4OINA

Crystal structure of thermus thermophilus transcription initiation complex soaked with ge23077
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
231
structure length
231
Chain Sequence
b'SKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQAAAVA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase subunit alpha
publication title GE23077 binds to the RNA polymerase 'i' and 'i+1' sites and prevents the binding of initiating nucleotides.
pubmed rcsb
source organism Thermus thermophilus
molecule tags Transcription, transferase/antibiotic
total genus 48
structure length 231
sequence length 231
chains with identical sequence B
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2014-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01000 RNA_pol_A_bac RNA polymerase Rpb3/RpoA insert domain
A PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain
A PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.12 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 DNA-directed RNA polymerase, insert domain 4oinA02
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 4oinA01
4MQ9A 4C3HC 3S14C 4A3MC 4Y7NC 4ZH4A 4A3IC 3I4NC 5C4JC 3H3VD 5M3FK 2JA5C 2E2IC 4XLPA 2O5JA 1SFOK 2R93K 1YNJA 3RZOC 2WAQL 1TWCC 4G7ZA 1Y1WC 3HOWC 4C3IC 3PO2C 2B63C 2WB1L 5C44K 2JA6K 4A3FK 4A3EC 4LJZA 4MEXA 2R7ZC 3S1MC 5IP9K 3S15C 4A3LC 2R92K 4BY7K 4BBRC 2NVYC 4C3JK 4A93K 1TWGC 3FKIC 4XSZA 1TWHC 5IYBC 2NVXC 1BDFA 4C3HK 3S2DC 3S14K 2JA6C 1TWFC 4A3JC 2BE5A 5FLMC 4Y52C 4Y7NK 4A3IK 5IYCC 4KMUA 5C4JK 4YFKA 4A3MK 3GTMC 3HOUC 3HOXC 5M5XK 1WCMC 3PO3C 4BY7C 2E2IK 2JA5K 3RZOK 1TWCK 1Y1WK 4OIPA 4QJVB 4C3IK 4A3CC 2B63K 3HOWK 3PO2K 4A3EK 4NOIA 2R7ZK 3S1MK 4JK1A 3S15K 4A3LK 4BBRK 2NVYK 4QJVA 1TWGK 4G7HA 2E2HC 3FKIK 1TWHK 3GTOC 4XLNA 5IYBK 2NVXK 3HKZD 4KN7A 2PMZD 3DXJA 3S2DK 2PA8D 1TWFK 4A3JK 2O5IA 5FLMK 5C4XC 4Y52K 2PPBA 5IYCK 3GTMK 4C2MC 3HOXK 3HOUK 1WCMK 4KN4A 2A6EA 3PO3K 5M3MK 4LK0A 3GTLC 4A3CK 2VUMC 1I6VA 4BBSC 5IP7C 3RZDC 2JA8C 4BXXC 3S17C 2A6HA 4Q4ZA 3I4MC 4X6AC 2E2HK 4OIRA 3H3VL 2Y0SD 1I50C 3GTOK 4QIWD 2A68A 4LLGA 3HOZC 3HKZL 3K7AC 1HQMA 2PMZL 5C4XK 1TWAC 4A3DC 4G7OA 2NVTC 4Q5SA 4C2MK 1IW7A 3S2HC 2A69A 3GTGC 3S1QC 3GTLK 1Y1VC 4YG2A 2VUMK 4BBSK 1R9TC 3M4OC 2NVQC 3M3YC 4AYBD 1I6HC 5IP7K 3RZDK 2JA8K 4BXXK 3S17K 3I4MK 3GTJC 4X6AK 4MEYA 5TMCA 1I50K 2Y0SL 5M5WK 3GTKC 1K83C 3S1NC 3S16C 3HOZK 5C3EC 3K7AK 4A3BK 3HOYC 1YNNA 1TWAK 4A3DK 