4OINA

Crystal structure of thermus thermophilus transcription initiation complex soaked with ge23077
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
231
structure length
231
Chain Sequence
SKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQAAAVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase subunit alpha
publication title GE23077 binds to the RNA polymerase 'i' and 'i+1' sites and prevents the binding of initiating nucleotides.
pubmed rcsb
source organism Thermus thermophilus
molecule tags Transcription, transferase/antibiotic
total genus 48
structure length 231
sequence length 231
chains with identical sequence B
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2014-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01000 RNA_pol_A_bac RNA polymerase Rpb3/RpoA insert domain
A PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain
A PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.12 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 DNA-directed RNA polymerase, insert domain 4oinA02
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 4oinA01
4A3BC 4BBRC 5M3MK 1TWAK 3S2DK 4A3CC 5IYBC 2NVTK 2Y0SL 2B63K 2PMZD 5D4DA 4BBRK 4G7ZA 4YFXA 2A6HA 5IYBK 4A3CK 4OIPA 1ZYRA 3FKIC 4Y7NC 4LK1A 3WODA 4XSZA 3FKIK 2R93C 5FLMC 4A3IC 4G7OA 4A3JC 2VUMC 5IP9C 2R93K 5FLMK 4KN7A 4C3HK 3GTGC 4A3JK 2VUMK 4A3GC 1K83C 4XLPA 5IP9K 2CW0A 2E2JC 3GTOC 3GTQC 3RZDK 3GTGK 4A3EC 4A3GK 1K83K 5M5WK 3GTLC 2E2JK 3GTQK 2R92K 2WAQD 1Y1VC 4BY1C 1I3QC 4A3EK 2BE5A 5C44C 2E2IC 3GTLK 4A3KC 3S17K 1Y1VK 4BY1K 1I3QK 3I4NC 3GTMC 4A93C 2E2IK 1TWGC 5C4XC 4A3KK 1R9TC 3CQZK 3HOVK 1TWAC 3I4NK 3GTMK 4A93K 5C4XK 1R9TK 4MEYA 2WB1L 3PO2C 2PPBA 1SMYA 2R7ZC 4BY7C 3HKZD 3PO2K 4A3MC 4Q5SA 2PMZL 2JA7K 3HOYK 2R7ZK 4BY7K 3HOWC 4A3LC 4C3JC 4A3MK 4YG2A 2JA8C 4QIWD 4XLNA 4BBSC 3S1MK 3HOWK 4C3HC 5C3EK 4C3JK 3S14C 4A3LK 2JA8K 3RZDC 4BBSK 5M5XK 3S14K 3HOUK 1SFOC 4QJVA 2R92C 3I4MC 3S1RC 1I50C 1YNJA 1SFOK 3H3VD 3S17C 2A6EA 4JK1A 4C2MC 1I50K 3S1RK 1TWCC 3I4MK 3HOVC 3CQZC 3K7AC 4OIOA 2WAQL 4C2MK 4YFKA 1TWCK 1TWGK 3M4OC 1BDFA 2O5IA 2JA6C 3K7AK 2E2HC 3M4OK 2JA6K 4OIQA 4A3DC 4OIRA 2E2HK 5M5YK 4XSXA 2JA7C 1WCMC 3HOYC 4A3DK 4Y52C 5FJ8K 4QJVB 4ZH4A 1TWFK 3GTKC 3S1MC 3S1NC 4LJZA 5C4JC 5IYDC 5C3EC 1WCMK 4Y52K 5TMCA 3HKZL 3GTPK 3GTKK 3S15C 5C4JK 3S1NK 4BXXK 5IYDK 3PO3C 2PA8D 3HOUC 4QIWL 3S15K 5TMFA 3PO3K 5IYCC 2PA8L 3RZOC 3EQLA 5IYCK 1TWHC 