2PPBA

Crystal structure of the t. thermophilus rnap polymerase elongation complex with the ntp substrate analog and antibiotic streptolydigin
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
229
structure length
229
Chain Sequence
MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for substrate loading in bacterial RNA polymerase.
pubmed doi rcsb
molecule tags Transferase/dna/rna
molecule keywords DNA (5'-D(P*CP*CP*CP*TP*GP*TP*CP*TP*GP*GP*CP*GP*TP*TP*CP*GP*
total genus 40
structure length 229
sequence length 229
chains with identical sequence B, K, L
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2007-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01000 RNA_pol_A_bac RNA polymerase Rpb3/RpoA insert domain
A PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain
A PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.12 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 DNA-directed RNA polymerase, insert domain 2ppbA02
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 2ppbA01
2R92K 3GTJC 2Y0SL 5C44C 5IYDK 2PMZD 4XLPA 2JA8C 1Y1VC 4A3KC 4MQ9A 3M3YC 3S2DK 4A3IK 4A93C 4A3FK 4C2MK 4OIRA 3GTGK 5D4DA 2E2JC 2WAQD 2B63C 3GTPC 2JA5C 5IP7C 2R7ZC 2JA8K 5C4JC 4XSZA 3GTMC 3HOWC 3HOUK 3M3YK 4MEXA 5M3MK 4A93K 4Y52K 4C3JC 4ZH4A 5M5WK 3PO2C 4G7HA 4A3BC 5IP7K 4A3EK 2R7ZK 4A3CK 3HOUC 1TWAC 3S16K 5M5YK 5TMFA 2NVTK 3H3VL 4LK1A 2E2IC 4C3JK 4A3EC 4A3CC 2JA6C 5M3FK 4GZYA 5C4XK 2NVTC 3CQZK 4BY1K 5C3EC 4BY7K 1TWFC 3S1QK 2E2HC 4C3HK 3GTLK 4QIWD 3S14K 1HQMA 1YNNA 4KN4A 4A3DC 4A3GC 4QJVB 4A3JK 1K83C 2VUMK 4BY1C 3M4OC 4OIPA 1TWFK 2NVXC 2YU9K 4C3HC 3S14C 1TWCC 2O5JA 5IP9C 3S1MK 2VUMC 4Q5SA 3WODA 4AYBL 3GTKK 2WB1D 4YFNA 4BBRC 3S1MC 1TWCK 1WCMC 3S1NC 4BBSK 2A6HA 1TWGC 4OINA 5TMCA 2PA8L 3HKZL 4BBRK 2R92C 3GTJK 3S1RK 4X6AC 2WAQL 5C44K 3S17C 1TWHK 5IYBC 5IYCK 2A6EA 1TWGK 4A3KK 3GTQC 3PO3K 3S2DC 4A3IC 1I50K 4Y7NK 4C2MC 3S15K 3S1RC 2O5IA 2E2JK 2NVQK 3GTPK 1I6HK 1TWHC 3S17K 5IYCC 5IYBK 2CW0A 3I4MK 5C4JK 3PO3C 3GTQK 4NOIA 3GTMK 4G7ZA 1SFOK 1I50C 4Y52C 4Y7NC 4XSXA 3PO2K 1I6HC 4A3BK 5IYDC 3H3VD 1Y1VK 1ZYRA 4A3LK 2Y0SD 2R93K 1TWAK 3HOXC 4A3FC 4LJZA 4QJVA 3GTGC 2E2IK 4YG2A 2B63K 2JA5K 3RZOC 3HOYK 2JA6K 4BXXK 4MEYA 4A3LC 1IW7A 1Y1WK 1BDFA 2R93C 3HOWK 3I4NK 3HOZK 2PMZL 4KN7A 3HOXK 3CQZC 4KMUA 4YFXA 2JA7K 5C3EK 4OIOA 3HOYC 4BXXC 1I3QK 3GTLC 2E2HK 3RZOK 1Y1WC 3I4NC 3FKIK 4A3JC 3S16C 4A3DK 3HOZC 1I6VA 3RZDC 