2PPBA

Crystal structure of the t. thermophilus rnap polymerase elongation complex with the ntp substrate analog and antibiotic streptolydigin
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
229
structure length
229
Chain Sequence
MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna/rna
molecule keywords DNA (5'-D(P*CP*CP*CP*TP*GP*TP*CP*TP*GP*GP*CP*GP*TP*TP*CP*GP*
publication title Structural basis for substrate loading in bacterial RNA polymerase.
pubmed doi rcsb
total genus 40
structure length 229
sequence length 229
chains with identical sequence B, K, L
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2007-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01000 RNA_pol_A_bac RNA polymerase Rpb3/RpoA insert domain
A PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain
A PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.12 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 DNA-directed RNA polymerase, insert domain 2ppbA02
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 2ppbA01
5C44C 1YNNA 3HOUK 4NOIA 3S1RC 2WAQL 2PA8L 1K83C 4JK1A 2WAQD 1R9TK 2PA8D 5M3FK 4Y52K 3HOYC 3GTQK 3HKZL 3I4MC 4YG2A 4A3BC 3HKZD 2R7ZK 1I50C 3GTLC 5IYDK 4C3IK 4BBRK 4KN4A 3GTJC 1TWFC 5C4JC 3I4NC 4A93C 3S14K 4C3HK 2O5IA 2NVYK 4AYBL 5IYBC 4Y7NK 2VUMK 4X6AC 1Y1WK 3M4OK 4A3CK 3FKIK 3S2HC 4G7OA 2JA6K 4A3IK 3S1NK 3K7AK 2A6EA 5FJ8K 4GZYA 4OIRA 3S2DC 3H3VL 4XSXA 5M5XK 4A3DC 4BY1K 3HOUC 1TWAC 2YU9K 2PPBA 2R93K 4A3MC 3S15K 4MEXA 4Y52C 1TWGK 3GTGK 4OIOA 5IP9K 4XLNA 3HOZC 3S16C 3M3YC 4C3IC 1TWHK 2JA7K 2A68A 2PMZD 4MEYA 3GTPK 1SFOK 3S14C 5TMCA 2R92K 3S1QK 3PO3K 4XSZA 4C3HC 1YNJA 1Y1VK 5C3EK 1TWCK 2VUMC 5M5WK 4LK1A 4A3GC 3RZOK 3FKIC 4BY7C 4QIWL 4QJVA 4QIWD 2JA6C 2A6HA 1XPPA 4A3IC 3S1NC 3K7AC 3PO2C 4G7ZA 4A3FC 5IYCK 1I3QK 2B63K 4OIPA 2NVXC 4YFKA 5IP7K 4A3EK 2NVQK 4BBSK 1WCMK 4A3LC 4BY1C 2YU9C 2E2HK 2R93C 3CQZK 2Y0SD 3HOWC 4C2MC 4G7HA 3PO3C 3RZDC 3S17C 3S15C 1SMYA 4QJVB 3GTMK 1TWGC 3GTGC 4Q5SA 3GTKK 5IP9C 1IW7A 1R9TC 1TWHC 2JA7C 4XLPA 3GTQC 3S1RK 1SFOC 1I6VA 2R7ZC 5IYDC 5C3EC 2PMZL 4BBRC 3HOYK 3RZOC 4OINA 3I4MK 2JA5K 4LK0A 3GTOK 2JA8K 1I50K 4YFXA 2NVYC 4MQ9A 4Y7NC 3M4OC 4C3JK 1Y1WC 3WODA 2BE5A 2B63C 1I3QC 4A3CC 5FLMK 4KMUA 5C4JK 4A93K 5IP7C 2NVQC 4BBSC 5M5YK 3HOVK 2NVTK 4LJZA 4A3JK 4KN7A 3S2HK 2E2HC 4A3KK 2O5JA 3HOXK 1I6HK 1HQMA 3GTKC 3S2DK 2Y0SL 2E2JK 4BXXK 3S1MK 4A3DK 2E2IK 1TWAK 4A3MK 3H0GK 