4OINA

Crystal structure of thermus thermophilus transcription initiation complex soaked with ge23077
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
231
structure length
231
Chain Sequence
SKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQAAAVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title GE23077 binds to the RNA polymerase 'i' and 'i+1' sites and prevents the binding of initiating nucleotides.
pubmed rcsb
source organism Thermus thermophilus
molecule tags Transcription, transferase/antibiotic
molecule keywords DNA-directed RNA polymerase subunit alpha
total genus 48
structure length 231
sequence length 231
chains with identical sequence B
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2014-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01000 RNA_pol_A_bac RNA polymerase Rpb3/RpoA insert domain
A PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain
A PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.12 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 DNA-directed RNA polymerase, insert domain 4oinA02
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 4oinA01
1TWCK 1ZYRA 3FKIK 3H3VD 3S14C 3HOXC 4C3HK 3HOYK 2VUMC 5C44C 1TWAK 4JK1A 4A93C 4LK0A 4YFNA 4YFXA 1SFOC 2JA7K 3I4NK 4C3IC 5IYCC 3S2HK 2NVTK 4BY1K 2R92C 1WCMC 3GTMC 2O5JA 4BBRC 3RZDC 2E2JC 3GTLC 4Y52K 4A3DC 4A3FC 2WB1L 3FKIC 3S1MC 4C2MK 5TMCA 1TWCC 5M3FK 2NVQK 1YNNA 4X6AK 4A3KC 4C3JC 4A3CC 3H3VL 4A3EC 2R93K 3H0GK 2PMZD 3PO2K 1SFOK 4Y7NC 4QIWD 3HOUC 5IP9C 4LLGA 4Y52C 2NVXC 3S17C 5FJ8K 2PMZL 3RZDK 1Y1WK 2E2JK 2A69A 3GTLK 4BXXC 2YU9C 4A3IK 3HOWK 4KMUA 4OIPA 4A3GC 2VUMK 4X6AC 1HQMA 4A3BK 1TWHC 3GTGC 2JA6C 5IP7C 4XSXA 4MQ9A 2E2HK 2JA5C 4A3GK 3HOUK 4MEYA 4XLNA 1WCMK 5M3MK 2NVYK 4A3DK 1SMYA 3CQZC 4G7HA 3S1NK 4OIOA 3GTOC 3M4OK 2B63K 4QIWL 3GTJC 4C3HC 3HOYC 3CQZK 4NOIA 5TMFA 4QJVB 2JA8K 2B63C 1K83C 4KN7A 3GTPK 3S16K 4A93K 5FLMK 3GTGK 3H0GC 4XLPA 2E2IC 4Q5SA 3K7AK 4Y7NK 5C4XK 3GTKC 4OIQA 4A3LC 1Y1VC 2NVQC 3M4OC 3K7AC 2E2IK 3HKZD 3M3YC 3GTKK 3HOVK 3RZOC 4BXXK 5M5YK 2Y0SL 3S1RK 3GTPC 3S16C 1K83K 4LK1A 2JA8C 2WAQL 3HOVC 2JA7C 3I4NC 3HOZK 1TWAC 3I4MK 5IYCK 4C3IK 2PA8L 2PA8D 4A3CK 3GTOK 4BBRK 4QJVA 4C2MC 3S1MK 1YNJA 3S1RC 3S1QC 4AYBL 2JA6K 3GTQK 1TWGK 4A3MK 1TWFK 2Y0SD 1I6HK 4C3JK 2R92K 1Y1VK 4A3IC 1I50C 3HOWC 1TWGC 2A6EA 3I4MC 5C4XC 4A3JC 2R7ZC 5D4DA 5IP9K 4A3FK 5C44K 1Y1WC 2NVXK 3S17K 3M3YK 2A68A 1XPPA 1I3QC 