4OIOA

Crystal structure of thermus thermophilus pre-insertion substrate complex for de novo transcription initiation
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
226
structure length
226
Chain Sequence
b'SKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase subunit alpha
publication title GE23077 binds to the RNA polymerase 'i' and 'i+1' sites and prevents the binding of initiating nucleotides.
pubmed rcsb
source organism Thermus thermophilus
molecule tags Transcription, transferase
total genus 50
structure length 226
sequence length 226
chains with identical sequence B
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2014-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01000 RNA_pol_A_bac RNA polymerase Rpb3/RpoA insert domain
A PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain
A PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.12 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 DNA-directed RNA polymerase, insert domain 4oioA02
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 4oioA01
4BY7K 3S1MC 2JA8K 4A3MC 5IYBK 3HOWC 4BY1K 4A3JC 2E2IK 1I6HC 2VUMK 2NVXK 3GTJK 2NVTK 4QJVB 3H0GC 3S16C 5FLMC 5M3FK 2WAQD 4JK1A 3GTOK 3M3YC 4OIRA 2R92C 4A93C 4YFKA 3I4MC 4QIWL 5C4XC 3HOYC 1I50K 3FKIC 1R9TK 5C3EC 2NVQC 2JA5C 1TWHK 3HOVK 4BXXK 1TWGC 3S14C 3H0GK 5IYDC 4XLPA 3HOZC 4G7HA 2B63C 4A3GK 1SFOC 4MEYA 1I6VA 2O5JA 3CQZC 2YU9C 4KMUA 2E2HC 3K7AC 3GTPC 5C4JK 2NVYC 5IYCK 4LLGA 4YFNA 4A3EC 4QIWD 3I4MK 1WCMC 4Y52C 4C3JC 4C3HK 4A3KK 4X6AK 4BBSC 2CW0A 4C3IC 3S17C 4AYBL 3S1QC 3HOZK 3PO2C 3K7AK 3HOUC 3WODA 3GTLK 2A69A 2PMZL 3RZOC 1Y1VC 3S1NK 4A3BC 1TWCK 4BBSK 2JA6C 4AYBD 4A3DC 3HOXC 2WB1L 4A3FC 5M3MK 4A3IK 2JA7C 3PO3K 2A6EA 2PPBA 3S2HC 4MEXA 4C2MC 3HKZL 4A3MK 4Y7NC 3PO2K 3S1MK 3HOWK 1HQMA 2R7ZC 2O5IA 3I4NC 4LK1A 2PMZD 4A3JK 1I6HK 3GTKC 2Y0SL 4OIOA 2WB1D 5TMCA 4MQ9A 3S16K 3S15C 4QJVA 5FLMK 4KN7A 3S1RC 5C44C 3HKZD 4XLNA 1XPPA 2R92K 3EQLA 3M3YK 1K83C 4A93K 4A3CC 5C4XK 3HOYK 3M4OK 3FKIK 4YG2A 5C3EK 4BBRK 3RZDC 2Y0SD 1YNNA 3GTMC 1TWGK 1TWAC 5M5WK 2JA5K 3S14K 5IYDK 4ZH4A 2B63K 1SFOK 1BDFA 3CQZK 5TMFA 3GTGC 2YU9K 5IP7C 2E2HK 3GTPK 4A3LC 4LJZA 2NVYK 5M5XK 4A3EK 1I3QC 1WCMK 4Y52K 4C3JK 1TWFC 2R93C 1Y1WC 5M5YK 4C3IK 3S17K 3GTQC 3S1QK 3S2DC 4G7OA 5D4DA 3HOUK 3DXJA 3M4OC 5IP9C 4C3HC 4BBRC 4BY7C 2JA8C 3RZOK 1Y1VK 5IYBC 4XSXA 4A3BK 2JA6K 4BY1C 4A3DK 3HOXK 4A3FK 4XSZA 2JA7K 2E2IC 2VUMC 