2L5NA

Nmr structure of ybbr family protein dhaf_0833 (residues 32-118) from desulfitobacterium hafniense dcb-2: northeast structural genomics consortium target dhr29b
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
96
structure length
96
Chain Sequence
SSQTLDRDPTLTLSLIAKNTPANSMIMTKLPSVRVKTEGYNPSINVNELFAYVDLSGSEPGEHDYEVKVEPIPNIKIVEISPRVVTLQLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of domains I and IV from YbbR are representative of a widely distributed protein family.
pubmed doi rcsb
source organism Desulfitobacterium hafniense
molecule tags Structural genomics, unknown function
molecule keywords YbbR family protein
total genus 3
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2010-11-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.30 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 RNA Polymerase Alpha Subunit; Chain A, domain 2 2l5nA00
3LYWA 5HQHA 2L5NA 2KQ1A 2L3UA 2KPUA
chains in the Genus database with same CATH superfamily
4C3HC 5JVGS 3S2DC 3HOWC 4A3BC 2A69A 1WCMC 1I50C 2L5NA 5HL7S 4A93C 3K7AC 4G7ZA 3S15C 2B63C 3GTOC 1FEUA 3CQZC 4C3IC 4OIPA 4IOCS 4BBSC 3GTKC 1I6VA 5D4DA 2PPBA 4A3DC 4BY7C 3H3VD 3GTMC 3GTGC 4G7OA 4WFNS 3S17C 2KXYA 4BBRC 3PIOS 3M3YC 1I6HC 4IO9S 3I4NC 4LJZA 3GTJC 4C2MC 4LK1A 5IP9C 2JA6C 1YNNA 1SMYA 5DM7S 5C44C 2ZJQS 2CW0A 3HOVC 2NVQC 4MEXA 3S16C 1K83C 3H0GC 3LYWA 2PA8D 4A3LC 1I3QC 2E2IC 3GTPC 4LK0A 4BY1C 5C4XC 2KPUA 2VUMC 2A6EA 4KN4A 4Y7NC 3S2HC 2YU9C 2A6HA 5HQHA 4XSZA 1TWCC 2BE5A 2ZJPS 3PO2C 1ZYRA 2L3UA 2R7ZC 4A3KC 2WB1D 3PO3C 4KN7A 4Q5SA 4OINA 2E2JC 3S1MC 1HQMA 5IP7C 2R92C 4OIOA 3RZDC 4WFAS 1IW7A 3DXJA 2JA7C 1Y1WC 3S1QC 3HKZD 4MEYA 4U67S 3S1RC 3CF5S 4MQ9A 4KMUA 2JA8C 2O5IA 4YFKA 5TMFA 3S14C 1TWFC 5TMCA 5IYDC 2KQ1A 3PIPS 4WF9S 4ZH4A 3GTLC 4A3MC 5JVHS 4A3CC 4WFBS 3HOXC 4A3JC 2O5JA 2NVYC 1TWAC 2JA5C 4XLNA 4LLGA 4JK1A 2NVTC 2E2HC 4BXXC 4YFNA 3RZOC 4X6AC 4YG2A 3EQLA 1TWHC 1Y1VC 4QJVA 3M4OC 2WAQD 1YNJA 4NOIA 1R9TC 3DLLS 4AYBD 4A3IC 4GZYA 3HOZC 3WODA 4WCES 3GTQC 4Q4ZA 4G7HA 3S1NC 1BDFA 5FLMC 5C4JC 4QIWD 1TWGC 3HOYC 4A3GC 4OIQA 4Y52C 2ZJRS 2R93C 4XLPA 3FKIC 3HOUC 4A3EC 2A68A 2PMZD 2NVXC 5IYBC 5C3EC 4OIRA 5DM6S 5IYCC 4XSXA 3I4MC 1SFOC 4YFXA 2Y0SD 4C3JC 4A3FC 4IOAS
