2PPBA

Crystal structure of the t. thermophilus rnap polymerase elongation complex with the ntp substrate analog and antibiotic streptolydigin
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
229
structure length
229
Chain Sequence
MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (5'-D(P*CP*CP*CP*TP*GP*TP*CP*TP*GP*GP*CP*GP*TP*TP*CP*GP*
publication title Structural basis for substrate loading in bacterial RNA polymerase.
pubmed doi rcsb
molecule tags Transferase/dna/rna
total genus 40
structure length 229
sequence length 229
chains with identical sequence B, K, L
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2007-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01000 RNA_pol_A_bac RNA polymerase Rpb3/RpoA insert domain
A PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain
A PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.12 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 DNA-directed RNA polymerase, insert domain 2ppbA02
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 2ppbA01
4Y7NC 1WCMC 2A6EA 4LK0A 5FLMC 1TWGK 3PO2C 5FJ8K 4AYBD 1Y1WK 3PO3K 3GTMK 4QIWL 3S2HK 4OINA 3HOZC 5C3EC 2R7ZC 4A3GC 3S15K 4MEYA 5IYDC 1I6HC 2E2JK 1K83C 3WODA 4LLGA 4OIPA 5IYCC 4A3JC 4Y7NK 2JA8C 2R92C 5C44K 1TWFC 1BDFA 5FLMK 4BBRC 2JA6K 4KN4A 4C3HK 3PO2K 4YG2A 2WB1D 3GTGC 3I4NK 4BY7K 2WAQL 4KN7A 4XSZA 3GTPK 4BXXC 1ZYRA 3HKZL 4A3BC 3S1QK 2PA8L 5M5YK 4Q5SA 3H3VL 3GTQK 4G7ZA 2NVXK 3HOZK 3FKIK 3I4MC 3S1MC 1YNNA 3RZOC 1I50K 5M5XK 4LK1A 1I3QK 4YFKA 3S2DC 4A3FC 2O5IA 2PPBA 2Y0SL 5C4JK 2YU9K 1TWCC 4C2MC 1TWAK 3HOVC 2PMZL 4XLPA 3M3YC 4A3IK 4A3MK 4LJZA 4G7OA 2B63C 2NVQC 2E2HK 5IYBK 1TWHC 4A3KK 3H0GC 1HQMA 3RZDK 2JA5K 2R93C 4A3DC 3CQZK 5IP7C 4A3BK 3HOWK 3HKZD 2VUMK 2PA8D 5IP9K 1Y1VC 3GTLC 1WCMK 2NVTC 3RZOK 1I6VA 4YFXA 4A93C 3GTJC 4A3CC 4ZH4A 2NVYC 1SFOC 3HOYC 4C2MK 3S14C 4XSXA 4BY1C 3S17C 1XPPA 2B63K 3HOXC 5TMFA 4QIWD 5C4XC 5C3EK 2A6HA 4Q4ZA 3HOUC 2R7ZK 2A69A 4A3GK 2R93K 3S1RC 4A3EC 3GTKC 3M4OC 1R9TC 3S1NC 5IYDK 1I6HK 1K83K 2JA7C 2CW0A 3S16C 5IYCK 4G7HA 3DXJA 4A3JK 2JA8K 2R92K 3GTLK 4XLNA 1TWFK 4BBRK 1YNJA 1TWGC 5M3FK 4Y52C 4AYBL 3GTGK 2WAQD 1Y1WC 3PO3C 4BBSC 4BXXK 3K7AC 4MEXA 3HOXK 3H3VD 1SMYA 3EQLA 2E2IC 3I4MK 3S1MK 4A3LC 4JK1A 4C3IC 3GTOC 2BE5A 4GZYA 2E2JC 4A3FK 2JA7K 5M5WK 3S2DK 1TWCK 4C3JC 4NOIA 2Y0SD 3HOVK 3M3YK 5C44C 2PMZD 2JA6C 4C3HC 2WB1L 4Y52K 2NVQK 1TWHK 4BY7C 3H0GK 3I4NC 4OIRA 