5C4XK 2A69A 5C44K 5TMFA 2JA5C 4OIQA 2R92C 3GTOC 2JA8C 3GTPC 3S1QC 1K83K 1Y1VC 3HOZK 3M3YK 4C3JC 3S16K 1TWCC 1ZYRA 4A3BK 4LLGA 5FLMC 3EQLA 4YFNA 3GTLK 3HOVC 4AYBD 4A3JC 2NVTC 4A3GK 3GTJK 4BY7K 2WB1L 5IYCC 1TWFK 4A3KC 2WB1D 3I4NK 3HOXC 3DXJA 5D4DA 4A3EC 1I6HC 1WCMC 5IYBK 3PO2K 4ZH4A 4A3FK 4X6AK 3CQZC 2E2JC 4Q4ZA 2CW0A 4BXXC 3H3VD 5C4XC 2NVXK 4A3LK 3GTMC 1BDFA 2E2IC 3S1MC 5M3MK 3S17K 3HOWK 4C2MK 3H0GC 3RZDK
chains in the Genus database with same CATH superfamily
1F9NA 3HOUK 3N0BA 4YG2A 4A3BC 5TJ3A 3TFJA 3GTMA 2V6UA 1B4BA 2R7ZK 3I4NC 4A93C 3S14K 3GSIA 1INNA 5IYBC 1K83A 1JQWA 3M4OK 3FKIK 4P5BA 2ZUEA 2JA6K 3S1NK 5CJ9A 3GTLA 3S2DC 4G0VA 1TWFA 4LOWA 4A3DC 3CF5S 4BLBA 4A3MC 1DCHA 4MEXA 1XZPA 3M3YC 1TWHK 2A68A 1WIHA 1SFOK 5TMCA 5IOQA 1XZQA 3S1QK 4C3HC 2E2IA 5C3EK 1FEUA 1O2BA 1EI6A 1KQ4A 1DCPA 4A3IC 3G4CA 2B63K 2NVXC 4YFKA 3LPXA 3Q3QA 1O25A 2ZUFA 4A3LC 2CFAA 3A8JA 2YU9C 3CQZK 3PO3C 3S15C 1VLOA 4GTAA 4WFAS 4BKWA 3GTGC 4Q5SA 2D6FC 5IP9C 1IW7A 1X31C 4XLPA 1IS1A 2PMZL 4BBRC 1DD5A 3RZOC 4OINA 1O2AA 2JA5K 4LK0A 1TWGA 3GTOK 1HI9A 2JA7A 4A93K 4GTDA 3GTQA 3GEIA 3HOVK 4A3JK 2XCOA 4WJ3M 1HQMA 3S2DK 2NVYA 3NUHA 1Y1WA 1PJ7A 4GTCA 4A3DK 4A3MK 4WFNS 2E2HA 3A8IA 5EGEA 3T02A 3GTKA 1Y1VC 1WSRA 3M3YK 4C3JC 5CHPA 3EQLA 4GTFA 3TFHA 3DXJA 2R92A 1IL2A 5JVGS 1TWCA 2E2JC 4Q4ZA 2NVXK 4BXXC 3H3VD 1WOPA 3L4KA 4A3LK 3GTMC 3PO3K 5M3MK 5C44C 1WCMA 4WCES 1K83C 1VJEA 3T01A 5M3FK 3HKZL 3HKZD 3GTLC 2P8TA 4BBRK 3H0GA 4KN4A 1TWFC 1J6XA 4KM8A 2VUMK 4X6AC 2GSOA 2Y3PA 3S2HC 2L5NA 4PAAA 2KQ1A 1XZQB 4LQYA 5FJ8K 2GAHC 1DCOA 1I50A 4OIRA 4GFQA 3GTJA 3IPJA 4BY1K 4XCHA 2R93K 1EFWA 4Y52C 4OIOA 2W7VA 4C3IC 1PJ5A 5JFEA 1Y1VK 1O2FB 1O29A 4IOCS 4LK1A 4A3GC 4BY7C 1JOEA 4QIWL 4QJVA 4QIWD 4G0UA 3K7AC 1YX2A 3PO2C 4G7ZA 1I3QK 3QX3A 3GEEA 2NVQK 4KDDA 1EQRA 4C2MC 4G7HA 3FKIA 3SZYA 3GTMK 2JA6A 1TWGC 4G0WA 2JA7C 3FOEA 3GTQC 3BP8C 2JH3A 1O27A 5IYDC 1GE9A 2JA8K 2NVYC 1F7UA 1Y1WC 1R9TA 1TWHA 3SZZA 5IP7C 4ILDA 4BBSC 1SFOA 4LJZA 1UV7A 3S2HK 2E2HC 3HOXK 1ISEA 3PIOS 3GTKC 4FZBA 2B63A 3JSTA 3S1MK 2E2IK 1WOOA 1VRQC 1O24A 5C4XK 2L3UA 5TMFA 2R92C 1TWCC 4KMHA 4A3BK 1L0WA 5FLMC 3LAPA 2KXYA 4AYBD 2NVTC 4A3GK 4BY7K 2WB1L 3I4NK 4A3KC 2WB1D 3L4JA 1WORA 3GTPA 4A3EC 1I6HC 5IYBK 1WCMC 3GTOA 3PO2K 2GAGC 2JA5A 2ZJPS 1V5VA 1J6VA 3G4AA 4LR2A 3N3YA 3OPFA 4DDQA 1IBAA 4C2MK 3H0GC 5HL7S 1YNNA 1WQFA 2WAQL 2WAQD 1USMA 3HOYC 3GTQK 3I4MC 2EBBA 4KATA 3GIRA 2XCRB 1I50C 5IYDK 1BS2A 3GTJC 5C4JC 