2PPBA

Crystal structure of the t. thermophilus rnap polymerase elongation complex with the ntp substrate analog and antibiotic streptolydigin
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
229
structure length
229
Chain Sequence
MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (5'-D(P*CP*CP*CP*TP*GP*TP*CP*TP*GP*GP*CP*GP*TP*TP*CP*GP*
publication title Structural basis for substrate loading in bacterial RNA polymerase.
pubmed doi rcsb
molecule tags Transferase/dna/rna
total genus 40
structure length 229
sequence length 229
chains with identical sequence B, K, L
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2007-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01000 RNA_pol_A_bac RNA polymerase Rpb3/RpoA insert domain
A PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain
A PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.12 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 DNA-directed RNA polymerase, insert domain 2ppbA02
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 2ppbA01
3H3VD 4A3JK 1TWCK 4XSZA 3WODA 1XPPA 3S1QC 2JA7C 1BDFA 4A3LC 2YU9K 4QJVA 2JA7K 2R92K 2B63C 1I6HC 1IW7A 3HKZD 1I6HK 5C4JC 5TMFA 2E2HC 1TWAK 5C4JK 4A3KC 4AYBD 3RZDK 1Y1VC 2JA8C 2E2HK 4A3KK 4A3GC 3HOWC 1Y1VK 2A68A 2O5JA 2WAQL 2JA8K 4A3EC 3S1MC 3HOWK 2E2JC 3HOXC 3GTQC 4C3HK 4C3IC 1TWGC 3S1MK 4OIOA 2PA8D 4BBRC 3GTQK 4C3IK 3HOYC 4A3JC 1TWGK 2WB1L 4A93C 4BBRK 4OIQA 3PO2C 2Y0SL 5IP9C 4A3IK 3HOYK 3K7AC 4GZYA 2NVYC 3PO2K 4A93K 5IP9K 4YFNA 3EQLA 5IYBC 3K7AK 5FLMC 2A6EA 4XSXA 2YU9C 2NVYK 4YFXA 2PMZL 2R92C 3HOVC 5IYBK 5FLMK 5C44C 5IYDK 3HOVK 4MEYA 3PO3C 3GTLK 5C44K 3S1RK 4A3FC 3PO3K 1TWAC 3RZDC 3DXJA 4KMUA 4A3FK 4XLNA 1I6VA 3FKIC 2NVQC 3H0GK 4BBSC 1TWFC 1TWHC 2NVQK 3FKIK 4A3CC 2NVXK 4BBSK 1R9TC 4OIRA 1TWFK 5C4XK 4C3HC 1TWHK 1SMYA 4A3CK 2A69A 3GTPK 2O5IA 1R9TK 4MEXA 4BY1C 3S2DK 1I3QC 4NOIA 1K83K 5IYCC 5M5XK 4BY1K 4A3IC 4G7OA 4A3DC 2WAQD 1I3QK 3HKZL 2E2IK 4G7ZA 5IYCK 4A3DK 4OINA 4OIPA 4AYBL 2JA6C 4G7HA 1WCMK 3I4NK 5IYDC 2Y0SD 2JA6K 3S14K 2NVTC 3S2HC 3S1RC 4YFKA 3M4OC 4QIWL 3S2HK 2VUMK 2PMZD 4KN7A 3GTJC 2PA8L 2A6HA 3S1NC 3M4OK 3S16C 3H0GC 5M3MK 3GTJK 3GTGK 5D4DA 3S1NK 3CQZK 3GTKK 1ZYRA 3H3VL 4MQ9A 2NVXC 3S16K 4JK1A 5C4XC 5M5YK 4Q5SA 3S2DC 3GTPC 2R93C 3RZOK 5C3EK 3S15K 4X6AC 4Y52K 1K83C 3HOUK 2R93K 3I4MC 3HOZC 2E2IC 5M3FK 4X6AK 4C2MK 2BE5A 5IP7C 4A3MK 2NVTK 4C3JC 3HOZK 4A3BC 3I4MK 1YNNA 4LK0A 