4OIOA

Crystal structure of thermus thermophilus pre-insertion substrate complex for de novo transcription initiation
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
226
structure length
226
Chain Sequence
SKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title GE23077 binds to the RNA polymerase 'i' and 'i+1' sites and prevents the binding of initiating nucleotides.
pubmed rcsb
source organism Thermus thermophilus
molecule tags Transcription, transferase
molecule keywords DNA-directed RNA polymerase subunit alpha
total genus 50
structure length 226
sequence length 226
chains with identical sequence B
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2014-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01000 RNA_pol_A_bac RNA polymerase Rpb3/RpoA insert domain
A PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain
A PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.12 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 DNA-directed RNA polymerase, insert domain 4oioA02
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 4oioA01
4BBSK 3PO2K 4A3GK 2A69A 1HQMA 4A3FK 2NVQC 3S15C 4Q5SA 4MEXA 3H3VL 4QIWD 3HKZL 3GTQK 4A3CK 4A3MK 3I4NK 3S2HC 5M5XK 3HOXC 4BXXC 3S1RC 4A3DC 4G7OA 3S1MK 3FKIC 4X6AC 1I50K 3GTPK 1TWHK 3RZOK 3RZDC 4G7HA 5M5YK 2A68A 4MQ9A 2E2HK 1ZYRA 2R92C 4BBRK 2R93C 3GTKK 3HOVK 5IYBC 4XSXA 3I4MC 3HOWC 3S17C 3GTGK 3HOZK 4A3IK 4A3IC 4C3HK 2R7ZK 3HOWK 2WB1L 2E2JC 5C4JK 2PA8D 4XLPA 1TWCK 1I3QC 5FLMC 4OINA 3M3YC 1XPPA 5FJ8K 4A3EK 2JA6K 1I50C 3H3VD 3FKIK 2E2IC 4A93K 4KN4A 5TMFA 2E2IK 4YFXA 4A3JK 4QJVB 5IYDK 5IP7C 4JK1A 1TWGC 3S1QC 2NVTK 1WCMC 4AYBL 4Y7NK 1TWCC 3GTLC 4QIWL 1YNJA 2E2JK 4A3GC 2VUMK 4YFNA 4C3HC 2R7ZC 4BBSC 2A6HA 3H0GK 3GTOK 4LK0A 3H0GC 5D4DA 5C4XK 5C44K 4BBRC 2R92K 1SFOC 4KMUA 1Y1WK 4MEYA 3GTLK 1K83C 2NVTC 3S1QK 4LLGA 4A3LK 1TWGK 3S1NK 5IYDC 3S1MC 4A3JC 4A3KC 3S1RK 4C3IC 4G7ZA 2B63C 4C3IK 2B63K 3HOXK 2PMZD 4BXXK 4A3DK 5IYCK 2Y0SL 3S1NC 4ZH4A 4A3EC 2JA6C 3I4NC 4GZYA 4OIQA 4BY7K 1SMYA 3M3YK 3S14K 2Y0SD 5FLMK 2NVQK 1Y1WC 2JA5C 1SFOK 3WODA 5C4XC 4Q4ZA 3PO2C 5C4JC 2O5IA 4XLNA 4C3JC 2CW0A 2JA7C 4OIOA 3GTOC 3GTGC 3HOZC 2VUMC 3HOYC 4AYBD 3CQZK 3GTKC 3HOVC 5M3FK 4Y52C 2NVXK 1I6HC 4BY1K 3S16K 3S2DK 3PO3K 4Y7NC 1WCMK 3HOUC 3RZDK 4KN7A 1TWAK 5IP7K 4C2MK 2NVYC 4LK1A 1TWFC 5C3EC 5TMCA 2JA8C 4A93C 2PPBA 2YU9K 1TWFK 5C3EK 3DXJA 4A3MC 4OIRA 4C2MC 2PA8L 3GTQC 3K7AC 1R9TC 