2JA7C 5FLMC 4AYBD 4A3MK 1I3QC 2YU9C 2NVXK 1SMYA 3FKIC 2PA8D 3HOVC 5C4XC 3HKZD 4YFKA 2A68A 3RZDK 4A3MC 4G7OA 4BY7C 5FLMK 4LK0A 3S1QC 5M5XK 2NVYC 4JK1A 1R9TK 3HOVK 4BBSC 1WCMK 4A3GK 4C3IC 1K83K 3K7AC 4QIWL 4LLGA 3DXJA 3H0GK 3M4OK 1XPPA 3S2HC 2NVYK 1R9TC 4XLNA 5IP9K 4C3IK 4X6AK 3K7AK 1YNJA 3GTKC 3H0GC 2A69A 3GTOK 3S2HK 2BE5A 3S15C 3S1NK 4OIQA 2PPBA 2NVQC 2WB1L 5FJ8K 3I4MC 4Q4ZA 3GTOC 3EQLA 1SFOC
chains in the Genus database with same CATH superfamily
2R92K 3GTJC 2E2IA 1PJ7A 3GTKA 1Y1VC 4A93C 1O25A 4A3FK 4C2MK 5JVHS 2WAQD 2JA5C 5IP7C 1O2AA 4BKWA 2XCQA 5C4JC 4XSZA 3QX3A 3M3YK 4KC6A 4A93K 5M3MK 4C3JC 3JSTA 5IP7K 1IL2A 4A3CK 3HOUC 1TWAC 2CFAA 4WJ4A 4A3CC 3TFHA 2VUMA 3GSIA 3CQZK 1B4BA 4BY1K 5C3EC 3H0GA 1TWFC 4C3HK 2EBBA 4A3GC 4A3DC 4QJVB 2VUMK 4FM9A 1K83C 3ERED 3DLLS 4BY1C 4OIPA 4LR2A 1C0AA 1TWCC 3S1MK 5IP9C 1J98A 3AD8C 3WODA 4AYBL 3GTKK 4BBRC 3S1MC 1TWCK 5E68A 1PJ6A 4J3NA 2A6HA 1TWGC 4KM8A 5TMCA 4P5BA 4X6AC 5C44K 4C45A 3MMLB 3VA7A 3LYWA 3L4KA 4A3KK 5TJ3A 3S2DC 4A3IC 4Y7NK 2B63A 2E2JK 1EI6A 1BS2A 4WJ3M 3S17K 2ZFZA 4P9SA 3I4MK 3GTGA 1YCLA 1I50C 1GE9A 3OREA 3PO2K 1YX2A 1I6HC 4WILA 4A3BK 2JA6A 3IPJA 1G51A 4GFQA 2JA5K 3RZOC 3HOYK 2JA6K 3HOZK 1DCHA 4KMUA 2JH3A 3HOYC 1I3QK 3RZOK 1VGXA 1JVIA 2E2HK 1Y1WC 3FKIK 4DDQA 3HOZC 5DM6S 2CFAB 5FLMC 4AYBD 2NVYA 1I3QC 2YU9C 2NVXK 2FQOA 3GEEA 3G4CA 1O2FB 4YFKA 3G4AA 5FLMK 4LK0A 1BGWA 2NVYC 4JK1A 4PABA 4C3IC 4P5AA 3L4JA 1K83K 4U67S 1IQ0A 2R92A 4LOWA 1YNJA 1K83A 3SZZA 1XXAA 5IORA 3GTMA 2PPBA 2NVQC 3NUHA 1ZVUA 1HI9A 1O27A 5FJ8K 4Q4ZA 1SFOC 4GTLA 4IOAS 2Y0SL 4PAAA 4O2DA 4A3IK 2B63C 2JA8K 3HOWC 4MEXA 1VJEA 2V6TA 4G7HA 1VLOA 4A3BC 5M5YK 3H3VL 1ZBSA 2YU9A 2ZJPS 4KARA 4GZYA 5C4XK 1O28A 3S1QK 4G0WA 3Q3QA 1USMA 1HQMA 1YNNA 4KN4A 2R93A 2FQTA 5HQHA 1O26A 3M4OC 1IE0A 3S14C 2O5JA 2V6SA 3CF5S 4YFNA 3AD9C 1WCMC 3FKIA 4FZBA 4BBSK 1TWHA 3FHZA 2PA8L 3HKZL 1SFOA 2R92C 3GTJK 3S1RK 2RH6A 4XCHA 1BJTA 2R7ZA 1TWHK 5IYCK 3OPFA 3GTQC 1F93A 3S15K 4C2MC 2P5MA 3GTPK 4ILDA 2NVQK 1TWHC 5IYCC 2CW0A 5CJ9A 3GTMK 3PO3C 4NOIA 1INNA 3A8JA 2KQ1A 2Y3PA 5IYDC 3LPXA 1J6WA 2GSNA 2R93K 1TWAK 4LJZA 2E2IK 4YG2A 1I50A 2RGRA 5JVOA 2R93C 2XCOA 5C3EK 3GTLC 1O24A 3GIRA 3RZDC 4IOCS 1L0WA 2W7VA 3GEHA 1SMYA 3HOVC 3T01A 5C4XC 3HKZD 2A68A 3RZDK 5M5XK 1WQHA 1R9TK 5JVGS 3H0GK 3DXJA 4KMHA 3M4OK 3S2HC 3S0XA 1TWGA 4X6AK 2ZUFA 1Y1VA 5EGHA 2ZJQS 3GTOK 3S2HK 4OIQA 2ZUEA 1O2BA 1JOEA 4GTAA 4AH6A 2GAGC 3I4MC 1TWCA 3ADAC 3TFJA 