4OINA

Crystal structure of thermus thermophilus transcription initiation complex soaked with ge23077
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
231
structure length
231
Chain Sequence
SKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQAAAVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription, transferase/antibiotic
molecule keywords DNA-directed RNA polymerase subunit alpha
publication title GE23077 binds to the RNA polymerase 'i' and 'i+1' sites and prevents the binding of initiating nucleotides.
pubmed rcsb
source organism Thermus thermophilus
total genus 48
structure length 231
sequence length 231
chains with identical sequence B
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2014-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01000 RNA_pol_A_bac RNA polymerase Rpb3/RpoA insert domain
A PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain
A PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.12 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 DNA-directed RNA polymerase, insert domain 4oinA02
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 4oinA01
4OIOA 3DXJA 3FKIC 5TMFA 4A3LC 1BDFA 4G7ZA 4AYBL 2NVXK 2WB1D 3S14K 4A93K 1Y1WK 3EQLA 3S15C 4BY7C 1SFOC 5C3EC 3S14C 4A93C 4KMUA 3S1RK 3GTJC 2BE5A 3GTGC 1XPPA 2R7ZK 4A3IK 1TWAK 3I4NC 2E2HK 2JA6C 4G7HA 1ZYRA 2E2IC 1R9TK 1TWAC 4OIRA 2NVQC 2E2HC 2WAQD 4A3FK 3GTPK 3M3YC 3M4OK 1I6HK 1R9TC 4A3KK 4BY1K 2A68A 3RZOK 2NVYC 4A3FC 1K83K 1TWFK 4BBSC 3HOYK 5IYDK 5IYBK 3HOUK 5IP7K 1TWFC 1K83C 3HOZK 2PMZL 4A3CK 1TWCK 4LK0A 2JA7K 3S17K 3RZDK 4LLGA 3S1NC 5IP9K 5FLMK 4C3HC 4OIQA 2R92C 4XLPA 4Y7NC 5FLMC 3HOVC 3K7AK 4QIWL 2JA5K 4Q5SA 5C4XC 2B63K 4A3BK 2O5JA 2PPBA 1SMYA 1I50C 3S2HK 3GTOC 5D4DA 5C4JK 5IYCK 3S2HC 1YNJA 4MEXA 2NVXC 1Y1WC 2PMZD 3GTKK 1HQMA 3S1RC 1Y1VK 3GTOK 4A3GK 2R7ZC 4BBRK 4A3IC 3PO2K 2Y0SL 4A3DK 3S16K 3PO2C 3M4OC 1I6HC 4C3IK 3GTPC 5FJ8K 4A3MK 4Y52K 4BXXK 4A3KC 2A6EA 4AYBD 4BY1C 3RZOC 5IYDC 4A3EK 2YU9K 3HOYC 4MQ9A 5C44K 5IYBC 3HOUC 5IP7C 4A3EC 3HOZC 4A3JK 2VUMK 4XSZA 5C44C 5M5XK 2PA8L 4A3CC 1TWCC 3HOXK 4YG2A 2JA7C 3S17C 3HKZL 2NVTK 3RZDC 4C2MK 3S1MK 5IP9C 3H3VL 1IW7A 4A3BC 3K7AC 3WODA 2B63C 2JA5C 3GTQK 1TWGK 3S2DK 3PO3K 5C4JC 5IYCC 2CW0A 3CQZK 1I6VA 4G7OA 1WCMK 3GTKC 3CQZC 3GTLK 1Y1VC 4ZH4A 1YNNA 4A3GC 3S1QK 4BBRC 4QIWD 5M3FK 4OIPA 3GTLC 2E2JK 3GTMK 4C3JK 3H0GK 2JA8K 1TWHK 4A3DC 3S16C 3I4MK 4YFKA 4C3IC 5M5WK 