2L5NA

Nmr structure of ybbr family protein dhaf_0833 (residues 32-118) from desulfitobacterium hafniense dcb-2: northeast structural genomics consortium target dhr29b
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
96
structure length
96
Chain Sequence
SSQTLDRDPTLTLSLIAKNTPANSMIMTKLPSVRVKTEGYNPSINVNELFAYVDLSGSEPGEHDYEVKVEPIPNIKIVEISPRVVTLQLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords YbbR family protein
publication title Structures of domains I and IV from YbbR are representative of a widely distributed protein family.
pubmed doi rcsb
source organism Desulfitobacterium hafniense
molecule tags Structural genomics, unknown function
total genus 3
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2010-11-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.30 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 RNA Polymerase Alpha Subunit; Chain A, domain 2 2l5nA00
3LYWA 2L3UA 2KQ1A 2L5NA 5HQHA 2KPUA
chains in the Genus database with same CATH superfamily
1TWGC 1TWFC 2WAQD 4QIWD 4Y52C 4WFBS 5C4JC 4BBRC 2E2IC 4C3JC 3S1RC 2A68A 3HOZC 3I4MC 3S2HC 3S2DC 5FLMC 4LLGA 4ZH4A 2KXYA 3GTGC 4OIQA 4AYBD 4LK1A 3RZOC 1FEUA 4A3FC 3S1QC 1YNJA 1Y1VC 5DM7S 5TMFA 2PPBA 3HOVC 4G7ZA 2JA5C 4YFKA 3PIPS 1SFOC 1ZYRA 3S14C 4IOAS 5C4XC 4WFNS 4WF9S 1Y1WC 5JVGS 4BXXC 1TWCC 2KPUA 2R92C 2A6EA 5IYBC 4A3GC 4A3BC 1TWAC 4OINA 3PO3C 4MQ9A 2R93C 4BBSC 3GTKC 3DLLS 3RZDC 4A3CC 1IW7A 4WCES 4LK0A 3S16C 3PIOS 2E2HC 3I4NC 5DM6S 3LYWA 3H0GC 2CW0A 3FKIC 5IYDC 5JVHS 3S15C 4BY1C 5D4DA 2PMZD 4A3MC 4C3HC 3HKZD 4KMUA 2BE5A 2ZJRS 1WCMC 2E2JC 1BDFA 5IYCC 5HL7S 4MEXA 2ZJPS 3WODA 3M4OC 4OIRA 3CQZC 2NVQC 4G7OA 4A93C 1I6HC 1SMYA 2NVTC 3S17C 2Y0SD 4MEYA 4A3JC 4C3IC 3S1NC 4IOCS 2YU9C 4WFAS 4NOIA 4A3KC 3GTJC 2L3UA 4A3EC 3HOWC 3K7AC 4Y7NC 3PO2C 4XSZA 3GTPC 1I3QC 1I6VA 4Q4ZA 4X6AC 1K83C 2WB1D 1I50C 2NVYC 2NVXC 4A3DC 1TWHC 4OIPA 3HOUC 3M3YC 2L5NA 4A3LC 4YFXA 4A3IC 4BY7C 1R9TC 3GTOC 5TMCA 2R7ZC 2O5IA 2O5JA 4Q5SA 4KN7A 4U67S 3GTMC 1YNNA 4OIOA 3CF5S 3GTLC 3H3VD 2A6HA 4G7HA 4GZYA 4XSXA 4KN4A 2B63C 1HQMA 3GTQC 3EQLA 5HQHA 3HOYC 2JA8C 3DXJA 3HOXC 2JA7C 4C2MC 4IO9S 4XLNA 4JK1A 5IP7C 4QJVA 2VUMC 2JA6C 4YFNA 3S1MC 2ZJQS 4YG2A 2KQ1A 5C44C 5C3EC 2PA8D 2A69A 5IP9C 4LJZA 4XLPA