4GT9A 4MQ9A 3M3YC 3GTQA 3GTPC 2R7ZC 4G0UA 1WOOA 3GTPA 3GTMC 1WQFA 3HOUK 4KB2A 1XXBA 2R7ZK 4A3EK 1UV7A 3CAGA 1J6XA 4KMAA 2NVTK 2E2IC 4C3JK 4GTBA 1RU0A 4A3EC 1VRQC 4WFAS 5M3FK 1DCOA 2NVTC 3N0CA 2JA5A 4G0VA 3GTLK 3AH5A 4QIWD 4A3JK 1XZQB 3GDZA 1I3QA 4KATA 1TWFK 4C3HC 2ZJRS 2P8TA 1Y1WA 2VUMC 2KWAA 3S1NC 1J6VA 1EK8A 4GTCA 5IOSA 4OINA 1WIHA 4WFNS 4BBRK 3S17C 1TWGK 4KB4A 1I50K 1JQWA 2O5IA 1EFWA 1I6HK 1WSRA 3HOWK 4G7ZA 4Y7NC 4Y52C 1Y1VK 1ZYRA 4A3LK 2Y0SD 4GTDA 1ZXOA 2KXYA 3HOXC 4A3FC 4QJVA 5JFEA 1EQRA 3BP3A 4BXXK 1F9NA 4A3LC 1Y1WK 3BP8C 2PMZL 4KN7A 3HOXK 4YFXA 1O29A 1F7VA 4BXXC 1WORA 4KAWX 1XZPA 1I6VA 3FOFA 3N3YA 3CQZA 4A3MK 1ISEA 1WCMA 3FKIC 2PA8D 4IO9S 2KPUA 3TTGA 4A3MC 4G7OA 3GEIA 2JA7A 1WOSA 4WFBS 4BBSC 1WCMK 1ZQ1C 4A3GK 3A8IA 3T02A 1XPPA 2NVYK 5IP9K 4C3IK 1AB4A 3GTKC 1TWFA 2E2HA 5EGEA 2A69A 3S15C 3S1NK 5CHPA 3AQPA 2GSUA 5C44C 5IYDK 2PMZD 4XLPA 2JA8C 3GTJA 2GSOA 4A3KC 2XCRB 1VH2A 3OEPA 1R9TA 3S2DK 3GTGK 4OIRA 3BUEA 5D4DA 2E2JC 4GTFA 1WOPA 1KQ4A 4Y52K 4ZH4A 5M5WK 3PO2C 1DCPA 3PIOS 4KM9A 3AQOA 3S16K 5TMFA 4LK1A 2GAHC 4WCES 2JA6C 3LAJA 3FOEA 2NVXA 4BY7K 2E2HC 3S14K 4WF9S 1EH1A 2NVXC 3TFIA 2YU9K 5DM7S 1WSVA 4Q5SA 1B4AA 2WB1D 3HXAA 2L3UA 3GTOA 5IOTA 4BLAA 1DD5A 2WAQL 5IYBC 2A6EA 3PO3K 3SZYA 3S1RC 2L5NA 3AD7C 5IYBK 3LAPA 2D6FC 5C4JK 3GTQK 1SFOK 1FEUA 4XSXA 3H3VD 4RMFA 1PJ5A 3GTGC 4KASA 2B63K 4MEYA 3I4NK 1IW7A 1BDFA 1F7UA 2PHCB 3CQZC 5L46A 2JA7K 4OIOA 3I4NC 4A3JC 3S16C 4A3DK 4KMDA 3N0BA 2JA7C 1XXCA 4GTEA 4LQYA 1WQGA 1XZQA 4BY7C 1X31C 3S1QC 2V6UA 4BLBA 1V5VA 3HOVK 3PIPS 1IS1A 3T00A 3K7AC 4QIWL 4LLGA 5HL7S 3A8KA 3GTLA 1R9TC 4XLNA 3V4GA 3K7AK 4KDDA 3H0GC 1IBAA 2BE5A 5HL8A 4M1XA 2WB1L 1XZPB 5IOQA 1USOA 3GTOC 3EQLA 1TWAA
chains in the Genus database with same CATH topology
2R92K 3GTJC 2Y0SL 5C44C 5IYDK 2PMZD 4XLPA 2JA8C 1Y1VC 4A3KC 4MQ9A 3M3YC 3S2DK 4A3IK 4A93C 4A3FK 4C2MK 4OIRA 3GTGK 5D4DA 2E2JC 2WAQD 2B63C 3GTPC 2JA5C 5IP7C 2R7ZC 2JA8K 5C4JC 4XSZA 3GTMC 3HOWC 3HOUK 3M3YK 4MEXA 5M3MK 4A93K 4Y52K 4C3JC 4ZH4A 5M5WK 3PO2C 4G7HA 4A3BC 5IP7K 4A3EK 2R7ZK 4A3CK 3HOUC 1TWAC 3S16K 5M5YK 5TMFA 2NVTK 3H3VL 4LK1A 2E2IC 4C3JK 4A3EC 4A3CC 2JA6C 5M3FK 4GZYA 5C4XK 2NVTC 3CQZK 4BY1K 5C3EC 4BY7K 1TWFC 3S1QK 2E2HC 4C3HK 3GTLK 4QIWD 3S14K 1HQMA 1YNNA 4KN4A 4A3DC 4A3GC 4QJVB 4A3JK 1K83C 2VUMK 4BY1C 3M4OC 4OIPA 1TWFK 2NVXC 2YU9K 4C3HC 3S14C 1TWCC 2O5JA 5IP9C 3S1MK 2VUMC 4Q5SA 3WODA 4AYBL 3GTKK 2WB1D 4YFNA 4BBRC 3S1MC 1TWCK 