4A3MC 4Y52C 2O5IA 4BXXC 5TMCA 2YU9C 2WAQL 3FKIK 4A3LK 4X6AK 4NOIA 3S15K 2VUMC 4A3JC 1SFOK 2A69A 4MEYA 4X6AC 5C3EK 3HOWK 4BY7K 4JK1A 3GTJK 3HOXC 4Q4ZA 2Y0SD 2NVTC 2A6HA 3HOWC 3GTGK 4C2MC 3S1MC 5M3MK 5M5YK 2JA6K 3I4NK 4LJZA 2E2IK 4YFNA 4XLNA 2NVQK 3M3YK 3GTQC 1I3QK 4OINA 2NVYK 1TWGC 4BBSK 1I3QC 3S2DC 3PO3C 4XSXA 4KN4A 2PA8D 4KN7A 4GZYA 2WB1L 3HKZD 1WCMC 4LK1A 3H3VD 4QJVB 3S1NK 3S1QC 4C3HK 2R92K 2E2JC 3GTMC 4C3JC 3H0GC 2JA8C 1TWHC 4QJVA 3I4MC 5C4XK 4YFXA 4Y7NK 3HOVK 2R93K 1I50K 2R93C
chains in the Genus database with same CATH superfamily
1EQRA 3LYWA 1ZVUA 2NVXK 1Y1WK 3S14C 1WORA 1XXBA 2BE5A 3GTGC 5JVOA 3I4NC 2JA6C 4OIRA 2E2HC 2WAQD 3GTLA 3S0XA 3RZOK 2GSNA 1TWFK 4A3FC 5IYDK 4BBSC 3H0GA 1TWHA 3HOZK 4GTLA 1TWCK 3FKIA 2VUMA 2ZJPS 3RZDK 4LLGA 3S1NC 5FLMK 4OIQA 1SFOA 2R92C 4A3BK 3GTJA 1WQGA 4QIWL 4Q5SA 3BUEA 3TFIA 3S2HK 1ZQ1C 2JH3A 5D4DA 2EBBA 5C4JK 1YNJA 2KWAA 3GTKK 5DM7S 2V6SA 4BLAA 1Y1VK 3GSIA 1WQHA 1IQ0A 3GTPC 5FJ8K 2A6EA 2YU9K 1GE9A 1BS2A 4MQ9A 3GDZA 1I50A 5C44C 4M1XA 1USOA 2FQOA 5IP9C 4WFNS 2B63C 1KQ4A 2GSUA 5JVGS 3N0BA 3N3YA 3CF5S 2R7ZA 1YX2A 2E2HA 4GTFA 3CQZK 4U67S 3MMLB 1F7UA 2D6FC 4BBRC 4QIWD 5M3FK 1EFWA 3GTMK 4C3JK 4A3DC 2JA7A 4C3IC 3HXAA 5M5WK 2GAGC 4LQYA 2PHCB 4A3LK 2JA5A 4KATA 4NOIA 4A3JC 5E68A 4JK1A 3HOXC 2A6HA 5IOQA 3BP8C 2NVQK 1XZPA 1IE0A 1I3QC 3FOFA 3QX3A 4KN4A 1WOOA 4P9SA 1O2BA 1F93A 4LK1A 1EI6A 1JOEA 4GTBA 2ZJRS 3LAJA 3AD8C 1O24A 4Y7NK 3H0GC 3HOVK 1TWHC 1B4AA 3SZZA 4YFXA 5C4XK 1YCLA 4P5AA 2B63A 2R93C 1VJEA 3DXJA 3FKIC 1RU0A 4LOWA 1O27A 3GTQA 3EQLA 3S15C 1SFOC 1JVIA 5C3EC 1WSVA 3PIOS 4KMUA 1TWGA 3S1RK 3GTJC 1XPPA 4A3IK 4G7HA 1FEUA 1J6VA 3M4OK 1I6HK 3M3YC 2NVYC 1K83K 3T01A 5IYBK 1JQWA 5IP7K 1TWFC 1ZXOA 1DCHA 4A3CK 3S17K 1EH1A 4C3HC 4XLPA 5FLMC 3OEPA 4FZBA 3SZYA 2O5JA 1SMYA 1I50C 2E2IA 5IYCK 3S2HC 4MEXA 1I3QA 3G4CA 2PMZD 1BGWA 2P8TA 4AH6A 4A3GK 5HQHA 2R7ZC 1XXCA 3GEEA 4KMDA 4A3MK 4BXXK 4A3KC 4BY1C 3HOYC 1O2AA 2R93A 3HOUC 2V6TA 2VUMK 2Y3PA 5M5XK 4GTAA 3GTOA 2PA8L 2JA7C 3HKZL 2NVXA 4C2MK 1Y1WA 1C0AA 3VA7A 1IW7A 3K7AC 2FQTA 2JA5C 1XZPB 2KXYA 4WJ4A 2CW0A 2NVYA 4G7OA 1WCMK 1TWFA 3CQZC 2CFAB 1DCOA 3S1QK 3S16C 4G0VA 3A8KA 4Y52C 4LR2A 5TMCA 4X6AK 3A8IA 2A69A 1WOSA 2NVTC 3GTGK 1O2FB 3S1MC 3I4NK 2JA6K 3GTKA 1J98A 4YFNA 4PAAA 1Y1VA 3GTQC 3Q3QA 1TWGC 4BBSK 3S2DC 3TFHA 3PO3C 3DLLS 2PA8D 4KN7A 3HKZD 1XXAA 1B4BA 2YU9A 3TFJA 1WOPA 5DM6S 4QJVB 3S1NK 1VRQC 5EGHA 2R92K 2E2JC 1X31C 2JA8C 3I4MC 1O26A 4OIOA 5TMFA 