1USOA 3A8KA 4KM9A 4C3HK 2O5IA 2NVYK 1Y1WK 4WILA 4G7OA 1IE0A 4A3IK 2FQOA 5HQHA 3HXAA 5IOSA 4GTLA 3H3VL 1WOSA 4XSXA 3MMLB 5M5XK 3HOUC 3GEHA 2YU9K 2PPBA 3T00A 3S15K 3GTGK 1J98A 5IP9K 3OEPA 3VA7A 4AH6A 4MEYA 2R92K 3S14C 2XCQA 1TWAA 1TWCK 5M5WK 3RZOK 3FKIC 4P5AA 2JA6C 1XPPA 4GTEA 3S1NC 1XZPB 4U67S 4A3EK 1WCMK 2VUMA 4M1XA 2Y0SD 3RZDC 3CAGA 1SMYA 5IORA 5JVOA 1R9TC 1TWHC 1SFOC 2CFAB 1I6VA 5C3EC 2R93A 3HOYK 3I4MK 1F93A 1I50K 4C3JK 4Y7NC 5IOTA 3WODA 2BE5A 2B63C 4A3CC 5C4JK 5EGHA 1WQGA 5M5YK 2KPUA 4KN7A 2R7ZA 4FM9A 3PIPS 3BUEA 1ZQ1C 1YCLA 1F7VA 2E2JK 4BXXK 1I3QA 1ZBSA 4IOAS 5C44K 4GT9A 3OREA 1PJ6A 2JA5C 3GTOC 3GTPC 1K83K 1VGXA 4WF9S 1ZYRA 4LLGA 1B4AA 3GTLK 3AD9C 3HOVC 5DM6S 4A3JC 3ERED 5IYCC 1TWFK 5DM7S 5D4DA 4X6AK 4ZH4A 1BDFA 1JVIA 3LAJA 3RZDK 1BJTA 4IO9S 4NOIA 3S1RC 1ZVUA 2PA8L 1XXBA 4JK1A 1R9TK 2PA8D 3CQZA 4Y52K 4KC6A 4C3IK 3GDZA 1ZXOA 1G51A 4AYBL 4Y7NK 1XXCA 4C45A 4A3CK 4GTBA 5JVHS 4BLAA 3TFIA 3K7AK 4KB2A 2A6EA 4GZYA 3AQPA 2ZJRS 3TTGA 1TWAC 4J3NA 3ADAC 2RGRA 1TWGK 4P9SA 3AQOA 4XLNA 1BGWA 1EH1A 3HOZC 3S16C 5L46A 3FOFA 2JA7K 2PMZD 3GTPK 3AD8C 1O26A 4XSZA 1YNJA 2VUMC 5HL8A 3AD7C 2A6HA 1WSVA 1O28A 4KARA 4WJ4A 2PHCB 4KMAA 4A3FC 5IYCK 4OIPA 5IP7K 2GSNA 3N0CA 4BBSK 4BY1C 3FHZA 2E2HK 2R93C 3S17C 3HOWC 2FQTA 4QJVB 1WQHA 1J6WA 3GTKK 4WFBS 2NVXA 3S1RK 2P5MA 2R7ZC 2YU9A 4RMFA 3GTGA 4YFXA 1AB4A 4MQ9A 3M4OC 2ZFZA 3S0XA 1I3QC 1C0AA 5FLMK 4KMUA 2NVQC 2GSUA 2NVTK 4O2DA 4A3KK 2O5JA 4KB4A 1I6HK 2V6SA 1RU0A 3BP3A 2Y0SL 3DLLS 1TWAK 1EK8A 4KMDA 4PABA 3V4GA 4KASA 3H0GK 2A69A 4OIQA 2V6TA 2JA8C 3HOZK 3S1QC 3S16K 1VH2A 3LYWA 1XXAA 4YFNA 2RH6A 5E68A 3GTJK 1IQ0A 3HOXC 2ZJQS 2KWAA 3AH5A 1Y1VA 4A3FK 3CQZC 2CW0A 4KAWX 3S1MC 2E2IC 3S17K 3HOWK 5C4XC
chains in the Genus database with same CATH topology
5C44C 1YNNA 3HOUK 4NOIA 3S1RC 2WAQL 2PA8L 1K83C 4JK1A 2WAQD 1R9TK 2PA8D 5M3FK 4Y52K 3HOYC 3GTQK 3HKZL 3I4MC 4YG2A 4A3BC 3HKZD 2R7ZK 1I50C 3GTLC 5IYDK 4C3IK 4BBRK 4KN4A 3GTJC 1TWFC 5C4JC 3I4NC 4A93C 3S14K 4C3HK 2O5IA 2NVYK 4AYBL 5IYBC 4Y7NK 2VUMK 4X6AC 1Y1WK 3M4OK 4A3CK 3FKIK 3S2HC 4G7OA 2JA6K 4A3IK 3S1NK 3K7AK 2A6EA 5FJ8K 4GZYA 4OIRA 3S2DC 3H3VL 4XSXA 5M5XK 4A3DC 4BY1K 3HOUC 1TWAC 2YU9K 2PPBA 2R93K 4A3MC 3S15K 4MEXA 4Y52C 1TWGK 3GTGK 4OIOA 5IP9K 4XLNA 3HOZC 3S16C 3M3YC 4C3IC 1TWHK 2JA7K 2A68A 2PMZD 4MEYA 3GTPK 1SFOK 3S14C 5TMCA 2R92K 3S1QK 3PO3K 4XSZA 4C3HC 1YNJA 1Y1VK 5C3EK 1TWCK 2VUMC 5M5WK 4LK1A 4A3GC 3RZOK 3FKIC 4BY7C 4QIWL 4QJVA 