2PPBA

Crystal structure of the t. thermophilus rnap polymerase elongation complex with the ntp substrate analog and antibiotic streptolydigin
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
229
structure length
229
Chain Sequence
MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for substrate loading in bacterial RNA polymerase.
pubmed doi rcsb
molecule tags Transferase/dna/rna
molecule keywords DNA (5'-D(P*CP*CP*CP*TP*GP*TP*CP*TP*GP*GP*CP*GP*TP*TP*CP*GP*
total genus 40
structure length 229
sequence length 229
chains with identical sequence B, K, L
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2007-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01000 RNA_pol_A_bac RNA polymerase Rpb3/RpoA insert domain
A PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain
A PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.12 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 DNA-directed RNA polymerase, insert domain 2ppbA02
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 2ppbA01
3HKZL 5C4JC 2E2IC 3I4NC 4QJVB 3M4OK 2R93K 1I50K 1YNNA 3S15C 5FLMK 3HOYC 2VUMC 3S17C 4YFKA 4KMUA 4LLGA 2JA8C 3S2DK 4C2MC 4A93K 1TWCK 1HQMA 2A6EA 3CQZC 1Y1WK 4C3IC 3PO3C 4Y52K 5C3EC 3GTQK 4A3CC 3HOVK 5IP7K 1TWHC 4A3DC 5C4XC 5M3MK 5FLMC 3GTKK 4A3CK 4OINA 4LK1A 4A3KC 4XLPA 2R93C 3S16K 3K7AC 4OIQA 1WCMK 2E2HC 3GTOK 1SFOK 1SFOC 2WB1D 2PPBA 2NVQC 4LK0A 4MEXA 4C3HK 2NVQK 4A3FC 3GTPK 4BY7C 4KN7A 5IYDK 3GTJC 4BY1K 2JA7K 4A3JK 3GTKC 4A3DK 3HOVC 1TWGK 3RZDK 3FKIC 4Y7NK 3HKZD 3FKIK 4A3KK 2E2JK 4YFNA 3S1MC 4AYBL 4Q4ZA 2NVXK 5IYCC 4A3MC 1R9TC 3S1RK 1TWAC 4BBRC 2B63C 4A3GC 4BY1C 2A68A 3GTJK 2R7ZK 3S2HK 4A93C 1XPPA 1TWGC 3GTPC 2VUMK 3S17K 3I4MC 1I3QK 2BE5A 3HOUK 4X6AC 4XSZA 3HOZK 4OIOA 3H0GC 5TMFA 3S14C 2JA6K 2JA6C 1I50C 4KN4A 4YG2A 1TWHK 3S2HC 4A3GK 4LJZA 2NVYC 3GTGK 5IYDC 2NVXC 4A3FK 5IP9K 3HOUC 3RZOC 3PO2K 3GTOC 3CQZK 2PMZD 2PA8L 1I6VA 1TWCC 1I3QC 4C3IK 4MEYA 5M5YK 4ZH4A 3HOWC 3HOXC 4A3EK 5IP7C 2JA7C 5TMCA 3GTMC 2PA8D 5C3EK 3GTGC 1K83C 4NOIA 1I6HC 4OIRA 1TWFC 3RZOK 4Y7NC 3WODA 1WCMC 3K7AK 3S1QK 5D4DA 4G7HA 4GZYA 1SMYA 4BY7K 3GTQC 4G7OA 4Y52C 3I4NK 3DXJA 2NVTK 2JA5C 4BBSC 4C3JK 5M3FK 2CW0A 1I6HK 4X6AK 5IYBC 1K83K 3S16C 4XSXA 4C2MK 5IYCK 4A3MK 1R9TK 1TWAK 4BBRK 4AYBD 2B63K 2E2JC 2NVYK 2O5JA 3M3YK 4A3IK 5C44C 1Y1WC 3PO2C 1YNJA 4QIWD 3GTMK 1ZYRA 4A3BC 2JA5K 3S15K 4YFXA 4BBSK 4BXXK 2A69A 2Y0SL 2WAQD 4QJVA 