5HL7S 1BDFA 1WQFA 4G7ZA 3IPJA 4AYBL 2WB1D 1INNA 4A93K 4BY7C 4RMFA 3GEIA 1V5VA 3OPFA 4KM8A 3CQZA 1TWAK 1VH2A 2ZUFA 3ERED 2E2IC 1R9TK 3GTPK 1G51A 3GTMA 3CAGA 2RGRA 3AD9C 1K83C 1O29A 4KC6A 2PMZL 3AQOA 4LK0A 4KARA 3JSTA 5IP9K 1PJ7A 2RH6A 2B63K 2XCOA 2PPBA 4GFQA 3GTOC 2NVXC 5CHPA 1Y1WC 4WF9S 1VGXA 4O2DA 4ILDA 4BBRK 1L0WA 3PO2K 5TJ3A 2Y0SL 4A3DK 4C3IK 1J6WA 4C45A 1IBAA 5IOSA 4AYBD 3RZOC 5IYDC 4A3EK 4G0WA 4J3NA 3HOZC 4KB2A 4A3JK 3AD7C 1F9NA 1TWCC 1IS1A 2ZFZA 3HOXK 3RZDC 5CJ9A 2ZUEA 3H3VL 3ADAC 4A3BC 4G0UA 5C4JC 2L3UA 1F7VA 1WIHA 4GTCA 4WFBS 3GTKC 1K83A 3GTLK 1Y1VC 4ZH4A 4FM9A 1YNNA 2KQ1A 4OIPA 3H0GK 1TWHK 4GT9A 3FHZA 2O5IA 2YU9C 3FKIK 2P5MA 5JVHS 3S15K 2KPUA 3AQPA 4MEYA 4X6AC 5C3EK 1SFOK 3HOWK 5IORA 3GTJK 2Y0SD 1IL2A 1BJTA 5M3MK 5M5YK 3M3YK 4OINA 2NVYK 5HL8A 4GTDA 2WB1L 1EK8A 5IOTA 3OREA 2W7VA 3H3VD 4P5BA 1TWCA 4C3HK 3GTMC 4C3JC 1O25A 1XZQA 2V6UA 2GSOA 1I50K 5JFEA 4KAWX 4A3LC 3LAPA 3S14K 1USMA 2L5NA 4A93C 2XCQA 4KM9A 2R7ZK 1O28A 3T00A 1WCMA 2E2HK 3GEHA 1ZYRA 1TWAC 2NVQC 4KB4A 4A3FK 1HI9A 1R9TC 4A3KK 4BY1K 2A68A 1UV7A 3HOYK 3HOUK 3LPXA 1WSRA 2JA7K 4XCHA 4WCES 4Y7NC 1AB4A 3HOVC 1PJ5A 3K7AK 2JA5K 5C4XC 4DDQA 3GTGA 2JA6A 2ZJQS 3L4JA 3AH5A 4BKWA 3FOEA 4PABA 3TTGA 1HQMA 3S1RC 4KMHA 4A3IC 4GTEA 4BLBA 3S16K 3PO2C 3M4OC 1I6HC 4Y52K 5L46A 2R92A 3L4KA 5C44K 5IYBC 5IP7C 1PJ6A 4A3EC 1ZBSA 3N0CA 4XSZA 4A3CC 2GAHC 4YG2A 3S17C 4KMAA 2NVTK 4WILA 3S1MK 2XCRB 4IOCS 3WODA 3GTQK 1TWAA 1TWGK 3NUHA 3S2DK 3PO3K 5IYCC 4KDDA 1R9TA 4WJ3M 3GTPA 1I6VA 1ISEA 4A3GC 3GTLC 1VLOA 2E2JK 4WFAS 2CFAA 2JA8K 3I4MK 1XZQB 4YFKA 3PIPS 4A3MC 3A8JA 4BXXC 4KASA 3V4GA 2WAQL 4IO9S 2VUMC 4BY7K 3BP3A 3GIRA 4Q4ZA 1J6XA 3HOWC 4C2MC 3T02A 1DD5A 4LJZA 2E2IK 4XLNA 3G4AA 1I3QK 4IOAS 4XSXA 4GZYA 1WCMC 5EGEA 3S1QC 1DCPA 4QJVA 2R93K 3GTOK
chains in the Genus database with same CATH topology
4OIOA 3DXJA 3FKIC 5TMFA 4A3LC 1BDFA 4G7ZA 4AYBL 2NVXK 2WB1D 3S14K 4A93K 1Y1WK 3EQLA 3S15C 4BY7C 1SFOC 5C3EC 3S14C 4A93C 4KMUA 3S1RK 3GTJC 2BE5A 3GTGC 1XPPA 2R7ZK 4A3IK 1TWAK 3I4NC 2E2HK 2JA6C 4G7HA 1ZYRA 2E2IC 1R9TK 1TWAC 4OIRA 2NVQC 2E2HC 2WAQD 4A3FK 3GTPK 3M3YC 3M4OK 1I6HK 1R9TC 4A3KK 4BY1K 2A68A 3RZOK 2NVYC 4A3FC 1K83K 1TWFK 4BBSC 3HOYK 5IYDK 5IYBK 3HOUK 5IP7K 1TWFC 1K83C 3HOZK 2PMZL 4A3CK 1TWCK 4LK0A 2JA7K 3S17K 3RZDK 4LLGA 3S1NC 5IP9K 5FLMK 4C3HC 4OIQA 2R92C 4XLPA 4Y7NC 5FLMC 3HOVC 3K7AK 4QIWL 2JA5K 4Q5SA 5C4XC 2B63K 4A3BK 2O5JA 2PPBA 1SMYA 1I50C 3S2HK 3GTOC 5D4DA 5C4JK 