4OIOA

Crystal structure of thermus thermophilus pre-insertion substrate complex for de novo transcription initiation
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
226
structure length
226
Chain Sequence
SKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase subunit alpha
publication title GE23077 binds to the RNA polymerase 'i' and 'i+1' sites and prevents the binding of initiating nucleotides.
pubmed rcsb
source organism Thermus thermophilus
molecule tags Transcription, transferase
total genus 50
structure length 226
sequence length 226
chains with identical sequence B
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2014-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01000 RNA_pol_A_bac RNA polymerase Rpb3/RpoA insert domain
A PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain
A PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.12 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 DNA-directed RNA polymerase, insert domain 4oioA02
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 4oioA01
4QIWD 3HOYC 4A3JC 3HOUC 3S1MC 4OIQA 4AYBL 3HOXC 4XLPA 4QIWL 5C4XC 2YU9C 1TWCK 1TWFC 2NVYK 5C3EK 3S1RK 2E2IK 3RZOC 2VUMK 4A3BC 5M5WK 2WAQD 4C3JK 4BY1K 4JK1A 3GTQC 4A3EC 3S17C 3I4NC 4QJVA 4G7ZA 5IP7C 1SFOC 3S1QC 4YFXA 3WODA 2JA8K 2E2HK 5IYCK 3GTJK 1R9TK 3M3YK 4A3FK 1Y1VC 2NVTK 3RZDK 3CQZK 3GTGK 5C4JC 4Y7NK 4C2MC 1K83C 1I6VA 5C44C 5M5XK 2E2JK 3RZDC 4LK1A 1TWGC 2O5IA 3EQLA 5IYBC 4BY7K 1WCMK 3H0GK 4BBSK 4Y52K 5C3EC 4AYBD 1TWCC 2NVYC 4OIPA 3S1RC 2E2IC 2VUMC 4YFNA 2O5JA 5IYDK 3GTMK 4A3GK 2A68A 1YNJA 4C3JC 4BY1C 5FLMK 4KN4A 4LJZA 1Y1WK 4BXXK 4A3CK 4X6AK 4MEXA 3S16K 1TWHK 2JA8C 4A3LC 5IYCC 3HOZK 3GTJC 1SMYA 3M3YC 4A3FC 2R7ZK 2NVTC 2JA5K 3CQZC 3GTGC 2B63K 4Y7NC 2E2JC 1YNNA 3DXJA 3S1NC 4LLGA 4BY7C 1WCMC 2R93K 3S2DK 5M3FK 3GTLK 3H0GC 4C3HK 4YG2A 3I4MK 4BBSC 4Y52C 3HKZD 2NVQK 4KN7A 3S15K 5IYDC 1I3QK 3S2HK 4A3GC 5FLMC 1Y1WC 4X6AC 4QJVB 4LK0A 4A93K 4A3CC 3HKZL 3HOWK 3K7AK 4A3KK 4Q5SA 2NVXK 3S16C 1TWHC 5IP9K 2R92K 1TWAK 4BBRK 3HOZC 2R7ZC 1XPPA 1I6HK 2JA6K 3S14K 2JA5C 4KMUA 2A69A 4MEYA 4C3IK 3HOVK 5TMCA 2YU9K 4A3MK 4A3DK 2E2HC 2BE5A 1R9TC 1BDFA 3S2DC 3GTLC 5M5YK 3GTOK 2WB1D 4C3HC 3I4MC 1I50K 2NVQC 5TMFA 3S15C 5IP7K 3PO2K 3PO3K 1ZYRA 1I3QC 3S2HC 2PA8L 4XLNA 2WB1L 4A93C 3HOWC 3K7AC 4A3KC 2JA7K 2NVXC 2PPBA 2R92C 3FKIK 5IP9C 2Y0SD 1TWAC 3GTKK 4BBRC 2A6EA 3GTMC 4GZYA 1I6HC 2JA6C 3S14C 