4OIOA

Crystal structure of thermus thermophilus pre-insertion substrate complex for de novo transcription initiation
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
226
structure length
226
Chain Sequence
SKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription, transferase
molecule keywords DNA-directed RNA polymerase subunit alpha
publication title GE23077 binds to the RNA polymerase 'i' and 'i+1' sites and prevents the binding of initiating nucleotides.
pubmed rcsb
source organism Thermus thermophilus
total genus 50
structure length 226
sequence length 226
chains with identical sequence B
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2014-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01000 RNA_pol_A_bac RNA polymerase Rpb3/RpoA insert domain
A PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain
A PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.12 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 DNA-directed RNA polymerase, insert domain 4oioA02
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 4oioA01
2R7ZC 2YU9K 1TWHK 4LLGA 3S2HC 1YNJA 5IYCK 4A3KK 1IW7A 4XLPA 2PA8L 4A3EK 1SMYA 3PO2C 2PA8D 3GTQC 4A3DK 3HKZD 3GTOC 2R92K 4A3FC 2JA5C 3I4MC 1I50K 4Y52K 4C3HK 3GTGC 2JA7K 3S14K 4A3GC 5TMFA 2WB1L 3S17C 3H0GC 1TWAK 4A93K 4OIQA 4BBSK 4LJZA 4C2MC 4Y7NC 3GTMC 2E2JK 1I6HK 5IYDK 4Q4ZA 3S1RK 4MEXA 4BXXC 2PMZL 3RZOK 4NOIA 2PMZD 1Y1WC 4YFKA 4X6AC 2O5IA 3I4NC 5IYBC 5FJ8K 5C4JK 2VUMK 4MEYA 2WAQD 4A3LC 2B63C 5C4XC 4YFNA 5IP9K 3HOZC 2NVXK 2E2IC 4BY1C 2NVTK 3M3YK 3S2DK 3PO3K 1HQMA 3I4NK 5M5WK 1I6VA 3S2HK 4C3JK 3S1MK 1Y1VK 4BY7C 3GTOK 3RZDC 3HKZL 3GTPK 1SFOC 2JA6C 4BBRC 4KN4A 4G7HA 1XPPA 3FKIK 5IP7K 5M3MK 1TWFC 1I3QK 4AYBD 3S17K 3S1NK 2JA8K 3H3VD 4G7ZA 3S16C 5FLMK 4Y7NK 3HOXK 4A3JK 3S15K 2NVQC 2NVYC 1K83K 4MQ9A 5C44C 4ZH4A 4YFXA 4A3MC 2E2HK 3GTLC 2PPBA 4JK1A 1R9TK 5C3EC 3GTJC 3HOYC 2WAQL 5C4XK 3HOUC 2R93C 3HOUK 3M4OC 3HOVK 2A6EA 3K7AK 2YU9C 1TWHC 3GTKK 4A3CK 4C3IK 5IYCC 4A3EC 4A3IC 2R7ZK 4A3DC 2R92C 4OIOA 3PO2K 1I50C 4Y52C 3S1QC 4C3HC 2JA7C 3S14C 3GTQK 1TWGC 4A3FK 4LK0A 2JA5K 3I4MK 3GTGK 1TWAC 4A93C 3CQZC 4A3GK 5TMCA 4BBSC 1WCMC 4QJVB 4AYBL 5M5XK 1I6HC 3S16K 2E2JC 3H0GK 3H3VL 3WODA 5M3FK 1TWCC 3RZOC 4C2MK 3GTMK 1BDFA 4GZYA 5C44K 4OIPA 4BXXK 5C4JC 1Y1WK 4X6AK 1ZYRA 5C3EK 5D4DA 5IP9C 4QIWL 5IYBK 2NVXC 3GTJK 2NVTC 4QIWD 2BE5A 4A3BC 3S2DC 3HOWC 2B63K 4A3LK 3PO3C 4G7OA 