1YNJA

Taq rna polymerase-sorangicin complex
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
230
structure length
230
Chain Sequence
LKAPVFTATTQGDHYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLDPKMASTTLILRAEGPKEVRAGDFTPSADVEIMNPDLHIATLEEGGKLYMEVRVDRGVGYVPAERHGIKDRINAIPVDAIFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVAILKEHLNYFANPEASLLPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural, functional, and genetic analysis of sorangicin inhibition of bacterial RNA polymerase
pubmed doi rcsb
molecule tags Transferase
molecule keywords DNA-directed RNA polymerase alpha chain
total genus 43
structure length 230
sequence length 230
chains with identical sequence B
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2005-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01000 RNA_pol_A_bac RNA polymerase Rpb3/RpoA insert domain
A PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain
A PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.12 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 DNA-directed RNA polymerase, insert domain 1ynjA02
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 1ynjA01
4YFNA 2NVQC 3HOUC 4LK1A 2VUMC 4Q5SA 3HOXK 4A3FK 3M4OK 1WCMC 3PO3C 5M5XK 3GTKK 4A3DC 2WB1D 2JA7C 1YNJA 4Y52K 3HOXC 2VUMK 4A93C 4C3IK 3I4NK 4OINA 5IP9K 2E2IK 1WCMK 3S1MC 3PO3K 3S1RC 5IP7K 3S17K 1TWFC 3PO2K 4X6AK 1XPPA 2JA7K 2E2IC 4YFKA 4XSXA 3S1MK 1YNNA 4LJZA 4G7ZA 1TWHK 4BY1K 5IYDC 3S17C 3GTGK 1TWCC 3EQLA 2R93K 1R9TC 1TWAK 4LLGA 3RZOK 4BBSK 4KN4A 4BY1C 5IYDK 4BBRC 3GTPK 5C4XC 2R93C 5M5YK 4QIWL 2R92K 3M3YK 3WODA 4BY7K 2PMZD 1I50C 3S14K 2Y0SL 2JA8C 2NVQK 3S1QC 1I6VA 4NOIA 4A3MK 4JK1A 3M4OC 3GTJC 1BDFA 5IYBK 1I3QK 3GTKC 4A3DK 4BY7C 4A3LC 2PPBA 2A69A 3S1QK 3CQZC 3H0GC 4A3MC 4KMUA 2PA8D 3S1NC 2PA8L 3HOYK 5IYBC 2R7ZK 4MQ9A 3S1RK 2A6HA 5C4JC 4MEYA 4OIRA 4XLNA 5M3FK 4A3LK 5D4DA 3S15C 5C44K 3H3VD 3CQZK 3H0GK 3PO2C 5IYCC 1TWFK 3FKIC 5FLMK 3I4MK 3S1NK 4C3HC 2R7ZC 3HOYC 4A3JK 2NVYC 4MEXA 4A3GC 2O5JA 2E2HK 3GTLK 1Y1VC 4G7OA 3HKZD 3GTQK 3GTGC 3HKZL 3HOVC 5C44C 5M3MK 5FJ8K 4A3IC 3I4MC 4A3EC 4A3JC 4G7HA 4C3HK 4Y7NK 3RZDK 1K83C 4A3BC 1Y1VK 4BBRK 3GTPC 5C4XK 2WAQD 3S2HC 5TMCA 4A3IK 1TWGK 4XSZA 2R92C 4KN7A 4Y7NC 3RZDC 3M3YC 4A3EK 1I50K 2NVXK 2JA8K 4A3BK 2JA5C 4GZYA 4LK0A 5TMFA 4YG2A 3GTJK 3S2HK 3GTMC 2A68A 3GTOC 1IW7A 3S2DC 1I3QC 2WB1L 3HOZK 4AYBD 1SMYA 2NVXC 4AYBL 2E2JK 2JA5K 5C3EK 4QJVA 4OIOA 