3CQZC 5IYDC 4BY1K 2E2JC 2NVTK 4A3KC 3S2HK 1I3QC 2JA7C 3GTGK 3S1QK 4LK1A 1Y1VK 3I4NK 1R9TK 4OIQA 4A3BC 2NVQK 3M3YK 3M4OK 3GTQC 4AYBL 3H0GC 2PA8L 1I6HK 5FJ8K 5D4DA 1ZYRA 4A3GC 4BY1C 3EQLA 3GTJK 5TMFA 2YU9C 1XPPA 4XSXA 3GTPC 3S1RC 3HOVC 1K83K 3GTKK 3S1NK 3S16K 5C3EK 3HOYK 2CW0A 1SFOC 2R93C 3CQZK 2WAQD 2E2JK 5IYDK 4YFXA 4A3KK 3WODA 1I3QK 2JA7K 2WB1D 5C44C 5M5YK 4A3FC 4OINA 4QIWL 5IP9C 2R92C 4GZYA 3GTQK 3H0GK 3S1RK 4C3JC 4A93C 1SMYA 4A3GK 2YU9K 3GTPK 4YFNA 4OIOA 3HOVK
chains in the Genus database with same CATH superfamily
4C3HC 2PHCB 3AH5A 4IOCS 4IOAS 1EQRA 4P9SA 2WAQL 3RZOC 5HL8A 1TWCC 3PIPS 2FQOA 4A3EC 2R92K 1TWGA 1VJEA 2NVYC 1WIHA 4A93K 1TWGC 1YCLA 2L3UA 1VLOA 5JFEA 1O2FB 5IORA 3S14K 4A3JC 5FLMC 4A3IK 3TFIA 5IOTA 4YFKA 4KMHA 1IL2A 3GEEA 1Y1WK 4QJVB 4WFBS 4C3IK 1O24A 3VA7A 4NOIA 3S1MK 4A3LK 4BBRK 4LR2A 3FKIK 2XCOA 1R9TA 1TWHK 2EBBA 2PMZD 3DXJA 2PA8D 2O5IA 5IYCK 4GTEA 3GTMK 1O2BA 3PO3K 5M3MK 1XZQB 4A3CK 4GTFA 1AB4A 4BBSC 3A8IA 5EGEA 4Q4ZA 3I4MC 2XCRB 4KM8A 1I50C 1J6WA 3CAGA 5CJ9A 3FOEA 5C4XK 3CF5S 4A3DC 5JVOA 4Q5SA 4WF9S 3MMLB 2R93A 1O2AA 1WOSA 4YG2A 2VUMK 1I6HC 3GTJA 1IE0A 3TFHA 5L46A 3GTJC 2Y0SL 4XCHA 5C3EC 4A3BK 2KPUA 2P5MA 1USOA 2NVTK 1I3QC 4PABA 1BS2A 3GTQA 3NUHA 1O27A 4KB4A 3L4JA 4OIQA 4A3BC 2NVQK 3GTQC 3TFJA 5D4DA 3LYWA 1BJTA 3GTKK 3S1NK 3S16K 1WORA 1SFOA 5JVHS 3BUEA 1WSVA 2NVXA 1SFOC 3CQZK 2E2JK 4BLBA 2JA6A 2JA7K 2WB1D 1XZPB 5IP9C 3OPFA 4A3GK 2YU9K 3AD8C 4YFNA 2E2HA 2FQTA 4A3MC 3I4NC 2E2IA 5C4JC 2JA5C 2E2IC 4KDDA 2B63A 4WJ4A 2B63C 1VH2A 4LJZA 3S15C 3GTLA 1VGXA 4DDQA 3SZZA 1TWFA 1JVIA 4C3HK 3S2DC 1TWFC 2BE5A 4Y52C 3JSTA 4KMUA 3LAPA 3HOUC 3HOXC 1WCMC 2ZJQS 3RZOK 1TWCK 3AQPA 1HI9A 1TWAA 1O26A 4A3EK 3GTGA 3GTOA 2NVYK 1TWGK 4G7HA 3GTOC 3HKZD 4KN7A 3IPJA 1J98A 4A3JK 5FLMK 4O2DA 2PPBA 1O28A 4C2MC 3G4CA 4KN4A 2A6EA 4KB2A 1ISEA 3RZDC 4IO9S 3H3VL 4WCES 2KQ1A 2A68A 3K7AC 1GE9A 3AQOA 4GTBA 4GTDA 1Y1VA 3S2HC 2A69A 4WFAS 4ILDA 3TTGA 1Y1VC 4BBSK 1R9TC 4KMDA 4G0VA 1YX2A 4GT9A 2GSNA 3I4MK 4MEYA 1I50K 5M5WK 4M1XA 3HOYC 1JQWA 1EFWA 4A3DK 5IYDC 3ERED 5IOSA 4LK1A 3H0GA 1I6HK 1Y1WA 4AYBL 3H0GC 5FJ8K 3GTPA 1WQFA 3GTJK 5TMFA 3GTPC 3BP3A 1O29A 3A8JA 1J6VA 3HOVC 5C3EK 3FKIA 4KMAA 2XCQA 2R93C 2WAQD 4U67S 4YFXA 1I3QK 5C44C 1DCHA 5M5YK 4A3FC 1F7UA 2ZUEA 4OINA 4LQYA 4GZYA 3GTQK 4C3JC 3QX3A 3S0XA 1PJ5A 4KM9A 1B4BA 3GSIA 4OIOA 4MQ9A 4Y7NC 4ZH4A 3H3VD 1SFOK 4XLPA 1ZXOA 3AD9C 3N3YA 1KQ4A 3HOWC 3PO2C 2R7ZA 2JA6K 4MEXA 2R7ZC 