3HOZK 2E2IK 3DXJA 4BY1K 2A68A 3EQLA 2O5JA 4C3JC 3S1MC 1Y1VC 4XLNA 4Q5SA 4KN7A 4A3KC 4A3IK 1YNNA 4OINA 3GTPC 4BY7K 3S1QK 3RZDK 5IP7C 3FKIC 1TWGK 1SFOK 2JA6K 1I3QC 3S1NC 2Y0SL 4BBRK 2WB1D 3CQZK 2JA8C 2Y0SD 4KMUA 5FLMC 3HOXC 1TWFK 1WCMK 4QJVA 4A3JC 2A69A 3S15C 5IYDC 2A6HA 4XSZA 1TWCK 1K83C 3S1RC 2E2HC 4XSXA 2CW0A 4YG2A 4OIRA 2NVYK 2NVQK 4A3MK 1R9TC 4LK1A 5M5YK 2VUMC 3GTLK 4A3BK 3HOYK 3HOWK 3HOVC 3K7AC 3GTKC 3M3YC 4A3CC 2R93K 4C3IC 3M4OK
chains in the Genus database with same CATH superfamily
5CJ9A 4LLGA 4GTFA 2L5NA 5JFEA 4XLPA 1G51A 4A3DK 1J6WA 3L4KA 3HKZD 4GTAA 3S14K 1IS1A 5TMFA 4AH6A 1YX2A 3S17C 4C2MC 1I6HK 3GTMC 3S1RK 1Y1WC 1WOPA 3I4NC 4MEYA 2NVYA 2B63C 1ZBSA 5IP9K 3GTLA 2NVXK 3PO3K 3GTJA 4BY7C 1BS2A 2YU9A 3GTOK 3RZDC 3GTPK 1XZPB 4KN4A 4G7HA 2R92A 4AYBD 3S1NK 2JA8K 2JA7A 3H3VD 3T02A 3OPFA 3S15K 4GT9A 4MQ9A 4KATA 4IO9S 4GFQA 1EK8A 4KARA 1R9TK 5DM7S 3HOYC 4XCHA 5EGHA 2PHCB 3LAPA 1IL2A 2GAGC 2A6EA 1TWHC 3GDZA 4C3IK 2P5MA 4GTEA 4FM9A 1WQGA 4OIOA 5HL8A 4BLBA 1I50C 1EFWA 1XXBA 1TWAC 3CQZC 3T00A 4QJVB 1BGWA 1O29A 2E2JC 3OEPA 3WODA 5JVOA 1TWCC 5HL7S 4C2MK 1I3QA 3GTMK 4GZYA 5C44K 2EBBA 5C4JC 1O27A 1Y1WK 1GE9A 1PJ7A 4U67S 3I4NK 4QIWD 2L3UA 2B63K 1O24A 2VUMA 4KC6A 2A68A 2O5JA 1IBAA 4C3JC 4WFNS 1Y1VC 3S1MC 4IOCS 3AH5A 4ILDA 4BY7K 2FQTA 2R7ZA 3RZDK 3L4JA 1TWGK 3GEHA 4DDQA 2A69A 3TTGA 4XSZA 1K83C 3S1RC 4XSXA 2CW0A 4OIRA 5JVHS 3BUEA 5DM6S 1O2AA 3V4GA 2ZJRS 5IOSA 1WOSA 3HOYK 3HOVC 1J98A 3GTKC 2RGRA 3GEEA 3AD9C 1VH2A 1TWHK 4A3KK 5TJ3A 1IW7A 1SMYA 2PA8D 5E68A 3GTOC 5HQHA 3I4MC 1I50K 3MMLB 3GTGC 4A3GC 1TWAK 1SFOA 4LOWA 5IYDK 2E2JK 4KMHA 1FEUA 2PMZL 4NOIA 3G4AA 5C4JK 5FJ8K 4G0UA 2E2IC 1HQMA 4KAWX 5M5WK 4P5BA 4C3JK 1Y1VK 3S1MK 2ZJPS 4BBRC 2CFAB 4G7ZA 4Y7NK 3AQPA 1K83K 1WCMA 2V6UA 5C44C 4ZH4A 4YFXA 4A3MC 1TWFA 1JOEA 3A8JA 5CHPA 4PAAA 3HOUC 3PIOS 3HOVK 3GTKK 1V5VA 2ZUEA 1PJ5A 4Y52C 5JVGS 1XZPA 1TWGC 3I4MK 4WFAS 1ZVUA 3A8IA 3GTGK 4A93C 3GTPA 4A3GK 3S16K 1VGXA 4G0VA 5M3FK 3RZOC 1BDFA 1HI9A 1O2FB 4WCES 4J3NA 4OIPA 2ZFZA 5C3EK 3GTJK 2BE5A 2E2IK 3AQOA 3EQLA 1WIHA 4A3KC 4A3IK 1O2BA 3LYWA 2XCQA 3S1QK 1ZQ1C 3HXAA 5EGEA 2GSOA 3FOFA 4BBRK 2Y0SL 3CAGA 4KMUA 5FLMC 4QJVA 4KB2A 4P5AA 5IYDC 3DLLS 3FKIA 1B4BA 4WJ3M 2E2HC 2KPUA 1INNA 3Q3QA 4KMAA 4A3MK 3GTMA 4LK1A 1Y1WA 4A3BK 3HOWK 3K7AC 3HOUK 4A3CC 1WOOA 3PO2C 3GTQC 1J6VA 4A3FC 2JA5C 1F7UA 4Y52K 2ZJQS 4C45A 3H0GC 4A93K 1VRQC 4OIQA 4RMFA 4LJZA 4Y7NC 1XXCA 5L46A 4MEXA 3RZOK 2GAHC 