4QIWD 2JA6C 2A6HA 1XPPA 4A3IC 3S1NC 3K7AC 3PO2C 4G7ZA 4A3FC 5IYCK 1I3QK 2B63K 4OIPA 2NVXC 4YFKA 5IP7K 4A3EK 2NVQK 4BBSK 1WCMK 4A3LC 4BY1C 2YU9C 2E2HK 2R93C 3CQZK 2Y0SD 3HOWC 4C2MC 4G7HA 3PO3C 3RZDC 3S17C 3S15C 1SMYA 4QJVB 3GTMK 1TWGC 3GTGC 4Q5SA 3GTKK 5IP9C 1IW7A 1R9TC 1TWHC 2JA7C 4XLPA 3GTQC 3S1RK 1SFOC 1I6VA 2R7ZC 5IYDC 5C3EC 2PMZL 4BBRC 3HOYK 3RZOC 4OINA 3I4MK 2JA5K 4LK0A 3GTOK 2JA8K 1I50K 4YFXA 2NVYC 4MQ9A 4Y7NC 3M4OC 4C3JK 1Y1WC 3WODA 2BE5A 2B63C 1I3QC 4A3CC 5FLMK 4KMUA 5C4JK 4A93K 5IP7C 2NVQC 4BBSC 5M5YK 3HOVK 2NVTK 4LJZA 4A3JK 4KN7A 3S2HK 2E2HC 4A3KK 2O5JA 3HOXK 1I6HK 1HQMA 3GTKC 3S2DK 2Y0SL 2E2JK 4BXXK 3S1MK 4A3DK 2E2IK 1TWAK 4A3MK 3H0GK 5C4XK 2A69A 5C44K 5TMFA 2JA5C 4OIQA 2R92C 3GTOC 2JA8C 3GTPC 3S1QC 1K83K 1Y1VC 3HOZK 3M3YK 4C3JC 3S16K 1TWCC 1ZYRA 4A3BK 4LLGA 5FLMC 3EQLA 4YFNA 3GTLK 3HOVC 4AYBD 4A3JC 2NVTC 4A3GK 3GTJK 4BY7K 2WB1L 5IYCC 1TWFK 4A3KC 2WB1D 3I4NK 3HOXC 3DXJA 5D4DA 4A3EC 1I6HC 1WCMC 5IYBK 3PO2K 4ZH4A 4A3FK 4X6AK 3CQZC 2E2JC 4Q4ZA 2CW0A 4BXXC 3H3VD 5C4XC 2NVXK 4A3LK 3GTMC 1BDFA 2E2IC 3S1MC 5M3MK 3S17K 3HOWK 4C2MK 3H0GC 3RZDK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C44 C;  1YNN A;  3HOU K;  4NOI A;  3S1R C;  2WAQ L;  2PA8 L;  1K83 C;  4JK1 A;  2WAQ D;  1R9T K;  2PA8 D;  5M3F K;  4Y52 K;  3HOY C;  3GTQ K;  3HKZ L;  3I4M C;  4YG2 A;  4A3B C;  3HKZ D;  2R7Z K;  1I50 C;  3GTL C;  5IYD K;  4C3I K;  4BBR K;  4KN4 A;  3GTJ C;  1TWF C;  5C4J C;  3I4N C;  4A93 C;  3S14 K;  4C3H K;  2O5I A;  2NVY K;  4AYB L;  5IYB C;  4Y7N K;  2VUM K;  4X6A C;  1Y1W K;  3M4O K;  4A3C K;  3FKI K;  3S2H C;  4G7O A;  2JA6 K;  4A3I K;  3S1N K;  3K7A K;  2A6E A;  5FJ8 K;  4GZY A;  4OIR A;  3S2D C;  3H3V L;  4XSX A;  5M5X K;  4A3D C;  4BY1 K;  3HOU C;  1TWA C;  2YU9 K;  2PPB A;  2R93 K;  4A3M C;  3S15 K;  4MEX A;  4Y52 C;  1TWG K;  3GTG K;  4OIO A;  5IP9 K;  4XLN A;  3HOZ C;  3S16 C;  3M3Y C;  4C3I C;  1TWH K;  2JA7 K;  2A68 A;  2PMZ D;  4MEY A;  3GTP K;  1SFO K;  3S14 C;  5TMC A;  2R92 K;  3S1Q K;  3PO3 K;  4XSZ A;  4C3H C;  1YNJ A;  1Y1V K;  5C3E K;  1TWC K;  2VUM C;  5M5W K;  4LK1 A;  4A3G C;  3RZO K;  3FKI C;  4BY7 C;  4QIW L;  4QJV A;  4QIW D;  2JA6 C;  2A6H A;  1XPP A;  4A3I C;  3S1N C;  3K7A C;  3PO2 C;  4G7Z A;  4A3F C;  5IYC K;  1I3Q K;  2B63 K;  4OIP A;  2NVX C;  4YFK A;  5IP7 K;  4A3E K;  2NVQ K;  4BBS K;  1WCM K;  4A3L C;  4BY1 C;  2YU9 C;  2E2H K;  2R93 C;  3CQZ K;  2Y0S D;  