2NVXC 3GTJC 2NVTC 3S2HK 4C2MK 1IW7A 4Y7NK 4Q5SA 4G7ZA 2R7ZK 2NVQK 3I4NK 3GTOC 3GTKK 4GZYA 1I50C 2BE5A 1R9TC 3HOVC 4BXXC 1TWHC 3S15K 3S1RK 1SMYA 5C44K 4A3GC 1K83K 4A3CK 2PA8L 4OIQA 5C4JC 5IYCC 3RZDK 3GTMK 4OINA 1TWAK 2A68A 5FJ8K 4A3KC 4Q4ZA 4X6AC 2E2JC 3GTGK 5IP7K 3H3VL 4A3LK 4YFXA 2PA8D 1I3QK 1TWFK 2R93K 1Y1WK 1YNJA 4NOIA 3GTQK 4LK0A 2A6HA 3GTLC 3S1NC 3S2DK 1TWCC 4KN4A 2E2JK 4A3IC 3H3VD 2WAQL 3PO3C 5IP9K 4OIPA 1ZYRA
chains in the Genus database with same CATH superfamily
2JA8K 1WOPA 1O2AA 4G0UA 3GDZA 2VUMK 1XZQA 3H0GC 2L3UA 2WAQD 3N3YA 4KAWX 3GTOK 1O28A 4G0WA 3HXAA 4QIWL 5C4XC 3HOYC 3FKIC 4KARA 3L4JA 5DM6S 2JA5C 3HOVK 3HOZC 4MEYA 1I6VA 2O5JA 2YU9C 2E2HC 3BP3A 3GTLA 2NVYC 4KASA 1B4BA 1F93A 4C3HK 3DLLS 4C3IC 2V6TA 2RH6A 1EQRA 3PO2C 1F7UA 3HOUC 3FOEA 2PMZL 5EGEA 2JA6C 2JA7C 3HKZL 4Y7NC 3LPXA 1HQMA 2R7ZC 3I4NC 2P5MA 2Y3PA 2JH3A 4OIOA 4MQ9A 1UV7A 4IOCS 1WORA 1EI6A 5C44C 1K83C 4A3CC 4GTLA 4LOWA 3GTMA 5C4XK 3HOYK 3FKIK 3RZDC 4C45A 3L4KA 2JA5K 5JVGS 1ZVUA 5TMFA 2YU9K 2E2HK 3GEHA 2NVYK 4LJZA 1Y1VA 3SZZA 4C3IK 1DD5A 5E68A 3S2DC 3AD9C 4KM9A 5D4DA 3HOUK 3DXJA 1WQGA 3M4OC 5IP9C 4GT9A 1F9NA 5L46A 4XSXA 1RU0A 4BY1C 1WSRA 3ADAC 3T00A 2JA6K 2VUMA 1XZQB 2JA7K 3N0BA 2NVXC 3GTJC 4Y7NK 2R7ZK 3I4NK 5DM7S 1I50C 1R9TC 1TWHC 3OREA 5C44K 3V4GA 1I3QA 1K83K 4A3CK 2PA8L 3GTQA 5IYCC 3T02A 3RZDK 4OINA 1J6XA 2A68A 2XCOA 5FJ8K 4X6AC 2E2JC 2KXYA 2E2IA 4PABA 2KWAA 3S1NC 1ZQ1C 3S2DK 1TWCC 2FQTA 2WAQL 3M4OK 5IP9K 3S1MC 1USOA 1YCLA 4BY1K 3H0GA 3LAPA 2NVXK 3GTJK 2ZJRS 5FLMC 1USMA 5JVHS 4P5AA 3FOFA 4LR2A 1G51A 4JK1A 2R92C 4J3NA 2XCRB 1I50K 1R9TK 2NVQC 1TWHK 1F7VA 4U67S 1XXAA 5IYCK 5HL7S 4LLGA 3A8IA 1L0WA 3I4MK 1WCMC 4X6AK 4ILDA 4KC6A 3S17C 1IS1A 3S1QC 3GEIA 1BS2A 4WFNS 3WODA 1ZBSA 1VGXA 3S1NK 4A3BC 1TWCK 4AYBD 3PIOS 3S1MK 4C2MC 1V5VA 1VJEA 1TWGA 1VRQC 2B63A 5IOTA 1SFOA 4BLAA 3CQZA 2W7VA 3GTPA 5FLMK 3BP8C 1XPPA 4GTBA 2R92K 3EQLA 1ISEA 1DCHA 2GSNA 4WJ3M 4AH6A 2NVQK 2Y0SD 1BGWA 4KATA 4KMHA 3GTGC 5IP7C 1O24A 1WCMK 1O2BA 3S17K 3S1QK 4KDDA 3CF5S 3GIRA 1JQWA 4BY7C 5IYBC 4A3BK 1EFWA 4XSZA 2NVTC 4C2MK 5JVOA 1AB4A 1HI9A 3CAGA 1TWAA 4M1XA 1R9TA 4BXXC 1JOEA 3S0XA 5IOSA 1DCPA 2XCQA 4A3GC 1TWFA 1Y1WA 5C4JC 2KQ1A 4A3KC 3GTGK 3GSIA 5IP7K 4YFXA 3AQOA 1PJ6A 4KB4A 4BLBA 3GTLC 3AD7C 4KN4A 2V6SA 4A3IC 3TTGA 3GTOA 4BY7K 3MMLB 4A3MC 1WOSA 5IYBK 4FZBA 4A3JC 2CFAA 1I6HC 2NVTK 4O2DA 2R92A 3M3YC 4A93C 4YFKA 3I4MC 1VLOA 4BXXK 5C3EC 1XXBA 4IOAS 4A3GK 4XLPA 