2PPBA

Crystal structure of the t. thermophilus rnap polymerase elongation complex with the ntp substrate analog and antibiotic streptolydigin
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
229
structure length
229
Chain Sequence
b'MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (5'-D(P*CP*CP*CP*TP*GP*TP*CP*TP*GP*GP*CP*GP*TP*TP*CP*GP*
publication title Structural basis for substrate loading in bacterial RNA polymerase.
pubmed doi rcsb
molecule tags Transferase/dna/rna
total genus 40
structure length 229
sequence length 229
chains with identical sequence B, K, L
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2007-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01000 RNA_pol_A_bac RNA polymerase Rpb3/RpoA insert domain
A PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain
A PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.12 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 DNA-directed RNA polymerase, insert domain 2ppbA02
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 2ppbA01
2NVQC 4A3DK 2JA6C 1SFOC 5M3MK 2PMZL 1YNJA 3I4NK 4YFNA 2PA8D 4A3DC 3S1NK 2B63K 3I4NC 2Y0SD 3S1NC 3FKIK 2YU9K 3DXJA 2B63C 3FKIC 3S1RK 2YU9C 1Y1VK 3HOYK 2A6HA 5M3FK 3HOZK 3S1RC 2NVTK 4BBSK 1Y1VC 3HOYC 4A3KK 2A69A 3HOZC 3WODA 2A68A 2NVTC 4BBSC 4A93K 4A3KC 2VUMK 2NVYK 4OIPA 4LLGA 4A93C 1XPPA 5M5YK 2VUMC 1HQMA 2A6EA 2NVYC 2JA7K 3HOXK 4A3BK 4Q5SA 4LJZA 4QIWL 5IP7K 4BY1K 2JA7C 4A3BC 3HOXC 2WAQD 5C4XK 3HOVK 5IP7C 3HOVC 4BY1C 5C4XC 1I3QK 4LK0A 5D4DA 3S17K 1I3QC 4C3HK 2PA8L 3HOUK 4OIRA 2CW0A 4C3HC 3S17C 2Y0SL 3GTOK 4JK1A 3HOUC 4QJVA 4A3JK 1BDFA 2O5JA 1TWGK 4OINA 3GTGK 4A3JC 4XSXA 4XLPA 1TWGC 3S1QK 3GTGC 3S1QC 3RZOK 2JA8K 4X6AK 2JA5K 4XLNA 3RZOC 5TMCA 4X6AC 5IYDK 2JA5C 2O5IA 5IYDC 1I50K 1TWAK 4G7ZA 3GTJK 2WAQL 1I50C 3GTJC 1TWAC 4MEYA 4AYBL 4Y7NK 3H3VD 1I6VA 4G7OA 4Y7NC 2E2HK 3S16K 5IP9K 4LK1A 4AYBD 2E2HC 3S16C 5IP9C 5IYBK 4YFKA 5TMFA 3PO2K 3M4OK 4A3LK 3HKZD 4C3IK 5IYBC 3PO2C 3M3YK 2WB1D 3M4OC 2JA6K 3GTKK 4A3LC 4C3IC 3M3YC 1TWCK 5C44K 3GTKC 4Y52K 1TWCC 3GTMK 5C44C 5C3EK 1I6HK 4Y52C 4C2MK 4YG2A 4A3IK 4A3MK 3GTMC 5M5XK 5C3EC 1I6HC 1TWFK 4BBRK 1R9TK 4KMUA 4C2MC 4A3IC 4A3MC 2PPBA 3GTOC 1TWFC 4BBRC 2R92K 1R9TC 5FLMK 4A3EK 2E2JK 4KN4A 2R92C 4BY7K 5M5WK 2E2JC 5FLMC 4A3EC 3S1MC 4BY7C 2JA8C 4YFXA 4GZYA 3H3VL 4A3CK 4A3GK 1K83K 4A3CC 4A3GC 1TWHK 2R93K 1K83C 4NOIA 3S2DK 1TWHC 1ZYRA 3CQZK 5C4JK 