3HOW C;  4C2M C;  4G7H A;  3PO3 C;  3RZD C;  3S17 C;  3S15 C;  1SMY A;  4QJV B;  3GTM K;  1TWG C;  3GTG C;  4Q5S A;  3GTK K;  5IP9 C;  1IW7 A;  1R9T C;  1TWH C;  2JA7 C;  4XLP A;  3GTQ C;  3S1R K;  1SFO C;  1I6V A;  2R7Z C;  5IYD C;  5C3E C;  2PMZ L;  4BBR C;  3HOY K;  3RZO C;  4OIN A;  3I4M K;  2JA5 K;  4LK0 A;  3GTO K;  2JA8 K;  1I50 K;  4YFX A;  2NVY C;  4MQ9 A;  4Y7N C;  3M4O C;  4C3J K;  1Y1W C;  3WOD A;  2BE5 A;  2B63 C;  1I3Q C;  4A3C C;  5FLM K;  4KMU A;  5C4J K;  4A93 K;  5IP7 C;  2NVQ C;  4BBS C;  5M5Y K;  3HOV K;  2NVT K;  4LJZ A;  4A3J K;  4KN7 A;  3S2H K;  2E2H C;  4A3K K;  2O5J A;  3HOX K;  1I6H K;  1HQM A;  3GTK C;  3S2D K;  2Y0S L;  2E2J K;  4BXX K;  3S1M K;  4A3D K;  2E2I K;  1TWA K;  4A3M K;  3H0G K;  5C4X K;  2A69 A;  5C44 K;  5TMF A;  2JA5 C;  4OIQ A;  2R92 C;  3GTO C;  2JA8 C;  3GTP C;  3S1Q C;  1K83 K;  1Y1V C;  3HOZ K;  3M3Y K;  4C3J C;  3S16 K;  1TWC C;  1ZYR A;  4A3B K;  4LLG A;  5FLM C;  3EQL A;  4YFN A;  3GTL K;  3HOV C;  4AYB D;  4A3J C;  2NVT C;  4A3G K;  3GTJ K;  4BY7 K;  2WB1 L;  5IYC C;  1TWF K;  4A3K C;  2WB1 D;  3I4N K;  3HOX C;  3DXJ A;  5D4D A;  4A3E C;  1I6H C;  1WCM C;  5IYB K;  3PO2 K;  4ZH4 A;  4A3F K;  4X6A K;  3CQZ C;  2E2J C;  4Q4Z A;  2CW0 A;  4BXX C;  3H3V D;  5C4X C;  2NVX K;  4A3L K;  3GTM C;  1BDF A;  2E2I C;  3S1M C;  5M3M K;  3S17 K;  3HOW K;  4C2M K;  3H0G C;  3RZD K; 
#chains in the Genus database with same CATH topology
 1F9N A;  3HOU K;  3N0B A;  4YG2 A;  4A3B C;  5TJ3 A;  3TFJ A;  3GTM A;  2V6U A;  1B4B A;  2R7Z K;  3I4N C;  4A93 C;  3S14 K;  3GSI A;  1INN A;  5IYB C;  1K83 A;  1JQW A;  3M4O K;  3FKI K;  4P5B A;  2ZUE A;  2JA6 K;  3S1N K;  5CJ9 A;  3GTL A;  3S2D C;  4G0V A;  1TWF A;  4LOW A;  4A3D C;  3CF5 S;  4BLB A;  4A3M C;  1DCH A;  4MEX A;  1XZP A;  3M3Y C;  1TWH K;  2A68 A;  1WIH A;  1SFO K;  5TMC A;  5IOQ A;  1XZQ A;  3S1Q K;  4C3H C;  2E2I A;  5C3E K;  1FEU A;  1O2B A;  1EI6 A;  1KQ4 A;  1DCP A;  4A3I C;  3G4C A;  2B63 K;  2NVX C;  4YFK A;  3LPX A;  3Q3Q A;  1O25 A;  2ZUF A;  4A3L C;  2CFA A;  3A8J A;  2YU9 C;  3CQZ K;  3PO3 C;  3S15 C;  1VLO A;  4GTA A;  4WFA S;  4BKW A;  3GTG C;  4Q5S A;  2D6F C;  5IP9 C;  1IW7 A;  1X31 C;  4XLP A;  1IS1 A;  2PMZ L;  4BBR C;  1DD5 A;  3RZO C;  4OIN A;  1O2A A;  2JA5 K;  4LK0 A;  1TWG A;  3GTO K;  1HI9 A;  2JA7 A;  4A93 K;  4GTD A;  3GTQ A;  3GEI A;  3HOV K;  4A3J K;  2XCO A;  4WJ3 M;  1HQM