4A3KC 3GTOK 4XLPA 3GTMK 4A3CK 3S2DK 5C4JK 2E2JC 4ZH4A 4C2MK 4C3IC 3I4NC 4A93K 3S15K 5IP9C 4BXXC 5C3EC 2O5IA 3S16C 2YU9C 5FLMC 5IP7C 3FKIK 5IYCK 2JA6C 3HOWC 1SFOC 4A3CC 4C3JK 1I6HC 2NVYK 2E2HC 4A3KK 3GTLC 3GTQC 4A3GK 4C2MC 4YFXA 4X6AC 3HOVK 3H3VL 4BXXK 1Y1WC 3S16K 2NVTK 5M5WK 2YU9K 1TWHC 3DXJA 2JA6K 3HOWK 4C3JC 1SFOK 4OIQA 1K83K 1TWCK 1I6HK 3K7AK 1TWAC 4Q4ZA 2A6EA 1ZYRA 3RZOC 1HQMA 4OIPA 4QIWD 2B63C 2NVTC 1Y1WK 1TWGC 2CW0A 2PMZL 4BBSC 2Y0SD 3HOUK 4A3FC 1R9TK 3K7AC 2WAQL 2BE5A 2B63K 4Y52C 3S14C 3HOZC 4QJVB
chains in the Genus database with same CATH superfamily
2NVQC 1ISEA 4M1XA 3HOXK 2VUMC 1F93A 4WCES 5JVHS 4J3NA 4Y52K 3HOXC 2VUMK 3I4NK 3S1MC 1WQFA 3GTPA 3VA7A 4LQYA 1YX2A 4FM9A 4X6AK 1ZXOA 3AD7C 3S1MK 2W7VA 4IOAS 5IYDC 1Y1VA 3IPJA 1IS1A 5JVOA 3GIRA 4BBSK 3AQPA 5IYDK 1B4BA 1EH1A 1J6WA 2ZJQS 3BP8C 3M3YK 4BY7K 2PMZD 3FOFA 2Y0SL 1BS2A 4JK1A 2FQOA 5IORA 1I3QK 3GTKC 1JVIA 2KPUA 4BY7C 4A3LC 5DM7S 3CQZC 3OPFA 4LR2A 1EI6A 2PA8D 4MQ9A 5TJ3A 3S1RK 5C4JC 4XLNA 3FHZA 3SZZA 4A3LK 2VUMA 3CQZK 3CF5S 4MEXA 1TWCA 4G7OA 3HKZD 3HKZL 1O2BA 1RU0A 3GTJA 1PJ5A 4Y7NK 4G7HA 3A8KA 4BBRK 5C4XK 2WAQD 3OREA 4KN7A 4Y7NC 1V5VA 4U67S 4BKWA 2JA8K 4GZYA 4KMAA 3TFIA 5TMFA 1INNA 2A68A 3GTOC 2WB1L 2V6UA 4AYBL 1PJ7A 1TWFA 3GTOK 4XLPA 3TFJA 3I4NC 4GTEA 1TWGA 3S15K 4GTFA 2V6TA 1TWHA 3FKIK 1SFOC 1I6HC 2NVYK 3GTQC 3MMLB 1DCOA 1ZBSA 4YFXA 4X6AC 3GTLA 1HI9A 3H3VL 1SFOK 1WSVA 5L46A 1K83K 2E2HA 4WFBS 2RGRA 1GE9A 4QIWD 3LAPA 2B63C 1TWGC 3DLLS 2PMZL 4BBSC 2GSOA 4G0VA 1XXCA 2BE5A 2B63K 1WSRA 3GTMA 5EGEA 2EBBA 4LK1A 1O2AA 1WCMC 1Y1WA 3GTKK 3ADAC 2R92A 1WOSA 4GTLA 4IOCS 1JOEA 2JH3A 2JA6A 4A93C 1WOOA 4C3IK 4GTBA 3HXAA 5IP9K 1WCMK 1C0AA 3S1RC 1BGWA 4LJZA 1TWHK 3FKIA 1F9NA 1R9TC 5IOQA 4KDDA 1WIHA 4P5AA 4BBRC 5C4XC 5M5YK 4C45A 3CQZA 4KASA 2JA8C 1WQHA 4A3MK 3M4OC 1EFWA 5IYBK 4A3DK 4P9SA 1O2FB 4A3MC 4KMUA 2PA8L 5IYBC 1XZQB 5M3FK 5D4DA 3S15C 3H3VD 2GAGC 3PO2C 5IOSA 3FKIC 4C3HC 4A3JK 2NVYC 1I6HK 2O5JA 1X31C 3GSIA 3GTQK 1J6VA 3GTGC 3G4AA 4G0WA 5M3MK 5FJ8K 4A3IC 3AH5A 3RZDK 4A3JC 4KARA 4C3HK 1K83C 5TMCA 4A3IK 1TWGK 2NVXK 3RZDC 2JA5C 1DCHA 1F7VA 1YCLA 2KQ1A 3S2DC 1IW7A 4GTDA 2NVXC 1DCPA 2JA5K 4QJVA 3GEEA 4OIOA 4A3CK 3S2DK 1O28A 4RMFA 1ZQ1C 4C3IC 4A93K 2ZUFA 5IP9C 2B63A 2O5IA 2YU9C 4LOWA 4A3CC 4C3JK 2E2HC 3GTLC 3QX3A 2JA7A 4PAAA 3GTQA 5M5WK 2YU9K 1TWHC 4C3JC 5EGHA 2CFAA 3K7AK 1R9TK 4Q4ZA 2Y0SD 1ZVUA 3S0XA 1J6XA 2FQTA 2P5MA 3K7AC 1VRQC 3Q3QA 2WAQL 4QJVB 4Q5SA 4GTCA 