4ZH4A 2R93C 3S15K 3S2DC 3CQZC 5C4JC 4OIQA 3S15C 3H0GK 2WB1L 2BE5A 3HKZL 4QJVB 5IYCK 2NVXK 5IYCC 4Q4ZA 3H0GC 3EQLA 4G7HA 2NVXC 4BXXC 5FJ8K 4BXXK 3I4MK 1IW7A 3I4MC 4XSZA 2PMZD 3GTPK 2R7ZK 3GTPC 2R7ZC 4A3FK 3S14K 4OIOA 2E2IK 3GTLK 4MEXA 4A3FC 3S14C 1WCMK 2E2IC 3GTLC 1Y1WK 3K7AK 1WCMC 3PO3K 4KN7A 1Y1WC 3S2HK 3K7AC 4MQ9A 3PO3C 3GTQK 3S2HC 3GTQC 3HOWK 3S1MK 3RZDK 4QIWD 4C3JK 1SMYA 2NVQK 3HOWC 3RZDC 4C3JC 1SFOK 1YNNA
chains in the Genus database with same CATH superfamily
2D6FC 1SFOC 1O2BA 2PMZL 1YNJA 3I4NK 3S1NK 2ZFZA 2VUMA 2V6UA 2YU9K 2E2IA 2NVYA 1Y1VK 3HOYK 1VJEA 3S1RC 1EI6A 4LQYA 2A69A 2JA7K 1WOSA 3Q3QA 4Q5SA 3HOVK 1FEUA 4BY1C 1EK8A 1I3QK 1F7VA 5D4DA 3S17K 2PA8L 1O24A 4OIRA 1EFWA 4J3NA 4RMFA 3HOUC 2JA5A 2O5JA 1XZQA 4PAAA 3GEHA 3GTGC 2V6SA 4GTEA 1XZPB 1I50K 5IYDC 2WAQL 2ZJPS 3GTJC 1TWAC 4P9SA 1PJ7A 4Y7NC 3OPFA 1DCOA 3MMLB 4P5BA 3PO2K 4YFKA 4G0VA 4C3IK 1R9TA 1TWCK 4O2DA 1O29A 3BP8C 3GTMK 1VGXA 4GTBA 4YG2A 3GTJA 4GTFA 1I6HC 4C2MC 4A3IC 4A3MC 3GTOC 1O2FB 3L4JA 4BBRC 1J6VA 2R92K 3CQZA 4KN4A 4BY7K 1PJ5A 2E2JC 2NVXA 3SZYA 4A3GK 2CFAA 1TWHK 1C0AA 4NOIA 5C4JK 2ZJRS 2R93C 3TTGA 2KPUA 4OIQA 3HKZL 5IYCK 5HL7S 1L0WA 2BE5A 4BXXK 5DM7S 1XZQB 4Q4ZA 3AD8C 3VA7A 5FJ8K 1O25A 3N0CA 3AD7C 2JH3A 1WSVA 5HL8A 5DM6S 3AQOA 3GTPK 3T02A 3TFJA 3QX3A 2R7ZC 1F7UA 4A3FK 4OIOA 2E2IK 4IO9S 3AQPA 4KMHA 1WCMC 1ZVUA 4KN7A 4FZBA 3S2HK 3LPXA 4QIWD 2PHCB 1F93A 3GSIA 1SFOK 2NVQC 2JA6C 1B4BA 1YX2A 5M3MK 4KMDA 2Y0SD 3ADAC 3DXJA 1JQWA 3S0XA 3PIPS 3FKIC 1WCMA 3S1RK 5M3FK 3IPJA 3WODA 2A68A 4WFAS 3AD9C 4A93C 2VUMC 2A6EA 1GE9A 2NVYC 2JA6A 4BY1K 4A3BC 3HOXC 1TWGA 5C4XC 1XZPA 1J6WA 3HOUK 1B4AA 4C3HC 4QJVA 3ERED 1BDFA 2GSNA 3TFHA 3GTGK 4XSXA 2V6TA 4C45A 5TMCA 2E2HA 4X6AC 5IYDK 2JA5C 3CAGA 3GTJK 1TWAK 4G7ZA 2XCQA 3SZZA 4MEYA 4Y7NK 1O27A 3G4CA 5IP9C 5TMFA 1TWFA 1WQFA 3T01A 5IYBC 2WB1D 4GT9A 1J6XA 3JSTA 3A8JA 3GTKC 5C44C 1I6HK 4C2MK 4A3IK 4A3MK 3GTOK 5C3EC 4BBRK 3NUHA 2PPBA 1R9TC 2E2JK 4A3EC 3FHZA 4YFXA 3H3VL 5CHPA 1ZXOA 2R93K 1K83C 5HQHA 3GEEA 3GTKA 4GFQA 4XCHA 2KXYA 3S2DC 3CQZC 1WIHA 4QJVB 1WQHA 1BJTA 2NVXC 3A8IA 4FM9A 1AB4A 3I4MC 4LOWA 2PMZD 1Y1WA 2R7ZK 1EH1A 1K83A 1VH2A 5EGEA 4MEXA 3S14C 5JVGS 1WCMK 3GTLC 2L3UA 3K7AC 2FQTA 3PO3C 1DCPA 3GTQC 2NVQK 3RZDC 2JA6K 2RGRA 3FOEA 1Y1VA 1VRQC 4KASA 3LAJA 4YFNA 2PA8D 4A3DC 2KQ1A 1HI9A 3FKIK 3V4GA 3GTLA 2B63C 1IE0A 1USOA 2JA7A 5E68A 3HOZC 3GTQA 2NVTC 4BBSC 4A93K 4A3KC 1I3QA 2VUMK 2NVYK 4KATA 4LLGA 1XPPA 