4C3HC 3H0GK 3S1QC 3M4OC 2WB1L 3S1NK 4MQ9A 2PMZL 5C44K 1TWFK 5M5WK 3I4MK 3H3VD 5FJ8K 4A3IC 2Y0SD 5C4XK 1Y1VC 3GTLC 4BXXC 4Q5SA 3EQLA 4A3EC 3HOXK 2R92K 3GTLK 4A3BK 3PO3K 3S1MK 3H3VL 4QIWL 3HOWK 4C3JC 1IW7A 5C4JK 2E2IK 4G7ZA 3S2DC 3M3YC 2A6HA 5IYBK 2JA8K 3S1RC 5IP9C 2R7ZC 4JK1A 2E2HK 2WAQL 3HOYK 4A3JC 2YU9K 1BDFA 2R92C 1Y1VK 4A3LC 5M5XK 4A3LK 4XLNA 3RZDC 2O5IA 3HOZC 3S14K 3S1NC 4OIPA 2YU9C 2NVTC
chains in the Genus database with same CATH superfamily
2E2IC 3CQZA 3I4NC 2ZJQS 2W7VA 3S15C 1L0WA 4A93K 3A8KA 2JA8C 4C2MC 1TWCK 1F9NA 3G4CA 3AQPA 2XCRB 5IORA 3HOVK 3A8JA 3L4KA 5DM6S 4LK1A 4A3KC 2E2HC 1O24A 3HXAA 2PPBA 1JVIA 3GTPK 3PIPS 2JA7K 1KQ4A 1RU0A 3GTPA 2RH6A 2V6TA 4YFNA 1EH1A 2NVXK 1DCOA 4LR2A 4BBRC 2B63C 2R7ZK 1IBAA 1J6XA 2A68A 4A93C 4FZBA 1SFOA 1DD5A 3HOZK 4WCES 4WF9S 2JA6K 3AD8C 5EGEA 1O26A 1I50C 1TWCA 1TWGA 1V5VA 1TWHK 5E68A 3MMLB 4IOCS 4GTAA 3CQZK 1I3QC 4MEYA 2P5MA 2ZFZA 4A3EK 3LYWA 3LPXA 2JA7C 3N0CA 3GTMC 4C45A 3GTGC 1K83C 1WOPA 1WCMC 4G7HA 2GAGC 4KAWX 4BY7K 3I4NK 4Y52C 3V4GA 3GTOA 1J6VA 2CW0A 4GTFA 5IYBC 4WFNS 5IOQA 3S16C 4C2MK 1R9TK 3N3YA 2R93A 2L5NA 1VH2A 1XXCA 3GEIA 3L4JA 4A3IK 5DM7S 5JVGS 1Y1WC 4QIWD 1XXBA 3GTMK 5CHPA 1WSRA 2GAHC 2A69A 4KMDA 2WB1L 4LOWA 4RMFA 2YU9A 3I4MK 4KARA 1PJ6A 3GTLC 4Q5SA 5HL8A 3HOXK 4A3BK 4GT9A 5EGHA 2A6HA 3AH5A 1FEUA 2JA8K 2R7ZC 2WAQL 1TWHA 4PAAA 3AQOA 4KM9A 4XLNA 3RZDC 4G0UA 3BP3A 3S1NC 3HOVC 2NVTK 3HKZL 4QJVB 1YNNA 3T01A 5FLMK 4LLGA 3GTMA 1HQMA 1WQFA 2A6EA 4Y52K 3GTQK 4KDDA 1O27A 5L46A 5IP7K 3GTKK 3GTJA 4OIQA 1WCMK 3GTOK 4DDQA 1SFOK 2WB1D 4MEXA 4A3FC 1EFWA 4BY7C 5IYDK 4BY1K 1R9TA 1TWGK 2B63A 3FKIC 5IOSA 2E2JK 1VGXA 5IYCC 3GTKA 1ZQ1C 4BY1C 3S17K 1TWGC 3ERED 1I3QK 4P5BA 4X6AC 4M1XA 2PHCB 1HI9A 5TMFA 1XZPA 2JA6C 4GTEA 3S2HC 4A3GK 4LJZA 3GDZA 1B4BA 2NVXC 1VJEA 1C0AA 5IP9K 4GTLA 3RZOC 1ZVUA 3PO2K 3H0GA 2PMZD 4C3IK 1O28A 5M5YK 1WCMA 2VUMA 5TMCA 5C3EK 1USOA 1VRQC 5IOTA 4OIRA 3AD9C 2KPUA 3WODA 1UV7A 2KWAA 4GZYA 4IO9S 1J98A 2XCOA 1O29A 5M3FK 1I6HK 4XSXA 4A3MK 4BBRK 2B63K 2NVYK 2JA5A 4P9SA 3M3YK 1PJ5A 3GSIA 4GTDA 2GSOA 3S0XA 2JA5K 3S15K 4BBSK 1O2BA 4U67S 2WAQD 4C3HC 1G51A 2ZUFA 3DLLS 2CFAA 2KXYA 3T00A 4A3IC 1I50A 2R7ZA 2NVYA 2FQOA 3S1MK 3HOWK 4QIWL 2XCQA 3LAJA 1IW7A 2E2IK 3S2DC 3M3YC 4ILDA 3S1RC 1J6WA 4KMAA 1IL2A 4A3JC 1Y1VK 5M5XK 1YCLA 1ZBSA 3T02A 1K83A 3S14K 4A3CK 2YU9C 3ADAC 1O2AA 4BLBA 5C4JC 5TJ3A 3M4OK 2RGRA 3VA7A 2R92A 4WILA 4G0VA 2VUMC 2JA7A 4KMUA 2P8TA 