2O5IA

Crystal structure of the t. thermophilus rna polymerase elongation complex
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
229
structure length
229
Chain Sequence
b'MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(P*CP*CP*CP*TP*GP*TP*CP*TP*GP*GP*CP*GP*TP*TP*CP*GP*CP*GP
publication title Structural basis for transcription elongation by bacterial RNA polymerase.
pubmed doi rcsb
molecule tags Transferase/dna-rna hybrid
total genus 39
structure length 229
sequence length 229
chains with identical sequence B, K, L
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2006-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01000 RNA_pol_A_bac RNA polymerase Rpb3/RpoA insert domain
A PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain
A PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.12 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 DNA-directed RNA polymerase, insert domain 2o5iA02
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 2o5iA01
2NVYC 5M5XK 2NVXK 3HOUK 4BXXC 4C3HC 2PMZD 3GTPC 1TWHC 4A3LK 3GTPK 4Y52C 1TWHK 3WODA 4Y52K 3M4OC 3S1NC 4A93C 3M4OK 2A6EA 3S1QC 1YNNA 4G7OA 3HKZL 4A93K 4C3IC 4OIRA 3H3VD 3S1QK 4BBRC 4C3IK 3RZDK 4X6AC 3HOZK 4A3IC 4X6AK 4QIWD 4KN4A 4A3IK 5M5WK 1TWGC 1Y1WC 1WCMC 3GTJC 2JA6K 1TWCC 2PA8D 3CQZC 3K7AC 2YU9C 4OIQA 4QJVA 1IW7A 1K83K 1TWCK 1TWGK 2WB1L 1I6HC 3CQZK 3K7AK 3GTJK 1TWAC 1BDFA 2YU9K 4LJZA 5C44C 3HOYC 3S17K 1TWAK 1I6HK 3HOWC 3HOYK 2R7ZC 2NVXC 3HOUC 2E2JK 2O5JA 3HOWK 2R7ZK 1Y1VC 3GTMC 4A3LC 3PO3C 4G7ZA 1Y1VK 1R9TC 1SFOC 3GTMK 3PO3K 4BY7C 1R9TK 1SFOK 2R93K 4OINA 4A3DK 4BY7K 3GTGC 5IP9C 4A3EC 4XSXA 2JA7C 3GTGK 5IP9K 4A3EK 4MEXA 4LK0A 3RZDC 2JA7K 3DXJA 1YNJA 3H0GK 3HOZC 4XLPA 5C4XC 3GTQC 4YG2A 2BE5A 5C4XK 4OIOA 2VUMC 2E2IK 3GTQK 2R92C 2Y0SL 2VUMK 4OIPA 2R92K 4YFXA 2JA6C 2O5IA 1K83C 4A3CC 5C4JC 1HQMA 4G7HA 4A3CK 3HKZD 4BY1C 4YFNA 4LLGA 2JA5C 3S17C 5C4JK 1XPPA 1TWFC 4BY1K 2JA5K 1ZYRA 2E2JC 3M3YC 4YFKA 1TWFK 2PPBA 1Y1WK 4A3KC 3GTKC 3M3YK 4A3KK 3GTKK 2NVTC 4AYBL 4ZH4A 5TMCA 3RZOC 2NVTK 2R93C 4KN7A 4MEYA 4A3DC 5FLMC 3S2HC 5M3FK 3RZOK 2WB1D 4A3GC 5FLMK 5M5YK 3S2HK 4XLNA 4XSZA 3S14C 5IP7C 2A6HA 3PO2C 3S16C 4GZYA 4A3GK 3S14K 3H0GC 5IP7K 3PO2K 3S16K 2CW0A 4C2MK 1I50K 5IYCK 2E2IC 1I3QK 4A3JC 3S1MC 3I4NC 4A3BC 4A3JK 3S1MK 3I4NK 3S15C 4A3BK 4A3FK 4Y7NC 2B63C 2WAQL 3FKIK 3S15K 4Y7NK 2B63K 4A3MC 5IYDC 4A3MK 4QJVB 5IYDK 3I4MC 2NVYK 