5M5YK 1HQMA 4A3BK 3N3YA 3HOXK 4KM9A 4LJZA 5C4XK 2WAQD 5IP7C 4WCES 5IOQA 5JFEA 2B63A 4C3HK 4GTAA 1JOEA 2RH6A 2XCOA 4WF9S 4KAWX 4GTDA 4OINA 4A3JC 1I50A 4XLPA 1TWGC 1DD5A 3GEIA 5EGHA 3S1QC 3TFIA 4X6AK 2JA5K 3RZOC 3G4AA 2GAHC 1IL2A 1WOPA 3A8KA 1TWCA 3CF5S 5IP9K 4AYBD 2E2HC 3S16C 5IYBK 3HKZD 3M4OC 3GDZA 2GAGC 4KB2A 4A3LC 3GTKK 3M3YC 2GSOA 4WJ3M 5C44K 5C3EK 4Y52C 2L5NA 1R9TK 1TWHA 3LAPA 1TWFC 4A3EK 5M5WK 5FLMC 4GZYA 1XXBA 4G0WA 1K83K 4M1XA 4A3CC 4AH6A 3S2DK 3CQZK 3BUEA 2KWAA 4WILA 3S15C 1WORA 2NVXK 2FQOA 3H0GC 3EQLA 4G7HA 1F9NA 4LR2A 3I4MK 4KDDA 5IOSA 2ZJQS 4KM8A 4WFBS 3S14K 1YCLA 3GTLK 2W7VA 3H0GA 4KC6A 3L4KA 3K7AK 1SFOA 1O2AA 1ZQ1C 3PO3K 1Y1WC 4MQ9A 3GTQK 1USMA 4BLAA 2GSUA 1BS2A 1IBAA 3RZDK 3S1MC 3HOWC 4C3JC 1YNNA 4G0UA 1WSRA 4A3DK 3FOFA 1IS1A 5IOTA 2B63K 3I4NC 1O28A 3S1NC 2YU9C 2A6HA 3HOZK 2NVTK 4BBSK 1Y1VC 3HOYC 3HXAA 4A3KK 5IORA 4OIPA 5IP7K 4QIWL 2JA7C 3HOVC 3GTGA 3LYWA 4LK0A 1I3QC 2YU9A 5TJ3A 5JVHS 2CW0A 3S17C 1IQ0A 2Y0SL 4JK1A 1XXAA 4WFNS 4A3JK 1VLOA 1TWGK 2ZUFA 1WQGA 1ISEA 1TWAA 3S1QK 1EQRA 4WJ4A 1JVIA 3RZOK 4IOCS 2JA8K 5L46A 4XLNA 2Y3PA 1V5VA 4P5AA 2O5IA 3N0BA 1I50C 5CJ9A 1O26A 4AYBL 3H3VD 1I6VA 4G7OA 2E2HK 3S16K 4LK1A 1KQ4A 4KMAA 3GTOA 3M4OK 4ILDA 4A3LK 3M3YK 3PO2C 4C3IC 1WOOA 4DDQA 2EBBA 4Y52K 1TWCC 4BLBA 1UV7A 3GTMC 5M5XK 1TWFK 1PJ6A 4KMUA 2ZUEA 3PIOS 2R93A 5FLMK 2R92C 3GIRA 1INNA 2XCRB 4BY7C 2JA8C 4A3CK 2P8TA 4A3GC 1TWHC 1ZYRA 3S15K 4ZH4A 3OEPA 1XXCA 1G51A 5C4JC 3H0GK 2WB1L 4IOAS 3GTMA 5IYCC 2R7ZA 4BXXC 2P5MA 2R92A 1ZBSA 1RU0A 1X31C 1IW7A 4XSZA 3DLLS 5JVOA 3GTPC 2CFAB 1BGWA 3OREA 4A3FC 2E2IC 1Y1WK 3AH5A 3BP3A 4GTLA 4KARA 4KB4A 3T00A 1J98A 3S2HC 4BKWA 3HOWK 4PABA 3S1MK 4C3JK 1DCHA 1SMYA 3FKIA 4GTCA 4U67S 3GTPA
chains in the Genus database with same CATH topology
2NVQC 4A3DK 2JA6C 1SFOC 5M3MK 2PMZL 1YNJA 3I4NK 4YFNA 2PA8D 4A3DC 3S1NK 2B63K 3I4NC 2Y0SD 3S1NC 3FKIK 2YU9K 3DXJA 2B63C 3FKIC 3S1RK 2YU9C 1Y1VK 3HOYK 2A6HA 5M3FK 3HOZK 3S1RC 2NVTK 4BBSK 1Y1VC 3HOYC 4A3KK 2A69A 3HOZC 3WODA 2A68A 2NVTC 4BBSC 4A93K 4A3KC 2VUMK 2NVYK 4OIPA 4LLGA 4A93C 1XPPA 5M5YK 2VUMC 1HQMA 2A6EA 2NVYC 2JA7K 3HOXK 4A3BK 4Q5SA 4LJZA 4QIWL 5IP7K 4BY1K 2JA7C 4A3BC 3HOXC 2WAQD 5C4XK 3HOVK 5IP7C 3HOVC 4BY1C 5C4XC 1I3QK 4LK0A 5D4DA 3S17K 1I3QC 4C3HK 2PA8L 3HOUK 4OIRA 2CW0A 4C3HC 3S17C 2Y0SL 3GTOK 4JK1A 3HOUC 4QJVA 4A3JK 1BDFA 2O5JA 1TWGK 4OINA 3GTGK 4A3JC 4XSXA 4XLPA 1TWGC 3S1QK 3GTGC 3S1QC 3RZOK 2JA8K 4X6AK 2JA5K 4XLNA 