2O5IA

Crystal structure of the t. thermophilus rna polymerase elongation complex
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
229
structure length
229
Chain Sequence
MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(P*CP*CP*CP*TP*GP*TP*CP*TP*GP*GP*CP*GP*TP*TP*CP*GP*CP*GP
publication title Structural basis for transcription elongation by bacterial RNA polymerase.
pubmed doi rcsb
molecule tags Transferase/dna-rna hybrid
total genus 39
structure length 229
sequence length 229
chains with identical sequence B, K, L
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2006-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01000 RNA_pol_A_bac RNA polymerase Rpb3/RpoA insert domain
A PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain
A PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.12 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 DNA-directed RNA polymerase, insert domain 2o5iA02
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 2o5iA01
1TWAK 1I3QC 1K83K 4C3JK 5IYDC 4BXXC 5IP9K 3GTMC 4A3FC 2JA5C 4BY7C 4A3CC 4OIQA 1I3QK 4QIWL 4BXXK 4LK0A 4Y7NC 3K7AC 4A3FK 4A3KK 2JA5K 3GTMK 4A3CK 4A3GK 4BY7K 2A6HA 4C3IC 2E2HC 3M3YC 3GTPC 4QJVB 4A3LK 5D4DA 4Y7NK 4XLPA 3GTQC 3HKZD 4OIRA 3S16C 2WAQD 4ZH4A 3K7AK 4C3IK 3M3YK 3GTPK 1TWHC 4BBRC 3I4NC 2B63C 3GTQK 3DXJA 1TWHK 4BBRK 4JK1A 2NVXC 3GTJK 5M3FK 2B63K 3I4NK 4QIWD 4YG2A 1TWFC 4G7OA 4A3EC 4BBSC 2O5JA 3S2HC 2NVXK 4MQ9A 4BY1C 1ZYRA 3S2DC 5C4JK 3S1RC 3S1MK 5M3MK 3HKZL 2WAQL 4A3EK 4BBSK 4LK1A 3S2HK 4XLNA 1WCMC 3S2DK 3GTLC 1XPPA 3S17C 4KMUA 2JA7C 1WCMK 5FLMC 3RZDC 3GTLK 3S17K 5IYDK 2JA8C 3HOYC 4YFNA 3HOVC 4Q4ZA 5FLMK 3RZDK 1SMYA 2JA8K 2YU9C 4A93C 3HOYK 3HOVK 4OINA 3HOXC 5M5WK 2E2HK 4A3BC 5FJ8K 2YU9K 4A93K 5M5YK 2NVYC 4OIPA 1IW7A 3S16K 3HOXK 2O5IA 2R7ZC 4A3BK 3M4OC 2NVYK 3CQZC 2NVQC 1YNJA 4A3MC 2A6EA 2R7ZK 3RZOC 4XSXA 5IYCC 3CQZK 2NVQK 4A3MK 4XSZA 4G7HA 4C3HC 2WB1D 3H0GC 1YNNA 1TWFK 3H3VL 3RZOK 3I4MC 5IYCK 4BY1K 3S15C 4C3HK 3S1RK 3HOWC 3H0GK 1TWGC 4OIOA 2Y0SD 4A3DC 3I4MK 3GTGC 3PO3C 2E2IC 3HOWK 1TWGK 2A69A 5M5XK 2VUMC 5C44C 2R92C 2PMZD 5IYBC 2JA7K 3GTGK 4A3DK 5C4XC 3PO3K 2VUMK 5C44K 2R92K 5IYBK 2WB1L 5C4XK 3HOZC 3H3VD 3S1QC 1SFOC 4A3JC 3HOZK 3S1MC 2Y0SL 3S1QK 4QJVA 5TMCA 1SFOK 1TWCC 4A3JK 2PMZL 1Y1VC 5IP9C 2PA8L 5C3EC 3M4OK 4AYBD 4C2MC 4Y52C 1TWCK 5TMFA 1Y1VK 3GTKC 4MEXA 1BDFA 5C3EK 4A3KC 4C2MK 4Y52K 4A3GC 3GTKK 4KN4A 