3JK 2GAHC 3M4OK 3T02A 3DXJA 3GSIA 5M5XK 1K83A 3GIRA 4A93K 4C2MC 4GTBA 1DCPA 4KB2A 2NVTK 3S2DK 4A3DC 3GTPK 3LYWA 1I3QA 3FHZA 5IYBC 2WAQL 2CFAA 3GEHA 3RZOK 5TMCA 5IOSA 3IPJA 1J6WA 4AYBD 1WQHA 5FLMK 3S1MK 1PJ7A 2FQTA 5DM7S 1TWHC 4A3FK 3H0GA 1PJ6A 4P9SA 1XZPB 3K7AK 3NUHA 2A68A 3GTKA 2YU9A 3S1RK 1USMA 3PIOS 4ZH4A 5IOQA 1TWGK 1O2AA 3PO2K 3HKZD 4BY7K 4LOWA 3TFIA 4MEXA 1V5VA 1YNNA 1TWFA 3GEEA 5C3EC 2VUMA 2JA5A 1JQWA 2ZJPS 4KN4A 3G4CA 1SFOC 1I50K 2P5MA 2R93K 1DD5A 4A3GK 3CAGA 3FKIC 2NVXA 4C3JK 1WCMK 1VH2A 1I6HC 2Y0SL 3GTQK 1R9TK 3M4OC 3GTOA 1WQFA 3ERED 5HL8A 5JVHS 3TFHA 3A8KA 4YFXA 5JFEA 4NOIA 3GTGA 3JSTA 2GSNA 1GE9A 4X6AC 3GTMC 3GEIA 4C2MK 4LK0A 1XZPA 3Q3QA 2R7ZA 4WJ3M 1KQ4A 2E2IC 3A8JA 2JA6C 1XZQB 3HOXK 1JOEA 2R92A 3S1RC 2XCRB 3L4JA 4QJVB 1TWHK 4XSZA 1DCHA 5C4XC 1XXCA 4A3MC 3GTJA 3CF5S 4C3IK 4KDDA 1FEUA 3H3VL 1F93A 1J98A 1TWCC 5M5WK 3AD9C 2A6EA 2R93C 3HOUC 2PA8L 1HQMA 4A3GC 3AH5A 5C3EK 3ADAC 4C3JC 4GFQA 1Y1VA 4KAWX 1SFOK 5EGHA 1ZBSA 4QIWL 4RMFA 3OEPA 1TWGA 1EH1A 5TMFA 2W7VA 1I3QC 4YG2A 3FOEA 1VGXA 4XCHA 5HQHA 4KASA 5IYDC 3N0BA 4C45A 2B63A 2A6HA 1RU0A 3S17C 1I50A 4G0WA 2RH6A 2E2HC 4QJVA 5C4JC 5DM6S 2L5NA 2KXYA 4BY1K 4C3HC 3G4AA 3GTMK 4X6AK 2V6UA 3HOXC 4WFBS 1WCMA 1BDFA 2JA7K 3GTQA 3RZDC 4BBSK 1TWAK 4KMUA 3T01A 3TTGA 3GTLC 1Y1WK 2E2IK 4XSXA 3MMLB 2Y3PA 2JA6K 1VLOA 4G7OA 1G51A 5JVOA 4C3IC 4KM8A 1F9NA 1ZQ1C 2V6SA 4FM9A 5C4XK 3CQZK 4GTLA 4A3MK 1INNA 2GSOA 5C44K 3TFJA 5IYCC 3OPFA 4A3CC 2ZJQS 1O28A 1I6VA 1TWCK 5M3FK 3HOUK 3I4NC 3S2HK 1TWHA 2PMZL 3L4KA 1WSVA 2V6TA 1O26A 3N0CA 2PHCB 4Y7NC 3OREA 3PIPS 1B4BA 1XXBA 2WB1D 1I3QK 4KATA 2R7ZC 1WSRA 4G0VA 3WODA 1ZVUA 4BY1C 5IYDK 4FZBA 1UV7A 2JA7C 3S1QC 4A3LC 4BBSC 1TWAC 4LR2A 3BUEA 2BE5A 5L46A 3S17K 1Y1WC 1SFOA 2E2HK 1O25A 2NVYC 5C4JK 3A8IA 4IOAS 4BLAA 2ZUFA 2JH3A 5E68A 3FKIA 4C3HK 4LLGA 1F7UA 4AYBL 4G7ZA 1YCLA 1L0WA 3I4MK 3RZDK 2NVQK 4U67S 3V4GA 3GTLK 4GT9A 3LAPA 1IL2A 2WAQD 1O29A 3SZZA 4BBRC 3GTPA 1EK8A 3CQZC 4A3IC 4AH6A 2A69A 5C44C 1BGWA 4GTDA 3S16K 4WILA 3HKZL 1F7VA 4Q5SA 1Y1VC 4JK1A 3S2HC 4Y52C 5IYCK
chains in the Genus database with same CATH topology