1O25A 2GAHC 4KMUA 1WCMA 5C4JK 2GAGC 4A3KK 4C3JC 4GFQA 4P9SA 2CW0A 4AYBL 4DDQA 3K7AK 1WQFA 1XXCA 3GTLK 1Y1VC 4RMFA 4BBSK 5M3MK 3HOXC 4A3IK 4A3FC 4BKWA 2A6EA 2PPBA 3S2HC 4A3MK 4GTFA 1FEUA 3FKIA 1J6VA 2JA5A 4A3JK 2O5IA 1X31C 4LK1A 1I6HK 3GTKC 2Y0SL 4GTEA 3AQPA 2WB1D 1XZPB 2YU9A 2E2HA 4QJVA 3JSTA 4KN7A 2NVYA 4PAAA 4XLNA 3M3YK 4A93K 3SZYA 1WIHA 3ERED 1PJ5A 5EGHA 4YG2A 5C3EK 5M5WK 1B4AA 3QX3A 4ZH4A 4WFBS 1VH2A 1BDFA 3GEEA 1GE9A 4A3LC 5M5XK 1I3QC 2JA6A 4C3JK 2R93C 2JA7A 3GTQC 2GSOA 4IO9S 2ZFZA 4GTCA 2R7ZA 3TFHA 2ZJPS 1Y1VK 3NUHA 1PJ7A 1KQ4A 1O26A 2CFAB 3HOXK 4A3FK 2E2IC 3S2HK 1K83A 1IW7A 3FHZA 4G7ZA 1O29A 3LYWA 3GTKK 3BUEA 1SMYA 3G4AA 1WOOA 1IBAA 1J98A 4A3LK 5IORA 2EBBA 1I3QK 2R93K 4NOIA 3GTQK 4LK0A 2A6HA 3GTJA 2NVXA 1O27A 1IQ0A 3H3VD 4KMAA 3PO3C 1ZYRA 1WSVA 4LQYA 3LAJA 1I50A 3HOWC 1TWHA 5IOQA 1YX2A 2E2IK 1XZPA 2FQOA 3N0CA 4QJVB 3S16C 2ZUFA 5M3FK 4WJ4A 4OIRA 1O2FB 4G0VA 4WILA 4XCHA 1TWGC 3S14C 3H0GK 5IYDC 4G7HA 2B63C 2KPUA 1SFOC 3CQZC 3GTPC 3K7AC 2L5NA 4YFNA 4A3EC 1TWCA 4QIWD 4GTAA 1INNA 4Y52C 1IL2A 2GSUA 4BBSC 4P5BA 1EH1A 3HOZK 1EK8A 4KM8A 5CHPA 2ZJQS 2A69A 3RZOC 1J6WA 3AH5A 2WB1L 4A3DC 4WCES 3PO3K 4MEXA 3PO2K 3HOWK 2RGRA 3GTKA 1JVIA 1IE0A 2PMZD 3A8KA 3S16K 5TMCA 3S15C 3S1RC 3HKZD 3VA7A 4FM9A 3TFIA 3IPJA 1YNNA 3GTMC 1TWGK 1TWAC 3S14K 5IYDK 5CJ9A 2B63K 1SFOK 3CQZK 1C0AA 3GTPK 3OPFA 2R93A 4A3EK 3G4CA 4Y52K 1TWFC 2PHCB 1Y1WC 5M5YK 4GTDA 4G7OA 3AD8C 4C3HC 4BBRC 2JA8C 3RZOK 4A3DK 2VUMC 2D6FC 4Q5SA 1BJTA 1DCOA 5TJ3A 3T01A 3GTOC 4GZYA 3GTGA 2BE5A 3HOVC 3S15K 3S1RK 1WQHA 4WF9S 3TFJA 3A8JA 3OEPA 4WFAS 4OIQA 2ZUEA 3GTMK 1TWAK 4Q4ZA 3Q3QA 3H3VL 1ZXOA 5HQHA 2P8TA 2PA8D 3PIPS 1TWFK 1Y1WK 1YNJA 4KB2A 4KMDA 5HL8A 2E2JK 5JFEA 2V6UA 4OIPA 4BBRK
chains in the Genus database with same CATH topology
4BY7K 3S1MC 2JA8K 4A3MC 5IYBK 3HOWC 4BY1K 4A3JC 2E2IK 1I6HC 2VUMK 2NVXK 3GTJK 2NVTK 4QJVB 3H0GC 3S16C 5FLMC 5M3FK 2WAQD 4JK1A 3GTOK 3M3YC 4OIRA 2R92C 4A93C 4YFKA 3I4MC 4QIWL 5C4XC 3HOYC 1I50K 3FKIC 1R9TK 5C3EC 2NVQC 2JA5C 1TWHK 3HOVK 4BXXK 1TWGC 3S14C 3H0GK 5IYDC 4XLPA 3HOZC 4G7HA 2B63C 4A3GK 1SFOC 4MEYA 1I6VA 2O5JA 3CQZC 2YU9C 4KMUA 2E2HC 3K7AC 3GTPC 5C4JK 2NVYC 5IYCK 4LLGA 4YFNA 4A3EC 4QIWD 3I4MK 1WCMC 4Y52C 4C3JC 4C3HK 4A3KK 4X6AK 4BBSC 2CW0A 4C3IC 3S17C 4AYBL 3S1QC 3HOZK 3PO2C 3K7AK 3HOUC 3WODA 3GTLK 2A69A 2PMZL 3RZOC 1Y1VC 3S1NK 4A3BC 1TWCK 4BBSK 2JA6C 4AYBD 4A3DC 3HOXC 2WB1L 4A3FC 5M3MK 4A3IK 2JA7C 3PO3K 2A6EA 2PPBA 