4A3CC 1I3QK 3GTJK 4NOIA 3GTMK 3EQLA 1TWAC 3S15K 5M3MK 3HOUK 3PO3C 3I4MK 3S17K 5IYBK 4Y52K 5IP9C 3S14C 2O5JA 2BE5A 3CQZC 4YG2A 2R93K 2JA7K 2E2HC 4C3JK 4A3BC 2WB1D 3HOYK 1TWHC 3RZOC 3GTJC 3GTPC 2JA5K 4X6AK 3K7AK 1R9TK 1Y1VC 4QJVA 3M4OK 4OIPA 4BY7C 2A6EA 1YNNA 2YU9C 2JA8K 1BDFA 4XSZA 4LJZA 1IW7A 5IYCC 3S2HK 2NVYK 3M4OC 1Y1VK 2PMZL 4A3KK 4A3FC 4A3LC 4YFKA 1K83K 4A3BK 5M5WK 3S16C 1I6VA 2WAQD 2WAQL 4BY1C 1I6HK 2NVXC 3GTMC 5C44C 3S2DC 3HKZD 5IP9K
chains in the Genus database with same CATH superfamily
1XXCA 1FEUA 4P9SA 1WOSA 3S2HC 4GTDA 1V5VA 1DD5A 3S1RC 4A3DC 1I50K 1O28A 1TWHK 3GTMA 4M1XA 2E2HK 1IL2A 1ZYRA 4BBRK 1GE9A 4A3IK 3SZZA 3HOWK 1Y1WA 1XPPA 3H3VD 1XXBA 3FKIK 3GTPA 2E2IK 3TTGA 3GTOA 3AQPA 3S1QC 2NVTK 1TWCC 3GTLC 4QIWL 2E2JK 4YFNA 4BBSC 2ZJPS 4J3NA 1JVIA 4BBRC 1HI9A 4MEYA 3GTLK 4P5AA 4A3LK 3FKIA 2NVYA 5IYDC 2D6FC 4A3JC 4KM9A 1EK8A 2B63K 3S1NC 5IOTA 1O27A 2Y0SD 4G0VA 5C4XC 1PJ6A 4Q4ZA 3LAJA 2JA7C 4OIOA 3HOYC 2VUMC 3CQZK 4AYBD 2NVXK 3HOVC 3N0BA 4Y52C 1IE0A 2R93A 1F93A 5DM7S 3L4KA 4KN7A 1TWAK 5IP7K 4G0WA 1C0AA 1F9NA 3GEEA 1O29A 5C3EC 5HQHA 2XCOA 3ADAC 1TWFK 4A3MC 1J6WA 3GTQC 4PAAA 3S15K 1G51A 5CHPA 3DLLS 1JOEA 4LOWA 3I4MK 3S17K 5IP9C 2O5JA 1VH2A 2R93K 4C3JK 4A3BC 1WQHA 3GTJC 2V6UA 1Y1VC 3AD8C 3M4OK 2A6EA 2EBBA 2FQTA 4XSZA 3AQOA 3S2HK 3GSIA 4FM9A 4A3FC 3GTJA 5M5WK 2XCQA 3HOYK 1IQ0A 4LQYA 2A69A 1HQMA 4KMDA 1WOPA 4A3CK 4A3MK 3I4NK 2CFAB 3TFHA 1Y1VA 1SFOA 4BXXC 3MMLB 5E68A 3OEPA 3S1MK 5JFEA 3RZOK 1IS1A 5HL7S 2A68A 4IOCS 4KB4A 3AD7C 4WJ4A 1DCHA 2KQ1A 2L3UA 3GTKK 1I3QA 2JA6A 3I4MC 3HOWC 3S17C 4KAWX 3AD9C 3GTGK 3HOZK 5C4JK 1J6VA 2PA8D 4XLPA 1TWCK 5FLMC 4OINA 1O2BA 4KB2A 5FJ8K 4BLBA 4A3EK 1I50C 1TWGA 2E2IC 4KN4A 1ZBSA 4YFXA 2RGRA 2ZUFA 1VGXA 2GAHC 2VUMK 3H0GK 4C3HC 2R7ZC 3GTOK 2E2IA 3HXAA 3H0GC 1TWCA 4WJ3M 3NUHA 2NVTC 3S1QK 4LLGA 1TWGK 4KASA 3S1MC 4KM8A 4A3KC 4KATA 4C3IC 1BJTA 4P5BA 4BXXK 4C45A 2R92A 1BGWA 2L5NA 2Y0SL 4A3EC 3I4NC 1DCPA 4OIQA 4BY7K 1VRQC 5DM6S 1Y1WC 3PO2C 4XLNA 4C3JC 3GTGC 3HOZC 4BY1K 1O25A 3S16K 4Y7NC 1WCMK 1YX2A 2B63A 4LK1A 1TWFC 4U67S 5TMCA 3V4GA 2PPBA 4FZBA 3LYWA 2V6SA 5IOSA 4OIRA 4C2MC 2PA8L 1I3QK 4NOIA 1WIHA 1TWAC 5M3MK 3HOUK 3BUEA 5IYBK 3S14C 2BE5A 3CQZC 3T02A 1WSVA 4KC6A 4GTLA 2GSNA 1F7UA 1INNA 4OIPA 1WORA 1PJ7A 2KXYA 4LJZA 1IW7A 4BLAA 4RMFA 4A3KK 5JVOA 3L4JA 1XZQB 2XCRB 1K83K 4A3BK 3S2DC 3GTMK 1VJEA 5IP9K 3ERED 4BBSK 3PO2K 4G0UA 4A3FK 1F7VA 2NVQC 3S15C 2FQOA 4Q5SA 4MEXA 2P5MA 