3RZOC 5TMCA 4X6AC 5IYDK 2JA5C 2O5IA 5IYDC 1I50K 1TWAK 4G7ZA 3GTJK 2WAQL 1I50C 3GTJC 1TWAC 4MEYA 4AYBL 4Y7NK 3H3VD 1I6VA 4G7OA 4Y7NC 2E2HK 3S16K 5IP9K 4LK1A 4AYBD 2E2HC 3S16C 5IP9C 5IYBK 4YFKA 5TMFA 3PO2K 3M4OK 4A3LK 3HKZD 4C3IK 5IYBC 3PO2C 3M3YK 2WB1D 3M4OC 2JA6K 3GTKK 4A3LC 4C3IC 3M3YC 1TWCK 5C44K 3GTKC 4Y52K 1TWCC 3GTMK 5C44C 5C3EK 1I6HK 4Y52C 4C2MK 4YG2A 4A3IK 4A3MK 3GTMC 5M5XK 5C3EC 1I6HC 1TWFK 4BBRK 1R9TK 4KMUA 4C2MC 4A3IC 4A3MC 2PPBA 3GTOC 1TWFC 4BBRC 2R92K 1R9TC 5FLMK 4A3EK 2E2JK 4KN4A 2R92C 4BY7K 5M5WK 2E2JC 5FLMC 4A3EC 3S1MC 4BY7C 2JA8C 4YFXA 4GZYA 3H3VL 4A3CK 4A3GK 1K83K 4A3CC 4A3GC 1TWHK 2R93K 1K83C 4NOIA 3S2DK 1TWHC 1ZYRA 3CQZK 5C4JK 4ZH4A 2R93C 3S15K 3S2DC 3CQZC 5C4JC 4OIQA 3S15C 3H0GK 2WB1L 2BE5A 3HKZL 4QJVB 5IYCK 2NVXK 5IYCC 4Q4ZA 3H0GC 3EQLA 4G7HA 2NVXC 4BXXC 5FJ8K 4BXXK 3I4MK 1IW7A 3I4MC 4XSZA 2PMZD 3GTPK 2R7ZK 3GTPC 2R7ZC 4A3FK 3S14K 4OIOA 2E2IK 3GTLK 4MEXA 4A3FC 3S14C 1WCMK 2E2IC 3GTLC 1Y1WK 3K7AK 1WCMC 3PO3K 4KN7A 1Y1WC 3S2HK 3K7AC 4MQ9A 3PO3C 3GTQK 3S2HC 3GTQC 3HOWK 3S1MK 3RZDK 4QIWD 4C3JK 1SMYA 2NVQK 3HOWC 3RZDC 4C3JC 1SFOK 1YNNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NVQ C;  4A3D K;  2JA6 C;  1SFO C;  5M3M K;  2PMZ L;  1YNJ A;  3I4N K;  4YFN A;  2PA8 D;  4A3D C;  3S1N K;  2B63 K;  3I4N C;  2Y0S D;  3S1N C;  3FKI K;  2YU9 K;  3DXJ A;  2B63 C;  3FKI C;  3S1R K;  2YU9 C;  1Y1V K;  3HOY K;  2A6H A;  5M3F K;  3HOZ K;  3S1R C;  2NVT K;  4BBS K;  1Y1V C;  3HOY C;  4A3K K;  2A69 A;  3HOZ C;  3WOD A;  2A68 A;  2NVT C;  4BBS C;  4A93 K;  4A3K C;  2VUM K;  2NVY K;  4OIP A;  4LLG A;  4A93 C;  1XPP A;  5M5Y K;  2VUM C;  1HQM A;  2A6E A;  2NVY C;  2JA7 K;  3HOX K;  4A3B K;  4Q5S A;  4LJZ A;  4QIW L;  5IP7 K;  4BY1 K;  2JA7 C;  4A3B C;  3HOX C;  2WAQ D;  5C4X K;  3HOV K;  5IP7 C;  3HOV C;  4BY1 C;  5C4X C;  1I3Q K;  4LK0 A;  5D4D A;  3S17 K;  1I3Q C;  4C3H K;  2PA8 L;  3HOU K;  4OIR A;  2CW0 A;  4C3H C;  3S17 C;  2Y0S L;  3GTO K;  4JK1 A;  3HOU C;  4QJV A;  4A3J K;  1BDF A;  2O5J A;  1TWG K;  4OIN A;  3GTG K;  4A3J C;  4XSX A;  4XLP A;  1TWG C;  3S1Q K;  3GTG C;  3S1Q C;  3RZO K;  2JA8 K;  4X6A K;  2JA5 K;  4XLN A;  3RZO C;  5TMC A;  4X6A C;  5IYD K;  2JA5 C;  2O5I A;  5IYD C;  1I50 K;  1TWA K;  4G7Z A;  3GTJ K;  2WAQ L;  1I50 C;  3GTJ C;  1TWA C;  4MEY A;  4AYB L;  4Y7N K;  3H3V D;  1I6V A;  4G7O A;  4Y7N C;  2E2H K;  3S16 K;  5IP9 K;  4LK1 A;  4AYB D;  2E2H C;  3S16 