2O5IA 2VUMK 5IYBC 1DCPA 4A3LC 4YFNA 3TFIA 3HOZC 4BY1C 1F7VA 3M3YK 2D6FC 3CF5S 3S2HK 1TWHA 4KM8A 2Y3PA 1XPPA 5M3MK 1TWFC 1VLOA 2V6SA 1I50A 3S16C 5FLMK 2JA6A 1TWAA 3CQZA 2NVQC 2NVYC 1IE0A 2KQ1A 2E2HK 3GTLC 1TWCA 5C3EC 3GTJC 2WAQL 5C4XK 2P8TA 4GTLA 3M4OC 1XZQA 1KQ4A 1XZQB 2YU9C 1YCLA 3K7AK 4A3CK 5IYCC 3SZZA 4A3EC 4A3IC 4O2DA 3IPJA 2R92C 2R93A 3PO2K 3A8KA 3GTQK 3S1QC 4C3HC 2JA7C 1DCOA 4A3FK 4LK0A 2JA5K 1C0AA 5TMCA 4BBSC 2CFAA 3N3YA 3NUHA 1O25A 3H0GK 2ZUFA 1EI6A 1PJ6A 3N0BA 3BP8C 4KB4A 3TFHA 1ZYRA 5IYBK 4QIWL 2NVTC 4A3BC 3S2DC 3HOWC 1L0WA 4A3LK 4G7OA 1UV7A 3HOZK 3DXJA 4FZBA 2V6TA 4BY1K 1USOA 2GSUA 4Q5SA 2NVXA 1YNNA 1ZXOA 3GTKA 5IP7C 3FKIC 2XCRB 1I3QC 3GTOA 3HOXC 1WCMK 4WF9S 1J6XA 1TWFK 4A3JC 3GTGA 1WQHA 4YG2A 1AB4A 2NVYK 1EH1A 4LR2A 2XCOA 1JVIA 2NVQK 4M1XA 2VUMC 5M5YK 3ERED 3GTLK 1ISEA 2W7VA 1VJEA 3M3YC 3QX3A 2GSNA 1R9TA 3M4OK 3GIRA 2R7ZC 2YU9K 3GEIA 3S2HC 1YNJA 1XXAA 5IYCK 2E2IA 1BJTA 2PA8L 4A3EK 3BP3A 2R92K 5IORA 4C3HK 2JA7K 3PIPS 4G0WA 2WB1L 3OREA 1DD5A 4BBSK 1B4AA 4WILA 3LAJA 4Q4ZA 4KASA 4BXXC 2KWAA 4KDDA 2PMZD 3G4CA 4YFKA 4X6AC 2WAQD 5C4XC 2NVTK 4KM9A 3S2DK 4GTBA 1I6VA 2B63A 1F9NA 3HKZL 1SFOC 2JA6C 5IP7K 3FKIK 1I3QK 3S17K 1IQ0A 5IOTA 4WJ4A 3AD8C 3HOXK 1WORA 1TWGA 4A3JK 3N0CA 1RU0A 3FOEA 4KMDA 2RH6A 2PPBA 4JK1A 3GSIA 2R93C 1X31C 2KXYA 1DCHA 3LPXA 4GTCA 2R7ZK 4A3DC 2FQOA 3TFJA 3S14C 1O26A 3S0XA 1JQWA 5M5XK 1WCMC 4AYBL 1I6HC 3H3VL 3T01A 3ADAC 4BXXK 3FHZA 4WFBS 4X6AK 2E2HA 5D4DA 5IP9C 2NVXC 1O28A 4GTDA 5IOQA 3PO3C 4BLAA 3AD7C 4PABA 4XLNA 4IOAS 4KN7A 1F93A 3VA7A 4OINA 4P9SA 3GTPC 2JH3A 1WSRA 1SFOK 1Y1VA 2JA6K 3S1NC 3GTQA 2WB1D 3CQZK 2JA8C 2Y0SD 3JSTA 1WQFA 2JA5A 3S15C 2A6HA 1WSVA 1TWCK 4LQYA 1EQRA 3H0GA 1R9TC 3SZYA 1K83A 4BKWA 1USMA 2R93K 4C3IC
chains in the Genus database with same CATH topology
2R7ZC 2YU9K 1TWHK 4LLGA 3S2HC 1YNJA 5IYCK 4A3KK 1IW7A 4XLPA 2PA8L 4A3EK 1SMYA 3PO2C 2PA8D 3GTQC 4A3DK 3HKZD 3GTOC 2R92K 4A3FC 2JA5C 3I4MC 1I50K 4Y52K 4C3HK 3GTGC 2JA7K 3S14K 4A3GC 5TMFA 2WB1L 3S17C 3H0GC 1TWAK 4A93K 4OIQA 4BBSK 4LJZA 4C2MC 4Y7NC 3GTMC 2E2JK 1I6HK 5IYDK 4Q4ZA 3S1RK 4MEXA 4BXXC 2PMZL 3RZOK 4NOIA 2PMZD 1Y1WC 4YFKA 4X6AC 2O5IA 3I4NC 5IYBC 5FJ8K 5C4JK 2VUMK 4MEYA 2WAQD 4A3LC 2B63C 5C4XC 4YFNA 5IP9K 3HOZC 2NVXK 2E2IC 4BY1C 2NVTK 3M3YK 3S2DK 3PO3K 1HQMA 3I4NK 5M5WK 1I6VA 3S2HK 4C3JK 3S1MK 1Y1VK 4BY7C 3GTOK 3RZDC 3HKZL 3GTPK 1SFOC 2JA6C 4BBRC 4KN4A 4G7HA 1XPPA 3FKIK 5IP7K 5M3MK 1TWFC 1I3QK 4AYBD 3S17K 