2NVQK 2NVYC 2YU9C 3RZOK 3S16K 1TWHK 2NVYK 1XPPA 2YU9K 1HQMA 3H3VL 4GZYA 2NVXC 3HOZK 1Y1WC 3H0GK 4A3BK 4LLGA 2NVXK 4YFNA 4KN4A 3DXJA 1Y1WK 1I6HC 4Y7NK 1TWFC 2A69A 1I6VA 3GTJC 4C3IC 1IW7A 4MEXA 1I6HK 2A68A 3GTPC 4BXXC 2O5JA 3GTJK 4A3IK 4OINA 4C3IK 2NVTC 4X6AC 4NOIA 4G7HA 3S2HC 4AYBD 3M3YC 4X6AK 4A3FC 3GTOK 3S2HK 5M3FK 4AYBL 3M3YK 4A3FK 5IP7C 2NVQC 4KMUA 3S1QC 1YNNA 3S16C 3HOXC 5C44K 4LK0A 5IP7K 2WB1D 4Q4ZA 4MQ9A 2JA5C 3S2DC 3S1QK 3HOZC 3HOXK 2Y0SD 2B63C 3H0GC 2JA5K
chains in the Genus database with same CATH superfamily
4A3BC 2KWAA 1TWAK 2NVTK 2Y0SL 3FHZA 1ZYRA 4Y7NC 3WODA 3GTLA 2E2IA 2GAHC 5IP9C 3CQZA 5FLMK 4KN7A 2JH3A 3GTGC 1K83C 4XLPA 2JA6A 2CW0A 2E2JC 4A3EC 3PIPS 5JVGS 3GEIA 5JVHS 4KB4A 3GTQK 2JA7A 1BJTA 1Y1VK 4BY1K 1I3QK 3ADAC 1TWGC 3GTMK 3TFHA 3LAJA 3PO2C 2CFAA 1B4BA 2R7ZC 1F7VA 1WIHA 3HKZD 3VA7A 3FOEA 4A3LC 2L3UA 3BP8C 2JA8C 3SZZA 3RZDC 1F93A 4BBSK 5M5XK 2GSUA 1B4AA 2RGRA 1Y1WA 3I4MC 1DCHA 1L0WA 4KC6A 1SFOK 2A6EA 1I50K 1TWFA 3HOVC 3CQZC 1WCMA 3AQOA 3GDZA 2JA6C 2O5IA 3K7AK 3M4OK 4OIQA 4A3DC 1XZQA 2E2HK 5M5YK 2JA7C 3HOYC 2RH6A 4Y52C 4LJZA 5C4JC 5C3EC 5TMCA 3N0BA 3GTKK 3PO3C 3AD7C 3S15K 5TMFA 1O2FB 5IYCC 2PA8L 4G0VA 3RZOC 1F9NA 2NVQK 4LQYA 3SZYA 1XXAA 1TWHK 1XPPA 2R93A 2GSNA 1WSRA 4GZYA 2NVXC 1Y1WC 4A3BK 1JVIA 4KAWX 4YFNA 2GSOA 4KN4A 3GTOA 1USMA 3AH5A 3MMLB 1F7UA 1I6HC 4Y7NK 1TWFC 1USOA 1I6VA 1IW7A 5EGEA 3GTJK 1HI9A 2CFAB 1R9TA 2EBBA 4FM9A 4ILDA 4A3FC 4WFAS 4GTLA 2GAGC 1YNNA 2WB1D 4MQ9A 3S2DC 3CF5S 4GTCA 1TWGK 2JA5K 4BBRC 2Y3PA 4A3CC 3TFJA 4WILA 4YFXA 2A6HA 5IYBK 4OIPA 3FKIC 1WQHA 2R92A 1EFWA 5IOSA 2R93C 3JSTA 4A3IC 4G7OA 1TWCA 3LYWA 5HL7S 4A3JC 1C0AA 1XZQB 3LPXA 1EI6A 1EQRA 4A3GC 2KPUA 5CJ9A 3RZDK 3GTOC 2VUMK 3G4CA 5M5WK 4KASA 3N0CA 3GTLK 4A3KC 5TJ3A 4A93C 2E2IK 1IE0A 4GTDA 3HOVK 1R9TC 3CQZK 3I4NK 5C4XK 2W7VA 4MEYA 2V6SA 2ZJPS 3V4GA 2V6TA 1GE9A 1SMYA 2PMZL 1VJEA 2JA7K 4PABA 3HOYK 4BY7K 3HOWC 4C3JC 4A3MK 4QIWD 4XLNA 5C3EK 4GTEA 4GTFA 3S14K 1DD5A 4IO9S 2R92C 1YNJA 3S17C 3S1RK 1TWCC 4KMDA 4GTBA 2KXYA 4O2DA 4C2MK 4OIOA 2WAQL 1ZVUA 1UV7A 3T02A 5DM6S 1EK8A 2ZUFA 4XSXA 4KMAA 1TWFK 3S1NC 1WCMK 5IYDC 2L5NA 3BUEA 4U67S 3OREA 4GFQA 1BGWA 4DDQA 1V5VA 2NVXA 4WFBS 2P5MA 2NVYK 2ZFZA 2YU9K 1HQMA 3H3VL 3L4JA 5JVOA 4LLGA 4WJ4A 1J6VA 3A8KA 1PJ5A 3GTQA 1VH2A 4WFNS 1Y1VA 1I3QA 4C3IC 4MEXA 2A68A 4BXXC 2O5JA 5L46A 4A3IK 3Q3QA 4NOIA 3S2HC 5EGHA 4AYBD 4WCES 3M3YC 2FQOA 4X6AK 3GTOK 4KM8A 3AQPA 1WQGA 3FKIA 5IP7K 3S1QK 4Q4ZA 