4OIOA

Crystal structure of thermus thermophilus pre-insertion substrate complex for de novo transcription initiation
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
226
structure length
226
Chain Sequence
SKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title GE23077 binds to the RNA polymerase 'i' and 'i+1' sites and prevents the binding of initiating nucleotides.
pubmed rcsb
source organism Thermus thermophilus
molecule tags Transcription, transferase
molecule keywords DNA-directed RNA polymerase subunit alpha
total genus 50
structure length 226
sequence length 226
chains with identical sequence B
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2014-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01000 RNA_pol_A_bac RNA polymerase Rpb3/RpoA insert domain
A PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain
A PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.12 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 DNA-directed RNA polymerase, insert domain 4oioA02
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 4oioA01
2WAQD 5FLMK 3S16C 2NVQK 3HOWK 4YFKA 3PO3C 3PO2K 5M3MK 2E2HK 3FKIC 4G7HA 3M4OK 1Y1VC 4GZYA 3EQLA 2JA6K 3GTPK 1TWCC 3GTLC 5IYBC 2NVYK 2VUMK 4OIQA 4YFXA 3M3YK 2PPBA 4C3HK 4KN4A 1TWGC 4C3IK 2A69A 4A3LK 5C4XK 5IP7K 4AYBL 4OIPA 2CW0A 4C2MK 3RZDK 3H0GK 2YU9K 3S1NC 3S14C 2Y0SL 1SFOC 3GTQK 5IP9K 4MQ9A 5FLMC 2NVQC 3HOWC 3HOUK 3DXJA 3S16K 3PO3K 2NVTC 4Q4ZA 2E2JK 2R7ZK 4A3MC 4BY1C 1Y1VK 4MEYA 3GTOC 4A3BC 5TMCA 3WODA 4A3IK 5IYCC 1TWCK 4OIRA 2NVYC 5IYBK 3GTLK 4A3GC 4OIOA 4KMUA 2PMZD 2WB1D 3RZOC 4XLNA 2O5IA 4A3LC 5IP7C 5C4XC 1I6HK 1Y1WC 1I3QK 1K83K 4C2MC 2YU9C 4A3JC 4OINA 3S14K 5FJ8K 5M3FK 4A3FK 4MEXA 3S1NK 5IP9C 3S1MK 5C3EC 4Y52C 1R9TC 3GTMC 4BY7K 3HOZC 4Q5SA 3HOUC 2A6EA 2NVTK 2E2JC 2R7ZC 4YFNA 4A3DK 4A3MK 4BY1K 2NVXC 3GTOK 4A3IC 5TMFA 4G7OA 3H3VL 4A3BK 5IYCK 3K7AC 4BBRK 4A3GK 1HQMA 3HOXK 1WCMC 2JA5K 1SMYA 4QIWD 3S1QK 3RZOK 1I6HC 2R92K 1YNNA 1I3QC 1K83C 1ZYRA 1Y1WK 2R93C 4A3JK 4A3CK 2JA8C 3HKZD 4A3FC 2A68A 4LJZA 3S1MC 4BY7C 3I4NC 5C3EK 1R9TK 3GTMK 3HOZK 4Y52K 2WAQL 3I4MK 4A3KK 1TWAC 3S1RC 4QJVB 5C4JK 3HOYK 5M5YK 4A3DC 1I50C 2PMZL 2NVXK 3S17K 1TWFC 4A93K 1BDFA 3K7AK 4BBRC 4A3EC 4BBSC 3HOXC 4C3JC 5IYDK 1WCMK 2JA5C 4JK1A 3GTGK 3S1QC 2PA8D 4G7ZA 2JA7K 2R92C 4XLPA 4A3CC 2R93K 1TWHC 2JA8K 3S15C 3GTKC 4YG2A 3I4NK 3GTJK 3I4MC 3HKZL 4A3KC 3HOVC 4LK0A 3S2HC 1TWAK 