4Q4ZA 5IP7K 2CW0A 4ZH4A 4C3JK 4A3BK 4BY7C 4LJZA 4LLGA 3S1QK 1YNJA 1WCMC 4Y7NC 3I4NC 4A3LK 4BY7K 2WB1D 3S14C 4Y7NK 2B63K 4LK1A 4YG2A 2VUMC 3GTMC 1Y1WC 3M3YC 1SFOC 3GTMK 4KN4A 4XLPA 2JA5C 3GTGC 3S17C 5M5WK 3CQZC 5TMCA 3GTKC 1Y1WK 2R7ZC 1SFOK 2JA5K 2PPBA 1I50C 3GTLC 3M3YK 3S17K 4A3GK 2R7ZK 1HQMA 4QIWD 3RZOC 3S15C 5C3EC 3GTOC 4BXXC 1I50K 5FJ8K 4A3EK 4Y52C 3HOXK 2E2JK 4BXXK 3HOUC 3GTOK 4C2MC 4QJVB 1TWCC 4A3MC
chains in the Genus database with same CATH superfamily
1IE0A 4KARA 1USMA 3LAJA 2ZJPS 4BLBA 1IQ0A 2B63C 1I6HC 1O28A 3G4AA 3TFJA 1I6HK 2R92A 1GE9A 2E2HC 1BS2A 2D6FC 1Y1VC 2E2HK 1Y1VK 5DM6S 5E68A 2WAQL 4KMDA 4AH6A 3S1MC 2E2JC 3GTQC 3S1MK 4OIOA 3GTQK 4PABA 5DM7S 3PIPS 3K7AC 3EQLA 5IYBC 3K7AK 2A6EA 2YU9C 3HOVC 5IYBK 3A8IA 3HOVK 1AB4A 2NVYA 3AD7C 3S1RK 1TWAC 1J6VA 2CFAB 4KMUA 4IOCS 4LOWA 4U67S 4PAAA 4BBSC 1TWHC 4BBSK 1TWHK 2O5IA 2CFAA 4BY1C 1VGXA 1UV7A 1I3QC 3FKIA 4FZBA 5M5XK 4BY1K 1TWFA 4WFNS 1I3QK 1R9TA 3T00A 1WQFA 4GTAA 4P5AA 2Y0SD 4WCES 3AD8C 1WCMA 2PMZD 4KN7A 3GTJC 2A6HA 3S1NC 3H0GC 5M3MK 4P5BA 3GTJK 5D4DA 3GTGK 3S1NK 3GTKK 2VUMA 4JK1A 5M5YK 4Q5SA 3S2DC 1YX2A 2R93C 5C3EK 3CQZA 1K83C 3HOUK 2R93K 3I4MC 3OEPA 2BE5A 3I4MK 2RH6A 1ZVUA 4Q4ZA 5HQHA 4BY7C 2ZFZA 3SZYA 1ZXOA 4XCHA 4BY7K 2WB1D 3S14C 1JOEA 5EGHA 3GTMC 1WSVA 3T01A 4WFAS 1BGWA 3GTMK 1WSRA 5TMCA 2R7ZC 4A3GK 1XXCA 2R7ZK 4QIWD 3S15C 1VRQC 5FJ8K 5IORA 2ZJRS 3HOXK 1IBAA 1JQWA 3H3VD 4XSZA 1G51A 1O27A 1EK8A 5JVHS 1XPPA 3IPJA 4WILA 1WOOA 1TWCA 2R92K 2P5MA 1BJTA 1IS1A 1XZQB 4AYBD 3RZDK 2JA8C 3SZZA 4GTLA 2A68A 5JVGS 4BLAA 2JA8K 4A3EC 1PJ5A 4A93C 5L46A 4A3IK 4A93K 2NVYC 4YFNA 2NVYK 4XSXA 4GFQA 4GTEA 5C44C 5IYDK 3PO3C 5C44K 1F9NA 4KMHA 3PO3K 2ZUFA 2XCOA 1WOPA 4LQYA 4XLNA 1I6VA 3FKIC 2NVQC 1TWFC 3BP8C 2NVQK 1DD5A 4A3CC 3FKIK 4RMFA 1R9TC 1TWFK 5C4XK 1XXAA 4A3CK 4M1XA 4DDQA 1R9TK 4MEXA 2NVXA 2GSUA 4G7OA 2WAQD 3GTPA 2JH3A 4OINA 2KXYA 4OIPA 3LYWA 2E2IA 4G7HA 1WCMK 3I4NK 3S1RC 1PJ7A 2KWAA 4KASA 4GT9A 3ERED 2VUMK 2JA6A 1HI9A 3CQZK 1WQGA 1VH2A 4Y52K 1XXBA 5EGEA 4C2MK 4A3MK 4C3JC 4A3BC 3A8JA 1J6WA 5HL8A 2CW0A 4ZH4A 4C3JK 4A3BK 3FHZA 4LLGA 3S1QK 2FQOA 4A3LK 4Y7NC 1O25A 1KQ4A 4Y7NK 4YG2A 3VA7A 3M3YC 4KN4A 4XLPA 2B63A 3GTGC 3NUHA 3GTKC 2GSNA 3M3YK 3GDZA 4BXXC 2EBBA 5C3EC 1Y1WA 1SFOA 1X31C 3HOUC 4BXXK 1B4BA 1XZPB 4QJVB 1EI6A 1TWCC 4A3JK 1TWCK 1BDFA 4WFBS 4GTCA 4QJVA 1PJ6A 1FEUA 3OPFA 1IW7A 3HKZD 2GAGC 2GAHC 3GEHA 3L4JA 2YU9A 3A8KA 2JA7A 4GTFA 3N0CA 1F93A 3BP3A 