4OINA 4BXXC 3GTPK 4NOIA 4YFKA 3RZOK 4C3IC 4A3IK 3H3VD 3HOVC 2PMZD 4A3DC 4A3MC 2Y0SL 3HOYK 4G7OA 4A3JK 3M4OK 5FJ8K 4OIRA 3HOUK 3S1MK 2B63C 3GTOC 1I50C 4MQ9A 3H3VL 4XSXA 2PMZL 5D4DA 5C4XK 3HOXK 1TWFK 3PO2C 3PO3C 2R93C 4A3LK 4A3BK 2WAQL 3S1NK 2PA8D 5M3MK 1HQMA 3GTQK 4A3EK 3S17K 3I4NK 4XSZA 4G7HA 2A6HA 2JA7C 3FKIC 1SFOK 3S1QK 4Q4ZA 3GTKC 2CW0A 1Y1VK 5C4JK 4OIOA 1K83K 4C2MK 5C44K 4ZH4A 3GTPC 1IW7A 1TWGK 5IYBK 4A3IC 3M4OC
chains in the Genus database with same CATH superfamily
4QIWD 3A8KA 1F7UA 2GSUA 4KM9A 5C4XC 4ILDA 2E2IK 2VUMK 2WAQD 4A3EC 4G0WA 4QJVA 1Y1WA 2E2HK 1EK8A 3GTGK 3LYWA 2R7ZA 1I6VA 1EH1A 4KMAA 1TWGC 3EQLA 1JVIA 3G4CA 2R93A 3MMLB 4Y52K 5C3EC 3A8JA 3S1RC 1YNJA 1Y1WK 3LPXA 4LJZA 1JQWA 1WQGA 4GTEA 4LOWA 3S16K 4A3LC 2R7ZK 3GTJC 1EQRA 3S1NC 1YNNA 4U67S 2JA6A 1BS2A 4LLGA 3SZZA 2R93K 4WFNS 1EI6A 1O2AA 1INNA 5M3FK 3S2DK 3H0GC 2V6UA 4KN7A 5JVGS 2RH6A 3S2HK 4X6AC 4QJVB 4A3CC 3K7AK 4KATA 4KB2A 3QX3A 1TWHC 5IP9K 4BBRK 2JA7A 3FKIA 2JA6K 3S14K 4KMUA 2RGRA 4A3DK 1WIHA 2E2HC 5IORA 2KXYA 2P5MA 1DCOA 1PJ5A 1DCPA 1ZYRA 2PA8L 1VRQC 4KB4A 3HOWC 3TFIA 2JA7K 3FKIK 2Y0SD 3AD7C 4GZYA 4OINA 3NUHA 4YFKA 3HOVC 2PMZD 1TWGA 3T01A 2V6TA 5C4XK 3PO2C 4WILA 4KARA 2R93C 2PA8D 2XCOA 4A3EK 3VA7A 4G7HA 2A6HA 3GTKC 4OIOA 1R9TA 3GTJA 3RZOC 1TWGK 3M4OC 3HOYC 1ZBSA 3S1MC 1KQ4A 5JVHS 4IO9S 3H0GA 5C3EK 4QIWL 1TWFC 3S1RK 1C0AA 2CFAA 4A3BC 1XXCA 1PJ6A 3S17C 3S1QC 1XZQA 1X31C 4FZBA 3GTJK 1R9TK 1TWHA 2L5NA 3S1NK 3ERED 2O5IA 2B63A 4KC6A 5EGHA 5DM6S 3H0GK 4GTDA 3FOFA 2NVYC 4OIPA 1O29A 1UV7A 3L4KA 4C3JC 4X6AK 4KN4A 4BXXK 4A3CK 4MEXA 1TWHK 1XXAA 5IYCC 2PHCB 1SMYA 2KPUA 4A3FC 2NVTC 3CQZC 4BLAA 2B63K 4Y7NC 4BY7C 4G0UA 1WCMC 2ZJPS 1FEUA 4BBSC 4PAAA 1XZPB 3AH5A 4M1XA 2ZJRS 2CFAB 3FOEA 1O2BA 5FLMC 4LQYA 1O27A 3HOWK 3TTGA 5HL8A 2XCRB 5CJ9A 4KASA 2ZUFA 2JA5C 3GTKA 2A69A 3A8IA 4KAWX 3HOVK 5TMCA 2YU9K 1USMA 2BE5A 1R9TC 1V5VA 3AD9C 3GTLC 2WB1D 4C3HC 2NVQC 5TMFA 3S15C 3PO2K 1I3QC 4XLNA 1TWFA 4A93C 2XCQA 1PJ7A 4A3KC 2R92C 1J6WA 1TWAC 3GTKK 2A6EA 1WQHA 4BXXC 5JFEA 3RZOK 1IBAA 4C3IC 5TJ3A 2Y0SL 3M4OK 3HOYK 1GE9A 1ZQ1C 3AQPA 5FJ8K 3S1MK 1YCLA 2B63C 2ZFZA 1I50C 4MQ9A 4G0VA 2PMZL 1F9NA 1WORA 1F7VA 1TWFK 3GEHA 4A3BK 4WCES 4IOCS 1VLOA 3V4GA 2NVYA 1HQMA 1WQFA 3S17K 4O2DA 3S1QK 5L46A 3GTPC 3CQZA 2GSNA 3HOUC 4OIQA 1WCMA 5IOTA 4XLPA 3ADAC 2YU9C 2NVYK 5M5WK 4C3JK 1G51A 3GTQC 3GTMA 3I4NC 4G7ZA 1SFOC 4YFXA 4GTBA 3JSTA 5IYCK 4A3FK 1Y1VC 1WSRA 4RMFA 2NVTK 3CQZK 