3HOXK 1EH1A 2NVTC 3AD8C 2PPBA 5M3MK 2B63K 4FZBA 4G7ZA 4LK1A 1I50A 4XSZA 5FLMC 1PJ7A 5IP9K 3GTQC 3GTGK 4M1XA 2E2HA 2PHCB 1K83K 2E2JK 2R92K 1Y1VC 4BY1C 1I3QC 3A8JA 4A3EK 5C44C 4KMHA 3S17K 3GTMC 3GTKA 5DM7S 3OEPA 1DCOA 4KDDA 3L4KA 3PO2K 2R7ZK 4RMFA 1TWHA 4YG2A 4BBSC 4A3LK 4C3HC 2ZUEA 2JA8K 1BS2A 1SFOC 3GEEA 1PJ6A 1I50C 1WOSA 2FQTA 3I4MK 3K7AC 1J6XA 4YFKA 3M4OC 1YX2A 3GIRA 4KATA 3GTPA 2E2HC 3T00A 2JA6K 4OIRA 4G0WA 4A3DK 1IBAA 5FJ8K 5JFEA 1DCPA 2V6UA 3GTKC 3S1MC 1G51A 4Y52K 3G4AA 3HKZL 4BLAA 4BXXK 2JA5A 3S15C 5C4JK 3HOUC 3H0GA 1IQ0A 3IPJA 3PO3K 3EQLA 4AH6A 5IYCK 1TWHC 3RZOK 1ISEA 1VLOA 1O25A 1XZPA 2VUMA 4KARA 2NVXK 5IOTA 1Y1WK 4LOWA 1FEUA 1O2AA 3GTJC 1ZQ1C 1ZXOA 1I6HK 3GTPC 4LR2A 3OPFA 4OINA 3BP3A 4C45A 3CAGA 1TWAA 4P5BA 5IOQA 4AYBL 4A3FK 4WJ3M 3S16C 4WF9S 5C44K 4LK0A 3LAPA 3TTGA 2JA5C 3HOZC 3HXAA 2Y0SD 4KM9A 3H0GC 3S2DK 1IL2A 1KQ4A 5IYBC 3GSIA 4IOAS 2PMZD 1AB4A 5D4DA 3DLLS 1XXCA 5HL8A 4BBRK 4A3CK 1O26A 4J3NA 3FKIK 1RU0A 2VUMC 2R93K 4C3HK 1J98A 3GTMA 4A3JK 1VRQC 1IS1A 1JQWA 3A8IA 4A3GK 1ZBSA 3GTLC 2WAQD 2BE5A 2E2IC 3I4NC 4GT9A 5C4XC 4A3KK 1TWAC 4BLBA 4A93K 1R9TK 2WB1L 1O28A 5CHPA 4G0UA 4BY7C 3T01A 4A3MC 1SFOA 4Q5SA 1XZPB 2NVYA 2YU9A 1O27A 3S1MK 3HOWK 1WSVA 4C3JK 3S14C 4XCHA 1WQFA 3HOUK 4QJVA 3S1RC 3H3VD 4C2MC 4JK1A 1O2BA 2XCQA 5IORA 4P5AA 2ZJQS 3AD9C 1TWCK 1BDFA 1J6WA 4GTAA 2KQ1A 1WORA 4PAAA 3PIOS 1WCMC 5HQHA 4ZH4A 4QJVB 3S0XA 2XCRB 3GTPK 3S1NK 3QX3A 3NUHA 5IYDK 4KB2A 2PA8D 2B63A 2D6FC 4QIWL 3TFIA 3FOFA 1JOEA 2XCOA 3GEHA 3ERED 1WOOA 2NVYC 2YU9C 3S16K 2ZJRS 3GTJA 3HOZK 1VGXA 3H0GK 3GTGA 1K83A 3DXJA 1WOPA 1O24A 1XXBA 4P9SA 4BKWA 2P8TA 2A69A 5E68A 4C3IK 4X6AC 1TWGA 4IOCS 4G7HA 3S2HK 5M3FK 3M3YK 1YCLA 5IP7C 2NVQC 1INNA 4KMUA 3S1QC 2R7ZA 3N3YA 3HOXC 1O29A 2B63C 1X31C
chains in the Genus database with same CATH topology
4A3BC 4BBRC 5M3MK 1TWAK 3S2DK 4A3CC 5IYBC 2NVTK 2Y0SL 2B63K 2PMZD 5D4DA 4BBRK 4G7ZA 4YFXA 2A6HA 5IYBK 4A3CK 4OIPA 1ZYRA 3FKIC 4Y7NC 4LK1A 3WODA 4XSZA 3FKIK 2R93C 5FLMC 4A3IC 4G7OA 4A3JC 2VUMC 5IP9C 2R93K 5FLMK 4KN7A 4C3HK 3GTGC 4A3JK 2VUMK 4A3GC 1K83C 4XLPA 5IP9K 2CW0A 2E2JC 3GTOC 3GTQC 3RZDK 3GTGK 4A3EC 4A3GK 1K83K 5M5WK 3GTLC 2E2JK 3GTQK 2R92K 2WAQD 1Y1VC 4BY1C 1I3QC 4A3EK 2BE5A 5C44C 2E2IC 3GTLK 4A3KC 3S17K 1Y1VK 4BY1K 1I3QK 3I4NC 3GTMC 4A93C 2E2IK 1TWGC 5C4XC 4A3KK 1R9TC 3CQZK 3HOVK 1TWAC 3I4NK 3GTMK 4A93K 5C4XK 1R9TK 4MEYA 2WB1L 3PO2C 2PPBA 1SMYA 2R7ZC 4BY7C 3HKZD 3PO2K 4A3MC 4Q5SA 