3TTGA 4A3GC 2L5NA 3HOWC 1TWAA 4KC6A 3HOWK 3HOXC 5JFEA 4C3HK 2R7ZA 1O24A 4ILDA 2PA8D 3S0XA 2L3UA 3HOYC 2WB1L 4OIQA 3PO2C 5IP9C 1B4AA 4G0UA 3HOYK 1VLOA 3PO2K 5IP9K 1TWGA 5FLMC 4J3NA 1IL2A 4YFXA 2R92C 5FLMK 4KM8A 4MEYA 1O2BA 3FOFA 3DLLS 4KATA 3G4CA 4A3FC 2PHCB 3RZDC 1ZBSA 5IOSA 4A3FK 2NVXK 4GTDA 4OIRA 1V5VA 2A69A 3GTPK 3H0GA 1XZQA 5IYCC 5IOQA 3GEIA 4A3IC 2E2IK 4A3DC 4G7ZA 5IYCK 4A3DK 1VJEA 1WQHA 1WORA 1K83A 4AYBL 2JA6C 1USOA 5IYDC 1F7UA 2KQ1A 2JA6K 3S2HC 3S2HK 1DCOA 3S16C 1J6XA 3LPXA 3S16K 4MQ9A 5C4XC 1O26A 3N3YA 3RZOK 5JVOA 4G0WA 1EFWA 2NVTK 1DCPA 1YNNA 1L0WA 1WIHA 4LJZA 2FQTA 1YNJA 1WCMC 3I4NC 5IOTA 1F7VA 2B63K 4BKWA 5CJ9A 1INNA 4KAWX 1DCHA 4LK1A 2VUMC 4LR2A 1Y1WC 1SFOC 3GEEA 3S17C 1Y1WK 3CQZC 1SFOK 3S17K 4Y52C 2E2JK 2JA5A 4C2MC 4A3MC 1I50A 3GTLA 4FM9A 2ZJQS 3WODA 3GTOA 3S1QC 2JA7C 4A3LC 2YU9K 1JVIA 2V6UA 3LAPA 1EH1A 2JA7K 1J98A 5TJ3A 5C4JC 5CHPA 5TMFA 1ISEA 1TWAK 5C4JK 4A3KC 1WOSA 5HL7S 4A3KK 2O5JA 2RGRA 3Q3QA 2E2HA 4C3IC 1TWGC 4BBRC 1Y1VA 4IO9S 4C3IK 4A3JC 1TWGK 4WJ3M 3BUEA 4BBRK 1EQRA 2Y0SL 4O2DA 4GZYA 2W7VA 3GTQA 3AQOA 2PMZL 3L4KA 3V4GA 1XZPA 4KB2A 2XCQA 4G0VA 3GSIA 4WF9S 3N0BA 3DXJA 3H0GK 3TFIA 4P9SA 1RU0A 1O2AA 3AQPA 4C3HC 1ZQ1C 1SMYA 3S2DK 4NOIA 1K83K 4WJ4A 3PIOS 1TWHA 3HKZL 3FOEA 1I3QA 4IOAS 2P8TA 1YCLA 3OREA 3S14K 2GSOA 3ADAC 1O29A 4YFKA 3M4OC 3CAGA 4QIWL 4KMAA 3M4OK 2PA8L 4KDDA 1ZYRA 3H3VL 2NVXC 3TFHA 3GTPC 3S15K 2KPUA 3GTJA 3CF5S 2ZUEA 3GTGA 4X6AC 3GTKA 3T02A 3HOZC 4KB4A 2E2IC 5M3FK 4X6AK 1O2FB 5IP7C 2Y3PA 3HOZK 4LK0A 4KM9A 5IP7K 2R93A 4GTBA 3JSTA 3AD9C 3QX3A 4C45A 3GIRA 2JA5C 5M5WK 3AH5A 2JA5K 2PPBA 1I50C 3GTLC 3MMLB 1C0AA 1HQMA 1I50K 3RZOC 3GTLK 3GTOC 2V6TA 4A3EK 3GTMA 2V6SA 3GTOK 3HXAA 2XCRB 2NVTC
chains in the Genus database with same CATH topology
3H3VD 4A3JK 1TWCK 4XSZA 3WODA 1XPPA 3S1QC 2JA7C 1BDFA 4A3LC 2YU9K 4QJVA 2JA7K 2R92K 2B63C 1I6HC 1IW7A 3HKZD 1I6HK 5C4JC 5TMFA 2E2HC 1TWAK 5C4JK 4A3KC 4AYBD 3RZDK 1Y1VC 2JA8C 2E2HK 4A3KK 4A3GC 3HOWC 1Y1VK 2A68A 2O5JA 2WAQL 2JA8K 4A3EC 3S1MC 3HOWK 2E2JC 3HOXC 3GTQC 4C3HK 4C3IC 1TWGC 3S1MK 4OIOA 2PA8D 4BBRC 3GTQK 4C3IK 3HOYC 4A3JC 1TWGK 2WB1L 4A93C 4BBRK 4OIQA 3PO2C 2Y0SL 5IP9C 4A3IK 3HOYK 3K7AC 4GZYA 2NVYC 3PO2K 4A93K 5IP9K 4YFNA 3EQLA 5IYBC 3K7AK 5FLMC 2A6EA 4XSXA 2YU9C 2NVYK 4YFXA 2PMZL 2R92C 3HOVC 5IYBK 5FLMK 5C44C 5IYDK 3HOVK 4MEYA 3PO3C 3GTLK 5C44K 3S1RK 4A3FC 3PO3K 1TWAC 3RZDC 3DXJA 4KMUA 4A3FK 4XLNA 1I6VA 3FKIC 2NVQC 3H0GK 