3S2HC 4MEXA 4C2MC 3HKZL 4A3MK 4Y7NC 3PO2K 3S1MK 3HOWK 1HQMA 2R7ZC 2O5IA 3I4NC 4LK1A 2PMZD 4A3JK 1I6HK 3GTKC 2Y0SL 4OIOA 2WB1D 5TMCA 4MQ9A 3S16K 3S15C 4QJVA 5FLMK 4KN7A 3S1RC 5C44C 3HKZD 4XLNA 1XPPA 2R92K 3EQLA 3M3YK 1K83C 4A93K 4A3CC 5C4XK 3HOYK 3M4OK 3FKIK 4YG2A 5C3EK 4BBRK 3RZDC 2Y0SD 1YNNA 3GTMC 1TWGK 1TWAC 5M5WK 2JA5K 3S14K 5IYDK 4ZH4A 2B63K 1SFOK 1BDFA 3CQZK 5TMFA 3GTGC 2YU9K 5IP7C 2E2HK 3GTPK 4A3LC 4LJZA 2NVYK 5M5XK 4A3EK 1I3QC 1WCMK 4Y52K 4C3JK 1TWFC 2R93C 1Y1WC 5M5YK 4C3IK 3S17K 3GTQC 3S1QK 3S2DC 4G7OA 5D4DA 3HOUK 3DXJA 3M4OC 5IP9C 4C3HC 4BBRC 4BY7C 2JA8C 3RZOK 1Y1VK 5IYBC 4XSXA 4A3BK 2JA6K 4BY1C 4A3DK 3HOXK 4A3FK 4XSZA 2JA7K 2E2IC 2VUMC 2NVXC 3GTJC 2NVTC 3S2HK 4C2MK 1IW7A 4Y7NK 4Q5SA 4G7ZA 2R7ZK 2NVQK 3I4NK 3GTOC 3GTKK 4GZYA 1I50C 2BE5A 1R9TC 3HOVC 4BXXC 1TWHC 3S15K 3S1RK 1SMYA 5C44K 4A3GC 1K83K 4A3CK 2PA8L 4OIQA 5C4JC 5IYCC 3RZDK 3GTMK 4OINA 1TWAK 2A68A 5FJ8K 4A3KC 4Q4ZA 4X6AC 2E2JC 3GTGK 5IP7K 3H3VL 4A3LK 4YFXA 2PA8D 1I3QK 1TWFK 2R93K 1Y1WK 1YNJA 4NOIA 3GTQK 4LK0A 2A6HA 3GTLC 3S1NC 3S2DK 1TWCC 4KN4A 2E2JK 4A3IC 3H3VD 2WAQL 3PO3C 5IP9K 4OIPA 1ZYRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BY7 K;  3S1M C;  2JA8 K;  4A3M C;  5IYB K;  3HOW C;  4BY1 K;  4A3J C;  2E2I K;  1I6H C;  2VUM K;  2NVX K;  3GTJ K;  2NVT K;  4QJV B;  3H0G C;  3S16 C;  5FLM C;  5M3F K;  2WAQ D;  4JK1 A;  3GTO K;  3M3Y C;  4OIR A;  2R92 C;  4A93 C;  4YFK A;  3I4M C;  4QIW L;  5C4X C;  3HOY C;  1I50 K;  3FKI C;  1R9T K;  5C3E C;  2NVQ C;  2JA5 C;  1TWH K;  3HOV K;  4BXX K;  1TWG C;  3S14 C;  3H0G K;  5IYD C;  4XLP A;  3HOZ C;  4G7H A;  2B63 C;  4A3G K;  1SFO C;  4MEY A;  1I6V A;  2O5J A;  3CQZ C;  2YU9 C;  4KMU A;  2E2H C;  3K7A C;  3GTP C;  5C4J K;  2NVY C;  5IYC K;  4LLG A;  4YFN A;  4A3E C;  4QIW D;  3I4M K;  1WCM C;  4Y52 C;  4C3J C;  4C3H K;  4A3K K;  4X6A K;  4BBS C;  2CW0 A;  4C3I C;  3S17 C;  4AYB L;  3S1Q C;  3HOZ K;  3PO2 C;  3K7A K;  3HOU C;  3WOD A;  3GTL K;  2A69 A;  2PMZ L;  3RZO C;  1Y1V C;  3S1N K;  4A3B C;  1TWC K;  4BBS K;  2JA6 C;  4AYB D;  4A3D C;  3HOX C;  2WB1 L;  4A3F C;  5M3M K;  4A3I K;  2JA7 C;  3PO3 K;  2A6E A;  2PPB A;  3S2H C;  4MEX A;  4C2M C;  3HKZ L;  4A3M K;  4Y7N C;  3PO2 K;  3S1M K;  3HOW K;  1HQM A;  2R7Z C;  2O5I A;  3I4N C;  4LK1 A;  2PMZ D;  4A3J K;  1I6H K;  3GTK C;  2Y0S L;  4OIO A;  2WB1 D;  5TMC A;  4MQ9 A;  3S16 K;  3S15 C;  4QJV A;  5FLM K;  4KN7 A;  3S1R C;  