3GTOC 1I6VA 4A3LC 1Y1WC 4Q5SA 2CW0A 4LJZA 3S15K 3EQLA 4YFKA 2PPBA 3GTOK 1Y1WK 3S1NC 3S14C 2PA8D 3FKIC 4AYBL 2BE5A 3GTJC 2E2IK 4A3IC 3HOUC 1HQMA 2R93C 4LLGA 3WODA 4G7ZA 4KN7A 3S14K 3S1NK 3FKIK 4NOIA 2E2JC 1I6HC 4X6AC 2JA6C 2NVTC 4GZYA 4A3IK 3HOUK 2R93K 5IP7C 4YFXA 5C4JC 1R9TC 2A68A 3PO2C 2E2JK 1I6HK 1I50C 2JA6K 2NVTK 4X6AK 5IP7K 1TWAC 1R9TK 4MEYA 1K83C 4C3JC 3PO2K 1I50K
chains in the Genus database with same CATH superfamily
3ADAC 2JA5C 4BY7C 2D6FC 1F93A 1USOA 4KARA 2ZUFA 3H0GA 4A3KK 5EGEA 3GTPC 3A8JA 3K7AK 4OIRA 2WAQD 2PHCB 2GAHC 4C3IK 1Y1WA 3M3YK 3GTQK 1TWHK 3AD7C 3A8KA 4RMFA 4QIWD 3S1RC 5IOTA 5M3MK 4LK1A 3S2DK 1XPPA 4O2DA 1TWCA 5CHPA 1K83A 1O2FB 1Y1VA 3RZDC 1JVIA 1I3QA 4LQYA 1DCHA 4GFQA 4YFNA 2ZJQS 1SMYA 2YU9C 5EGHA 3HOVK 1B4AA 4KM9A 3GTOA 1WQHA 4OINA 4GTCA 1ZBSA 1ZXOA 3HOXK 1GE9A 4WFAS 4A3BK 3M4OC 2NVYK 3GTJA 4A3MC 1G51A 3RZOC 3CQZK 4G0WA 4XSZA 2FQOA 2NVXA 2JA6A 2WB1D 4IO9S 1YNNA 1TWFK 4KATA 1XXBA 2V6UA 1VGXA 5IYCK 4C3HK 1TWAA 3HXAA 4A3DC 1ISEA 1EI6A 2E2IC 2VUMC 2R92K 3T00A 1VRQC 3H3VD 3S1QC 1O2BA 4C45A 2V6TA 4A3JC 3GTPA 2Y0SL 2KQ1A 3G4AA 4QJVA 1XZPB 1IQ0A 4KMDA 3FOEA 2R7ZA 5TJ3A 5TMFA 3GTKC 4M1XA 1BDFA 4A3KC 4KB4A 5HQHA 3N3YA 4KN4A 2GSNA 1Y1WC 1EQRA 3Q3QA 1JOEA 1TWGA 2PA8D 3FKIC 1INNA 1O28A 4AYBL 3GTGA 3HOUC 1KQ4A 3S14K 3GEEA 5DM7S 3AD9C 1YCLA 2GSUA 4A3IK 3SZZA 1F7UA 2R93K 1XXAA 3LPXA 3N0CA 4WJ4A 2YU9A 3GEHA 1I6HK 2NVTK 1BS2A 4IOCS 3DLLS 4MEYA 1K83C 1I50K 5CJ9A 2ZFZA 3L4KA 3PIOS 4GT9A 1I3QC 4C3JK 4BXXC 3BP8C 3GDZA 3GTMC 4A3FC 4A3CC 4OIQA 1IL2A 3SZYA 4WFBS 1ZQ1C 4LK0A 2ZUEA 4Y7NC 4A3GK 4KMHA 2A6HA 1ZVUA 5IOQA 1L0WA 1DD5A 1XZQA 2E2IA 3DXJA 1X31C 2P5MA 4GTBA 4BBRK 2NVXC 3LAJA 2B63K 3I4NK 4U67S 3FHZA 4YG2A 1PJ5A 1TWFC 4BBSC 2O5JA 1ZYRA 5C4JK 2EBBA 4A3EK 3S2HK 4XLNA 3GTLC 3S17C 1USMA 4KMUA 3TFIA 1IS1A 1WOSA 1WCMK 3CAGA 3A8IA 5IYDK 4LR2A 3GEIA 4Q4ZA 5FLMK 3GTKA 2JA8K 3HOYK 2P8TA 2FQTA 4KMAA 5M5WK 4A93K 4OIPA 1IW7A 4P5BA 3S16K 2R7ZC 3FKIA 3BUEA 4GTDA 2NVQC 1YNJA 3OREA 4WJ3M 3I4MC 4PABA 4BY1K 3H0GK 1TWGC 2Y0SD 3GTGC 3HOWK 2JA7K 5C44C 3PIPS 3PO3K 1VH2A 3GTMA 5HL7S 1WOOA 5IYBK 4LOWA 5C4XK 1BJTA 1O24A 4KAWX 1RU0A 1SFOC 5HL8A 3HOZK 4G0UA 1XXCA 2PMZL 2NVYA 3OPFA 4AYBD 4C2MC 1TWCK 4DDQA 1Y1VK 4MEXA 1WSRA 5C3EK 4Y52K 4A3GC 1TWFA 2CW0A 1FEUA 3EQLA 2PPBA 1WQFA 3GTOK 4WILA 3GTLA 5JVGS 2RGRA 1VLOA 2BE5A 3S1NK 2E2JC 4X6AC 4GZYA 2RH6A 4YFXA 5C4JC 1R9TC 4GTFA 2JA6K 5IP7K 3S1MK 3PO2K 3TFJA 1TWAK 4AH6A 