4YFNA 4BBSK 3GTPC 4A3DK 5IP7K 3K7AK 3S1QC 5TMCA 4X6AC 4KMUA 3GTQC 2NVXC 1Y1VK 4QJVB 3FKIC 2E2IK 2A68A 1IW7A 2NVTK 4A3LK 5M3MK 4A93K 3GTJK 4A3CK 1I50C 4C3IK 5D4DA 3GTOK 1I3QC 4MQ9A 2NVYK 4QJVA 4C3JK 1SFOK 5C4JC 2YU9C 3HOYK 3S14K 4OIOA 1TWAC 2O5JA 3GTMC 4BY1K 3S17K 4A3IC 4A3MC 5C4XK 2E2HC 3S2HC 3HOUK 5IYBC 4A3KC 3RZDC 2JA5C 4A3EK 3S1RK 3S15C 3CQZC 3GTKK 1R9TK 3S1NK 4OIQA 3HOWC 3M4OK 4X6AK 3S16K 2VUMC 5IP9C
chains in the Genus database with same CATH superfamily
4KMAA 2JA7A 2ZFZA 4G0WA 1YCLA 4AYBD 4GTEA 3AD8C 3OREA 4XCHA 3HOZC 2XCOA 4G0VA 4A3GC 2P8TA 2E2JK 4Y7NK 1J6VA 3PO2K 1ISEA 4KN7A 1WOPA 1WIHA 4Q5SA 1DCOA 3V4GA 3FKIK 3I4MC 1WSVA 1O29A 1WQGA 1I50K 3FKIA 4LK1A 1I3QK 3S2DC 4A3FC 3FOFA 4GTFA 1I50A 1TWCC 4GTCA 2YU9K 1I3QA 3GEHA 3HOVC 2PMZL 3M3YC 4A3MK 2YU9A 1JVIA 4LJZA 4G7OA 2NVQC 3GTMA 3PIPS 3GEEA 5IP9K 2NVTC 1GE9A 4A3CC 4ZH4A 2NVYC 2RGRA 1IBAA 2B63K 5TMFA 4QIWD 5C3EK 2A6HA 3HOUC 2GSOA 1F7VA 2KQ1A 4A3EC 3GTKC 1R9TC 3GTLK 2JA8K 3CF5S 1TWGC 3TFIA 4Y52C 4AYBL 3GTGK 2WAQD 3PO3C 1KQ4A 4BXXK 3GTGA 4U67S 4WFAS 3HOXK 3H3VD 3S1MK 2V6SA 4JK1A 4GTAA 1RU0A 2BE5A 1J98A 3A8JA 4C45A 3L4KA 2KPUA 4BY7C 2CFAB 3GTPC 3S1QC 3LPXA 3GTQC 2E2IK 3NUHA 1XXAA 4C3IK 3GTOK 1VRQC 1SFOK 3HOYK 5C4JC 1IL2A 5JFEA 3S14K 1JQWA 2O5JA 3S17K 1EI6A 1SFOA 4GFQA 5C4XK 3TTGA 5IYBC 1XZPA 3OPFA 2EBBA 2JA5C 3S15C 3CQZC 3S1NK 3S16K 2VUMC 3AD7C 1WCMC 5FLMC 1AB4A 1IQ0A 3T00A 4QIWL 4P9SA 3S2HK 4OINA 4KAWX 5DM7S 3S0XA 5IYCC 2R92C 2L3UA 1WSRA 5C44K 1TWFC 1BDFA 4BBRC 2JA6K 4KN4A 4YG2A 2WB1D 2WAQL 2GAGC 2L5NA 4XSZA 2JA6A 3AQOA 1ZYRA 3HKZL 4A3BC 2PA8L 3H3VL 2ZJRS 4G7ZA 5IOTA 3HOZK 1YNNA 3AQPA 1IE0A 1XZQB 2PPBA 2ZJPS 1PJ6A 3RZDK 4A3KK 3A8IA 1ZBSA 2R93C 1EQRA 2FQTA 3MMLB 3L4JA 1YX2A 4YFXA 4WFBS 4GTDA 3BUEA 1XPPA 2R7ZK 2A69A 1XXBA 2RH6A 3M4OC 3LYWA 5IYDK 1I6HK 2R7ZA 1K83K 2JA7C 4A3JK 3FOEA 4IOCS 1O27A 5CHPA 1K83A 1YNJA 3K7AC 3TFHA 5HL7S 1O26A 1SMYA 1USMA 2FQOA 3GDZA 4G0UA 2E2JC 1VLOA 4C3JC 2Y0SD 1O2AA 3N3YA 2WB1L 4Y52K 1TWHK 3H0GK 4A3DK 2B63A 5IP7K 1TWHA 3H0GA 4X6AC 4QJVB 1F7UA 1Y1VK 4GTLA 3FKIC 4KDDA 4A93K 3GTJK 1I50C 5D4DA 1Y1VA 3GTLA 3A8KA 1I3QC 2GSUA 4QJVA 3GTJA 2YU9C 3GTMC 4BY1K 4A3MC 5CJ9A 3S1RK 5IP9C 4M1XA 4WF9S 1ZXOA 2PHCB 1B4AA 4KMHA 1BGWA 2W7VA 3BP8C 3AD9C 1Y1WK 2ZUFA 1Y1WA 4IO9S 5C3EC 3T01A 4BKWA 2CFAA 3S15K 2E2IA 1BS2A 1O25A 4MEYA 3WODA 4LLGA 4OIPA 3GTOA 2JA8C 1UV7A 4LR2A 5FLMK 4C3HK 3GTGC 3I4NK 4IOAS 4BXXC 5M5YK 2NVXK 3GSIA 4PAAA 4FM9A 