A;  3S2D K;  2NVY A;  3NUH A;  1Y1W A;  1PJ7 A;  4GTC A;  4A3D K;  4A3M K;  4WFN S;  2E2H A;  3A8I A;  5EGE A;  3T02 A;  3GTK A;  1Y1V C;  1WSR A;  3M3Y K;  4C3J C;  5CHP A;  3EQL A;  4GTF A;  3TFH A;  3DXJ A;  2R92 A;  1IL2 A;  5JVG S;  1TWC A;  2E2J C;  4Q4Z A;  2NVX K;  4BXX C;  3H3V D;  1WOP A;  3L4K A;  4A3L K;  3GTM C;  3PO3 K;  5M3M K;  5C44 C;  1WCM A;  4WCE S;  1K83 C;  1VJE A;  3T01 A;  5M3F K;  3HKZ L;  3HKZ D;  3GTL C;  2P8T A;  4BBR K;  3H0G A;  4KN4 A;  1TWF C;  1J6X A;  4KM8 A;  2VUM K;  4X6A C;  2GSO A;  2Y3P A;  3S2H C;  2L5N A;  4PAA A;  2KQ1 A;  1XZQ B;  4LQY A;  5FJ8 K;  2GAH C;  1DCO A;  1I50 A;  4OIR A;  4GFQ A;  3GTJ A;  3IPJ A;  4BY1 K;  4XCH A;  2R93 K;  1EFW A;  4Y52 C;  4OIO A;  2W7V A;  4C3I C;  1PJ5 A;  5JFE A;  1Y1V K;  1O2F B;  1O29 A;  4IOC S;  4LK1 A;  4A3G C;  4BY7 C;  1JOE A;  4QIW L;  4QJV A;  4QIW D;  4G0U A;  3K7A C;  1YX2 A;  3PO2 C;  4G7Z A;  1I3Q K;  3QX3 A;  3GEE A;  2NVQ K;  4KDD A;  1EQR A;  4C2M C;  4G7H A;  3FKI A;  3SZY A;  3GTM K;  2JA6 A;  1TWG C;  4G0W A;  2JA7 C;  3FOE A;  3GTQ C;  3BP8 C;  2JH3 A;  1O27 A;  5IYD C;  1GE9 A;  2JA8 K;  2NVY C;  1F7U A;  1Y1W C;  1R9T A;  1TWH A;  3SZZ A;  5IP7 C;  4ILD A;  4BBS C;  1SFO A;  4LJZ A;  1UV7 A;  3S2H K;  2E2H C;  3HOX K;  1ISE A;  3PIO S;  3GTK C;  4FZB A;  2B63 A;  3JST A;  3S1M K;  2E2I K;  1WOO A;  1VRQ C;  1O24 A;  5C4X K;  2L3U A;  5TMF A;  2R92 C;  1TWC C;  4KMH A;  4A3B K;  1L0W A;  5FLM C;  3LAP A;  2KXY A;  4AYB D;  2NVT C;  4A3G K;  4BY7 K;  2WB1 L;  3I4N K;  4A3K C;  2WB1 D;  3L4J A;  1WOR A;  3GTP A;  4A3E C;  1I6H C;  5IYB K;  1WCM C;  3GTO A;  3PO2 K;  2GAG C;  2JA5 A;  2ZJP S;  1V5V A;  1J6V A;  3G4A A;  4LR2 A;  3N3Y A;  3OPF A;  4DDQ A;  1IBA A;  4C2M K;  3H0G C;  5HL7 S;  1YNN A;  1WQF A;  2WAQ L;  2WAQ D;  1USM A;  3HOY C;  3GTQ K;  3I4M C;  2EBB A;  4KAT A;  3GIR A;  2XCR B;  1I50 C;  5IYD K;  1BS2 A;  3GTJ C;  5C4J C;  1USO A;  3A8K A;  4KM9 A;  4C3H K;  2O5I A;  2NVY K;  1Y1W K;  4WIL A;  4G7O A;  1IE0 A;  4A3I K;  2FQO A;  5HQH A;  3HXA A;  5IOS A;  4GTL A;  3H3V L;  1WOS A;  4XSX A;  3MML B;  5M5X K;  3HOU C;  3GEH A;  2YU9 K;  2PPB A;  3T00 A;  3S15 K;  3GTG K;  1J98 A;  5IP9 K;  3OEP A;  3VA7 A;  4AH6 A;  4MEY A;  2R92 K;  3S14 C;  2XCQ A;  1TWA A;  1TWC K;  5M5W K;  3RZO K;  3FKI C;  4P5A A;  2JA6 C;  1XPP A;  4GTE A;  3S1N C;  1XZP B;  4U67 S;  4A3E K;  1WCM K;  2VUM