3S1RK 4KN7A 4Y7NC 2E2IK 5C4JC 3HOYC 4XSXA 3CQZK 2B63C 5C44K 3S2DK 3S17C 1I50K 4QIWL 4BXXK 4A93C 4X6AC 2A6HA 1TWFK 4XSZA 1I6VA 4A3EK 4BBSK 3PO2C 5M5WK 5M5XK 5IYDC 4C3JK 2BE5A 2E2HC 3FKIK 4NOIA 3M4OC 3GTGC 2WB1L 2JA7C 2JA6C 3GTPC 2VUMC 1TWHK 3M3YC 4C3HC 3S15K 1IW7A 3GTKK 2O5JA 1YNJA 5D4DA 4AYBD 1TWGK 4C3IC 3GTJC 2Y0SD 4ZH4A 3HOVK 3S2HK 3RZDC 4LK1A 3H0GC 4LLGA 2E2IC 3GTQC 1XPPA 4Y7NK 3H3VD 3CQZC 4QJVA 5C44C 3S2DC 4BXXC 1SFOK 2B63K 2PA8L 4X6AK
chains in the Genus database with same CATH superfamily
3L4KA 3PO3C 3SZYA 3MMLB 5M3MK 2CFAB 4G7HA 4KARA 1Y1VC 4GZYA 4LQYA 3M4OK 5IYBC 3LYWA 2NVYK 3G4CA 2PPBA 4C3HK 2GAHC 3AD8C 3FOFA 2RGRA 4WFNS 4AYBL 4RMFA 2YU9K 1PJ5A 1SFOC 4MQ9A 1YCLA 1O2AA 2NVQC 3S16K 4U67S 1J6WA 1DCHA 2R7ZK 3VA7A 1XZPB 4MEYA 4A3IK 5TMCA 1TWCK 4OIOA 2L3UA 2E2IA 3LPXA 4XLNA 1I6HK 1K83K 4OINA 3S14K 5M3FK 3S1NK 4A3FK 2R7ZA 3GTMC 4Y52C 2A6EA 2EBBA 2GSNA 1EI6A 4G7OA 1YX2A 1FEUA 3K7AC 1EK8A 4A3GK 4KC6A 1HQMA 1F93A 4PABA 1WQHA 2B63A 1EH1A 1PJ6A 3AQOA 1SMYA 2GAGC 2NVYA 3ERED 3RZOK 3S1QK 2R92K 1WORA 4A3CK 3L4JA 2V6UA 4LJZA 1J6XA 1WQGA 1XZQB 3H0GA 3V4GA 3HOYK 5M5YK 1I50C 2NVXK 1O27A 5TJ3A 4A93K 1O2BA 3DLLS 1XXBA 1EQRA 2NVXA 3HOXC 4C3JC 4XCHA 4AH6A 3GTGK 1WIHA 3N3YA 1BS2A 1WOSA 3I4NK 4KASA 3GTLA 3HKZL 3HOVC 4LK0A 1WSRA 4WJ3M 5C4JC 2B63C 3JSTA 3S17C 3T02A 1TWFK 3QX3A 5M5XK 1RU0A 3GTOA 2JA6C 1WQFA 2VUMC 3M3YC 1YNJA 1TWGK 4C3IC 3T01A 3T00A 5IOQA 2Y0SD 2FQTA 4ZH4A 3S2HK 4LK1A 3H0GC 3GTQC 2E2IC 4Y7NK 3H3VD 4QJVA 3S2DC 4BXXC 3GEHA 3FKIA 2PA8L 4X6AK 1UV7A 4PAAA 5FLMK 4G0VA 3HOWK 3PO2K 1WOPA 3FKIC 3GTKA 3EQLA 3GTPK 1BGWA 3AD9C 3BUEA 1SFOA 1INNA 5C4XK 5IP7K 4C2MK 3RZDK 3IPJA 3GTGA 5IP9K 2YU9A 4O2DA 1WOOA 2NVTC 1J6VA 4Q4ZA 2E2JK 2L5NA 4BY1C 5HL7S 4DDQA 1PJ7A 3GTLK 2W7VA 1IS1A 1Y1VA 1VJEA 4GTBA 4KMUA 4KAWX 2ZJQS 5EGEA 2D6FC 2WB1D 4A3LC 3AH5A 2XCQA 1Y1WC 3GTJA 5FJ8K 5E68A 4G0WA 5C3EC 4BY7K 1EFWA 1L0WA 3HOZC 3CQZA 3HOUC 2KWAA 4A3MK 1R9TA 1ZVUA 3GTOK 1O2FB 4A3BK 2FQOA 5IYCK 4IOAS 1HI9A 1WCMC 4GFQA 1O29A 4QIWD 1I3QC 4A3JK 2JA8C 3S1MC 1R9TK 3I4MK 4P9SA 3ADAC 4FM9A 2KPUA 3S1RC 4QJVB 4J3NA 4A3DC 3GTQA 4BBRC 4BBSC 3HXAA 4WFAS 5IYDK 2JA7A 2JA5C 1I50A 4G7ZA 2JA7K 2R93K 1TWHC 3S15C 3GTKC 1TWAA 2R93A 3GTJK 4A3KC 4KMAA 3PIOS 1TWAK 4KN7A 1IL2A 4WFBS 5C44K 3N0BA 1XZPA 4GTEA 4A3EK 1WSVA 2Y3PA 4BKWA 1USMA 3S0XA 3M4OC 1ZXOA 2WB1L 4C3HC 1IW7A 4AYBD 1XPPA 1SFOK 3CQZC 2E2HA 2WAQD 1DCOA 3S16C 2NVQK 2E2HK 1ZQ1C 3G4AA 3PIPS 4KB2A 