2L5NA

Nmr structure of ybbr family protein dhaf_0833 (residues 32-118) from desulfitobacterium hafniense dcb-2: northeast structural genomics consortium target dhr29b
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
96
structure length
96
Chain Sequence
b'SSQTLDRDPTLTLSLIAKNTPANSMIMTKLPSVRVKTEGYNPSINVNELFAYVDLSGSEPGEHDYEVKVEPIPNIKIVEISPRVVTLQLEHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords YbbR family protein
publication title Structures of domains I and IV from YbbR are representative of a widely distributed protein family.
pubmed doi rcsb
source organism Desulfitobacterium hafniense
molecule tags Structural genomics, unknown function
total genus 3
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2010-11-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.30 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 RNA Polymerase Alpha Subunit; Chain A, domain 2 2l5nA00
2L3UA 5HQHA 2KPUA 2KQ1A 2L5NA 3LYWA
chains in the Genus database with same CATH superfamily
4YFKA 1I6VA 4A93C 1R9TC 1BDFA 2R92C 4A3IC 4IOAS 4IO9S 4QJVA 2L3UA 3S16C 2E2IC 3I4MC 3S2HC 4OINA 3I4NC 5TMCA 3GTOC 4LK1A 4G7ZA 4BY1C 4KMUA 5IP9C 4U67S 3PIPS 2BE5A 3K7AC 1YNNA 4WFBS 3FKIC 2A69A 2CW0A 2PPBA 4BBSC 3GTGC 4XLNA 4MQ9A 2JA6C 2KQ1A 2L5NA 4Y52C 2NVQC 3PO3C 2WAQD 4A3KC 4A3BC 4KN7A 3PIOS 4NOIA 2R7ZC 2E2JC 4A3CC 2O5IA 2O5JA 3CF5S 4A3MC 2NVXC 3HOZC 1TWCC 2B63C 2WB1D 4OIRA 4Q4ZA 4AYBD 4Y7NC 2VUMC 4A3LC 5HL7S 2ZJPS 3DLLS 5FLMC 3M4OC 2JA7C 4YFNA 4G7HA 4BY7C 4OIOA 4WFAS 4XSXA 2KPUA 4G7OA 1I6HC 1WCMC 3S1MC 1I3QC 5IYCC 3HOVC 5D4DA 3EQLA 5HQHA 3GTJC 4MEXA 5IP7C 5JVHS 5IYBC 1FEUA 3S17C 4LJZA 4OIQA 3M3YC 5C3EC 3GTQC 1K83C 3S15C 1Y1VC 4C3IC 3S1NC 4XLPA 4YG2A 4A3GC 3HOUC 4A3EC 2NVTC 5C44C 2NVYC 5DM6S 2E2HC 4A3FC 4WCES 4KN4A 1TWGC 3RZDC 1TWHC 4C3HC 3GTKC 4JK1A 5IYDC 4GZYA 4LK0A 2A68A 3S14C 3GTPC 5DM7S 5JVGS 2Y0SD 4XSZA 4MEYA 3PO2C 1I50C 2R93C 3H3VD 4YFXA 4A3JC 4WF9S 3DXJA 4IOCS 2PMZD 4Q5SA 3LYWA 1ZYRA 2YU9C 3HOXC 2JA5C 3HOYC 1TWAC 3CQZC 2ZJQS 3H0GC 4BXXC 3GTMC 2A6EA 2KXYA 4ZH4A 4LLGA 4OIPA 4QIWD 4BBRC 1SFOC 4A3DC 4C2MC 3S2DC 4X6AC 1SMYA 5TMFA 3S1RC 3RZOC 2ZJRS 4WFNS 1HQMA 3GTLC 2JA8C 1IW7A 1YNJA 2PA8D 2A6HA 1TWFC 4C3JC 5C4JC 3HOWC 3S1QC 1Y1WC 3HKZD 3WODA 5C4XC