4BXXK 3GTOC 4QIWL 4C3HK 2JA8C 3I4MK 3GTOK 2JA8K 5TMFA 3GTLC 2Y0SD 2PA8L 5IYBC 3HOXC 4Q5SA 2NVQC 3GTLK 4BBSC 3S1NK 2WAQD 3HOVC 5IYBK 2A68A 3HOXK 2NVQK 4BBSK 5C3EC 3HOVK 5C3EK 4BBRK 3H3VL 4C2MC 2E2HC 1I50C 5IYCC 1I6VA 5M3MK 1SMYA 4C3JC 1I3QC 3S2DC 2PMZL 2E2HK 4C3JK 3S2DK 4AYBD 3S1RC 1WCMK 4KMUA 4NOIA 3EQLA 4A3FC 3S1RK 5FJ8K 3FKIC 4LK1A 4MQ9A 4Q4ZA 5D4DA 5C44K 4JK1A 2A69A
chains in the Genus database with same CATH superfamily
3HXAA 4C3HC 3GTPC 2E2IA 1TWHC 3GTPK 1TWHK 1O27A 4A93C 3S1QC 4O2DA 4A93K 4C3IC 4OIRA 2P8TA 3S1QK 4C3IK 1GE9A 4KAWX 3HOZK 5DM7S 3GTLA 1WCMC 3DLLS 2YU9C 1O29A 1IW7A 2YU9K 3TTGA 5C44C 3S17K 3FOFA 3AQOA 2R7ZC 3HOUC 1XZPB 1USOA 2W7VA 2CFAB 2R7ZK 3BUEA 3CAGA 4PABA 1X31C 3G4CA 3FKIA 4A3DK 3GTGC 5JVHS 2JA7C 3GTGK 2JA7K 2NVYA 3DXJA 5TJ3A 3GTQC 2BE5A 2D6FC 3GTQK 3AD7C 4BLBA 4A3CC 1K83C 1HQMA 4A3CK 3HKZD 4BY1C 1WQHA 3OREA 4BY1K 3PIPS 4WF9S 4WJ4A 3GTJA 3CQZA 2R93C 4KN7A 2WB1D 2KPUA 5IP7C 2A6HA 2NVXA 5IP7K 4C2MK 4BLAA 4A3JC 3I4NC 4A3JK 3I4NK 4A3FK 2WAQL 2CFAA 4GT9A 2KQ1A 4KB4A 1EH1A 5TMFA 2JA6A 2V6TA 2PA8L 2KWAA 2NVQC 4WILA 2WAQD 4WCES 2NVQK 3L4JA 2JA5A 4BBRK 1I50C 4IO9S 1B4AA 1I6VA 5M3MK 3S2DC 5HQHA 5L46A 3S2DK 4AYBD 3S1RC 4NOIA 1XZQB 3G4AA 3S1RK 1JVIA 2L5NA 3FOEA 3H0GA 1DCOA 2V6UA 2RH6A 4P5AA 3VA7A 1PJ6A 1YCLA 4A3LK 3S1NC 4G7OA 4KASA 5HL7S 3AH5A 4IOAS 1IS1A 3MMLB 3T02A 3GTOA 3T00A 4QIWD 4WFAS 1Y1WC 5JVOA 1IL2A 3K7AC 4OIQA 1Y1WK 3LAPA 3K7AK 1BDFA 3A8JA 3TFJA 3HOWC 4C45A 2E2JK 3HOWK 1I3QA 5E68A 3PO3C 4G7ZA 5IOSA 1SFOC 3PO3K 1SFOK 1IQ0A 4OINA 4WFNS 4IOCS 5CJ9A 2ZUEA 3HOZC 1O25A 3GTPA 1TWHA 4ILDA 2E2IK 4OIPA 4U67S 4G7HA 4YFNA 3S17C 1WOSA 2ZJQS 1TWFC 2GAHC 1TWFK 3GTKC 4KMHA 1B4BA 1WOPA 3GTKK 1WCMA 4ZH4A 5TMCA 3RZOC 1VJEA 2YU9A 4A3DC 3IPJA 5M3FK 3RZOK 4G0UA 5M5YK 4GZYA 3GSIA 5HL8A 4WJ3M 2R7ZA 4GTDA 3AQPA 1FEUA 3S1MC 4A3BC 3S1MK 3GTGA 4A3BK 1WQFA 4Y7NC 2B63C 2JA7A 3FKIK 4Y7NK 3GIRA 2B63K 4QJVB 1ZXOA 2NVYK 3GTQA 1INNA 4BXXK 2JA8C 2JA8K 3SZYA 3OEPA 3HOXC 4Q5SA 4GTFA 1K83A 4LOWA 3HOVC 3HOXK 3HOVK 4GFQA 4KB2A 1PJ5A 4GTCA 4C2MC 2E2HC 2PMZL 2E2HK 2R93A 3N0BA 1G51A 3NUHA 4KMUA 4A3FC 3CF5S 1XZPA 1VLOA 5D4DA 2NVXK 1KQ4A 2PMZD 2ZFZA 2XCOA 4Y52C 3WODA 1USMA 4Y52K 3M4OC 2GSNA 3M4OK 2A6EA 1YNNA 4BBRC 3TFHA 3RZDK 1XXCA 4FM9A 1XXAA 1RU0A 4A3IC 3SZZA 4A3IK 2FQOA 5M5WK 3ADAC 1TWGC 1PJ7A 1TWCC 2PA8D 1TWGK 3LPXA 2JA6K 4QJVA 2PHCB 1TWCK 3AD8C 1TWAC 3LYWA 3HOYC 1TWAK 1I50A 3HOYK 1BJTA 3V4GA 2O5JA 1O28A 