4Y7NK 4C2MC 1IS1A 4KDDA 2JA5A 5IYBC 4BY7K 1J6XA 1WCMK 1O25A 2JH3A 1L0WA 3OEPA 5JVOA 4BBSK 3GTLA 1ISEA 1TWCC 2O5JA 2GAGC 3T02A 3GTMK 4WJ4A 2A68A 4KMHA 5FLMK 4BY1C 1I3QA 2GAHC 4WFBS 1O24A 5IOQA 2JA8C 1O2FB 4LR2A 2R92A 3M3YC 1YX2A 2JA5K 1TWAA 1VH2A 2E2JC 3DLLS 1AB4A 3GTLK 4C3HK 4YG2A 3HKZD 2NVQK 3S15K 1I50A 5IYDC 1I3QK 1USOA 4A3GC 5IOSA 1EFWA 4A93K 1BJTA 3T00A 1F93A 4A3KK 4Q5SA 2R92K 1TWAK 4AH6A 3HOZC 3GIRA 4MEYA 1BGWA 4C3IK 3GTPA 2FQOA 4P5AA 3N0BA 5M5YK 3I4MC 1I50K 5IP7K 2YU9A 4DDQA 2WB1L 3TFJA 3GTQA 2NVXC 2ZUEA 3GTMC 1SFOA 3PIPS 3GEEA 1I6HC 1Y1VA 3GTPK 1XZQB 3H3VD 4A3MC 4G7OA 4OIRA 3HOUK 1RU0A 3GTOC 5CHPA 1J6VA 3PO3C 2KWAA 1J98A 1TWCA 4C45A 3GTQK 4GTCA 4XSZA 3LAJA 3I4NK 1SFOK 3BP3A 1Y1VK 4C2MK 1IW7A 5IYBK 4A3IC 2Y3PA 4A3JC 3G4AA 2L3UA 4KM8A 4AYBL 3HOXC 1TWCK 5HL7S 1IQ0A 3N0CA 1ZXOA 4BY1K 4JK1A 2V6SA 1DD5A 2KQ1A 4GTLA 3OPFA 5IP7C 3FHZA 1IL2A 3WODA 2JA8K 1JOEA 2W7VA 3M3YK 5C4JC 5C44C 1K83C 4WFAS 5M5XK 2E2JK 3RZDC 4LK1A 3AD8C 3Q3QA 1O26A 5E68A 5DM7S 4AYBD 4PABA 5EGEA 1VJEA 2E2IC 2VUMC 5IYDK 4YFNA 3LAPA 4GFQA 4A3GK 3S0XA 4WF9S 3PIOS 3CF5S 1WOPA 5HQHA 3HOZK 4BKWA 2NVXA 2P8TA 3GTGC 4KMDA 4P9SA 3DXJA 3N3YA 3I4MK 4Y52C 3GTOA 1IE0A 3AQOA 3CAGA 1Y1WC 4LK0A 3HKZL 1WOSA 2NVXK 3S16C 3SZYA 1XXBA 2R7ZC 1XPPA 3OREA 1I6HK 1DCHA 3TFHA 3HXAA 1ZVUA 1HI9A 1WSVA 4A3MK 3GDZA 1BDFA 3S2DC 3GTOK 1B4AA 3PO3K 4BLBA 3S2HC 4WJ3M 4J3NA 1VGXA 3K7AC 1O28A 4P5BA 5IP9C 4BBRC 3GSIA 2JA6C 3S14C 3IPJA 4GT9A 4GTFA 4NOIA 1B4BA 4A3IK 1K83A 4A3DC 1XZPA 4GTAA 3L4JA 4A3JK 4XCHA 2ZJQS 3GEIA 1WOOA 4FM9A 3H3VL 4XSXA 3HOXK 5D4DA 3BP8C 4A3LK 2WAQL 3BUEA 2FQTA 5M3MK 2VUMA 4IOAS 2E2IA 2JA7C 3FKIC 2EBBA 4Q4ZA 2D6FC 2CW0A 2GSOA 5C4JK 2E2HA 5C44K 1K83K 4ZH4A 3RZDK 3GTGA 2PPBA
chains in the Genus database with same CATH topology
4QIWD 3HOYC 4A3JC 3HOUC 3S1MC 4OIQA 4AYBL 3HOXC 4XLPA 4QIWL 5C4XC 2YU9C 1TWCK 1TWFC 2NVYK 5C3EK 3S1RK 2E2IK 3RZOC 2VUMK 4A3BC 5M5WK 2WAQD 4C3JK 4BY1K 4JK1A 3GTQC 4A3EC 3S17C 3I4NC 4QJVA 4G7ZA 5IP7C 1SFOC 3S1QC 4YFXA 3WODA 2JA8K 2E2HK 5IYCK 3GTJK 1R9TK 3M3YK 4A3FK 1Y1VC 2NVTK 3RZDK 3CQZK 3GTGK 5C4JC 4Y7NK 4C2MC 1K83C 1I6VA 5C44C 5M5XK 2E2JK 3RZDC 4LK1A 1TWGC 2O5IA 3EQLA 5IYBC 4BY7K 1WCMK 3H0GK 4BBSK 4Y52K 5C3EC 4AYBD 1TWCC 2NVYC 4OIPA 3S1RC 2E2IC 2VUMC 4YFNA 2O5JA 5IYDK 3GTMK 4A3GK 2A68A 1YNJA 4C3JC 4BY1C 5FLMK 4KN4A 4LJZA 1Y1WK 4BXXK 4A3CK 4X6AK 4MEXA 3S16K 1TWHK 2JA8C 4A3LC 5IYCC 3HOZK 3GTJC 1SMYA 3M3YC 4A3FC 2R7ZK 2NVTC 