3S15C 4XSZA 3S1NC 1R9TC 4OIRA 4A3MC 2R93C 3PO3K 5M5XK 3S2DK 2PPBA 2BE5A 4AYBD 5IYBK 4MEXA 4A3LK 5IP7K 5C4JC 4BY7K 1TWHK 3S14K 3DXJA 4G7ZA 2WB1D 5IYDK 3S2DC 2JA5K 4A3JK 4LJZA 4Q4ZA 2A6HA 2CW0A 2NVTC 4BY7C 2YU9K 2R7ZK 5C3EK 3GTMK 3S2HC 4GZYA 4ZH4A 4BBSK 4KN4A 4G7OA 4YG2A 1I6HC 1IW7A 1R9TK 3GTJK 3GTQC 1BDFA 3HOZC 3HOXK 4YFKA 2WAQD 1I6VA 2E2HC 4BBSC 5C4JK 5FLMC 2NVYC 4OINA 5IYBC 1I50K 5M5WK 3EQLA 3HKZL 5IYDC 4A3KK 4BY1C 3PO2C 4A3BC 1I3QK 4A3EK 3S15K 3S1QK 5C3EC 3PO3C 2O5IA 1TWFC 3RZOK 3WODA
chains in the Genus database with same CATH superfamily
3GIRA 3S14C 3JSTA 2VUMC 5C44C 4KMAA 4LK0A 2GSOA 1SFOC 3S2HK 4C3IC 1BS2A 1YX2A 1FEUA 2V6TA 3PIOS 1F9NA 2CFAB 4BBRC 2V6UA 4U67S 2WB1L 2JA5A 1WQFA 3N0BA 1C0AA 2PMZD 4Y7NC 3HOUC 3N0CA 1INNA 4RMFA 4LLGA 1O24A 3A8JA 2L5NA 4Y52C 2ZUFA 2E2JK 4KATA 2YU9C 1ZBSA 4KMUA 4GTCA 1F93A 4X6AC 4A3BK 3AH5A 4XSXA 2JA5C 1JQWA 5JVHS 3HOUK 5M3MK 2NVYK 3CQZC 3S1NK 3GTOC 4G0VA 1TWAA 1WOOA 2ZJRS 4GTDA 4QJVB 2JA8K 4KN7A 3GTGK 2NVXA 1VH2A 3K7AK 4A3LC 1Y1VC 4ILDA 3HKZD 2Y3PA 4P9SA 3GTGA 3RZOC 4BXXK 2JA6A 3S1RK 4LK1A 3CQZA 3HOVC 4G0UA 1XZQB 1TWAC 4GFQA 4BLAA 5IYCK 3SZYA 2PA8L 2PA8D 1DD5A 2GAGC 3G4AA 1ZXOA 2D6FC 1YNJA 2ZJQS 3S1RC 1J6WA 4AYBL 1TWGK 4A3MK 1I6HK 2R92K 3HOWC 1JVIA 4DDQA 2A6EA 4A3JC 2R7ZC 3GDZA 1Y1WC 1KQ4A 4KMHA 3S1NC 4A3MC 3GEIA 3S2DK 4AYBD 4MEXA 4PABA 4BY7K 3S14K 2WB1D 3GTMK 4BBSK 1PJ7A 1GE9A 4YG2A 1R9TK 1VGXA 3GTJK 4FM9A 4BBSC 1I6VA 2E2HC 2P8TA 3Q3QA 3HKZL 3T00A 3S1QK 1DCPA 1TWFC 3AQOA 3G4CA 3WODA 3ADAC 1ZYRA 3H3VD 1PJ6A 3HOXC 4C3HK 3HOYK 4A93C 4YFNA 3I4NK 1WSVA 2NVTK 2R92C 2O5JA 1VLOA 2CFAA 3RZDC 3GTLC 1WQGA 3S1MC 5M3FK 3CF5S 4KB4A 4X6AK 2ZUEA 4A3CC 1ZVUA 3H0GK 3PO2K 2KPUA 3RZDK 3S17C 4LR2A 3GTLK 2PMZL 3BP8C 3MMLB 2E2IA 4BXXC 4P5AA 1JOEA 4A3IK 3ERED 1BGWA 2R92A 3GTMA 1WOSA 5IP7C 4A3GK 3AD8C 2XCRB 2JA7A 4GTBA 1IS1A 4C3HC 3HOYC 1WSRA 3IPJA 2RGRA 4A93K 1K83C 3S16K 1VJEA 4XLPA 2E2IC 4Q5SA 1WQHA 1HI9A 3FOFA 2KXYA 4J3NA 3M4OC 3L4KA 2E2IK 1TWGA 3S16C 1K83K 2WAQL 5IOTA 2JH3A 5EGEA 3HOZK 3NUHA 1R9TA 3FHZA 3A8IA 3LPXA 4LOWA 4BBRK 5L46A 4C2MC 3OEPA 1B4AA 4FZBA 1XXAA 4A3IC 1I50C 4KB2A 5C4XC 3I4MC 5C44K 3S17K 3M3YK 2A68A 3L4JA 1EQRA 2R93C 3LYWA 4AH6A 4G0WA 3DLLS 5M5XK 1O29A 1TWFA 4WJ3M 4G7ZA 1O2AA 5IYDK 3TFJA 5IORA 1X31C 4Q4ZA 2NVTC 2CW0A 4KAWX 2YU9K 5C3EK 4GZYA 1IW7A 3V4GA 3GTQC 1BDFA 3HOXK 1Y1WA 1EFWA 4OINA 2ZFZA 3EQLA 3FKIA 1L0WA 1TWCA 4A3KK 4A3EK 3GSIA 2RH6A 3PO3C 4GTFA 4QIWL 4IO9S 1TWCK 