chains in the Genus database with same CATH topology
3LYWA 5HQHA 2L5NA 2KQ1A 2L3UA 2KPUA 2KXYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LYW A;  5HQH A;  2L5N A;  2KQ1 A;  2L3U A;  2KPU A; 
#chains in the Genus database with same CATH topology
 4C3H C;  5JVG S;  3S2D C;  3HOW C;  4A3B C;  2A69 A;  1WCM C;  1I50 C;  2L5N A;  5HL7 S;  4A93 C;  3K7A C;  4G7Z A;  3S15 C;  2B63 C;  3GTO C;  1FEU A;  3CQZ C;  4C3I C;  4OIP A;  4IOC S;  4BBS C;  3GTK C;  1I6V A;  5D4D A;  2PPB A;  4A3D C;  4BY7 C;  3H3V D;  3GTM C;  3GTG C;  4G7O A;  4WFN S;  3S17 C;  2KXY A;  4BBR C;  3PIO S;  3M3Y C;  1I6H C;  4IO9 S;  3I4N C;  4LJZ A;  3GTJ C;  4C2M C;  4LK1 A;  5IP9 C;  2JA6 C;  1YNN A;  1SMY A;  5DM7 S;  5C44 C;  2ZJQ S;  2CW0 A;  3HOV C;  2NVQ C;  4MEX A;  3S16 C;  1K83 C;  3H0G C;  3LYW A;  2PA8 D;  4A3L C;  1I3Q C;  2E2I C;  3GTP C;  4LK0 A;  4BY1 C;  5C4X C;  2KPU A;  2VUM C;  2A6E A;  4KN4 A;  4Y7N C;  3S2H C;  2YU9 C;  2A6H A;  5HQH A;  4XSZ A;  1TWC C;  2BE5 A;  2ZJP S;  3PO2 C;  1ZYR A;  2L3U A;  2R7Z C;  4A3K C;  2WB1 D;  3PO3 C;  4KN7 A;  4Q5S A;  4OIN A;  2E2J C;  3S1M C;  1HQM A;  5IP7 C;  2R92 C;  4OIO A;  3RZD C;  4WFA S;  1IW7 A;  3DXJ A;  2JA7 C;  1Y1W C;  3S1Q C;  3HKZ D;  4MEY A;  4U67 S;  3S1R C;  3CF5 S;  4MQ9 A;  4KMU A;  2JA8 C;  2O5I A;  4YFK A;  5TMF A;  3S14 C;  1TWF C;  5TMC A;  5IYD C;  2KQ1 A;  3PIP S;  4WF9 S;  4ZH4 A;  3GTL C;  4A3M C;  5JVH S;  4A3C C;  4WFB S;  3HOX C;  4A3J C;  2O5J A;  2NVY C;  1TWA C;  2JA5 C;  4XLN A;  4LLG A;  4JK1 A;  2NVT C;  2E2H C;  4BXX C;  4YFN A;  3RZO C;  4X6A C;  4YG2 A;  3EQL A;  1TWH C;  1Y1V C;  4QJV A;  3M4O C;  2WAQ D;  1YNJ A;  4NOI A;  1R9T C;  3DLL S;  4AYB D;  4A3I C;  4GZY A;  3HOZ C;  3WOD A;  4WCE S;  3GTQ C;  4Q4Z A;  4G7H A;  3S1N C;  1BDF A;  5FLM C;  5C4J C;  4QIW D;  1TWG C;  3HOY C;  4A3G C;  4OIQ A;  4Y52 C;  2ZJR S;  2R93 C;  4XLP A;  3FKI C;  3HOU C;  4A3E C;  2A68 A;  2PMZ D;  2NVX C;  5IYB C;  5C3E C;  4OIR A;  5DM6 S;  5IYC C;  4XSX A;  3I4M C;  1SFO C;  4YFX A;  2Y0S D;  4C3J C;  4A3F C;  4IOA S; 
#chains in the Genus database with same CATH homology
 3LYW A;  5HQH A;  2L5N A;  2KQ1 A;  2L3U A;  2KPU A;  2KXY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...