2JA5K 3CQZC 3GTGC 2B63K 4Y7NC 2E2JC 1YNNA 3DXJA 3S1NC 4LLGA 4BY7C 1WCMC 2R93K 3S2DK 5M3FK 3GTLK 3H0GC 4C3HK 4YG2A 3I4MK 4BBSC 4Y52C 3HKZD 2NVQK 4KN7A 3S15K 5IYDC 1I3QK 3S2HK 4A3GC 5FLMC 1Y1WC 4X6AC 4QJVB 4LK0A 4A93K 4A3CC 3HKZL 3HOWK 3K7AK 4A3KK 4Q5SA 2NVXK 3S16C 1TWHC 5IP9K 2R92K 1TWAK 4BBRK 3HOZC 2R7ZC 1XPPA 1I6HK 2JA6K 3S14K 2JA5C 4KMUA 2A69A 4MEYA 4C3IK 3HOVK 5TMCA 2YU9K 4A3MK 4A3DK 2E2HC 2BE5A 1R9TC 1BDFA 3S2DC 3GTLC 5M5YK 3GTOK 2WB1D 4C3HC 3I4MC 1I50K 2NVQC 5TMFA 3S15C 5IP7K 3PO2K 3PO3K 1ZYRA 1I3QC 3S2HC 2PA8L 4XLNA 2WB1L 4A93C 3HOWC 3K7AC 4A3KC 2JA7K 2NVXC 2PPBA 2R92C 3FKIK 5IP9C 2Y0SD 1TWAC 3GTKK 4BBRC 2A6EA 3GTMC 4GZYA 1I6HC 2JA6C 3S14C 4OINA 4BXXC 3GTPK 4NOIA 4YFKA 3RZOK 4C3IC 4A3IK 3H3VD 3HOVC 2PMZD 4A3DC 4A3MC 2Y0SL 3HOYK 4G7OA 4A3JK 3M4OK 5FJ8K 4OIRA 3HOUK 3S1MK 2B63C 3GTOC 1I50C 4MQ9A 3H3VL 4XSXA 2PMZL 5D4DA 5C4XK 3HOXK 1TWFK 3PO2C 3PO3C 2R93C 4A3LK 4A3BK 2WAQL 3S1NK 2PA8D 5M3MK 1HQMA 3GTQK 4A3EK 3S17K 3I4NK 4XSZA 4G7HA 2A6HA 2JA7C 3FKIC 1SFOK 3S1QK 4Q4ZA 3GTKC 2CW0A 1Y1VK 5C4JK 4OIOA 1K83K 4C2MK 5C44K 4ZH4A 3GTPC 1IW7A 1TWGK 5IYBK 4A3IC 3M4OC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QIW D;  3HOY C;  4A3J C;  3HOU C;  3S1M C;  4OIQ A;  4AYB L;  3HOX C;  4XLP A;  4QIW L;  5C4X C;  2YU9 C;  1TWC K;  1TWF C;  2NVY K;  5C3E K;  3S1R K;  2E2I K;  3RZO C;  2VUM K;  4A3B C;  5M5W K;  2WAQ D;  4C3J K;  4BY1 K;  4JK1 A;  3GTQ C;  4A3E C;  3S17 C;  3I4N C;  4QJV A;  4G7Z A;  5IP7 C;  1SFO C;  3S1Q C;  4YFX A;  3WOD A;  2JA8 K;  2E2H K;  5IYC K;  3GTJ K;  1R9T K;  3M3Y K;  4A3F K;  1Y1V C;  2NVT K;  3RZD K;  3CQZ K;  3GTG K;  5C4J C;  4Y7N K;  4C2M C;  1K83 C;  1I6V A;  5C44 C;  5M5X K;  2E2J K;  3RZD C;  4LK1 A;  1TWG C;  2O5I A;  3EQL A;  5IYB C;  4BY7 K;  1WCM K;  3H0G K;  4BBS K;  4Y52 K;  5C3E C;  4AYB D;  1TWC C;  2NVY C;  4OIP A;  3S1R C;  2E2I C;  2VUM C;  4YFN A;  2O5J A;  5IYD K;  3GTM K;  4A3G K;  2A68 A;  1YNJ A;  4C3J C;  4BY1 C;  5FLM K;  4KN4 A;  4LJZ A;  1Y1W K;  4BXX K;  4A3C K;  4X6A K;  4MEX A;  3S16 K;  1TWH K;  2JA8 C;  4A3L C;  5IYC C;  3HOZ K;  3GTJ C;  1SMY A;  3M3Y C;  4A3F C;  2R7Z K;  2NVT C;  2JA5 K;  3CQZ C;  3GTG C;  2B63 K;  4Y7N C;  2E2J C;  1YNN A;  3DXJ A;  3S1N C;  4LLG A;  4BY7 C;  1WCM C;  2R93 K;  3S2D K;  5M3F K;  3GTL K;  3H0G C;  4C3H K;  4YG2 A;  3I4M K;  4BBS C;  4Y52 C;  3HKZ D;  2NVQ K;  4KN7 A;  3S15 K;  5IYD C;  1I3Q K;  3S2H K;  