5IP9K 4AH6A 4P5AA 5IYBC 2NVXC 4PAAA 1BDFA 3N0BA 1XXCA 4KAWX 1UV7A 2JA6C 4A3MK 3I4NK 5C4JK 2GSOA 2JA5K 2E2IK 1WOPA 4OIPA 4KC6A 5E68A 2B63K 3OEPA 3S15K 4BLAA 4WFNS 2E2HC 1PJ6A 3GDZA 4KATA 5TJ3A 3S2DK 1IQ0A 1TWFK 4Y52K 3HXAA 3HOUK 3HOXK 1WCMK 1B4AA 3GTLC 1JOEA 1I6VA 5IP7C 2JA8C 1BGWA 2Y3PA 3Q3QA 4BXXC 2RGRA 2JA7A 3S17C 2A6HA 4X6AC 2Y0SD 2GAGC 3GTOK 1F7VA 4LLGA 3HOZC 1HQMA 2CFAA 2PMZL 1F93A 1TWAC 4G7OA 3FOFA 2GSUA 4C2MK 1IW7A 2ZUFA 5DM7S 3GTGC 3S1QC 4J3NA 2V6SA 3RZDK 3M4OC 3M3YC 1DCPA 4GTLA 1C0AA 1K83A 3LAJA 1K83C 3K7AK 2P8TA 4A3KC 5CHPA 1ZQ1C 3S2HK 1F9NA 1O25A 2D6FC 1Y1VK 3T01A 1R9TK 1WSRA 1TWCA 1X31C 4LOWA 1INNA 1XPPA 4G0UA 4XSXA 4WJ3M 3S1RC 4KARA 2NVYA 3HOYK 5HQHA 2CW0A 5IYDK 4KASA 5JVGS 2R92A 1RU0A 4QIWL 2R92C 3H0GK 4A93C 3GTPK 1ZVUA 3HOVK 3GEHA 3S14C 1XXAA 5M3FK 4A3IC 3PIOS 1USMA 3BP8C 2O5JA 2R93K 2KXYA 1YNJA 4G7ZA 1Y1WC 4C3IC 5C44K 2WB1L 4A3FK 3S1MC 4A3LC 1TWHA 4BY7K 4BBRC 4RMFA 4C3JK 3FKIC 4XSZA 1TWHC 2W7VA 4C45A 3GTMA 4Y7NK 1IBAA 4WILA 5IYCC 3GEIA 1EI6A 1I50A 3GTMC 5M5XK 3PO3C 4BY7C 3HOWK 3PO2K 4A3CC 1J6XA 3T02A 2RH6A 3N0CA 4BKWA 2R7ZK 4JK1A 2V6TA 3SZYA 4QJVA 1FEUA 3L4KA 4XLNA 5IYBK 2NVXK 5IOQA 3DLLS 4GTAA 5C4XC 4GTCA 4LK0A 2VUMA 1EK8A 2VUMC 1I3QA 2ZFZA 2CFAB 3LPXA 1XZQA 4GFQA 1WQGA 3G4AA 2E2HK 4OIRA 2L5NA 3GIRA 3FHZA 4QIWD 1EH1A 3HKZL 1DD5A 3T00A 2NVTC 1VRQC 1IS1A 3GTLK 1L0WA 2GAHC 5IP7K 2JA8K 2NVQC 4AYBD 4BXXK 2ZJRS 5EGHA 3S17K 3GTKA 4X6AK 2V6UA 5TMCA 2JH3A 3GTKC 3S1NC 3S16C 3HOZK 3CQZA 1YNNA 4P5BA 1TWAK 3OREA 3CQZC 4BY1K 2E2JC 3AD7C 1G51A 2JA7C 3GTGK 3S1QK 2KWAA 2JA5A 1DCOA 3M3YK 3M4OK 2PA8L 2YU9A 1ZBSA 1ZYRA 4A3GC 4BY1C 3EQLA 1V5VA 4FZBA 2YU9C 4FM9A 3V4GA 4G0WA 1K83K 4A3KK 5HL7S 3WODA 3A8KA 1WCMA 1XXBA 1PJ7A 3ADAC 1WOOA 1SMYA 1WQHA 1XZPA 2ZJPS 5DM6S 3S1RK
chains in the Genus database with same CATH topology
4MQ9A 4C3HC 3S14C 4A3MC 4Y7NC 4ZH4A 4A3IC 3I4NC 5C4JC 3H3VD 5M3FK 2JA5C 2E2IC 4XLPA 2O5JA 1SFOK 2R93K 1YNJA 3RZOC 2WAQL 1TWCC 4G7ZA 1Y1WC 3HOWC 4C3IC 3PO2C 2B63C 2WB1L 5C44K 2JA6K 4A3FK 4A3EC 4LJZA 4MEXA 2R7ZC 3S1MC 5IP9K 3S15C 4A3LC 2R92K 4BY7K 4BBRC 2NVYC 4C3JK 4A93K 1TWGC 3FKIC 4XSZA 1TWHC 5IYBC 2NVXC 1BDFA 4C3HK 3S2DC 3S14K 2JA6C 1TWFC 4A3JC 2BE5A 5FLMC 4Y52C 4Y7NK 4A3IK 5IYCC 4KMUA 5C4JK 4YFKA 4A3MK 3GTMC 3HOUC 3HOXC 5M5XK 1WCMC 3PO3C 4BY7C 2E2IK 2JA5K 3RZOK 1TWCK 1Y1WK 4OIPA 4QJVB 4C3IK 4A3CC 2B63K 3HOWK 3PO2K 4A3EK 4NOIA 2R7ZK 3S1MK 4JK1A 3S15K 4A3LK 4BBRK 2NVYK 4QJVA 1TWGK 4G7HA 