3A8IA 5IORA 1TWCC 4OIQA 4KN4A 5DM7S 4LR2A 4KM9A 1F9NA 4OIPA 2CW0A 1J98A 3Q3QA 3S1NC 3S14C 2CFAA 4KM8A 4P5AA 1VH2A 3OEPA 4GTAA 2JA6A 1IBAA 5JVGS 2V6SA 3PO3K 1B4BA 1Y1VK 4OIRA 2NVYC 3TTGA 5IYBK 4A3GC 2PMZD 3RZOC 2O5IA 1TWHA 1G51A 2RH6A 1USOA 3BP3A 2KQ1A 2YU9C 3LAPA 2JH3A 2PHCB 4MEXA 1VLOA 1VRQC 2R7ZC 3FOEA 2XCOA 5HL8A 2NVXC 4A3IC 5TMFA 3H3VL 3HOXK 3OREA 5CHPA 3N0CA 1F7UA 1IE0A 1I6HC 1YNNA 1K83C 1ISEA 2ZJRS 3GIRA 3HKZD 4A3FC 2ZFZA 2A68A 1ZBSA 3GTMK 3I4NC 4Y52K 1VGXA 2WAQL 3FHZA 1JQWA 5C4JK 4P5BA 3S17K 1TWFC 1WCMA 2R92A 3K7AK 3GEIA 5DM6S 4LOWA 3GTPA 5HQHA 4BLAA 3S1QC 5IOSA 2R92C 4XLPA 4A3CC 4KB4A 1V5VA 1X31C 4YG2A 3CAGA 3S2HC 4Y7NC 2E2IK 3HOYC 3S2DK 4BXXK 1I50K 4QIWL 4A93C 4X6AC 1K83A 3PO2C 5M5WK 4C3JK 3FKIK 3AD7C 5IOTA 4NOIA 3GTGC 4BLBA 3GTPC 1TWGA 2JA5A 4WCES 2O5JA 1B4AA 5D4DA 4WJ4A 3CF5S 3HOVK 3RZDC 4LLGA 3TFHA 5L46A 2B63K 5JVOA 1XZQA 1XXCA 2ZJPS 4YFKA 1BJTA 2JA6K 3GTLC 2VUMK 5EGHA 4YFXA 3M3YK 1XXAA 1DCPA 1TWGC 4C3IK 2A69A 4A3LK 4GTDA 3H0GK 3GTQK 5JVHS 2Y0SL 3A8KA 3TFIA 5FLMC 3HOWC 3HOUK 3DXJA 4GTCA 2VUMA 4A3MC 2P5MA 3GTOC 4A3BC 3WODA 5IYCC 1F7VA 4GT9A 4M1XA 3AQPA 5IP7C 5C4XC 2KXYA 1I3QK 4C2MC 4A3JC 5IP9C 3S1MK 1R9TC 1JVIA 4Q5SA 1O24A 1TWFA 2NVTK 2E2JC 3GDZA 4YFNA 4A3DK 4BY1K 4BBRK 4KMDA 2ZUFA 1AB4A 2JA5K 3NUHA 2GSOA 1O28A 1ZYRA 1Y1WK 2R93C 4G0UA 5C3EK 4BY7C 3HOZK 3A8JA 4A3KK 1TWAC 2GSUA 1KQ4A 2PMZL 4KMHA 1BDFA 1O25A 4A3EC 1WCMK 4GTFA 3SZZA 2XCRB 3GTMA 1JOEA 4JK1A 3GEEA 1DD5A 2PA8D 4C45A 4WILA 4ILDA 2JA8K 1C0AA 4IO9S 3I4MC 2V6TA 3TFJA 4WF9S 1IQ0A 1TWCA 2P8TA 3S1RK 4XSXA 3CQZK 4FZBA 2A6HA 1I3QA 4XSZA 1I6VA 2ZUEA 4BBSK 5IYDC 5CJ9A 2BE5A 2E2HC 1O26A 3BP8C 2JA7C 3OPFA 3LAJA 4KATA 1TWHK 5JFEA 3S15K 3GTKK 4IOCS 3GTJC 4KDDA 3GSIA 1GE9A 5C44C 4GTLA 1Y1WA
chains in the Genus database with same CATH topology
2WAQD 5FLMK 3S16C 2NVQK 3HOWK 4YFKA 3PO3C 3PO2K 5M3MK 2E2HK 3FKIC 4G7HA 3M4OK 1Y1VC 4GZYA 3EQLA 2JA6K 3GTPK 1TWCC 3GTLC 5IYBC 2NVYK 2VUMK 4OIQA 4YFXA 3M3YK 2PPBA 4C3HK 4KN4A 1TWGC 4C3IK 2A69A 4A3LK 5C4XK 5IP7K 4AYBL 4OIPA 2CW0A 4C2MK 3RZDK 3H0GK 2YU9K 3S1NC 3S14C 2Y0SL 1SFOC 3GTQK 5IP9K 4MQ9A 5FLMC 2NVQC 3HOWC 3HOUK 3DXJA 3S16K 3PO3K 2NVTC 4Q4ZA 2E2JK 2R7ZK 4A3MC 4BY1C 1Y1VK 4MEYA 3GTOC 4A3BC 5TMCA 3WODA 4A3IK 5IYCC 1TWCK 4OIRA 2NVYC 5IYBK 3GTLK 4A3GC 4OIOA 4KMUA 2PMZD 2WB1D 3RZOC 4XLNA 2O5IA 4A3LC 5IP7C 5C4XC 1I6HK 1Y1WC 1I3QK 1K83K 4C2MC 2YU9C 4A3JC 4OINA 3S14K 5FJ8K 5M3FK 4A3FK 4MEXA 3S1NK 5IP9C 3S1MK 