3BUEA 1XZPB 3FKIK 3TFHA 2L3UA 4JK1A 2JA7K 5JVOA 3GTQA 3GTMC 2E2HA 1TWHA 2E2JC 4Y52K 5IOSA 2NVYA 4A3DC 4GTEA 1J6XA 4A3FC 2GSUA 3FKIC 2NVQK 5TMCA 1WORA 1YNNA 4C3JC 1O2BA 2V6SA 1J98A 3GEEA 2R93K 1IE0A 4QIWD 1VRQC 4KM9A 5IOQA 5TJ3A 1Y1WK 3H0GA 4GT9A 4WILA 1O27A 3HOWK 1Y1VA 1HQMA 4BKWA 3GTGC 3AD9C 2GSNA 3SZZA 4MQ9A 4MEYA 1WCMK 4O2DA 4G7HA 4OIOA 3OPFA 2B63K 4KARA 3CQZK 4KM8A 2B63C 4PAAA 1ISEA 3H0GC 4WJ4A 4WFNS 5C4XK 4WFAS 2NVQC 3K7AC 3M3YC 1I50A 1UV7A 3HOVK 1EH1A 4WF9S 2XCQA 5E68A 1USMA 3GTOA 2JA7C 1DCHA 3I4MK 2KQ1A 4WFBS 4QJVA 1B4BA 3S1QC 1J6VA 3GTQK 3GTKA 4P5BA 1TWFK 2Y0SD 1TWGC 1G51A 1XXBA 3CAGA 3TTGA 3FOEA 4LQYA 5DM6S 2EBBA 3S15C 1R9TC 4OIRA 3PO3K 1IBAA 1XZPA 5HL7S 5CJ9A 4A3LK 5C4JC 1TWHK 3DXJA 3S2DC 3RZOK 4M1XA 2A6HA 4BY7C 2VUMA 3S2HC 4ZH4A 3PIPS 2R7ZA 1WCMA 4XCHA 3GTLA 2XCOA 5C4JK 5FLMC 1I50K 5IYBC 2P5MA 5IYDC 1I3QK 1YCLA 5C3EC 2FQOA 2PHCB 1TWAK 3AD7C 4YFXA 5JFEA 2YU9A 5IYCC 4BY1K 1WCMC 3HXAA 5EGHA 5DM7S 1F7UA 4C2MK 1TWCC 3OREA 4A3KC 1XZQA 2KWAA 3H3VL 4A3EC 1DCOA 2W7VA 3T01A 1SFOK 1K83A 1EI6A 4IOCS 5IP9C 2NVXC 5FJ8K 3T02A 3S0XA 2A69A 1WIHA 5JVGS 1SFOA 4KMDA 2GAHC 4OIPA 4A3GC 2VUMK 1TWHC 2JA6C 2E2HK 3GTPA 4XLNA 4A3DK 1SMYA 1PJ5A 3LAPA 3M4OK 3GTJC 4NOIA 5TMFA 3GTPK 5FLMK 3AQPA 3QX3A 4Y7NK 3GTKC 4OIQA 1BJTA 3GTKK 5M5YK 2Y0SL 4WCES 3GTPC 3BP3A 2JA8C 4IOAS 1IL2A 3I4NC 3GTJA 4C3IK 3GEHA 4KDDA 4A3CK 2B63A 3GTOK 5HQHA 1RU0A 3S1MK 2JA6K 1EK8A 1ZQ1C 1O25A 2FQTA 4C3JK 3N3YA 1Y1VK 3A8KA 4GTLA 3VA7A 5D4DA 5IP9K 4A3FK 1O26A 3LAJA 1IQ0A 2NVXK 4GTAA 1XPPA 1I3QC 4XSZA 3TFIA 4KC6A 2PPBA 2BE5A 5IYBK 1USOA 5IP7K 1O28A 5HL8A 2JA5K 4A3JK 4LJZA 2R7ZK 5CHPA 4KN4A 4G7OA 1I6HC 1AB4A 4C45A 3HOZC 1F7VA 4YFKA 2WAQD 1WOPA 1V5VA 2NVYC 5M5WK 2ZJPS 1I3QA 4BY1C 3PO2C 4KASA 4BLBA 4A3BC 2R93A 3S15K 1O2FB 1XXCA 2O5IA
chains in the Genus database with same CATH topology
1TWCK 1ZYRA 3FKIK 3H3VD 3S14C 3HOXC 4C3HK 3HOYK 2VUMC 5C44C 1TWAK 4JK1A 4A93C 4LK0A 4YFNA 4YFXA 1SFOC 2JA7K 3I4NK 4C3IC 5IYCC 3S2HK 2NVTK 4BY1K 2R92C 1WCMC 3GTMC 2O5JA 4BBRC 3RZDC 2E2JC 3GTLC 4Y52K 4A3DC 4A3FC 2WB1L 3FKIC 3S1MC 4C2MK 5TMCA 1TWCC 5M3FK 2NVQK 1YNNA 4X6AK 4A3KC 4C3JC 4A3CC 3H3VL 4A3EC 2R93K 3H0GK 2PMZD 3PO2K 1SFOK 4Y7NC 4QIWD 3HOUC 5IP9C 4LLGA 4Y52C 2NVXC 3S17C 5FJ8K 2PMZL 3RZDK 1Y1WK 2E2JK 2A69A 3GTLK 4BXXC 2YU9C 4A3IK 3HOWK 4KMUA 4OIPA 4A3GC 2VUMK 4X6AC 1HQMA 4A3BK 1TWHC 3GTGC 2JA6C 5IP7C 4XSXA 4MQ9A 2E2HK 2JA5C 4A3GK 3HOUK 4MEYA 4XLNA 1WCMK 5M3MK 2NVYK 