5IYCK 3S2HC 1YNJA 4MEXA 2NVXC 1Y1WC 2PMZD 3GTKK 1HQMA 3S1RC 1Y1VK 3GTOK 4A3GK 2R7ZC 4BBRK 4A3IC 3PO2K 2Y0SL 4A3DK 3S16K 3PO2C 3M4OC 1I6HC 4C3IK 3GTPC 5FJ8K 4A3MK 4Y52K 4BXXK 4A3KC 2A6EA 4AYBD 4BY1C 3RZOC 5IYDC 4A3EK 2YU9K 3HOYC 4MQ9A 5C44K 5IYBC 3HOUC 5IP7C 4A3EC 3HOZC 4A3JK 2VUMK 4XSZA 5C44C 5M5XK 2PA8L 4A3CC 1TWCC 3HOXK 4YG2A 2JA7C 3S17C 3HKZL 2NVTK 3RZDC 4C2MK 3S1MK 5IP9C 3H3VL 1IW7A 4A3BC 3K7AC 3WODA 2B63C 2JA5C 3GTQK 1TWGK 3S2DK 3PO3K 5C4JC 5IYCC 2CW0A 3CQZK 1I6VA 4G7OA 1WCMK 3GTKC 3CQZC 3GTLK 1Y1VC 4ZH4A 1YNNA 4A3GC 3S1QK 4BBRC 4QIWD 5M3FK 4OIPA 3GTLC 2E2JK 3GTMK 4C3JK 3H0GK 2JA8K 1TWHK 4A3DC 3S16C 3I4MK 4YFKA 4C3IC 5M5WK 4A3MC 4Y52C 2O5IA 4BXXC 5TMCA 2YU9C 2WAQL 3FKIK 4A3LK 4X6AK 4NOIA 3S15K 2VUMC 4A3JC 1SFOK 2A69A 4MEYA 4X6AC 5C3EK 3HOWK 4BY7K 4JK1A 3GTJK 3HOXC 4Q4ZA 2Y0SD 2NVTC 2A6HA 3HOWC 3GTGK 4C2MC 3S1MC 5M3MK 5M5YK 2JA6K 3I4NK 4LJZA 2E2IK 4YFNA 4XLNA 2NVQK 3M3YK 3GTQC 1I3QK 4OINA 2NVYK 1TWGC 4BBSK 1I3QC 3S2DC 3PO3C 4XSXA 4KN4A 2PA8D 4KN7A 4GZYA 2WB1L 3HKZD 1WCMC 4LK1A 3H3VD 4QJVB 3S1NK 3S1QC 4C3HK 2R92K 2E2JC 3GTMC 4C3JC 3H0GC 2JA8C 1TWHC 4QJVA 3I4MC 5C4XK 4YFXA 4Y7NK 3HOVK 2R93K 1I50K 2R93C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OIO A;  3DXJ A;  3FKI C;  5TMF A;  4A3L C;  1BDF A;  4G7Z A;  4AYB L;  2NVX K;  2WB1 D;  3S14 K;  4A93 K;  1Y1W K;  3EQL A;  3S15 C;  4BY7 C;  1SFO C;  5C3E C;  3S14 C;  4A93 C;  4KMU A;  3S1R K;  3GTJ C;  2BE5 A;  3GTG C;  1XPP A;  2R7Z K;  4A3I K;  1TWA K;  3I4N C;  2E2H K;  2JA6 C;  4G7H A;  1ZYR A;  2E2I C;  1R9T K;  1TWA C;  4OIR A;  2NVQ C;  2E2H C;  2WAQ D;  4A3F K;  3GTP K;  3M3Y C;  3M4O K;  1I6H K;  1R9T C;  4A3K K;  4BY1 K;  2A68 A;  3RZO K;  2NVY C;  4A3F C;  1K83 K;  1TWF K;  4BBS C;  3HOY K;  5IYD K;  5IYB K;  3HOU K;  5IP7 K;  1TWF C;  1K83 C;  3HOZ K;  2PMZ L;  4A3C K;  1TWC K;  4LK0 A;  2JA7 K;  3S17 K;  3RZD K;  4LLG A;  3S1N C;  5IP9 K;  5FLM K;  4C3H C;  4OIQ A;  2R92 C;  4XLP A;  4Y7N C;  5FLM C;  3HOV C;  3K7A K;  4QIW L;  2JA5 K;  4Q5S A;  5C4X C;  2B63 K;  4A3B K;  2O5J A;  2PPB A;  1SMY A;  1I50 C;  3S2H K;  3GTO C;  5D4D A;  5C4J K;  5IYC K;  3S2H C;  1YNJ A;  4MEX A;  2NVX C;  1Y1W C;  2PMZ D;  3GTK K;  1HQM A;  3S1R C;  1Y1V K;  3GTO K;  4A3G K;  2R7Z C;  4BBR K;  4A3I C;  3PO2 K;  2Y0S L;  4A3D K;  3S16 K;  3PO2 C;  3M4O C;  1I6H C;  4C3I K;  3GTP C;  5FJ8 K;  4A3M K;  4Y52 K;  4BXX K;  4A3K C;  2A6E A;  4AYB D;  4BY1 