5IYDC 3LAPA 5IP9K 4QIWL 3K7AC 2JA5K 4BY7K 4C3IC 3M3YC 5D4DA 4XLPA 3GTQC 4KASA 4BLBA 3S16C 4ZH4A 4KM8A 3GTPK 1TWHC 2XCQA 3AQPA 1DCOA 3JSTA 5M3FK 2CFAB 3N0BA 2R93A 5L46A 4MQ9A 4BY1C 3S2DC 3HKZL 1SFOA 3T02A 2JH3A 2JA7C 1WOPA 1XZPA 1V5VA 3CF5S 3HOVC 4WF9S 4G0VA 3RZDK 1DCPA 2ZJPS 3HOXC 3MMLB 2E2HK 2YU9K 4A3BC 5M5YK 2NVYC 2O5IA 4KB2A 3CQZC 1EH1A 1WSVA 4P9SA 2B63A 3ERED 4PAAA 3T01A 5IYCC 2Y3PA 4A3MK 4C3HC 1R9TA 3H3VL 3RZOK 4OIOA 1WCMA 2A69A 2R92C 2PMZD 1J6VA 4A3DK 4XCHA 2VUMK 3AQOA 3FOFA 3NUHA 3S1MC 3S1QK 3GTQA 3LYWA 4A3JK 1TWHA 1F7VA 5IP9C 2PA8L 5JVHS 1IBAA 3G4CA 3GTKK 1BGWA 3AH5A 1I6VA 2L3UA 2KWAA 4Q5SA 4LJZA 3S15K 2KXYA 2W7VA 1Y1WK 4BLAA 3S14C 2JA7A 4A3IC 2R93C 4G7ZA 1YX2A 3FKIK 4NOIA 1I6HC 2NVTC 3HOUK 2L5NA 2A68A 4J3NA 1I50C 4C3JC 4FZBA 4ILDA 1K83K 1O2AA 3CQZA 1I3QK 4BXXK 1EK8A 5IORA 3GTMK 3TTGA 4A3FK 4A3CK 2V6SA 4WFNS 2KPUA 2E2HC 4QJVB 3GSIA 4A3LK 4Y7NK 3S0XA 3HKZD 4BBRC 3I4NC 1JQWA 3QX3A 2B63C 1HI9A 2R92A 1O27A 3GTJK 4JK1A 1O29A 3BP3A 2GAGC 4G7OA 1J98A 4A3EC 2NVXK 3S2HC 2WAQL 4BBSK 3OEPA 1WCMC 1O26A 1PJ7A 5FLMC 3GTLK 3S17K 2JA8C 3HOYC 1WIHA 1AB4A 1VJEA 2JA5A 4A93C 4GTEA 5FJ8K 1EFWA 1PJ6A 3VA7A 4BKWA 3AD8C 2A6EA 2R7ZK 4XSXA 3TFHA 2NVQK 4G7HA 2XCOA 3H0GC 1O25A 3GIRA 1I50A 4WCES 3S15C 1J6WA 3S1RK 3HOWC 3I4MK 1XZQB 5DM6S 3PO3C 1J6XA 1TWGK 5M5XK 4FM9A 5IYBC 3GTGK 5C4XC 5JFEA 5E68A 1WORA 5C44K 5IOSA 2WB1L 3HOZC 1UV7A 2E2HA 4KDDA 4KC6A 3IPJA 5TMCA 1WQGA 1TWCC 1SFOK 1Y1VC 5C3EC 3M4OK 4Y52C 4P5AA 2CFAA 4C2MK 4IOAS 5JVOA 3GTOC 2ZJRS 4A3LC 1F9NA 4YFKA 2XCRB 3S1NC 4GTLA 2E2IK 3GTJC 1HQMA 1IE0A 4LLGA 3WODA 3V4GA 4KN7A 2VUMA 2JA6C 4GTAA 5IP7C 2GSOA 3PO2C 2E2JK 4X6AK 3L4JA 1B4BA 1TWAC 1R9TK 1C0AA
chains in the Genus database with same CATH topology
1TWAK 1I3QC 1K83K 4C3JK 5IYDC 4BXXC 5IP9K 3GTMC 4A3FC 2JA5C 4BY7C 4A3CC 4OIQA 1I3QK 4QIWL 4BXXK 4LK0A 4Y7NC 3K7AC 4A3FK 4A3KK 2JA5K 3GTMK 4A3CK 4A3GK 4BY7K 2A6HA 4C3IC 2E2HC 3M3YC 3GTPC 4QJVB 4A3LK 5D4DA 4Y7NK 4XLPA 3GTQC 3HKZD 4OIRA 3S16C 2WAQD 4ZH4A 3K7AK 4C3IK 3M3YK 3GTPK 1TWHC 4BBRC 3I4NC 2B63C 3GTQK 3DXJA 1TWHK 4BBRK 4JK1A 2NVXC 3GTJK 5M3FK 2B63K 3I4NK 4QIWD 4YG2A 1TWFC 4G7OA 4A3EC 4BBSC 2O5JA 3S2HC 2NVXK 4MQ9A 4BY1C 1ZYRA 3S2DC 5C4JK 3S1RC 3S1MK 5M3MK 3HKZL 2WAQL 4A3EK 4BBSK 4LK1A 3S2HK 4XLNA 1WCMC 3S2DK 3GTLC 1XPPA 3S17C 4KMUA 2JA7C 1WCMK 5FLMC 3RZDC 3GTLK 3S17K 5IYDK 2JA8C 3HOYC 4YFNA 3HOVC 4Q4ZA 5FLMK 3RZDK 1SMYA 2JA8K 2YU9C 4A93C 3HOYK 3HOVK 4OINA 