2L5NA

Nmr structure of ybbr family protein dhaf_0833 (residues 32-118) from desulfitobacterium hafniense dcb-2: northeast structural genomics consortium target dhr29b
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
96
structure length
96
Chain Sequence
SSQTLDRDPTLTLSLIAKNTPANSMIMTKLPSVRVKTEGYNPSINVNELFAYVDLSGSEPGEHDYEVKVEPIPNIKIVEISPRVVTLQLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords YbbR family protein
publication title Structures of domains I and IV from YbbR are representative of a widely distributed protein family.
pubmed doi rcsb
source organism Desulfitobacterium hafniense
total genus 3
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2010-11-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.30 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 RNA Polymerase Alpha Subunit; Chain A, domain 2 2l5nA00
2KQ1A 3LYWA 5HQHA 2L5NA 2L3UA 2KPUA
chains in the Genus database with same CATH superfamily
4IO9S 4Q5SA 2ZJPS 5D4DA 2JA8C 5HL7S 1IW7A 1I6VA 2NVYC 4LJZA 4YFXA 4QJVA 2NVTC 4GZYA 4X6AC 3S15C 2R92C 1YNJA 4LK1A 2NVXC 1ZYRA 2A6EA 5DM7S 5IYBC 4WF9S 2Y0SD 5HQHA 2BE5A 3S2HC 2A68A 4BBSC 2VUMC 4BY7C 3HOYC 2PMZD 4LLGA 2O5IA 4U67S 2KXYA 3GTGC 1SFOC 1Y1VC 1TWGC 4WFBS 1R9TC 4XSXA 4A3KC 3HOVC 3EQLA 3HOWC 4C2MC 2A69A 4NOIA 5C4JC 3M4OC 2JA5C 1TWAC 2PPBA 4G7OA 4YFNA 2L3UA 1I3QC 4A3MC 4AYBD 3S16C 3GTPC 5IYCC 2R7ZC 2B63C 5C3EC 4A3CC 1K83C 4YFKA 2A6HA 1WCMC 3CQZC 4OIQA 4A3GC 3HOUC 3S1QC 3PIOS 5TMCA 4A3DC 4KMUA 1BDFA 5DM6S 3RZDC 2JA6C 2E2JC 3S2DC 4OIPA 3GTLC 5C44C 1I50C 2PA8D 2L5NA 4IOAS 4G7ZA 5FLMC 1YNNA 4IOCS 3GTMC 4A3JC 3PIPS 3K7AC 4MEYA 4WFNS 4A3EC 2NVQC 4YG2A 1I6HC 4JK1A 3I4MC 5JVHS 4C3HC 3LYWA 3S1NC 4Y52C 2WB1D 4A3BC 3PO3C 3S1RC 4MEXA 4A93C 3GTQC 4ZH4A 3GTJC 4A3FC 4A3IC 3HOXC 4QIWD 4Q4ZA 5IP7C 3S1MC 2WAQD 1TWCC 5IYDC 3FKIC 4BXXC 3HOZC 4C3JC 3S14C 4LK0A 4OINA 2O5JA 2KPUA 4MQ9A 4BY1C 4Y7NC 3H0GC 3GTKC 3S17C 2CW0A 1TWFC 3DXJA 4KN4A 3PO2C 5JVGS 3HKZD 2KQ1A 3DLLS 4XLNA 4KN7A 4A3LC 3M3YC 2ZJRS 4WCES 4XSZA 5IP9C 4BBRC 2E2HC 4OIOA 1FEUA 4XLPA 3GTOC 1SMYA 4WFAS 2ZJQS 2E2IC 3I4NC 1TWHC 4OIRA 2YU9C 4G7HA 3H3VD 3RZOC 5C4XC 2JA7C 1HQMA 4C3IC 2R93C 3WODA 5TMFA 1Y1WC 3CF5S
chains in the Genus database with same CATH topology