C;  5IP9 C;  5IYB K;  4YFK A;  5TMF A;  3PO2 K;  3M4O K;  4A3L K;  3HKZ D;  4C3I K;  5IYB C;  3PO2 C;  3M3Y K;  2WB1 D;  3M4O C;  2JA6 K;  3GTK K;  4A3L C;  4C3I C;  3M3Y C;  1TWC K;  5C44 K;  3GTK C;  4Y52 K;  1TWC C;  3GTM K;  5C44 C;  5C3E K;  1I6H K;  4Y52 C;  4C2M K;  4YG2 A;  4A3I K;  4A3M K;  3GTM C;  5M5X K;  5C3E C;  1I6H C;  1TWF K;  4BBR K;  1R9T K;  4KMU A;  4C2M C;  4A3I C;  4A3M C;  2PPB A;  3GTO C;  1TWF C;  4BBR C;  2R92 K;  1R9T C;  5FLM K;  4A3E K;  2E2J K;  4KN4 A;  2R92 C;  4BY7 K;  5M5W K;  2E2J C;  5FLM C;  4A3E C;  3S1M C;  4BY7 C;  2JA8 C;  4YFX A;  4GZY A;  3H3V L;  4A3C K;  4A3G K;  1K83 K;  4A3C C;  4A3G C;  1TWH K;  2R93 K;  1K83 C;  4NOI A;  3S2D K;  1TWH C;  1ZYR A;  3CQZ K;  5C4J K;  4ZH4 A;  2R93 C;  3S15 K;  3S2D C;  3CQZ C;  5C4J C;  4OIQ A;  3S15 C;  3H0G K;  2WB1 L;  2BE5 A;  3HKZ L;  4QJV B;  5IYC K;  2NVX K;  5IYC C;  4Q4Z A;  3H0G C;  3EQL A;  4G7H A;  2NVX C;  4BXX C;  5FJ8 K;  4BXX K;  3I4M K;  1IW7 A;  3I4M C;  4XSZ A;  2PMZ D;  3GTP K;  2R7Z K;  3GTP C;  2R7Z C;  4A3F K;  3S14 K;  4OIO A;  2E2I K;  3GTL K;  4MEX A;  4A3F C;  3S14 C;  1WCM K;  2E2I C;  3GTL C;  1Y1W K;  3K7A K;  1WCM C;  3PO3 K;  4KN7 A;  1Y1W C;  3S2H K;  3K7A C;  4MQ9 A;  3PO3 C;  3GTQ K;  3S2H C;  3GTQ C;  3HOW K;  3S1M K;  3RZD K;  4QIW D;  4C3J K;  1SMY A;  2NVQ K;  3HOW C;  3RZD C;  4C3J C;  1SFO K;  1YNN A; 
#chains in the Genus database with same CATH topology
 2D6F C;  1SFO C;  1O2B A;  2PMZ L;  1YNJ A;  3I4N K;  3S1N K;  2ZFZ A;  2VUM A;  2V6U A;  2YU9 K;  2E2I A;  2NVY A;  1Y1V K;  3HOY K;  1VJE A;  3S1R C;  1EI6 A;  4LQY A;  2A69 A;  2JA7 K;  1WOS A;  3Q3Q A;  4Q5S A;  3HOV K;  1FEU A;  4BY1 C;  1EK8 A;  1I3Q K;  1F7V A;  5D4D A;  3S17 K;  2PA8 L;  1O24 A;  4OIR A;  1EFW A;  4J3N A;  4RMF A;  3HOU C;  2JA5 A;  2O5J A;  1XZQ A;  4PAA A;  3GEH A;  3GTG C;  2V6S A;  4GTE A;  1XZP B;  1I50 K;  5IYD C;  2WAQ L;  2ZJP S;  3GTJ C;  1TWA C;  4P9S A;  1PJ7 A;  4Y7N C;  3OPF A;  1DCO A;  3MML B;  4P5B A;  3PO2 K;  4YFK A;  4G0V A;  4C3I K;  1R9T A;  1TWC K;  4O2D A;  1O29 A;  3BP8 C;  3GTM K;  1VGX A;  4GTB A;  4YG2 A;  3GTJ A;  4GTF A;  1I6H C;  4C2M C;  4A3I C;  4A3M C;  3GTO C;  1O2F B;  3L4J A;  4BBR C;  1J6V A;  2R92 K;  3CQZ A;  4KN4 A;  4BY7 K;  1PJ5 A;  2E2J C;  2NVX A;  3SZY A;  4A3G K;  2CFA A;  1TWH K;  1C0A A;  4NOI A;  5C4J K;  2ZJR S;  2R93 C;  3TTG A;  2KPU A;  