1Y1VC 3GTMC 4A3LC 1EK8A 1Y1VK 1R9TC 4GTEA 3GTMK 4KATA 1R9TK 1WSVA 4BKWA 2GSUA 4GTAA 1EQRA 4MEXA 5EGEA 1JOEA 1YNJA 3H0GK 4OIOA 2VUMC 2R92C 2FQTA 2Y0SL 2VUMK 3A8IA 2R92K 3BP3A 5C4JC 5C4JK 4LLGA 1XPPA 1HI9A 2E2JC 5JVGS 2XCRB 2GSOA 2NVTC 1Y1WA 4M1XA 3T01A 1L0WA 2NVTK 4MEYA 5FLMC 3S2HC 1O26A 4A3GC 5FLMK 3S2HK 4XLNA 1EI6A 3BP8C 3S16C 4A3GK 3ERED 3S16K 1UV7A 1VGXA 5IYCK 1XXBA 2E2IC 1I3QK 1SFOA 1XZQA 3AD9C 2GAGC 1DCPA 5EGHA 4A3MC 1IBAA 2ZJPS 4A3MK 3I4MC 2ZJRS 4LR2A 4C3HK 4AH6A 3I4MK 3A8KA 1J6VA 5JFEA 3GTLC 4KARA 1J98A 3GTLK 4LQYA 5IORA 5C3EC 1WIHA 2RGRA 1TWFA 5C3EK 1ZQ1C 3N0CA 2ZUFA 3GTKA 3GDZA 3TFIA 4XCHA 1SMYA 4C3JC 4C3JK 1WCMK 3EQLA 3FKIC 4LK1A 4MQ9A 3H3VL 5C44K 2A69A 2NVYC 5M5XK 3HOUK 4P9SA 4BXXC 1C0AA 5CHPA 4G0VA 1VRQC 2B63A 3HKZL 4PAAA 5IOTA 3H3VD 1WOOA 4X6AC 4X6AK 4KN4A 1ISEA 1F7UA 3GTJC 4FZBA 1O2FB 3CQZC 2WB1L 3GTJK 1K83K 3CQZK 1I6HC 1O2BA 3S0XA 4J3NA 4LJZA 1I6HK 2XCQA 2E2HA 2NVXC 4KMAA 3JSTA 4P5BA 4BY7C 1J6WA 4GTLA 2R93K 4BY7K 5IP9C 4A3EC 4XSXA 3OPFA 5IP9K 4A3EK 4LK0A 3RZDC 4XLPA 5C4XC 3L4KA 3GEEA 1BS2A 4YG2A 5C4XK 4DDQA 1IE0A 1YX2A 1VH2A 4YFXA 2JA6C 4GTBA 4WFBS 2O5IA 5IOQA 3GEIA 2JA5C 1AB4A 1J6XA 2L3UA 2JA5K 1ZYRA 3M3YC 4YFKA 2PPBA 4A3KC 3M3YK 3N3YA 4A3KK 1ZBSA 1TWGA 2EBBA 4AYBL 1TWCA 3GEHA 4KM8A 3FHZA 1TWAA 1WSRA 2Y3PA 4XSZA 3S14C 1DD5A 3PO2C 2V6SA 4G0WA 1ZVUA 3S14K 3H0GC 1O2AA 3PO2K 2CW0A 1Y1VA 1I50K 2P5MA 3GTMA 1R9TA 3PIOS 3S15C 1EFWA 3S15K 4KMDA 3QX3A 5IYDC 3Q3QA 1DCHA 5IYDK 3LAJA 3GTOC 4KM9A 4QIWL 2VUMA 2R92A 3GTOK 2Y0SD 5DM6S 5IYBC 1O24A 1F7VA 3S1NK 4BBSC 5IYBK 2A68A 1V5VA 4BBSK 1BGWA 2JH3A 4KDDA 1F93A 1F9NA 1JQWA 2KXYA 5IYCC 1I3QC 4KC6A 1WORA 1WQGA 5FJ8K 4Q4ZA 4RMFA 4JK1A
chains in the Genus database with same CATH topology
2NVYC 5M5XK 2NVXK 3HOUK 4BXXC 4C3HC 2PMZD 3GTPC 1TWHC 4A3LK 3GTPK 4Y52C 1TWHK 3WODA 4Y52K 3M4OC 3S1NC 4A93C 3M4OK 2A6EA 3S1QC 1YNNA 4G7OA 3HKZL 4A93K 4C3IC 4OIRA 3H3VD 3S1QK 4BBRC 4C3IK 3RZDK 4X6AC 3HOZK 4A3IC 4X6AK 4QIWD 4KN4A 4A3IK 5M5WK 1TWGC 1Y1WC 1WCMC 3GTJC 2JA6K 1TWCC 2PA8D 3CQZC 3K7AC 2YU9C 4OIQA 4QJVA 1IW7A 1K83K 1TWCK 1TWGK 2WB1L 1I6HC 3CQZK 3K7AK 3GTJK 1TWAC 1BDFA 2YU9K 4LJZA 5C44C 3HOYC 3S17K 1TWAK 1I6HK 3HOWC 3HOYK 2R7ZC 2NVXC 3HOUC 2E2JK 2O5JA 3HOWK 2R7ZK 1Y1VC 3GTMC 4A3LC 3PO3C 4G7ZA 1Y1VK 1R9TC 1SFOC 3GTMK 3PO3K 4BY7C 1R9TK 1SFOK 2R93K 4OINA 4A3DK 4BY7K 3GTGC 5IP9C 4A3EC 4XSXA 2JA7C 3GTGK 5IP9K 4A3EK 4MEXA 4LK0A 3RZDC 2JA7K 3DXJA 1YNJA 3H0GK 