5C44 C;  3HKZ D;  4XLN A;  1XPP A;  2R92 K;  3EQL A;  3M3Y K;  1K83 C;  4A93 K;  4A3C C;  5C4X K;  3HOY K;  3M4O K;  3FKI K;  4YG2 A;  5C3E K;  4BBR K;  3RZD C;  2Y0S D;  1YNN A;  3GTM C;  1TWG K;  1TWA C;  5M5W K;  2JA5 K;  3S14 K;  5IYD K;  4ZH4 A;  2B63 K;  1SFO K;  1BDF A;  3CQZ K;  5TMF A;  3GTG C;  2YU9 K;  5IP7 C;  2E2H K;  3GTP K;  4A3L C;  4LJZ A;  2NVY K;  5M5X K;  4A3E K;  1I3Q C;  1WCM K;  4Y52 K;  4C3J K;  1TWF C;  2R93 C;  1Y1W C;  5M5Y K;  4C3I K;  3S17 K;  3GTQ C;  3S1Q K;  3S2D C;  4G7O A;  5D4D A;  3HOU K;  3DXJ A;  3M4O C;  5IP9 C;  4C3H C;  4BBR C;  4BY7 C;  2JA8 C;  3RZO K;  1Y1V K;  5IYB C;  4XSX A;  4A3B K;  2JA6 K;  4BY1 C;  4A3D K;  3HOX K;  4A3F K;  4XSZ A;  2JA7 K;  2E2I C;  2VUM C;  2NVX C;  3GTJ C;  2NVT C;  3S2H K;  4C2M K;  1IW7 A;  4Y7N K;  4Q5S A;  4G7Z A;  2R7Z K;  2NVQ K;  3I4N K;  3GTO C;  3GTK K;  4GZY A;  1I50 C;  2BE5 A;  1R9T C;  3HOV C;  4BXX C;  1TWH C;  3S15 K;  3S1R K;  1SMY A;  5C44 K;  4A3G C;  1K83 K;  4A3C K;  2PA8 L;  4OIQ A;  5C4J C;  5IYC C;  3RZD K;  3GTM K;  4OIN A;  1TWA K;  2A68 A;  5FJ8 K;  4A3K C;  4Q4Z A;  4X6A C;  2E2J C;  3GTG K;  5IP7 K;  3H3V L;  4A3L K;  4YFX A;  2PA8 D;  1I3Q K;  1TWF K;  2R93 K;  1Y1W K;  1YNJ A;  4NOI A;  3GTQ K;  4LK0 A;  2A6H A;  3GTL C;  3S1N C;  3S2D K;  1TWC C;  4KN4 A;  2E2J K;  4A3I C;  3H3V D;  2WAQ L;  3PO3 C;  5IP9 K;  4OIP A;  1ZYR A; 
#chains in the Genus database with same CATH topology
 2JA8 K;  1WOP A;  1O2A A;  4G0U A;  3GDZ A;  2VUM K;  1XZQ A;  3H0G C;  2L3U A;  2WAQ D;  3N3Y A;  4KAW X;  3GTO K;  1O28 A;  4G0W A;  3HXA A;  4QIW L;  5C4X C;  3HOY C;  3FKI C;  4KAR A;  3L4J A;  5DM6 S;  2JA5 C;  3HOV K;  3HOZ C;  4MEY A;  1I6V A;  2O5J A;  2YU9 C;  2E2H C;  3BP3 A;  3GTL A;  2NVY C;  4KAS A;  1B4B A;  1F93 A;  4C3H K;  3DLL S;  4C3I C;  2V6T A;  2RH6 A;  1EQR A;  3PO2 C;  1F7U A;  3HOU C;  3FOE A;  2PMZ L;  5EGE A;  2JA6 C;  2JA7 C;  3HKZ L;  4Y7N C;  3LPX A;  1HQM A;  2R7Z C;  3I4N C;  2P5M A;  2Y3P A;  2JH3 A;  4OIO A;  4MQ9 A;  1UV7 A;  4IOC S;  1WOR A;  1EI6 A;  5C44 C;  1K83 C;  4A3C C;  4GTL A;  4LOW A;  3GTM A;  5C4X K;  3HOY K;  3FKI K;  3RZD C;  4C45 A;  3L4K A;  2JA5 K;  5JVG S;  1ZVU A;  5TMF A;  2YU9 K;  2E2H K;  3GEH A;  2NVY K;  4LJZ A;  1Y1V A;  3SZZ A;  4C3I K;  1DD5 A;  5E68 A;  3S2D C;  3AD9 C;  4KM9 A;  5D4D A;  3HOU K;  3DXJ A;  1WQG A;  3M4O C;  5IP9 C;  4GT9 A;  1F9N