4QIWD 1TWHA 5EGHA 1DCOA 3TFJA 1R9TA 3A8IA 4GTBA 5M5XK 3HOXC 4WF9S 4G7OA 5JVHS 2KPUA 3GTQA 4G7HA 2JA5A 4MQ9A 2YU9A 3HOVK 1EI6A 5IYBC 3A8KA 4ILDA 4A3IC 4C3HK 3LAPA 2R7ZK 2WB1L 1L0WA 4O2DA 3FOFA 1I3QC 1O2FB 4WFBS 2PHCB 5TMFA 1B4AA 5IP7C 4JK1A 1TWGC 4XCHA 1I50A 1WCMC 4AYBL 4Y7NK 2ZFZA 1YNJA 1JQWA 4BKWA 3N0CA 5D4DA 5C44K 4KMUA 1Y1WK 3SZYA 3QX3A 3S1NK 3A8JA 2GSUA 2B63C 4G7ZA 4GFQA 3S1RK 4A3DK 3HOXK 4GZYA 1SMYA 3M3YK 1EQRA 5FLMK 2NVQK 2JA5C 1KQ4A 2ZJQS 3WODA 5C4JC 1TWAA 3VA7A 2CW0A 3GTOC 5M3FK 3CAGA 3FHZA 4WFAS 1I6HC 3PO3K 3HOUC 2JA7A 2GAGC 1J6XA 1O26A 3GEIA 2JA8C 3DXJA 1BS2A 4A3CC 3GTJK 3EQLA 1ISEA 1TWFA 4YG2A 3JSTA 4IOAS 2NVXA 1TWHC 2ZJRS 4GTAA 1O24A 3K7AK 1R9TK 4QJVA 4BY7C 1YNNA 2YU9C 3OPFA 3G4CA 3CQZA 5HL8A 2NVYK 3M4OC 1Y1VK 4GT9A 2PMZL 4KMAA 4YFKA 3S16C 2WAQD 2NVXC 3HKZD 3S14K 1XZQA 1USMA 4A3GK 3LPXA 4AH6A 1PJ5A 3H3VL 3HKZL 3GTQK 4LR2A 3H0GA 1J98A 1WSRA 3N3YA 3GEHA 3FKIC 4X6AC 3GTPK 3T00A 3RZDC 4IO9S 5M5YK 1XXAA 2R92C 2R93C 4GTEA 4XSXA 5EGEA 3BP8C 1EFWA 4PABA 2E2JC 4WILA 3GTLA 3M3YC 3GTGA 1K83A 2KWAA 2JA6K 4WFNS 4A93K 3TFIA 1O2AA 4KDDA 4A3JK 4QJVB 5IYDK 5TJ3A 1USOA 2GSOA 3T01A 1ZQ1C 4GTFA 4A3GC 2A6HA 3CF5S 4LK0A 5C4XK 2R92K 1SFOC 1WQFA 1K83C 1ZXOA 2W7VA 1X31C 3AH5A 3PIOS 2V6TA 4C3IK 2PMZD 5IYCK 1VLOA 4KMHA 4ZH4A 2JA6C 4KARA 3OREA 2VUMA 1SFOK 1XZPB 2O5IA 1WOOA 5IORA 3IPJA 2Y3PA 3Q3QA 3GTKC 3S2DK 1UV7A 4GTCA 1EH1A 5CJ9A 3RZDK 2R7ZA 2RH6A 4WCES 4C2MK 2NVYC 4A93C 1YCLA 2YU9K 5C3EK 2CFAA 3GDZA 3GIRA 3K7AC 1R9TC 2JH3A 2ZUEA 3G4AA 3FOEA 5IOQA 5L46A 3PO3C 4Y52K 1WCMA 1AB4A 2E2HC 2JA7K 1IBAA 2WB1D 3PIPS 3BP3A 3RZOC 3GTPC 2JA5K 4X6AK 4DDQA 1WQGA 1B4BA 1RU0A 3S0XA 2JA8K 1BDFA 5IYCC 4A3LC 5JVGS 2P8TA 1I6HK 1I6VA 2WAQL 4BY1C 1ZVUA 3GTMC 5C44C 2E2HA 3GTKA 1XZPA
chains in the Genus database with same CATH topology
4BBSK 3PO2K 4A3GK 2A69A 1HQMA 4A3FK 2NVQC 3S15C 4Q5SA 4MEXA 3H3VL 4QIWD 3HKZL 3GTQK 4A3CK 4A3MK 3I4NK 3S2HC 5M5XK 3HOXC 4BXXC 3S1RC 4A3DC 4G7OA 3S1MK 3FKIC 4X6AC 1I50K 3GTPK 1TWHK 3RZOK 3RZDC 4G7HA 5M5YK 2A68A 4MQ9A 2E2HK 1ZYRA 2R92C 4BBRK 2R93C 3GTKK 3HOVK 5IYBC 4XSXA 3I4MC 3HOWC 3S17C 3GTGK 3HOZK 4A3IK 4A3IC 4C3HK 2R7ZK 3HOWK 2WB1L 2E2JC 5C4JK 2PA8D 4XLPA 1TWCK 1I3QC 5FLMC 4OINA 3M3YC 1XPPA 5FJ8K 4A3EK 2JA6K 1I50C 3H3VD 3FKIK 2E2IC 4A93K 4KN4A 5TMFA 2E2IK 4YFXA 4A3JK 4QJVB 5IYDK 5IP7C 4JK1A 1TWGC 3S1QC 2NVTK 1WCMC 4AYBL 4Y7NK 1TWCC 3GTLC 4QIWL 1YNJA 2E2JK 4A3GC 2VUMK 4YFNA 4C3HC 2R7ZC 4BBSC 2A6HA 3H0GK 