3HOZC 4XLPA 5C4XC 3GTQC 4YG2A 2BE5A 5C4XK 4OIOA 2VUMC 2E2IK 3GTQK 2R92C 2Y0SL 2VUMK 4OIPA 2R92K 4YFXA 2JA6C 2O5IA 1K83C 4A3CC 5C4JC 1HQMA 4G7HA 4A3CK 3HKZD 4BY1C 4YFNA 4LLGA 2JA5C 3S17C 5C4JK 1XPPA 1TWFC 4BY1K 2JA5K 1ZYRA 2E2JC 3M3YC 4YFKA 1TWFK 2PPBA 1Y1WK 4A3KC 3GTKC 3M3YK 4A3KK 3GTKK 2NVTC 4AYBL 4ZH4A 5TMCA 3RZOC 2NVTK 2R93C 4KN7A 4MEYA 4A3DC 5FLMC 3S2HC 5M3FK 3RZOK 2WB1D 4A3GC 5FLMK 5M5YK 3S2HK 4XLNA 4XSZA 3S14C 5IP7C 2A6HA 3PO2C 3S16C 4GZYA 4A3GK 3S14K 3H0GC 5IP7K 3PO2K 3S16K 2CW0A 4C2MK 1I50K 5IYCK 2E2IC 1I3QK 4A3JC 3S1MC 3I4NC 4A3BC 4A3JK 3S1MK 3I4NK 3S15C 4A3BK 4A3FK 4Y7NC 2B63C 2WAQL 3FKIK 3S15K 4Y7NK 2B63K 4A3MC 5IYDC 4A3MK 4QJVB 5IYDK 3I4MC 2NVYK 4BXXK 3GTOC 4QIWL 4C3HK 2JA8C 3I4MK 3GTOK 2JA8K 5TMFA 3GTLC 2Y0SD 2PA8L 5IYBC 3HOXC 4Q5SA 2NVQC 3GTLK 4BBSC 3S1NK 2WAQD 3HOVC 5IYBK 2A68A 3HOXK 2NVQK 4BBSK 5C3EC 3HOVK 5C3EK 4BBRK 3H3VL 4C2MC 2E2HC 1I50C 5IYCC 1I6VA 5M3MK 1SMYA 4C3JC 1I3QC 3S2DC 2PMZL 2E2HK 4C3JK 3S2DK 4AYBD 3S1RC 1WCMK 4KMUA 4NOIA 3EQLA 4A3FC 3S1RK 5FJ8K 3FKIC 4LK1A 4MQ9A 4Q4ZA 5D4DA 5C44K 4JK1A 2A69A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NVY C;  5M5X K;  2NVX K;  3HOU K;  4BXX C;  4C3H C;  2PMZ D;  3GTP C;  1TWH C;  4A3L K;  3GTP K;  4Y52 C;  1TWH K;  3WOD A;  4Y52 K;  3M4O C;  3S1N C;  4A93 C;  3M4O K;  2A6E A;  3S1Q C;  1YNN A;  4G7O A;  3HKZ L;  4A93 K;  4C3I C;  4OIR A;  3H3V D;  3S1Q K;  4BBR C;  4C3I K;  3RZD K;  4X6A C;  3HOZ K;  4A3I C;  4X6A K;  4QIW D;  4KN4 A;  4A3I K;  5M5W K;  1TWG C;  1Y1W C;  1WCM C;  3GTJ C;  2JA6 K;  1TWC C;  2PA8 D;  3CQZ C;  3K7A C;  2YU9 C;  4OIQ A;  4QJV A;  1IW7 A;  1K83 K;  1TWC K;  1TWG K;  2WB1 L;  1I6H C;  3CQZ K;  3K7A K;  3GTJ K;  1TWA C;  1BDF A;  2YU9 K;  4LJZ A;  5C44 C;  3HOY C;  3S17 K;  1TWA K;  1I6H K;  3HOW C;  3HOY K;  2R7Z C;  2NVX C;  3HOU C;  2E2J K;  2O5J A;  3HOW K;  2R7Z K;  1Y1V C;  3GTM C;  4A3L C;  3PO3 C;  4G7Z A;  1Y1V K;  1R9T C;  1SFO C;  3GTM K;  3PO3 K;  4BY7 C;  1R9T K;  1SFO K;  2R93 K;  4OIN A;  4A3D K;  4BY7 K;  3GTG C;  5IP9 C;  4A3E C;  4XSX A;  2JA7 C;  3GTG K;  5IP9 K;  4A3E K;  4MEX A;  4LK0 A;  3RZD C;  2JA7 K;  3DXJ A;  1YNJ A;  3H0G K;  3HOZ C;  4XLP A;  5C4X C;  3GTQ C;  4YG2 A;  2BE5 A;  5C4X K;  4OIO A;  2VUM C;  2E2I K;  3GTQ K;  2R92 C;  2Y0S L;  2VUM K;  4OIP A;  2R92 K;  4YFX A;  2JA6 C;  2O5I A;  1K83 C;  4A3C C;  5C4J C;  1HQM A;  4G7H A;  4A3C K;  3HKZ D;  