4BLAA 5JVHS 1YX2A 4GTCA 1VLOA 1Y1WK 4C3IC 4KB4A 3PO3C 5C3EC 4GTBA 1IE0A 1TWHC 4A3DC 5M3MK 1GE9A 4KASA 2R93C 3S16K 5HL7S 1SFOC 2NVQC 4LK0A 1WSVA 2GSUA 3SZYA 4A3JK 4AH6A 3A8IA 4A3DK 1O25A 4P5AA 1Y1WA 3FKIK 1IQ0A 4AYBL 3GTGK 4A3MC 3CAGA 1TWAC 3AD7C 1XPPA 2VUMK 3BP8C 3I4MC 2BE5A 2GSNA 2NVXA 2V6SA 4XSZA 1EK8A 3BUEA 1Y1VA 4KN4A 4YG2A 4G0WA 3GTQA 1BGWA 4KATA 4ZH4A 3HOWC 5IP7C 2PA8D 2V6UA 4IOAS 3K7AK 5D4DA 4XCHA 4GFQA 1SMYA 4G7OA 3DXJA 3TFHA 2JA5C 4BBSC 1F93A 5IYCK 2E2JC 2Y3PA 3OREA 2ZJPS 3TFJA 3NUHA 4WJ4A 2L3UA 4WFAS 3LAPA 4YFXA 4QJVA 3H0GK 1WOSA 1JOEA 4KB2A 2PMZL 2D6FC 1BS2A 5M5WK 5FJ8K 2Y0SD 5C4XK 2R92K 1F7UA 1XXAA 1WIHA 1F7VA 3H3VL 1ZXOA 5IYBK 2EBBA 1O2FB 4JK1A 1AB4A 3HOYK 2JA6A 1BDFA 2R92C 4A3LC 3GTGA 4PABA 3HOZC 2O5IA 1TWFA 4G7ZA 4OIPA 2YU9K 3GEEA 1I3QA 2R93K 1I50K 3FHZA 1ISEA 3HOYC 3S17C 3S2DK 4YFKA 3TTGA 3SZZA 1DCHA 2JH3A 3CQZC 1JQWA 2E2IA 1PJ7A 3FKIA 2ZJRS 3QX3A 4A3CC 1WQHA 5C4XC 5FLMC 4OINA 4XLPA 1INNA 1XZQB 4J3NA 3K7AC 4WFBS 1XZPB 4LQYA 1EI6A 4C3HK 2NVQK 4KN7A 3GTJC 3Q3QA 3GTKC 1TWAA 3RZDK 3OEPA 4Y7NK 3HKZD 4A3KK 3S1MC 4O2DA 4Q4ZA 1R9TC 3G4AA 3S1RK 4A3GC 3S2HK 3GTJK 3GTPC 3HOUK 5CJ9A 4KC6A 2ZUEA 4BKWA 1XZQA 4OIOA 3H0GC 3S14C 3PIOS 2NVYC 5IYDC 4A3FK 3GEHA 3HOUC 3GTOC 2PA8L 1I6VA 1TWCC 3HOXC 3JSTA 1WQGA 4NOIA 1I6HC 1TWFC 3RZOK 4Y7NC 2FQTA 3S1QK 3GIRA 2CFAB 3GTQC 2E2HA 4C3JK 1USMA 1WORA 3OPFA 4X6AK 3CF5S 1K83K 1IS1A 1TWAK 4AYBD 3GTLA 2O5JA 3TFIA 3FOFA 5C44C 3PO2C 1YNJA 1ZYRA 1BJTA 4A3BC 4KMHA 3IPJA 5JVOA 4BXXK 2Y0SL 1EQRA 5JFEA 3S1QC 3M4OC 3N0BA 4MQ9A 5C44K 1TWFK 3H3VD 1Y1VC 4BXXC 3GTLK 3EQLA 4A3EC 4WJ3M 1B4AA 3FOEA 3PO3K 4KM8A 1DCPA 4C3JC 2KQ1A 1WOOA 5C4JK 4FM9A 5IP9C 1X31C 2E2HK 4A3LK 5HQHA 3S1NK 2NVTC
chains in the Genus database with same CATH topology
3HKZL 5C4JC 2E2IC 3I4NC 4QJVB 3M4OK 2R93K 1I50K 1YNNA 3S15C 5FLMK 3HOYC 2VUMC 3S17C 4YFKA 4KMUA 4LLGA 2JA8C 3S2DK 4C2MC 4A93K 1TWCK 1HQMA 2A6EA 3CQZC 1Y1WK 4C3IC 3PO3C 4Y52K 5C3EC 3GTQK 4A3CC 3HOVK 5IP7K 1TWHC 4A3DC 5C4XC 5M3MK 5FLMC 3GTKK 4A3CK 4OINA 4LK1A 4A3KC 4XLPA 2R93C 3S16K 3K7AC 4OIQA 1WCMK 2E2HC 3GTOK 1SFOK 1SFOC 2WB1D 2PPBA 2NVQC 4LK0A 4MEXA 4C3HK 2NVQK 4A3FC 3GTPK 4BY7C 4KN7A 5IYDK 3GTJC 4BY1K 2JA7K 4A3JK 3GTKC 4A3DK 3HOVC 1TWGK 3RZDK 3FKIC 4Y7NK 3HKZD 3FKIK 4A3KK 2E2JK 4YFNA 3S1MC 4AYBL 4Q4ZA 2NVXK 5IYCC 4A3MC 1R9TC 3S1RK 1TWAC 4BBRC 2B63C 4A3GC 4BY1C 2A68A 3GTJK 2R7ZK 3S2HK 4A93C 1XPPA 1TWGC 3GTPC 2VUMK 3S17K 3I4MC 1I3QK 