3S1NK 2JA8K 3H3VD 4G7ZA 3S16C 5FLMK 4Y7NK 3HOXK 4A3JK 3S15K 2NVQC 2NVYC 1K83K 4MQ9A 5C44C 4ZH4A 4YFXA 4A3MC 2E2HK 3GTLC 2PPBA 4JK1A 1R9TK 5C3EC 3GTJC 3HOYC 2WAQL 5C4XK 3HOUC 2R93C 3HOUK 3M4OC 3HOVK 2A6EA 3K7AK 2YU9C 1TWHC 3GTKK 4A3CK 4C3IK 5IYCC 4A3EC 4A3IC 2R7ZK 4A3DC 2R92C 4OIOA 3PO2K 1I50C 4Y52C 3S1QC 4C3HC 2JA7C 3S14C 3GTQK 1TWGC 4A3FK 4LK0A 2JA5K 3I4MK 3GTGK 1TWAC 4A93C 3CQZC 4A3GK 5TMCA 4BBSC 1WCMC 4QJVB 4AYBL 5M5XK 1I6HC 3S16K 2E2JC 3H0GK 3H3VL 3WODA 5M3FK 1TWCC 3RZOC 4C2MK 3GTMK 1BDFA 4GZYA 5C44K 4OIPA 4BXXK 5C4JC 1Y1WK 4X6AK 1ZYRA 5C3EK 5D4DA 5IP9C 4QIWL 5IYBK 2NVXC 3GTJK 2NVTC 4QIWD 2BE5A 4A3BC 3S2DC 3HOWC 2B63K 4A3LK 3PO3C 4G7OA 3HOZK 2E2IK 3DXJA 4BY1K 2A68A 3EQLA 2O5JA 4C3JC 3S1MC 1Y1VC 4XLNA 4Q5SA 4KN7A 4A3KC 4A3IK 1YNNA 4OINA 3GTPC 4BY7K 3S1QK 3RZDK 5IP7C 3FKIC 1TWGK 1SFOK 2JA6K 1I3QC 3S1NC 2Y0SL 4BBRK 2WB1D 3CQZK 2JA8C 2Y0SD 4KMUA 5FLMC 3HOXC 1TWFK 1WCMK 4QJVA 4A3JC 2A69A 3S15C 5IYDC 2A6HA 4XSZA 1TWCK 1K83C 3S1RC 2E2HC 4XSXA 2CW0A 4YG2A 4OIRA 2NVYK 2NVQK 4A3MK 1R9TC 4LK1A 5M5YK 2VUMC 3GTLK 4A3BK 3HOYK 3HOWK 3HOVC 3K7AC 3GTKC 3M3YC 4A3CC 2R93K 4C3IC 3M4OK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R7Z C;  2YU9 K;  1TWH K;  4LLG A;  3S2H C;  1YNJ A;  5IYC K;  4A3K K;  1IW7 A;  4XLP A;  2PA8 L;  4A3E K;  1SMY A;  3PO2 C;  2PA8 D;  3GTQ C;  4A3D K;  3HKZ D;  3GTO C;  2R92 K;  4A3F C;  2JA5 C;  3I4M C;  1I50 K;  4Y52 K;  4C3H K;  3GTG C;  2JA7 K;  3S14 K;  4A3G C;  5TMF A;  2WB1 L;  3S17 C;  3H0G C;  1TWA K;  4A93 K;  4OIQ A;  4BBS K;  4LJZ A;  4C2M C;  4Y7N C;  3GTM C;  2E2J K;  1I6H K;  5IYD K;  4Q4Z A;  3S1R K;  4MEX A;  4BXX C;  2PMZ L;  3RZO K;  4NOI A;  2PMZ D;  1Y1W C;  4YFK A;  4X6A C;  2O5I A;  3I4N C;  5IYB C;  5FJ8 K;  5C4J K;  2VUM K;  4MEY A;  2WAQ D;  4A3L C;  2B63 C;  5C4X C;  4YFN A;  5IP9 K;  3HOZ C;  2NVX K;  2E2I C;  4BY1 C;  2NVT K;  3M3Y K;  3S2D K;  3PO3 K;  1HQM A;  3I4N K;  5M5W K;  1I6V A;  3S2H K;  4C3J K;  3S1M K;  1Y1V K;  4BY7 C;  3GTO K;  3RZD C;  3HKZ L;  3GTP K;  1SFO C;  2JA6 C;  4BBR C;  4KN4 A;  4G7H A;  1XPP A;  3FKI K;  5IP7 K;  5M3M K;  1TWF C;  1I3Q K;  4AYB D;  3S17 K;  3S1N K;  2JA8 K;  3H3V D;  4G7Z A;  3S16 C;  5FLM K;  4Y7N K;  3HOX K;  4A3J K;  3S15 K;  2NVQ C;  2NVY C;  1K83 K;  4MQ9 A;  5C44 C;  4ZH4 A;  4YFX A;  4A3M C;  2E2H K;  3GTL C;  2PPB A;  4JK1 A;  1R9T K;  5C3E C;  3GTJ C;  3HOY C;  2WAQ L;  5C4X K;  3HOU C;  2R93 