4BY1 C;  4YFN A;  4LLG A;  2JA5 C;  3S17 C;  5C4J K;  1XPP A;  1TWF C;  4BY1 K;  2JA5 K;  1ZYR A;  2E2J C;  3M3Y C;  4YFK A;  1TWF K;  2PPB A;  1Y1W K;  4A3K C;  3GTK C;  3M3Y K;  4A3K K;  3GTK K;  2NVT C;  4AYB L;  4ZH4 A;  5TMC A;  3RZO C;  2NVT K;  2R93 C;  4KN7 A;  4MEY A;  4A3D C;  5FLM C;  3S2H C;  5M3F K;  3RZO K;  2WB1 D;  4A3G C;  5FLM K;  5M5Y K;  3S2H K;  4XLN A;  4XSZ A;  3S14 C;  5IP7 C;  2A6H A;  3PO2 C;  3S16 C;  4GZY A;  4A3G K;  3S14 K;  3H0G C;  5IP7 K;  3PO2 K;  3S16 K;  2CW0 A;  4C2M K;  1I50 K;  5IYC K;  2E2I C;  1I3Q K;  4A3J C;  3S1M C;  3I4N C;  4A3B C;  4A3J K;  3S1M K;  3I4N K;  3S15 C;  4A3B K;  4A3F K;  4Y7N C;  2B63 C;  2WAQ L;  3FKI K;  3S15 K;  4Y7N K;  2B63 K;  4A3M C;  5IYD C;  4A3M K;  4QJV B;  5IYD K;  3I4M C;  2NVY K;  4BXX K;  3GTO C;  4QIW L;  4C3H K;  2JA8 C;  3I4M K;  3GTO K;  2JA8 K;  5TMF A;  3GTL C;  2Y0S D;  2PA8 L;  5IYB C;  3HOX C;  4Q5S A;  2NVQ C;  3GTL K;  4BBS C;  3S1N K;  2WAQ D;  3HOV C;  5IYB K;  2A68 A;  3HOX K;  2NVQ K;  4BBS K;  5C3E C;  3HOV K;  5C3E K;  4BBR K;  3H3V L;  4C2M C;  2E2H C;  1I50 C;  5IYC C;  1I6V A;  5M3M K;  1SMY A;  4C3J C;  1I3Q C;  3S2D C;  2PMZ L;  2E2H K;  4C3J K;  3S2D K;  4AYB D;  3S1R C;  1WCM K;  4KMU A;  4NOI A;  3EQL A;  4A3F C;  3S1R K;  5FJ8 K;  3FKI C;  4LK1 A;  4MQ9 A;  4Q4Z A;  5D4D A;  5C44 K;  4JK1 A;  2A69 A; 
#chains in the Genus database with same CATH topology
 3HXA A;  4C3H C;  3GTP C;  2E2I A;  1TWH C;  3GTP K;  1TWH K;  1O27 A;  4A93 C;  3S1Q C;  4O2D A;  4A93 K;  4C3I C;  4OIR A;  2P8T A;  3S1Q K;  4C3I K;  1GE9 A;  4KAW X;  3HOZ K;  5DM7 S;  3GTL A;  1WCM C;  3DLL S;  2YU9 C;  1O29 A;  1IW7 A;  2YU9 K;  3TTG A;  5C44 C;  3S17 K;  3FOF A;  3AQO A;  2R7Z C;  3HOU C;  1XZP B;  1USO A;  2W7V A;  2CFA B;  2R7Z K;  3BUE A;  3CAG A;  4PAB A;  1X31 C;  3G4C A;  3FKI A;  4A3D K;  3GTG C;  5JVH S;  2JA7 C;  3GTG K;  2JA7 K;  2NVY A;  3DXJ A;  5TJ3 A;  3GTQ C;  2BE5 A;  2D6F C;  3GTQ K;  3AD7 C;  4BLB A;  4A3C C;  1K83 C;  1HQM A;  4A3C K;  3HKZ D;  4BY1 C;  1WQH A;  3ORE A;  4BY1 K;  3PIP S;  4WF9 S;  4WJ4 A;  3GTJ A;  3CQZ A;  2R93 C;  4KN7 A;  2WB1 D;  2KPU A;  5IP7 C;  2A6H A;  2NVX A;  5IP7 K;  4C2M K;  4BLA A;  4A3J C;  3I4N C;  4A3J K;  3I4N K;  4A3F K;  2WAQ L;  2CFA A;  4GT9 A;  2KQ1 A;  4KB4 A;  1EH1 A;  5TMF A;  2JA6 A;  2V6T A;  2PA8 L;  2KWA A;  2NVQ C;  4WIL A;  2WAQ D;  4WCE S;  