A;  5L46 A;  4XSX A;  1RU0 A;  4BY1 C;  1WSR A;  3ADA C;  3T00 A;  2JA6 K;  2VUM A;  1XZQ B;  2JA7 K;  3N0B A;  2NVX C;  3GTJ C;  4Y7N K;  2R7Z K;  3I4N K;  5DM7 S;  1I50 C;  1R9T C;  1TWH C;  3ORE A;  5C44 K;  3V4G A;  1I3Q A;  1K83 K;  4A3C K;  2PA8 L;  3GTQ A;  5IYC C;  3T02 A;  3RZD K;  4OIN A;  1J6X A;  2A68 A;  2XCO A;  5FJ8 K;  4X6A C;  2E2J C;  2KXY A;  2E2I A;  4PAB A;  2KWA A;  3S1N C;  1ZQ1 C;  3S2D K;  1TWC C;  2FQT A;  2WAQ L;  3M4O K;  5IP9 K;  3S1M C;  1USO A;  1YCL A;  4BY1 K;  3H0G A;  3LAP A;  2NVX K;  3GTJ K;  2ZJR S;  5FLM C;  1USM A;  5JVH S;  4P5A A;  3FOF A;  4LR2 A;  1G51 A;  4JK1 A;  2R92 C;  4J3N A;  2XCR B;  1I50 K;  1R9T K;  2NVQ C;  1TWH K;  1F7V A;  4U67 S;  1XXA A;  5IYC K;  5HL7 S;  4LLG A;  3A8I A;  1L0W A;  3I4M K;  1WCM C;  4X6A K;  4ILD A;  4KC6 A;  3S17 C;  1IS1 A;  3S1Q C;  3GEI A;  1BS2 A;  4WFN S;  3WOD A;  1ZBS A;  1VGX A;  3S1N K;  4A3B C;  1TWC K;  4AYB D;  3PIO S;  3S1M K;  4C2M C;  1V5V A;  1VJE A;  1TWG A;  1VRQ C;  2B63 A;  5IOT A;  1SFO A;  4BLA A;  3CQZ A;  2W7V A;  3GTP A;  5FLM K;  3BP8 C;  1XPP A;  4GTB A;  2R92 K;  3EQL A;  1ISE A;  1DCH A;  2GSN A;  4WJ3 M;  4AH6 A;  2NVQ K;  2Y0S D;  1BGW A;  4KAT A;  4KMH A;  3GTG C;  5IP7 C;  1O24 A;  1WCM K;  1O2B A;  3S17 K;  3S1Q K;  4KDD A;  3CF5 S;  3GIR A;  1JQW A;  4BY7 C;  5IYB C;  4A3B K;  1EFW A;  4XSZ A;  2NVT C;  4C2M K;  5JVO A;  1AB4 A;  1HI9 A;  3CAG A;  1TWA A;  4M1X A;  1R9T A;  4BXX C;  1JOE A;  3S0X A;  5IOS A;  1DCP A;  2XCQ A;  4A3G C;  1TWF A;  1Y1W A;  5C4J C;  2KQ1 A;  4A3K C;  3GTG K;  3GSI A;  5IP7 K;  4YFX A;  3AQO A;  1PJ6 A;  4KB4 A;  4BLB A;  3GTL C;  3AD7 C;  4KN4 A;  2V6S A;  4A3I C;  3TTG A;  3GTO A;  4BY7 K;  3MML B;  4A3M C;  1WOS A;  5IYB K;  4FZB A;  4A3J C;  2CFA A;  1I6H C;  2NVT K;  4O2D A;  2R92 A;  3M3Y C;  4A93 C;  4YFK A;  3I4M C;  1VLO A;  4BXX K;  5C3E C;  1XXB A;  4IOA S;  4A3G K;  4XLP A;  1O25 A;  2GAH C;  4KMU A;  1WCM A;  5C4J K;  2GAG C;  4A3K K;  4C3J C;  4GFQ A;  4P9S A;  2CW0 A;  4AYB L;  4DDQ A;  3K7A K;  1WQF A;  1XXC A;  3GTL K;  1Y1V C;  4RMF A;  4BBS K;  5M3M K;  3HOX C;  4A3I K;  4A3F C;  4BKW A;  2A6E A;  2PPB A;  3S2H C;  4A3M K;  4GTF A;  1FEU A;  3FKI A;  1J6V A;  2JA5 A;  4A3J K;  2O5I A;  1X31 C;  4LK1 A;  1I6H K;  3GTK C;  2Y0S L;  4GTE A;  3AQP A;  2WB1 D;  1XZP B;  2YU9 A;  2E2H A;  4QJV A;  3JST A;  4KN7 A;  2NVY A;  4PAA A;  4XLN