3M4OK 1I3QA 3GTOA 3GDZA 4A3DC 4DDQA 2PHCB 2WB1D 1YNJA 3PIPS 1VGXA 4OINA 1K83A 5IP7K 4KB4A 3FOEA 1L0WA 1FEUA 3PO2K 1IE0A 1YNNA 4G7ZA 4BY1K 5CJ9A 3GTGK 1TWCC 3EQLA 3NUHA 2R7ZA 1F7UA 3RZOK 2GAHC 4KN4A 4BY1C 5IOTA 5DM6S 4WJ3M 3AQOA 1O24A 5CHPA 4QIWL 1G51A 1KQ4A 3T01A 4GFQA 2E2IA 4P5BA 1I6VA 4NOIA 1O27A 1VJEA 3N0CA 1VLOA 1BDFA 1O29A 2XCQA 1J98A 3GEHA 3OEPA 3LPXA 4KATA 2A69A 2ZUEA 3H0GC 2ZJRS 3S1NC 2R93A 4OIRA 4BLBA 3H0GK 1TWFK 3PIOS 3S1NK 2E2HK 5HL7S 3GTLK 1Y1VC 1B4AA 3G4CA 1IBAA 5JFEA 1XXBA 4A3EC 3AD9C 3CAGA 4A3BC 1Y1VK 3GTPC 3S2HC 1EK8A 3LAJA 4O2DA 2R92C 3T00A 4A3EK 2XCRB 1I50K 3N3YA 4A3BK 4LK0A 3GTJK 1R9TA 3S2HK 3GTMC 4AYBD 3GTMK 4A3KC 4ZH4A 4KB2A 3T02A 4BXXC 2NVXA 5FLMC 5IP7C 3BP3A 5IYCK 2D6FC 4A3KK 4A3GK 1UV7A 2GSUA 4BLAA 1O25A 4PABA 3HOVK 4BXXK 1Y1WC 2NVTK 4G0UA 1IQ0A 4OIQA 1TWCK 2KWAA 2A6EA 1ZYRA 3RZOC 1HQMA 4OIPA 1Y1WK 2NVTC 5JVGS 2CW0A 3HOUK 4A3FC 3JSTA 2XCOA 3GTGA 3TTGA 4WF9S 2KXYA 1XZQA 4KMDA 4AH6A 2JA7K 3HOZC 4GTAA 4YFNA 3HOUC 3A8JA 4A3FK 1USMA 3AD8C 1DD5A 3PO3C 5M5XK 2JA7C 3V4GA 2E2IK 3N0BA 2YU9A 3SZYA 3PO3K 3LYWA 5HQHA 3S17K 1TWFC 1IL2A 1XPPA 2E2IC 4YFKA 1AB4A 4XSXA 3S17C 2R93K 1TWAK 4LLGA 4KAWX 2ZFZA 4KM8A 5E68A 3GTPK 2R93C 5HL8A 3H0GA 3WODA 2R92K 3GTKA 1I50C 3S14K 2NVQK 3S1QC 1BJTA 2V6SA 3GTJC 2PPBA 1WQGA 1I50A 3S1QK 4WILA 3HOYK 2R7ZK 2CFAB 2A6HA 4MEYA 1WCMA 1USOA 3A8IA 1PJ6A 5C44K 5IYCC 5FLMK 1O26A 3I4MK 2R7ZC 3HOYC 4A3GC 3TFHA 2Y3PA 3HOVC 2L5NA 1XZPB 5C44C 4FZBA 3I4MC 3ERED 2ZJPS 2P8TA 4XSZA 4WFNS 3M3YC 1JQWA 4WFAS 4KC6A 4YG2A 3BUEA 1SFOA 3GEIA 1I3QC 3HOZK 1SMYA 2E2JK 4IO9S 1WORA 5C3EK 4ILDA 5C4JK 2E2JC 4C2MK 5C3EC 3S16C 1EQRA 1VH2A 2JA6C 3HOWC 3L4KA 4WJ4A 2JA5A 4C2MC 1WOPA 3S16K 3DXJA 2JA6K 3HOWK 1TWAC 3L4JA 4GT9A 2L3UA 4KMHA 1XXAA 4KM9A 4XCHA 2NVYA 1TWAA 2RH6A 2GSNA 4Y52C 1XZPA 3S14C
chains in the Genus database with same CATH topology
4YFNA 2NVQC 3HOUC 4LK1A 2VUMC 4Q5SA 3HOXK 4A3FK 3M4OK 1WCMC 3PO3C 5M5XK 3GTKK 4A3DC 2WB1D 2JA7C 1YNJA 4Y52K 3HOXC 2VUMK 4A93C 4C3IK 3I4NK 4OINA 5IP9K 2E2IK 1WCMK 3S1MC 3PO3K 3S1RC 5IP7K 3S17K 1TWFC 3PO2K 4X6AK 1XPPA 2JA7K 2E2IC 4YFKA 4XSXA 3S1MK 1YNNA 4LJZA 4G7ZA 1TWHK 4BY1K 5IYDC 3S17C 3GTGK 1TWCC 3EQLA 2R93K 1R9TC 1TWAK 4LLGA 3RZOK 4BBSK 4KN4A 4BY1C 5IYDK 4BBRC 3GTPK 5C4XC 2R93C 5M5YK 4QIWL 2R92K 3M3YK 3WODA 4BY7K 2PMZD 1I50C 3S14K 2Y0SL 2JA8C 2NVQK 3S1QC 1I6VA 4NOIA 4A3MK 4JK1A 3M4OC 3GTJC 1BDFA 5IYBK 1I3QK 3GTKC 4A3DK 4BY7C 4A3LC 2PPBA 2A69A 3S1QK 3CQZC 