4A3DK 1SMYA 3CQZC 4G7HA 3S1NK 4OIOA 3GTOC 3M4OK 2B63K 4QIWL 3GTJC 4C3HC 3HOYC 3CQZK 4NOIA 5TMFA 4QJVB 2JA8K 2B63C 1K83C 4KN7A 3GTPK 3S16K 4A93K 5FLMK 3GTGK 3H0GC 4XLPA 2E2IC 4Q5SA 3K7AK 4Y7NK 5C4XK 3GTKC 4OIQA 4A3LC 1Y1VC 2NVQC 3M4OC 3K7AC 2E2IK 3HKZD 3M3YC 3GTKK 3HOVK 3RZOC 4BXXK 5M5YK 2Y0SL 3S1RK 3GTPC 3S16C 1K83K 4LK1A 2JA8C 2WAQL 3HOVC 2JA7C 3I4NC 3HOZK 1TWAC 3I4MK 5IYCK 4C3IK 2PA8L 2PA8D 4A3CK 3GTOK 4BBRK 4QJVA 4C2MC 3S1MK 1YNJA 3S1RC 3S1QC 4AYBL 2JA6K 3GTQK 1TWGK 4A3MK 1TWFK 2Y0SD 1I6HK 4C3JK 2R92K 1Y1VK 4A3IC 1I50C 3HOWC 1TWGC 2A6EA 3I4MC 5C4XC 4A3JC 2R7ZC 5D4DA 5IP9K 4A3FK 5C44K 1Y1WC 2NVXK 3S17K 3M3YK 2A68A 1XPPA 1I3QC 3S15C 4XSZA 3S1NC 1R9TC 4OIRA 4A3MC 2R93C 3PO3K 5M5XK 3S2DK 2PPBA 2BE5A 4AYBD 5IYBK 4MEXA 4A3LK 5IP7K 5C4JC 4BY7K 1TWHK 3S14K 3DXJA 4G7ZA 2WB1D 5IYDK 3S2DC 2JA5K 4A3JK 4LJZA 4Q4ZA 2A6HA 2CW0A 2NVTC 4BY7C 2YU9K 2R7ZK 5C3EK 3GTMK 3S2HC 4GZYA 4ZH4A 4BBSK 4KN4A 4G7OA 4YG2A 1I6HC 1IW7A 1R9TK 3GTJK 3GTQC 1BDFA 3HOZC 3HOXK 4YFKA 2WAQD 1I6VA 2E2HC 4BBSC 5C4JK 5FLMC 2NVYC 4OINA 5IYBC 1I50K 5M5WK 3EQLA 3HKZL 5IYDC 4A3KK 4BY1C 3PO2C 4A3BC 1I3QK 4A3EK 3S15K 3S1QK 5C3EC 3PO3C 2O5IA 1TWFC 3RZOK 3WODA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TWC K;  1ZYR A;  3FKI K;  3H3V D;  3S14 C;  3HOX C;  4C3H K;  3HOY K;  2VUM C;  5C44 C;  1TWA K;  4JK1 A;  4A93 C;  4LK0 A;  4YFN A;  4YFX A;  1SFO C;  2JA7 K;  3I4N K;  4C3I C;  5IYC C;  3S2H K;  2NVT K;  4BY1 K;  2R92 C;  1WCM C;  3GTM C;  2O5J A;  4BBR C;  3RZD C;  2E2J C;  3GTL C;  4Y52 K;  4A3D C;  4A3F C;  2WB1 L;  3FKI C;  3S1M C;  4C2M K;  5TMC A;  1TWC C;  5M3F K;  2NVQ K;  1YNN A;  4X6A K;  4A3K C;  4C3J C;  4A3C C;  3H3V L;  4A3E C;  2R93 K;  3H0G K;  2PMZ D;  3PO2 K;  1SFO K;  4Y7N C;  4QIW D;  3HOU C;  5IP9 C;  4LLG A;  4Y52 C;  2NVX C;  3S17 C;  5FJ8 K;  2PMZ L;  3RZD K;  1Y1W K;  2E2J K;  2A69 A;  3GTL K;  4BXX C;  2YU9 C;  4A3I K;  3HOW K;  4KMU A;  4OIP A;  4A3G C;  2VUM K;  4X6A C;  1HQM A;  4A3B K;  1TWH C;  3GTG C;  2JA6 C;  5IP7 C;  4XSX A;  4MQ9 A;  2E2H K;  2JA5 C;  4A3G K;  3HOU K;  4MEY A;  4XLN A;  1WCM K;  5M3M K;  2NVY K;  4A3D K;  1SMY A;  3CQZ C;  4G7H A;  3S1N K;  4OIO A;  3GTO C;  3M4O K;  2B63 K;  4QIW L;  3GTJ C;  4C3H C;  3HOY C;  3CQZ K;  4NOI A;  5TMF A;  4QJV B;  2JA8 K;  2B63 C;  1K83 C;  4KN7 A;  3GTP K;  3S16 K;  4A93 K;  5FLM K;  3GTG K;  3H0G C;  4XLP A;  2E2I C;  4Q5S A;  3K7A K;  4Y7N K;  5C4X K;  