2BE5A 3HOUK 4X6AC 4XSZA 3HOZK 4OIOA 3H0GC 5TMFA 3S14C 2JA6K 2JA6C 1I50C 4KN4A 4YG2A 1TWHK 3S2HC 4A3GK 4LJZA 2NVYC 3GTGK 5IYDC 2NVXC 4A3FK 5IP9K 3HOUC 3RZOC 3PO2K 3GTOC 3CQZK 2PMZD 2PA8L 1I6VA 1TWCC 1I3QC 4C3IK 4MEYA 5M5YK 4ZH4A 3HOWC 3HOXC 4A3EK 5IP7C 2JA7C 5TMCA 3GTMC 2PA8D 5C3EK 3GTGC 1K83C 4NOIA 1I6HC 4OIRA 1TWFC 3RZOK 4Y7NC 3WODA 1WCMC 3K7AK 3S1QK 5D4DA 4G7HA 4GZYA 1SMYA 4BY7K 3GTQC 4G7OA 4Y52C 3I4NK 3DXJA 2NVTK 2JA5C 4BBSC 4C3JK 5M3FK 2CW0A 1I6HK 4X6AK 5IYBC 1K83K 3S16C 4XSXA 4C2MK 5IYCK 4A3MK 1R9TK 1TWAK 4BBRK 4AYBD 2B63K 2E2JC 2NVYK 2O5JA 3M3YK 4A3IK 5C44C 1Y1WC 3PO2C 1YNJA 4QIWD 3GTMK 1ZYRA 4A3BC 2JA5K 3S15K 4YFXA 4BBSK 4BXXK 2A69A 2Y0SL 2WAQD 4QJVA 4C3HC 3H0GK 3S1QC 3M4OC 2WB1L 3S1NK 4MQ9A 2PMZL 5C44K 1TWFK 5M5WK 3I4MK 3H3VD 5FJ8K 4A3IC 2Y0SD 5C4XK 1Y1VC 3GTLC 4BXXC 4Q5SA 3EQLA 4A3EC 3HOXK 2R92K 3GTLK 4A3BK 3PO3K 3S1MK 3H3VL 4QIWL 3HOWK 4C3JC 1IW7A 5C4JK 2E2IK 4G7ZA 3S2DC 3M3YC 2A6HA 5IYBK 2JA8K 3S1RC 5IP9C 2R7ZC 4JK1A 2E2HK 2WAQL 3HOYK 4A3JC 2YU9K 1BDFA 2R92C 1Y1VK 4A3LC 5M5XK 4A3LK 4XLNA 3RZDC 2O5IA 3HOZC 3S14K 3S1NC 4OIPA 2YU9C 2NVTC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HKZ L;  5C4J C;  2E2I C;  3I4N C;  4QJV B;  3M4O K;  2R93 K;  1I50 K;  1YNN A;  3S15 C;  5FLM K;  3HOY C;  2VUM C;  3S17 C;  4YFK A;  4KMU A;  4LLG A;  2JA8 C;  3S2D K;  4C2M C;  4A93 K;  1TWC K;  1HQM A;  2A6E A;  3CQZ C;  1Y1W K;  4C3I C;  3PO3 C;  4Y52 K;  5C3E C;  3GTQ K;  4A3C C;  3HOV K;  5IP7 K;  1TWH C;  4A3D C;  5C4X C;  5M3M K;  5FLM C;  3GTK K;  4A3C K;  4OIN A;  4LK1 A;  4A3K C;  4XLP A;  2R93 C;  3S16 K;  3K7A C;  4OIQ A;  1WCM K;  2E2H C;  3GTO K;  1SFO K;  1SFO C;  2WB1 D;  2PPB A;  2NVQ C;  4LK0 A;  4MEX A;  4C3H K;  2NVQ K;  4A3F C;  3GTP K;  4BY7 C;  4KN7 A;  5IYD K;  3GTJ C;  4BY1 K;  2JA7 K;  4A3J K;  3GTK C;  4A3D K;  3HOV C;  1TWG K;  3RZD K;  3FKI C;  4Y7N K;  3HKZ D;  3FKI K;  4A3K K;  2E2J K;  4YFN A;  3S1M C;  4AYB L;  4Q4Z A;  2NVX K;  5IYC C;  4A3M C;  1R9T C;  3S1R K;  1TWA C;  4BBR C;  2B63 C;  4A3G C;  4BY1 C;  2A68 A;  3GTJ K;  2R7Z K;  3S2H K;  4A93 C;  1XPP A;  1TWG C;  3GTP C;  2VUM K;  3S17 K;  3I4M C;  1I3Q K;  2BE5 A;  3HOU K;  4X6A C;  4XSZ A;  3HOZ K;  4OIO A;  3H0G C;  5TMF A;  3S14 C;  2JA6 K;  2JA6 C;  1I50 C;  4KN4 A;  4YG2 A;  1TWH K;  3S2H C;  4A3G K;  4LJZ A;  2NVY C;  3GTG K;  5IYD C;  2NVX C;  4A3F K;  5IP9 K;  3HOU C;  3RZO C;  3PO2 K;  3GTO C;  3CQZ K;  2PMZ D;  2PA8 L;  1I6V A;  1TWC C;  1I3Q C;  4C3I K;  4MEY A;  5M5Y K;  4ZH4 A;  3HOW C;  3HOX C;  4A3E K;  5IP7 C;  2JA7 C;  5TMC A;  3GTM C;  2PA8 D;  5C3E K;  3GTG C;  1K83 C;  4NOI A;  1I6H C;  4OIR A;  1TWF C;  3RZO K;  4Y7N C;  3WOD A;  1WCM C;  3K7A K;  3S1Q K;  5D4D A;  4G7H A;  4GZY A;  1SMY A;  4BY7 K;  3GTQ C;  4G7O A;  4Y52 C;  3I4N K;  3DXJ A;  2NVT K;  2JA5 C;  4BBS C;  4C3J K;  5M3F K;  2CW0 A;  1I6H K;  4X6A K;  5IYB C;  1K83 K;  3S16 C;  4XSX A;  4C2M K;  5IYC K;  4A3M K;  1R9T K;  1TWA K;  4BBR K;  4AYB D;  2B63 K;  2E2J C;  2NVY K;  2O5J A;  3M3Y K;  4A3I K;  5C44 C;  1Y1W C;  3PO2 C;  1YNJ A;  4QIW D;  3GTM K;  1ZYR A;  4A3B C;  2JA5 K;  3S15 K;  4YFX A;  4BBS K;  4BXX K;  2A69 A;  2Y0S L;  2WAQ D;  4QJV A;  4C3H C;  3H0G K;  3S1Q C;  3M4O C;  2WB1 L;  3S1N K;  4MQ9 A;  2PMZ L;  5C44 K;  1TWF K;  5M5W K;  3I4M K;  3H3V D;  5FJ8 K;  4A3I C;  2Y0S D;  5C4X K;  1Y1V C;  3GTL C;  4BXX C;  4Q5S A;  3EQL A;  4A3E C;  3HOX K;  2R92 K;  3GTL K;  4A3B K;  3PO3 K;  3S1M K;  3H3V L;  4QIW L;  3HOW K;  4C3J C;  1IW7 A;  5C4J K;  2E2I K;  4G7Z A;  3S2D C;  3M3Y C;  2A6H A;  5IYB K;  2JA8 K;  3S1R C;  5IP9 C;  2R7Z C;  4JK1 A;  2E2H K;  2WAQ L;  3HOY K;  4A3J C;  2YU9 K;  1BDF A;  2R92 C;  1Y1V K;  4A3L C;  5M5X K;  4A3L K;  4XLN A;  3RZD C;  2O5I A;  3HOZ C;  3S14 K;  3S1N C;  4OIP A;  2YU9 C;  2NVT C; 
#chains in the Genus database with same CATH topology
 2E2I C;  3CQZ A;  3I4N C;  2ZJQ S;  2W7V A;  3S15 C;  1L0W A;  4A93 K;  3A8K A;  2JA8 C;  4C2M C;  1TWC K;  1F9N A;  3G4C A;  3AQP A;  2XCR B;  5IOR A;  3HOV K;  3A8J A;  3L4K A;  5DM6 S;  4LK1 A;  4A3K C;  2E2H C;  1O24 A;  3HXA A;  2PPB A;  1JVI A;  3GTP K;  3PIP S;  2JA7 K;  1KQ4 A;  1RU0 A;  3GTP A;  2RH6 A;  2V6T A;  4YFN A;  1EH1 A;  2NVX K;  1DCO A;  4LR2 A;  4BBR C;  2B63 C;  2R7Z K;  1IBA A;  1J6X A;  2A68 A;  4A93 C;  4FZB A;  1SFO A;  1DD5 A;  3HOZ K;  4WCE S;  4WF9 S;  2JA6 K;  3AD8 C;  5EGE A;  1O26 A;  1I50 C;  1TWC A;  1TWG A;  1V5V A;  1TWH K;  5E68 A;  3MML B;  4IOC S;  4GTA A;  3CQZ K;  1I3Q C;  4MEY A;  2P5M A;  2ZFZ A;  4A3E K;  3LYW A;  3LPX A;  2JA7 C;  3N0C A;  3GTM C;  4C45 A;  3GTG C;  1K83 C;  1WOP A;  1WCM C;  4G7H A;  2GAG C;  4KAW X;  4BY7 K;  3I4N K;  4Y52 C;  3V4G A;  3GTO A;  1J6V A;  2CW0 A;  4GTF A;  5IYB C;  4WFN S;  5IOQ A;  3S16 C;  4C2M K;  1R9T K;  3N3Y A;  2R93 A;  2L5N A;  1VH2 A;  