3H0GC 4A3MC 4KMUA 2PA8D 3S1NC 2PA8L 3HOYK 5IYBC 2R7ZK 4MQ9A 3S1RK 2A6HA 5C4JC 4MEYA 4OIRA 4XLNA 5M3FK 4A3LK 5D4DA 3S15C 5C44K 3H3VD 3CQZK 3H0GK 3PO2C 5IYCC 1TWFK 3FKIC 5FLMK 3I4MK 3S1NK 4C3HC 2R7ZC 3HOYC 4A3JK 2NVYC 4MEXA 4A3GC 2O5JA 2E2HK 3GTLK 1Y1VC 4G7OA 3HKZD 3GTQK 3GTGC 3HKZL 3HOVC 5C44C 5M3MK 5FJ8K 4A3IC 3I4MC 4A3EC 4A3JC 4G7HA 4C3HK 4Y7NK 3RZDK 1K83C 4A3BC 1Y1VK 4BBRK 3GTPC 5C4XK 2WAQD 3S2HC 5TMCA 4A3IK 1TWGK 4XSZA 2R92C 4KN7A 4Y7NC 3RZDC 3M3YC 4A3EK 1I50K 2NVXK 2JA8K 4A3BK 2JA5C 4GZYA 4LK0A 5TMFA 4YG2A 3GTJK 3S2HK 3GTMC 2A68A 3GTOC 1IW7A 3S2DC 1I3QC 2WB1L 3HOZK 4AYBD 1SMYA 2NVXC 4AYBL 2E2JK 2JA5K 5C3EK 4QJVA 4OIOA 4A3KC 3GTOK 4XLPA 3GTMK 4A3CK 3S2DK 5C4JK 2E2JC 4ZH4A 4C2MK 4C3IC 3I4NC 4A93K 3S15K 5IP9C 4BXXC 5C3EC 2O5IA 3S16C 2YU9C 5FLMC 5IP7C 3FKIK 5IYCK 2JA6C 3HOWC 1SFOC 4A3CC 4C3JK 1I6HC 2NVYK 2E2HC 4A3KK 3GTLC 3GTQC 4A3GK 4C2MC 4YFXA 4X6AC 3HOVK 3H3VL 4BXXK 1Y1WC 3S16K 2NVTK 5M5WK 2YU9K 1TWHC 3DXJA 2JA6K 3HOWK 4C3JC 1SFOK 4OIQA 1K83K 1TWCK 1I6HK 3K7AK 1TWAC 4Q4ZA 2A6EA 1ZYRA 3RZOC 1HQMA 4OIPA 4QIWD 2B63C 2NVTC 1Y1WK 1TWGC 2CW0A 2PMZL 4BBSC 2Y0SD 3HOUK 4A3FC 1R9TK 3K7AC 2WAQL 2BE5A 2B63K 4Y52C 3S14C 3HOZC 4QJVB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YFN A;  2NVQ C;  3HOU C;  4LK1 A;  2VUM C;  4Q5S A;  3HOX K;  4A3F K;  3M4O K;  1WCM C;  3PO3 C;  5M5X K;  3GTK K;  4A3D C;  2WB1 D;  2JA7 C;  1YNJ A;  4Y52 K;  3HOX C;  2VUM K;  4A93 C;  4C3I K;  3I4N K;  4OIN A;  5IP9 K;  2E2I K;  1WCM K;  3S1M C;  3PO3 K;  3S1R C;  5IP7 K;  3S17 K;  1TWF C;  3PO2 K;  4X6A K;  1XPP A;  2JA7 K;  2E2I C;  4YFK A;  4XSX A;  3S1M K;  1YNN A;  4LJZ A;  4G7Z A;  1TWH K;  4BY1 K;  5IYD C;  3S17 C;  3GTG K;  1TWC C;  3EQL A;  2R93 K;  1R9T C;  1TWA K;  4LLG A;  3RZO K;  4BBS K;  4KN4 A;  4BY1 C;  5IYD K;  4BBR C;  3GTP K;  5C4X C;  2R93 C;  5M5Y K;  4QIW L;  2R92 K;  3M3Y K;  3WOD A;  4BY7 K;  2PMZ D;  1I50 C;  3S14 K;  2Y0S L;  2JA8 C;  2NVQ K;  3S1Q C;  1I6V A;  4NOI A;  4A3M K;  4JK1 A;  3M4O C;  3GTJ C;  1BDF A;  5IYB K;  1I3Q K;  3GTK C;  4A3D K;  4BY7 C;  4A3L C;  2PPB A;  2A69 A;  3S1Q K;  3CQZ C;  3H0G C;  4A3M C;  4KMU A;  2PA8 D;  3S1N C;  2PA8 L;  3HOY K;  5IYB C;  2R7Z K;  4MQ9 A;  3S1R K;  2A6H A;  5C4J C;  4MEY A;  4OIR A;  4XLN A;  5M3F K;  4A3L K;  5D4D A;  3S15 C;  5C44 K;  3H3V D;  3CQZ K;  3H0G K;  3PO2 C;  5IYC C;  1TWF K;  3FKI C;  5FLM K;  3I4M K;  3S1N K;  4C3H C;  2R7Z C;  3HOY C;  