3GTOK 4LK0A 3H0GC 5D4DA 5C4XK 5C44K 4BBRC 2R92K 1SFOC 4KMUA 1Y1WK 4MEYA 3GTLK 1K83C 2NVTC 3S1QK 4LLGA 4A3LK 1TWGK 3S1NK 5IYDC 3S1MC 4A3JC 4A3KC 3S1RK 4C3IC 4G7ZA 2B63C 4C3IK 2B63K 3HOXK 2PMZD 4BXXK 4A3DK 5IYCK 2Y0SL 3S1NC 4ZH4A 4A3EC 2JA6C 3I4NC 4GZYA 4OIQA 4BY7K 1SMYA 3M3YK 3S14K 2Y0SD 5FLMK 2NVQK 1Y1WC 2JA5C 1SFOK 3WODA 5C4XC 4Q4ZA 3PO2C 5C4JC 2O5IA 4XLNA 4C3JC 2CW0A 2JA7C 4OIOA 3GTOC 3GTGC 3HOZC 2VUMC 3HOYC 4AYBD 3CQZK 3GTKC 3HOVC 5M3FK 4Y52C 2NVXK 1I6HC 4BY1K 3S16K 3S2DK 3PO3K 4Y7NC 1WCMK 3HOUC 3RZDK 4KN7A 1TWAK 5IP7K 4C2MK 2NVYC 4LK1A 1TWFC 5C3EC 5TMCA 2JA8C 4A93C 2PPBA 2YU9K 1TWFK 5C3EK 3DXJA 4A3MC 4OIRA 4C2MC 2PA8L 3GTQC 3K7AC 1R9TC 4A3CC 1I3QK 3GTJK 4NOIA 3GTMK 3EQLA 1TWAC 3S15K 5M3MK 3HOUK 3PO3C 3I4MK 3S17K 5IYBK 4Y52K 5IP9C 3S14C 2O5JA 2BE5A 3CQZC 4YG2A 2R93K 2JA7K 2E2HC 4C3JK 4A3BC 2WB1D 3HOYK 1TWHC 3RZOC 3GTJC 3GTPC 2JA5K 4X6AK 3K7AK 1R9TK 1Y1VC 4QJVA 3M4OK 4OIPA 4BY7C 2A6EA 1YNNA 2YU9C 2JA8K 1BDFA 4XSZA 4LJZA 1IW7A 5IYCC 3S2HK 2NVYK 3M4OC 1Y1VK 2PMZL 4A3KK 4A3FC 4A3LC 4YFKA 1K83K 4A3BK 5M5WK 3S16C 1I6VA 2WAQD 2WAQL 4BY1C 1I6HK 2NVXC 3GTMC 5C44C 3S2DC 3HKZD 5IP9K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BBS K;  3PO2 K;  4A3G K;  2A69 A;  1HQM A;  4A3F K;  2NVQ C;  3S15 C;  4Q5S A;  4MEX A;  3H3V L;  4QIW D;  3HKZ L;  3GTQ K;  4A3C K;  4A3M K;  3I4N K;  3S2H C;  5M5X K;  3HOX C;  4BXX C;  3S1R C;  4A3D C;  4G7O A;  3S1M K;  3FKI C;  4X6A C;  1I50 K;  3GTP K;  1TWH K;  3RZO K;  3RZD C;  4G7H A;  5M5Y K;  2A68 A;  4MQ9 A;  2E2H K;  1ZYR A;  2R92 C;  4BBR K;  2R93 C;  3GTK K;  3HOV K;  5IYB C;  4XSX A;  3I4M C;  3HOW C;  3S17 C;  3GTG K;  3HOZ K;  4A3I K;  4A3I C;  4C3H K;  2R7Z K;  3HOW K;  2WB1 L;  2E2J C;  5C4J K;  2PA8 D;  4XLP A;  1TWC K;  1I3Q C;  5FLM C;  4OIN A;  3M3Y C;  1XPP A;  5FJ8 K;  4A3E K;  2JA6 K;  1I50 C;  3H3V D;  3FKI K;  2E2I C;  4A93 K;  4KN4 A;  5TMF A;  2E2I K;  4YFX A;  4A3J K;  4QJV B;  5IYD K;  5IP7 C;  4JK1 A;  1TWG C;  3S1Q C;  2NVT K;  1WCM C;  4AYB L;  4Y7N K;  1TWC C;  3GTL C;  4QIW L;  1YNJ A;  2E2J K;  4A3G C;  2VUM K;  4YFN A;  4C3H C;  2R7Z C;  4BBS C;  2A6H A;  3H0G K;  3GTO K;  4LK0 A;  3H0G C;  5D4D A;  5C4X K;  5C44 K;  4BBR C;  2R92 K;  1SFO C;  4KMU A;  1Y1W K;  4MEY A;  3GTL K;  1K83 C;  2NVT C;  3S1Q K;  4LLG A;  4A3L K;  1TWG K;  3S1N K;  5IYD C;  3S1M C;  4A3J C;  4A3K C;  3S1R K;  4C3I C;  4G7Z A;  2B63 C;  4C3I K;  2B63 K;  