3S1MC 3RZOC 1BJTA 1XXCA 2NVXA 4YFKA 2Y0SL 1J6XA 4C2MC 1TWAK 3T02A 4XLPA 4A3IK 2P5MA 2E2HK 1TWAA 1ZVUA 4A3BK 5IORA 3HOWK 2Y3PA 1I6VA 4ILDA 1JOEA 1SFOC 3HOYC 3S14C 2D6FC 2GAHC 3Q3QA 3S17C 3GEIA 5C4XC 2V6UA 4Q4ZA 4WJ3M 3JSTA 4A3GK 2R93K 3S1NC 3BP3A 2CW0A 3S16C 3DXJA 1PJ7A 1EFWA 2JH3A 4KM9A 1B4BA 1XZQA 5TJ3A 1EK8A 1O24A 1DCPA 4KMDA 4BBSC 5JVGS 1VGXA 3EQLA 3I4MK 5HQHA 4A3LC 3CAGA 2KWAA 1J6WA 3G4AA 2JA7K 4A3FK 3DLLS 3S2DK 1TWCK 4NOIA 1VH2A 3HOVK 3M3YK 5C44C 2JA6C 1TWCA 4LQYA 2NVQK 4OIRA 4YFNA 3K7AK 5TMCA 2NVTK 2A68A 3SZYA 1PJ5A 4DDQA 4FZBA 5M3MK 4A3CK 2XCQA 4MQ9A 2NVYK 4C3JK 4KATA 2NVYA 4BLAA 1IS1A 3HOUK 3RZDC 4A3KC 4A3EK 3GTKK 1R9TK 4OIQA 4X6AK 4Y7NC 1WQFA 1L0WA 2A6EA 1R9TA 3GTKA 4LK0A 3SZZA 5JVOA 1TWGK 3PO2C 5FJ8K 2KXYA 5DM6S 3PO3K 1WOSA 1TWGA 3GTMK 1USOA 3IPJA 1WQHA 2ZJQS 2R7ZC 4P5AA 5IYDC 1I6HC 1K83C 4A3JC 4KASA 1FEUA 4BY7K 3N0BA 5JVHS 3GTPK 3S1QK 1WORA 3GTQK 3GTPA 3LAPA 3ADAC 3PIOS 3N0CA 5L46A 5M5XK 3GTQA 2O5IA 5C4JK 2GSNA 3GIRA 4KB2A 1F9NA 4WILA 2B63C 5IYBK 1TWHC 3H0GC 1HQMA 1DCHA 2JA5K 4KC6A 4A3DC 3CQZK 5IP7C 1O2FB 3HKZD 2VUMK 2PA8D 2JA5A 1Y1VC 3GTLC 1WCMK 3CQZA 3RZOK 4A93C 2VUMA 3GTJC 2XCRB 1WCMA 4WCES 4GT9A 4C2MK 4WJ4A 4XSXA 4BY1C 4LOWA 3FHZA 3VA7A 3HOXC 5IOQA 1O28A 3S1RC 1HI9A 2ZUEA 1ZQ1C 5IYCK 4G7HA 4KARA 2R92K 1DD5A 4XLNA 1TWFK 4BBRK 4P5BA 4O2DA 2R92A 1INNA 5M3FK 1TWFA 1V5VA 1X31C 1XZPB 3G4CA 4AH6A 5IOSA 3LAJA 1Y1WC 2E2HA 2V6TA 5HL8A 4MEXA 4KM8A 2E2IC 3OEPA 3HXAA 1EH1A 4C3IC 3GTOC 1F93A 4GZYA 5M5WK 4RMFA 2PMZD 4C3HC 4WFNS 4BLBA 3I4NC 4BBSK 3ERED 1C0AA 1VJEA 4KMUA 1O2BA 2NVXC 5EGHA 2R93A 1IW7A 4A3LK 4GTBA 1G51A 4KB4A 4J3NA 4OIOA 1TWAC 4A3IC 3AH5A 2E2HC 3S2HC 5E68A 1WOOA 3QX3A 4PABA 3M4OK 3TFJA 3HOWC 5EGEA
chains in the Genus database with same CATH topology
4Y7NC 1WCMC 2A6EA 4LK0A 5FLMC 1TWGK 3PO2C 5FJ8K 4AYBD 1Y1WK 3PO3K 3GTMK 4QIWL 3S2HK 4OINA 3HOZC 5C3EC 2R7ZC 4A3GC 3S15K 4MEYA 5IYDC 1I6HC 2E2JK 1K83C 3WODA 4LLGA 4OIPA 5IYCC 4A3JC 4Y7NK 2JA8C 2R92C 5C44K 1TWFC 1BDFA 5FLMK 4BBRC 2JA6K 4KN4A 4C3HK 3PO2K 4YG2A 2WB1D 3GTGC 3I4NK 4BY7K 2WAQL 4KN7A 4XSZA 3GTPK 4BXXC 1ZYRA 3HKZL 4A3BC 3S1QK 2PA8L 5M5YK 4Q5SA 3H3VL 3GTQK 4G7ZA 2NVXK 3HOZK 3FKIK 3I4MC 3S1MC 1YNNA 3RZOC 1I50K 5M5XK 4LK1A 1I3QK 4YFKA 3S2DC 4A3FC 2O5IA 2PPBA 2Y0SL 5C4JK 2YU9K 1TWCC 4C2MC 1TWAK 3HOVC 2PMZL 4XLPA 3M3YC 4A3IK 4A3MK 4LJZA 4G7OA 2B63C 2NVQC 2E2HK 5IYBK 1TWHC 4A3KK 3H0GC 1HQMA 3RZDK 2JA5K 2R93C 4A3DC 3CQZK 5IP7C 