4OIQ A;  3HKZ L;  5IYC K;  5HL7 S;  1L0W A;  2BE5 A;  4BXX K;  5DM7 S;  1XZQ B;  4Q4Z A;  3AD8 C;  3VA7 A;  5FJ8 K;  1O25 A;  3N0C A;  3AD7 C;  2JH3 A;  1WSV A;  5HL8 A;  5DM6 S;  3AQO A;  3GTP K;  3T02 A;  3TFJ A;  3QX3 A;  2R7Z C;  1F7U A;  4A3F K;  4OIO A;  2E2I K;  4IO9 S;  3AQP A;  4KMH A;  1WCM C;  1ZVU A;  4KN7 A;  4FZB A;  3S2H K;  3LPX A;  4QIW D;  2PHC B;  1F93 A;  3GSI A;  1SFO K;  2NVQ C;  2JA6 C;  1B4B A;  1YX2 A;  5M3M K;  4KMD A;  2Y0S D;  3ADA C;  3DXJ A;  1JQW A;  3S0X A;  3PIP S;  3FKI C;  1WCM A;  3S1R K;  5M3F K;  3IPJ A;  3WOD A;  2A68 A;  4WFA S;  3AD9 C;  4A93 C;  2VUM C;  2A6E A;  1GE9 A;  2NVY C;  2JA6 A;  4BY1 K;  4A3B C;  3HOX C;  1TWG A;  5C4X C;  1XZP A;  1J6W A;  3HOU K;  1B4A A;  4C3H C;  4QJV A;  3ERE D;  1BDF A;  2GSN A;  3TFH A;  3GTG K;  4XSX A;  2V6T A;  4C45 A;  5TMC A;  2E2H A;  4X6A C;  5IYD K;  2JA5 C;  3CAG A;  3GTJ K;  1TWA K;  4G7Z A;  2XCQ A;  3SZZ A;  4MEY A;  4Y7N K;  1O27 A;  3G4C A;  5IP9 C;  5TMF A;  1TWF A;  1WQF A;  3T01 A;  5IYB C;  2WB1 D;  4GT9 A;  1J6X A;  3JST A;  3A8J A;  3GTK C;  5C44 C;  1I6H K;  4C2M K;  4A3I K;  4A3M K;  3GTO K;  5C3E C;  4BBR K;  3NUH A;  2PPB A;  1R9T C;  2E2J K;  4A3E C;  3FHZ A;  4YFX A;  3H3V L;  5CHP A;  1ZXO A;  2R93 K;  1K83 C;  5HQH A;  3GEE A;  3GTK A;  4GFQ A;  4XCH A;  2KXY A;  3S2D C;  3CQZ C;  1WIH A;  4QJV B;  1WQH A;  1BJT A;  2NVX C;  3A8I A;  4FM9 A;  1AB4 A;  3I4M C;  4LOW A;  2PMZ D;  1Y1W A;  2R7Z K;  1EH1 A;  1K83 A;  1VH2 A;  5EGE A;  4MEX A;  3S14 C;  5JVG S;  1WCM K;  3GTL C;  2L3U A;  3K7A C;  2FQT A;  3PO3 C;  1DCP A;  3GTQ C;  2NVQ K;  3RZD C;  2JA6 K;  2RGR A;  3FOE A;  1Y1V A;  1VRQ C;  4KAS A;  3LAJ A;  4YFN A;  2PA8 D;  4A3D C;  2KQ1 A;  1HI9 A;  3FKI K;  3V4G A;  3GTL A;  2B63 C;  1IE0 A;  1USO A;  2JA7 A;  5E68 A;  3HOZ C;  3GTQ A;  2NVT C;  4BBS C;  4A93 K;  4A3K C;  1I3Q A;  2VUM K;  2NVY K;  4KAT A;  4LLG A;  1XPP A;  5M5Y K;  1HQM A;  4A3B K;  3N3Y A;  3HOX K;  4KM9 A;  4LJZ A;  5C4X K;  2WAQ D;  5IP7 C;  4WCE S;  5IOQ A;  5JFE A;  2B63 A;  4C3H K;  4GTA A;  1JOE A;  2RH6 A;  2XCO A;  4WF9 S;  4KAW X;  4GTD A;  4OIN A;  4A3J C;  1I50 A;  4XLP A;  1TWG C;  1DD5 A;  3GEI A;  5EGH A;  3S1Q C;  3TFI A;  4X6A K;  2JA5 K;  3RZO C;  3G4A A;  2GAH C;  1IL2 A;  1WOP A;  3A8K A;  1TWC A;  3CF5 S;  5IP9 K;  4AYB D;  2E2H C;  3S16 C;  5IYB K;  3HKZ D;  3M4O C;  3GDZ A;  2GAG C;  4KB2 A;  