2PMZL 2JA7K 3HOYK 2R7ZK 4BY7K 3HOWC 4A3LC 4C3JC 4A3MK 4YG2A 2JA8C 4QIWD 4XLNA 4BBSC 3S1MK 3HOWK 4C3HC 5C3EK 4C3JK 3S14C 4A3LK 2JA8K 3RZDC 4BBSK 5M5XK 3S14K 3HOUK 1SFOC 4QJVA 2R92C 3I4MC 3S1RC 1I50C 1YNJA 1SFOK 3H3VD 3S17C 2A6EA 4JK1A 4C2MC 1I50K 3S1RK 1TWCC 3I4MK 3HOVC 3CQZC 3K7AC 4OIOA 2WAQL 4C2MK 4YFKA 1TWCK 1TWGK 3M4OC 1BDFA 2O5IA 2JA6C 3K7AK 2E2HC 3M4OK 2JA6K 4OIQA 4A3DC 4OIRA 2E2HK 5M5YK 4XSXA 2JA7C 1WCMC 3HOYC 4A3DK 4Y52C 5FJ8K 4QJVB 4ZH4A 1TWFK 3GTKC 3S1MC 3S1NC 4LJZA 5C4JC 5IYDC 5C3EC 1WCMK 4Y52K 5TMCA 3HKZL 3GTPK 3GTKK 3S15C 5C4JK 3S1NK 4BXXK 5IYDK 3PO3C 2PA8D 3HOUC 4QIWL 3S15K 5TMFA 3PO3K 5IYCC 2PA8L 3RZOC 3EQLA 5IYCK 1TWHC 2NVQK 2NVYC 2YU9C 3RZOK 3S16K 1TWHK 2NVYK 1XPPA 2YU9K 1HQMA 3H3VL 4GZYA 2NVXC 3HOZK 1Y1WC 3H0GK 4A3BK 4LLGA 2NVXK 4YFNA 4KN4A 3DXJA 1Y1WK 1I6HC 4Y7NK 1TWFC 2A69A 1I6VA 3GTJC 4C3IC 1IW7A 4MEXA 1I6HK 2A68A 3GTPC 4BXXC 2O5JA 3GTJK 4A3IK 4OINA 4C3IK 2NVTC 4X6AC 4NOIA 4G7HA 3S2HC 4AYBD 3M3YC 4X6AK 4A3FC 3GTOK 3S2HK 5M3FK 4AYBL 3M3YK 4A3FK 5IP7C 2NVQC 4KMUA 3S1QC 1YNNA 3S16C 3HOXC 5C44K 4LK0A 5IP7K 2WB1D 4Q4ZA 4MQ9A 2JA5C 3S2DC 3S1QK 3HOZC 3HOXK 2Y0SD 2B63C 3H0GC 2JA5K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A3B C;  4BBR C;  5M3M K;  1TWA K;  3S2D K;  4A3C C;  5IYB C;  2NVT K;  2Y0S L;  2B63 K;  2PMZ D;  5D4D A;  4BBR K;  4G7Z A;  4YFX A;  2A6H A;  5IYB K;  4A3C K;  4OIP A;  1ZYR A;  3FKI C;  4Y7N C;  4LK1 A;  3WOD A;  4XSZ A;  3FKI K;  2R93 C;  5FLM C;  4A3I C;  4G7O A;  4A3J C;  2VUM C;  5IP9 C;  2R93 K;  5FLM K;  4KN7 A;  4C3H K;  3GTG C;  4A3J K;  2VUM K;  4A3G C;  1K83 C;  4XLP A;  5IP9 K;  2CW0 A;  2E2J C;  3GTO C;  3GTQ C;  3RZD K;  3GTG K;  4A3E C;  4A3G K;  1K83 K;  5M5W K;  3GTL C;  2E2J K;  3GTQ K;  2R92 K;  2WAQ D;  1Y1V C;  4BY1 C;  1I3Q C;  4A3E K;  2BE5 A;  5C44 C;  2E2I C;  3GTL K;  4A3K C;  3S17 K;  1Y1V K;  4BY1 K;  1I3Q K;  3I4N C;  3GTM C;  4A93 C;  2E2I K;  1TWG C;  5C4X C;  4A3K K;  1R9T C;  3CQZ K;  3HOV K;  1TWA C;  3I4N K;  3GTM K;  4A93 K;  5C4X K;  1R9T K;  4MEY A;  2WB1 L;  3PO2 C;  2PPB A;  1SMY A;  2R7Z C;  4BY7 C;  3HKZ D;  3PO2 K;  4A3M C;  4Q5S A;  2PMZ L;  2JA7 K;  3HOY K;  2R7Z K;  4BY7 K;  3HOW C;  4A3L C;  4C3J C;  4A3M K;  4YG2 A;  2JA8 C;  4QIW D;  4XLN A;  4BBS C;  3S1M K;  3HOW K;  4C3H C;  5C3E K;  4C3J K;  3S14 C;  4A3L K;  2JA8 K;  3RZD C;  4BBS K;  5M5X K;  3S14 K;  3HOU K;  1SFO C;  4QJV A;  2R92 C;  3I4M C;  3S1R C;  