A;  4M1X A;  2Y0S D;  3RZD C;  3CAG A;  1SMY A;  5IOR A;  5JVO A;  1R9T C;  1TWH C;  1SFO C;  2CFA B;  1I6V A;  5C3E C;  2R93 A;  3HOY K;  3I4M K;  1F93 A;  1I50 K;  4C3J K;  4Y7N C;  5IOT A;  3WOD A;  2BE5 A;  2B63 C;  4A3C C;  5C4J K;  5EGH A;  1WQG A;  5M5Y K;  2KPU A;  4KN7 A;  2R7Z A;  4FM9 A;  3PIP S;  3BUE A;  1ZQ1 C;  1YCL A;  1F7V A;  2E2J K;  4BXX K;  1I3Q A;  1ZBS A;  4IOA S;  5C44 K;  4GT9 A;  3ORE A;  1PJ6 A;  2JA5 C;  3GTO C;  3GTP C;  1K83 K;  1VGX A;  4WF9 S;  1ZYR A;  4LLG A;  1B4A A;  3GTL K;  3AD9 C;  3HOV C;  5DM6 S;  4A3J C;  3ERE D;  5IYC C;  1TWF K;  5DM7 S;  5D4D A;  4X6A K;  4ZH4 A;  1BDF A;  1JVI A;  3LAJ A;  3RZD K;  1BJT A;  4IO9 S;  4NOI A;  3S1R C;  1ZVU A;  2PA8 L;  1XXB A;  4JK1 A;  1R9T K;  2PA8 D;  3CQZ A;  4Y52 K;  4KC6 A;  4C3I K;  3GDZ A;  1ZXO A;  1G51 A;  4AYB L;  4Y7N K;  1XXC A;  4C45 A;  4A3C K;  4GTB A;  5JVH S;  4BLA A;  3TFI A;  3K7A K;  4KB2 A;  2A6E A;  4GZY A;  3AQP A;  2ZJR S;  3TTG A;  1TWA C;  4J3N A;  3ADA C;  2RGR A;  1TWG K;  4P9S A;  3AQO A;  4XLN A;  1BGW A;  1EH1 A;  3HOZ C;  3S16 C;  5L46 A;  3FOF A;  2JA7 K;  2PMZ D;  3GTP K;  3AD8 C;  1O26 A;  4XSZ A;  1YNJ A;  2VUM C;  5HL8 A;  3AD7 C;  2A6H A;  1WSV A;  1O28 A;  4KAR A;  4WJ4 A;  2PHC B;  4KMA A;  4A3F C;  5IYC K;  4OIP A;  5IP7 K;  2GSN A;  3N0C A;  4BBS K;  4BY1 C;  3FHZ A;  2E2H K;  2R93 C;  3S17 C;  3HOW C;  2FQT A;  4QJV B;  1WQH A;  1J6W A;  3GTK K;  4WFB S;  2NVX A;  3S1R K;  2P5M A;  2R7Z C;  2YU9 A;  4RMF A;  3GTG A;  4YFX A;  1AB4 A;  4MQ9 A;  3M4O C;  2ZFZ A;  3S0X A;  1I3Q C;  1C0A A;  5FLM K;  4KMU A;  2NVQ C;  2GSU A;  2NVT K;  4O2D A;  4A3K K;  2O5J A;  4KB4 A;  1I6H K;  2V6S A;  1RU0 A;  3BP3 A;  2Y0S L;  3DLL S;  1TWA K;  1EK8 A;  4KMD A;  4PAB A;  3V4G A;  4KAS A;  3H0G K;  2A69 A;  4OIQ A;  2V6T A;  2JA8 C;  3HOZ K;  3S1Q C;  3S16 K;  1VH2 A;  3LYW A;  1XXA A;  4YFN A;  2RH6 A;  5E68 A;  3GTJ K;  1IQ0 A;  3HOX C;  2ZJQ S;  2KWA A;  3AH5 A;  1Y1V A;  4A3F K;  3CQZ C;  2CW0 A;  4KAW X;  3S1M C;  2E2I C;  3S17 K;  3HOW K;  5C4X C; 
#chains in the Genus database with same CATH homology