4A3J K;  2NVY C;  4MEX A;  4A3G C;  2O5J A;  2E2H K;  3GTL K;  1Y1V C;  4G7O A;  3HKZ D;  3GTQ K;  3GTG C;  3HKZ L;  3HOV C;  5C44 C;  5M3M K;  5FJ8 K;  4A3I C;  3I4M C;  4A3E C;  4A3J C;  4G7H A;  4C3H K;  4Y7N K;  3RZD K;  1K83 C;  4A3B C;  1Y1V K;  4BBR K;  3GTP C;  5C4X K;  2WAQ D;  3S2H C;  5TMC A;  4A3I K;  1TWG K;  4XSZ A;  2R92 C;  4KN7 A;  4Y7N C;  3RZD C;  3M3Y C;  4A3E K;  1I50 K;  2NVX K;  2JA8 K;  4A3B K;  2JA5 C;  4GZY A;  4LK0 A;  5TMF A;  4YG2 A;  3GTJ K;  3S2H K;  3GTM C;  2A68 A;  3GTO C;  1IW7 A;  3S2D C;  1I3Q C;  2WB1 L;  3HOZ K;  4AYB D;  1SMY A;  2NVX C;  4AYB L;  2E2J K;  2JA5 K;  5C3E K;  4QJV A;  4OIO A;  4A3K C;  3GTO K;  4XLP A;  3GTM K;  4A3C K;  3S2D K;  5C4J K;  2E2J C;  4ZH4 A;  4C2M K;  4C3I C;  3I4N C;  4A93 K;  3S15 K;  5IP9 C;  4BXX C;  5C3E C;  2O5I A;  3S16 C;  2YU9 C;  5FLM C;  5IP7 C;  3FKI K;  5IYC K;  2JA6 C;  3HOW C;  1SFO C;  4A3C C;  4C3J K;  1I6H C;  2NVY K;  2E2H C;  4A3K K;  3GTL C;  3GTQ C;  4A3G K;  4C2M C;  4YFX A;  4X6A C;  3HOV K;  3H3V L;  4BXX K;  1Y1W C;  3S16 K;  2NVT K;  5M5W K;  2YU9 K;  1TWH C;  3DXJ A;  2JA6 K;  3HOW K;  4C3J C;  1SFO K;  4OIQ A;  1K83 K;  1TWC K;  1I6H K;  3K7A K;  1TWA C;  4Q4Z A;  2A6E A;  1ZYR A;  3RZO C;  1HQM A;  4OIP A;  4QIW D;  2B63 C;  2NVT C;  1Y1W K;  1TWG C;  2CW0 A;  2PMZ L;  4BBS C;  2Y0S D;  3HOU K;  4A3F C;  1R9T K;  3K7A C;  2WAQ L;  2BE5 A;  2B63 K;  4Y52 C;  3S14 C;  3HOZ C;  4QJV B; 
#chains in the Genus database with same CATH topology
 2NVQ C;  1ISE A;  4M1X A;  3HOX K;  2VUM C;  1F93 A;  4WCE S;  5JVH S;  4J3N A;  4Y52 K;  3HOX C;  2VUM K;  3I4N K;  3S1M C;  1WQF A;  3GTP A;  3VA7 A;  4LQY A;  1YX2 A;  4FM9 A;  4X6A K;  1ZXO A;  3AD7 C;  3S1M K;  2W7V A;  4IOA S;  5IYD C;  1Y1V A;  3IPJ A;  1IS1 A;  5JVO A;  3GIR A;  4BBS K;  3AQP A;  5IYD K;  1B4B A;  1EH1 A;  1J6W A;  2ZJQ S;  3BP8 C;  3M3Y K;  4BY7 K;  2PMZ D;  3FOF A;  2Y0S L;  1BS2 A;  4JK1 A;  2FQO A;  5IOR A;  1I3Q K;  3GTK C;  1JVI A;  2KPU A;  4BY7 C;  4A3L C;  5DM7 S;  3CQZ C;  3OPF A;  4LR2 A;  1EI6 A;  2PA8 D;  4MQ9 A;  5TJ3 A;  3S1R K;  5C4J C;  4XLN A;  3FHZ A;  3SZZ A;  4A3L K;  2VUM A;  3CQZ K;  3CF5 S;  4MEX A;  1TWC A;  4G7O A;  3HKZ D;  3HKZ L;  1O2B A;  1RU0 A;  3GTJ A;  1PJ5 A;  4Y7N K;  4G7H A;  3A8K A;  4BBR K;  5C4X K;  2WAQ D;  3ORE A;  4KN7 A;  4Y7N C;  1V5V A;  4U67 S;  4BKW A;  2JA8 K;  4GZY A;  4KMA A;  3TFI A;  5TMF A;  1INN