4A3G C;  5FLM C;  1Y1W C;  4X6A C;  4QJV B;  4LK0 A;  4A93 K;  4A3C C;  3HKZ L;  3HOW K;  3K7A K;  4A3K K;  4Q5S A;  2NVX K;  3S16 C;  1TWH C;  5IP9 K;  2R92 K;  1TWA K;  4BBR K;  3HOZ C;  2R7Z C;  1XPP A;  1I6H K;  2JA6 K;  3S14 K;  2JA5 C;  4KMU A;  2A69 A;  4MEY A;  4C3I K;  3HOV K;  5TMC A;  2YU9 K;  4A3M K;  4A3D K;  2E2H C;  2BE5 A;  1R9T C;  1BDF A;  3S2D C;  3GTL C;  5M5Y K;  3GTO K;  2WB1 D;  4C3H C;  3I4M C;  1I50 K;  2NVQ C;  5TMF A;  3S15 C;  5IP7 K;  3PO2 K;  3PO3 K;  1ZYR A;  1I3Q C;  3S2H C;  2PA8 L;  4XLN A;  2WB1 L;  4A93 C;  3HOW C;  3K7A C;  4A3K C;  2JA7 K;  2NVX C;  2PPB A;  2R92 C;  3FKI K;  5IP9 C;  2Y0S D;  1TWA C;  3GTK K;  4BBR C;  2A6E A;  3GTM C;  4GZY A;  1I6H C;  2JA6 C;  3S14 C;  4OIN A;  4BXX C;  3GTP K;  4NOI A;  4YFK A;  3RZO K;  4C3I C;  4A3I K;  3H3V D;  3HOV C;  2PMZ D;  4A3D C;  4A3M C;  2Y0S L;  3HOY K;  4G7O A;  4A3J K;  3M4O K;  5FJ8 K;  4OIR A;  3HOU K;  3S1M K;  2B63 C;  3GTO C;  1I50 C;  4MQ9 A;  3H3V L;  4XSX A;  2PMZ L;  5D4D A;  5C4X K;  3HOX K;  1TWF K;  3PO2 C;  3PO3 C;  2R93 C;  4A3L K;  4A3B K;  2WAQ L;  3S1N K;  2PA8 D;  5M3M K;  1HQM A;  3GTQ K;  4A3E K;  3S17 K;  3I4N K;  4XSZ A;  4G7H A;  2A6H A;  2JA7 C;  3FKI C;  1SFO K;  3S1Q K;  4Q4Z A;  3GTK C;  2CW0 A;  1Y1V K;  5C4J K;  4OIO A;  1K83 K;  4C2M K;  5C44 K;  4ZH4 A;  3GTP C;  1IW7 A;  1TWG K;  5IYB K;  4A3I C;  3M4O C; 
#chains in the Genus database with same CATH topology
 4QIW D;  3A8K A;  1F7U A;  2GSU A;  4KM9 A;  5C4X C;  4ILD A;  2E2I K;  2VUM K;  2WAQ D;  4A3E C;  4G0W A;  4QJV A;  1Y1W A;  2E2H K;  1EK8 A;  3GTG K;  3LYW A;  2R7Z A;  1I6V A;  1EH1 A;  4KMA A;  1TWG C;  3EQL A;  1JVI A;  3G4C A;  2R93 A;  3MML B;  4Y52 K;  5C3E C;  3A8J A;  3S1R C;  1YNJ A;  1Y1W K;  3LPX A;  4LJZ A;  1JQW A;  1WQG A;  4GTE A;  4LOW A;  3S16 K;  4A3L C;  2R7Z K;  3GTJ C;  1EQR A;  3S1N C;  1YNN A;  4U67 S;  2JA6 A;  1BS2 A;  4LLG A;  3SZZ A;  2R93 K;  4WFN S;  1EI6 A;  1O2A A;  1INN A;  5M3F K;  3S2D K;  3H0G C;  2V6U A;  4KN7 A;  5JVG S;  2RH6 A;  3S2H K;  4X6A C;  4QJV B;  4A3C C;  3K7A K;  4KAT A;  4KB2 A;  3QX3 A;  1TWH C;  5IP9 K;  4BBR K;  2JA7 A;  3FKI A;  2JA6 K;  3S14 K;  4KMU A;  2RGR A;  4A3D K;  1WIH A;  2E2H C;  5IOR A;  2KXY A;  2P5M A;  1DCO A;  1PJ5 A;  1DCP A;  1ZYR A;  2PA8 L;  1VRQ C;  4KB4 A;  3HOW C;  3TFI A;  2JA7 K;  3FKI K;  2Y0S D;  3AD7 C;  4GZY A;  4OIN A;  3NUH A;  