2NVQ K;  3L4J A;  2JA5 A;  4BBR K;  1I50 C;  4IO9 S;  1B4A A;  1I6V A;  5M3M K;  3S2D C;  5HQH A;  5L46 A;  3S2D K;  4AYB D;  3S1R C;  4NOI A;  1XZQ B;  3G4A A;  3S1R K;  1JVI A;  2L5N A;  3FOE A;  3H0G A;  1DCO A;  2V6U A;  2RH6 A;  4P5A A;  3VA7 A;  1PJ6 A;  1YCL A;  4A3L K;  3S1N C;  4G7O A;  4KAS A;  5HL7 S;  3AH5 A;  4IOA S;  1IS1 A;  3MML B;  3T02 A;  3GTO A;  3T00 A;  4QIW D;  4WFA S;  1Y1W C;  5JVO A;  1IL2 A;  3K7A C;  4OIQ A;  1Y1W K;  3LAP A;  3K7A K;  1BDF A;  3A8J A;  3TFJ A;  3HOW C;  4C45 A;  2E2J K;  3HOW K;  1I3Q A;  5E68 A;  3PO3 C;  4G7Z A;  5IOS A;  1SFO C;  3PO3 K;  1SFO K;  1IQ0 A;  4OIN A;  4WFN S;  4IOC S;  5CJ9 A;  2ZUE A;  3HOZ C;  1O25 A;  3GTP A;  1TWH A;  4ILD A;  2E2I K;  4OIP A;  4U67 S;  4G7H A;  4YFN A;  3S17 C;  1WOS A;  2ZJQ S;  1TWF C;  2GAH C;  1TWF K;  3GTK C;  4KMH A;  1B4B A;  1WOP A;  3GTK K;  1WCM A;  4ZH4 A;  5TMC A;  3RZO C;  1VJE A;  2YU9 A;  4A3D C;  3IPJ A;  5M3F K;  3RZO K;  4G0U A;  5M5Y K;  4GZY A;  3GSI A;  5HL8 A;  4WJ3 M;  2R7Z A;  4GTD A;  3AQP A;  1FEU A;  3S1M C;  4A3B C;  3S1M K;  3GTG A;  4A3B K;  1WQF A;  4Y7N C;  2B63 C;  2JA7 A;  3FKI K;  4Y7N K;  3GIR A;  2B63 K;  4QJV B;  1ZXO A;  2NVY K;  3GTQ A;  1INN A;  4BXX K;  2JA8 C;  2JA8 K;  3SZY A;  3OEP A;  3HOX C;  4Q5S A;  4GTF A;  1K83 A;  4LOW A;  3HOV C;  3HOX K;  3HOV K;  4GFQ A;  4KB2 A;  1PJ5 A;  4GTC A;  4C2M C;  2E2H C;  2PMZ L;  2E2H K;  2R93 A;  3N0B A;  1G51 A;  3NUH A;  4KMU A;  4A3F C;  3CF5 S;  1XZP A;  1VLO A;  5D4D A;  2NVX K;  1KQ4 A;  2PMZ D;  2ZFZ A;  2XCO A;  4Y52 C;  3WOD A;  1USM A;  4Y52 K;  3M4O C;  2GSN A;  3M4O K;  2A6E A;  1YNN A;  4BBR C;  3TFH A;  3RZD K;  1XXC A;  4FM9 A;  1XXA A;  1RU0 A;  4A3I C;  3SZZ A;  4A3I K;  2FQO A;  5M5W K;  3ADA C;  1TWG C;  1PJ7 A;  1TWC C;  2PA8 D;  1TWG K;  3LPX A;  2JA6 K;  4QJV A;  2PHC B;  1TWC K;  3AD8 C;  1TWA C;  3LYW A;  3HOY C;  1TWA K;  1I50 A;  3HOY K;  1BJT A;  3V4G A;  2O5J A;  1O28 A;  1Y1V C;  3GTM C;  4A3L C;  1EK8 A;  1Y1V K;  1R9T C;  4GTE A;  3GTM K;  4KAT A;  1R9T K;  1WSV A;  4BKW A;  2GSU A;  4GTA A;  1EQR A;  4MEX A;  5EGE A;  1JOE A;  1YNJ A;  3H0G K;  4OIO A;  2VUM C;  2R92 C;  2FQT A;  2Y0S L;  2VUM K;  3A8I A;  2R92 K;  3BP3 A;  5C4J C;  5C4J K;  4LLG A;  1XPP A;  1HI9 A;  2E2J C;  5JVG S;  2XCR B;  2GSO A;  2NVT C;  1Y1W A;  4M1X A;  3T01 A;  1L0W A;  2NVT K;  4MEY A;  5FLM C;  3S2H C;  1O26 