3GTK C;  4OIQ A;  4A3L C;  1Y1V C;  2NVQ C;  3M4O C;  3K7A C;  2E2I K;  3HKZ D;  3M3Y C;  3GTK K;  3HOV K;  3RZO C;  4BXX K;  5M5Y K;  2Y0S L;  3S1R K;  3GTP C;  3S16 C;  1K83 K;  4LK1 A;  2JA8 C;  2WAQ L;  3HOV C;  2JA7 C;  3I4N C;  3HOZ K;  1TWA C;  3I4M K;  5IYC K;  4C3I K;  2PA8 L;  2PA8 D;  4A3C K;  3GTO K;  4BBR K;  4QJV A;  4C2M C;  3S1M K;  1YNJ A;  3S1R C;  3S1Q C;  4AYB L;  2JA6 K;  3GTQ K;  1TWG K;  4A3M K;  1TWF K;  2Y0S D;  1I6H K;  4C3J K;  2R92 K;  1Y1V K;  4A3I C;  1I50 C;  3HOW C;  1TWG C;  2A6E A;  3I4M C;  5C4X C;  4A3J C;  2R7Z C;  5D4D A;  5IP9 K;  4A3F K;  5C44 K;  1Y1W C;  2NVX K;  3S17 K;  3M3Y K;  2A68 A;  1XPP A;  1I3Q C;  3S15 C;  4XSZ A;  3S1N C;  1R9T C;  4OIR A;  4A3M C;  2R93 C;  3PO3 K;  5M5X K;  3S2D K;  2PPB A;  2BE5 A;  4AYB D;  5IYB K;  4MEX A;  4A3L K;  5IP7 K;  5C4J C;  4BY7 K;  1TWH K;  3S14 K;  3DXJ A;  4G7Z A;  2WB1 D;  5IYD K;  3S2D C;  2JA5 K;  4A3J K;  4LJZ A;  4Q4Z A;  2A6H A;  2CW0 A;  2NVT C;  4BY7 C;  2YU9 K;  2R7Z K;  5C3E K;  3GTM K;  3S2H C;  4GZY A;  4ZH4 A;  4BBS K;  4KN4 A;  4G7O A;  4YG2 A;  1I6H C;  1IW7 A;  1R9T K;  3GTJ K;  3GTQ C;  1BDF A;  3HOZ C;  3HOX K;  4YFK A;  2WAQ D;  1I6V A;  2E2H C;  4BBS C;  5C4J K;  5FLM C;  2NVY C;  4OIN A;  5IYB C;  1I50 K;  5M5W K;  3EQL A;  3HKZ L;  5IYD C;  4A3K K;  4BY1 C;  3PO2 C;  4A3B C;  1I3Q K;  4A3E K;  3S15 K;  3S1Q K;  5C3E C;  3PO3 C;  2O5I A;  1TWF C;  3RZO K;  3WOD A; 
#chains in the Genus database with same CATH topology
 3GIR A;  3S14 C;  3JST A;  2VUM C;  5C44 C;  4KMA A;  4LK0 A;  2GSO A;  1SFO C;  3S2H K;  4C3I C;  1BS2 A;  1YX2 A;  1FEU A;  2V6T A;  3PIO S;  1F9N A;  2CFA B;  4BBR C;  2V6U A;  4U67 S;  2WB1 L;  2JA5 A;  1WQF A;  3N0B A;  1C0A A;  2PMZ D;  4Y7N C;  3HOU C;  3N0C A;  1INN A;  4RMF A;  4LLG A;  1O24 A;  3A8J A;  2L5N A;  4Y52 C;  2ZUF A;  2E2J K;  4KAT A;  2YU9 C;  1ZBS A;  4KMU A;  4GTC A;  1F93 A;  4X6A C;  4A3B K;  3AH5 A;  4XSX A;  2JA5 C;  1JQW A;  5JVH S;  3HOU K;  5M3M K;  2NVY K;  3CQZ C;  3S1N K;  3GTO C;  4G0V A;  1TWA A;  1WOO A;  2ZJR S;  4GTD A;  4QJV B;  2JA8 K;  4KN7 A;  3GTG K;  2NVX A;  1VH2 A;  3K7A K;  4A3L C;  1Y1V C;  4ILD A;  3HKZ D;  2Y3P A;  4P9S A;  3GTG A;  3RZO C;  4BXX K;  2JA6 A;  3S1R K;  4LK1 A;  3CQZ A;  3HOV C;  4G0U A;  1XZQ B;  1TWA C;  4GFQ A;  4BLA A;  5IYC K;  3SZY A;  2PA8 L;  2PA8 D;  1DD5 A;  2GAG C;  3G4A A;  1ZXO A;  2D6F C;  1YNJ A;  2ZJQ S;  3S1R C;  1J6W A;  4AYB L;  1TWG K;  4A3M K;  1I6H K;  2R92 K;  3HOW C;  1JVI A;  4DDQ A;  2A6E A;  4A3J C;  2R7Z C;  3GDZ A;  1Y1W C;  1KQ4 A;  4KMH A;  3S1N C;  4A3M C;  3GEI A;  3S2D K;  4AYB D;  4MEX A;  4PAB A;  4BY7 K;  3S14 K;  2WB1 D;  3GTM K;  4BBS K;  1PJ7 A;  1GE9 A;  4YG2 A;  1R9T K;  1VGX A;  3GTJ K;  4FM9 A;  4BBS C;  1I6V A;  2E2H C;  2P8T A;  3Q3Q A;  3HKZ L;  3T00 A;  3S1Q K;  1DCP A;  1TWF C;  3AQO A;  3G4C A;  3WOD A;  3ADA C;  1ZYR A;  3H3V D;  1PJ6 A;  3HOX C;  4C3H K;  3HOY K;  4A93 C;  4YFN A;  3I4N K;  1WSV A;  2NVT K;  2R92 C;  2O5J A;  1VLO A;  2CFA A;  3RZD C;  3GTL C;  1WQG A;  3S1M C;  5M3F K;  3CF5 S;  4KB4 A;  4X6A K;  2ZUE A;  4A3C C;  1ZVU A;  3H0G K;  3PO2 K;  2KPU A;  3RZD K;  3S17 C;  4LR2 A;  3GTL K;  2PMZ L;  3BP8 C;  3MML B;  2E2I A;  4BXX C;  4P5A A;  1JOE A;  4A3I K;  3ERE D;  1BGW A;  2R92 A;  3GTM A;  1WOS A;  5IP7 C;  4A3G K;  3AD8 C;  2XCR B;  2JA7 A;  4GTB A;  1IS1 A;  4C3H C;  3HOY C;  1WSR A;  3IPJ A;  2RGR A;  4A93 K;  1K83 C;  3S16 K;  1VJE A;  4XLP A;  2E2I C;  4Q5S A;  1WQH A;  1HI9 A;  3FOF A;  2KXY A;  4J3N A;  3M4O C;  3L4K A;  2E2I K;  1TWG A;  3S16 C;  1K83 K;  2WAQ L;  5IOT A;  2JH3 A;  5EGE A;  3HOZ K;  3NUH A;  1R9T A;  3FHZ A;  3A8I A;  3LPX A;  4LOW A;  4BBR K;  5L46 A;  4C2M C;  3OEP A;  1B4A A;  4FZB A;  1XXA A;  4A3I C;  1I50 C;  4KB2 A;  5C4X C;  3I4M C;  5C44 K;  3S17 K;  3M3Y K;  2A68 A;  3L4J A;  1EQR A;  2R93 C;  3LYW A;  4AH6 A;  4G0W A;  3DLL S;  5M5X K;  1O29 A;  1TWF A;  4WJ3 M;  4G7Z A;  1O2A A;  5IYD K;  3TFJ A;  5IOR A;  1X31 C;  4Q4Z A;  2NVT C;  2CW0 A;  4KAW X;  2YU9 K;  5C3E K;  4GZY A;  1IW7 A;  3V4G A;  3GTQ C;  1BDF A;  3HOX K;  1Y1W A;  1EFW A;  4OIN A;  2ZFZ A;  3EQL A;  3FKI A;  1L0W A;  1TWC A;  4A3K K;  4A3E K;  3GSI A;  2RH6 A;  3PO3 C;  4GTF A;  4QIW L;  4IO9 S;  1TWC K;  3BUE A;  1XZP B;  3FKI K;  3TFH A;  2L3U A;  4JK1 A;  2JA7 K;  5JVO A;  3GTQ A;  3GTM C;  2E2H A;  1TWH A;  2E2J C;  4Y52 K;  5IOS A;  2NVY A;  4A3D C;  4GTE A;  1J6X A;  4A3F C;  2GSU A;  3FKI C;  2NVQ K;  5TMC A;  1WOR A;  1YNN A;  4C3J C;  1O2B A;  2V6S A;  1J98 A;  3GEE A;  2R93 K;  1IE0 A;  4QIW D;  1VRQ C;  4KM9 A;  5IOQ A;  5TJ3 A;  1Y1W K;  3H0G A;  4GT9 A;  4WIL A;  1O27 A;  3HOW K;  1Y1V A;  1HQM A;  4BKW A;  3GTG C;  3AD9 C;  2GSN A;  3SZZ A;  4MQ9 A;  4MEY A;  1WCM K;  4O2D A;  4G7H A;  4OIO A;  3OPF A;  2B63 K;  4KAR A;  3CQZ K;  4KM8 A;  2B63 C;  4PAA A;  1ISE A;  3H0G C;  4WJ4 A;  4WFN S;  5C4X K;  4WFA S;  2NVQ C;  3K7A C;  3M3Y C;  1I50 A;  1UV7 A;  3HOV K;  1EH1 A;  4WF9 S;  2XCQ A;  5E68 A;  1USM A;  3GTO A;  2JA7 C;  1DCH A;  3I4M K;  2KQ1 A;  4WFB S;  4QJV A;  1B4B A;  3S1Q C;  1J6V A;  3GTQ K;  3GTK A;  4P5B A;  1TWF K;  2Y0S D;  1TWG C;  1G51 A;  1XXB A;  3CAG A;  3TTG A;  3FOE A;  4LQY A;  5DM6 S;  2EBB A;  3S15 C;  1R9T C;  4OIR A;  3PO3 K;  1IBA A;  1XZP A;  5HL7 S;  5CJ9 A;  4A3L K;  5C4J C;  1TWH K;  3DXJ A;  3S2D C;  3RZO K;  4M1X A;  2A6H A;  4BY7 C;  2VUM A;  3S2H C;  4ZH4 A;  3PIP S;  2R7Z A;  1WCM A;  4XCH A;  3GTL A;  2XCO A;  5C4J K;  5FLM C;  1I50 K;  5IYB C;  2P5M A;  5IYD C;  1I3Q K;  1YCL A;  5C3E C;  2FQO A;  2PHC B;  1TWA K;  3AD7 C;  4YFX A;  5JFE A;  2YU9 A;  5IYC C;  4BY1 K;  1WCM C;  3HXA A;  5EGH A;  5DM7 S;  1F7U A;  4C2M K;  1TWC C;  3ORE A;  4A3K C;  1XZQ A;  2KWA A;  3H3V L;  4A3E C;  1DCO A;  2W7V A;  3T01 A;  1SFO K;  1K83 A;  1EI6 A;  4IOC S;  5IP9 C;  2NVX C;  5FJ8 K;  3T02 A;  3S0X A;  2A69 A;  1WIH A;  5JVG S;  1SFO A;  4KMD A;  2GAH C;  4OIP A;  4A3G C;  2VUM K;  1TWH C;  2JA6 C;  2E2H K;  3GTP A;  4XLN A;  4A3D K;  1SMY A;  1PJ5 A;  3LAP A;  3M4O K;  3GTJ C;  4NOI A;  5TMF A;  3GTP K;  5FLM K;  3AQP A;  3QX3 A;  4Y7N K;  3GTK C;  4OIQ A;  1BJT A;  3GTK K;  5M5Y K;  2Y0S L;  4WCE S;  3GTP C;  3BP3 A;  2JA8 C;  4IOA S;  1IL2 A;  3I4N C;  3GTJ A;  4C3I K;  3GEH A;  4KDD A;  4A3C K;  2B63 A;  3GTO K;  5HQH A;  1RU0 A;  3S1M K;  2JA6 K;  1EK8 A;  1ZQ1 C;  1O25 A;  2FQT A;  4C3J K;  3N3Y A;  1Y1V K;  3A8K A;  4GTL A;  3VA7 A;  5D4D A;  5IP9 K;  4A3F K;  1O26 A;  3LAJ A;  1IQ0 A;  2NVX K;  4GTA A;  1XPP A;  1I3Q C;  4XSZ A;  3TFI A;  4KC6 A;  2PPB A;  2BE5 A;  5IYB K;  1USO A;  5IP7 K;  1O28 A;  5HL8 A;  2JA5 K;  4A3J K;  4LJZ A;  2R7Z K;  5CHP A;  4KN4 A;  4G7O A;  1I6H C;  1AB4 A;  4C45 A;  3HOZ C;  1F7V A;  4YFK A;  2WAQ D;  1WOP A;  1V5V A;  2NVY C;  5M5W K;  2ZJP S;  1I3Q A;  4BY1 C;  3PO2 C;  4KAS A;  4BLB A;  4A3B C;  2R93 A;  3S15 K;  1O2F B;  1XXC A;  2O5I A; 
#chains in the Genus database with same CATH homology