1WCMC 3S1NC 4BBSK 2A6HA 1TWGC 4OINA 5TMCA 2PA8L 3HKZL 4BBRK 2R92C 3GTJK 3S1RK 4X6AC 2WAQL 5C44K 3S17C 1TWHK 5IYBC 5IYCK 2A6EA 1TWGK 4A3KK 3GTQC 3PO3K 3S2DC 4A3IC 1I50K 4Y7NK 4C2MC 3S15K 3S1RC 2O5IA 2E2JK 2NVQK 3GTPK 1I6HK 1TWHC 3S17K 5IYCC 5IYBK 2CW0A 3I4MK 5C4JK 3PO3C 3GTQK 4NOIA 3GTMK 4G7ZA 1SFOK 1I50C 4Y52C 4Y7NC 4XSXA 3PO2K 1I6HC 4A3BK 5IYDC 3H3VD 1Y1VK 1ZYRA 4A3LK 2Y0SD 2R93K 1TWAK 3HOXC 4A3FC 4LJZA 4QJVA 3GTGC 2E2IK 4YG2A 2B63K 2JA5K 3RZOC 3HOYK 2JA6K 4BXXK 4MEYA 4A3LC 1IW7A 1Y1WK 1BDFA 2R93C 3HOWK 3I4NK 3HOZK 2PMZL 4KN7A 3HOXK 3CQZC 4KMUA 4YFXA 2JA7K 5C3EK 4OIOA 3HOYC 4BXXC 1I3QK 3GTLC 2E2HK 3RZOK 1Y1WC 3I4NC 3FKIK 4A3JC 3S16C 4A3DK 3HOZC 1I6VA 3RZDC 2JA7C 5FLMC 4AYBD 4A3MK 1I3QC 2YU9C 2NVXK 1SMYA 3FKIC 2PA8D 3HOVC 5C4XC 3HKZD 4YFKA 2A68A 3RZDK 4A3MC 4G7OA 4BY7C 5FLMK 4LK0A 3S1QC 5M5XK 2NVYC 4JK1A 1R9TK 3HOVK 4BBSC 1WCMK 4A3GK 4C3IC 1K83K 3K7AC 4QIWL 4LLGA 3DXJA 3H0GK 3M4OK 1XPPA 3S2HC 2NVYK 1R9TC 4XLNA 5IP9K 4C3IK 4X6AK 3K7AK 1YNJA 3GTKC 3H0GC 2A69A 3GTOK 3S2HK 2BE5A 3S15C 3S1NK 4OIQA 2PPBA 2NVQC 2WB1L 5FJ8K 3I4MC 4Q4ZA 3GTOC 3EQLA 1SFOC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R92 K;  3GTJ C;  2Y0S L;  5C44 C;  5IYD K;  2PMZ D;  4XLP A;  2JA8 C;  1Y1V C;  4A3K C;  4MQ9 A;  3M3Y C;  3S2D K;  4A3I K;  4A93 C;  4A3F K;  4C2M K;  4OIR A;  3GTG K;  5D4D A;  2E2J C;  2WAQ D;  2B63 C;  3GTP C;  2JA5 C;  5IP7 C;  2R7Z C;  2JA8 K;  5C4J C;  4XSZ A;  3GTM C;  3HOW C;  3HOU K;  3M3Y K;  4MEX A;  5M3M K;  4A93 K;  4Y52 K;  4C3J C;  4ZH4 A;  5M5W K;  3PO2 C;  4G7H A;  4A3B C;  5IP7 K;  4A3E K;  2R7Z K;  4A3C K;  3HOU C;  1TWA C;  3S16 K;  5M5Y K;  5TMF A;  2NVT K;  3H3V L;  4LK1 A;  2E2I C;  4C3J K;  4A3E C;  4A3C C;  2JA6 C;  5M3F K;  4GZY A;  5C4X K;  2NVT C;  3CQZ K;  4BY1 K;  5C3E C;  4BY7 K;  1TWF C;  3S1Q K;  2E2H C;  4C3H K;  3GTL K;  4QIW D;  3S14 K;  1HQM A;  1YNN A;  4KN4 A;  4A3D C;  4A3G C;  4QJV B;  4A3J K;  1K83 C;  2VUM K;  4BY1 C;  3M4O C;  4OIP A;  1TWF K;  2NVX C;  2YU9 K;  4C3H C;  3S14 C;  1TWC C;  2O5J A;  5IP9 C;  3S1M K;  2VUM C;  4Q5S A;  3WOD A;  4AYB L;  3GTK K;  2WB1 D;  4YFN A;  4BBR C;  3S1M C;  1TWC K;  1WCM C;  3S1N C;  4BBS K;  2A6H A;  1TWG C;  4OIN A;  5TMC A;  2PA8 L;  3HKZ L;  4BBR K;  2R92 C;  3GTJ K;  3S1R K;  4X6A C;  2WAQ L;  5C44 K;  3S17 C;  1TWH K;  5IYB C;  5IYC K;  2A6E A;  1TWG K;  4A3K K;  3GTQ C;  3PO3 K;  3S2D C;  4A3I C;  1I50 K;  4Y7N