A;  3M3Y K;  4A93 K;  3SZY A;  1WIH A;  3ERE D;  1PJ5 A;  5EGH A;  4YG2 A;  5C3E K;  5M5W K;  1B4A A;  3QX3 A;  4ZH4 A;  4WFB S;  1VH2 A;  1BDF A;  3GEE A;  1GE9 A;  4A3L C;  5M5X K;  1I3Q C;  2JA6 A;  4C3J K;  2R93 C;  2JA7 A;  3GTQ C;  2GSO A;  4IO9 S;  2ZFZ A;  4GTC A;  2R7Z A;  3TFH A;  2ZJP S;  1Y1V K;  3NUH A;  1PJ7 A;  1KQ4 A;  1O26 A;  2CFA B;  3HOX K;  4A3F K;  2E2I C;  3S2H K;  1K83 A;  1IW7 A;  3FHZ A;  4G7Z A;  1O29 A;  3LYW A;  3GTK K;  3BUE A;  1SMY A;  3G4A A;  1WOO A;  1IBA A;  1J98 A;  4A3L K;  5IOR A;  2EBB A;  1I3Q K;  2R93 K;  4NOI A;  3GTQ K;  4LK0 A;  2A6H A;  3GTJ A;  2NVX A;  1O27 A;  1IQ0 A;  3H3V D;  4KMA A;  3PO3 C;  1ZYR A;  1WSV A;  4LQY A;  3LAJ A;  1I50 A;  3HOW C;  1TWH A;  5IOQ A;  1YX2 A;  2E2I K;  1XZP A;  2FQO A;  3N0C A;  4QJV B;  3S16 C;  2ZUF A;  5M3F K;  4WJ4 A;  4OIR A;  1O2F B;  4G0V A;  4WIL A;  4XCH A;  1TWG C;  3S14 C;  3H0G K;  5IYD C;  4G7H A;  2B63 C;  2KPU A;  1SFO C;  3CQZ C;  3GTP C;  3K7A C;  2L5N A;  4YFN A;  4A3E C;  1TWC A;  4QIW D;  4GTA A;  1INN A;  4Y52 C;  1IL2 A;  2GSU A;  4BBS C;  4P5B A;  1EH1 A;  3HOZ K;  1EK8 A;  4KM8 A;  5CHP A;  2ZJQ S;  2A69 A;  3RZO C;  1J6W A;  3AH5 A;  2WB1 L;  4A3D C;  4WCE S;  3PO3 K;  4MEX A;  3PO2 K;  3HOW K;  2RGR A;  3GTK A;  1JVI A;  1IE0 A;  2PMZ D;  3A8K A;  3S16 K;  5TMC A;  3S15 C;  3S1R C;  3HKZ D;  3VA7 A;  4FM9 A;  3TFI A;  3IPJ A;  1YNN A;  3GTM C;  1TWG K;  1TWA C;  3S14 K;  5IYD K;  5CJ9 A;  2B63 K;  1SFO K;  3CQZ K;  1C0A A;  3GTP K;  3OPF A;  2R93 A;  4A3E K;  3G4C A;  4Y52 K;  1TWF C;  2PHC B;  1Y1W C;  5M5Y K;  4GTD A;  4G7O A;  3AD8 C;  4C3H C;  4BBR C;  2JA8 C;  3RZO K;  4A3D K;  2VUM C;  2D6F C;  4Q5S A;  1BJT A;  1DCO A;  5TJ3 A;  3T01 A;  3GTO C;  4GZY A;  3GTG A;  2BE5 A;  3HOV C;  3S15 K;  3S1R K;  1WQH A;  4WF9 S;  3TFJ A;  3A8J A;  3OEP A;  4WFA S;  4OIQ A;  2ZUE A;  3GTM K;  1TWA K;  4Q4Z A;  3Q3Q A;  3H3V L;  1ZXO A;  5HQH A;  2P8T A;  2PA8 D;  3PIP S;  1TWF K;  1Y1W K;  1YNJ A;  4KB2 A;  4KMD A;  5HL8 A;  2E2J K;  5JFE A;  2V6U A;  4OIP A;  4BBR K; 
#chains in the Genus database with same CATH homology