5C3EC 4Y52C 1R9TC 3GTMC 4BY7K 3HOZC 4Q5SA 3HOUC 2A6EA 2NVTK 2E2JC 2R7ZC 4YFNA 4A3DK 4A3MK 4BY1K 2NVXC 3GTOK 4A3IC 5TMFA 4G7OA 3H3VL 4A3BK 5IYCK 3K7AC 4BBRK 4A3GK 1HQMA 3HOXK 1WCMC 2JA5K 1SMYA 4QIWD 3S1QK 3RZOK 1I6HC 2R92K 1YNNA 1I3QC 1K83C 1ZYRA 1Y1WK 2R93C 4A3JK 4A3CK 2JA8C 3HKZD 4A3FC 2A68A 4LJZA 3S1MC 4BY7C 3I4NC 5C3EK 1R9TK 3GTMK 3HOZK 4Y52K 2WAQL 3I4MK 4A3KK 1TWAC 3S1RC 4QJVB 5C4JK 3HOYK 5M5YK 4A3DC 1I50C 2PMZL 2NVXK 3S17K 1TWFC 4A93K 1BDFA 3K7AK 4BBRC 4A3EC 4BBSC 3HOXC 4C3JC 5IYDK 1WCMK 2JA5C 4JK1A 3GTGK 3S1QC 2PA8D 4G7ZA 2JA7K 2R92C 4XLPA 4A3CC 2R93K 1TWHC 2JA8K 3S15C 3GTKC 4YG2A 3I4NK 3GTJK 3I4MC 3HKZL 4A3KC 3HOVC 4LK0A 3S2HC 1TWAK 3S1RK 4KN7A 4Y7NC 2E2IK 5C4JC 3HOYC 4XSXA 3CQZK 2B63C 5C44K 3S2DK 3S17C 1I50K 4QIWL 4BXXK 4A93C 4X6AC 2A6HA 1TWFK 4XSZA 1I6VA 4A3EK 4BBSK 3PO2C 5M5WK 5M5XK 5IYDC 4C3JK 2BE5A 2E2HC 3FKIK 4NOIA 3M4OC 3GTGC 2WB1L 2JA7C 2JA6C 3GTPC 2VUMC 1TWHK 3M3YC 4C3HC 3S15K 1IW7A 3GTKK 2O5JA 1YNJA 5D4DA 4AYBD 1TWGK 4C3IC 3GTJC 2Y0SD 4ZH4A 3HOVK 3S2HK 3RZDC 4LK1A 3H0GC 4LLGA 2E2IC 3GTQC 1XPPA 4Y7NK 3H3VD 3CQZC 4QJVA 5C44C 3S2DC 4BXXC 1SFOK 2B63K 2PA8L 4X6AK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WAQ D;  5FLM K;  3S16 C;  2NVQ K;  3HOW K;  4YFK A;  3PO3 C;  3PO2 K;  5M3M K;  2E2H K;  3FKI C;  4G7H A;  3M4O K;  1Y1V C;  4GZY A;  3EQL A;  2JA6 K;  3GTP K;  1TWC C;  3GTL C;  5IYB C;  2NVY K;  2VUM K;  4OIQ A;  4YFX A;  3M3Y K;  2PPB A;  4C3H K;  4KN4 A;  1TWG C;  4C3I K;  2A69 A;  4A3L K;  5C4X K;  5IP7 K;  4AYB L;  4OIP A;  2CW0 A;  4C2M K;  3RZD K;  3H0G K;  2YU9 K;  3S1N C;  3S14 C;  2Y0S L;  1SFO C;  3GTQ K;  5IP9 K;  4MQ9 A;  5FLM C;  2NVQ C;  3HOW C;  3HOU K;  3DXJ A;  3S16 K;  3PO3 K;  2NVT C;  4Q4Z A;  2E2J K;  2R7Z K;  4A3M C;  4BY1 C;  1Y1V K;  4MEY A;  3GTO C;  4A3B C;  5TMC A;  3WOD A;  4A3I K;  5IYC C;  1TWC K;  4OIR A;  2NVY C;  5IYB K;  3GTL K;  4A3G C;  4OIO A;  4KMU A;  2PMZ D;  2WB1 D;  3RZO C;  4XLN A;  2O5I A;  4A3L C;  5IP7 C;  5C4X C;  1I6H K;  1Y1W C;  1I3Q K;  1K83 K;  4C2M C;  2YU9 C;  4A3J C;  4OIN A;  3S14 K;  5FJ8 K;  5M3F K;  4A3F K;  4MEX A;  3S1N K;  5IP9 C;  3S1M K;  5C3E C;  4Y52 C;  1R9T C;  3GTM C;  4BY7 K;  3HOZ C;  4Q5S A;  3HOU C;  2A6E A;  2NVT K;  2E2J C;  2R7Z C;  4YFN A;  4A3D K;  4A3M K;  4BY1 K;  2NVX C;  3GTO K;  4A3I C;  5TMF A;  4G7O A;  3H3V L;  4A3B K;  5IYC K;  3K7A C;  4BBR K;  4A3G K;  1HQM A;  3HOX K;  1WCM C;  2JA5 