1I50 C;  1YNJ A;  1SFO K;  3H3V D;  3S17 C;  2A6E A;  4JK1 A;  4C2M C;  1I50 K;  3S1R K;  1TWC C;  3I4M K;  3HOV C;  3CQZ C;  3K7A C;  4OIO A;  2WAQ L;  4C2M K;  4YFK A;  1TWC K;  1TWG K;  3M4O C;  1BDF A;  2O5I A;  2JA6 C;  3K7A K;  2E2H C;  3M4O K;  2JA6 K;  4OIQ A;  4A3D C;  4OIR A;  2E2H K;  5M5Y K;  4XSX A;  2JA7 C;  1WCM C;  3HOY C;  4A3D K;  4Y52 C;  5FJ8 K;  4QJV B;  4ZH4 A;  1TWF K;  3GTK C;  3S1M C;  3S1N C;  4LJZ A;  5C4J C;  5IYD C;  5C3E C;  1WCM K;  4Y52 K;  5TMC A;  3HKZ L;  3GTP K;  3GTK K;  3S15 C;  5C4J K;  3S1N K;  4BXX K;  5IYD K;  3PO3 C;  2PA8 D;  3HOU C;  4QIW L;  3S15 K;  5TMF A;  3PO3 K;  5IYC C;  2PA8 L;  3RZO C;  3EQL A;  5IYC K;  1TWH C;  2NVQ K;  2NVY C;  2YU9 C;  3RZO K;  3S16 K;  1TWH K;  2NVY K;  1XPP A;  2YU9 K;  1HQM A;  3H3V L;  4GZY A;  2NVX C;  3HOZ K;  1Y1W C;  3H0G K;  4A3B K;  4LLG A;  2NVX K;  4YFN A;  4KN4 A;  3DXJ A;  1Y1W K;  1I6H C;  4Y7N K;  1TWF C;  2A69 A;  1I6V A;  3GTJ C;  4C3I C;  1IW7 A;  4MEX A;  1I6H K;  2A68 A;  3GTP C;  4BXX C;  2O5J A;  3GTJ K;  4A3I K;  4OIN A;  4C3I K;  2NVT C;  4X6A C;  4NOI A;  4G7H A;  3S2H C;  4AYB D;  3M3Y C;  4X6A K;  4A3F C;  3GTO K;  3S2H K;  5M3F K;  4AYB L;  3M3Y K;  4A3F K;  5IP7 C;  2NVQ C;  4KMU A;  3S1Q C;  1YNN A;  3S16 C;  3HOX C;  5C44 K;  4LK0 A;  5IP7 K;  2WB1 D;  4Q4Z A;  4MQ9 A;  2JA5 C;  3S2D C;  3S1Q K;  3HOZ C;  3HOX K;  2Y0S D;  2B63 C;  3H0G C;  2JA5 K; 
#chains in the Genus database with same CATH topology
 4A3B C;  2KWA A;  1TWA K;  2NVT K;  2Y0S L;  3FHZ A;  1ZYR A;  4Y7N C;  3WOD A;  3GTL A;  2E2I A;  2GAH C;  5IP9 C;  3CQZ A;  5FLM K;  4KN7 A;  2JH3 A;  3GTG C;  1K83 C;  4XLP A;  2JA6 A;  2CW0 A;  2E2J C;  4A3E C;  3PIP S;  5JVG S;  3GEI A;  5JVH S;  4KB4 A;  3GTQ K;  2JA7 A;  1BJT A;  1Y1V K;  4BY1 K;  1I3Q K;  3ADA C;  1TWG C;  3GTM K;  3TFH A;  3LAJ A;  3PO2 C;  2CFA A;  1B4B A;  2R7Z C;  1F7V A;  1WIH A;  3HKZ D;  3VA7 A;  3FOE A;  4A3L C;  2L3U A;  3BP8 C;  2JA8 C;  3SZZ A;  3RZD C;  1F93 A;  4BBS K;  5M5X K;  2GSU A;  1B4A A;  2RGR A;  1Y1W A;  3I4M C;  1DCH A;  1L0W A;  4KC6 A;  1SFO K;  2A6E A;  1I50 K;  1TWF A;  3HOV C;  3CQZ C;  1WCM A;  3AQO A;  3GDZ A;  2JA6 C;  2O5I A;  3K7A K;  3M4O K;  4OIQ A;  4A3D C;  1XZQ A;  2E2H K;  5M5Y K;  2JA7 C;  3HOY C;  2RH6 A;  4Y52 C;  4LJZ A;  5C4J C;  5C3E C;  5TMC A;  3N0B A;  3GTK K;  3PO3 C;  3AD7 C;  3S15 K;  5TMF A;  1O2F B;  5IYC C;  2PA8 