C;  3HOU K;  3M4O C;  3HOV K;  2A6E A;  3K7A K;  2YU9 C;  1TWH C;  3GTK K;  4A3C K;  4C3I K;  5IYC C;  4A3E C;  4A3I C;  2R7Z K;  4A3D C;  2R92 C;  4OIO A;  3PO2 K;  1I50 C;  4Y52 C;  3S1Q C;  4C3H C;  2JA7 C;  3S14 C;  3GTQ K;  1TWG C;  4A3F K;  4LK0 A;  2JA5 K;  3I4M K;  3GTG K;  1TWA C;  4A93 C;  3CQZ C;  4A3G K;  5TMC A;  4BBS C;  1WCM C;  4QJV B;  4AYB L;  5M5X K;  1I6H C;  3S16 K;  2E2J C;  3H0G K;  3H3V L;  3WOD A;  5M3F K;  1TWC C;  3RZO C;  4C2M K;  3GTM K;  1BDF A;  4GZY A;  5C44 K;  4OIP A;  4BXX K;  5C4J C;  1Y1W K;  4X6A K;  1ZYR A;  5C3E K;  5D4D A;  5IP9 C;  4QIW L;  5IYB K;  2NVX C;  3GTJ K;  2NVT C;  4QIW D;  2BE5 A;  4A3B C;  3S2D C;  3HOW C;  2B63 K;  4A3L K;  3PO3 C;  4G7O A;  3HOZ K;  2E2I K;  3DXJ A;  4BY1 K;  2A68 A;  3EQL A;  2O5J A;  4C3J C;  3S1M C;  1Y1V C;  4XLN A;  4Q5S A;  4KN7 A;  4A3K C;  4A3I K;  1YNN A;  4OIN A;  3GTP C;  4BY7 K;  3S1Q K;  3RZD K;  5IP7 C;  3FKI C;  1TWG K;  1SFO K;  2JA6 K;  1I3Q C;  3S1N C;  2Y0S L;  4BBR K;  2WB1 D;  3CQZ K;  2JA8 C;  2Y0S D;  4KMU A;  5FLM C;  3HOX C;  1TWF K;  1WCM K;  4QJV A;  4A3J C;  2A69 A;  3S15 C;  5IYD C;  2A6H A;  4XSZ A;  1TWC K;  1K83 C;  3S1R C;  2E2H C;  4XSX A;  2CW0 A;  4YG2 A;  4OIR A;  2NVY K;  2NVQ K;  4A3M K;  1R9T C;  4LK1 A;  5M5Y K;  2VUM C;  3GTL K;  4A3B K;  3HOY K;  3HOW K;  3HOV C;  3K7A C;  3GTK C;  3M3Y C;  4A3C C;  2R93 K;  4C3I C;  3M4O K; 
#chains in the Genus database with same CATH topology
 5CJ9 A;  4LLG A;  4GTF A;  2L5N A;  5JFE A;  4XLP A;  1G51 A;  4A3D K;  1J6W A;  3L4K A;  3HKZ D;  4GTA A;  3S14 K;  1IS1 A;  5TMF A;  4AH6 A;  1YX2 A;  3S17 C;  4C2M C;  1I6H K;  3GTM C;  3S1R K;  1Y1W C;  1WOP A;  3I4N C;  4MEY A;  2NVY A;  2B63 C;  1ZBS A;  5IP9 K;  3GTL A;  2NVX K;  3PO3 K;  3GTJ A;  4BY7 C;  1BS2 A;  2YU9 A;  3GTO K;  3RZD C;  3GTP K;  1XZP B;  4KN4 A;  4G7H A;  2R92 A;  4AYB D;  3S1N K;  2JA8 K;  2JA7 A;  3H3V D;  3T02 A;  3OPF A;  3S15 K;  4GT9 A;  4MQ9 A;  4KAT A;  4IO9 S;  4GFQ A;  1EK8 A;  4KAR A;  1R9T K;  5DM7 S;  3HOY C;  4XCH A;  5EGH A;  2PHC B;  3LAP A;  1IL2 A;  2GAG C;  2A6E A;  1TWH C;  3GDZ A;  4C3I K;  2P5M A;  4GTE A;  4FM9 A;  1WQG A;  4OIO A;  5HL8 A;  4BLB A;  1I50 C;  1EFW A;  1XXB A;  1TWA C;  3CQZ C;  3T00 A;  4QJV B;  1BGW A;  1O29 A;  2E2J C;  3OEP A;  3WOD A;  5JVO A;  1TWC C;  5HL7 S;  4C2M K;  1I3Q A;  3GTM K;  4GZY A;  5C44 K;  2EBB A;  5C4J C;  1O27 A;  