 4BY7 K;  3S1M C;  2JA8 K;  4A3M C;  5IYB K;  3HOW C;  4BY1 K;  4A3J C;  2E2I K;  1I6H C;  2VUM K;  2NVX K;  3GTJ K;  2NVT K;  4QJV B;  3H0G C;  3S16 C;  5FLM C;  5M3F K;  2WAQ D;  4JK1 A;  3GTO K;  3M3Y C;  4OIR A;  2R92 C;  4A93 C;  4YFK A;  3I4M C;  4QIW L;  5C4X C;  3HOY C;  1I50 K;  3FKI C;  1R9T K;  5C3E C;  2NVQ C;  2JA5 C;  1TWH K;  3HOV K;  4BXX K;  1TWG C;  3S14 C;  3H0G K;  5IYD C;  4XLP A;  3HOZ C;  4G7H A;  2B63 C;  4A3G K;  1SFO C;  4MEY A;  1I6V A;  2O5J A;  3CQZ C;  2YU9 C;  4KMU A;  2E2H C;  3K7A C;  3GTP C;  5C4J K;  2NVY C;  5IYC K;  4LLG A;  4YFN A;  4A3E C;  4QIW D;  3I4M K;  1WCM C;  4Y52 C;  4C3J C;  4C3H K;  4A3K K;  4X6A K;  4BBS C;  2CW0 A;  4C3I C;  3S17 C;  4AYB L;  3S1Q C;  3HOZ K;  3PO2 C;  3K7A K;  3HOU C;  3WOD A;  3GTL K;  2A69 A;  2PMZ L;  3RZO C;  1Y1V C;  3S1N K;  4A3B C;  1TWC K;  4BBS K;  2JA6 C;  4AYB D;  4A3D C;  3HOX C;  2WB1 L;  4A3F C;  5M3M K;  4A3I K;  2JA7 C;  3PO3 K;  2A6E A;  2PPB A;  3S2H C;  4MEX A;  4C2M C;  3HKZ L;  4A3M K;  4Y7N C;  3PO2 K;  3S1M K;  3HOW K;  1HQM A;  2R7Z C;  2O5I A;  3I4N C;  4LK1 A;  2PMZ D;  4A3J K;  1I6H K;  3GTK C;  2Y0S L;  4OIO A;  2WB1 D;  5TMC A;  4MQ9 A;  3S16 K;  3S15 C;  4QJV A;  5FLM K;  4KN7 A;  3S1R C;  5C44 C;  3HKZ D;  4XLN A;  1XPP A;  2R92 K;  3EQL A;  3M3Y K;  1K83 C;  4A93 K;  4A3C C;  5C4X K;  3HOY K;  3M4O K;  3FKI K;  4YG2 A;  5C3E K;  4BBR K;  3RZD C;  2Y0S D;  1YNN A;  3GTM C;  1TWG K;  1TWA C;  5M5W K;  2JA5 K;  3S14 K;  5IYD K;  4ZH4 A;  2B63 K;  1SFO K;  1BDF A;  3CQZ K;  5TMF A;  3GTG C;  2YU9 K;  5IP7 C;  2E2H K;  3GTP K;  4A3L C;  4LJZ A;  2NVY K;  5M5X K;  4A3E K;  1I3Q C;  1WCM K;  4Y52 K;  4C3J K;  1TWF C;  2R93 C;  1Y1W C;  5M5Y K;  4C3I K;  3S17 K;  3GTQ C;  3S1Q K;  3S2D C;  4G7O A;  5D4D A;  3HOU K;  3DXJ A;  3M4O C;  5IP9 C;  4C3H C;  4BBR C;  4BY7 C;  2JA8 C;  3RZO K;  1Y1V K;  5IYB C;  4XSX A;  4A3B K;  2JA6 K;  4BY1 C;  4A3D K;  3HOX K;  4A3F K;  4XSZ A;  2JA7 K;  2E2I C;  2VUM C;  2NVX C;  3GTJ C;  2NVT C;  3S2H K;  4C2M K;  1IW7 A;  4Y7N K;  4Q5S A;  4G7Z A;  2R7Z K;  2NVQ K;  3I4N K;  3GTO C;  3GTK K;  4GZY A;  1I50 C;  2BE5 A;  1R9T C;  3HOV C;  4BXX C;  1TWH C;  3S15 K;  3S1R K;  1SMY A;  5C44 K;  4A3G C;  1K83 K;  4A3C K;  2PA8 L;  4OIQ A;  5C4J C;  5IYC C;  3RZD K;  3GTM K;  4OIN A;  1TWA K;  2A68 A;  5FJ8 K;  4A3K C;  4Q4Z A;  4X6A C;  2E2J C;  3GTG K;  5IP7 K;  3H3V L;  4A3L K;  4YFX A;  2PA8 D;  1I3Q K;  1TWF K;  2R93 K;  1Y1W K;  1YNJ A;  4NOI A;  3GTQ K;  4LK0 A;  2A6H A;  3GTL C;  3S1N C;  3S2D K;  1TWC C;  4KN4 A;  2E2J K;  4A3I C;  3H3V D;  2WAQ L;  3PO3 C;  5IP9 K;  4OIP A;  1ZYR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...