4A3BK 3HOWK 3HKZD 2VUMK 2PA8D 5IP9K 1Y1VC 3GTLC 1WCMK 2NVTC 3RZOK 1I6VA 4YFXA 4A93C 3GTJC 4A3CC 4ZH4A 2NVYC 1SFOC 3HOYC 4C2MK 3S14C 4XSXA 4BY1C 3S17C 1XPPA 2B63K 3HOXC 5TMFA 4QIWD 5C4XC 5C3EK 2A6HA 4Q4ZA 3HOUC 2R7ZK 2A69A 4A3GK 2R93K 3S1RC 4A3EC 3GTKC 3M4OC 1R9TC 3S1NC 5IYDK 1I6HK 1K83K 2JA7C 2CW0A 3S16C 5IYCK 4G7HA 3DXJA 4A3JK 2JA8K 2R92K 3GTLK 4XLNA 1TWFK 4BBRK 1YNJA 1TWGC 5M3FK 4Y52C 4AYBL 3GTGK 2WAQD 1Y1WC 3PO3C 4BBSC 4BXXK 3K7AC 4MEXA 3HOXK 3H3VD 1SMYA 3EQLA 2E2IC 3I4MK 3S1MK 4A3LC 4JK1A 4C3IC 3GTOC 2BE5A 4GZYA 2E2JC 4A3FK 2JA7K 5M5WK 3S2DK 1TWCK 4C3JC 4NOIA 2Y0SD 3HOVK 3M3YK 5C44C 2PMZD 2JA6C 4C3HC 2WB1L 4Y52K 2NVQK 1TWHK 4BY7C 3H0GK 3I4NC 4OIRA 4YFNA 4BBSK 3GTPC 4A3DK 5IP7K 3K7AK 3S1QC 5TMCA 4X6AC 4KMUA 3GTQC 2NVXC 1Y1VK 4QJVB 3FKIC 2E2IK 2A68A 1IW7A 2NVTK 4A3LK 5M3MK 4A93K 3GTJK 4A3CK 1I50C 4C3IK 5D4DA 3GTOK 1I3QC 4MQ9A 2NVYK 4QJVA 4C3JK 1SFOK 5C4JC 2YU9C 3HOYK 3S14K 4OIOA 1TWAC 2O5JA 3GTMC 4BY1K 3S17K 4A3IC 4A3MC 5C4XK 2E2HC 3S2HC 3HOUK 5IYBC 4A3KC 3RZDC 2JA5C 4A3EK 3S1RK 3S15C 3CQZC 3GTKK 1R9TK 3S1NK 4OIQA 3HOWC 3M4OK 4X6AK 3S16K 2VUMC 5IP9C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Y7N C;  1WCM C;  2A6E A;  4LK0 A;  5FLM C;  1TWG K;  3PO2 C;  5FJ8 K;  4AYB D;  1Y1W K;  3PO3 K;  3GTM K;  4QIW L;  3S2H K;  4OIN A;  3HOZ C;  5C3E C;  2R7Z C;  4A3G C;  3S15 K;  4MEY A;  5IYD C;  1I6H C;  2E2J K;  1K83 C;  3WOD A;  4LLG A;  4OIP A;  5IYC C;  4A3J C;  4Y7N K;  2JA8 C;  2R92 C;  5C44 K;  1TWF C;  1BDF A;  5FLM K;  4BBR C;  2JA6 K;  4KN4 A;  4C3H K;  3PO2 K;  4YG2 A;  2WB1 D;  3GTG C;  3I4N K;  4BY7 K;  2WAQ L;  4KN7 A;  4XSZ A;  3GTP K;  4BXX C;  1ZYR A;  3HKZ L;  4A3B C;  3S1Q K;  2PA8 L;  5M5Y K;  4Q5S A;  3H3V L;  3GTQ K;  4G7Z A;  2NVX K;  3HOZ K;  3FKI K;  3I4M C;  3S1M C;  1YNN A;  3RZO C;  1I50 K;  5M5X K;  4LK1 A;  1I3Q K;  4YFK A;  3S2D C;  4A3F C;  2O5I A;  2PPB A;  2Y0S L;  5C4J K;  2YU9 K;  1TWC C;  4C2M C;  1TWA K;  3HOV C;  2PMZ L;  4XLP A;  3M3Y C;  4A3I K;  4A3M K;  4LJZ A;  4G7O A;  2B63 C;  2NVQ C;  2E2H K;  5IYB K;  1TWH C;  4A3K K;  3H0G C;  1HQM A;  3RZD K;  2JA5 K;  2R93 C;  4A3D C;  3CQZ K;  5IP7 C;  4A3B K;  3HOW K;  3HKZ D;  2VUM K;  2PA8 D;  5IP9 K;  1Y1V C;  3GTL C;  1WCM K;  2NVT C;  3RZO K;  1I6V A;  4YFX A;  4A93 C;  3GTJ C;  4A3C C;  4ZH4 A;  2NVY C;  1SFO C;  3HOY C;  4C2M K;  3S14 C;  4XSX A;  4BY1 C;  3S17 C;  1XPP A;  2B63 K;  3HOX C;  5TMF