4A3CK 3S17C 3HKZD 2NVTC 3S2DC 3PO2K 5M3MK 2E2HC 4QJVA 3GTPC 5C4JC 3H0GK 4BY7K 4MEXA 3GTKK 3M3YK 2YU9K 1YNNA 4BY1K 4C3HC 5C3EC 3GTJC 3GTMK 4OIPA 4X6AK 3HOXC 3HOVC 1BDFA 2JA7K 4KN4A 3RZDC 5IP7K 1TWAK 3S1NK 4KMUA 4BBSK 1K83C 4A3KC 3I4NK 3S14K 3GTLC 3RZOC 4A3BC 1Y1WK 1ZYRA 4A3DK 1SFOC 5FLMC 1I50K 2R93K 2E2IK 2B63C 4A3GK 5IP9C 3S1MC 2VUMK 5IYBK 1TWFK 4XLNA 4A3EC 4XSXA 4LK1A 2JA6K 3FKIC 4GZYA 4A3FC 3HOZC 4MQ9A 2JA8C 1WCMK 4G7OA 4C3JK 3PO3C 1I6HC 1XPPA 4Y7NK 2Y0SL 3GTQK 1R9TK 3K7AC 4C3IC 3M4OC 4G7HA 2WB1L 5C4XK 2Y0SD 2R7ZK 1YNJA 3CQZK 4OIOA 4YFKA 1TWGC 4A3MK 5C44K 4YFXA 2NVXK 3HOWK 5IYCC 3H0GC 4A3CC 5M5YK 4NOIA 3PO2C 3S1NC 2O5IA 4BY7C 3S15C 3S1QK 4A3LK 3I4MC 3GTOK 1I6VA 3GTKC 2YU9C 5D4DA 2NVQC 2R92K 4X6AC 3GTMC 1SMYA 4C2MK 1TWCK 4LK0A 5M3FK 5IP7C 2NVYK 3HOUK 3I4NC 3S2HK 3S14C 2PMZL 2CW0A 1I50C 2E2IC 3GTGK 3S16C 3GTJK 1TWFC 2JA6C 3HOXK 3HOVK 2VUMC 2PMZD 2JA5C 4OINA 4BXXK 1WCMC 3S1RC 4Y7NC 3GTQC 1R9TC 4QJVB 4BBRK 4A3IK 2E2JC 4XSZA 1TWHK 2WB1D 2JA5K 5C4XC 1I3QK 2R7ZC 4A3EK 3FKIK 3HOYK 2O5JA 4A3MC 3M3YC 3WODA 2NVXC 4BY1C 3HOWC 4A3JK 1I6HK 5IYDK 4C3IK 3M4OK 3DXJA 2JA7C 3S1QC 4A3LC 1Y1VK 3GTOC 4BBSC 1TWAC 2PPBA 5M5XK 4Y52K 3H3VL 4A93K 2BE5A 4C2MC 1TWCC 5M5WK 1Y1WC 2NVTK 3S17K 3S2DK 4A3DC 2A6EA 2NVYC 4Q4ZA 2R93C 5C4JK 2E2HK 3HOUC 3GTPK 2PA8L 1HQMA 4A3GC 5IYBC 4C3HK 5C3EK 4LLGA 3H3VD 2WAQL 4AYBL 4G7ZA 3S15K 4C3JC 3I4MK 3RZDK 1IW7A 4MEYA 3GTGC 1K83K 4A3KK 2NVQK 5FJ8K 3GTLK 2PA8D 4LJZA 5TMCA 3RZOK 4A3BK 4BXXC 1SFOK 4AYBD 2WAQD 5FLMK 4QIWL 2B63K 5IP9K 4YFNA 4BBRC 3S1MK 3EQLA 3CQZC 4A3IC 1TWHC 4A3FK 3HOZK 2A69A 2JA8K 5C44C 3PO3K 5TMFA 3S16K 3K7AK 4A93C 1I3QC 2A68A 4QIWD 4YG2A 4OIRA 3HOYC 3S1RK 5IYDC 4A3JC 2R92C 3HKZL 4XLPA 4ZH4A 4OIQA 4Q5SA 1Y1VC 4KN7A 2E2JK 4JK1A 1TWGK 3S2HC 4Y52C 5IYCK 2A6HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A3C K;  3S17 C;  3HKZ D;  2NVT C;  3S2D C;  3PO2 K;  5M3M K;  2E2H C;  4QJV A;  3GTP C;  5C4J C;  3H0G K;  4BY7 K;  4MEX A;  3GTK K;  3M3Y K;  2YU9 K;  1YNN A;  4BY1 K;  4C3H C;  5C3E C;  3GTJ C;  3GTM K;  4OIP A;  4X6A K;  3HOX C;  3HOV C;  1BDF A;  2JA7 K;  4KN4 A;  3RZD C;  5IP7 K;  1TWA K;  3S1N K;  4KMU A;  