A;  2A68 A;  3GTO C;  2WB1 L;  2V6U A;  4AYB L;  1PJ7 A;  1TWF A;  3GTO K;  4XLP A;  3TFJ A;  3I4N C;  4GTE A;  1TWG A;  3S15 K;  4GTF A;  2V6T A;  1TWH A;  3FKI K;  1SFO C;  1I6H C;  2NVY K;  3GTQ C;  3MML B;  1DCO A;  1ZBS A;  4YFX A;  4X6A C;  3GTL A;  1HI9 A;  3H3V L;  1SFO K;  1WSV A;  5L46 A;  1K83 K;  2E2H A;  4WFB S;  2RGR A;  1GE9 A;  4QIW D;  3LAP A;  2B63 C;  1TWG C;  3DLL S;  2PMZ L;  4BBS C;  2GSO A;  4G0V A;  1XXC A;  2BE5 A;  2B63 K;  1WSR A;  3GTM A;  5EGE A;  2EBB A;  4LK1 A;  1O2A A;  1WCM C;  1Y1W A;  3GTK K;  3ADA C;  2R92 A;  1WOS A;  4GTL A;  4IOC S;  1JOE A;  2JH3 A;  2JA6 A;  4A93 C;  1WOO A;  4C3I K;  4GTB A;  3HXA A;  5IP9 K;  1WCM K;  1C0A A;  3S1R C;  1BGW A;  4LJZ A;  1TWH K;  3FKI A;  1F9N A;  1R9T C;  5IOQ A;  4KDD A;  1WIH A;  4P5A A;  4BBR C;  5C4X C;  5M5Y K;  4C45 A;  3CQZ A;  4KAS A;  2JA8 C;  1WQH A;  4A3M K;  3M4O C;  1EFW A;  5IYB K;  4A3D K;  4P9S A;  1O2F B;  4A3M C;  4KMU A;  2PA8 L;  5IYB C;  1XZQ B;  5M3F K;  5D4D A;  3S15 C;  3H3V D;  2GAG C;  3PO2 C;  5IOS A;  3FKI C;  4C3H C;  4A3J K;  2NVY C;  1I6H K;  2O5J A;  1X31 C;  3GSI A;  3GTQ K;  1J6V A;  3GTG C;  3G4A A;  4G0W A;  5M3M K;  5FJ8 K;  4A3I C;  3AH5 A;  3RZD K;  4A3J C;  4KAR A;  4C3H K;  1K83 C;  5TMC A;  4A3I K;  1TWG K;  2NVX K;  3RZD C;  2JA5 C;  1DCH A;  1F7V A;  1YCL A;  2KQ1 A;  3S2D C;  1IW7 A;  4GTD A;  2NVX C;  1DCP A;  2JA5 K;  4QJV A;  3GEE A;  4OIO A;  4A3C K;  3S2D K;  1O28 A;  4RMF A;  1ZQ1 C;  4C3I C;  4A93 K;  2ZUF A;  5IP9 C;  2B63 A;  2O5I A;  2YU9 C;  4LOW A;  4A3C C;  4C3J K;  2E2H C;  3GTL C;  3QX3 A;  2JA7 A;  4PAA A;  3GTQ A;  5M5W K;  2YU9 K;  1TWH C;  4C3J C;  5EGH A;  2CFA A;  3K7A K;  1R9T K;  4Q4Z A;  2Y0S D;  1ZVU A;  3S0X A;  1J6X A;  2FQT A;  2P5M A;  3K7A C;  1VRQ C;  3Q3Q A;  2WAQ L;  4QJV B;  4Q5S A;  4GTC A;  3M4O K;  1I3Q A;  3GTO A;  3GDZ A;  4A3D C;  4DDQ A;  2PHC B;  2WB1 D;  1YNJ A;  3PIP S;  1VGX A;  4OIN A;  1K83 A;  5IP7 K;  4KB4 A;  3FOE A;  1L0W A;  1FEU A;  3PO2 K;  1IE0 A;  1YNN A;  4G7Z A;  4BY1 K;  5CJ9 A;  3GTG K;  1TWC C;  3EQL A;  3NUH A;  2R7Z A;  1F7U A;  3RZO K;  2GAH C;  4KN4 A;  4BY1 C;  5IOT A;  5DM6 S;  4WJ3 M;  3AQO A;  1O24 A;  5CHP A;  4QIW L;  1G51 A;  1KQ4 A;  3T01 A;  4GFQ A;  2E2I A;  4P5B A;  1I6V A;  4NOI A;  1O27 A;  1VJE A;  3N0C A;  1VLO A;  1BDF A;  1O29 A;  2XCQ A;  1J98 A;  3GEH A;  3OEP A;  3LPX A;  4KAT A;  2A69 A;  2ZUE A;  