L;  4G0V A;  3RZO C;  1F9N A;  2NVQ K;  4LQY A;  3SZY A;  1XXA A;  1TWH K;  1XPP A;  2R93 A;  2GSN A;  1WSR A;  4GZY A;  2NVX C;  1Y1W C;  4A3B K;  1JVI A;  4KAW X;  4YFN A;  2GSO A;  4KN4 A;  3GTO A;  1USM A;  3AH5 A;  3MML B;  1F7U A;  1I6H C;  4Y7N K;  1TWF C;  1USO A;  1I6V A;  1IW7 A;  5EGE A;  3GTJ K;  1HI9 A;  2CFA B;  1R9T A;  2EBB A;  4FM9 A;  4ILD A;  4A3F C;  4WFA S;  4GTL A;  2GAG C;  1YNN A;  2WB1 D;  4MQ9 A;  3S2D C;  3CF5 S;  4GTC A;  1TWG K;  2JA5 K;  4BBR C;  2Y3P A;  4A3C C;  3TFJ A;  4WIL A;  4YFX A;  2A6H A;  5IYB K;  4OIP A;  3FKI C;  1WQH A;  2R92 A;  1EFW A;  5IOS A;  2R93 C;  3JST A;  4A3I C;  4G7O A;  1TWC A;  3LYW A;  5HL7 S;  4A3J C;  1C0A A;  1XZQ B;  3LPX A;  1EI6 A;  1EQR A;  4A3G C;  2KPU A;  5CJ9 A;  3RZD K;  3GTO C;  2VUM K;  3G4C A;  5M5W K;  4KAS A;  3N0C A;  3GTL K;  4A3K C;  5TJ3 A;  4A93 C;  2E2I K;  1IE0 A;  4GTD A;  3HOV K;  1R9T C;  3CQZ K;  3I4N K;  5C4X K;  2W7V A;  4MEY A;  2V6S A;  2ZJP S;  3V4G A;  2V6T A;  1GE9 A;  1SMY A;  2PMZ L;  1VJE A;  2JA7 K;  4PAB A;  3HOY K;  4BY7 K;  3HOW C;  4C3J C;  4A3M K;  4QIW D;  4XLN A;  5C3E K;  4GTE A;  4GTF A;  3S14 K;  1DD5 A;  4IO9 S;  2R92 C;  1YNJ A;  3S17 C;  3S1R K;  1TWC C;  4KMD A;  4GTB A;  2KXY A;  4O2D A;  4C2M K;  4OIO A;  2WAQ L;  1ZVU A;  1UV7 A;  3T02 A;  5DM6 S;  1EK8 A;  2ZUF A;  4XSX A;  4KMA A;  1TWF K;  3S1N C;  1WCM K;  5IYD C;  2L5N A;  3BUE A;  4U67 S;  3ORE A;  4GFQ A;  1BGW A;  4DDQ A;  1V5V A;  2NVX A;  4WFB S;  2P5M A;  2NVY K;  2ZFZ A;  2YU9 K;  1HQM A;  3H3V L;  3L4J A;  5JVO A;  4LLG A;  4WJ4 A;  1J6V A;  3A8K A;  1PJ5 A;  3GTQ A;  1VH2 A;  4WFN S;  1Y1V A;  1I3Q A;  4C3I C;  4MEX A;  2A68 A;  4BXX C;  2O5J A;  5L46 A;  4A3I K;  3Q3Q A;  4NOI A;  3S2H C;  5EGH A;  4AYB D;  4WCE S;  3M3Y C;  2FQO A;  4X6A K;  3GTO K;  4KM8 A;  3AQP A;  1WQG A;  3FKI A;  5IP7 K;  3S1Q K;  4Q4Z A;  3HOX K;  1EH1 A;  2NVT C;  3AD8 C;  2PPB A;  5M3M K;  2B63 K;  4FZB A;  4G7Z A;  4LK1 A;  1I50 A;  4XSZ A;  5FLM C;  1PJ7 A;  5IP9 K;  3GTQ C;  3GTG K;  4M1X A;  2E2H A;  2PHC B;  1K83 K;  2E2J K;  2R92 K;  1Y1V C;  4BY1 C;  1I3Q C;  3A8J A;  4A3E K;  5C44 C;  4KMH A;  3S17 K;  3GTM C;  3GTK A;  5DM7 S;  3OEP A;  1DCO A;  4KDD A;  3L4K A;  3PO2 K;  2R7Z K;  4RMF A;  1TWH A;  4YG2 A;  4BBS C;  4A3L K;  4C3H C;  2ZUE A;  2JA8 K;  1BS2 A;  1SFO C;  3GEE A;  1PJ6 A;  1I50 C;  1WOS A;  2FQT A;  3I4M K;  3K7A C;  1J6X