4A3L C;  3GTK K;  3M3Y C;  2GSO A;  4WJ3 M;  5C44 K;  5C3E K;  4Y52 C;  2L5N A;  1R9T K;  1TWH A;  3LAP A;  1TWF C;  4A3E K;  5M5W K;  5FLM C;  4GZY A;  1XXB A;  4G0W A;  1K83 K;  4M1X A;  4A3C C;  4AH6 A;  3S2D K;  3CQZ K;  3BUE A;  2KWA A;  4WIL A;  3S15 C;  1WOR A;  2NVX K;  2FQO A;  3H0G C;  3EQL A;  4G7H A;  1F9N A;  4LR2 A;  3I4M K;  4KDD A;  5IOS A;  2ZJQ S;  4KM8 A;  4WFB S;  3S14 K;  1YCL A;  3GTL K;  2W7V A;  3H0G A;  4KC6 A;  3L4K A;  3K7A K;  1SFO A;  1O2A A;  1ZQ1 C;  3PO3 K;  1Y1W C;  4MQ9 A;  3GTQ K;  1USM A;  4BLA A;  2GSU A;  1BS2 A;  1IBA A;  3RZD K;  3S1M C;  3HOW C;  4C3J C;  1YNN A;  4G0U A;  1WSR A;  4A3D K;  3FOF A;  1IS1 A;  5IOT A;  2B63 K;  3I4N C;  1O28 A;  3S1N C;  2YU9 C;  2A6H A;  3HOZ K;  2NVT K;  4BBS K;  1Y1V C;  3HOY C;  3HXA A;  4A3K K;  5IOR A;  4OIP A;  5IP7 K;  4QIW L;  2JA7 C;  3HOV C;  3GTG A;  3LYW A;  4LK0 A;  1I3Q C;  2YU9 A;  5TJ3 A;  5JVH S;  2CW0 A;  3S17 C;  1IQ0 A;  2Y0S L;  4JK1 A;  1XXA A;  4WFN S;  4A3J K;  1VLO A;  1TWG K;  2ZUF A;  1WQG A;  1ISE A;  1TWA A;  3S1Q K;  1EQR A;  4WJ4 A;  1JVI A;  3RZO K;  4IOC S;  2JA8 K;  5L46 A;  4XLN A;  2Y3P A;  1V5V A;  4P5A A;  2O5I A;  3N0B A;  1I50 C;  5CJ9 A;  1O26 A;  4AYB L;  3H3V D;  1I6V A;  4G7O A;  2E2H K;  3S16 K;  4LK1 A;  1KQ4 A;  4KMA A;  3GTO A;  3M4O K;  4ILD A;  4A3L K;  3M3Y K;  3PO2 C;  4C3I C;  1WOO A;  4DDQ A;  2EBB A;  4Y52 K;  1TWC C;  4BLB A;  1UV7 A;  3GTM C;  5M5X K;  1TWF K;  1PJ6 A;  4KMU A;  2ZUE A;  3PIO S;  2R93 A;  5FLM K;  2R92 C;  3GIR A;  1INN A;  2XCR B;  4BY7 C;  2JA8 C;  4A3C K;  2P8T A;  4A3G C;  1TWH C;  1ZYR A;  3S15 K;  4ZH4 A;  3OEP A;  1XXC A;  1G51 A;  5C4J C;  3H0G K;  2WB1 L;  4IOA S;  3GTM A;  5IYC C;  2R7Z A;  4BXX C;  2P5M A;  2R92 A;  1ZBS A;  1RU0 A;  1X31 C;  1IW7 A;  4XSZ A;  3DLL S;  5JVO A;  3GTP C;  2CFA B;  1BGW A;  3ORE A;  4A3F C;  2E2I C;  1Y1W K;  3AH5 A;  3BP3 A;  4GTL A;  4KAR A;  4KB4 A;  3T00 A;  1J98 A;  3S2H C;  4BKW A;  3HOW K;  4PAB A;  3S1M K;  4C3J K;  1DCH A;  1SMY A;  3FKI A;  4GTC A;  4U67 S;  3GTP A; 
#chains in the Genus database with same CATH homology