4BBSC 1TWFC 1TWHC 2NVQK 3FKIK 4A3CC 2NVXK 4BBSK 1R9TC 4OIRA 1TWFK 5C4XK 4C3HC 1TWHK 1SMYA 4A3CK 2A69A 3GTPK 2O5IA 1R9TK 4MEXA 4BY1C 3S2DK 1I3QC 4NOIA 1K83K 5IYCC 5M5XK 4BY1K 4A3IC 4G7OA 4A3DC 2WAQD 1I3QK 3HKZL 2E2IK 4G7ZA 5IYCK 4A3DK 4OINA 4OIPA 4AYBL 2JA6C 4G7HA 1WCMK 3I4NK 5IYDC 2Y0SD 2JA6K 3S14K 2NVTC 3S2HC 3S1RC 4YFKA 3M4OC 4QIWL 3S2HK 2VUMK 2PMZD 4KN7A 3GTJC 2PA8L 2A6HA 3S1NC 3M4OK 3S16C 3H0GC 5M3MK 3GTJK 3GTGK 5D4DA 3S1NK 3CQZK 3GTKK 1ZYRA 3H3VL 4MQ9A 2NVXC 3S16K 4JK1A 5C4XC 5M5YK 4Q5SA 3S2DC 3GTPC 2R93C 3RZOK 5C3EK 3S15K 4X6AC 4Y52K 1K83C 3HOUK 2R93K 3I4MC 3HOZC 2E2IC 5M3FK 4X6AK 4C2MK 2BE5A 5IP7C 4A3MK 2NVTK 4C3JC 3HOZK 4A3BC 3I4MK 1YNNA 4LK0A 4Q4ZA 5IP7K 2CW0A 4ZH4A 4C3JK 4A3BK 4BY7C 4LJZA 4LLGA 3S1QK 1YNJA 1WCMC 4Y7NC 3I4NC 4A3LK 4BY7K 2WB1D 3S14C 4Y7NK 2B63K 4LK1A 4YG2A 2VUMC 3GTMC 1Y1WC 3M3YC 1SFOC 3GTMK 4KN4A 4XLPA 2JA5C 3GTGC 3S17C 5M5WK 3CQZC 5TMCA 3GTKC 1Y1WK 2R7ZC 1SFOK 2JA5K 2PPBA 1I50C 3GTLC 3M3YK 3S17K 4A3GK 2R7ZK 1HQMA 4QIWD 3RZOC 3S15C 5C3EC 3GTOC 4BXXC 1I50K 5FJ8K 4A3EK 4Y52C 3HOXK 2E2JK 4BXXK 3HOUC 3GTOK 4C2MC 4QJVB 1TWCC 4A3MC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H3V D;  4A3J K;  1TWC K;  4XSZ A;  3WOD A;  1XPP A;  3S1Q C;  2JA7 C;  1BDF A;  4A3L C;  2YU9 K;  4QJV A;  2JA7 K;  2R92 K;  2B63 C;  1I6H C;  1IW7 A;  3HKZ D;  1I6H K;  5C4J C;  5TMF A;  2E2H C;  1TWA K;  5C4J K;  4A3K C;  4AYB D;  3RZD K;  1Y1V C;  2JA8 C;  2E2H K;  4A3K K;  4A3G C;  3HOW C;  1Y1V K;  2A68 A;  2O5J A;  2WAQ L;  2JA8 K;  4A3E C;  3S1M C;  3HOW K;  2E2J C;  3HOX C;  3GTQ C;  4C3H K;  4C3I C;  1TWG C;  3S1M K;  4OIO A;  2PA8 D;  4BBR C;  3GTQ K;  4C3I K;  3HOY C;  4A3J C;  1TWG K;  2WB1 L;  4A93 C;  4BBR K;  4OIQ A;  3PO2 C;  2Y0S L;  5IP9 C;  4A3I K;  3HOY K;  3K7A C;  4GZY A;  2NVY C;  3PO2 K;  4A93 K;  5IP9 K;  4YFN A;  3EQL A;  5IYB C;  3K7A K;  5FLM C;  2A6E A;  4XSX A;  2YU9 C;  2NVY K;  4YFX A;  2PMZ L;  2R92 C;  3HOV C;  5IYB K;  5FLM K;  5C44 C;  5IYD K;  3HOV K;  4MEY A;  3PO3 C;  3GTL K;  5C44 K;  3S1R K;  4A3F C;  3PO3 K;  1TWA C;  3RZD C;  3DXJ A;  4KMU A;  4A3F K;  4XLN A;  1I6V A;  3FKI C;  2NVQ C;  3H0G K;  4BBS C;  1TWF C;  1TWH C;  2NVQ K;  3FKI K;  4A3C C;  2NVX K;  4BBS K;  1R9T C;  4OIR A;  1TWF K;  5C4X K;  4C3H C;  1TWH K;  1SMY A;  4A3C K;  2A69 A;  3GTP K;  2O5I A;  1R9T K;  4MEX A;  4BY1 C;  3S2D K;  1I3Q C;  4NOI A;  1K83 K;  5IYC C;  5M5X K;  4BY1 