1XXC A;  3GEI A;  3L4J A;  4A3I K;  5DM7 S;  5JVG S;  1Y1W C;  4QIW D;  1XXB A;  3GTM K;  5CHP A;  1WSR A;  2GAH C;  2A69 A;  4KMD A;  2WB1 L;  4LOW A;  4RMF A;  2YU9 A;  3I4M K;  4KAR A;  1PJ6 A;  3GTL C;  4Q5S A;  5HL8 A;  3HOX K;  4A3B K;  4GT9 A;  5EGH A;  2A6H A;  3AH5 A;  1FEU A;  2JA8 K;  2R7Z C;  2WAQ L;  1TWH A;  4PAA A;  3AQO A;  4KM9 A;  4XLN A;  3RZD C;  4G0U A;  3BP3 A;  3S1N C;  3HOV C;  2NVT K;  3HKZ L;  4QJV B;  1YNN A;  3T01 A;  5FLM K;  4LLG A;  3GTM A;  1HQM A;  1WQF A;  2A6E A;  4Y52 K;  3GTQ K;  4KDD A;  1O27 A;  5L46 A;  5IP7 K;  3GTK K;  3GTJ A;  4OIQ A;  1WCM K;  3GTO K;  4DDQ A;  1SFO K;  2WB1 D;  4MEX A;  4A3F C;  1EFW A;  4BY7 C;  5IYD K;  4BY1 K;  1R9T A;  1TWG K;  2B63 A;  3FKI C;  5IOS A;  2E2J K;  1VGX A;  5IYC C;  3GTK A;  1ZQ1 C;  4BY1 C;  3S17 K;  1TWG C;  3ERE D;  1I3Q K;  4P5B A;  4X6A C;  4M1X A;  2PHC B;  1HI9 A;  5TMF A;  1XZP A;  2JA6 C;  4GTE A;  3S2H C;  4A3G K;  4LJZ A;  3GDZ A;  1B4B A;  2NVX C;  1VJE A;  1C0A A;  5IP9 K;  4GTL A;  3RZO C;  1ZVU A;  3PO2 K;  3H0G A;  2PMZ D;  4C3I K;  1O28 A;  5M5Y K;  1WCM A;  2VUM A;  5TMC A;  5C3E K;  1USO A;  1VRQ C;  5IOT A;  4OIR A;  3AD9 C;  2KPU A;  3WOD A;  1UV7 A;  2KWA A;  4GZY A;  4IO9 S;  1J98 A;  2XCO A;  1O29 A;  5M3F K;  1I6H K;  4XSX A;  4A3M K;  4BBR K;  2B63 K;  2NVY K;  2JA5 A;  4P9S A;  3M3Y K;  1PJ5 A;  3GSI A;  4GTD A;  2GSO A;  3S0X A;  2JA5 K;  3S15 K;  4BBS K;  1O2B A;  4U67 S;  2WAQ D;  4C3H C;  1G51 A;  2ZUF A;  3DLL S;  2CFA A;  2KXY A;  3T00 A;  4A3I C;  1I50 A;  2R7Z A;  2NVY A;  2FQO A;  3S1M K;  3HOW K;  4QIW L;  2XCQ A;  3LAJ A;  1IW7 A;  2E2I K;  3S2D C;  3M3Y C;  4ILD A;  3S1R C;  1J6W A;  4KMA A;  1IL2 A;  4A3J C;  1Y1V K;  5M5X K;  1YCL A;  1ZBS A;  3T02 A;  1K83 A;  3S14 K;  4A3C K;  2YU9 C;  3ADA C;  1O2A A;  4BLB A;  5C4J C;  5TJ3 A;  3M4O K;  2RGR A;  3VA7 A;  2R92 A;  4WIL A;  4G0V A;  2VUM C;  2JA7 A;  4KMU A;  2P8T A;  4BLA A;  5JVH S;  1YX2 A;  4GTC A;  1VLO A;  1Y1W K;  4C3I C;  4KB4 A;  3PO3 C;  5C3E C;  4GTB A;  1IE0 A;  1TWH C;  4A3D C;  5M3M K;  1GE9 A;  4KAS A;  2R93 C;  3S16 K;  5HL7 S;  1SFO C;  2NVQ C;  4LK0 A;  1WSV A;  2GSU A;  3SZY A;  4A3J K;  4AH6 A;  3A8I A;  4A3D K;  1O25 A;  4P5A A;  1Y1W A;  3FKI K;  1IQ0 A;  4AYB L;  3GTG K;  4A3M C;  3CAG A;  1TWA C;  3AD7 C;  1XPP A;  2VUM K;  3BP8 C;  3I4M C;  2BE5 A;  2GSN A;  2NVX A;  2V6S A;  4XSZ A;  1EK8 