4BBS K;  1K83 C;  4A3K C;  3I4N K;  3S14 K;  3GTL C;  3RZO C;  4A3B C;  1Y1W K;  1ZYR A;  4A3D K;  1SFO C;  5FLM C;  1I50 K;  2R93 K;  2E2I K;  2B63 C;  4A3G K;  5IP9 C;  3S1M C;  2VUM K;  5IYB K;  1TWF K;  4XLN A;  4A3E C;  4XSX A;  4LK1 A;  2JA6 K;  3FKI C;  4GZY A;  4A3F C;  3HOZ C;  4MQ9 A;  2JA8 C;  1WCM K;  4G7O A;  4C3J K;  3PO3 C;  1I6H C;  1XPP A;  4Y7N K;  2Y0S L;  3GTQ K;  1R9T K;  3K7A C;  4C3I C;  3M4O C;  4G7H A;  2WB1 L;  5C4X K;  2Y0S D;  2R7Z K;  1YNJ A;  3CQZ K;  4OIO A;  4YFK A;  1TWG C;  4A3M K;  5C44 K;  4YFX A;  2NVX K;  3HOW K;  5IYC C;  3H0G C;  4A3C C;  5M5Y K;  4NOI A;  3PO2 C;  3S1N C;  2O5I A;  4BY7 C;  3S15 C;  3S1Q K;  4A3L K;  3I4M C;  3GTO K;  1I6V A;  3GTK C;  2YU9 C;  5D4D A;  2NVQ C;  2R92 K;  4X6A C;  3GTM C;  1SMY A;  4C2M K;  1TWC K;  4LK0 A;  5M3F K;  5IP7 C;  2NVY K;  3HOU K;  3I4N C;  3S2H K;  3S14 C;  2PMZ L;  2CW0 A;  1I50 C;  2E2I C;  3GTG K;  3S16 C;  3GTJ K;  1TWF C;  2JA6 C;  3HOX K;  3HOV K;  2VUM C;  2PMZ D;  2JA5 C;  4OIN A;  4BXX K;  1WCM C;  3S1R C;  4Y7N C;  3GTQ C;  1R9T C;  4QJV B;  4BBR K;  4A3I K;  2E2J C;  4XSZ A;  1TWH K;  2WB1 D;  2JA5 K;  5C4X C;  1I3Q K;  2R7Z C;  4A3E K;  3FKI K;  3HOY K;  2O5J A;  4A3M C;  3M3Y C;  3WOD A;  2NVX C;  4BY1 C;  3HOW C;  4A3J K;  1I6H K;  5IYD K;  4C3I K;  3M4O K;  3DXJ A;  2JA7 C;  3S1Q C;  4A3L C;  1Y1V K;  3GTO C;  4BBS C;  1TWA C;  2PPB A;  5M5X K;  4Y52 K;  3H3V L;  4A93 K;  2BE5 A;  4C2M C;  1TWC C;  5M5W K;  1Y1W C;  2NVT K;  3S17 K;  3S2D K;  4A3D C;  2A6E A;  2NVY C;  4Q4Z A;  2R93 C;  5C4J K;  2E2H K;  3HOU C;  3GTP K;  2PA8 L;  1HQM A;  4A3G C;  5IYB C;  4C3H K;  5C3E K;  4LLG A;  3H3V D;  2WAQ L;  4AYB L;  4G7Z A;  3S15 K;  4C3J C;  3I4M K;  3RZD K;  1IW7 A;  4MEY A;  3GTG C;  1K83 K;  4A3K K;  2NVQ K;  5FJ8 K;  3GTL K;  2PA8 D;  4LJZ A;  5TMC A;  3RZO K;  4A3B K;  4BXX C;  1SFO K;  4AYB D;  2WAQ D;  5FLM K;  4QIW L;  2B63 K;  5IP9 K;  4YFN A;  4BBR C;  3S1M K;  3EQL A;  3CQZ C;  4A3I C;  1TWH C;  4A3F K;  3HOZ K;  2A69 A;  2JA8 K;  5C44 C;  3PO3 K;  5TMF A;  3S16 K;  3K7A K;  4A93 C;  1I3Q C;  2A68 A;  4QIW D;  4YG2 A;  4OIR A;  3HOY C;  3S1R K;  5IYD C;  4A3J C;  2R92 C;  3HKZ L;  4XLP A;  4ZH4 A;  4OIQ A;  4Q5S A;  1Y1V C;  4KN7 A;  2E2J K;  4JK1 A;  1TWG K;  3S2H C;  4Y52 C;  5IYC K;  2A6H A; 