 1TWC K;  1ZYR A;  3FKI K;  3H3V D;  3S14 C;  3HOX C;  4C3H K;  3HOY K;  2VUM C;  5C44 C;  1TWA K;  4JK1 A;  4A93 C;  4LK0 A;  4YFN A;  4YFX A;  1SFO C;  2JA7 K;  3I4N K;  4C3I C;  5IYC C;  3S2H K;  2NVT K;  4BY1 K;  2R92 C;  1WCM C;  3GTM C;  2O5J A;  4BBR C;  3RZD C;  2E2J C;  3GTL C;  4Y52 K;  4A3D C;  4A3F C;  2WB1 L;  3FKI C;  3S1M C;  4C2M K;  5TMC A;  1TWC C;  5M3F K;  2NVQ K;  1YNN A;  4X6A K;  4A3K C;  4C3J C;  4A3C C;  3H3V L;  4A3E C;  2R93 K;  3H0G K;  2PMZ D;  3PO2 K;  1SFO K;  4Y7N C;  4QIW D;  3HOU C;  5IP9 C;  4LLG A;  4Y52 C;  2NVX C;  3S17 C;  5FJ8 K;  2PMZ L;  3RZD K;  1Y1W K;  2E2J K;  2A69 A;  3GTL K;  4BXX C;  2YU9 C;  4A3I K;  3HOW K;  4KMU A;  4OIP A;  4A3G C;  2VUM K;  4X6A C;  1HQM A;  4A3B K;  1TWH C;  3GTG C;  2JA6 C;  5IP7 C;  4XSX A;  4MQ9 A;  2E2H K;  2JA5 C;  4A3G K;  3HOU K;  4MEY A;  4XLN A;  1WCM K;  5M3M K;  2NVY K;  4A3D K;  1SMY A;  3CQZ C;  4G7H A;  3S1N K;  4OIO A;  3GTO C;  3M4O K;  2B63 K;  4QIW L;  3GTJ C;  4C3H C;  3HOY C;  3CQZ K;  4NOI A;  5TMF A;  4QJV B;  2JA8 K;  2B63 C;  1K83 C;  4KN7 A;  3GTP K;  3S16 K;  4A93 K;  5FLM K;  3GTG K;  3H0G C;  4XLP A;  2E2I C;  4Q5S A;  3K7A K;  4Y7N K;  5C4X K;  3GTK C;  4OIQ A;  4A3L C;  1Y1V C;  2NVQ C;  3M4O C;  3K7A C;  2E2I K;  3HKZ D;  3M3Y C;  3GTK K;  3HOV K;  3RZO C;  4BXX K;  5M5Y K;  2Y0S L;  3S1R K;  3GTP C;  3S16 C;  1K83 K;  4LK1 A;  2JA8 C;  2WAQ L;  3HOV C;  2JA7 C;  3I4N C;  3HOZ K;  1TWA C;  3I4M K;  5IYC K;  4C3I K;  2PA8 L;  2PA8 D;  4A3C K;  3GTO K;  4BBR K;  4QJV A;  4C2M C;  3S1M K;  1YNJ A;  3S1R C;  3S1Q C;  4AYB L;  2JA6 K;  3GTQ K;  1TWG K;  4A3M K;  1TWF K;  2Y0S D;  1I6H K;  4C3J K;  2R92 K;  1Y1V K;  4A3I C;  1I50 C;  3HOW C;  1TWG C;  2A6E A;  3I4M C;  5C4X C;  4A3J C;  2R7Z C;  5D4D A;  5IP9 K;  4A3F K;  5C44 K;  1Y1W C;  2NVX K;  3S17 K;  3M3Y K;  2A68 A;  1XPP A;  1I3Q C;  3S15 C;  4XSZ A;  3S1N C;  1R9T C;  4OIR A;  4A3M C;  2R93 C;  3PO3 K;  5M5X K;  3S2D K;  2PPB A;  2BE5 A;  4AYB D;  5IYB K;  4MEX A;  4A3L K;  5IP7 K;  5C4J C;  4BY7 K;  1TWH K;  3S14 K;  3DXJ A;  4G7Z A;  2WB1 D;  5IYD K;  3S2D C;  2JA5 K;  4A3J K;  4LJZ A;  4Q4Z A;  2A6H A;  2CW0 A;  2NVT C;  4BY7 C;  2YU9 K;  2R7Z K;  5C3E K;  3GTM K;  3S2H C;  4GZY A;  4ZH4 A;  4BBS K;  4KN4 A;  4G7O A;  4YG2 A;  1I6H C;  1IW7 A;  1R9T K;  3GTJ K;  3GTQ C;  1BDF A;  3HOZ C;  3HOX K;  4YFK A;  2WAQ D;  1I6V A;  2E2H C;  4BBS C;  5C4J K;  5FLM C;  2NVY C;  4OIN A;  5IYB C;  1I50 K;  5M5W K;  3EQL A;  3HKZ L;  5IYD C;  4A3K K;  4BY1 C;  3PO2 C;  4A3B C;  1I3Q K;  4A3E K;  3S15 K;  3S1Q K;  5C3E C;  3PO3 C;  2O5I A;  1TWF C;  3RZO K;  3WOD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...