K;  1SMY A;  4QIW D;  3S1Q K;  3RZO K;  1I6H C;  2R92 K;  1YNN A;  1I3Q C;  1K83 C;  1ZYR A;  1Y1W K;  2R93 C;  4A3J K;  4A3C K;  2JA8 C;  3HKZ D;  4A3F C;  2A68 A;  4LJZ A;  3S1M C;  4BY7 C;  3I4N C;  5C3E K;  1R9T K;  3GTM K;  3HOZ K;  4Y52 K;  2WAQ L;  3I4M K;  4A3K K;  1TWA C;  3S1R C;  4QJV B;  5C4J K;  3HOY K;  5M5Y K;  4A3D C;  1I50 C;  2PMZ L;  2NVX K;  3S17 K;  1TWF C;  4A93 K;  1BDF A;  3K7A K;  4BBR C;  4A3E C;  4BBS C;  3HOX C;  4C3J C;  5IYD K;  1WCM K;  2JA5 C;  4JK1 A;  3GTG K;  3S1Q C;  2PA8 D;  4G7Z A;  2JA7 K;  2R92 C;  4XLP A;  4A3C C;  2R93 K;  1TWH C;  2JA8 K;  3S15 C;  3GTK C;  4YG2 A;  3I4N K;  3GTJ K;  3I4M C;  3HKZ L;  4A3K C;  3HOV C;  4LK0 A;  3S2H C;  1TWA K;  3S1R K;  4KN7 A;  4Y7N C;  2E2I K;  5C4J C;  3HOY C;  4XSX A;  3CQZ K;  2B63 C;  5C44 K;  3S2D K;  3S17 C;  1I50 K;  4QIW L;  4BXX K;  4A93 C;  4X6A C;  2A6H A;  1TWF K;  4XSZ A;  1I6V A;  4A3E K;  4BBS K;  3PO2 C;  5M5W K;  5M5X K;  5IYD C;  4C3J K;  2BE5 A;  2E2H C;  3FKI K;  4NOI A;  3M4O C;  3GTG C;  2WB1 L;  2JA7 C;  2JA6 C;  3GTP C;  2VUM C;  1TWH K;  3M3Y C;  4C3H C;  3S15 K;  1IW7 A;  3GTK K;  2O5J A;  1YNJ A;  5D4D A;  4AYB D;  1TWG K;  4C3I C;  3GTJ C;  2Y0S D;  4ZH4 A;  3HOV K;  3S2H K;  3RZD C;  4LK1 A;  3H0G C;  4LLG A;  2E2I C;  3GTQ C;  1XPP A;  4Y7N K;  3H3V D;  3CQZ C;  4QJV A;  5C44 C;  3S2D C;  4BXX C;  1SFO K;  2B63 K;  2PA8 L;  4X6A K; 
#chains in the Genus database with same CATH topology
 3L4K A;  3PO3 C;  3SZY A;  3MML B;  5M3M K;  2CFA B;  4G7H A;  4KAR A;  1Y1V C;  4GZY A;  4LQY A;  3M4O K;  5IYB C;  3LYW A;  2NVY K;  3G4C A;  2PPB A;  4C3H K;  2GAH C;  3AD8 C;  3FOF A;  2RGR A;  4WFN S;  4AYB L;  4RMF A;  2YU9 K;  1PJ5 A;  1SFO C;  4MQ9 A;  1YCL A;  1O2A A;  2NVQ C;  3S16 K;  4U67 S;  1J6W A;  1DCH A;  2R7Z K;  3VA7 A;  1XZP B;  4MEY A;  4A3I K;  5TMC A;  1TWC K;  4OIO A;  2L3U A;  2E2I A;  3LPX A;  4XLN A;  1I6H K;  1K83 K;  4OIN A;  3S14 K;  5M3F K;  3S1N K;  4A3F K;  2R7Z A;  3GTM C;  4Y52 C;  2A6E A;  2EBB A;  2GSN A;  1EI6 A;  4G7O A;  1YX2 A;  1FEU A;  3K7A C;  1EK8 A;  4A3G K;  4KC6 A;  1HQM A;  1F93 A;  4PAB A;  1WQH A;  2B63 A;  1EH1 A;  1PJ6 A;  3AQO A;  1SMY A;  2GAG C;  2NVY A;  3ERE D;  3RZO K;  3S1Q K;  2R92 K;  1WOR A;  4A3C K;  3L4J A;  2V6U A;  4LJZ A;  1J6X A;  1WQG A;  1XZQ B;  3H0G A;  3V4G A;  3HOY K;  5M5Y K;  1I50 C;  2NVX K;  1O27 A;  5TJ3 A;  4A93 K;  1O2B A;  3DLL S;  1XXB A;  1EQR A;  2NVX A;  3HOX C;  4C3J C;  4XCH A;  4AH6 A;  3GTG K;  1WIH A;  3N3Y A;  1BS2 A;  1WOS A;  3I4N K;  4KAS A;  3GTL A;  3HKZ L;  3HOV C;  4LK0 A;  1WSR A;  4WJ3 M;  5C4J C;  2B63 C;  3JST A;  3S17 C;  3T02 A;  1TWF K;  3QX3 A;  5M5X K;  1RU0 A;  3GTO A;  2JA6 C;  1WQF A;  2VUM C;  3M3Y C;  1YNJ A;  1TWG K;  4C3I C;  3T01 A;  3T00 A;  5IOQ A;  2Y0S D;  2FQT A;  4ZH4 A;  3S2H K;  4LK1 A;  3H0G C;  3GTQ C;  2E2I C;  4Y7N K;  3H3V D;  4QJV A;  3S2D C;  4BXX C;  3GEH A;  3FKI A;  2PA8 L;  4X6A K;  1UV7 A;  4PAA A;  5FLM K;  4G0V A;  3HOW K;  3PO2 K;  1WOP A;  3FKI C;  3GTK A;  3EQL A;  3GTP K;  1BGW A;  3AD9 C;  3BUE A;  1SFO A;  1INN A;  5C4X K;  5IP7 K;  4C2M K;  3RZD K;  3IPJ A;  3GTG A;  5IP9 K;  2YU9 A;  4O2D A;  1WOO A;  2NVT C;  1J6V A;  4Q4Z A;  2E2J K;  2L5N A;  4BY1 C;  5HL7 S;  4DDQ A;  1PJ7 A;  3GTL K;  2W7V A;  1IS1 A;  1Y1V A;  1VJE A;  4GTB A;  4KMU A;  4KAW X;  2ZJQ S;  5EGE A;  2D6F C;  2WB1 D;  4A3L C;  3AH5 A;  2XCQ A;  1Y1W C;  3GTJ A;  5FJ8 K;  5E68 A;  4G0W A;  5C3E C;  4BY7 K;  1EFW A;  1L0W A;  3HOZ C;  3CQZ A;  3HOU C;  2KWA A;  4A3M K;  1R9T A;  1ZVU A;  3GTO K;  1O2F B;  4A3B K;  2FQO A;  5IYC K;  4IOA S;  1HI9 A;  1WCM C;  4GFQ A;  1O29 A;  4QIW D;  1I3Q C;  4A3J K;  2JA8 C;  3S1M C;  1R9T K;  3I4M K;  4P9S A;  3ADA C;  4FM9 A;  2KPU A;  3S1R C;  4QJV B;  4J3N A;  4A3D C;  3GTQ A;  4BBR C;  4BBS C;  3HXA A;  4WFA S;  5IYD K;  2JA7 A;  2JA5 C;  1I50 A;  4G7Z A;  2JA7 K;  2R93 K;  1TWH C;  3S15 C;  3GTK C;  1TWA A;  2R93 A;  3GTJ K;  4A3K C;  4KMA A;  3PIO S;  1TWA K;  4KN7 A;  1IL2 A;  4WFB S;  5C44 K;  3N0B A;  1XZP A;  4GTE A;  4A3E K;  1WSV A;  2Y3P A;  4BKW A;  1USM A;  3S0X A;  3M4O C;  1ZXO A;  2WB1 L;  4C3H C;  1IW7 A;  4AYB D;  1XPP A;  1SFO K;  3CQZ C;  2E2H A;  2WAQ D;  1DCO A;  3S16 C;  2NVQ K;  2E2H K;  1ZQ1 C;  3G4A A;  3PIP S;  4KB2 A;  3A8I A;  5IOR A;  1TWC C;  4OIQ A;  4KN4 A;  5DM7 S;  4LR2 A;  4KM9 A;  1F9N A;  4OIP A;  2CW0 A;  1J98 A;  3Q3Q A;  3S1N C;  3S14 C;  2CFA A;  4KM8 A;  4P5A A;  1VH2 A;  3OEP A;  4GTA A;  2JA6 A;  1IBA A;  5JVG S;  2V6S A;  3PO3 K;  1B4B A;  1Y1V K;  4OIR A;  2NVY C;  3TTG A;  5IYB K;  4A3G C;  2PMZ D;  3RZO C;  2O5I A;  1TWH A;  1G51 A;  2RH6 A;  1USO A;  3BP3 A;  2KQ1 A;  2YU9 C;  3LAP A;  2JH3 A;  2PHC B;  4MEX A;  1VLO A;  1VRQ C;  2R7Z C;  3FOE A;  2XCO A;  5HL8 A;  2NVX C;  4A3I C;  5TMF A;  