#chains in the Genus database with same CATH topology
 4A3C K;  2ZJR S;  5M3M K;  2E2I A;  4BKW A;  3GDZ A;  3M3Y K;  2JA6 A;  4OIP A;  1K83 C;  4A3K C;  3I4N K;  4DDQ A;  4A3B C;  1ZYR A;  2B63 C;  4M1X A;  5IP9 C;  4GTE A;  3DLL S;  4GZY A;  3HOZ C;  2JA8 C;  3PO3 C;  4Y7N K;  1XPP A;  4LQY A;  4G7H A;  1IS1 A;  1USO A;  2WB1 L;  1XZQ A;  1TWC A;  2XCQ A;  2Y0S D;  2R7Z K;  2R93 A;  4OIO A;  5M5Y K;  3H0G C;  3S1N C;  2O5I A;  3S1Q K;  4A3L K;  3I4M C;  1O27 A;  1R9T A;  3GTK C;  2YU9 C;  2NVQ C;  2R92 K;  1O2F B;  5IP7 C;  2NVY K;  4GTF A;  4BLB A;  2D6F C;  3S14 C;  1WQG A;  1ZXO A;  1ISE A;  2CW0 A;  5TJ3 A;  5CJ9 A;  5IOT A;  1EFW A;  2RGR A;  3S16 C;  1WOP A;  3BP3 A;  1TWF C;  3GTJ K;  1O24 A;  3HOV K;  2VUM C;  2JA5 C;  4P5A A;  4BBR K;  1WOR A;  4IO9 S;  3LAJ A;  4A3I K;  1O2B A;  2KQ1 A;  2E2H A;  3HXA A;  4A3E K;  2KWA A;  2EBB A;  3M3Y C;  2NVX C;  3HOW C;  1EI6 A;  1Y1V K;  5CHP A;  3GTO C;  2PPB A;  1DCO A;  3GTL A;  4Y52 K;  3SZY A;  4Q4Z A;  1X31 C;  3H3V D;  3S15 K;  3BP8 C;  2ZUE A;  1IW7 A;  1BS2 A;  4MEY A;  3GTG C;  1K83 K;  4KMA A;  4WCE S;  4A3K K;  4IOC S;  5FJ8 K;  2PA8 D;  4LJZ A;  4A3B K;  4BXX C;  2B63 K;  5IP9 K;  1BJT A;  4YFN A;  3AD7 C;  1EQR A;  3EQL A;  3QX3 A;  4WFN S;  4P5B A;  4O2D A;  5JVG S;  3HOZ K;  2JA8 K;  3PO3 K;  1JVI A;  4KMD A;  4KC6 A;  4QIW D;  4OIR A;  1PJ5 A;  1HI9 A;  3HOY C;  3AQP A;  4A3J C;  2R92 C;  4XLP A;  4OIQ A;  1WIH A;  4G0U A;  4KN7 A;  2E2J K;  4A93 C;  3H0G K;  3S1N K;  2NVT C;  3S2D C;  5EGE A;  3GTP C;  4KMH A;  3GTK K;  2YU9 K;  5IOR A;  3FOF A;  3GTJ C;  3HOV C;  4PAB A;  5IP7 K;  2ZFZ A;  3LPX A;  1AB4 A;  3S14 K;  4GTC A;  3RZO C;  2KPU A;  4A3D K;  4KM9 A;  5FLM C;  3N3Y A;  1WOS A;  1WOO A;  3S1M C;  5IYB K;  4KB4 A;  1TWF K;  4XLN A;  4A3E C;  4LK1 A;  3T00 A;  3S0X A;  2VUM K;  4A3F C;  2JA5 K;  4MQ9 A;  3GTM A;  3K7A C;  2JA7 A;  2P8T