A;  4A3G C;  5FLM K;  3S2H K;  4XLN A;  1EI6 A;  3BP8 C;  3S16 C;  4A3G K;  3ERE D;  3S16 K;  1UV7 A;  1VGX A;  5IYC K;  1XXB A;  2E2I C;  1I3Q K;  1SFO A;  1XZQ A;  3AD9 C;  2GAG C;  1DCP A;  5EGH A;  4A3M C;  1IBA A;  2ZJP S;  4A3M K;  3I4M C;  2ZJR S;  4LR2 A;  4C3H K;  4AH6 A;  3I4M K;  3A8K A;  1J6V A;  5JFE A;  3GTL C;  4KAR A;  1J98 A;  3GTL K;  4LQY A;  5IOR A;  5C3E C;  1WIH A;  2RGR A;  1TWF A;  5C3E K;  1ZQ1 C;  3N0C A;  2ZUF A;  3GTK A;  3GDZ A;  3TFI A;  4XCH A;  1SMY A;  4C3J C;  4C3J K;  1WCM K;  3EQL A;  3FKI C;  4LK1 A;  4MQ9 A;  3H3V L;  5C44 K;  2A69 A;  2NVY C;  5M5X K;  3HOU K;  4P9S A;  4BXX C;  1C0A A;  5CHP A;  4G0V A;  1VRQ C;  2B63 A;  3HKZ L;  4PAA A;  5IOT A;  3H3V D;  1WOO A;  4X6A C;  4X6A K;  4KN4 A;  1ISE A;  1F7U A;  3GTJ C;  4FZB A;  1O2F B;  3CQZ C;  2WB1 L;  3GTJ K;  1K83 K;  3CQZ K;  1I6H C;  1O2B A;  3S0X A;  4J3N A;  4LJZ A;  1I6H K;  2XCQ A;  2E2H A;  2NVX C;  4KMA A;  3JST A;  4P5B A;  4BY7 C;  1J6W A;  4GTL A;  2R93 K;  4BY7 K;  5IP9 C;  4A3E C;  4XSX A;  3OPF A;  5IP9 K;  4A3E K;  4LK0 A;  3RZD C;  4XLP A;  5C4X C;  3L4K A;  3GEE A;  1BS2 A;  4YG2 A;  5C4X K;  4DDQ A;  1IE0 A;  1YX2 A;  1VH2 A;  4YFX A;  2JA6 C;  4GTB A;  4WFB S;  2O5I A;  5IOQ A;  3GEI A;  2JA5 C;  1AB4 A;  1J6X A;  2L3U A;  2JA5 K;  1ZYR A;  3M3Y C;  4YFK A;  2PPB A;  4A3K C;  3M3Y K;  3N3Y A;  4A3K K;  1ZBS A;  1TWG A;  2EBB A;  4AYB L;  1TWC A;  3GEH A;  4KM8 A;  3FHZ A;  1TWA A;  1WSR A;  2Y3P A;  4XSZ A;  3S14 C;  1DD5 A;  3PO2 C;  2V6S A;  4G0W A;  1ZVU A;  3S14 K;  3H0G C;  1O2A A;  3PO2 K;  2CW0 A;  1Y1V A;  1I50 K;  2P5M A;  3GTM A;  1R9T A;  3PIO S;  3S15 C;  1EFW A;  3S15 K;  4KMD A;  3QX3 A;  5IYD C;  3Q3Q A;  1DCH A;  5IYD K;  3LAJ A;  3GTO C;  4KM9 A;  4QIW L;  2VUM A;  2R92 A;  3GTO K;  2Y0S D;  5DM6 S;  5IYB C;  1O24 A;  1F7V A;  3S1N K;  4BBS C;  5IYB K;  2A68 A;  1V5V A;  4BBS K;  1BGW A;  2JH3 A;  4KDD A;  1F93 A;  1F9N A;  1JQW A;  2KXY A;  5IYC C;  1I3Q C;  4KC6 A;  1WOR A;  1WQG A;  5FJ8 K;  4Q4Z A;  4RMF A;  4JK1 A; 
#chains in the Genus database with same CATH homology