3H3V L;  3HOX K;  3ORE A;  5CHP A;  3N0C A;  1F7U A;  1IE0 A;  1I6H C;  1YNN A;  1K83 C;  1ISE A;  2ZJR S;  3GIR A;  3HKZ D;  4A3F C;  2ZFZ A;  2A68 A;  1ZBS A;  3GTM K;  3I4N C;  4Y52 K;  1VGX A;  2WAQ L;  3FHZ A;  1JQW A;  5C4J K;  4P5B A;  3S17 K;  1TWF C;  1WCM A;  2R92 A;  3K7A K;  3GEI A;  5DM6 S;  4LOW A;  3GTP A;  5HQH A;  4BLA A;  3S1Q C;  5IOS A;  2R92 C;  4XLP A;  4A3C C;  4KB4 A;  1V5V A;  1X31 C;  4YG2 A;  3CAG A;  3S2H C;  4Y7N C;  2E2I K;  3HOY C;  3S2D K;  4BXX K;  1I50 K;  4QIW L;  4A93 C;  4X6A C;  1K83 A;  3PO2 C;  5M5W K;  4C3J K;  3FKI K;  3AD7 C;  5IOT A;  4NOI A;  3GTG C;  4BLB A;  3GTP C;  1TWG A;  2JA5 A;  4WCE S;  2O5J A;  1B4A A;  5D4D A;  4WJ4 A;  3CF5 S;  3HOV K;  3RZD C;  4LLG A;  3TFH A;  5L46 A;  2B63 K;  5JVO A;  1XZQ A;  1XXC A;  2ZJP S;  4YFK A;  1BJT A;  2JA6 K;  3GTL C;  2VUM K;  5EGH A;  4YFX A;  3M3Y K;  1XXA A;  1DCP A;  1TWG C;  4C3I K;  2A69 A;  4A3L K;  4GTD A;  3H0G K;  3GTQ K;  5JVH S;  2Y0S L;  3A8K A;  3TFI A;  5FLM C;  3HOW C;  3HOU K;  3DXJ A;  4GTC A;  2VUM A;  4A3M C;  2P5M A;  3GTO C;  4A3B C;  3WOD A;  5IYC C;  1F7V A;  4GT9 A;  4M1X A;  3AQP A;  5IP7 C;  5C4X C;  2KXY A;  1I3Q K;  4C2M C;  4A3J C;  5IP9 C;  3S1M K;  1R9T C;  1JVI A;  4Q5S A;  1O24 A;  1TWF A;  2NVT K;  2E2J C;  3GDZ A;  4YFN A;  4A3D K;  4BY1 K;  4BBR K;  4KMD A;  2ZUF A;  1AB4 A;  2JA5 K;  3NUH A;  2GSO A;  1O28 A;  1ZYR A;  1Y1W K;  2R93 C;  4G0U A;  5C3E K;  4BY7 C;  3HOZ K;  3A8J A;  4A3K K;  1TWA C;  2GSU A;  1KQ4 A;  2PMZ L;  4KMH A;  1BDF A;  1O25 A;  4A3E C;  1WCM K;  4GTF A;  3SZZ A;  2XCR B;  3GTM A;  1JOE A;  4JK1 A;  3GEE A;  1DD5 A;  2PA8 D;  4C45 A;  4WIL A;  4ILD A;  2JA8 K;  1C0A A;  4IO9 S;  3I4M C;  2V6T A;  3TFJ A;  4WF9 S;  1IQ0 A;  1TWC A;  2P8T A;  3S1R K;  4XSX A;  3CQZ K;  4FZB A;  2A6H A;  1I3Q A;  4XSZ A;  1I6V A;  2ZUE A;  4BBS K;  5IYD C;  5CJ9 A;  2BE5 A;  2E2H C;  1O26 A;  3BP8 C;  2JA7 C;  3OPF A;  3LAJ A;  4KAT A;  1TWH K;  5JFE A;  3S15 K;  3GTK K;  4IOC S;  3GTJ C;  4KDD A;  3GSI A;  1GE9 A;  5C44 C;  4GTL A;  1Y1W A; 
#chains in the Genus database with same CATH homology