3HOX K;  2PMZ D;  4BXX K;  4A3D K;  5IYC K;  2Y0S L;  3S1N C;  4ZH4 A;  4A3E C;  2JA6 C;  3I4N C;  4GZY A;  4OIQ A;  4BY7 K;  1SMY A;  3M3Y K;  3S14 K;  2Y0S D;  5FLM K;  2NVQ K;  1Y1W C;  2JA5 C;  1SFO K;  3WOD A;  5C4X C;  4Q4Z A;  3PO2 C;  5C4J C;  2O5I A;  4XLN A;  4C3J C;  2CW0 A;  2JA7 C;  4OIO A;  3GTO C;  3GTG C;  3HOZ C;  2VUM C;  3HOY C;  4AYB D;  3CQZ K;  3GTK C;  3HOV C;  5M3F K;  4Y52 C;  2NVX K;  1I6H C;  4BY1 K;  3S16 K;  3S2D K;  3PO3 K;  4Y7N C;  1WCM K;  3HOU C;  3RZD K;  4KN7 A;  1TWA K;  5IP7 K;  4C2M K;  2NVY C;  4LK1 A;  1TWF C;  5C3E C;  5TMC A;  2JA8 C;  4A93 C;  2PPB A;  2YU9 K;  1TWF K;  5C3E K;  3DXJ A;  4A3M C;  4OIR A;  4C2M C;  2PA8 L;  3GTQ C;  3K7A C;  1R9T C;  4A3C C;  1I3Q K;  3GTJ K;  4NOI A;  3GTM K;  3EQL A;  1TWA C;  3S15 K;  5M3M K;  3HOU K;  3PO3 C;  3I4M K;  3S17 K;  5IYB K;  4Y52 K;  5IP9 C;  3S14 C;  2O5J A;  2BE5 A;  3CQZ C;  4YG2 A;  2R93 K;  2JA7 K;  2E2H C;  4C3J K;  4A3B C;  2WB1 D;  3HOY K;  1TWH C;  3RZO C;  3GTJ C;  3GTP C;  2JA5 K;  4X6A K;  3K7A K;  1R9T K;  1Y1V C;  4QJV A;  3M4O K;  4OIP A;  4BY7 C;  2A6E A;  1YNN A;  2YU9 C;  2JA8 K;  1BDF A;  4XSZ A;  4LJZ A;  1IW7 A;  5IYC C;  3S2H K;  2NVY K;  3M4O C;  1Y1V K;  2PMZ L;  4A3K K;  4A3F C;  4A3L C;  4YFK A;  1K83 K;  4A3B K;  5M5W K;  3S16 C;  1I6V A;  2WAQ D;  2WAQ L;  4BY1 C;  1I6H K;  2NVX C;  3GTM C;  5C44 C;  3S2D C;  3HKZ D;  5IP9 K; 
#chains in the Genus database with same CATH topology
 1XXC A;  1FEU A;  4P9S A;  1WOS A;  3S2H C;  4GTD A;  1V5V A;  1DD5 A;  3S1R C;  4A3D C;  1I50 K;  1O28 A;  1TWH K;  3GTM A;  4M1X A;  2E2H K;  1IL2 A;  1ZYR A;  4BBR K;  1GE9 A;  4A3I K;  3SZZ A;  3HOW K;  1Y1W A;  1XPP A;  3H3V D;  1XXB A;  3FKI K;  3GTP A;  2E2I K;  3TTG A;  3GTO A;  3AQP A;  3S1Q C;  2NVT K;  1TWC C;  3GTL C;  4QIW L;  2E2J K;  4YFN A;  4BBS C;  2ZJP S;  4J3N A;  1JVI A;  4BBR C;  1HI9 A;  4MEY A;  3GTL K;  4P5A A;  4A3L K;  3FKI A;  2NVY A;  5IYD C;  2D6F C;  4A3J C;  4KM9 A;  1EK8 A;  2B63 K;  3S1N C;  5IOT A;  1O27 A;  2Y0S D;  4G0V A;  5C4X C;  1PJ6 A;  4Q4Z A;  3LAJ A;  2JA7 C;  4OIO A;  3HOY C;  2VUM C;  3CQZ K;  4AYB D;  2NVX K;  3HOV C;  3N0B A;  4Y52 C;  1IE0 A;  2R93 A;  1F93 A;  5DM7 S;  3L4K A;  4KN7 A;  1TWA K;  5IP7 K;  4G0W A;  1C0A A;  1F9N A;  3GEE A;  1O29 A;  5C3E C;  5HQH A;  2XCO A;  3ADA C;  1TWF K;  4A3M C;  1J6W A;  3GTQ C;  4PAA A;  3S15 K;  1G51 A;  5CHP