 2NVY C;  5M5X K;  2NVX K;  3HOU K;  4BXX C;  4C3H C;  2PMZ D;  3GTP C;  1TWH C;  4A3L K;  3GTP K;  4Y52 C;  1TWH K;  3WOD A;  4Y52 K;  3M4O C;  3S1N C;  4A93 C;  3M4O K;  2A6E A;  3S1Q C;  1YNN A;  4G7O A;  3HKZ L;  4A93 K;  4C3I C;  4OIR A;  3H3V D;  3S1Q K;  4BBR C;  4C3I K;  3RZD K;  4X6A C;  3HOZ K;  4A3I C;  4X6A K;  4QIW D;  4KN4 A;  4A3I K;  5M5W K;  1TWG C;  1Y1W C;  1WCM C;  3GTJ C;  2JA6 K;  1TWC C;  2PA8 D;  3CQZ C;  3K7A C;  2YU9 C;  4OIQ A;  4QJV A;  1IW7 A;  1K83 K;  1TWC K;  1TWG K;  2WB1 L;  1I6H C;  3CQZ K;  3K7A K;  3GTJ K;  1TWA C;  1BDF A;  2YU9 K;  4LJZ A;  5C44 C;  3HOY C;  3S17 K;  1TWA K;  1I6H K;  3HOW C;  3HOY K;  2R7Z C;  2NVX C;  3HOU C;  2E2J K;  2O5J A;  3HOW K;  2R7Z K;  1Y1V C;  3GTM C;  4A3L C;  3PO3 C;  4G7Z A;  1Y1V K;  1R9T C;  1SFO C;  3GTM K;  3PO3 K;  4BY7 C;  1R9T K;  1SFO K;  2R93 K;  4OIN A;  4A3D K;  4BY7 K;  3GTG C;  5IP9 C;  4A3E C;  4XSX A;  2JA7 C;  3GTG K;  5IP9 K;  4A3E K;  4MEX A;  4LK0 A;  3RZD C;  2JA7 K;  3DXJ A;  1YNJ A;  3H0G K;  3HOZ C;  4XLP A;  5C4X C;  3GTQ C;  4YG2 A;  2BE5 A;  5C4X K;  4OIO A;  2VUM C;  2E2I K;  3GTQ K;  2R92 C;  2Y0S L;  2VUM K;  4OIP A;  2R92 K;  4YFX A;  2JA6 C;  2O5I A;  1K83 C;  4A3C C;  5C4J C;  1HQM A;  4G7H A;  4A3C K;  3HKZ D;  4BY1 C;  4YFN A;  4LLG A;  2JA5 C;  3S17 C;  5C4J K;  1XPP A;  1TWF C;  4BY1 K;  2JA5 K;  1ZYR A;  2E2J C;  3M3Y C;  4YFK A;  1TWF K;  2PPB A;  1Y1W K;  4A3K C;  3GTK C;  3M3Y K;  4A3K K;  3GTK K;  2NVT C;  4AYB L;  4ZH4 A;  5TMC A;  3RZO C;  2NVT K;  2R93 C;  4KN7 A;  4MEY A;  4A3D C;  5FLM C;  3S2H C;  5M3F K;  3RZO K;  2WB1 D;  4A3G C;  5FLM K;  5M5Y K;  3S2H K;  4XLN A;  4XSZ A;  3S14 C;  5IP7 C;  2A6H A;  3PO2 C;  3S16 C;  4GZY A;  4A3G K;  3S14 K;  3H0G C;  5IP7 K;  3PO2 K;  3S16 K;  2CW0 A;  4C2M K;  1I50 K;  5IYC K;  2E2I C;  1I3Q K;  4A3J C;  3S1M C;  3I4N C;  4A3B C;  4A3J K;  3S1M K;  3I4N K;  3S15 C;  4A3B K;  4A3F K;  4Y7N C;  2B63 C;  2WAQ L;  3FKI K;  3S15 K;  4Y7N K;  2B63 K;  4A3M C;  5IYD C;  4A3M K;  4QJV B;  5IYD K;  3I4M C;  2NVY K;  4BXX K;  3GTO C;  4QIW L;  4C3H K;  2JA8 C;  3I4M K;  3GTO K;  2JA8 K;  5TMF A;  3GTL C;  2Y0S D;  2PA8 L;  5IYB C;  3HOX C;  4Q5S A;  2NVQ C;  3GTL K;  4BBS C;  3S1N K;  2WAQ D;  3HOV C;  5IYB K;  2A68 A;  3HOX K;  2NVQ K;  4BBS K;  5C3E C;  3HOV K;  5C3E K;  4BBR K;  3H3V L;  4C2M C;  2E2H C;  1I50 C;  5IYC C;  1I6V A;  5M3M K;  1SMY A;  4C3J C;  1I3Q C;  3S2D C;  2PMZ L;  2E2H K;  4C3J K;  3S2D K;  4AYB D;  3S1R C;  1WCM K;  4KMU A;  4NOI A;  3EQL A;  4A3F C;  3S1R K;  5FJ8 K;  3FKI C;  4LK1 A;  4MQ9 A;  4Q4Z A;  5D4D A;  5C44 K;  4JK1 A;  2A69 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...