 2WAQ D;  5FLM K;  3S16 C;  2NVQ K;  3HOW K;  4YFK A;  3PO3 C;  3PO2 K;  5M3M K;  2E2H K;  3FKI C;  4G7H A;  3M4O K;  1Y1V C;  4GZY A;  3EQL A;  2JA6 K;  3GTP K;  1TWC C;  3GTL C;  5IYB C;  2NVY K;  2VUM K;  4OIQ A;  4YFX A;  3M3Y K;  2PPB A;  4C3H K;  4KN4 A;  1TWG C;  4C3I K;  2A69 A;  4A3L K;  5C4X K;  5IP7 K;  4AYB L;  4OIP A;  2CW0 A;  4C2M K;  3RZD K;  3H0G K;  2YU9 K;  3S1N C;  3S14 C;  2Y0S L;  1SFO C;  3GTQ K;  5IP9 K;  4MQ9 A;  5FLM C;  2NVQ C;  3HOW C;  3HOU K;  3DXJ A;  3S16 K;  3PO3 K;  2NVT C;  4Q4Z A;  2E2J K;  2R7Z K;  4A3M C;  4BY1 C;  1Y1V K;  4MEY A;  3GTO C;  4A3B C;  5TMC A;  3WOD A;  4A3I K;  5IYC C;  1TWC K;  4OIR A;  2NVY C;  5IYB K;  3GTL K;  4A3G C;  4OIO A;  4KMU A;  2PMZ D;  2WB1 D;  3RZO C;  4XLN A;  2O5I A;  4A3L C;  5IP7 C;  5C4X C;  1I6H K;  1Y1W C;  1I3Q K;  1K83 K;  4C2M C;  2YU9 C;  4A3J C;  4OIN A;  3S14 K;  5FJ8 K;  5M3F K;  4A3F K;  4MEX A;  3S1N K;  5IP9 C;  3S1M K;  5C3E C;  4Y52 C;  1R9T C;  3GTM C;  4BY7 K;  3HOZ C;  4Q5S A;  3HOU C;  2A6E A;  2NVT K;  2E2J C;  2R7Z C;  4YFN A;  4A3D K;  4A3M K;  4BY1 K;  2NVX C;  3GTO K;  4A3I C;  5TMF A;  4G7O A;  3H3V L;  4A3B K;  5IYC K;  3K7A C;  4BBR K;  4A3G K;  1HQM A;  3HOX K;  1WCM C;  2JA5 K;  1SMY A;  4QIW D;  3S1Q K;  3RZO K;  1I6H C;  2R92 K;  1YNN A;  1I3Q C;  1K83 C;  1ZYR A;  1Y1W K;  2R93 C;  4A3J K;  4A3C K;  2JA8 C;  3HKZ D;  4A3F C;  2A68 A;  4LJZ A;  3S1M C;  4BY7 C;  3I4N C;  5C3E K;  1R9T K;  3GTM K;  3HOZ K;  4Y52 K;  2WAQ L;  3I4M K;  4A3K K;  1TWA C;  3S1R C;  4QJV B;  5C4J K;  3HOY K;  5M5Y K;  4A3D C;  1I50 C;  2PMZ L;  2NVX K;  3S17 K;  1TWF C;  4A93 K;  1BDF A;  3K7A K;  4BBR C;  4A3E C;  4BBS C;  3HOX C;  4C3J C;  5IYD K;  1WCM K;  2JA5 C;  4JK1 A;  3GTG K;  3S1Q C;  2PA8 D;  4G7Z A;  2JA7 K;  2R92 C;  4XLP A;  4A3C C;  2R93 K;  1TWH C;  2JA8 K;  3S15 C;  3GTK C;  4YG2 A;  3I4N K;  3GTJ K;  3I4M C;  3HKZ L;  4A3K C;  3HOV C;  4LK0 A;  3S2H C;  1TWA K;  3S1R K;  4KN7 A;  4Y7N C;  2E2I K;  5C4J C;  3HOY C;  4XSX A;  3CQZ K;  2B63 C;  5C44 K;  3S2D K;  3S17 C;  1I50 K;  4QIW L;  4BXX K;  4A93 C;  4X6A C;  2A6H A;  1TWF K;  4XSZ A;  1I6V A;  4A3E K;  4BBS K;  3PO2 C;  5M5W K;  5M5X K;  5IYD C;  4C3J K;  2BE5 A;  2E2H C;  3FKI K;  4NOI A;  3M4O C;  3GTG C;  2WB1 L;  2JA7 C;  2JA6 C;  3GTP C;  2VUM C;  1TWH K;  3M3Y C;  4C3H C;  3S15 K;  1IW7 A;  3GTK K;  2O5J A;  1YNJ A;  5D4D A;  4AYB D;  1TWG K;  4C3I C;  3GTJ C;  2Y0S D;  4ZH4 A;  3HOV K;  3S2H K;  3RZD C;  4LK1 A;  3H0G C;  4LLG A;  2E2I C;  3GTQ C;  1XPP A;  4Y7N K;  3H3V D;  3CQZ C;  4QJV A;  5C44 C;  3S2D C;  4BXX C;  1SFO K;  2B63 K;  2PA8 L;  4X6A K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...