A;  4YFK A;  3M4O C;  1YX2 A;  3GIR A;  4KAT A;  3GTP A;  2E2H C;  3T00 A;  2JA6 K;  4OIR A;  4G0W A;  4A3D K;  1IBA A;  5FJ8 K;  5JFE A;  1DCP A;  2V6U A;  3GTK C;  3S1M C;  1G51 A;  4Y52 K;  3G4A A;  3HKZ L;  4BLA A;  4BXX K;  2JA5 A;  3S15 C;  5C4J K;  3HOU C;  3H0G A;  1IQ0 A;  3IPJ A;  3PO3 K;  3EQL A;  4AH6 A;  5IYC K;  1TWH C;  3RZO K;  1ISE A;  1VLO A;  1O25 A;  1XZP A;  2VUM A;  4KAR A;  2NVX K;  5IOT A;  1Y1W K;  4LOW A;  1FEU A;  1O2A A;  3GTJ C;  1ZQ1 C;  1ZXO A;  1I6H K;  3GTP C;  4LR2 A;  3OPF A;  4OIN A;  3BP3 A;  4C45 A;  3CAG A;  1TWA A;  4P5B A;  5IOQ A;  4AYB L;  4A3F K;  4WJ3 M;  3S16 C;  4WF9 S;  5C44 K;  4LK0 A;  3LAP A;  3TTG A;  2JA5 C;  3HOZ C;  3HXA A;  2Y0S D;  4KM9 A;  3H0G C;  3S2D K;  1IL2 A;  1KQ4 A;  5IYB C;  3GSI A;  4IOA S;  2PMZ D;  1AB4 A;  5D4D A;  3DLL S;  1XXC A;  5HL8 A;  4BBR K;  4A3C K;  1O26 A;  4J3N A;  3FKI K;  1RU0 A;  2VUM C;  2R93 K;  4C3H K;  1J98 A;  3GTM A;  4A3J K;  1VRQ C;  1IS1 A;  1JQW A;  3A8I A;  4A3G K;  1ZBS A;  3GTL C;  2WAQ D;  2BE5 A;  2E2I C;  3I4N C;  4GT9 A;  5C4X C;  4A3K K;  1TWA C;  4BLB A;  4A93 K;  1R9T K;  2WB1 L;  1O28 A;  5CHP A;  4G0U A;  4BY7 C;  3T01 A;  4A3M C;  1SFO A;  4Q5S A;  1XZP B;  2NVY A;  2YU9 A;  1O27 A;  3S1M K;  3HOW K;  1WSV A;  4C3J K;  3S14 C;  4XCH A;  1WQF A;  3HOU K;  4QJV A;  3S1R C;  3H3V D;  4C2M C;  4JK1 A;  1O2B A;  2XCQ A;  5IOR A;  4P5A A;  2ZJQ S;  3AD9 C;  1TWC K;  1BDF A;  1J6W A;  4GTA A;  2KQ1 A;  1WOR A;  4PAA A;  3PIO S;  1WCM C;  5HQH A;  4ZH4 A;  4QJV B;  3S0X A;  2XCR B;  3GTP K;  3S1N K;  3QX3 A;  3NUH A;  5IYD K;  4KB2 A;  2PA8 D;  2B63 A;  2D6F C;  4QIW L;  3TFI A;  3FOF A;  1JOE A;  2XCO A;  3GEH A;  3ERE D;  1WOO A;  2NVY C;  2YU9 C;  3S16 K;  2ZJR S;  3GTJ A;  3HOZ K;  1VGX A;  3H0G K;  3GTG A;  1K83 A;  3DXJ A;  1WOP A;  1O24 A;  1XXB A;  4P9S A;  4BKW A;  2P8T A;  2A69 A;  5E68 A;  4C3I K;  4X6A C;  1TWG A;  4IOC S;  4G7H A;  3S2H K;  5M3F K;  3M3Y K;  1YCL A;  5IP7 C;  2NVQ C;  1INN A;  4KMU A;  3S1Q C;  2R7Z A;  3N3Y A;  3HOX C;  1O29 A;  2B63 C;  1X31 C; 
#chains in the Genus database with same CATH homology