C;  3RZO C;  5IYD C;  4A3E K;  2YU9 K;  3HOY C;  4MQ9 A;  5C44 K;  5IYB C;  3HOU C;  5IP7 C;  4A3E C;  3HOZ C;  4A3J K;  2VUM K;  4XSZ A;  5C44 C;  5M5X K;  2PA8 L;  4A3C C;  1TWC C;  3HOX K;  4YG2 A;  2JA7 C;  3S17 C;  3HKZ L;  2NVT K;  3RZD C;  4C2M K;  3S1M K;  5IP9 C;  3H3V L;  1IW7 A;  4A3B C;  3K7A C;  3WOD A;  2B63 C;  2JA5 C;  3GTQ K;  1TWG K;  3S2D K;  3PO3 K;  5C4J C;  5IYC C;  2CW0 A;  3CQZ K;  1I6V A;  4G7O A;  1WCM K;  3GTK C;  3CQZ C;  3GTL K;  1Y1V C;  4ZH4 A;  1YNN A;  4A3G C;  3S1Q K;  4BBR C;  4QIW D;  5M3F K;  4OIP A;  3GTL C;  2E2J K;  3GTM K;  4C3J K;  3H0G K;  2JA8 K;  1TWH K;  4A3D C;  3S16 C;  3I4M K;  4YFK A;  4C3I C;  5M5W K;  4A3M C;  4Y52 C;  2O5I A;  4BXX C;  5TMC A;  2YU9 C;  2WAQ L;  3FKI K;  4A3L K;  4X6A K;  4NOI A;  3S15 K;  2VUM C;  4A3J C;  1SFO K;  2A69 A;  4MEY A;  4X6A C;  5C3E K;  3HOW K;  4BY7 K;  4JK1 A;  3GTJ K;  3HOX C;  4Q4Z A;  2Y0S D;  2NVT C;  2A6H A;  3HOW C;  3GTG K;  4C2M C;  3S1M C;  5M3M K;  5M5Y K;  2JA6 K;  3I4N K;  4LJZ A;  2E2I K;  4YFN A;  4XLN A;  2NVQ K;  3M3Y K;  3GTQ C;  1I3Q K;  4OIN A;  2NVY K;  1TWG C;  4BBS K;  1I3Q C;  3S2D C;  3PO3 C;  4XSX A;  4KN4 A;  2PA8 D;  4KN7 A;  4GZY A;  2WB1 L;  3HKZ D;  1WCM C;  4LK1 A;  3H3V D;  4QJV B;  3S1N K;  3S1Q C;  4C3H K;  2R92 K;  2E2J C;  3GTM C;  4C3J C;  3H0G C;  2JA8 C;  1TWH C;  4QJV A;  3I4M C;  5C4X K;  4YFX A;  4Y7N K;  3HOV K;  2R93 K;  1I50 K;  2R93 C; 
#chains in the Genus database with same CATH topology
 1EQR A;  3LYW A;  1ZVU A;  2NVX K;  1Y1W K;  3S14 C;  1WOR A;  1XXB A;  2BE5 A;  3GTG C;  5JVO A;  3I4N C;  2JA6 C;  4OIR A;  2E2H C;  2WAQ D;  3GTL A;  3S0X A;  3RZO K;  2GSN A;  1TWF K;  4A3F C;  5IYD K;  4BBS C;  3H0G A;  1TWH A;  3HOZ K;  4GTL A;  1TWC K;  3FKI A;  2VUM A;  2ZJP S;  3RZD K;  4LLG A;  3S1N C;  5FLM K;  4OIQ A;  1SFO A;  2R92 C;  4A3B K;  3GTJ A;  1WQG A;  4QIW L;  4Q5S A;  3BUE A;  3TFI A;  3S2H K;  1ZQ1 C;  2JH3 A;  5D4D A;  2EBB A;  5C4J K;  1YNJ A;  2KWA A;  3GTK K;  5DM7 S;  2V6S A;  4BLA A;  1Y1V K;  3GSI A;  1WQH A;  1IQ0 A;  3GTP C;  5FJ8 K;  2A6E A;  2YU9 K;  1GE9 A;  1BS2 A;  4MQ9 A;  3GDZ A;  1I50 A;  5C44 C;  4M1X A;  1USO A;  2FQO A;  5IP9 C;  4WFN S;  2B63 C;  1KQ4 A;  2GSU A;  5JVG S;  3N0B A;  3N3Y A;  3CF5 S;  2R7Z A;  1YX2 A;  2E2H A;  4GTF A;  3CQZ K;  4U67 S;  3MML B;  1F7U A;  2D6F C;  4BBR C;  4QIW D;  5M3F K;  1EFW A;  3GTM K;  4C3J K;  4A3D C;  2JA7 A;  4C3I C;  3HXA A;  5M5W K;  2GAG C;  4LQY A;  2PHC B;  4A3L K;  2JA5 A;  4KAT A;  4NOI A;  4A3J C;  5E68 A;  4JK1 A;  3HOX C;  2A6H A;  5IOQ A;  3BP8 C;  2NVQ K;  1XZP A;  1IE0 A;  1I3Q C;  3FOF A;  3QX3 A;  4KN4 A;  1WOO A;  4P9S A;  1O2B A;  1F93 A;  4LK1 A;  1EI6 A;  1JOE A;  4GTB A;  2ZJR S;  3LAJ A;  3AD8 C;  1O24 A;  4Y7N K;  3H0G C;  3HOV K;  1TWH C;  1B4A A;  3SZZ A;  4YFX A;  5C4X K;  1YCL A;  4P5A A;  2B63 A;  2R93 C;  1VJE A;  3DXJ A;  3FKI C;  1RU0 A;  4LOW A;  1O27 A;  3GTQ A;  3EQL A;  3S15 C;  1SFO C;  1JVI A;  5C3E C;  1WSV A;  3PIO S;  4KMU A;  1TWG A;  3S1R K;  3GTJ C;  1XPP A;  4A3I K;  4G7H A;  1FEU A;  1J6V A;  3M4O K;  1I6H K;  3M3Y C;  2NVY C;  1K83 K;  3T01 A;  5IYB K;  1JQW A;  5IP7 K;  1TWF C;  1ZXO A;  1DCH A;  4A3C K;  3S17 K;  1EH1 A;  4C3H C;  4XLP A;  5FLM C;  3OEP A;  4FZB A;  3SZY A;  2O5J A;  1SMY A;  1I50 C;  2E2I A;  5IYC K;  3S2H C;  4MEX A;  1I3Q A;  3G4C A;  2PMZ D;  1BGW A;  2P8T A;  4AH6 A;  4A3G K;  5HQH A;  2R7Z C;  1XXC A;  3GEE A;  4KMD A;  4A3M K;  4BXX K;  4A3K C;  4BY1 C;  3HOY C;  1O2A A;  2R93 A;  3HOU C;  2V6T A;  2VUM K;  2Y3P A;  5M5X K;  4GTA A;  3GTO A;  2PA8 L;  2JA7 C;  3HKZ L;  2NVX A;  4C2M K;  1Y1W A;  1C0A A;  3VA7 A;  1IW7 A;  3K7A C;  2FQT A;  2JA5 C;  1XZP B;  2KXY A;  4WJ4 A;  2CW0 A;  2NVY A;  4G7O A;  1WCM K;  1TWF A;  3CQZ C;  2CFA B;  1DCO A;  3S1Q K;  3S16 C;  4G0V A;  3A8K A;  4Y52 C;  4LR2 A;  5TMC A;  4X6A K;  3A8I A;  2A69 A;  1WOS A;  2NVT C;  3GTG K;  1O2F B;  3S1M C;  3I4N K;  2JA6 K;  3GTK A;  1J98 A;  4YFN A;  4PAA A;  1Y1V A;  3GTQ C;  3Q3Q A;  1TWG C;  4BBS K;  3S2D C;  3TFH A;  3PO3 C;  3DLL S;  2PA8 D;  4KN7 A;  3HKZ D;  1XXA A;  1B4B A;  2YU9 A;  3TFJ A;  1WOP A;  5DM6 S;  4QJV B;  3S1N K;  1VRQ C;  5EGH A;  2R92 K;  2E2J C;  1X31 C;  2JA8 C;  3I4M C;  1O26 A;  4OIO A;  5TMF A;  5HL7 S;  1BDF A;  1WQF A;  4G7Z A;  3IPJ A;  4AYB L;  2WB1 D;  1INN A;  4A93 K;  4BY7 C;  4RMF A;  3GEI A;  1V5V A;  3OPF A;  4KM8 A;  3CQZ A;  1TWA K;  1VH2 A;  2ZUF A;  3ERE D;  2E2I C;  1R9T K;  3GTP K;  1G51 A;  3GTM A;  3CAG A;  2RGR A;  3AD9 C;  1K83 C;  1O29 A;  4KC6 A;  2PMZ L;  3AQO A;  4LK0 A;  4KAR A;  3JST A;  5IP9 K;  1PJ7 A;  2RH6 A;  2B63 K;  2XCO A;  2PPB A;  4GFQ A;  3GTO C;  2NVX C;  5CHP A;  1Y1W C;  4WF9 S;  1VGX A;  4O2D A;  4ILD A;  4BBR K;  1L0W A;  3PO2 K;  5TJ3 A;  2Y0S L;  4A3D K;  4C3I K;  1J6W A;  4C45 