4YFK A;  3HOV C;  2PMZ D;  1TWG A;  3T01 A;  2V6T A;  5C4X K;  3PO2 C;  4WIL A;  4KAR A;  2R93 C;  2PA8 D;  2XCO A;  4A3E K;  3VA7 A;  4G7H A;  2A6H A;  3GTK C;  4OIO A;  1R9T A;  3GTJ A;  3RZO C;  1TWG K;  3M4O C;  3HOY C;  1ZBS A;  3S1M C;  1KQ4 A;  5JVH S;  4IO9 S;  3H0G A;  5C3E K;  4QIW L;  1TWF C;  3S1R K;  1C0A A;  2CFA A;  4A3B C;  1XXC A;  1PJ6 A;  3S17 C;  3S1Q C;  1XZQ A;  1X31 C;  4FZB A;  3GTJ K;  1R9T K;  1TWH A;  2L5N A;  3S1N K;  3ERE D;  2O5I A;  2B63 A;  4KC6 A;  5EGH A;  5DM6 S;  3H0G K;  4GTD A;  3FOF A;  2NVY C;  4OIP A;  1O29 A;  1UV7 A;  3L4K A;  4C3J C;  4X6A K;  4KN4 A;  4BXX K;  4A3C K;  4MEX A;  1TWH K;  1XXA A;  5IYC C;  2PHC B;  1SMY A;  2KPU A;  4A3F C;  2NVT C;  3CQZ C;  4BLA A;  2B63 K;  4Y7N C;  4BY7 C;  4G0U A;  1WCM C;  2ZJP S;  1FEU A;  4BBS C;  4PAA A;  1XZP B;  3AH5 A;  4M1X A;  2ZJR S;  2CFA B;  3FOE A;  1O2B A;  5FLM C;  4LQY A;  1O27 A;  3HOW K;  3TTG A;  5HL8 A;  2XCR B;  5CJ9 A;  4KAS A;  2ZUF A;  2JA5 C;  3GTK A;  2A69 A;  3A8I A;  4KAW X;  3HOV K;  5TMC A;  2YU9 K;  1USM A;  2BE5 A;  1R9T C;  1V5V A;  3AD9 C;  3GTL C;  2WB1 D;  4C3H C;  2NVQ C;  5TMF A;  3S15 C;  3PO2 K;  1I3Q C;  4XLN A;  1TWF A;  4A93 C;  2XCQ A;  1PJ7 A;  4A3K C;  2R92 C;  1J6W A;  1TWA C;  3GTK K;  2A6E A;  1WQH A;  4BXX C;  5JFE A;  3RZO K;  1IBA A;  4C3I C;  5TJ3 A;  2Y0S L;  3M4O K;  3HOY K;  1GE9 A;  1ZQ1 C;  3AQP A;  5FJ8 K;  3S1M K;  1YCL A;  2B63 C;  2ZFZ A;  1I50 C;  4MQ9 A;  4G0V A;  2PMZ L;  1F9N A;  1WOR A;  1F7V A;  1TWF K;  3GEH A;  4A3B K;  4WCE S;  4IOC S;  1VLO A;  3V4G A;  2NVY A;  1HQM A;  1WQF A;  3S17 K;  4O2D A;  3S1Q K;  5L46 A;  3GTP C;  3CQZ A;  2GSN A;  3HOU C;  4OIQ A;  1WCM A;  5IOT A;  4XLP A;  3ADA C;  2YU9 C;  2NVY K;  5M5W K;  4C3J K;  1G51 A;  3GTQ C;  3GTM A;  3I4N C;  4G7Z A;  1SFO C;  4YFX A;  4GTB A;  3JST A;  5IYC K;  4A3F K;  1Y1V C;  1WSR A;  4RMF A;  2NVT K;  3CQZ K;  4Y7N K;  4C2M C;  1IS1 A;  4KDD A;  2JA5 A;  5IYB C;  4BY7 K;  1J6X A;  1WCM K;  1O25 A;  2JH3 A;  1L0W A;  3OEP A;  5JVO A;  4BBS K;  3GTL A;  1ISE A;  1TWC C;  2O5J A;  2GAG C;  3T02 A;  3GTM K;  4WJ4 A;  2A68 A;  4KMH A;  5FLM K;  4BY1 C;  1I3Q A;  2GAH C;  4WFB S;  1O24 A;  5IOQ A;  2JA8 C;  1O2F B;  4LR2 A;  2R92 A;  3M3Y C;  1YX2 A;  2JA5 K;  1TWA A;  1VH2 A;  2E2J C;  3DLL S;  1AB4 A;  3GTL K;  4C3H K;  4YG2 A;  3HKZ D;  2NVQ K;  3S15 K;  1I50 A;  5IYD C;  1I3Q K;  