3H0G C;  2ZJR S;  3S1N C;  2R93 A;  4OIR A;  4BLB A;  3H0G K;  1TWF K;  3PIO S;  3S1N K;  2E2H K;  5HL7 S;  3GTL K;  1Y1V C;  1B4A A;  3G4C A;  1IBA A;  5JFE A;  1XXB A;  4A3E C;  3AD9 C;  3CAG A;  4A3B C;  1Y1V K;  3GTP C;  3S2H C;  1EK8 A;  3LAJ A;  4O2D A;  2R92 C;  3T00 A;  4A3E K;  2XCR B;  1I50 K;  3N3Y A;  4A3B K;  4LK0 A;  3GTJ K;  1R9T A;  3S2H K;  3GTM C;  4AYB D;  3GTM K;  4A3K C;  4ZH4 A;  4KB2 A;  3T02 A;  4BXX C;  2NVX A;  5FLM C;  5IP7 C;  3BP3 A;  5IYC K;  2D6F C;  4A3K K;  4A3G K;  1UV7 A;  2GSU A;  4BLA A;  1O25 A;  4PAB A;  3HOV K;  4BXX K;  1Y1W C;  2NVT K;  4G0U A;  1IQ0 A;  4OIQ A;  1TWC K;  2KWA A;  2A6E A;  1ZYR A;  3RZO C;  1HQM A;  4OIP A;  1Y1W K;  2NVT C;  5JVG S;  2CW0 A;  3HOU K;  4A3F C;  3JST A;  2XCO A;  3GTG A;  3TTG A;  4WF9 S;  2KXY A;  1XZQ A;  4KMD A;  4AH6 A;  2JA7 K;  3HOZ C;  4GTA A;  4YFN A;  3HOU C;  3A8J A;  4A3F K;  1USM A;  3AD8 C;  1DD5 A;  3PO3 C;  5M5X K;  2JA7 C;  3V4G A;  2E2I K;  3N0B A;  2YU9 A;  3SZY A;  3PO3 K;  3LYW A;  5HQH A;  3S17 K;  1TWF C;  1IL2 A;  1XPP A;  2E2I C;  4YFK A;  1AB4 A;  4XSX A;  3S17 C;  2R93 K;  1TWA K;  4LLG A;  4KAW X;  2ZFZ A;  4KM8 A;  5E68 A;  3GTP K;  2R93 C;  5HL8 A;  3H0G A;  3WOD A;  2R92 K;  3GTK A;  1I50 C;  3S14 K;  2NVQ K;  3S1Q C;  1BJT A;  2V6S A;  3GTJ C;  2PPB A;  1WQG A;  1I50 A;  3S1Q K;  4WIL A;  3HOY K;  2R7Z K;  2CFA B;  2A6H A;  4MEY A;  1WCM A;  1USO A;  3A8I A;  1PJ6 A;  5C44 K;  5IYC C;  5FLM K;  1O26 A;  3I4M K;  2R7Z C;  3HOY C;  4A3G C;  3TFH A;  2Y3P A;  3HOV C;  2L5N A;  1XZP B;  5C44 C;  4FZB A;  3I4M C;  3ERE D;  2ZJP S;  2P8T A;  4XSZ A;  4WFN S;  3M3Y C;  1JQW A;  4WFA S;  4KC6 A;  4YG2 A;  3BUE A;  1SFO A;  3GEI A;  1I3Q C;  3HOZ K;  1SMY A;  2E2J K;  4IO9 S;  1WOR A;  5C3E K;  4ILD A;  5C4J K;  2E2J C;  4C2M K;  5C3E C;  3S16 C;  1EQR A;  1VH2 A;  2JA6 C;  3HOW C;  3L4K A;  4WJ4 A;  2JA5 A;  4C2M C;  1WOP A;  3S16 K;  3DXJ A;  2JA6 K;  3HOW K;  1TWA C;  3L4J A;  4GT9 A;  2L3U A;  4KMH A;  1XXA A;  4KM9 A;  4XCH A;  2NVY A;  1TWA A;  2RH6 A;  2GSN A;  4Y52 C;  1XZP A;  3S14 C; 
#chains in the Genus database with same CATH homology