3HOXC 5M5WK 2E2HK 4A3BC 5FJ8K 2YU9K 4A93K 5M5YK 2NVYC 4OIPA 1IW7A 3S16K 3HOXK 2O5IA 2R7ZC 4A3BK 3M4OC 2NVYK 3CQZC 2NVQC 1YNJA 4A3MC 2A6EA 2R7ZK 3RZOC 4XSXA 5IYCC 3CQZK 2NVQK 4A3MK 4XSZA 4G7HA 4C3HC 2WB1D 3H0GC 1YNNA 1TWFK 3H3VL 3RZOK 3I4MC 5IYCK 4BY1K 3S15C 4C3HK 3S1RK 3HOWC 3H0GK 1TWGC 4OIOA 2Y0SD 4A3DC 3I4MK 3GTGC 3PO3C 2E2IC 3HOWK 1TWGK 2A69A 5M5XK 2VUMC 5C44C 2R92C 2PMZD 5IYBC 2JA7K 3GTGK 4A3DK 5C4XC 3PO3K 2VUMK 5C44K 2R92K 5IYBK 2WB1L 5C4XK 3HOZC 3H3VD 3S1QC 1SFOC 4A3JC 3HOZK 3S1MC 2Y0SL 3S1QK 4QJVA 5TMCA 1SFOK 1TWCC 4A3JK 2PMZL 1Y1VC 5IP9C 2PA8L 5C3EC 3M4OK 4AYBD 4C2MC 4Y52C 1TWCK 5TMFA 1Y1VK 3GTKC 4MEXA 1BDFA 5C3EK 4A3KC 4C2MK 4Y52K 4A3GC 3GTKK 4KN4A 3GTOC 1I6VA 4A3LC 1Y1WC 4Q5SA 2CW0A 4LJZA 3S15K 3EQLA 4YFKA 2PPBA 3GTOK 1Y1WK 3S1NC 3S14C 2PA8D 3FKIC 4AYBL 2BE5A 3GTJC 2E2IK 4A3IC 3HOUC 1HQMA 2R93C 4LLGA 3WODA 4G7ZA 4KN7A 3S14K 3S1NK 3FKIK 4NOIA 2E2JC 1I6HC 4X6AC 2JA6C 2NVTC 4GZYA 4A3IK 3HOUK 2R93K 5IP7C 4YFXA 5C4JC 1R9TC 2A68A 3PO2C 2E2JK 1I6HK 1I50C 2JA6K 2NVTK 4X6AK 5IP7K 1TWAC 1R9TK 4MEYA 1K83C 4C3JC 3PO2K 1I50K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TWA K;  1I3Q C;  1K83 K;  4C3J K;  5IYD C;  4BXX C;  5IP9 K;  3GTM C;  4A3F C;  2JA5 C;  4BY7 C;  4A3C C;  4OIQ A;  1I3Q K;  4QIW L;  4BXX K;  4LK0 A;  4Y7N C;  3K7A C;  4A3F K;  4A3K K;  2JA5 K;  3GTM K;  4A3C K;  4A3G K;  4BY7 K;  2A6H A;  4C3I C;  2E2H C;  3M3Y C;  3GTP C;  4QJV B;  4A3L K;  5D4D A;  4Y7N K;  4XLP A;  3GTQ C;  3HKZ D;  4OIR A;  3S16 C;  2WAQ D;  4ZH4 A;  3K7A K;  4C3I K;  3M3Y K;  3GTP K;  1TWH C;  4BBR C;  3I4N C;  2B63 C;  3GTQ K;  3DXJ A;  1TWH K;  4BBR K;  4JK1 A;  2NVX C;  3GTJ K;  5M3F K;  2B63 K;  3I4N K;  4QIW D;  4YG2 A;  1TWF C;  4G7O A;  4A3E C;  4BBS C;  2O5J A;  3S2H C;  2NVX K;  4MQ9 A;  4BY1 C;  1ZYR A;  3S2D C;  5C4J K;  3S1R C;  3S1M K;  5M3M K;  3HKZ L;  2WAQ L;  4A3E K;  4BBS K;  4LK1 A;  3S2H K;  4XLN A;  1WCM C;  3S2D K;  3GTL C;  1XPP A;  3S17 C;  4KMU A;  2JA7 C;  1WCM K;  5FLM C;  3RZD C;  3GTL K;  3S17 K;  5IYD K;  2JA8 C;  3HOY C;  4YFN A;  3HOV C;  4Q4Z A;  5FLM K;  3RZD K;  1SMY A;  2JA8 K;  2YU9 C;  4A93 C;  3HOY K;  3HOV K;  4OIN A;  3HOX C;  5M5W K;  2E2H K;  4A3B C;  5FJ8 K;  2YU9 K;  4A93 K;  5M5Y K;  2NVY C;  4OIP A;  1IW7 A;  3S16 K;  3HOX K;  2O5I A;  2R7Z C;  4A3B K;  3M4O C;  2NVY K;  3CQZ C;  2NVQ C;  1YNJ A;  4A3M C;  2A6E A;  2R7Z K;  3RZO C;  4XSX A;  