K;  4A3I C;  4G7O A;  4A3D C;  2WAQ D;  1I3Q K;  3HKZ L;  2E2I K;  4G7Z A;  5IYC K;  4A3D K;  4OIN A;  4OIP A;  4AYB L;  2JA6 C;  4G7H A;  1WCM K;  3I4N K;  5IYD C;  2Y0S D;  2JA6 K;  3S14 K;  2NVT C;  3S2H C;  3S1R C;  4YFK A;  3M4O C;  4QIW L;  3S2H K;  2VUM K;  2PMZ D;  4KN7 A;  3GTJ C;  2PA8 L;  2A6H A;  3S1N C;  3M4O K;  3S16 C;  3H0G C;  5M3M K;  3GTJ K;  3GTG K;  5D4D A;  3S1N K;  3CQZ K;  3GTK K;  1ZYR A;  3H3V L;  4MQ9 A;  2NVX C;  3S16 K;  4JK1 A;  5C4X C;  5M5Y K;  4Q5S A;  3S2D C;  3GTP C;  2R93 C;  3RZO K;  5C3E K;  3S15 K;  4X6A C;  4Y52 K;  1K83 C;  3HOU K;  2R93 K;  3I4M C;  3HOZ C;  2E2I C;  5M3F K;  4X6A K;  4C2M K;  2BE5 A;  5IP7 C;  4A3M K;  2NVT K;  4C3J C;  3HOZ K;  4A3B C;  3I4M K;  1YNN A;  4LK0 A;  4Q4Z A;  5IP7 K;  2CW0 A;  4ZH4 A;  4C3J K;  4A3B K;  4BY7 C;  4LJZ A;  4LLG A;  3S1Q K;  1YNJ A;  1WCM C;  4Y7N C;  3I4N C;  4A3L K;  4BY7 K;  2WB1 D;  3S14 C;  4Y7N K;  2B63 K;  4LK1 A;  4YG2 A;  2VUM C;  3GTM C;  1Y1W C;  3M3Y C;  1SFO C;  3GTM K;  4KN4 A;  4XLP A;  2JA5 C;  3GTG C;  3S17 C;  5M5W K;  3CQZ C;  5TMC A;  3GTK C;  1Y1W K;  2R7Z C;  1SFO K;  2JA5 K;  2PPB A;  1I50 C;  3GTL C;  3M3Y K;  3S17 K;  4A3G K;  2R7Z K;  1HQM A;  4QIW D;  3RZO C;  3S15 C;  5C3E C;  3GTO C;  4BXX C;  1I50 K;  5FJ8 K;  4A3E K;  4Y52 C;  3HOX K;  2E2J K;  4BXX K;  3HOU C;  3GTO K;  4C2M C;  4QJV B;  1TWC C;  4A3M C; 
#chains in the Genus database with same CATH topology
 1IE0 A;  4KAR A;  1USM A;  3LAJ A;  2ZJP S;  4BLB A;  1IQ0 A;  2B63 C;  1I6H C;  1O28 A;  3G4A A;  3TFJ A;  1I6H K;  2R92 A;  1GE9 A;  2E2H C;  1BS2 A;  2D6F C;  1Y1V C;  2E2H K;  1Y1V K;  5DM6 S;  5E68 A;  2WAQ L;  4KMD A;  4AH6 A;  3S1M C;  2E2J C;  3GTQ C;  3S1M K;  4OIO A;  3GTQ K;  4PAB A;  5DM7 S;  3PIP S;  3K7A C;  3EQL A;  5IYB C;  3K7A K;  2A6E A;  2YU9 C;  3HOV C;  5IYB K;  3A8I A;  3HOV K;  1AB4 A;  2NVY A;  3AD7 C;  3S1R K;  1TWA C;  1J6V A;  2CFA B;  4KMU A;  4IOC S;  4LOW A;  4U67 S;  4PAA A;  4BBS C;  1TWH C;  4BBS K;  1TWH K;  2O5I A;  2CFA A;  4BY1 C;  1VGX A;  1UV7 A;  1I3Q C;  3FKI A;  4FZB A;  5M5X K;  4BY1 K;  1TWF A;  4WFN S;  1I3Q K;  1R9T A;  3T00 A;  1WQF A;  4GTA A;  4P5A A;  2Y0S D;  4WCE S;  3AD8 C;  1WCM A;  2PMZ D;  4KN7 A;  3GTJ C;  2A6H A;  3S1N C;  3H0G C;  5M3M K;  4P5B A;  3GTJ K;  5D4D A;  3GTG K;  3S1N K;  3GTK K;  2VUM A;  4JK1 A;  5M5Y K;  4Q5S A;  3S2D C;  1YX2 A;  2R93 C;  5C3E