A;  3DLL S;  1JOE A;  4LOW A;  3I4M K;  3S17 K;  5IP9 C;  2O5J A;  1VH2 A;  2R93 K;  4C3J K;  4A3B C;  1WQH A;  3GTJ C;  2V6U A;  1Y1V C;  3AD8 C;  3M4O K;  2A6E A;  2EBB A;  2FQT A;  4XSZ A;  3AQO A;  3S2H K;  3GSI A;  4FM9 A;  4A3F C;  3GTJ A;  5M5W K;  2XCQ A;  3HOY K;  1IQ0 A;  4LQY A;  2A69 A;  1HQM A;  4KMD A;  1WOP A;  4A3C K;  4A3M K;  3I4N K;  2CFA B;  3TFH A;  1Y1V A;  1SFO A;  4BXX C;  3MML B;  5E68 A;  3OEP A;  3S1M K;  5JFE A;  3RZO K;  1IS1 A;  5HL7 S;  2A68 A;  4IOC S;  4KB4 A;  3AD7 C;  4WJ4 A;  1DCH A;  2KQ1 A;  2L3U A;  3GTK K;  1I3Q A;  2JA6 A;  3I4M C;  3HOW C;  3S17 C;  4KAW X;  3AD9 C;  3GTG K;  3HOZ K;  5C4J K;  1J6V A;  2PA8 D;  4XLP A;  1TWC K;  5FLM C;  4OIN A;  1O2B A;  4KB2 A;  5FJ8 K;  4BLB A;  4A3E K;  1I50 C;  1TWG A;  2E2I C;  4KN4 A;  1ZBS A;  4YFX A;  2RGR A;  2ZUF A;  1VGX A;  2GAH C;  2VUM K;  3H0G K;  4C3H C;  2R7Z C;  3GTO K;  2E2I A;  3HXA A;  3H0G C;  1TWC A;  4WJ3 M;  3NUH A;  2NVT C;  3S1Q K;  4LLG A;  1TWG K;  4KAS A;  3S1M C;  4KM8 A;  4A3K C;  4KAT A;  4C3I C;  1BJT A;  4P5B A;  4BXX K;  4C45 A;  2R92 A;  1BGW A;  2L5N A;  2Y0S L;  4A3E C;  3I4N C;  1DCP A;  4OIQ A;  4BY7 K;  1VRQ C;  5DM6 S;  1Y1W C;  3PO2 C;  4XLN A;  4C3J C;  3GTG C;  3HOZ C;  4BY1 K;  1O25 A;  3S16 K;  4Y7N C;  1WCM K;  1YX2 A;  2B63 A;  4LK1 A;  1TWF C;  4U67 S;  5TMC A;  3V4G A;  2PPB A;  4FZB A;  3LYW A;  2V6S A;  5IOS A;  4OIR A;  4C2M C;  2PA8 L;  1I3Q K;  4NOI A;  1WIH A;  1TWA C;  5M3M K;  3HOU K;  3BUE A;  5IYB K;  3S14 C;  2BE5 A;  3CQZ C;  3T02 A;  1WSV A;  4KC6 A;  4GTL A;  2GSN A;  1F7U A;  1INN A;  4OIP A;  1WOR A;  1PJ7 A;  2KXY A;  4LJZ A;  1IW7 A;  4BLA A;  4RMF A;  4A3K K;  5JVO A;  3L4J A;  1XZQ B;  2XCR B;  1K83 K;  4A3B K;  3S2D C;  3GTM K;  1VJE A;  5IP9 K;  3ERE D;  4BBS K;  3PO2 K;  4G0U A;  4A3F K;  1F7V A;  2NVQ C;  3S15 C;  2FQO A;  4Q5S A;  4MEX A;  2P5M A;  4QIW D;  1TWH A;  5EGH A;  1DCO A;  3TFJ A;  1R9T A;  3A8I A;  4GTB A;  5M5X K;  3HOX C;  4WF9 S;  4G7O A;  5JVH S;  2KPU A;  3GTQ A;  4G7H A;  2JA5 A;  4MQ9 A;  2YU9 A;  3HOV K;  1EI6 A;  5IYB C;  3A8K A;  4ILD A;  4A3I C;  4C3H K;  3LAP A;  2R7Z K;  2WB1 L;  1L0W A;  4O2D A;  3FOF A;  1I3Q C;  1O2F B;  4WFB S;  2PHC B;  5TMF A;  1B4A A;  5IP7 C;  4JK1 A;  1TWG C;  4XCH A;  1I50 A;  1WCM C;  4AYB L;  4Y7N K;  2ZFZ A;  1YNJ A;  1JQW A;  4BKW A;  3N0C A;  5D4D A;  5C44 K;  4KMU A;  1Y1W K;  3SZY A;  