5IYC C;  3CQZ K;  2NVQ K;  4A3M K;  4XSZ A;  4G7H A;  4C3H C;  2WB1 D;  3H0G C;  1YNN A;  1TWF K;  3H3V L;  3RZO K;  3I4M C;  5IYC K;  4BY1 K;  3S15 C;  4C3H K;  3S1R K;  3HOW C;  3H0G K;  1TWG C;  4OIO A;  2Y0S D;  4A3D C;  3I4M K;  3GTG C;  3PO3 C;  2E2I C;  3HOW K;  1TWG K;  2A69 A;  5M5X K;  2VUM C;  5C44 C;  2R92 C;  2PMZ D;  5IYB C;  2JA7 K;  3GTG K;  4A3D K;  5C4X C;  3PO3 K;  2VUM K;  5C44 K;  2R92 K;  5IYB K;  2WB1 L;  5C4X K;  3HOZ C;  3H3V D;  3S1Q C;  1SFO C;  4A3J C;  3HOZ K;  3S1M C;  2Y0S L;  3S1Q K;  4QJV A;  5TMC A;  1SFO K;  1TWC C;  4A3J K;  2PMZ L;  1Y1V C;  5IP9 C;  2PA8 L;  5C3E C;  3M4O K;  4AYB D;  4C2M C;  4Y52 C;  1TWC K;  5TMF A;  1Y1V K;  3GTK C;  4MEX A;  1BDF A;  5C3E K;  4A3K C;  4C2M K;  4Y52 K;  4A3G C;  3GTK K;  4KN4 A;  3GTO C;  1I6V A;  4A3L C;  1Y1W C;  4Q5S A;  2CW0 A;  4LJZ A;  3S15 K;  3EQL A;  4YFK A;  2PPB A;  3GTO K;  1Y1W K;  3S1N C;  3S14 C;  2PA8 D;  3FKI C;  4AYB L;  2BE5 A;  3GTJ C;  2E2I K;  4A3I C;  3HOU C;  1HQM A;  2R93 C;  4LLG A;  3WOD A;  4G7Z A;  4KN7 A;  3S14 K;  3S1N K;  3FKI K;  4NOI A;  2E2J C;  1I6H C;  4X6A C;  2JA6 C;  2NVT C;  4GZY A;  4A3I K;  3HOU K;  2R93 K;  5IP7 C;  4YFX A;  5C4J C;  1R9T C;  2A68 A;  3PO2 C;  2E2J K;  1I6H K;  1I50 C;  2JA6 K;  2NVT K;  4X6A K;  5IP7 K;  1TWA C;  1R9T K;  4MEY A;  1K83 C;  4C3J C;  3PO2 K;  1I50 K; 
#chains in the Genus database with same CATH topology
 3ADA C;  2JA5 C;  4BY7 C;  2D6F C;  1F93 A;  1USO A;  4KAR A;  2ZUF A;  3H0G A;  4A3K K;  5EGE A;  3GTP C;  3A8J A;  3K7A K;  4OIR A;  2WAQ D;  2PHC B;  2GAH C;  4C3I K;  1Y1W A;  3M3Y K;  3GTQ K;  1TWH K;  3AD7 C;  3A8K A;  4RMF A;  4QIW D;  3S1R C;  5IOT A;  5M3M K;  4LK1 A;  3S2D K;  1XPP A;  4O2D A;  1TWC A;  5CHP A;  1K83 A;  1O2F B;  1Y1V A;  3RZD C;  1JVI A;  1I3Q A;  4LQY A;  1DCH A;  4GFQ A;  4YFN A;  2ZJQ S;  1SMY A;  2YU9 C;  5EGH A;  3HOV K;  1B4A A;  4KM9 A;  3GTO A;  1WQH A;  4OIN A;  4GTC A;  1ZBS A;  1ZXO A;  3HOX K;  1GE9 A;  4WFA S;  4A3B K;  3M4O C;  2NVY K;  3GTJ A;  4A3M C;  1G51 A;  3RZO C;  3CQZ K;  4G0W A;  4XSZ A;  2FQO A;  2NVX A;  2JA6 A;  2WB1 D;  4IO9 S;  1YNN A;  1TWF K;  4KAT A;  1XXB A;  2V6U A;  1VGX A;  5IYC K;  4C3H K;  1TWA A;  3HXA A;  4A3D C;  1ISE A;  1EI6 A;  2E2I C;  2VUM C;  2R92 K;  3T00 A;  1VRQ C;  3H3V D;  3S1Q C;  1O2B A;  4C45 A;  2V6T A;  4A3J C;  3GTP A;  2Y0S L;  2KQ1 A;  3G4A A;  