2E2HC 3FKIK 1TWHK 3GTOC 4XLNA 5IYBK 2NVXK 3HKZD 4KN7A 2PMZD 3DXJA 3S2DK 2PA8D 1TWFK 4A3JK 2O5IA 5FLMK 5C4XC 4Y52K 2PPBA 5IYCK 3GTMK 4C2MC 3HOXK 3HOUK 1WCMK 4KN4A 2A6EA 3PO3K 5M3MK 4LK0A 3GTLC 4A3CK 2VUMC 1I6VA 4BBSC 5IP7C 3RZDC 2JA8C 4BXXC 3S17C 2A6HA 4Q4ZA 3I4MC 4X6AC 2E2HK 4OIRA 3H3VL 2Y0SD 1I50C 3GTOK 4QIWD 2A68A 4LLGA 3HOZC 3HKZL 3K7AC 1HQMA 2PMZL 5C4XK 1TWAC 4A3DC 4G7OA 2NVTC 4Q5SA 4C2MK 1IW7A 3S2HC 2A69A 3GTGC 3S1QC 3GTLK 1Y1VC 4YG2A 2VUMK 4BBSK 1R9TC 3M4OC 2NVQC 3M3YC 4AYBD 1I6HC 5IP7K 3RZDK 2JA8K 4BXXK 3S17K 3I4MK 3GTJC 4X6AK 4MEYA 5TMCA 1I50K 2Y0SL 5M5WK 3GTKC 1K83C 3S1NC 3S16C 3HOZK 5C3EC 3K7AK 4A3BK 3HOYC 1YNNA 1TWAK 4A3DK 3CQZC 5IYDC 4BY1K 2E2JC 2NVTK 4A3KC 3S2HK 1I3QC 2JA7C 3GTGK 3S1QK 4LK1A 1Y1VK 3I4NK 1R9TK 4OIQA 4A3BC 2NVQK 3M3YK 3M4OK 3GTQC 4AYBL 3H0GC 2PA8L 1I6HK 5FJ8K 5D4DA 1ZYRA 4A3GC 4BY1C 3EQLA 3GTJK 5TMFA 2YU9C 1XPPA 4XSXA 3GTPC 3S1RC 3HOVC 1K83K 3GTKK 3S1NK 3S16K 5C3EK 3HOYK 2CW0A 1SFOC 2R93C 3CQZK 2WAQD 2E2JK 5IYDK 4YFXA 4A3KK 3WODA 1I3QK 2JA7K 2WB1D 5C44C 5M5YK 4A3FC 4OINA 4QIWL 5IP9C 2R92C 4GZYA 3GTQK 3H0GK 3S1RK 4C3JC 4A93C 1SMYA 4A3GK 2YU9K 3GTPK 4YFNA 4OIOA 3HOVK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MQ9 A;  4C3H C;  3S14 C;  4A3M C;  4Y7N C;  4ZH4 A;  4A3I C;  3I4N C;  5C4J C;  3H3V D;  5M3F K;  2JA5 C;  2E2I C;  4XLP A;  2O5J A;  1SFO K;  2R93 K;  1YNJ A;  3RZO C;  2WAQ L;  1TWC C;  4G7Z A;  1Y1W C;  3HOW C;  4C3I C;  3PO2 C;  2B63 C;  2WB1 L;  5C44 K;  2JA6 K;  4A3F K;  4A3E C;  4LJZ A;  4MEX A;  2R7Z C;  3S1M C;  5IP9 K;  3S15 C;  4A3L C;  2R92 K;  4BY7 K;  4BBR C;  2NVY C;  4C3J K;  4A93 K;  1TWG C;  3FKI C;  4XSZ A;  1TWH C;  5IYB C;  2NVX C;  1BDF A;  4C3H K;  3S2D C;  3S14 K;  2JA6 C;  1TWF C;  4A3J C;  2BE5 A;  5FLM C;  4Y52 C;  4Y7N K;  4A3I K;  5IYC C;  4KMU A;  5C4J K;  4YFK A;  4A3M K;  3GTM C;  3HOU C;  3HOX C;  5M5X K;  1WCM C;  3PO3 C;  4BY7 C;  2E2I K;  2JA5 K;  3RZO K;  1TWC K;  1Y1W K;  4OIP A;  4QJV B;  4C3I K;  4A3C C;  2B63 K;  3HOW K;  3PO2 K;  4A3E K;  4NOI A;  2R7Z K;  3S1M K;  4JK1 A;  3S15 K;  4A3L K;  4BBR K;  2NVY K;  4QJV A;  1TWG K;  4G7H A;  2E2H C;  3FKI K;  1TWH K;  3GTO C;  4XLN A;  5IYB K;  2NVX K;  3HKZ D;  4KN7 A;  2PMZ D;  3DXJ A;  3S2D K;  2PA8 D;  1TWF K;  4A3J K;  2O5I A;  5FLM K;  5C4X C;  4Y52 K;  2PPB A;  5IYC K;  3GTM K;  4C2M C;  3HOX K;  3HOU K;  1WCM K;  4KN4 A;  2A6E A;  3PO3 K;  5M3M K;  4LK0 A;  3GTL C;  