1Y1W K;  1GE9 A;  1PJ7 A;  4U67 S;  3I4N K;  4QIW D;  2L3U A;  2B63 K;  1O24 A;  2VUM A;  4KC6 A;  2A68 A;  2O5J A;  1IBA A;  4C3J C;  4WFN S;  1Y1V C;  3S1M C;  4IOC S;  3AH5 A;  4ILD A;  4BY7 K;  2FQT A;  2R7Z A;  3RZD K;  3L4J A;  1TWG K;  3GEH A;  4DDQ A;  2A69 A;  3TTG A;  4XSZ A;  1K83 C;  3S1R C;  4XSX A;  2CW0 A;  4OIR A;  5JVH S;  3BUE A;  5DM6 S;  1O2A A;  3V4G A;  2ZJR S;  5IOS A;  1WOS A;  3HOY K;  3HOV C;  1J98 A;  3GTK C;  2RGR A;  3GEE A;  3AD9 C;  1VH2 A;  1TWH K;  4A3K K;  5TJ3 A;  1IW7 A;  1SMY A;  2PA8 D;  5E68 A;  3GTO C;  5HQH A;  3I4M C;  1I50 K;  3MML B;  3GTG C;  4A3G C;  1TWA K;  1SFO A;  4LOW A;  5IYD K;  2E2J K;  4KMH A;  1FEU A;  2PMZ L;  4NOI A;  3G4A A;  5C4J K;  5FJ8 K;  4G0U A;  2E2I C;  1HQM A;  4KAW X;  5M5W K;  4P5B A;  4C3J K;  1Y1V K;  3S1M K;  2ZJP S;  4BBR C;  2CFA B;  4G7Z A;  4Y7N K;  3AQP A;  1K83 K;  1WCM A;  2V6U A;  5C44 C;  4ZH4 A;  4YFX A;  4A3M C;  1TWF A;  1JOE A;  3A8J A;  5CHP A;  4PAA A;  3HOU C;  3PIO S;  3HOV K;  3GTK K;  1V5V A;  2ZUE A;  1PJ5 A;  4Y52 C;  5JVG S;  1XZP A;  1TWG C;  3I4M K;  4WFA S;  1ZVU A;  3A8I A;  3GTG K;  4A93 C;  3GTP A;  4A3G K;  3S16 K;  1VGX A;  4G0V A;  5M3F K;  3RZO C;  1BDF A;  1HI9 A;  1O2F B;  4WCE S;  4J3N A;  4OIP A;  2ZFZ A;  5C3E K;  3GTJ K;  2BE5 A;  2E2I K;  3AQO A;  3EQL A;  1WIH A;  4A3K C;  4A3I K;  1O2B A;  3LYW A;  2XCQ A;  3S1Q K;  1ZQ1 C;  3HXA A;  5EGE A;  2GSO A;  3FOF A;  4BBR K;  2Y0S L;  3CAG A;  4KMU A;  5FLM C;  4QJV A;  4KB2 A;  4P5A A;  5IYD C;  3DLL S;  3FKI A;  1B4B A;  4WJ3 M;  2E2H C;  2KPU A;  1INN A;  3Q3Q A;  4KMA A;  4A3M K;  3GTM A;  4LK1 A;  1Y1W A;  4A3B K;  3HOW K;  3K7A C;  3HOU K;  4A3C C;  1WOO A;  3PO2 C;  3GTQ C;  1J6V A;  4A3F C;  2JA5 C;  1F7U A;  4Y52 K;  2ZJQ S;  4C45 A;  3H0G C;  4A93 K;  1VRQ C;  4OIQ A;  4RMF A;  4LJZ A;  4Y7N C;  1XXC A;  5L46 A;  4MEX A;  3RZO K;  2GAH C;  2O5I A;  2VUM K;  5IYB C;  1DCP A;  4A3L C;  4YFN A;  3TFI A;  3HOZ C;  4BY1 C;  1F7V A;  3M3Y K;  2D6F C;  3CF5 S;  3S2H K;  1TWH A;  4KM8 A;  2Y3P A;  1XPP A;  5M3M K;  1TWF C;  1VLO A;  2V6S A;  1I50 A;  3S16 C;  5FLM K;  2JA6 A;  1TWA A;  3CQZ A;  2NVQ C;  2NVY C;  1IE0 A;  2KQ1 A;  2E2H K;  3GTL C;  1TWC A;  5C3E C;  3GTJ C;  2WAQ L;  5C4X K;  2P8T A;  4GTL A;  3M4O C;  1XZQ A;  1KQ4 A;  1XZQ B;  2YU9 C;  1YCL A;  3K7A K;  4A3C K;  5IYC C;  3SZZ A;  4A3E C;  4A3I C;  4O2D A;  3IPJ A;  2R92 