chains in the Genus database with same CATH topology
2L3UA 2KXYA 5HQHA 2KPUA 2KQ1A 2L5NA 3LYWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L3U A;  5HQH A;  2KPU A;  2KQ1 A;  2L5N A;  3LYW A; 
#chains in the Genus database with same CATH topology
 4YFK A;  1I6V A;  4A93 C;  1R9T C;  1BDF A;  2R92 C;  4A3I C;  4IOA S;  4IO9 S;  4QJV A;  2L3U A;  3S16 C;  2E2I C;  3I4M C;  3S2H C;  4OIN A;  3I4N C;  5TMC A;  3GTO C;  4LK1 A;  4G7Z A;  4BY1 C;  4KMU A;  5IP9 C;  4U67 S;  3PIP S;  2BE5 A;  3K7A C;  1YNN A;  4WFB S;  3FKI C;  2A69 A;  2CW0 A;  2PPB A;  4BBS C;  3GTG C;  4XLN A;  4MQ9 A;  2JA6 C;  2KQ1 A;  2L5N A;  4Y52 C;  2NVQ C;  3PO3 C;  2WAQ D;  4A3K C;  4A3B C;  4KN7 A;  3PIO S;  4NOI A;  2R7Z C;  2E2J C;  4A3C C;  2O5I A;  2O5J A;  3CF5 S;  4A3M C;  2NVX C;  3HOZ C;  1TWC C;  2B63 C;  2WB1 D;  4OIR A;  4Q4Z A;  4AYB D;  4Y7N C;  2VUM C;  4A3L C;  5HL7 S;  2ZJP S;  3DLL S;  5FLM C;  3M4O C;  2JA7 C;  4YFN A;  4G7H A;  4BY7 C;  4OIO A;  4WFA S;  4XSX A;  2KPU A;  4G7O A;  1I6H C;  1WCM C;  3S1M C;  1I3Q C;  5IYC C;  3HOV C;  5D4D A;  3EQL A;  5HQH A;  3GTJ C;  4MEX A;  5IP7 C;  5JVH S;  5IYB C;  1FEU A;  3S17 C;  4LJZ A;  4OIQ A;  3M3Y C;  5C3E C;  3GTQ C;  1K83 C;  3S15 C;  1Y1V C;  4C3I C;  3S1N C;  4XLP A;  4YG2 A;  4A3G C;  3HOU C;  4A3E C;  2NVT C;  5C44 C;  2NVY C;  5DM6 S;  2E2H C;  4A3F C;  4WCE S;  4KN4 A;  1TWG C;  3RZD C;  1TWH C;  4C3H C;  3GTK C;  4JK1 A;  5IYD C;  4GZY A;  4LK0 A;  2A68 A;  3S14 C;  3GTP C;  5DM7 S;  5JVG S;  2Y0S D;  4XSZ A;  4MEY A;  3PO2 C;  1I50 C;  2R93 C;  3H3V D;  4YFX A;  4A3J C;  4WF9 S;  3DXJ A;  4IOC S;  2PMZ D;  4Q5S A;  3LYW A;  1ZYR A;  2YU9 C;  3HOX C;  2JA5 C;  3HOY C;  1TWA C;  3CQZ C;  2ZJQ S;  3H0G C;  4BXX C;  3GTM C;  2A6E A;  2KXY A;  4ZH4 A;  4LLG A;  4OIP A;  4QIW D;  4BBR C;  1SFO C;  4A3D C;  4C2M C;  3S2D C;  4X6A C;  1SMY A;  5TMF A;  3S1R C;  3RZO C;  2ZJR S;  4WFN S;  1HQM A;  3GTL C;  2JA8 C;  1IW7 A;  1YNJ A;  2PA8 D;  2A6H A;  1TWF C;  4C3J C;  5C4J C;  3HOW C;  3S1Q C;  1Y1W C;  3HKZ D;  3WOD A;  5C4X C; 
#chains in the Genus database with same CATH homology
 2L3U A;  2KXY A;  5HQH A;  2KPU A;  2KQ1 A;  2L5N A;  3LYW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...