A;  1IBA A;  5IOS A;  4AYB D;  3RZO C;  5IYD C;  4A3E K;  4G0W A;  4J3N A;  3HOZ C;  4KB2 A;  4A3J K;  3AD7 C;  1F9N A;  1TWC C;  1IS1 A;  2ZFZ A;  3HOX K;  3RZD C;  5CJ9 A;  2ZUE A;  3H3V L;  3ADA C;  4A3B C;  4G0U A;  5C4J C;  2L3U A;  1F7V A;  1WIH A;  4GTC A;  4WFB S;  3GTK C;  1K83 A;  3GTL K;  1Y1V C;  4ZH4 A;  4FM9 A;  1YNN A;  2KQ1 A;  4OIP A;  3H0G K;  1TWH K;  4GT9 A;  3FHZ A;  2O5I A;  2YU9 C;  3FKI K;  2P5M A;  5JVH S;  3S15 K;  2KPU A;  3AQP A;  4MEY A;  4X6A C;  5C3E K;  1SFO K;  3HOW K;  5IOR A;  3GTJ K;  2Y0S D;  1IL2 A;  1BJT A;  5M3M K;  5M5Y K;  3M3Y K;  4OIN A;  2NVY K;  5HL8 A;  4GTD A;  2WB1 L;  1EK8 A;  5IOT A;  3ORE A;  2W7V A;  3H3V D;  4P5B A;  1TWC A;  4C3H K;  3GTM C;  4C3J C;  1O25 A;  1XZQ A;  2V6U A;  2GSO A;  1I50 K;  5JFE A;  4KAW X;  4A3L C;  3LAP A;  3S14 K;  1USM A;  2L5N A;  4A93 C;  2XCQ A;  4KM9 A;  2R7Z K;  1O28 A;  3T00 A;  1WCM A;  2E2H K;  3GEH A;  1ZYR A;  1TWA C;  2NVQ C;  4KB4 A;  4A3F K;  1HI9 A;  1R9T C;  4A3K K;  4BY1 K;  2A68 A;  1UV7 A;  3HOY K;  3HOU K;  3LPX A;  1WSR A;  2JA7 K;  4XCH A;  4WCE S;  4Y7N C;  1AB4 A;  3HOV C;  1PJ5 A;  3K7A K;  2JA5 K;  5C4X C;  4DDQ A;  3GTG A;  2JA6 A;  2ZJQ S;  3L4J A;  3AH5 A;  4BKW A;  3FOE A;  4PAB A;  3TTG A;  1HQM A;  3S1R C;  4KMH A;  4A3I C;  4GTE A;  4BLB A;  3S16 K;  3PO2 C;  3M4O C;  1I6H C;  4Y52 K;  5L46 A;  2R92 A;  3L4K A;  5C44 K;  5IYB C;  5IP7 C;  1PJ6 A;  4A3E C;  1ZBS A;  3N0C A;  4XSZ A;  4A3C C;  2GAH C;  4YG2 A;  3S17 C;  4KMA A;  2NVT K;  4WIL A;  3S1M K;  2XCR B;  4IOC S;  3WOD A;  3GTQ K;  1TWA A;  1TWG K;  3NUH A;  3S2D K;  3PO3 K;  5IYC C;  4KDD A;  1R9T A;  4WJ3 M;  3GTP A;  1I6V A;  1ISE A;  4A3G C;  3GTL C;  1VLO A;  2E2J K;  4WFA S;  2CFA A;  2JA8 K;  3I4M K;  1XZQ B;  4YFK A;  3PIP S;  4A3M C;  3A8J A;  4BXX C;  4KAS A;  3V4G A;  2WAQ L;  4IO9 S;  2VUM C;  4BY7 K;  3BP3 A;  3GIR A;  4Q4Z A;  1J6X A;  3HOW C;  4C2M C;  3T02 A;  1DD5 A;  4LJZ A;  2E2I K;  4XLN A;  3G4A A;  1I3Q K;  4IOA S;  4XSX A;  4GZY A;  1WCM C;  5EGE A;  3S1Q C;  1DCP A;  4QJV A;  2R93 K;  3GTO K; 
#chains in the Genus database with same CATH homology