K;  3CQZ A;  1K83 C;  3HOU K;  2R93 K;  3I4M C;  3OEP A;  2BE5 A;  3I4M K;  2RH6 A;  1ZVU A;  4Q4Z A;  5HQH A;  4BY7 C;  2ZFZ A;  3SZY A;  1ZXO A;  4XCH A;  4BY7 K;  2WB1 D;  3S14 C;  1JOE A;  5EGH A;  3GTM C;  1WSV A;  3T01 A;  4WFA S;  1BGW A;  3GTM K;  1WSR A;  5TMC A;  2R7Z C;  4A3G K;  1XXC A;  2R7Z K;  4QIW D;  3S15 C;  1VRQ C;  5FJ8 K;  5IOR A;  2ZJR S;  3HOX K;  1IBA A;  1JQW A;  3H3V D;  4XSZ A;  1G51 A;  1O27 A;  1EK8 A;  5JVH S;  1XPP A;  3IPJ A;  4WIL A;  1WOO A;  1TWC A;  2R92 K;  2P5M A;  1BJT A;  1IS1 A;  1XZQ B;  4AYB D;  3RZD K;  2JA8 C;  3SZZ A;  4GTL A;  2A68 A;  5JVG S;  4BLA A;  2JA8 K;  4A3E C;  1PJ5 A;  4A93 C;  5L46 A;  4A3I K;  4A93 K;  2NVY C;  4YFN A;  2NVY K;  4XSX A;  4GFQ A;  4GTE A;  5C44 C;  5IYD K;  3PO3 C;  5C44 K;  1F9N A;  4KMH A;  3PO3 K;  2ZUF A;  2XCO A;  1WOP A;  4LQY A;  4XLN A;  1I6V A;  3FKI C;  2NVQ C;  1TWF C;  3BP8 C;  2NVQ K;  1DD5 A;  4A3C C;  3FKI K;  4RMF A;  1R9T C;  1TWF K;  5C4X K;  1XXA A;  4A3C K;  4M1X A;  4DDQ A;  1R9T K;  4MEX A;  2NVX A;  2GSU A;  4G7O A;  2WAQ D;  3GTP A;  2JH3 A;  4OIN A;  2KXY A;  4OIP A;  3LYW A;  2E2I A;  4G7H A;  1WCM K;  3I4N K;  3S1R C;  1PJ7 A;  2KWA A;  4KAS A;  4GT9 A;  3ERE D;  2VUM K;  2JA6 A;  1HI9 A;  3CQZ K;  1WQG A;  1VH2 A;  4Y52 K;  1XXB A;  5EGE A;  4C2M K;  4A3M K;  4C3J C;  4A3B C;  3A8J A;  1J6W A;  5HL8 A;  2CW0 A;  4ZH4 A;  4C3J K;  4A3B K;  3FHZ A;  4LLG A;  3S1Q K;  2FQO A;  4A3L K;  4Y7N C;  1O25 A;  1KQ4 A;  4Y7N K;  4YG2 A;  3VA7 A;  3M3Y C;  4KN4 A;  4XLP A;  2B63 A;  3GTG C;  3NUH A;  3GTK C;  2GSN A;  3M3Y K;  3GDZ A;  4BXX C;  2EBB A;  5C3E C;  1Y1W A;  1SFO A;  1X31 C;  3HOU C;  4BXX K;  1B4B A;  1XZP B;  4QJV B;  1EI6 A;  1TWC C;  4A3J K;  1TWC K;  1BDF A;  4WFB S;  4GTC A;  4QJV A;  1PJ6 A;  1FEU A;  3OPF A;  1IW7 A;  3HKZ D;  2GAG C;  2GAH C;  3GEH A;  3L4J A;  2YU9 A;  3A8K A;  2JA7 A;  4GTF A;  3N0C A;  1F93 A;  3BP3 A;  3TTG A;  4A3G C;  2L5N A;  3HOW C;  1TWA A;  4KC6 A;  3HOW K;  3HOX C;  5JFE A;  4C3H K;  2R7Z A;  1O24 A;  4ILD A;  2PA8 D;  3S0X A;  2L3U A;  3HOY C;  2WB1 L;  4OIQ A;  3PO2 C;  5IP9 C;  1B4A A;  4G0U A;  3HOY K;  1VLO A;  3PO2 K;  5IP9 K;  1TWG A;  5FLM C;  4J3N A;  1IL2 A;  4YFX A;  2R92 C;  5FLM K;  4KM8 A;  4MEY A;  1O2B A;  3FOF A;  3DLL S;  4KAT A;  3G4C A;  4A3F C;  2PHC B;  3RZD C;  1ZBS A;  5IOS A;  4A3F K;  2NVX K;  4GTD A;  4OIR A;  1V5V A;  