3QX3 A;  3S1N K;  3A8J A;  2GSU A;  2B63 C;  4G7Z A;  4GFQ A;  3S1R K;  4A3D K;  3HOX K;  4GZY A;  1SMY A;  3M3Y K;  1EQR A;  5FLM K;  2NVQ K;  2JA5 C;  1KQ4 A;  2ZJQ S;  3WOD A;  5C4J C;  1TWA A;  3VA7 A;  2CW0 A;  3GTO C;  5M3F K;  3CAG A;  3FHZ A;  4WFA S;  1I6H C;  3PO3 K;  3HOU C;  2JA7 A;  2GAG C;  1J6X A;  1O26 A;  3GEI A;  2JA8 C;  3DXJ A;  1BS2 A;  4A3C C;  3GTJ K;  3EQL A;  1ISE A;  1TWF A;  4YG2 A;  3JST A;  4IOA S;  2NVX A;  1TWH C;  2ZJR S;  4GTA A;  1O24 A;  3K7A K;  1R9T K;  4QJV A;  4BY7 C;  1YNN A;  2YU9 C;  3OPF A;  3G4C A;  3CQZ A;  5HL8 A;  2NVY K;  3M4O C;  1Y1V K;  4GT9 A;  2PMZ L;  4KMA A;  4YFK A;  3S16 C;  2WAQ D;  2NVX C;  3HKZ D;  3S14 K;  1XZQ A;  1USM A;  4A3G K;  3LPX A;  4AH6 A;  1PJ5 A;  3H3V L;  3HKZ L;  3GTQ K;  4LR2 A;  3H0G A;  1J98 A;  1WSR A;  3N3Y A;  3GEH A;  3FKI C;  4X6A C;  3GTP K;  3T00 A;  3RZD C;  4IO9 S;  5M5Y K;  1XXA A;  2R92 C;  2R93 C;  4GTE A;  4XSX A;  5EGE A;  3BP8 C;  1EFW A;  4PAB A;  2E2J C;  4WIL A;  3GTL A;  3M3Y C;  3GTG A;  1K83 A;  2KWA A;  2JA6 K;  4WFN S;  4A93 K;  3TFI A;  1O2A A;  4KDD A;  4A3J K;  4QJV B;  5IYD K;  5TJ3 A;  1USO A;  2GSO A;  3T01 A;  1ZQ1 C;  4GTF A;  4A3G C;  2A6H A;  3CF5 S;  4LK0 A;  5C4X K;  2R92 K;  1SFO C;  1WQF A;  1K83 C;  1ZXO A;  2W7V A;  1X31 C;  3AH5 A;  3PIO S;  2V6T A;  4C3I K;  2PMZ D;  5IYC K;  1VLO A;  4KMH A;  4ZH4 A;  2JA6 C;  4KAR A;  3ORE A;  2VUM A;  1SFO K;  1XZP B;  2O5I A;  1WOO A;  5IOR A;  3IPJ A;  2Y3P A;  3Q3Q A;  3GTK C;  3S2D K;  1UV7 A;  4GTC A;  1EH1 A;  5CJ9 A;  3RZD K;  2R7Z A;  2RH6 A;  4WCE S;  4C2M K;  2NVY C;  4A93 C;  1YCL A;  2YU9 K;  5C3E K;  2CFA A;  3GDZ A;  3GIR A;  3K7A C;  1R9T C;  2JH3 A;  2ZUE A;  3G4A A;  3FOE A;  5IOQ A;  5L46 A;  3PO3 C;  4Y52 K;  1WCM A;  1AB4 A;  2E2H C;  2JA7 K;  1IBA A;  2WB1 D;  3PIP S;  3BP3 A;  3RZO C;  3GTP C;  2JA5 K;  4X6A K;  4DDQ A;  1WQG A;  1B4B A;  1RU0 A;  3S0X A;  2JA8 K;  1BDF A;  5IYC C;  4A3L C;  5JVG S;  2P8T A;  1I6H K;  1I6V A;  2WAQ L;  4BY1 C;  1ZVU A;  3GTM C;  5C44 C;  2E2H A;  3GTK A;  1XZP A; 
#chains in the Genus database with same CATH homology