A;  4QIW D;  5C4X C;  5C3E K;  2A6H A;  4Q4Z A;  3HOU C;  2R7Z K;  2A69 A;  4A3G K;  2R93 K;  3S1R C;  4A3E C;  3GTK C;  3M4O C;  1R9T C;  3S1N C;  5IYD K;  1I6H K;  1K83 K;  2JA7 C;  2CW0 A;  3S16 C;  5IYC K;  4G7H A;  3DXJ A;  4A3J K;  2JA8 K;  2R92 K;  3GTL K;  4XLN A;  1TWF K;  4BBR K;  1YNJ A;  1TWG C;  5M3F K;  4Y52 C;  4AYB L;  3GTG K;  2WAQ D;  1Y1W C;  3PO3 C;  4BBS C;  4BXX K;  3K7A C;  4MEX A;  3HOX K;  3H3V D;  1SMY A;  3EQL A;  2E2I C;  3I4M K;  3S1M K;  4A3L C;  4JK1 A;  4C3I C;  3GTO C;  2BE5 A;  4GZY A;  2E2J C;  4A3F K;  2JA7 K;  5M5W K;  3S2D K;  1TWC K;  4C3J C;  4NOI A;  2Y0S D;  3HOV K;  3M3Y K;  5C44 C;  2PMZ D;  2JA6 C;  4C3H C;  2WB1 L;  4Y52 K;  2NVQ K;  1TWH K;  4BY7 C;  3H0G K;  3I4N C;  4OIR A;  4YFN A;  4BBS K;  3GTP C;  4A3D K;  5IP7 K;  3K7A K;  3S1Q C;  5TMC A;  4X6A C;  4KMU A;  3GTQ C;  2NVX C;  1Y1V K;  4QJV B;  3FKI C;  2E2I K;  2A68 A;  1IW7 A;  2NVT K;  4A3L K;  5M3M K;  4A93 K;  3GTJ K;  4A3C K;  1I50 C;  4C3I K;  5D4D A;  3GTO K;  1I3Q C;  4MQ9 A;  2NVY K;  4QJV A;  4C3J K;  1SFO K;  5C4J C;  2YU9 C;  3HOY K;  3S14 K;  4OIO A;  1TWA C;  2O5J A;  3GTM C;  4BY1 K;  3S17 K;  4A3I C;  4A3M C;  5C4X K;  2E2H C;  3S2H C;  3HOU K;  5IYB C;  4A3K C;  3RZD C;  2JA5 C;  4A3E K;  3S1R K;  3S15 C;  3CQZ C;  3GTK K;  1R9T K;  3S1N K;  4OIQ A;  3HOW C;  3M4O K;  4X6A K;  3S16 K;  2VUM C;  5IP9 C; 
#chains in the Genus database with same CATH topology
 4KMA A;  2JA7 A;  2ZFZ A;  4G0W A;  1YCL A;  4AYB D;  4GTE A;  3AD8 C;  3ORE A;  4XCH A;  3HOZ C;  2XCO A;  4G0V A;  4A3G C;  2P8T A;  2E2J K;  4Y7N K;  1J6V A;  3PO2 K;  1ISE A;  4KN7 A;  1WOP A;  1WIH A;  4Q5S A;  1DCO A;  3V4G A;  3FKI K;  3I4M C;  1WSV A;  1O29 A;  1WQG A;  1I50 K;  3FKI A;  4LK1 A;  1I3Q K;  3S2D C;  4A3F C;  3FOF A;  4GTF A;  1I50 A;  1TWC C;  4GTC A;  2YU9 K;  1I3Q A;  3GEH A;  3HOV C;  2PMZ L;  3M3Y C;  4A3M K;  2YU9 A;  1JVI A;  4LJZ A;  4G7O A;  2NVQ C;  3GTM A;  3PIP S;  3GEE A;  5IP9 K;  2NVT C;  1GE9 A;  4A3C C;  4ZH4 A;  2NVY C;  2RGR A;  1IBA A;  2B63 K;  5TMF A;  4QIW D;  5C3E K;  2A6H A;  3HOU C;  2GSO A;  1F7V A;  2KQ1 A;  4A3E C;  3GTK C;  1R9T C;  3GTL K;  2JA8 K;  3CF5 S;  1TWG C;  3TFI A;  4Y52 C;  4AYB L;  3GTG K;  2WAQ D;  3PO3 C;  1KQ4 A;  4BXX K;  3GTG A;  4U67 S;  4WFA S;  3HOX K;  3H3V D;  3S1M K;  2V6S A;  4JK1 A;  4GTA A;  1RU0 A;  2BE5 A;  1J98 A;  3A8J A;  4C45 A;  3L4K