 4YFN A;  2NVQ C;  3HOU C;  4LK1 A;  2VUM C;  4Q5S A;  3HOX K;  4A3F K;  3M4O K;  1WCM C;  3PO3 C;  5M5X K;  3GTK K;  4A3D C;  2WB1 D;  2JA7 C;  1YNJ A;  4Y52 K;  3HOX C;  2VUM K;  4A93 C;  4C3I K;  3I4N K;  4OIN A;  5IP9 K;  2E2I K;  1WCM K;  3S1M C;  3PO3 K;  3S1R C;  5IP7 K;  3S17 K;  1TWF C;  3PO2 K;  4X6A K;  1XPP A;  2JA7 K;  2E2I C;  4YFK A;  4XSX A;  3S1M K;  1YNN A;  4LJZ A;  4G7Z A;  1TWH K;  4BY1 K;  5IYD C;  3S17 C;  3GTG K;  1TWC C;  3EQL A;  2R93 K;  1R9T C;  1TWA K;  4LLG A;  3RZO K;  4BBS K;  4KN4 A;  4BY1 C;  5IYD K;  4BBR C;  3GTP K;  5C4X C;  2R93 C;  5M5Y K;  4QIW L;  2R92 K;  3M3Y K;  3WOD A;  4BY7 K;  2PMZ D;  1I50 C;  3S14 K;  2Y0S L;  2JA8 C;  2NVQ K;  3S1Q C;  1I6V A;  4NOI A;  4A3M K;  4JK1 A;  3M4O C;  3GTJ C;  1BDF A;  5IYB K;  1I3Q K;  3GTK C;  4A3D K;  4BY7 C;  4A3L C;  2PPB A;  2A69 A;  3S1Q K;  3CQZ C;  3H0G C;  4A3M C;  4KMU A;  2PA8 D;  3S1N C;  2PA8 L;  3HOY K;  5IYB C;  2R7Z K;  4MQ9 A;  3S1R K;  2A6H A;  5C4J C;  4MEY A;  4OIR A;  4XLN A;  5M3F K;  4A3L K;  5D4D A;  3S15 C;  5C44 K;  3H3V D;  3CQZ K;  3H0G K;  3PO2 C;  5IYC C;  1TWF K;  3FKI C;  5FLM K;  3I4M K;  3S1N K;  4C3H C;  2R7Z C;  3HOY C;  4A3J K;  2NVY C;  4MEX A;  4A3G C;  2O5J A;  2E2H K;  3GTL K;  1Y1V C;  4G7O A;  3HKZ D;  3GTQ K;  3GTG C;  3HKZ L;  3HOV C;  5C44 C;  5M3M K;  5FJ8 K;  4A3I C;  3I4M C;  4A3E C;  4A3J C;  4G7H A;  4C3H K;  4Y7N K;  3RZD K;  1K83 C;  4A3B C;  1Y1V K;  4BBR K;  3GTP C;  5C4X K;  2WAQ D;  3S2H C;  5TMC A;  4A3I K;  1TWG K;  4XSZ A;  2R92 C;  4KN7 A;  4Y7N C;  3RZD C;  3M3Y C;  4A3E K;  1I50 K;  2NVX K;  2JA8 K;  4A3B K;  2JA5 C;  4GZY A;  4LK0 A;  5TMF A;  4YG2 A;  3GTJ K;  3S2H K;  3GTM C;  2A68 A;  3GTO C;  1IW7 A;  3S2D C;  1I3Q C;  2WB1 L;  3HOZ K;  4AYB D;  1SMY A;  2NVX C;  4AYB L;  2E2J K;  2JA5 K;  5C3E K;  4QJV A;  4OIO A;  4A3K C;  3GTO K;  4XLP A;  3GTM K;  4A3C K;  3S2D K;  5C4J K;  2E2J C;  4ZH4 A;  4C2M K;  4C3I C;  3I4N C;  4A93 K;  3S15 K;  5IP9 C;  4BXX C;  5C3E C;  2O5I A;  3S16 C;  2YU9 C;  5FLM C;  5IP7 C;  3FKI K;  5IYC K;  2JA6 C;  3HOW C;  1SFO C;  4A3C C;  4C3J K;  1I6H C;  2NVY K;  2E2H C;  4A3K K;  3GTL C;  3GTQ C;  4A3G K;  4C2M C;  4YFX A;  4X6A C;  3HOV K;  3H3V L;  4BXX K;  1Y1W C;  3S16 K;  2NVT K;  5M5W K;  2YU9 K;  1TWH C;  3DXJ A;  2JA6 K;  3HOW K;  4C3J C;  1SFO K;  4OIQ A;  1K83 K;  1TWC K;  1I6H K;  3K7A K;  1TWA C;  4Q4Z A;  2A6E A;  1ZYR A;  3RZO C;  1HQM A;  4OIP A;  4QIW D;  2B63 C;  2NVT C;  1Y1W K;  1TWG C;  2CW0 A;  2PMZ L;  4BBS C;  2Y0S D;  3HOU K;  4A3F C;  1R9T K;  3K7A C;  2WAQ L;  2BE5 A;  2B63 K;  4Y52 C;  3S14 C;  3HOZ C;  4QJV B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...