 5C44 C;  1YNN A;  3HOU K;  4NOI A;  3S1R C;  2WAQ L;  2PA8 L;  1K83 C;  4JK1 A;  2WAQ D;  1R9T K;  2PA8 D;  5M3F K;  4Y52 K;  3HOY C;  3GTQ K;  3HKZ L;  3I4M C;  4YG2 A;  4A3B C;  3HKZ D;  2R7Z K;  1I50 C;  3GTL C;  5IYD K;  4C3I K;  4BBR K;  4KN4 A;  3GTJ C;  1TWF C;  5C4J C;  3I4N C;  4A93 C;  3S14 K;  4C3H K;  2O5I A;  2NVY K;  4AYB L;  5IYB C;  4Y7N K;  2VUM K;  4X6A C;  1Y1W K;  3M4O K;  4A3C K;  3FKI K;  3S2H C;  4G7O A;  2JA6 K;  4A3I K;  3S1N K;  3K7A K;  2A6E A;  5FJ8 K;  4GZY A;  4OIR A;  3S2D C;  3H3V L;  4XSX A;  5M5X K;  4A3D C;  4BY1 K;  3HOU C;  1TWA C;  2YU9 K;  2PPB A;  2R93 K;  4A3M C;  3S15 K;  4MEX A;  4Y52 C;  1TWG K;  3GTG K;  4OIO A;  5IP9 K;  4XLN A;  3HOZ C;  3S16 C;  3M3Y C;  4C3I C;  1TWH K;  2JA7 K;  2A68 A;  2PMZ D;  4MEY A;  3GTP K;  1SFO K;  3S14 C;  5TMC A;  2R92 K;  3S1Q K;  3PO3 K;  4XSZ A;  4C3H C;  1YNJ A;  1Y1V K;  5C3E K;  1TWC K;  2VUM C;  5M5W K;  4LK1 A;  4A3G C;  3RZO K;  3FKI C;  4BY7 C;  4QIW L;  4QJV A;  4QIW D;  2JA6 C;  2A6H A;  1XPP A;  4A3I C;  3S1N C;  3K7A C;  3PO2 C;  4G7Z A;  4A3F C;  5IYC K;  1I3Q K;  2B63 K;  4OIP A;  2NVX C;  4YFK A;  5IP7 K;  4A3E K;  2NVQ K;  4BBS K;  1WCM K;  4A3L C;  4BY1 C;  2YU9 C;  2E2H K;  2R93 C;  3CQZ K;  2Y0S D;  3HOW C;  4C2M C;  4G7H A;  3PO3 C;  3RZD C;  3S17 C;  3S15 C;  1SMY A;  4QJV B;  3GTM K;  1TWG C;  3GTG C;  4Q5S A;  3GTK K;  5IP9 C;  1IW7 A;  1R9T C;  1TWH C;  2JA7 C;  4XLP A;  3GTQ C;  3S1R K;  1SFO C;  1I6V A;  2R7Z C;  5IYD C;  5C3E C;  2PMZ L;  4BBR C;  3HOY K;  3RZO C;  4OIN A;  3I4M K;  2JA5 K;  4LK0 A;  3GTO K;  2JA8 K;  1I50 K;  4YFX A;  2NVY C;  4MQ9 A;  4Y7N C;  3M4O C;  4C3J K;  1Y1W C;  3WOD A;  2BE5 A;  2B63 C;  1I3Q C;  4A3C C;  5FLM K;  4KMU A;  5C4J K;  4A93 K;  5IP7 C;  2NVQ C;  4BBS C;  5M5Y K;  3HOV K;  2NVT K;  4LJZ A;  4A3J K;  4KN7 A;  3S2H K;  2E2H C;  4A3K K;  2O5J A;  3HOX K;  1I6H K;  1HQM A;  3GTK C;  3S2D K;  2Y0S L;  2E2J K;  4BXX K;  3S1M K;  4A3D K;  2E2I K;  1TWA K;  4A3M K;  3H0G K;  5C4X K;  2A69 A;  5C44 K;  5TMF A;  2JA5 C;  4OIQ A;  2R92 C;  3GTO C;  2JA8 C;  3GTP C;  3S1Q C;  1K83 K;  1Y1V C;  3HOZ K;  3M3Y K;  4C3J C;  3S16 K;  1TWC C;  1ZYR A;  4A3B K;  4LLG A;  5FLM C;  3EQL A;  4YFN A;  3GTL K;  3HOV C;  4AYB D;  4A3J C;  2NVT C;  4A3G K;  3GTJ K;  4BY7 K;  2WB1 L;  5IYC C;  1TWF K;  4A3K C;  2WB1 D;  3I4N K;  3HOX C;  3DXJ A;  5D4D A;  4A3E C;  1I6H C;  1WCM C;  5IYB K;  3PO2 K;  4ZH4 A;  4A3F K;  4X6A K;  3CQZ C;  2E2J C;  4Q4Z A;  2CW0 A;  4BXX C;  3H3V D;  5C4X C;  2NVX K;  4A3L K;  3GTM C;  1BDF A;  2E2I C;  3S1M C;  5M3M K;  3S17 K;  3HOW K;  4C2M K;  3H0G C;  3RZD K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...