1USO A;  4A3G C;  5IOS A;  1EFW A;  4A93 K;  1BJT A;  3T00 A;  1F93 A;  4A3K K;  4Q5S A;  2R92 K;  1TWA K;  4AH6 A;  3HOZ C;  3GIR A;  4MEY A;  1BGW A;  4C3I K;  3GTP A;  2FQO A;  4P5A A;  3N0B A;  5M5Y K;  3I4M C;  1I50 K;  5IP7 K;  2YU9 A;  4DDQ A;  2WB1 L;  3TFJ A;  3GTQ A;  2NVX C;  2ZUE A;  3GTM C;  1SFO A;  3PIP S;  3GEE A;  1I6H C;  1Y1V A;  3GTP K;  1XZQ B;  3H3V D;  4A3M C;  4G7O A;  4OIR A;  3HOU K;  1RU0 A;  3GTO C;  5CHP A;  1J6V A;  3PO3 C;  2KWA A;  1J98 A;  1TWC A;  4C45 A;  3GTQ K;  4GTC A;  4XSZ A;  3LAJ A;  3I4N K;  1SFO K;  3BP3 A;  1Y1V K;  4C2M K;  1IW7 A;  5IYB K;  4A3I C;  2Y3P A;  4A3J C;  3G4A A;  2L3U A;  4KM8 A;  4AYB L;  3HOX C;  1TWC K;  5HL7 S;  1IQ0 A;  3N0C A;  1ZXO A;  4BY1 K;  4JK1 A;  2V6S A;  1DD5 A;  2KQ1 A;  4GTL A;  3OPF A;  5IP7 C;  3FHZ A;  1IL2 A;  3WOD A;  2JA8 K;  1JOE A;  2W7V A;  3M3Y K;  5C4J C;  5C44 C;  1K83 C;  4WFA S;  5M5X K;  2E2J K;  3RZD C;  4LK1 A;  3AD8 C;  3Q3Q A;  1O26 A;  5E68 A;  5DM7 S;  4AYB D;  4PAB A;  5EGE A;  1VJE A;  2E2I C;  2VUM C;  5IYD K;  4YFN A;  3LAP A;  4GFQ A;  4A3G K;  3S0X A;  4WF9 S;  3PIO S;  3CF5 S;  1WOP A;  5HQH A;  3HOZ K;  4BKW A;  2NVX A;  2P8T A;  3GTG C;  4KMD A;  4P9S A;  3DXJ A;  3N3Y A;  3I4M K;  4Y52 C;  3GTO A;  1IE0 A;  3AQO A;  3CAG A;  1Y1W C;  4LK0 A;  3HKZ L;  1WOS A;  2NVX K;  3S16 C;  3SZY A;  1XXB A;  2R7Z C;  1XPP A;  3ORE A;  1I6H K;  1DCH A;  3TFH A;  3HXA A;  1ZVU A;  1HI9 A;  1WSV A;  4A3M K;  3GDZ A;  1BDF A;  3S2D C;  3GTO K;  1B4A A;  3PO3 K;  4BLB A;  3S2H C;  4WJ3 M;  4J3N A;  1VGX A;  3K7A C;  1O28 A;  4P5B A;  5IP9 C;  4BBR C;  3GSI A;  2JA6 C;  3S14 C;  3IPJ A;  4GT9 A;  4GTF A;  4NOI A;  1B4B A;  4A3I K;  1K83 A;  4A3D C;  1XZP A;  4GTA A;  3L4J A;  4A3J K;  4XCH A;  2ZJQ S;  3GEI A;  1WOO A;  4FM9 A;  3H3V L;  4XSX A;  3HOX K;  5D4D A;  3BP8 C;  4A3L K;  2WAQ L;  3BUE A;  2FQT A;  5M3M K;  2VUM A;  4IOA S;  2E2I A;  2JA7 C;  3FKI C;  2EBB A;  4Q4Z A;  2D6F C;  2CW0 A;  2GSO A;  5C4J K;  2E2H A;  5C44 K;  1K83 K;  4ZH4 A;  3RZD K;  3GTG A;  2PPB A; 
#chains in the Genus database with same CATH homology