A;  3BUE A;  1Y1V A;  4KN4 A;  4YG2 A;  4G0W A;  3GTQ A;  1BGW A;  4KAT A;  4ZH4 A;  3HOW C;  5IP7 C;  2PA8 D;  2V6U A;  4IOA S;  3K7A K;  5D4D A;  4XCH A;  4GFQ A;  1SMY A;  4G7O A;  3DXJ A;  3TFH A;  2JA5 C;  4BBS C;  1F93 A;  5IYC K;  2E2J C;  2Y3P A;  3ORE A;  2ZJP S;  3TFJ A;  3NUH A;  4WJ4 A;  2L3U A;  4WFA S;  3LAP A;  4YFX A;  4QJV A;  3H0G K;  1WOS A;  1JOE A;  4KB2 A;  2PMZ L;  2D6F C;  1BS2 A;  5M5W K;  5FJ8 K;  2Y0S D;  5C4X K;  2R92 K;  1F7U A;  1XXA A;  1WIH A;  1F7V A;  3H3V L;  1ZXO A;  5IYB K;  2EBB A;  1O2F B;  4JK1 A;  1AB4 A;  3HOY K;  2JA6 A;  1BDF A;  2R92 C;  4A3L C;  3GTG A;  4PAB A;  3HOZ C;  2O5I A;  1TWF A;  4G7Z A;  4OIP A;  2YU9 K;  3GEE A;  1I3Q A;  2R93 K;  1I50 K;  3FHZ A;  1ISE A;  3HOY C;  3S17 C;  3S2D K;  4YFK A;  3TTG A;  3SZZ A;  1DCH A;  2JH3 A;  3CQZ C;  1JQW A;  2E2I A;  1PJ7 A;  3FKI A;  2ZJR S;  3QX3 A;  4A3C C;  1WQH A;  5C4X C;  5FLM C;  4OIN A;  4XLP A;  1INN A;  1XZQ B;  4J3N A;  3K7A C;  4WFB S;  1XZP B;  4LQY A;  1EI6 A;  4C3H K;  2NVQ K;  4KN7 A;  3GTJ C;  3Q3Q A;  3GTK C;  1TWA A;  3RZD K;  3OEP A;  4Y7N K;  3HKZ D;  4A3K K;  3S1M C;  4O2D A;  4Q4Z A;  1R9T C;  3G4A A;  3S1R K;  4A3G C;  3S2H K;  3GTJ K;  3GTP C;  3HOU K;  5CJ9 A;  4KC6 A;  2ZUE A;  4BKW A;  1XZQ A;  4OIO A;  3H0G C;  3S14 C;  3PIO S;  2NVY C;  5IYD C;  4A3F K;  3GEH A;  3HOU C;  3GTO C;  2PA8 L;  1I6V A;  1TWC C;  3HOX C;  3JST A;  1WQG A;  4NOI A;  1I6H C;  1TWF C;  3RZO K;  4Y7N C;  2FQT A;  3S1Q K;  3GIR A;  2CFA B;  3GTQ C;  2E2H A;  4C3J K;  1USM A;  1WOR A;  3OPF A;  4X6A K;  3CF5 S;  1K83 K;  1IS1 A;  1TWA K;  4AYB D;  3GTL A;  2O5J A;  3TFI A;  3FOF A;  5C44 C;  3PO2 C;  1YNJ A;  1ZYR A;  1BJT A;  4A3B C;  4KMH A;  3IPJ A;  5JVO A;  4BXX K;  2Y0S L;  1EQR A;  5JFE A;  3S1Q C;  3M4O C;  3N0B A;  4MQ9 A;  5C44 K;  1TWF K;  3H3V D;  1Y1V C;  4BXX C;  3GTL K;  3EQL A;  4A3E C;  4WJ3 M;  1B4A A;  3FOE A;  3PO3 K;  4KM8 A;  1DCP A;  4C3J C;  2KQ1 A;  1WOO A;  5C4J K;  4FM9 A;  5IP9 C;  1X31 C;  2E2H K;  4A3L K;  5HQH A;  3S1N K;  2NVT C; 
#chains in the Genus database with same CATH homology