C;  2R93 A;  3PO2 K;  3A8K A;  3GTQ K;  3S1Q C;  4C3H C;  2JA7 C;  1DCO A;  4A3F K;  4LK0 A;  2JA5 K;  1C0A A;  5TMC A;  4BBS C;  2CFA A;  3N3Y A;  3NUH A;  1O25 A;  3H0G K;  2ZUF A;  1EI6 A;  1PJ6 A;  3N0B A;  3BP8 C;  4KB4 A;  3TFH A;  1ZYR A;  5IYB K;  4QIW L;  2NVT C;  4A3B C;  3S2D C;  3HOW C;  1L0W A;  4A3L K;  4G7O A;  1UV7 A;  3HOZ K;  3DXJ A;  4FZB A;  2V6T A;  4BY1 K;  1USO A;  2GSU A;  4Q5S A;  2NVX A;  1YNN A;  1ZXO A;  3GTK A;  5IP7 C;  3FKI C;  2XCR B;  1I3Q C;  3GTO A;  3HOX C;  1WCM K;  4WF9 S;  1J6X A;  1TWF K;  4A3J C;  3GTG A;  1WQH A;  4YG2 A;  1AB4 A;  2NVY K;  1EH1 A;  4LR2 A;  2XCO A;  1JVI A;  2NVQ K;  4M1X A;  2VUM C;  5M5Y K;  3ERE D;  3GTL K;  1ISE A;  2W7V A;  1VJE A;  3M3Y C;  3QX3 A;  2GSN A;  1R9T A;  3M4O K;  3GIR A;  2R7Z C;  2YU9 K;  3GEI A;  3S2H C;  1YNJ A;  1XXA A;  5IYC K;  2E2I A;  1BJT A;  2PA8 L;  4A3E K;  3BP3 A;  2R92 K;  5IOR A;  4C3H K;  2JA7 K;  3PIP S;  4G0W A;  2WB1 L;  3ORE A;  1DD5 A;  4BBS K;  1B4A A;  4WIL A;  3LAJ A;  4Q4Z A;  4KAS A;  4BXX C;  2KWA A;  4KDD A;  2PMZ D;  3G4C A;  4YFK A;  4X6A C;  2WAQ D;  5C4X C;  2NVT K;  4KM9 A;  3S2D K;  4GTB A;  1I6V A;  2B63 A;  1F9N A;  3HKZ L;  1SFO C;  2JA6 C;  5IP7 K;  3FKI K;  1I3Q K;  3S17 K;  1IQ0 A;  5IOT A;  4WJ4 A;  3AD8 C;  3HOX K;  1WOR A;  1TWG A;  4A3J K;  3N0C A;  1RU0 A;  3FOE A;  4KMD A;  2RH6 A;  2PPB A;  4JK1 A;  3GSI A;  2R93 C;  1X31 C;  2KXY A;  1DCH A;  3LPX A;  4GTC A;  2R7Z K;  4A3D C;  2FQO A;  3TFJ A;  3S14 C;  1O26 A;  3S0X A;  1JQW A;  5M5X K;  1WCM C;  4AYB L;  1I6H C;  3H3V L;  3T01 A;  3ADA C;  4BXX K;  3FHZ A;  4WFB S;  4X6A K;  2E2H A;  5D4D A;  5IP9 C;  2NVX C;  1O28 A;  4GTD A;  5IOQ A;  3PO3 C;  4BLA A;  3AD7 C;  4PAB A;  4XLN A;  4IOA S;  4KN7 A;  1F93 A;  3VA7 A;  4OIN A;  4P9S A;  3GTP C;  2JH3 A;  1WSR A;  1SFO K;  1Y1V A;  2JA6 K;  3S1N C;  3GTQ A;  2WB1 D;  3CQZ K;  2JA8 C;  2Y0S D;  3JST A;  1WQF A;  2JA5 A;  3S15 C;  2A6H A;  1WSV A;  1TWC K;  4LQY A;  1EQR A;  3H0G A;  1R9T C;  3SZY A;  1K83 A;  4BKW A;  1USM A;  2R93 K;  4C3I C; 
#chains in the Genus database with same CATH homology