K;  4C2M C;  3S15 K;  3S1R C;  2O5I A;  2E2J K;  2NVQ K;  3GTP K;  1I6H K;  1TWH C;  3S17 K;  5IYC C;  5IYB K;  2CW0 A;  3I4M K;  5C4J K;  3PO3 C;  3GTQ K;  4NOI A;  3GTM K;  4G7Z A;  1SFO K;  1I50 C;  4Y52 C;  4Y7N C;  4XSX A;  3PO2 K;  1I6H C;  4A3B K;  5IYD C;  3H3V D;  1Y1V K;  1ZYR A;  4A3L K;  2Y0S D;  2R93 K;  1TWA K;  3HOX C;  4A3F C;  4LJZ A;  4QJV A;  3GTG C;  2E2I K;  4YG2 A;  2B63 K;  2JA5 K;  3RZO C;  3HOY K;  2JA6 K;  4BXX K;  4MEY A;  4A3L C;  1IW7 A;  1Y1W K;  1BDF A;  2R93 C;  3HOW K;  3I4N K;  3HOZ K;  2PMZ L;  4KN7 A;  3HOX K;  3CQZ C;  4KMU A;  4YFX A;  2JA7 K;  5C3E K;  4OIO A;  3HOY C;  4BXX C;  1I3Q K;  3GTL C;  2E2H K;  3RZO K;  1Y1W C;  3I4N C;  3FKI K;  4A3J C;  3S16 C;  4A3D K;  3HOZ C;  1I6V A;  3RZD C;  2JA7 C;  5FLM C;  4AYB D;  4A3M K;  1I3Q C;  2YU9 C;  2NVX K;  1SMY A;  3FKI C;  2PA8 D;  3HOV C;  5C4X C;  3HKZ D;  4YFK A;  2A68 A;  3RZD K;  4A3M C;  4G7O A;  4BY7 C;  5FLM K;  4LK0 A;  3S1Q C;  5M5X K;  2NVY C;  4JK1 A;  1R9T K;  3HOV K;  4BBS C;  1WCM K;  4A3G K;  4C3I C;  1K83 K;  3K7A C;  4QIW L;  4LLG A;  3DXJ A;  3H0G K;  3M4O K;  1XPP A;  3S2H C;  2NVY K;  1R9T C;  4XLN A;  5IP9 K;  4C3I K;  4X6A K;  3K7A K;  1YNJ A;  3GTK C;  3H0G C;  2A69 A;  3GTO K;  3S2H K;  2BE5 A;  3S15 C;  3S1N K;  4OIQ A;  2PPB A;  2NVQ C;  2WB1 L;  5FJ8 K;  3I4M C;  4Q4Z A;  3GTO C;  3EQL A;  1SFO C; 
#chains in the Genus database with same CATH topology
 2R92 K;  3GTJ C;  2E2I A;  1PJ7 A;  3GTK A;  1Y1V C;  4A93 C;  1O25 A;  4A3F K;  4C2M K;  5JVH S;  2WAQ D;  2JA5 C;  5IP7 C;  1O2A A;  4BKW A;  2XCQ A;  5C4J C;  4XSZ A;  3QX3 A;  3M3Y K;  4KC6 A;  4A93 K;  5M3M K;  4C3J C;  3JST A;  5IP7 K;  1IL2 A;  4A3C K;  3HOU C;  1TWA C;  2CFA A;  4WJ4 A;  4A3C C;  3TFH A;  2VUM A;  3GSI A;  3CQZ K;  1B4B A;  4BY1 K;  5C3E C;  3H0G A;  1TWF C;  4C3H K;  2EBB A;  4A3G C;  4A3D C;  4QJV B;  2VUM K;  4FM9 A;  1K83 C;  3ERE D;  3DLL S;  4BY1 C;  4OIP A;  4LR2 A;  1C0A A;  1TWC C;  3S1M K;  5IP9 C;  1J98 A;  3AD8 C;  3WOD A;  4AYB L;  3GTK K;  4BBR C;  3S1M C;  1TWC K;  5E68 A;  1PJ6 A;  4J3N A;  2A6H A;  1TWG C;  4KM8 A;  5TMC A;  4P5B A;  4X6A C;  5C44 K;  4C45 A;  3MML B;  3VA7 A;  3LYW A;  3L4K A;  4A3K K;  5TJ3 A;  3S2D C;  4A3I C;  4Y7N K;  2B63 A;  2E2J K;  1EI6 A;  1BS2 A;  4WJ3 M;  3S17 K;  2ZFZ A;  4P9S A;  3I4M K;  3GTG A;  1YCL A;  1I50 C;  1GE9 A;  3ORE A;  3PO2 K;  1YX2 A;  