4QJV A;  1XZP B;  1IQ0 A;  4KMD A;  3FOE A;  2R7Z A;  5TJ3 A;  5TMF A;  3GTK C;  4M1X A;  1BDF A;  4A3K C;  4KB4 A;  5HQH A;  3N3Y A;  4KN4 A;  2GSN A;  1Y1W C;  1EQR A;  3Q3Q A;  1JOE A;  1TWG A;  2PA8 D;  3FKI C;  1INN A;  1O28 A;  4AYB L;  3GTG A;  3HOU C;  1KQ4 A;  3S14 K;  3GEE A;  5DM7 S;  3AD9 C;  1YCL A;  2GSU A;  4A3I K;  3SZZ A;  1F7U A;  2R93 K;  1XXA A;  3LPX A;  3N0C A;  4WJ4 A;  2YU9 A;  3GEH A;  1I6H K;  2NVT K;  1BS2 A;  4IOC S;  3DLL S;  4MEY A;  1K83 C;  1I50 K;  5CJ9 A;  2ZFZ A;  3L4K A;  3PIO S;  4GT9 A;  1I3Q C;  4C3J K;  4BXX C;  3BP8 C;  3GDZ A;  3GTM C;  4A3F C;  4A3C C;  4OIQ A;  1IL2 A;  3SZY A;  4WFB S;  1ZQ1 C;  4LK0 A;  2ZUE A;  4Y7N C;  4A3G K;  4KMH A;  2A6H A;  1ZVU A;  5IOQ A;  1L0W A;  1DD5 A;  1XZQ A;  2E2I A;  3DXJ A;  1X31 C;  2P5M A;  4GTB A;  4BBR K;  2NVX C;  3LAJ A;  2B63 K;  3I4N K;  4U67 S;  3FHZ A;  4YG2 A;  1PJ5 A;  1TWF C;  4BBS C;  2O5J A;  1ZYR A;  5C4J K;  2EBB A;  4A3E K;  3S2H K;  4XLN A;  3GTL C;  3S17 C;  1USM A;  4KMU A;  3TFI A;  1IS1 A;  1WOS A;  1WCM K;  3CAG A;  3A8I A;  5IYD K;  4LR2 A;  3GEI A;  4Q4Z A;  5FLM K;  3GTK A;  2JA8 K;  3HOY K;  2P8T A;  2FQT A;  4KMA A;  5M5W K;  4A93 K;  4OIP A;  1IW7 A;  4P5B A;  3S16 K;  2R7Z C;  3FKI A;  3BUE A;  4GTD A;  2NVQ C;  1YNJ A;  3ORE A;  4WJ3 M;  3I4M C;  4PAB A;  4BY1 K;  3H0G K;  1TWG C;  2Y0S D;  3GTG C;  3HOW K;  2JA7 K;  5C44 C;  3PIP S;  3PO3 K;  1VH2 A;  3GTM A;  5HL7 S;  1WOO A;  5IYB K;  4LOW A;  5C4X K;  1BJT A;  1O24 A;  4KAW X;  1RU0 A;  1SFO C;  5HL8 A;  3HOZ K;  4G0U A;  1XXC A;  2PMZ L;  2NVY A;  3OPF A;  4AYB D;  4C2M C;  1TWC K;  4DDQ A;  1Y1V K;  4MEX A;  1WSR A;  5C3E K;  4Y52 K;  4A3G C;  1TWF A;  2CW0 A;  1FEU A;  3EQL A;  2PPB A;  1WQF A;  3GTO K;  4WIL A;  3GTL A;  5JVG S;  2RGR A;  1VLO A;  2BE5 A;  3S1N K;  2E2J C;  4X6A C;  4GZY A;  2RH6 A;  4YFX A;  5C4J C;  1R9T C;  4GTF A;  2JA6 K;  5IP7 K;  3S1M K;  3PO2 K;  3TFJ A;  1TWA K;  4AH6 A;  5IYD C;  3LAP A;  5IP9 K;  4QIW L;  3K7A C;  2JA5 K;  4BY7 K;  4C3I C;  3M3Y C;  5D4D A;  4XLP A;  3GTQ C;  4KAS A;  4BLB A;  3S16 C;  4ZH4 A;  4KM8 A;  3GTP K;  1TWH C;  2XCQ A;  3AQP A;  1DCO A;  3JST A;  5M3F K;  2CFA B;  3N0B A;  2R93 A;  5L46 A;  4MQ9 A;  4BY1 C;  3S2D C;  3HKZ L;  1SFO A;  3T02 A;  2JH3 A;  2JA7 C;  1WOP A;  1XZP A;  1V5V A;  3CF5 S;  3HOV C;  4WF9 S;  4G0V A;  3RZD K;  1DCP A;  2ZJP S;  3HOX C;  3MML