A;  2KPU A;  4BY7 C;  2CFA B;  3GTP C;  3S1Q C;  3LPX A;  3GTQ C;  2E2I K;  3NUH A;  1XXA A;  4C3I K;  3GTO K;  1VRQ C;  1SFO K;  3HOY K;  5C4J C;  1IL2 A;  5JFE A;  3S14 K;  1JQW A;  2O5J A;  3S17 K;  1EI6 A;  1SFO A;  4GFQ A;  5C4X K;  3TTG A;  5IYB C;  1XZP A;  3OPF A;  2EBB A;  2JA5 C;  3S15 C;  3CQZ C;  3S1N K;  3S16 K;  2VUM C;  3AD7 C;  1WCM C;  5FLM C;  1AB4 A;  1IQ0 A;  3T00 A;  4QIW L;  4P9S A;  3S2H K;  4OIN A;  4KAW X;  5DM7 S;  3S0X A;  5IYC C;  2R92 C;  2L3U A;  1WSR A;  5C44 K;  1TWF C;  1BDF A;  4BBR C;  2JA6 K;  4KN4 A;  4YG2 A;  2WB1 D;  2WAQ L;  2GAG C;  2L5N A;  4XSZ A;  2JA6 A;  3AQO A;  1ZYR A;  3HKZ L;  4A3B C;  2PA8 L;  3H3V L;  2ZJR S;  4G7Z A;  5IOT A;  3HOZ K;  1YNN A;  3AQP A;  1IE0 A;  1XZQ B;  2PPB A;  2ZJP S;  1PJ6 A;  3RZD K;  4A3K K;  3A8I A;  1ZBS A;  2R93 C;  1EQR A;  2FQT A;  3MML B;  3L4J A;  1YX2 A;  4YFX A;  4WFB S;  4GTD A;  3BUE A;  1XPP A;  2R7Z K;  2A69 A;  1XXB A;  2RH6 A;  3M4O C;  3LYW A;  5IYD K;  1I6H K;  2R7Z A;  1K83 K;  2JA7 C;  4A3J K;  3FOE A;  4IOC S;  1O27 A;  5CHP A;  1K83 A;  1YNJ A;  3K7A C;  3TFH A;  5HL7 S;  1O26 A;  1SMY A;  1USM A;  2FQO A;  3GDZ A;  4G0U A;  2E2J C;  1VLO A;  4C3J C;  2Y0S D;  1O2A A;  3N3Y A;  2WB1 L;  4Y52 K;  1TWH K;  3H0G K;  4A3D K;  2B63 A;  5IP7 K;  1TWH A;  3H0G A;  4X6A C;  4QJV B;  1F7U A;  1Y1V K;  4GTL A;  3FKI C;  4KDD A;  4A93 K;  3GTJ K;  1I50 C;  5D4D A;  1Y1V A;  3GTL A;  3A8K A;  1I3Q C;  2GSU A;  4QJV A;  3GTJ A;  2YU9 C;  3GTM C;  4BY1 K;  4A3M C;  5CJ9 A;  3S1R K;  5IP9 C;  4M1X A;  4WF9 S;  1ZXO A;  2PHC B;  1B4A A;  4KMH A;  1BGW A;  2W7V A;  3BP8 C;  3AD9 C;  1Y1W K;  2ZUF A;  1Y1W A;  4IO9 S;  5C3E C;  3T01 A;  4BKW A;  2CFA A;  3S15 K;  2E2I A;  1BS2 A;  1O25 A;  4MEY A;  3WOD A;  4LLG A;  4OIP A;  3GTO A;  2JA8 C;  1UV7 A;  4LR2 A;  5FLM K;  4C3H K;  3GTG C;  3I4N K;  4IOA S;  4BXX C;  5M5Y K;  2NVX K;  3GSI A;  4PAA A;  4FM9 A;  3S1M C;  3RZO C;  1BJT A;  1XXC A;  2NVX A;  4YFK A;  2Y0S L;  1J6X A;  4C2M C;  1TWA K;  3T02 A;  4XLP A;  4A3I K;  2P5M A;  2E2H K;  1TWA A;  1ZVU A;  4A3B K;  5IOR A;  3HOW K;  2Y3P A;  1I6V A;  4ILD A;  1JOE A;  1SFO C;  3HOY C;  3S14 C;  2D6F C;  2GAH C;  3Q3Q A;  3S17 C;  3GEI A;  5C4X C;  2V6U A;  4Q4Z A;  4WJ3 M;  3JST A;  4A3G K;  2R93 K;  3S1N C;  3BP3 A;  2CW0 A;  3S16 C;  3DXJ A;  1PJ7 A;  1EFW A;  2JH3 A;  4KM9 A;  1B4B A;  1XZQ A;  5TJ3 A;  