A;  1TWA A;  2FQO A;  1IBA A;  3AQO A;  1Y1W A;  1B4A A;  2NVY A;  1J6X A;  1YNJ A;  2CFA B;  4YFK A;  1TWG C;  2NVX K;  3HOW K;  3PO2 C;  1J6V A;  4BY7 C;  3S15 C;  3GTO K;  5D4D A;  2GAG C;  1IQ0 A;  1SMY A;  4WJ4 A;  4WF9 S;  1C0A A;  3VA7 A;  3CQZ A;  3AD8 C;  1I50 C;  4J3N A;  3GTG K;  2L3U A;  2PMZ D;  4OIN A;  4BXX K;  1WCM C;  4KAR A;  5HL7 S;  3GTQ C;  1R9T C;  1VRQ C;  1XXA A;  1IE0 A;  2E2J C;  4PAA A;  4WFA S;  1VJE A;  1YX2 A;  2GSU A;  4ILD A;  4GTA A;  3FKI K;  2XCO A;  3HOY K;  2O5J A;  1I6H K;  4A3J K;  2GAH C;  3M4O K;  3T02 A;  3DXJ A;  3GSI A;  5M5X K;  1K83 A;  3GIR A;  4A93 K;  4C2M C;  4GTB A;  1DCP A;  4KB2 A;  2NVT K;  3S2D K;  4A3D C;  3GTP K;  3LYW A;  1I3Q A;  3FHZ A;  5IYB C;  2WAQ L;  2CFA A;  3GEH A;  3RZO K;  5TMC A;  5IOS A;  3IPJ A;  1J6W A;  4AYB D;  1WQH A;  5FLM K;  3S1M K;  1PJ7 A;  2FQT A;  5DM7 S;  1TWH C;  4A3F K;  3H0G A;  1PJ6 A;  4P9S A;  1XZP B;  3K7A K;  3NUH A;  2A68 A;  3GTK A;  2YU9 A;  3S1R K;  1USM A;  3PIO S;  4ZH4 A;  5IOQ A;  1TWG K;  1O2A A;  3PO2 K;  3HKZ D;  4BY7 K;  4LOW A;  3TFI A;  4MEX A;  1V5V A;  1YNN A;  1TWF A;  3GEE A;  5C3E C;  2VUM A;  2JA5 A;  1JQW A;  2ZJP S;  4KN4 A;  3G4C A;  1SFO C;  1I50 K;  2P5M A;  2R93 K;  1DD5 A;  4A3G K;  3CAG A;  3FKI C;  2NVX A;  4C3J K;  1WCM K;  1VH2 A;  1I6H C;  2Y0S L;  3GTQ K;  1R9T K;  3M4O C;  3GTO A;  1WQF A;  3ERE D;  5HL8 A;  5JVH S;  3TFH A;  3A8K A;  4YFX A;  5JFE A;  4NOI A;  3GTG A;  3JST A;  2GSN A;  1GE9 A;  4X6A C;  3GTM C;  3GEI A;  4C2M K;  4LK0 A;  1XZP A;  3Q3Q A;  2R7Z A;  4WJ3 M;  1KQ4 A;  2E2I C;  3A8J A;  2JA6 C;  1XZQ B;  3HOX K;  1JOE A;  2R92 A;  3S1R C;  2XCR B;  3L4J A;  4QJV B;  1TWH K;  4XSZ A;  1DCH A;  5C4X C;  1XXC A;  4A3M C;  3GTJ A;  3CF5 S;  4C3I K;  4KDD A;  1FEU A;  3H3V L;  1F93 A;  1J98 A;  1TWC C;  5M5W K;  3AD9 C;  2A6E A;  2R93 C;  3HOU C;  2PA8 L;  1HQM A;  4A3G C;  3AH5 A;  5C3E K;  3ADA C;  4C3J C;  4GFQ A;  1Y1V A;  4KAW X;  1SFO K;  5EGH A;  1ZBS A;  4QIW L;  4RMF A;  3OEP A;  1TWG A;  1EH1 A;  5TMF A;  2W7V A;  1I3Q C;  4YG2 A;  3FOE A;  1VGX A;  4XCH A;  5HQH