 4QIW D;  3HOY C;  4A3J C;  3HOU C;  3S1M C;  4OIQ A;  4AYB L;  3HOX C;  4XLP A;  4QIW L;  5C4X C;  2YU9 C;  1TWC K;  1TWF C;  2NVY K;  5C3E K;  3S1R K;  2E2I K;  3RZO C;  2VUM K;  4A3B C;  5M5W K;  2WAQ D;  4C3J K;  4BY1 K;  4JK1 A;  3GTQ C;  4A3E C;  3S17 C;  3I4N C;  4QJV A;  4G7Z A;  5IP7 C;  1SFO C;  3S1Q C;  4YFX A;  3WOD A;  2JA8 K;  2E2H K;  5IYC K;  3GTJ K;  1R9T K;  3M3Y K;  4A3F K;  1Y1V C;  2NVT K;  3RZD K;  3CQZ K;  3GTG K;  5C4J C;  4Y7N K;  4C2M C;  1K83 C;  1I6V A;  5C44 C;  5M5X K;  2E2J K;  3RZD C;  4LK1 A;  1TWG C;  2O5I A;  3EQL A;  5IYB C;  4BY7 K;  1WCM K;  3H0G K;  4BBS K;  4Y52 K;  5C3E C;  4AYB D;  1TWC C;  2NVY C;  4OIP A;  3S1R C;  2E2I C;  2VUM C;  4YFN A;  2O5J A;  5IYD K;  3GTM K;  4A3G K;  2A68 A;  1YNJ A;  4C3J C;  4BY1 C;  5FLM K;  4KN4 A;  4LJZ A;  1Y1W K;  4BXX K;  4A3C K;  4X6A K;  4MEX A;  3S16 K;  1TWH K;  2JA8 C;  4A3L C;  5IYC C;  3HOZ K;  3GTJ C;  1SMY A;  3M3Y C;  4A3F C;  2R7Z K;  2NVT C;  2JA5 K;  3CQZ C;  3GTG C;  2B63 K;  4Y7N C;  2E2J C;  1YNN A;  3DXJ A;  3S1N C;  4LLG A;  4BY7 C;  1WCM C;  2R93 K;  3S2D K;  5M3F K;  3GTL K;  3H0G C;  4C3H K;  4YG2 A;  3I4M K;  4BBS C;  4Y52 C;  3HKZ D;  2NVQ K;  4KN7 A;  3S15 K;  5IYD C;  1I3Q K;  3S2H K;  4A3G C;  5FLM C;  1Y1W C;  4X6A C;  4QJV B;  4LK0 A;  4A93 K;  4A3C C;  3HKZ L;  3HOW K;  3K7A K;  4A3K K;  4Q5S A;  2NVX K;  3S16 C;  1TWH C;  5IP9 K;  2R92 K;  1TWA K;  4BBR K;  3HOZ C;  2R7Z C;  1XPP A;  1I6H K;  2JA6 K;  3S14 K;  2JA5 C;  4KMU A;  2A69 A;  4MEY A;  4C3I K;  3HOV K;  5TMC A;  2YU9 K;  4A3M K;  4A3D K;  2E2H C;  2BE5 A;  1R9T C;  1BDF A;  3S2D C;  3GTL C;  5M5Y K;  3GTO K;  2WB1 D;  4C3H C;  3I4M C;  1I50 K;  2NVQ C;  5TMF A;  3S15 C;  5IP7 K;  3PO2 K;  3PO3 K;  1ZYR A;  1I3Q C;  3S2H C;  2PA8 L;  4XLN A;  2WB1 L;  4A93 C;  3HOW C;  3K7A C;  4A3K C;  2JA7 K;  2NVX C;  2PPB A;  2R92 C;  3FKI K;  5IP9 C;  2Y0S D;  1TWA C;  3GTK K;  4BBR C;  2A6E A;  3GTM C;  4GZY A;  1I6H C;  2JA6 C;  3S14 C;  4OIN A;  4BXX C;  3GTP K;  4NOI A;  4YFK A;  3RZO K;  4C3I C;  4A3I K;  3H3V D;  3HOV C;  2PMZ D;  4A3D C;  4A3M C;  2Y0S L;  3HOY K;  4G7O A;  4A3J K;  3M4O K;  5FJ8 K;  4OIR A;  3HOU K;  3S1M K;  2B63 C;  3GTO C;  1I50 C;  4MQ9 A;  3H3V L;  4XSX A;  2PMZ L;  5D4D A;  5C4X K;  3HOX K;  1TWF K;  3PO2 C;  3PO3 C;  2R93 C;  4A3L K;  4A3B K;  2WAQ L;  3S1N K;  2PA8 D;  5M3M K;  1HQM A;  3GTQ K;  4A3E K;  3S17 K;  3I4N K;  4XSZ A;  4G7H A;  2A6H A;  2JA7 C;  3FKI C;  1SFO K;  3S1Q K;  4Q4Z A;  3GTK C;  2CW0 A;  1Y1V K;  5C4J K;  4OIO A;  1K83 K;  4C2M K;  5C44 K;  4ZH4 A;  3GTP C;  1IW7 A;  1TWG K;  5IYB K;  4A3I C;  3M4O C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...