 2R7Z C;  2YU9 K;  1TWH K;  4LLG A;  3S2H C;  1YNJ A;  5IYC K;  4A3K K;  1IW7 A;  4XLP A;  2PA8 L;  4A3E K;  1SMY A;  3PO2 C;  2PA8 D;  3GTQ C;  4A3D K;  3HKZ D;  3GTO C;  2R92 K;  4A3F C;  2JA5 C;  3I4M C;  1I50 K;  4Y52 K;  4C3H K;  3GTG C;  2JA7 K;  3S14 K;  4A3G C;  5TMF A;  2WB1 L;  3S17 C;  3H0G C;  1TWA K;  4A93 K;  4OIQ A;  4BBS K;  4LJZ A;  4C2M C;  4Y7N C;  3GTM C;  2E2J K;  1I6H K;  5IYD K;  4Q4Z A;  3S1R K;  4MEX A;  4BXX C;  2PMZ L;  3RZO K;  4NOI A;  2PMZ D;  1Y1W C;  4YFK A;  4X6A C;  2O5I A;  3I4N C;  5IYB C;  5FJ8 K;  5C4J K;  2VUM K;  4MEY A;  2WAQ D;  4A3L C;  2B63 C;  5C4X C;  4YFN A;  5IP9 K;  3HOZ C;  2NVX K;  2E2I C;  4BY1 C;  2NVT K;  3M3Y K;  3S2D K;  3PO3 K;  1HQM A;  3I4N K;  5M5W K;  1I6V A;  3S2H K;  4C3J K;  3S1M K;  1Y1V K;  4BY7 C;  3GTO K;  3RZD C;  3HKZ L;  3GTP K;  1SFO C;  2JA6 C;  4BBR C;  4KN4 A;  4G7H A;  1XPP A;  3FKI K;  5IP7 K;  5M3M K;  1TWF C;  1I3Q K;  4AYB D;  3S17 K;  3S1N K;  2JA8 K;  3H3V D;  4G7Z A;  3S16 C;  5FLM K;  4Y7N K;  3HOX K;  4A3J K;  3S15 K;  2NVQ C;  2NVY C;  1K83 K;  4MQ9 A;  5C44 C;  4ZH4 A;  4YFX A;  4A3M C;  2E2H K;  3GTL C;  2PPB A;  4JK1 A;  1R9T K;  5C3E C;  3GTJ C;  3HOY C;  2WAQ L;  5C4X K;  3HOU C;  2R93 C;  3HOU K;  3M4O C;  3HOV K;  2A6E A;  3K7A K;  2YU9 C;  1TWH C;  3GTK K;  4A3C K;  4C3I K;  5IYC C;  4A3E C;  4A3I C;  2R7Z K;  4A3D C;  2R92 C;  4OIO A;  3PO2 K;  1I50 C;  4Y52 C;  3S1Q C;  4C3H C;  2JA7 C;  3S14 C;  3GTQ K;  1TWG C;  4A3F K;  4LK0 A;  2JA5 K;  3I4M K;  3GTG K;  1TWA C;  4A93 C;  3CQZ C;  4A3G K;  5TMC A;  4BBS C;  1WCM C;  4QJV B;  4AYB L;  5M5X K;  1I6H C;  3S16 K;  2E2J C;  3H0G K;  3H3V L;  3WOD A;  5M3F K;  1TWC C;  3RZO C;  4C2M K;  3GTM K;  1BDF A;  4GZY A;  5C44 K;  4OIP A;  4BXX K;  5C4J C;  1Y1W K;  4X6A K;  1ZYR A;  5C3E K;  5D4D A;  5IP9 C;  4QIW L;  5IYB K;  2NVX C;  3GTJ K;  2NVT C;  4QIW D;  2BE5 A;  4A3B C;  3S2D C;  3HOW C;  2B63 K;  4A3L K;  3PO3 C;  4G7O A;  3HOZ K;  2E2I K;  3DXJ A;  4BY1 K;  2A68 A;  3EQL A;  2O5J A;  4C3J C;  3S1M C;  1Y1V C;  4XLN A;  4Q5S A;  4KN7 A;  4A3K C;  4A3I K;  1YNN A;  4OIN A;  3GTP C;  4BY7 K;  3S1Q K;  3RZD K;  5IP7 C;  3FKI C;  1TWG K;  1SFO K;  2JA6 K;  1I3Q C;  3S1N C;  2Y0S L;  4BBR K;  2WB1 D;  3CQZ K;  2JA8 C;  2Y0S D;  4KMU A;  5FLM C;  3HOX C;  1TWF K;  1WCM K;  4QJV A;  4A3J C;  2A69 A;  3S15 C;  5IYD C;  2A6H A;  4XSZ A;  1TWC K;  1K83 C;  3S1R C;  2E2H C;  4XSX A;  2CW0 A;  4YG2 A;  4OIR A;  2NVY K;  2NVQ K;  4A3M K;  1R9T C;  4LK1 A;  5M5Y K;  2VUM C;  3GTL K;  4A3B K;  3HOY K;  3HOW K;  3HOV C;  3K7A C;  3GTK C;  3M3Y C;  4A3C C;  2R93 K;  4C3I C;  3M4O K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...