 4OIO A;  3DXJ A;  3FKI C;  5TMF A;  4A3L C;  1BDF A;  4G7Z A;  4AYB L;  2NVX K;  2WB1 D;  3S14 K;  4A93 K;  1Y1W K;  3EQL A;  3S15 C;  4BY7 C;  1SFO C;  5C3E C;  3S14 C;  4A93 C;  4KMU A;  3S1R K;  3GTJ C;  2BE5 A;  3GTG C;  1XPP A;  2R7Z K;  4A3I K;  1TWA K;  3I4N C;  2E2H K;  2JA6 C;  4G7H A;  1ZYR A;  2E2I C;  1R9T K;  1TWA C;  4OIR A;  2NVQ C;  2E2H C;  2WAQ D;  4A3F K;  3GTP K;  3M3Y C;  3M4O K;  1I6H K;  1R9T C;  4A3K K;  4BY1 K;  2A68 A;  3RZO K;  2NVY C;  4A3F C;  1K83 K;  1TWF K;  4BBS C;  3HOY K;  5IYD K;  5IYB K;  3HOU K;  5IP7 K;  1TWF C;  1K83 C;  3HOZ K;  2PMZ L;  4A3C K;  1TWC K;  4LK0 A;  2JA7 K;  3S17 K;  3RZD K;  4LLG A;  3S1N C;  5IP9 K;  5FLM K;  4C3H C;  4OIQ A;  2R92 C;  4XLP A;  4Y7N C;  5FLM C;  3HOV C;  3K7A K;  4QIW L;  2JA5 K;  4Q5S A;  5C4X C;  2B63 K;  4A3B K;  2O5J A;  2PPB A;  1SMY A;  1I50 C;  3S2H K;  3GTO C;  5D4D A;  5C4J K;  5IYC K;  3S2H C;  1YNJ A;  4MEX A;  2NVX C;  1Y1W C;  2PMZ D;  3GTK K;  1HQM A;  3S1R C;  1Y1V K;  3GTO K;  4A3G K;  2R7Z C;  4BBR K;  4A3I C;  3PO2 K;  2Y0S L;  4A3D K;  3S16 K;  3PO2 C;  3M4O C;  1I6H C;  4C3I K;  3GTP C;  5FJ8 K;  4A3M K;  4Y52 K;  4BXX K;  4A3K C;  2A6E A;  4AYB D;  4BY1 C;  3RZO C;  5IYD C;  4A3E K;  2YU9 K;  3HOY C;  4MQ9 A;  5C44 K;  5IYB C;  3HOU C;  5IP7 C;  4A3E C;  3HOZ C;  4A3J K;  2VUM K;  4XSZ A;  5C44 C;  5M5X K;  2PA8 L;  4A3C C;  1TWC C;  3HOX K;  4YG2 A;  2JA7 C;  3S17 C;  3HKZ L;  2NVT K;  3RZD C;  4C2M K;  3S1M K;  5IP9 C;  3H3V L;  1IW7 A;  4A3B C;  3K7A C;  3WOD A;  2B63 C;  2JA5 C;  3GTQ K;  1TWG K;  3S2D K;  3PO3 K;  5C4J C;  5IYC C;  2CW0 A;  3CQZ K;  1I6V A;  4G7O A;  1WCM K;  3GTK C;  3CQZ C;  3GTL K;  1Y1V C;  4ZH4 A;  1YNN A;  4A3G C;  3S1Q K;  4BBR C;  4QIW D;  5M3F K;  4OIP A;  3GTL C;  2E2J K;  3GTM K;  4C3J K;  3H0G K;  2JA8 K;  1TWH K;  4A3D C;  3S16 C;  3I4M K;  4YFK A;  4C3I C;  5M5W K;  4A3M C;  4Y52 C;  2O5I A;  4BXX C;  5TMC A;  2YU9 C;  2WAQ L;  3FKI K;  4A3L K;  4X6A K;  4NOI A;  3S15 K;  2VUM C;  4A3J C;  1SFO K;  2A69 A;  4MEY A;  4X6A C;  5C3E K;  3HOW K;  4BY7 K;  4JK1 A;  3GTJ K;  3HOX C;  4Q4Z A;  2Y0S D;  2NVT C;  2A6H A;  3HOW C;  3GTG K;  4C2M C;  3S1M C;  5M3M K;  5M5Y K;  2JA6 K;  3I4N K;  4LJZ A;  2E2I K;  4YFN A;  4XLN A;  2NVQ K;  3M3Y K;  3GTQ C;  1I3Q K;  4OIN A;  2NVY K;  1TWG C;  4BBS K;  1I3Q C;  3S2D C;  3PO3 C;  4XSX A;  4KN4 A;  2PA8 D;  4KN7 A;  4GZY A;  2WB1 L;  3HKZ D;  1WCM C;  4LK1 A;  3H3V D;  4QJV B;  3S1N K;  3S1Q C;  4C3H K;  2R92 K;  2E2J C;  3GTM C;  4C3J C;  3H0G C;  2JA8 C;  1TWH C;  4QJV A;  3I4M C;  5C4X K;  4YFX A;  4Y7N K;  3HOV K;  2R93 K;  1I50 K;  2R93 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...