2A69 A;  3GTP K;  3H0G A;  1XZQ A;  5IYC C;  5IOQ A;  3GEI A;  4A3I C;  2E2I K;  4A3D C;  4G7Z A;  5IYC K;  4A3D K;  1VJE A;  1WQH A;  1WOR A;  1K83 A;  4AYB L;  2JA6 C;  1USO A;  5IYD C;  1F7U A;  2KQ1 A;  2JA6 K;  3S2H C;  3S2H K;  1DCO A;  3S16 C;  1J6X A;  3LPX A;  3S16 K;  4MQ9 A;  5C4X C;  1O26 A;  3N3Y A;  3RZO K;  5JVO A;  4G0W A;  1EFW A;  2NVT K;  1DCP A;  1YNN A;  1L0W A;  1WIH A;  4LJZ A;  2FQT A;  1YNJ A;  1WCM C;  3I4N C;  5IOT A;  1F7V A;  2B63 K;  4BKW A;  5CJ9 A;  1INN A;  4KAW X;  1DCH A;  4LK1 A;  2VUM C;  4LR2 A;  1Y1W C;  1SFO C;  3GEE A;  3S17 C;  1Y1W K;  3CQZ C;  1SFO K;  3S17 K;  4Y52 C;  2E2J K;  2JA5 A;  4C2M C;  4A3M C;  1I50 A;  3GTL A;  4FM9 A;  2ZJQ S;  3WOD A;  3GTO A;  3S1Q C;  2JA7 C;  4A3L C;  2YU9 K;  1JVI A;  2V6U A;  3LAP A;  1EH1 A;  2JA7 K;  1J98 A;  5TJ3 A;  5C4J C;  5CHP A;  5TMF A;  1ISE A;  1TWA K;  5C4J K;  4A3K C;  1WOS A;  5HL7 S;  4A3K K;  2O5J A;  2RGR A;  3Q3Q A;  2E2H A;  4C3I C;  1TWG C;  4BBR C;  1Y1V A;  4IO9 S;  4C3I K;  4A3J C;  1TWG K;  4WJ3 M;  3BUE A;  4BBR K;  1EQR A;  2Y0S L;  4O2D A;  4GZY A;  2W7V A;  3GTQ A;  3AQO A;  2PMZ L;  3L4K A;  3V4G A;  1XZP A;  4KB2 A;  2XCQ A;  4G0V A;  3GSI A;  4WF9 S;  3N0B A;  3DXJ A;  3H0G K;  3TFI A;  4P9S A;  1RU0 A;  1O2A A;  3AQP A;  4C3H C;  1ZQ1 C;  1SMY A;  3S2D K;  4NOI A;  1K83 K;  4WJ4 A;  3PIO S;  1TWH A;  3HKZ L;  3FOE A;  1I3Q A;  4IOA S;  2P8T A;  1YCL A;  3ORE A;  3S14 K;  2GSO A;  3ADA C;  1O29 A;  4YFK A;  3M4O C;  3CAG A;  4QIW L;  4KMA A;  3M4O K;  2PA8 L;  4KDD A;  1ZYR A;  3H3V L;  2NVX C;  3TFH A;  3GTP C;  3S15 K;  2KPU A;  3GTJ A;  3CF5 S;  2ZUE A;  3GTG A;  4X6A C;  3GTK A;  3T02 A;  3HOZ C;  4KB4 A;  2E2I C;  5M3F K;  4X6A K;  1O2F B;  5IP7 C;  2Y3P A;  3HOZ K;  4LK0 A;  4KM9 A;  5IP7 K;  2R93 A;  4GTB A;  3JST A;  3AD9 C;  3QX3 A;  4C45 A;  3GIR A;  2JA5 C;  5M5W K;  3AH5 A;  2JA5 K;  2PPB A;  1I50 C;  3GTL C;  3MML B;  1C0A A;  1HQM A;  1I50 K;  3RZO C;  3GTL K;  3GTO C;  2V6T A;  4A3E K;  3GTM A;  2V6S A;  3GTO K;  3HXA A;  2XCR B;  2NVT C; 
#chains in the Genus database with same CATH homology