A;  4KAS A;  5IYD C;  3N0B A;  4C45 A;  2B63 A;  2A6H A;  1RU0 A;  3S17 C;  1I50 A;  4G0W A;  2RH6 A;  2E2H C;  4QJV A;  5C4J C;  5DM6 S;  2L5N A;  2KXY A;  4BY1 K;  4C3H C;  3G4A A;  3GTM K;  4X6A K;  2V6U A;  3HOX C;  4WFB S;  1WCM A;  1BDF A;  2JA7 K;  3GTQ A;  3RZD C;  4BBS K;  1TWA K;  4KMU A;  3T01 A;  3TTG A;  3GTL C;  1Y1W K;  2E2I K;  4XSX A;  3MML B;  2Y3P A;  2JA6 K;  1VLO A;  4G7O A;  1G51 A;  5JVO A;  4C3I C;  4KM8 A;  1F9N A;  1ZQ1 C;  2V6S A;  4FM9 A;  5C4X K;  3CQZ K;  4GTL A;  4A3M K;  1INN A;  2GSO A;  5C44 K;  3TFJ A;  5IYC C;  3OPF A;  4A3C C;  2ZJQ S;  1O28 A;  1I6V A;  1TWC K;  5M3F K;  3HOU K;  3I4N C;  3S2H K;  1TWH A;  2PMZ L;  3L4K A;  1WSV A;  2V6T A;  1O26 A;  3N0C A;  2PHC B;  4Y7N C;  3ORE A;  3PIP S;  1B4B A;  1XXB A;  2WB1 D;  1I3Q K;  4KAT A;  2R7Z C;  1WSR A;  4G0V A;  3WOD A;  1ZVU A;  4BY1 C;  5IYD K;  4FZB A;  1UV7 A;  2JA7 C;  3S1Q C;  4A3L C;  4BBS C;  1TWA C;  4LR2 A;  3BUE A;  2BE5 A;  5L46 A;  3S17 K;  1Y1W C;  1SFO A;  2E2H K;  1O25 A;  2NVY C;  5C4J K;  3A8I A;  4IOA S;  4BLA A;  2ZUF A;  2JH3 A;  5E68 A;  3FKI A;  4C3H K;  4LLG A;  1F7U A;  4AYB L;  4G7Z A;  1YCL A;  1L0W A;  3I4M K;  3RZD K;  2NVQ K;  4U67 S;  3V4G A;  3GTL K;  4GT9 A;  3LAP A;  1IL2 A;  2WAQ D;  1O29 A;  3SZZ A;  4BBR C;  3GTP A;  1EK8 A;  3CQZ C;  4A3I C;  4AH6 A;  2A69 A;  5C44 C;  1BGW A;  4GTD A;  3S16 K;  4WIL A;  3HKZ L;  1F7V A;  4Q5S A;  1Y1V C;  4JK1 A;  3S2H C;  4Y52 C;  5IYC K; 
#chains in the Genus database with same CATH homology
 4A3C K;  3S17 C;  3HKZ D;  2NVT C;  3S2D C;  3PO2 K;  5M3M K;  2E2H C;  4QJV A;  3GTP C;  5C4J C;  3H0G K;  4BY7 K;  4MEX A;  3GTK K;  3M3Y K;  2YU9 K;  1YNN A;  4BY1 K;  4C3H C;  5C3E C;  3GTJ C;  3GTM K;  4OIP A;  4X6A K;  3HOX C;  3HOV C;  1BDF A;  2JA7 K;  4KN4 A;  3RZD C;  5IP7 K;  1TWA K;  3S1N K;  4KMU A;  4BBS K;  1K83 C;  4A3K C;  3I4N K;  3S14 K;  3GTL C;  3RZO C;  4A3B C;  1Y1W K;  1ZYR A;  4A3D K;  1SFO C;  5FLM C;  1I50 K;  2R93 K;  2E2I K;  2B63 C;  4A3G K;  5IP9 C;  3S1M C;  2VUM K;  5IYB K;  1TWF K;  4XLN A;  4A3E C;  4XSX A;  4LK1 A;  2JA6 