1I6H C;  4WIL A;  4A3B K;  2JA6 A;  3IPJ A;  1G51 A;  4GFQ A;  2JA5 K;  3RZO C;  3HOY K;  2JA6 K;  3HOZ K;  1DCH A;  4KMU A;  2JH3 A;  3HOY C;  1I3Q K;  3RZO K;  1VGX A;  1JVI A;  2E2H K;  1Y1W C;  3FKI K;  4DDQ A;  3HOZ C;  5DM6 S;  2CFA B;  5FLM C;  4AYB D;  2NVY A;  1I3Q C;  2YU9 C;  2NVX K;  2FQO A;  3GEE A;  3G4C A;  1O2F B;  4YFK A;  3G4A A;  5FLM K;  4LK0 A;  1BGW A;  2NVY C;  4JK1 A;  4PAB A;  4C3I C;  4P5A A;  3L4J A;  1K83 K;  4U67 S;  1IQ0 A;  2R92 A;  4LOW A;  1YNJ A;  1K83 A;  3SZZ A;  1XXA A;  5IOR A;  3GTM A;  2PPB A;  2NVQ C;  3NUH A;  1ZVU A;  1HI9 A;  1O27 A;  5FJ8 K;  4Q4Z A;  1SFO C;  4GTL A;  4IOA S;  2Y0S L;  4PAA A;  4O2D A;  4A3I K;  2B63 C;  2JA8 K;  3HOW C;  4MEX A;  1VJE A;  2V6T A;  4G7H A;  1VLO A;  4A3B C;  5M5Y K;  3H3V L;  1ZBS A;  2YU9 A;  2ZJP S;  4KAR A;  4GZY A;  5C4X K;  1O28 A;  3S1Q K;  4G0W A;  3Q3Q A;  1USM A;  1HQM A;  1YNN A;  4KN4 A;  2R93 A;  2FQT A;  5HQH A;  1O26 A;  3M4O C;  1IE0 A;  3S14 C;  2O5J A;  2V6S A;  3CF5 S;  4YFN A;  3AD9 C;  1WCM C;  3FKI A;  4FZB A;  4BBS K;  1TWH A;  3FHZ A;  2PA8 L;  3HKZ L;  1SFO A;  2R92 C;  3GTJ K;  3S1R K;  2RH6 A;  4XCH A;  1BJT A;  2R7Z A;  1TWH K;  5IYC K;  3OPF A;  3GTQ C;  1F93 A;  3S15 K;  4C2M C;  2P5M A;  3GTP K;  4ILD A;  2NVQ K;  1TWH C;  5IYC C;  2CW0 A;  5CJ9 A;  3GTM K;  3PO3 C;  4NOI A;  1INN A;  3A8J A;  2KQ1 A;  2Y3P A;  5IYD C;  3LPX A;  1J6W A;  2GSN A;  2R93 K;  1TWA K;  4LJZ A;  2E2I K;  4YG2 A;  1I50 A;  2RGR A;  5JVO A;  2R93 C;  2XCO A;  5C3E K;  3GTL C;  1O24 A;  3GIR A;  3RZD C;  4IOC S;  1L0W A;  2W7V A;  3GEH A;  1SMY A;  3HOV C;  3T01 A;  5C4X C;  3HKZ D;  2A68 A;  3RZD K;  5M5X K;  1WQH A;  1R9T K;  5JVG S;  3H0G K;  3DXJ A;  4KMH A;  3M4O K;  3S2H C;  3S0X A;  1TWG A;  4X6A K;  2ZUF A;  1Y1V A;  5EGH A;  2ZJQ S;  3GTO K;  3S2H K;  4OIQ A;  2ZUE A;  1O2B A;  1JOE A;  4GTA A;  4AH6 A;  2GAG C;  3I4M C;  1TWC A;  3ADA C;  3TFJ A;  4GT9 A;  4MQ9 A;  3M3Y C;  3GTQ A;  3GTP C;  2R7Z C;  4G0U A;  1WOO A;  3GTP A;  3GTM C;  1WQF A;  3HOU K;  4KB2 A;  1XXB A;  2R7Z K;  4A3E K;  1UV7 A;  3CAG A;  1J6X A;  4KMA A;  2NVT K;  2E2I C;  4C3J K;  4GTB A;  1RU0 A;  4A3E C;  1VRQ C;  4WFA S;  5M3F K;  1DCO A;  2NVT C;  3N0C A;  2JA5 A;  4G0V A;  3GTL K;  3AH5 A;  4QIW D;  4A3J K;  1XZQ B;  3GDZ A;  1I3Q A;  4KAT A;  1TWF K;  4C3H C;  2ZJR S;  2P8T A;  1Y1W A;  2VUM C;  2KWA A;  3S1N C;  1J6V