B;  2E2H K;  2YU9 K;  4A3B C;  5M5Y K;  2NVY C;  2O5I A;  4KB2 A;  3CQZ C;  1EH1 A;  1WSV A;  4P9S A;  2B63 A;  3ERE D;  4PAA A;  3T01 A;  5IYC C;  2Y3P A;  4A3M K;  4C3H C;  1R9T A;  3H3V L;  3RZO K;  4OIO A;  1WCM A;  2A69 A;  2R92 C;  2PMZ D;  1J6V A;  4A3D K;  4XCH A;  2VUM K;  3AQO A;  3FOF A;  3NUH A;  3S1M C;  3S1Q K;  3GTQ A;  3LYW A;  4A3J K;  1TWH A;  1F7V A;  5IP9 C;  2PA8 L;  5JVH S;  1IBA A;  3G4C A;  3GTK K;  1BGW A;  3AH5 A;  1I6V A;  2L3U A;  2KWA A;  4Q5S A;  4LJZ A;  3S15 K;  2KXY A;  2W7V A;  1Y1W K;  4BLA A;  3S14 C;  2JA7 A;  4A3I C;  2R93 C;  4G7Z A;  1YX2 A;  3FKI K;  4NOI A;  1I6H C;  2NVT C;  3HOU K;  2L5N A;  2A68 A;  4J3N A;  1I50 C;  4C3J C;  4FZB A;  4ILD A;  1K83 K;  1O2A A;  3CQZ A;  1I3Q K;  4BXX K;  1EK8 A;  5IOR A;  3GTM K;  3TTG A;  4A3F K;  4A3C K;  2V6S A;  4WFN S;  2KPU A;  2E2H C;  4QJV B;  3GSI A;  4A3L K;  4Y7N K;  3S0X A;  3HKZ D;  4BBR C;  3I4N C;  1JQW A;  3QX3 A;  2B63 C;  1HI9 A;  2R92 A;  1O27 A;  3GTJ K;  4JK1 A;  1O29 A;  3BP3 A;  2GAG C;  4G7O A;  1J98 A;  4A3E C;  2NVX K;  3S2H C;  2WAQ L;  4BBS K;  3OEP A;  1WCM C;  1O26 A;  1PJ7 A;  5FLM C;  3GTL K;  3S17 K;  2JA8 C;  3HOY C;  1WIH A;  1AB4 A;  1VJE A;  2JA5 A;  4A93 C;  4GTE A;  5FJ8 K;  1EFW A;  1PJ6 A;  3VA7 A;  4BKW A;  3AD8 C;  2A6E A;  2R7Z K;  4XSX A;  3TFH A;  2NVQ K;  4G7H A;  2XCO A;  3H0G C;  1O25 A;  3GIR A;  1I50 A;  4WCE S;  3S15 C;  1J6W A;  3S1R K;  3HOW C;  3I4M K;  1XZQ B;  5DM6 S;  3PO3 C;  1J6X A;  1TWG K;  5M5X K;  4FM9 A;  5IYB C;  3GTG K;  5C4X C;  5JFE A;  5E68 A;  1WOR A;  5C44 K;  5IOS A;  2WB1 L;  3HOZ C;  1UV7 A;  2E2H A;  4KDD A;  4KC6 A;  3IPJ A;  5TMC A;  1WQG A;  1TWC C;  1SFO K;  1Y1V C;  5C3E C;  3M4O K;  4Y52 C;  4P5A A;  2CFA A;  4C2M K;  4IOA S;  5JVO A;  3GTO C;  2ZJR S;  4A3L C;  1F9N A;  4YFK A;  2XCR B;  3S1N C;  4GTL A;  2E2I K;  3GTJ C;  1HQM A;  1IE0 A;  4LLG A;  3WOD A;  3V4G A;  4KN7 A;  2VUM A;  2JA6 C;  4GTA A;  5IP7 C;  2GSO A;  3PO2 C;  2E2J K;  4X6A K;  3L4J A;  1B4B A;  1TWA C;  1R9T K;  1C0A A; 
#chains in the Genus database with same CATH homology