 4A3B C;  4BBR C;  5M3M K;  1TWA K;  3S2D K;  4A3C C;  5IYB C;  2NVT K;  2Y0S L;  2B63 K;  2PMZ D;  5D4D A;  4BBR K;  4G7Z A;  4YFX A;  2A6H A;  5IYB K;  4A3C K;  4OIP A;  1ZYR A;  3FKI C;  4Y7N C;  4LK1 A;  3WOD A;  4XSZ A;  3FKI K;  2R93 C;  5FLM C;  4A3I C;  4G7O A;  4A3J C;  2VUM C;  5IP9 C;  2R93 K;  5FLM K;  4KN7 A;  4C3H K;  3GTG C;  4A3J K;  2VUM K;  4A3G C;  1K83 C;  4XLP A;  5IP9 K;  2CW0 A;  2E2J C;  3GTO C;  3GTQ C;  3RZD K;  3GTG K;  4A3E C;  4A3G K;  1K83 K;  5M5W K;  3GTL C;  2E2J K;  3GTQ K;  2R92 K;  2WAQ D;  1Y1V C;  4BY1 C;  1I3Q C;  4A3E K;  2BE5 A;  5C44 C;  2E2I C;  3GTL K;  4A3K C;  3S17 K;  1Y1V K;  4BY1 K;  1I3Q K;  3I4N C;  3GTM C;  4A93 C;  2E2I K;  1TWG C;  5C4X C;  4A3K K;  1R9T C;  3CQZ K;  3HOV K;  1TWA C;  3I4N K;  3GTM K;  4A93 K;  5C4X K;  1R9T K;  4MEY A;  2WB1 L;  3PO2 C;  2PPB A;  1SMY A;  2R7Z C;  4BY7 C;  3HKZ D;  3PO2 K;  4A3M C;  4Q5S A;  2PMZ L;  2JA7 K;  3HOY K;  2R7Z K;  4BY7 K;  3HOW C;  4A3L C;  4C3J C;  4A3M K;  4YG2 A;  2JA8 C;  4QIW D;  4XLN A;  4BBS C;  3S1M K;  3HOW K;  4C3H C;  5C3E K;  4C3J K;  3S14 C;  4A3L K;  2JA8 K;  3RZD C;  4BBS K;  5M5X K;  3S14 K;  3HOU K;  1SFO C;  4QJV A;  2R92 C;  3I4M C;  3S1R C;  1I50 C;  1YNJ A;  1SFO K;  3H3V D;  3S17 C;  2A6E A;  4JK1 A;  4C2M C;  1I50 K;  3S1R K;  1TWC C;  3I4M K;  3HOV C;  3CQZ C;  3K7A C;  4OIO A;  2WAQ L;  4C2M K;  4YFK A;  1TWC K;  1TWG K;  3M4O C;  1BDF A;  2O5I A;  2JA6 C;  3K7A K;  2E2H C;  3M4O K;  2JA6 K;  4OIQ A;  4A3D C;  4OIR A;  2E2H K;  5M5Y K;  4XSX A;  2JA7 C;  1WCM C;  3HOY C;  4A3D K;  4Y52 C;  5FJ8 K;  4QJV B;  4ZH4 A;  1TWF K;  3GTK C;  3S1M C;  3S1N C;  4LJZ A;  5C4J C;  5IYD C;  5C3E C;  1WCM K;  4Y52 K;  5TMC A;  3HKZ L;  3GTP K;  3GTK K;  3S15 C;  5C4J K;  3S1N K;  4BXX K;  5IYD K;  3PO3 C;  2PA8 D;  3HOU C;  4QIW L;  3S15 K;  5TMF A;  3PO3 K;  5IYC C;  2PA8 L;  3RZO C;  3EQL A;  5IYC K;  1TWH C;  2NVQ K;  2NVY C;  2YU9 C;  3RZO K;  3S16 K;  1TWH K;  2NVY K;  1XPP A;  2YU9 K;  1HQM A;  3H3V L;  4GZY A;  2NVX C;  3HOZ K;  1Y1W C;  3H0G K;  4A3B K;  4LLG A;  2NVX K;  4YFN A;  4KN4 A;  3DXJ A;  1Y1W K;  1I6H C;  4Y7N K;  1TWF C;  2A69 A;  1I6V A;  3GTJ C;  4C3I C;  1IW7 A;  4MEX A;  1I6H K;  2A68 A;  3GTP C;  4BXX C;  2O5J A;  3GTJ K;  4A3I K;  4OIN A;  4C3I K;  2NVT C;  4X6A C;  4NOI A;  4G7H A;  3S2H C;  4AYB D;  3M3Y C;  4X6A K;  4A3F C;  3GTO K;  3S2H K;  5M3F K;  4AYB L;  3M3Y K;  4A3F K;  5IP7 C;  2NVQ C;  4KMU A;  3S1Q C;  1YNN A;  3S16 C;  3HOX C;  5C44 K;  4LK0 A;  5IP7 K;  2WB1 D;  4Q4Z A;  4MQ9 A;  2JA5 C;  3S2D C;  3S1Q K;  3HOZ C;  3HOX K;  2Y0S D;  2B63 C;  3H0G C;  2JA5 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...