K;  3FKI C;  4GZY A;  4A3F C;  3HOZ C;  4MQ9 A;  2JA8 C;  1WCM K;  4G7O A;  4C3J K;  3PO3 C;  1I6H C;  1XPP A;  4Y7N K;  2Y0S L;  3GTQ K;  1R9T K;  3K7A C;  4C3I C;  3M4O C;  4G7H A;  2WB1 L;  5C4X K;  2Y0S D;  2R7Z K;  1YNJ A;  3CQZ K;  4OIO A;  4YFK A;  1TWG C;  4A3M K;  5C44 K;  4YFX A;  2NVX K;  3HOW K;  5IYC C;  3H0G C;  4A3C C;  5M5Y K;  4NOI A;  3PO2 C;  3S1N C;  2O5I A;  4BY7 C;  3S15 C;  3S1Q K;  4A3L K;  3I4M C;  3GTO K;  1I6V A;  3GTK C;  2YU9 C;  5D4D A;  2NVQ C;  2R92 K;  4X6A C;  3GTM C;  1SMY A;  4C2M K;  1TWC K;  4LK0 A;  5M3F K;  5IP7 C;  2NVY K;  3HOU K;  3I4N C;  3S2H K;  3S14 C;  2PMZ L;  2CW0 A;  1I50 C;  2E2I C;  3GTG K;  3S16 C;  3GTJ K;  1TWF C;  2JA6 C;  3HOX K;  3HOV K;  2VUM C;  2PMZ D;  2JA5 C;  4OIN A;  4BXX K;  1WCM C;  3S1R C;  4Y7N C;  3GTQ C;  1R9T C;  4QJV B;  4BBR K;  4A3I K;  2E2J C;  4XSZ A;  1TWH K;  2WB1 D;  2JA5 K;  5C4X C;  1I3Q K;  2R7Z C;  4A3E K;  3FKI K;  3HOY K;  2O5J A;  4A3M C;  3M3Y C;  3WOD A;  2NVX C;  4BY1 C;  3HOW C;  4A3J K;  1I6H K;  5IYD K;  4C3I K;  3M4O K;  3DXJ A;  2JA7 C;  3S1Q C;  4A3L C;  1Y1V K;  3GTO C;  4BBS C;  1TWA C;  2PPB A;  5M5X K;  4Y52 K;  3H3V L;  4A93 K;  2BE5 A;  4C2M C;  1TWC C;  5M5W K;  1Y1W C;  2NVT K;  3S17 K;  3S2D K;  4A3D C;  2A6E A;  2NVY C;  4Q4Z A;  2R93 C;  5C4J K;  2E2H K;  3HOU C;  3GTP K;  2PA8 L;  1HQM A;  4A3G C;  5IYB C;  4C3H K;  5C3E K;  4LLG A;  3H3V D;  2WAQ L;  4AYB L;  4G7Z A;  3S15 K;  4C3J C;  3I4M K;  3RZD K;  1IW7 A;  4MEY A;  3GTG C;  1K83 K;  4A3K K;  2NVQ K;  5FJ8 K;  3GTL K;  2PA8 D;  4LJZ A;  5TMC A;  3RZO K;  4A3B K;  4BXX C;  1SFO K;  4AYB D;  2WAQ D;  5FLM K;  4QIW L;  2B63 K;  5IP9 K;  4YFN A;  4BBR C;  3S1M K;  3EQL A;  3CQZ C;  4A3I C;  1TWH C;  4A3F K;  3HOZ K;  2A69 A;  2JA8 K;  5C44 C;  3PO3 K;  5TMF A;  3S16 K;  3K7A K;  4A93 C;  1I3Q C;  2A68 A;  4QIW D;  4YG2 A;  4OIR A;  3HOY C;  3S1R K;  5IYD C;  4A3J C;  2R92 C;  3HKZ L;  4XLP A;  4ZH4 A;  4OIQ A;  4Q5S A;  1Y1V C;  4KN7 A;  2E2J K;  4JK1 A;  1TWG K;  3S2H C;  4Y52 C;  5IYC K;  2A6H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...