 1TWA K;  1I3Q C;  1K83 K;  4C3J K;  5IYD C;  4BXX C;  5IP9 K;  3GTM C;  4A3F C;  2JA5 C;  4BY7 C;  4A3C C;  4OIQ A;  1I3Q K;  4QIW L;  4BXX K;  4LK0 A;  4Y7N C;  3K7A C;  4A3F K;  4A3K K;  2JA5 K;  3GTM K;  4A3C K;  4A3G K;  4BY7 K;  2A6H A;  4C3I C;  2E2H C;  3M3Y C;  3GTP C;  4QJV B;  4A3L K;  5D4D A;  4Y7N K;  4XLP A;  3GTQ C;  3HKZ D;  4OIR A;  3S16 C;  2WAQ D;  4ZH4 A;  3K7A K;  4C3I K;  3M3Y K;  3GTP K;  1TWH C;  4BBR C;  3I4N C;  2B63 C;  3GTQ K;  3DXJ A;  1TWH K;  4BBR K;  4JK1 A;  2NVX C;  3GTJ K;  5M3F K;  2B63 K;  3I4N K;  4QIW D;  4YG2 A;  1TWF C;  4G7O A;  4A3E C;  4BBS C;  2O5J A;  3S2H C;  2NVX K;  4MQ9 A;  4BY1 C;  1ZYR A;  3S2D C;  5C4J K;  3S1R C;  3S1M K;  5M3M K;  3HKZ L;  2WAQ L;  4A3E K;  4BBS K;  4LK1 A;  3S2H K;  4XLN A;  1WCM C;  3S2D K;  3GTL C;  1XPP A;  3S17 C;  4KMU A;  2JA7 C;  1WCM K;  5FLM C;  3RZD C;  3GTL K;  3S17 K;  5IYD K;  2JA8 C;  3HOY C;  4YFN A;  3HOV C;  4Q4Z A;  5FLM K;  3RZD K;  1SMY A;  2JA8 K;  2YU9 C;  4A93 C;  3HOY K;  3HOV K;  4OIN A;  3HOX C;  5M5W K;  2E2H K;  4A3B C;  5FJ8 K;  2YU9 K;  4A93 K;  5M5Y K;  2NVY C;  4OIP A;  1IW7 A;  3S16 K;  3HOX K;  2O5I A;  2R7Z C;  4A3B K;  3M4O C;  2NVY K;  3CQZ C;  2NVQ C;  1YNJ A;  4A3M C;  2A6E A;  2R7Z K;  3RZO C;  4XSX A;  5IYC C;  3CQZ K;  2NVQ K;  4A3M K;  4XSZ A;  4G7H A;  4C3H C;  2WB1 D;  3H0G C;  1YNN A;  1TWF K;  3H3V L;  3RZO K;  3I4M C;  5IYC K;  4BY1 K;  3S15 C;  4C3H K;  3S1R K;  3HOW C;  3H0G K;  1TWG C;  4OIO A;  2Y0S D;  4A3D C;  3I4M K;  3GTG C;  3PO3 C;  2E2I C;  3HOW K;  1TWG K;  2A69 A;  5M5X K;  2VUM C;  5C44 C;  2R92 C;  2PMZ D;  5IYB C;  2JA7 K;  3GTG K;  4A3D K;  5C4X C;  3PO3 K;  2VUM K;  5C44 K;  2R92 K;  5IYB K;  2WB1 L;  5C4X K;  3HOZ C;  3H3V D;  3S1Q C;  1SFO C;  4A3J C;  3HOZ K;  3S1M C;  2Y0S L;  3S1Q K;  4QJV A;  5TMC A;  1SFO K;  1TWC C;  4A3J K;  2PMZ L;  1Y1V C;  5IP9 C;  2PA8 L;  5C3E C;  3M4O K;  4AYB D;  4C2M C;  4Y52 C;  1TWC K;  5TMF A;  1Y1V K;  3GTK C;  4MEX A;  1BDF A;  5C3E K;  4A3K C;  4C2M K;  4Y52 K;  4A3G C;  3GTK K;  4KN4 A;  3GTO C;  1I6V A;  4A3L C;  1Y1W C;  4Q5S A;  2CW0 A;  4LJZ A;  3S15 K;  3EQL A;  4YFK A;  2PPB A;  3GTO K;  1Y1W K;  3S1N C;  3S14 C;  2PA8 D;  3FKI C;  4AYB L;  2BE5 A;  3GTJ C;  2E2I K;  4A3I C;  3HOU C;  1HQM A;  2R93 C;  4LLG A;  3WOD A;  4G7Z A;  4KN7 A;  3S14 K;  3S1N K;  3FKI K;  4NOI A;  2E2J C;  1I6H C;  4X6A C;  2JA6 C;  2NVT C;  4GZY A;  4A3I K;  3HOU K;  2R93 K;  5IP7 C;  4YFX A;  5C4J C;  1R9T C;  2A68 A;  3PO2 C;  2E2J K;  1I6H K;  1I50 C;  2JA6 K;  2NVT K;  4X6A K;  5IP7 K;  1TWA C;  1R9T K;  4MEY A;  1K83 C;  4C3J C;  3PO2 K;  1I50 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...