4A3C K;  2VUM C;  1I6V A;  4BBS C;  5IP7 C;  3RZD C;  2JA8 C;  4BXX C;  3S17 C;  2A6H A;  4Q4Z A;  3I4M C;  4X6A C;  2E2H K;  4OIR A;  3H3V L;  2Y0S D;  1I50 C;  3GTO K;  4QIW D;  2A68 A;  4LLG A;  3HOZ C;  3HKZ L;  3K7A C;  1HQM A;  2PMZ L;  5C4X K;  1TWA C;  4A3D C;  4G7O A;  2NVT C;  4Q5S A;  4C2M K;  1IW7 A;  3S2H C;  2A69 A;  3GTG C;  3S1Q C;  3GTL K;  1Y1V C;  4YG2 A;  2VUM K;  4BBS K;  1R9T C;  3M4O C;  2NVQ C;  3M3Y C;  4AYB D;  1I6H C;  5IP7 K;  3RZD K;  2JA8 K;  4BXX K;  3S17 K;  3I4M K;  3GTJ C;  4X6A K;  4MEY A;  5TMC A;  1I50 K;  2Y0S L;  5M5W K;  3GTK C;  1K83 C;  3S1N C;  3S16 C;  3HOZ K;  5C3E C;  3K7A K;  4A3B K;  3HOY C;  1YNN A;  1TWA K;  4A3D K;  3CQZ C;  5IYD C;  4BY1 K;  2E2J C;  2NVT K;  4A3K C;  3S2H K;  1I3Q C;  2JA7 C;  3GTG K;  3S1Q K;  4LK1 A;  1Y1V K;  3I4N K;  1R9T K;  4OIQ A;  4A3B C;  2NVQ K;  3M3Y K;  3M4O K;  3GTQ C;  4AYB L;  3H0G C;  2PA8 L;  1I6H K;  5FJ8 K;  5D4D A;  1ZYR A;  4A3G C;  4BY1 C;  3EQL A;  3GTJ K;  5TMF A;  2YU9 C;  1XPP A;  4XSX A;  3GTP C;  3S1R C;  3HOV C;  1K83 K;  3GTK K;  3S1N K;  3S16 K;  5C3E K;  3HOY K;  2CW0 A;  1SFO C;  2R93 C;  3CQZ K;  2WAQ D;  2E2J K;  5IYD K;  4YFX A;  4A3K K;  3WOD A;  1I3Q K;  2JA7 K;  2WB1 D;  5C44 C;  5M5Y K;  4A3F C;  4OIN A;  4QIW L;  5IP9 C;  2R92 C;  4GZY A;  3GTQ K;  3H0G K;  3S1R K;  4C3J C;  4A93 C;  1SMY A;  4A3G K;  2YU9 K;  3GTP K;  4YFN A;  4OIO A;  3HOV K; 
#chains in the Genus database with same CATH topology
 4C3H C;  2PHC B;  3AH5 A;  4IOC S;  4IOA S;  1EQR A;  4P9S A;  2WAQ L;  3RZO C;  5HL8 A;  1TWC C;  3PIP S;  2FQO A;  4A3E C;  2R92 K;  1TWG A;  1VJE A;  2NVY C;  1WIH A;  4A93 K;  1TWG C;  1YCL A;  2L3U A;  1VLO A;  5JFE A;  1O2F B;  5IOR A;  3S14 K;  4A3J C;  5FLM C;  4A3I K;  3TFI A;  5IOT A;  4YFK A;  4KMH A;  1IL2 A;  3GEE A;  1Y1W K;  4QJV B;  4WFB S;  4C3I K;  1O24 A;  3VA7 A;  4NOI A;  3S1M K;  4A3L K;  4BBR K;  4LR2 A;  3FKI K;  2XCO A;  1R9T A;  1TWH K;  2EBB A;  2PMZ D;  3DXJ A;  2PA8 D;  2O5I A;  5IYC K;  4GTE A;  3GTM K;  1O2B A;  3PO3 K;  5M3M K;  1XZQ B;  4A3C K;  4GTF A;  1AB4 A;  4BBS C;  3A8I A;  5EGE A;  4Q4Z A;  3I4M C;  2XCR B;  4KM8 A;  1I50 C;  1J6W A;  3CAG A;  5CJ9 A;  3FOE A;  5C4X K;  3CF5 S;  4A3D C;  5JVO A;  4Q5S A;  4WF9 S;  3MML B;  2R93 A;  1O2A A;  1WOS A;  4YG2 A;  2VUM K;  1I6H C;  3GTJ A;  1IE0 A;  3TFH A;  5L46 A;  3GTJ C;  2Y0S L;  4XCH A;  5C3E C;  4A3B