 2NVQ C;  4A3D K;  2JA6 C;  1SFO C;  5M3M K;  2PMZ L;  1YNJ A;  3I4N K;  4YFN A;  2PA8 D;  4A3D C;  3S1N K;  2B63 K;  3I4N C;  2Y0S D;  3S1N C;  3FKI K;  2YU9 K;  3DXJ A;  2B63 C;  3FKI C;  3S1R K;  2YU9 C;  1Y1V K;  3HOY K;  2A6H A;  5M3F K;  3HOZ K;  3S1R C;  2NVT K;  4BBS K;  1Y1V C;  3HOY C;  4A3K K;  2A69 A;  3HOZ C;  3WOD A;  2A68 A;  2NVT C;  4BBS C;  4A93 K;  4A3K C;  2VUM K;  2NVY K;  4OIP A;  4LLG A;  4A93 C;  1XPP A;  5M5Y K;  2VUM C;  1HQM A;  2A6E A;  2NVY C;  2JA7 K;  3HOX K;  4A3B K;  4Q5S A;  4LJZ A;  4QIW L;  5IP7 K;  4BY1 K;  2JA7 C;  4A3B C;  3HOX C;  2WAQ D;  5C4X K;  3HOV K;  5IP7 C;  3HOV C;  4BY1 C;  5C4X C;  1I3Q K;  4LK0 A;  5D4D A;  3S17 K;  1I3Q C;  4C3H K;  2PA8 L;  3HOU K;  4OIR A;  2CW0 A;  4C3H C;  3S17 C;  2Y0S L;  3GTO K;  4JK1 A;  3HOU C;  4QJV A;  4A3J K;  1BDF A;  2O5J A;  1TWG K;  4OIN A;  3GTG K;  4A3J C;  4XSX A;  4XLP A;  1TWG C;  3S1Q K;  3GTG C;  3S1Q C;  3RZO K;  2JA8 K;  4X6A K;  2JA5 K;  4XLN A;  3RZO C;  5TMC A;  4X6A C;  5IYD K;  2JA5 C;  2O5I A;  5IYD C;  1I50 K;  1TWA K;  4G7Z A;  3GTJ K;  2WAQ L;  1I50 C;  3GTJ C;  1TWA C;  4MEY A;  4AYB L;  4Y7N K;  3H3V D;  1I6V A;  4G7O A;  4Y7N C;  2E2H K;  3S16 K;  5IP9 K;  4LK1 A;  4AYB D;  2E2H C;  3S16 C;  5IP9 C;  5IYB K;  4YFK A;  5TMF A;  3PO2 K;  3M4O K;  4A3L K;  3HKZ D;  4C3I K;  5IYB C;  3PO2 C;  3M3Y K;  2WB1 D;  3M4O C;  2JA6 K;  3GTK K;  4A3L C;  4C3I C;  3M3Y C;  1TWC K;  5C44 K;  3GTK C;  4Y52 K;  1TWC C;  3GTM K;  5C44 C;  5C3E K;  1I6H K;  4Y52 C;  4C2M K;  4YG2 A;  4A3I K;  4A3M K;  3GTM C;  5M5X K;  5C3E C;  1I6H C;  1TWF K;  4BBR K;  1R9T K;  4KMU A;  4C2M C;  4A3I C;  4A3M C;  2PPB A;  3GTO C;  1TWF C;  4BBR C;  2R92 K;  1R9T C;  5FLM K;  4A3E K;  2E2J K;  4KN4 A;  2R92 C;  4BY7 K;  5M5W K;  2E2J C;  5FLM C;  4A3E C;  3S1M C;  4BY7 C;  2JA8 C;  4YFX A;  4GZY A;  3H3V L;  4A3C K;  4A3G K;  1K83 K;  4A3C C;  4A3G C;  1TWH K;  2R93 K;  1K83 C;  4NOI A;  3S2D K;  1TWH C;  1ZYR A;  3CQZ K;  5C4J K;  4ZH4 A;  2R93 C;  3S15 K;  3S2D C;  3CQZ C;  5C4J C;  4OIQ A;  3S15 C;  3H0G K;  2WB1 L;  2BE5 A;  3HKZ L;  4QJV B;  5IYC K;  2NVX K;  5IYC C;  4Q4Z A;  3H0G C;  3EQL A;  4G7H A;  2NVX C;  4BXX C;  5FJ8 K;  4BXX K;  3I4M K;  1IW7 A;  3I4M C;  4XSZ A;  2PMZ D;  3GTP K;  2R7Z K;  3GTP C;  2R7Z C;  4A3F K;  3S14 K;  4OIO A;  2E2I K;  3GTL K;  4MEX A;  4A3F C;  3S14 C;  1WCM K;  2E2I C;  3GTL C;  1Y1W K;  3K7A K;  1WCM C;  3PO3 K;  4KN7 A;  1Y1W C;  3S2H K;  3K7A C;  4MQ9 A;  3PO3 C;  3GTQ K;  3S2H C;  3GTQ C;  3HOW K;  3S1M K;  3RZD K;  4QIW D;  4C3J K;  1SMY A;  2NVQ K;  3HOW C;  3RZD C;  4C3J C;  1SFO K;  1YNN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...