 4BBS K;  3PO2 K;  4A3G K;  2A69 A;  1HQM A;  4A3F K;  2NVQ C;  3S15 C;  4Q5S A;  4MEX A;  3H3V L;  4QIW D;  3HKZ L;  3GTQ K;  4A3C K;  4A3M K;  3I4N K;  3S2H C;  5M5X K;  3HOX C;  4BXX C;  3S1R C;  4A3D C;  4G7O A;  3S1M K;  3FKI C;  4X6A C;  1I50 K;  3GTP K;  1TWH K;  3RZO K;  3RZD C;  4G7H A;  5M5Y K;  2A68 A;  4MQ9 A;  2E2H K;  1ZYR A;  2R92 C;  4BBR K;  2R93 C;  3GTK K;  3HOV K;  5IYB C;  4XSX A;  3I4M C;  3HOW C;  3S17 C;  3GTG K;  3HOZ K;  4A3I K;  4A3I C;  4C3H K;  2R7Z K;  3HOW K;  2WB1 L;  2E2J C;  5C4J K;  2PA8 D;  4XLP A;  1TWC K;  1I3Q C;  5FLM C;  4OIN A;  3M3Y C;  1XPP A;  5FJ8 K;  4A3E K;  2JA6 K;  1I50 C;  3H3V D;  3FKI K;  2E2I C;  4A93 K;  4KN4 A;  5TMF A;  2E2I K;  4YFX A;  4A3J K;  4QJV B;  5IYD K;  5IP7 C;  4JK1 A;  1TWG C;  3S1Q C;  2NVT K;  1WCM C;  4AYB L;  4Y7N K;  1TWC C;  3GTL C;  4QIW L;  1YNJ A;  2E2J K;  4A3G C;  2VUM K;  4YFN A;  4C3H C;  2R7Z C;  4BBS C;  2A6H A;  3H0G K;  3GTO K;  4LK0 A;  3H0G C;  5D4D A;  5C4X K;  5C44 K;  4BBR C;  2R92 K;  1SFO C;  4KMU A;  1Y1W K;  4MEY A;  3GTL K;  1K83 C;  2NVT C;  3S1Q K;  4LLG A;  4A3L K;  1TWG K;  3S1N K;  5IYD C;  3S1M C;  4A3J C;  4A3K C;  3S1R K;  4C3I C;  4G7Z A;  2B63 C;  4C3I K;  2B63 K;  3HOX K;  2PMZ D;  4BXX K;  4A3D K;  5IYC K;  2Y0S L;  3S1N C;  4ZH4 A;  4A3E C;  2JA6 C;  3I4N C;  4GZY A;  4OIQ A;  4BY7 K;  1SMY A;  3M3Y K;  3S14 K;  2Y0S D;  5FLM K;  2NVQ K;  1Y1W C;  2JA5 C;  1SFO K;  3WOD A;  5C4X C;  4Q4Z A;  3PO2 C;  5C4J C;  2O5I A;  4XLN A;  4C3J C;  2CW0 A;  2JA7 C;  4OIO A;  3GTO C;  3GTG C;  3HOZ C;  2VUM C;  3HOY C;  4AYB D;  3CQZ K;  3GTK C;  3HOV C;  5M3F K;  4Y52 C;  2NVX K;  1I6H C;  4BY1 K;  3S16 K;  3S2D K;  3PO3 K;  4Y7N C;  1WCM K;  3HOU C;  3RZD K;  4KN7 A;  1TWA K;  5IP7 K;  4C2M K;  2NVY C;  4LK1 A;  1TWF C;  5C3E C;  5TMC A;  2JA8 C;  4A93 C;  2PPB A;  2YU9 K;  1TWF K;  5C3E K;  3DXJ A;  4A3M C;  4OIR A;  4C2M C;  2PA8 L;  3GTQ C;  3K7A C;  1R9T C;  4A3C C;  1I3Q K;  3GTJ K;  4NOI A;  3GTM K;  3EQL A;  1TWA C;  3S15 K;  5M3M K;  3HOU K;  3PO3 C;  3I4M K;  3S17 K;  5IYB K;  4Y52 K;  5IP9 C;  3S14 C;  2O5J A;  2BE5 A;  3CQZ C;  4YG2 A;  2R93 K;  2JA7 K;  2E2H C;  4C3J K;  4A3B C;  2WB1 D;  3HOY K;  1TWH C;  3RZO C;  3GTJ C;  3GTP C;  2JA5 K;  4X6A K;  3K7A K;  1R9T K;  1Y1V C;  4QJV A;  3M4O K;  4OIP A;  4BY7 C;  2A6E A;  1YNN A;  2YU9 C;  2JA8 K;  1BDF A;  4XSZ A;  4LJZ A;  1IW7 A;  5IYC C;  3S2H K;  2NVY K;  3M4O C;  1Y1V K;  2PMZ L;  4A3K K;  4A3F C;  4A3L C;  4YFK A;  1K83 K;  4A3B K;  5M5W K;  3S16 C;  1I6V A;  2WAQ D;  2WAQ L;  4BY1 C;  1I6H K;  2NVX C;  3GTM C;  5C44 C;  3S2D C;  3HKZ D;  5IP9 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...