K;  2KPU A;  2P5M A;  1USO A;  2NVT K;  1I3Q C;  4PAB A;  1BS2 A;  3GTQ A;  3NUH A;  1O27 A;  4KB4 A;  3L4J A;  4OIQ A;  4A3B C;  2NVQ K;  3GTQ C;  3TFJ A;  5D4D A;  3LYW A;  1BJT A;  3GTK K;  3S1N K;  3S16 K;  1WOR A;  1SFO A;  5JVH S;  3BUE A;  1WSV A;  2NVX A;  1SFO C;  3CQZ K;  2E2J K;  4BLB A;  2JA6 A;  2JA7 K;  2WB1 D;  1XZP B;  5IP9 C;  3OPF A;  4A3G K;  2YU9 K;  3AD8 C;  4YFN A;  2E2H A;  2FQT A;  4A3M C;  3I4N C;  2E2I A;  5C4J C;  2JA5 C;  2E2I C;  4KDD A;  2B63 A;  4WJ4 A;  2B63 C;  1VH2 A;  4LJZ A;  3S15 C;  3GTL A;  1VGX A;  4DDQ A;  3SZZ A;  1TWF A;  1JVI A;  4C3H K;  3S2D C;  1TWF C;  2BE5 A;  4Y52 C;  3JST A;  4KMU A;  3LAP A;  3HOU C;  3HOX C;  1WCM C;  2ZJQ S;  3RZO K;  1TWC K;  3AQP A;  1HI9 A;  1TWA A;  1O26 A;  4A3E K;  3GTG A;  3GTO A;  2NVY K;  1TWG K;  4G7H A;  3GTO C;  3HKZ D;  4KN7 A;  3IPJ A;  1J98 A;  4A3J K;  5FLM K;  4O2D A;  2PPB A;  1O28 A;  4C2M C;  3G4C A;  4KN4 A;  2A6E A;  4KB2 A;  1ISE A;  3RZD C;  4IO9 S;  3H3V L;  4WCE S;  2KQ1 A;  2A68 A;  3K7A C;  1GE9 A;  3AQO A;  4GTB A;  4GTD A;  1Y1V A;  3S2H C;  2A69 A;  4WFA S;  4ILD A;  3TTG A;  1Y1V C;  4BBS K;  1R9T C;  4KMD A;  4G0V A;  1YX2 A;  4GT9 A;  2GSN A;  3I4M K;  4MEY A;  1I50 K;  5M5W K;  4M1X A;  3HOY C;  1JQW A;  1EFW A;  4A3D K;  5IYD C;  3ERE D;  5IOS A;  4LK1 A;  3H0G A;  1I6H K;  1Y1W A;  4AYB L;  3H0G C;  5FJ8 K;  3GTP A;  1WQF A;  3GTJ K;  5TMF A;  3GTP C;  3BP3 A;  1O29 A;  3A8J A;  1J6V A;  3HOV C;  5C3E K;  3FKI A;  4KMA A;  2XCQ A;  2R93 C;  2WAQ D;  4U67 S;  4YFX A;  1I3Q K;  5C44 C;  1DCH A;  5M5Y K;  4A3F C;  1F7U A;  2ZUE A;  4OIN A;  4LQY A;  4GZY A;  3GTQ K;  4C3J C;  3QX3 A;  3S0X A;  1PJ5 A;  4KM9 A;  1B4B A;  3GSI A;  4OIO A;  4MQ9 A;  4Y7N C;  4ZH4 A;  3H3V D;  1SFO K;  4XLP A;  1ZXO A;  3AD9 C;  3N3Y A;  1KQ4 A;  3HOW C;  3PO2 C;  2R7Z A;  2JA6 K;  4MEX A;  2R7Z C;  5IP9 K;  4AH6 A;  4P5A A;  5IYB C;  2NVX C;  4PAA A;  1BDF A;  3N0B A;  1XXC A;  4KAW X;  1UV7 A;  2JA6 C;  4A3M K;  3I4N K;  5C4J K;  2GSO A;  2JA5 K;  2E2I K;  1WOP A;  4OIP A;  4KC6 A;  5E68 A;  2B63 K;  3OEP A;  3S15 K;  4BLA A;  4WFN S;  2E2H C;  1PJ6 A;  3GDZ A;  4KAT A;  5TJ3 A;  3S2D K;  1IQ0 A;  1TWF K;  4Y52 K;  3HXA A;  3HOU K;  3HOX K;  1WCM K;  1B4A A;  3GTL C;  1JOE A;  1I6V A;  5IP7 C;  2JA8 C;  1BGW A;  2Y3P A;  3Q3Q A;  4BXX C;  2RGR A;  2JA7 A;  3S17 C;  2A6H A;  4X6A C;  2Y0S D;  2GAG C;  3GTO K;  1F7V