chains in the Genus database with same CATH topology
3LYWA 2L3UA 2KQ1A 2L5NA 5HQHA 2KPUA 2KXYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LYW A;  2L3U A;  2KQ1 A;  2L5N A;  5HQH A;  2KPU A; 
#chains in the Genus database with same CATH topology
 1TWG C;  1TWF C;  2WAQ D;  4QIW D;  4Y52 C;  4WFB S;  5C4J C;  4BBR C;  2E2I C;  4C3J C;  3S1R C;  2A68 A;  3HOZ C;  3I4M C;  3S2H C;  3S2D C;  5FLM C;  4LLG A;  4ZH4 A;  2KXY A;  3GTG C;  4OIQ A;  4AYB D;  4LK1 A;  3RZO C;  1FEU A;  4A3F C;  3S1Q C;  1YNJ A;  1Y1V C;  5DM7 S;  5TMF A;  2PPB A;  3HOV C;  4G7Z A;  2JA5 C;  4YFK A;  3PIP S;  1SFO C;  1ZYR A;  3S14 C;  4IOA S;  5C4X C;  4WFN S;  4WF9 S;  1Y1W C;  5JVG S;  4BXX C;  1TWC C;  2KPU A;  2R92 C;  2A6E A;  5IYB C;  4A3G C;  4A3B C;  1TWA C;  4OIN A;  3PO3 C;  4MQ9 A;  2R93 C;  4BBS C;  3GTK C;  3DLL S;  3RZD C;  4A3C C;  1IW7 A;  4WCE S;  4LK0 A;  3S16 C;  3PIO S;  2E2H C;  3I4N C;  5DM6 S;  3LYW A;  3H0G C;  2CW0 A;  3FKI C;  5IYD C;  5JVH S;  3S15 C;  4BY1 C;  5D4D A;  2PMZ D;  4A3M C;  4C3H C;  3HKZ D;  4KMU A;  2BE5 A;  2ZJR S;  1WCM C;  2E2J C;  1BDF A;  5IYC C;  5HL7 S;  4MEX A;  2ZJP S;  3WOD A;  3M4O C;  4OIR A;  3CQZ C;  2NVQ C;  4G7O A;  4A93 C;  1I6H C;  1SMY A;  2NVT C;  3S17 C;  2Y0S D;  4MEY A;  4A3J C;  4C3I C;  3S1N C;  4IOC S;  2YU9 C;  4WFA S;  4NOI A;  4A3K C;  3GTJ C;  2L3U A;  4A3E C;  3HOW C;  3K7A C;  4Y7N C;  3PO2 C;  4XSZ A;  3GTP C;  1I3Q C;  1I6V A;  4Q4Z A;  4X6A C;  1K83 C;  2WB1 D;  1I50 C;  2NVY C;  2NVX C;  4A3D C;  1TWH C;  4OIP A;  3HOU C;  3M3Y C;  2L5N A;  4A3L C;  4YFX A;  4A3I C;  4BY7 C;  1R9T C;  3GTO C;  5TMC A;  2R7Z C;  2O5I A;  2O5J A;  4Q5S A;  4KN7 A;  4U67 S;  3GTM C;  1YNN A;  4OIO A;  3CF5 S;  3GTL C;  3H3V D;  2A6H A;  4G7H A;  4GZY A;  4XSX A;  4KN4 A;  2B63 C;  1HQM A;  3GTQ C;  3EQL A;  5HQH A;  3HOY C;  2JA8 C;  3DXJ A;  3HOX C;  2JA7 C;  4C2M C;  4IO9 S;  4XLN A;  4JK1 A;  5IP7 C;  4QJV A;  2VUM C;  2JA6 C;  4YFN A;  3S1M C;  2ZJQ S;  4YG2 A;  2KQ1 A;  5C44 C;  5C3E C;  2PA8 D;  2A69 A;  5IP9 C;  4LJZ A;  4XLP A; 
#chains in the Genus database with same CATH homology
 3LYW A;  2L3U A;  2KQ1 A;  2L5N A;  5HQH A;  2KPU A;  2KXY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...