 3HKZ L;  5C4J C;  2E2I C;  3I4N C;  4QJV B;  3M4O K;  2R93 K;  1I50 K;  1YNN A;  3S15 C;  5FLM K;  3HOY C;  2VUM C;  3S17 C;  4YFK A;  4KMU A;  4LLG A;  2JA8 C;  3S2D K;  4C2M C;  4A93 K;  1TWC K;  1HQM A;  2A6E A;  3CQZ C;  1Y1W K;  4C3I C;  3PO3 C;  4Y52 K;  5C3E C;  3GTQ K;  4A3C C;  3HOV K;  5IP7 K;  1TWH C;  4A3D C;  5C4X C;  5M3M K;  5FLM C;  3GTK K;  4A3C K;  4OIN A;  4LK1 A;  4A3K C;  4XLP A;  2R93 C;  3S16 K;  3K7A C;  4OIQ A;  1WCM K;  2E2H C;  3GTO K;  1SFO K;  1SFO C;  2WB1 D;  2PPB A;  2NVQ C;  4LK0 A;  4MEX A;  4C3H K;  2NVQ K;  4A3F C;  3GTP K;  4BY7 C;  4KN7 A;  5IYD K;  3GTJ C;  4BY1 K;  2JA7 K;  4A3J K;  3GTK C;  4A3D K;  3HOV C;  1TWG K;  3RZD K;  3FKI C;  4Y7N K;  3HKZ D;  3FKI K;  4A3K K;  2E2J K;  4YFN A;  3S1M C;  4AYB L;  4Q4Z A;  2NVX K;  5IYC C;  4A3M C;  1R9T C;  3S1R K;  1TWA C;  4BBR C;  2B63 C;  4A3G C;  4BY1 C;  2A68 A;  3GTJ K;  2R7Z K;  3S2H K;  4A93 C;  1XPP A;  1TWG C;  3GTP C;  2VUM K;  3S17 K;  3I4M C;  1I3Q K;  2BE5 A;  3HOU K;  4X6A C;  4XSZ A;  3HOZ K;  4OIO A;  3H0G C;  5TMF A;  3S14 C;  2JA6 K;  2JA6 C;  1I50 C;  4KN4 A;  4YG2 A;  1TWH K;  3S2H C;  4A3G K;  4LJZ A;  2NVY C;  3GTG K;  5IYD C;  2NVX C;  4A3F K;  5IP9 K;  3HOU C;  3RZO C;  3PO2 K;  3GTO C;  3CQZ K;  2PMZ D;  2PA8 L;  1I6V A;  1TWC C;  1I3Q C;  4C3I K;  4MEY A;  5M5Y K;  4ZH4 A;  3HOW C;  3HOX C;  4A3E K;  5IP7 C;  2JA7 C;  5TMC A;  3GTM C;  2PA8 D;  5C3E K;  3GTG C;  1K83 C;  4NOI A;  1I6H C;  4OIR A;  1TWF C;  3RZO K;  4Y7N C;  3WOD A;  1WCM C;  3K7A K;  3S1Q K;  5D4D A;  4G7H A;  4GZY A;  1SMY A;  4BY7 K;  3GTQ C;  4G7O A;  4Y52 C;  3I4N K;  3DXJ A;  2NVT K;  2JA5 C;  4BBS C;  4C3J K;  5M3F K;  2CW0 A;  1I6H K;  4X6A K;  5IYB C;  1K83 K;  3S16 C;  4XSX A;  4C2M K;  5IYC K;  4A3M K;  1R9T K;  1TWA K;  4BBR K;  4AYB D;  2B63 K;  2E2J C;  2NVY K;  2O5J A;  3M3Y K;  4A3I K;  5C44 C;  1Y1W C;  3PO2 C;  1YNJ A;  4QIW D;  3GTM K;  1ZYR A;  4A3B C;  2JA5 K;  3S15 K;  4YFX A;  4BBS K;  4BXX K;  2A69 A;  2Y0S L;  2WAQ D;  4QJV A;  4C3H C;  3H0G K;  3S1Q C;  3M4O C;  2WB1 L;  3S1N K;  4MQ9 A;  2PMZ L;  5C44 K;  1TWF K;  5M5W K;  3I4M K;  3H3V D;  5FJ8 K;  4A3I C;  2Y0S D;  5C4X K;  1Y1V C;  3GTL C;  4BXX C;  4Q5S A;  3EQL A;  4A3E C;  3HOX K;  2R92 K;  3GTL K;  4A3B K;  3PO3 K;  3S1M K;  3H3V L;  4QIW L;  3HOW K;  4C3J C;  1IW7 A;  5C4J K;  2E2I K;  4G7Z A;  3S2D C;  3M3Y C;  2A6H A;  5IYB K;  2JA8 K;  3S1R C;  5IP9 C;  2R7Z C;  4JK1 A;  2E2H K;  2WAQ L;  3HOY K;  4A3J C;  2YU9 K;  1BDF A;  2R92 C;  1Y1V K;  4A3L C;  5M5X K;  4A3L K;  4XLN A;  3RZD C;  2O5I A;  3HOZ C;  3S14 K;  3S1N C;  4OIP A;  2YU9 C;  2NVT C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...