A;  4LLG A;  3HOZ C;  1HQM A;  2CFA A;  2PMZ L;  1F93 A;  1TWA C;  4G7O A;  3FOF A;  2GSU A;  4C2M K;  1IW7 A;  2ZUF A;  5DM7 S;  3GTG C;  3S1Q C;  4J3N A;  2V6S A;  3RZD K;  3M4O C;  3M3Y C;  1DCP A;  4GTL A;  1C0A A;  1K83 A;  3LAJ A;  1K83 C;  3K7A K;  2P8T A;  4A3K C;  5CHP A;  1ZQ1 C;  3S2H K;  1F9N A;  1O25 A;  2D6F C;  1Y1V K;  3T01 A;  1R9T K;  1WSR A;  1TWC A;  1X31 C;  4LOW A;  1INN A;  1XPP A;  4G0U A;  4XSX A;  4WJ3 M;  3S1R C;  4KAR A;  2NVY A;  3HOY K;  5HQH A;  2CW0 A;  5IYD K;  4KAS A;  5JVG S;  2R92 A;  1RU0 A;  4QIW L;  2R92 C;  3H0G K;  4A93 C;  3GTP K;  1ZVU A;  3HOV K;  3GEH A;  3S14 C;  1XXA A;  5M3F K;  4A3I C;  3PIO S;  1USM A;  3BP8 C;  2O5J A;  2R93 K;  2KXY A;  1YNJ A;  4G7Z A;  1Y1W C;  4C3I C;  5C44 K;  2WB1 L;  4A3F K;  3S1M C;  4A3L C;  1TWH A;  4BY7 K;  4BBR C;  4RMF A;  4C3J K;  3FKI C;  4XSZ A;  1TWH C;  2W7V A;  4C45 A;  3GTM A;  4Y7N K;  1IBA A;  4WIL A;  5IYC C;  3GEI A;  1EI6 A;  1I50 A;  3GTM C;  5M5X K;  3PO3 C;  4BY7 C;  3HOW K;  3PO2 K;  4A3C C;  1J6X A;  3T02 A;  2RH6 A;  3N0C A;  4BKW A;  2R7Z K;  4JK1 A;  2V6T A;  3SZY A;  4QJV A;  1FEU A;  3L4K A;  4XLN A;  5IYB K;  2NVX K;  5IOQ A;  3DLL S;  4GTA A;  5C4X C;  4GTC A;  4LK0 A;  2VUM A;  1EK8 A;  2VUM C;  1I3Q A;  2ZFZ A;  2CFA B;  3LPX A;  1XZQ A;  4GFQ A;  1WQG A;  3G4A A;  2E2H K;  4OIR A;  2L5N A;  3GIR A;  3FHZ A;  4QIW D;  1EH1 A;  3HKZ L;  1DD5 A;  3T00 A;  2NVT C;  1VRQ C;  1IS1 A;  3GTL K;  1L0W A;  2GAH C;  5IP7 K;  2JA8 K;  2NVQ C;  4AYB D;  4BXX K;  2ZJR S;  5EGH A;  3S17 K;  3GTK A;  4X6A K;  2V6U A;  5TMC A;  2JH3 A;  3GTK C;  3S1N C;  3S16 C;  3HOZ K;  3CQZ A;  1YNN A;  4P5B A;  1TWA K;  3ORE A;  3CQZ C;  4BY1 K;  2E2J C;  3AD7 C;  1G51 A;  2JA7 C;  3GTG K;  3S1Q K;  2KWA A;  2JA5 A;  1DCO A;  3M3Y K;  3M4O K;  2PA8 L;  2YU9 A;  1ZBS A;  1ZYR A;  4A3G C;  4BY1 C;  3EQL A;  1V5V A;  4FZB A;  2YU9 C;  4FM9 A;  3V4G A;  4G0W A;  1K83 K;  4A3K K;  5HL7 S;  3WOD A;  3A8K A;  1WCM A;  1XXB A;  1PJ7 A;  3ADA C;  1WOO A;  1SMY A;  1WQH A;  1XZP A;  2ZJP S;  5DM6 S;  3S1R K; 
#chains in the Genus database with same CATH homology