1EK8 A;  1O24 A;  1DCP A;  4KMD A;  4BBS C;  5JVG S;  1VGX A;  3EQL A;  3I4M K;  5HQH A;  4A3L C;  3CAG A;  2KWA A;  1J6W A;  3G4A A;  2JA7 K;  4A3F K;  3DLL S;  3S2D K;  1TWC K;  4NOI A;  1VH2 A;  3HOV K;  3M3Y K;  5C44 C;  2JA6 C;  1TWC A;  4LQY A;  2NVQ K;  4OIR A;  4YFN A;  3K7A K;  5TMC A;  2NVT K;  2A68 A;  3SZY A;  1PJ5 A;  4DDQ A;  4FZB A;  5M3M K;  4A3C K;  2XCQ A;  4MQ9 A;  2NVY K;  4C3J K;  4KAT A;  2NVY A;  4BLA A;  1IS1 A;  3HOU K;  3RZD C;  4A3K C;  4A3E K;  3GTK K;  1R9T K;  4OIQ A;  4X6A K;  4Y7N C;  1WQF A;  1L0W A;  2A6E A;  1R9T A;  3GTK A;  4LK0 A;  3SZZ A;  5JVO A;  1TWG K;  3PO2 C;  5FJ8 K;  2KXY A;  5DM6 S;  3PO3 K;  1WOS A;  1TWG A;  3GTM K;  1USO A;  3IPJ A;  1WQH A;  2ZJQ S;  2R7Z C;  4P5A A;  5IYD C;  1I6H C;  1K83 C;  4A3J C;  4KAS A;  1FEU A;  4BY7 K;  3N0B A;  5JVH S;  3GTP K;  3S1Q K;  1WOR A;  3GTQ K;  3GTP A;  3LAP A;  3ADA C;  3PIO S;  3N0C A;  5L46 A;  5M5X K;  3GTQ A;  2O5I A;  5C4J K;  2GSN A;  3GIR A;  4KB2 A;  1F9N A;  4WIL A;  2B63 C;  5IYB K;  1TWH C;  3H0G C;  1HQM A;  1DCH A;  2JA5 K;  4KC6 A;  4A3D C;  3CQZ K;  5IP7 C;  1O2F B;  3HKZ D;  2VUM K;  2PA8 D;  2JA5 A;  1Y1V C;  3GTL C;  1WCM K;  3CQZ A;  3RZO K;  4A93 C;  2VUM A;  3GTJ C;  2XCR B;  1WCM A;  4WCE S;  4GT9 A;  4C2M K;  4WJ4 A;  4XSX A;  4BY1 C;  4LOW A;  3FHZ A;  3VA7 A;  3HOX C;  5IOQ A;  1O28 A;  3S1R C;  1HI9 A;  2ZUE A;  1ZQ1 C;  5IYC K;  4G7H A;  4KAR A;  2R92 K;  1DD5 A;  4XLN A;  1TWF K;  4BBR K;  4P5B A;  4O2D A;  2R92 A;  1INN A;  5M3F K;  1TWF A;  1V5V A;  1X31 C;  1XZP B;  3G4C A;  4AH6 A;  5IOS A;  3LAJ A;  1Y1W C;  2E2H A;  2V6T A;  5HL8 A;  4MEX A;  4KM8 A;  2E2I C;  3OEP A;  3HXA A;  1EH1 A;  4C3I C;  3GTO C;  1F93 A;  4GZY A;  5M5W K;  4RMF A;  2PMZ D;  4C3H C;  4WFN S;  4BLB A;  3I4N C;  4BBS K;  3ERE D;  1C0A A;  1VJE A;  4KMU A;  1O2B A;  2NVX C;  5EGH A;  2R93 A;  1IW7 A;  4A3L K;  4GTB A;  1G51 A;  4KB4 A;  4J3N A;  4OIO A;  1TWA C;  4A3I C;  3AH5 A;  2E2H C;  3S2H C;  5E68 A;  1WOO A;  3QX3 A;  4PAB A;  3M4O K;  3TFJ A;  3HOW C;  5EGE A; 
#chains in the Genus database with same CATH homology