 3H3V D;  4A3J K;  1TWC K;  4XSZ A;  3WOD A;  1XPP A;  3S1Q C;  2JA7 C;  1BDF A;  4A3L C;  2YU9 K;  4QJV A;  2JA7 K;  2R92 K;  2B63 C;  1I6H C;  1IW7 A;  3HKZ D;  1I6H K;  5C4J C;  5TMF A;  2E2H C;  1TWA K;  5C4J K;  4A3K C;  4AYB D;  3RZD K;  1Y1V C;  2JA8 C;  2E2H K;  4A3K K;  4A3G C;  3HOW C;  1Y1V K;  2A68 A;  2O5J A;  2WAQ L;  2JA8 K;  4A3E C;  3S1M C;  3HOW K;  2E2J C;  3HOX C;  3GTQ C;  4C3H K;  4C3I C;  1TWG C;  3S1M K;  4OIO A;  2PA8 D;  4BBR C;  3GTQ K;  4C3I K;  3HOY C;  4A3J C;  1TWG K;  2WB1 L;  4A93 C;  4BBR K;  4OIQ A;  3PO2 C;  2Y0S L;  5IP9 C;  4A3I K;  3HOY K;  3K7A C;  4GZY A;  2NVY C;  3PO2 K;  4A93 K;  5IP9 K;  4YFN A;  3EQL A;  5IYB C;  3K7A K;  5FLM C;  2A6E A;  4XSX A;  2YU9 C;  2NVY K;  4YFX A;  2PMZ L;  2R92 C;  3HOV C;  5IYB K;  5FLM K;  5C44 C;  5IYD K;  3HOV K;  4MEY A;  3PO3 C;  3GTL K;  5C44 K;  3S1R K;  4A3F C;  3PO3 K;  1TWA C;  3RZD C;  3DXJ A;  4KMU A;  4A3F K;  4XLN A;  1I6V A;  3FKI C;  2NVQ C;  3H0G K;  4BBS C;  1TWF C;  1TWH C;  2NVQ K;  3FKI K;  4A3C C;  2NVX K;  4BBS K;  1R9T C;  4OIR A;  1TWF K;  5C4X K;  4C3H C;  1TWH K;  1SMY A;  4A3C K;  2A69 A;  3GTP K;  2O5I A;  1R9T K;  4MEX A;  4BY1 C;  3S2D K;  1I3Q C;  4NOI A;  1K83 K;  5IYC C;  5M5X K;  4BY1 K;  4A3I C;  4G7O A;  4A3D C;  2WAQ D;  1I3Q K;  3HKZ L;  2E2I K;  4G7Z A;  5IYC K;  4A3D K;  4OIN A;  4OIP A;  4AYB L;  2JA6 C;  4G7H A;  1WCM K;  3I4N K;  5IYD C;  2Y0S D;  2JA6 K;  3S14 K;  2NVT C;  3S2H C;  3S1R C;  4YFK A;  3M4O C;  4QIW L;  3S2H K;  2VUM K;  2PMZ D;  4KN7 A;  3GTJ C;  2PA8 L;  2A6H A;  3S1N C;  3M4O K;  3S16 C;  3H0G C;  5M3M K;  3GTJ K;  3GTG K;  5D4D A;  3S1N K;  3CQZ K;  3GTK K;  1ZYR A;  3H3V L;  4MQ9 A;  2NVX C;  3S16 K;  4JK1 A;  5C4X C;  5M5Y K;  4Q5S A;  3S2D C;  3GTP C;  2R93 C;  3RZO K;  5C3E K;  3S15 K;  4X6A C;  4Y52 K;  1K83 C;  3HOU K;  2R93 K;  3I4M C;  3HOZ C;  2E2I C;  5M3F K;  4X6A K;  4C2M K;  2BE5 A;  5IP7 C;  4A3M K;  2NVT K;  4C3J C;  3HOZ K;  4A3B C;  3I4M K;  1YNN A;  4LK0 A;  4Q4Z A;  5IP7 K;  2CW0 A;  4ZH4 A;  4C3J K;  4A3B K;  4BY7 C;  4LJZ A;  4LLG A;  3S1Q K;  1YNJ A;  1WCM C;  4Y7N C;  3I4N C;  4A3L K;  4BY7 K;  2WB1 D;  3S14 C;  4Y7N K;  2B63 K;  4LK1 A;  4YG2 A;  2VUM C;  3GTM C;  1Y1W C;  3M3Y C;  1SFO C;  3GTM K;  4KN4 A;  4XLP A;  2JA5 C;  3GTG C;  3S17 C;  5M5W K;  3CQZ C;  5TMC A;  3GTK C;  1Y1W K;  2R7Z C;  1SFO K;  2JA5 K;  2PPB A;  1I50 C;  3GTL C;  3M3Y K;  3S17 K;  4A3G K;  2R7Z K;  1HQM A;  4QIW D;  3RZO C;  3S15 C;  5C3E C;  3GTO C;  4BXX C;  1I50 K;  5FJ8 K;  4A3E K;  4Y52 C;  3HOX K;  2E2J K;  4BXX K;  3HOU C;  3GTO K;  4C2M C;  4QJV B;  1TWC C;  4A3M C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...