 4MQ9 A;  4C3H C;  3S14 C;  4A3M C;  4Y7N C;  4ZH4 A;  4A3I C;  3I4N C;  5C4J C;  3H3V D;  5M3F K;  2JA5 C;  2E2I C;  4XLP A;  2O5J A;  1SFO K;  2R93 K;  1YNJ A;  3RZO C;  2WAQ L;  1TWC C;  4G7Z A;  1Y1W C;  3HOW C;  4C3I C;  3PO2 C;  2B63 C;  2WB1 L;  5C44 K;  2JA6 K;  4A3F K;  4A3E C;  4LJZ A;  4MEX A;  2R7Z C;  3S1M C;  5IP9 K;  3S15 C;  4A3L C;  2R92 K;  4BY7 K;  4BBR C;  2NVY C;  4C3J K;  4A93 K;  1TWG C;  3FKI C;  4XSZ A;  1TWH C;  5IYB C;  2NVX C;  1BDF A;  4C3H K;  3S2D C;  3S14 K;  2JA6 C;  1TWF C;  4A3J C;  2BE5 A;  5FLM C;  4Y52 C;  4Y7N K;  4A3I K;  5IYC C;  4KMU A;  5C4J K;  4YFK A;  4A3M K;  3GTM C;  3HOU C;  3HOX C;  5M5X K;  1WCM C;  3PO3 C;  4BY7 C;  2E2I K;  2JA5 K;  3RZO K;  1TWC K;  1Y1W K;  4OIP A;  4QJV B;  4C3I K;  4A3C C;  2B63 K;  3HOW K;  3PO2 K;  4A3E K;  4NOI A;  2R7Z K;  3S1M K;  4JK1 A;  3S15 K;  4A3L K;  4BBR K;  2NVY K;  4QJV A;  1TWG K;  4G7H A;  2E2H C;  3FKI K;  1TWH K;  3GTO C;  4XLN A;  5IYB K;  2NVX K;  3HKZ D;  4KN7 A;  2PMZ D;  3DXJ A;  3S2D K;  2PA8 D;  1TWF K;  4A3J K;  2O5I A;  5FLM K;  5C4X C;  4Y52 K;  2PPB A;  5IYC K;  3GTM K;  4C2M C;  3HOX K;  3HOU K;  1WCM K;  4KN4 A;  2A6E A;  3PO3 K;  5M3M K;  4LK0 A;  3GTL C;  4A3C K;  2VUM C;  1I6V A;  4BBS C;  5IP7 C;  3RZD C;  2JA8 C;  4BXX C;  3S17 C;  2A6H A;  4Q4Z A;  3I4M C;  4X6A C;  2E2H K;  4OIR A;  3H3V L;  2Y0S D;  1I50 C;  3GTO K;  4QIW D;  2A68 A;  4LLG A;  3HOZ C;  3HKZ L;  3K7A C;  1HQM A;  2PMZ L;  5C4X K;  1TWA C;  4A3D C;  4G7O A;  2NVT C;  4Q5S A;  4C2M K;  1IW7 A;  3S2H C;  2A69 A;  3GTG C;  3S1Q C;  3GTL K;  1Y1V C;  4YG2 A;  2VUM K;  4BBS K;  1R9T C;  3M4O C;  2NVQ C;  3M3Y C;  4AYB D;  1I6H C;  5IP7 K;  3RZD K;  2JA8 K;  4BXX K;  3S17 K;  3I4M K;  3GTJ C;  4X6A K;  4MEY A;  5TMC A;  1I50 K;  2Y0S L;  5M5W K;  3GTK C;  1K83 C;  3S1N C;  3S16 C;  3HOZ K;  5C3E C;  3K7A K;  4A3B K;  3HOY C;  1YNN A;  1TWA K;  4A3D K;  3CQZ C;  5IYD C;  4BY1 K;  2E2J C;  2NVT K;  4A3K C;  3S2H K;  1I3Q C;  2JA7 C;  3GTG K;  3S1Q K;  4LK1 A;  1Y1V K;  3I4N K;  1R9T K;  4OIQ A;  4A3B C;  2NVQ K;  3M3Y K;  3M4O K;  3GTQ C;  4AYB L;  3H0G C;  2PA8 L;  1I6H K;  5FJ8 K;  5D4D A;  1ZYR A;  4A3G C;  4BY1 C;  3EQL A;  3GTJ K;  5TMF A;  2YU9 C;  1XPP A;  4XSX A;  3GTP C;  3S1R C;  3HOV C;  1K83 K;  3GTK K;  3S1N K;  3S16 K;  5C3E K;  3HOY K;  2CW0 A;  1SFO C;  2R93 C;  3CQZ K;  2WAQ D;  2E2J K;  5IYD K;  4YFX A;  4A3K K;  3WOD A;  1I3Q K;  2JA7 K;  2WB1 D;  5C44 C;  5M5Y K;  4A3F C;  4OIN A;  4QIW L;  5IP9 C;  2R92 C;  4GZY A;  3GTQ K;  3H0G K;  3S1R K;  4C3J C;  4A93 C;  1SMY A;  4A3G K;  2YU9 K;  3GTP K;  4YFN A;  4OIO A;  3HOV K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...