A;  1EK8 A;  4GTC A;  5IOS A;  4OIN A;  1WIH A;  4WFN S;  4BBR K;  3S17 C;  1TWG K;  4KB4 A;  1I50 K;  1JQW A;  2O5I A;  1EFW A;  1I6H K;  1WSR A;  3HOW K;  4G7Z A;  4Y7N C;  4Y52 C;  1Y1V K;  1ZYR A;  4A3L K;  2Y0S D;  4GTD A;  1ZXO A;  2KXY A;  3HOX C;  4A3F C;  4QJV A;  5JFE A;  1EQR A;  3BP3 A;  4BXX K;  1F9N A;  4A3L C;  1Y1W K;  3BP8 C;  2PMZ L;  4KN7 A;  3HOX K;  4YFX A;  1O29 A;  1F7V A;  4BXX C;  1WOR A;  4KAW X;  1XZP A;  1I6V A;  3FOF A;  3N3Y A;  3CQZ A;  4A3M K;  1ISE A;  1WCM A;  3FKI C;  2PA8 D;  4IO9 S;  2KPU A;  3TTG A;  4A3M C;  4G7O A;  3GEI A;  2JA7 A;  1WOS A;  4WFB S;  4BBS C;  1WCM K;  1ZQ1 C;  4A3G K;  3A8I A;  3T02 A;  1XPP A;  2NVY K;  5IP9 K;  4C3I K;  1AB4 A;  3GTK C;  1TWF A;  2E2H A;  5EGE A;  2A69 A;  3S15 C;  3S1N K;  5CHP A;  3AQP A;  2GSU A;  5C44 C;  5IYD K;  2PMZ D;  4XLP A;  2JA8 C;  3GTJ A;  2GSO A;  4A3K C;  2XCR B;  1VH2 A;  3OEP A;  1R9T A;  3S2D K;  3GTG K;  4OIR A;  3BUE A;  5D4D A;  2E2J C;  4GTF A;  1WOP A;  1KQ4 A;  4Y52 K;  4ZH4 A;  5M5W K;  3PO2 C;  1DCP A;  3PIO S;  4KM9 A;  3AQO A;  3S16 K;  5TMF A;  4LK1 A;  2GAH C;  4WCE S;  2JA6 C;  3LAJ A;  3FOE A;  2NVX A;  4BY7 K;  2E2H C;  3S14 K;  4WF9 S;  1EH1 A;  2NVX C;  3TFI A;  2YU9 K;  5DM7 S;  1WSV A;  4Q5S A;  1B4A A;  2WB1 D;  3HXA A;  2L3U A;  3GTO A;  5IOT A;  4BLA A;  1DD5 A;  2WAQ L;  5IYB C;  2A6E A;  3PO3 K;  3SZY A;  3S1R C;  2L5N A;  3AD7 C;  5IYB K;  3LAP A;  2D6F C;  5C4J K;  3GTQ K;  1SFO K;  1FEU A;  4XSX A;  3H3V D;  4RMF A;  1PJ5 A;  3GTG C;  4KAS A;  2B63 K;  4MEY A;  3I4N K;  1IW7 A;  1BDF A;  1F7U A;  2PHC B;  3CQZ C;  5L46 A;  2JA7 K;  4OIO A;  3I4N C;  4A3J C;  3S16 C;  4A3D K;  4KMD A;  3N0B A;  2JA7 C;  1XXC A;  4GTE A;  4LQY A;  1WQG A;  1XZQ A;  4BY7 C;  1X31 C;  3S1Q C;  2V6U A;  4BLB A;  1V5V A;  3HOV K;  3PIP S;  1IS1 A;  3T00 A;  3K7A C;  4QIW L;  4LLG A;  5HL7 S;  3A8K A;  3GTL A;  1R9T C;  4XLN A;  3V4G A;  3K7A K;  4KDD A;  3H0G C;  1IBA A;  2BE5 A;  5HL8 A;  4M1X A;  2WB1 L;  1XZP B;  5IOQ A;  1USO A;  3GTO C;  3EQL A;  1TWA A; 
#chains in the Genus database with same CATH homology