2KQ1A 3LYWA 5HQHA 2L5NA 2L3UA 2KPUA 2KXYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KQ1 A;  3LYW A;  5HQH A;  2L5N A;  2L3U A;  2KPU A; 
#chains in the Genus database with same CATH topology
 4IO9 S;  4Q5S A;  2ZJP S;  5D4D A;  2JA8 C;  5HL7 S;  1IW7 A;  1I6V A;  2NVY C;  4LJZ A;  4YFX A;  4QJV A;  2NVT C;  4GZY A;  4X6A C;  3S15 C;  2R92 C;  1YNJ A;  4LK1 A;  2NVX C;  1ZYR A;  2A6E A;  5DM7 S;  5IYB C;  4WF9 S;  2Y0S D;  5HQH A;  2BE5 A;  3S2H C;  2A68 A;  4BBS C;  2VUM C;  4BY7 C;  3HOY C;  2PMZ D;  4LLG A;  2O5I A;  4U67 S;  2KXY A;  3GTG C;  1SFO C;  1Y1V C;  1TWG C;  4WFB S;  1R9T C;  4XSX A;  4A3K C;  3HOV C;  3EQL A;  3HOW C;  4C2M C;  2A69 A;  4NOI A;  5C4J C;  3M4O C;  2JA5 C;  1TWA C;  2PPB A;  4G7O A;  4YFN A;  2L3U A;  1I3Q C;  4A3M C;  4AYB D;  3S16 C;  3GTP C;  5IYC C;  2R7Z C;  2B63 C;  5C3E C;  4A3C C;  1K83 C;  4YFK A;  2A6H A;  1WCM C;  3CQZ C;  4OIQ A;  4A3G C;  3HOU C;  3S1Q C;  3PIO S;  5TMC A;  4A3D C;  4KMU A;  1BDF A;  5DM6 S;  3RZD C;  2JA6 C;  2E2J C;  3S2D C;  4OIP A;  3GTL C;  5C44 C;  1I50 C;  2PA8 D;  2L5N A;  4IOA S;  4G7Z A;  5FLM C;  1YNN A;  4IOC S;  3GTM C;  4A3J C;  3PIP S;  3K7A C;  4MEY A;  4WFN S;  4A3E C;  2NVQ C;  4YG2 A;  1I6H C;  4JK1 A;  3I4M C;  5JVH S;  4C3H C;  3LYW A;  3S1N C;  4Y52 C;  2WB1 D;  4A3B C;  3PO3 C;  3S1R C;  4MEX A;  4A93 C;  3GTQ C;  4ZH4 A;  3GTJ C;  4A3F C;  4A3I C;  3HOX C;  4QIW D;  4Q4Z A;  5IP7 C;  3S1M C;  2WAQ D;  1TWC C;  5IYD C;  3FKI C;  4BXX C;  3HOZ C;  4C3J C;  3S14 C;  4LK0 A;  4OIN A;  2O5J A;  2KPU A;  4MQ9 A;  4BY1 C;  4Y7N C;  3H0G C;  3GTK C;  3S17 C;  2CW0 A;  1TWF C;  3DXJ A;  4KN4 A;  3PO2 C;  5JVG S;  3HKZ D;  2KQ1 A;  3DLL S;  4XLN A;  4KN7 A;  4A3L C;  3M3Y C;  2ZJR S;  4WCE S;  4XSZ A;  5IP9 C;  4BBR C;  2E2H C;  4OIO A;  1FEU A;  4XLP A;  3GTO C;  1SMY A;  4WFA S;  2ZJQ S;  2E2I C;  3I4N C;  1TWH C;  4OIR A;  2YU9 C;  4G7H A;  3H3V D;  3RZO C;  5C4X C;  2JA7 C;  1HQM A;  4C3I C;  2R93 C;  3WOD A;  5TMF A;  1Y1W C;  3CF5 S; 
#chains in the Genus database with same CATH homology
 2KQ1 A;  3LYW A;  5HQH A;  2L5N A;  2L3U A;  2KPU A;  2KXY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...