 4Y7N C;  1WCM C;  2A6E A;  4LK0 A;  5FLM C;  1TWG K;  3PO2 C;  5FJ8 K;  4AYB D;  1Y1W K;  3PO3 K;  3GTM K;  4QIW L;  3S2H K;  4OIN A;  3HOZ C;  5C3E C;  2R7Z C;  4A3G C;  3S15 K;  4MEY A;  5IYD C;  1I6H C;  2E2J K;  1K83 C;  3WOD A;  4LLG A;  4OIP A;  5IYC C;  4A3J C;  4Y7N K;  2JA8 C;  2R92 C;  5C44 K;  1TWF C;  1BDF A;  5FLM K;  4BBR C;  2JA6 K;  4KN4 A;  4C3H K;  3PO2 K;  4YG2 A;  2WB1 D;  3GTG C;  3I4N K;  4BY7 K;  2WAQ L;  4KN7 A;  4XSZ A;  3GTP K;  4BXX C;  1ZYR A;  3HKZ L;  4A3B C;  3S1Q K;  2PA8 L;  5M5Y K;  4Q5S A;  3H3V L;  3GTQ K;  4G7Z A;  2NVX K;  3HOZ K;  3FKI K;  3I4M C;  3S1M C;  1YNN A;  3RZO C;  1I50 K;  5M5X K;  4LK1 A;  1I3Q K;  4YFK A;  3S2D C;  4A3F C;  2O5I A;  2PPB A;  2Y0S L;  5C4J K;  2YU9 K;  1TWC C;  4C2M C;  1TWA K;  3HOV C;  2PMZ L;  4XLP A;  3M3Y C;  4A3I K;  4A3M K;  4LJZ A;  4G7O A;  2B63 C;  2NVQ C;  2E2H K;  5IYB K;  1TWH C;  4A3K K;  3H0G C;  1HQM A;  3RZD K;  2JA5 K;  2R93 C;  4A3D C;  3CQZ K;  5IP7 C;  4A3B K;  3HOW K;  3HKZ D;  2VUM K;  2PA8 D;  5IP9 K;  1Y1V C;  3GTL C;  1WCM K;  2NVT C;  3RZO K;  1I6V A;  4YFX A;  4A93 C;  3GTJ C;  4A3C C;  4ZH4 A;  2NVY C;  1SFO C;  3HOY C;  4C2M K;  3S14 C;  4XSX A;  4BY1 C;  3S17 C;  1XPP A;  2B63 K;  3HOX C;  5TMF A;  4QIW D;  5C4X C;  5C3E K;  2A6H A;  4Q4Z A;  3HOU C;  2R7Z K;  2A69 A;  4A3G K;  2R93 K;  3S1R C;  4A3E C;  3GTK C;  3M4O C;  1R9T C;  3S1N C;  5IYD K;  1I6H K;  1K83 K;  2JA7 C;  2CW0 A;  3S16 C;  5IYC K;  4G7H A;  3DXJ A;  4A3J K;  2JA8 K;  2R92 K;  3GTL K;  4XLN A;  1TWF K;  4BBR K;  1YNJ A;  1TWG C;  5M3F K;  4Y52 C;  4AYB L;  3GTG K;  2WAQ D;  1Y1W C;  3PO3 C;  4BBS C;  4BXX K;  3K7A C;  4MEX A;  3HOX K;  3H3V D;  1SMY A;  3EQL A;  2E2I C;  3I4M K;  3S1M K;  4A3L C;  4JK1 A;  4C3I C;  3GTO C;  2BE5 A;  4GZY A;  2E2J C;  4A3F K;  2JA7 K;  5M5W K;  3S2D K;  1TWC K;  4C3J C;  4NOI A;  2Y0S D;  3HOV K;  3M3Y K;  5C44 C;  2PMZ D;  2JA6 C;  4C3H C;  2WB1 L;  4Y52 K;  2NVQ K;  1TWH K;  4BY7 C;  3H0G K;  3I4N C;  4OIR A;  4YFN A;  4BBS K;  3GTP C;  4A3D K;  5IP7 K;  3K7A K;  3S1Q C;  5TMC A;  4X6A C;  4KMU A;  3GTQ C;  2NVX C;  1Y1V K;  4QJV B;  3FKI C;  2E2I K;  2A68 A;  1IW7 A;  2NVT K;  4A3L K;  5M3M K;  4A93 K;  3GTJ K;  4A3C K;  1I50 C;  4C3I K;  5D4D A;  3GTO K;  1I3Q C;  4MQ9 A;  2NVY K;  4QJV A;  4C3J K;  1SFO K;  5C4J C;  2YU9 C;  3HOY K;  3S14 K;  4OIO A;  1TWA C;  2O5J A;  3GTM C;  4BY1 K;  3S17 K;  4A3I C;  4A3M C;  5C4X K;  2E2H C;  3S2H C;  3HOU K;  5IYB C;  4A3K C;  3RZD C;  2JA5 C;  4A3E K;  3S1R K;  3S15 C;  3CQZ C;  3GTK K;  1R9T K;  3S1N K;  4OIQ A;  3HOW C;  3M4O K;  4X6A K;  3S16 K;  2VUM C;  5IP9 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...