 2R92 K;  3GTJ C;  2Y0S L;  5C44 C;  5IYD K;  2PMZ D;  4XLP A;  2JA8 C;  1Y1V C;  4A3K C;  4MQ9 A;  3M3Y C;  3S2D K;  4A3I K;  4A93 C;  4A3F K;  4C2M K;  4OIR A;  3GTG K;  5D4D A;  2E2J C;  2WAQ D;  2B63 C;  3GTP C;  2JA5 C;  5IP7 C;  2R7Z C;  2JA8 K;  5C4J C;  4XSZ A;  3GTM C;  3HOW C;  3HOU K;  3M3Y K;  4MEX A;  5M3M K;  4A93 K;  4Y52 K;  4C3J C;  4ZH4 A;  5M5W K;  3PO2 C;  4G7H A;  4A3B C;  5IP7 K;  4A3E K;  2R7Z K;  4A3C K;  3HOU C;  1TWA C;  3S16 K;  5M5Y K;  5TMF A;  2NVT K;  3H3V L;  4LK1 A;  2E2I C;  4C3J K;  4A3E C;  4A3C C;  2JA6 C;  5M3F K;  4GZY A;  5C4X K;  2NVT C;  3CQZ K;  4BY1 K;  5C3E C;  4BY7 K;  1TWF C;  3S1Q K;  2E2H C;  4C3H K;  3GTL K;  4QIW D;  3S14 K;  1HQM A;  1YNN A;  4KN4 A;  4A3D C;  4A3G C;  4QJV B;  4A3J K;  1K83 C;  2VUM K;  4BY1 C;  3M4O C;  4OIP A;  1TWF K;  2NVX C;  2YU9 K;  4C3H C;  3S14 C;  1TWC C;  2O5J A;  5IP9 C;  3S1M K;  2VUM C;  4Q5S A;  3WOD A;  4AYB L;  3GTK K;  2WB1 D;  4YFN A;  4BBR C;  3S1M C;  1TWC K;  1WCM C;  3S1N C;  4BBS K;  2A6H A;  1TWG C;  4OIN A;  5TMC A;  2PA8 L;  3HKZ L;  4BBR K;  2R92 C;  3GTJ K;  3S1R K;  4X6A C;  2WAQ L;  5C44 K;  3S17 C;  1TWH K;  5IYB C;  5IYC K;  2A6E A;  1TWG K;  4A3K K;  3GTQ C;  3PO3 K;  3S2D C;  4A3I C;  1I50 K;  4Y7N K;  4C2M C;  3S15 K;  3S1R C;  2O5I A;  2E2J K;  2NVQ K;  3GTP K;  1I6H K;  1TWH C;  3S17 K;  5IYC C;  5IYB K;  2CW0 A;  3I4M K;  5C4J K;  3PO3 C;  3GTQ K;  4NOI A;  3GTM K;  4G7Z A;  1SFO K;  1I50 C;  4Y52 C;  4Y7N C;  4XSX A;  3PO2 K;  1I6H C;  4A3B K;  5IYD C;  3H3V D;  1Y1V K;  1ZYR A;  4A3L K;  2Y0S D;  2R93 K;  1TWA K;  3HOX C;  4A3F C;  4LJZ A;  4QJV A;  3GTG C;  2E2I K;  4YG2 A;  2B63 K;  2JA5 K;  3RZO C;  3HOY K;  2JA6 K;  4BXX K;  4MEY A;  4A3L C;  1IW7 A;  1Y1W K;  1BDF A;  2R93 C;  3HOW K;  3I4N K;  3HOZ K;  2PMZ L;  4KN7 A;  3HOX K;  3CQZ C;  4KMU A;  4YFX A;  2JA7 K;  5C3E K;  4OIO A;  3HOY C;  4BXX C;  1I3Q K;  3GTL C;  2E2H K;  3RZO K;  1Y1W C;  3I4N C;  3FKI K;  4A3J C;  3S16 C;  4A3D K;  3HOZ C;  1I6V A;  3RZD C;  2JA7 C;  5FLM C;  4AYB D;  4A3M K;  1I3Q C;  2YU9 C;  2NVX K;  1SMY A;  3FKI C;  2PA8 D;  3HOV C;  5C4X C;  3HKZ D;  4YFK A;  2A68 A;  3RZD K;  4A3M C;  4G7O A;  4BY7 C;  5FLM K;  4LK0 A;  3S1Q C;  5M5X K;  2NVY C;  4JK1 A;  1R9T K;  3HOV K;  4BBS C;  1WCM K;  4A3G K;  4C3I C;  1K83 K;  3K7A C;  4QIW L;  4LLG A;  3DXJ A;  3H0G K;  3M4O K;  1XPP A;  3S2H C;  2NVY K;  1R9T C;  4XLN A;  5IP9 K;  4C3I K;  4X6A K;  3K7A K;  1YNJ A;  3GTK C;  3H0G C;  2A69 A;  3GTO K;  3S2H K;  2BE5 A;  3S15 C;  3S1N K;  4OIQ A;  2PPB A;  2NVQ C;  2WB1 L;  5FJ8 K;  3I4M C;  4Q4Z A;  3GTO C;  3EQL A;  1SFO C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...