1YNJA

Taq rna polymerase-sorangicin complex
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
230
structure length
230
Chain Sequence
LKAPVFTATTQGDHYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLDPKMASTTLILRAEGPKEVRAGDFTPSADVEIMNPDLHIATLEEGGKLYMEVRVDRGVGYVPAERHGIKDRINAIPVDAIFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVAILKEHLNYFANPEASLLPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase alpha chain
publication title Structural, functional, and genetic analysis of sorangicin inhibition of bacterial RNA polymerase
pubmed doi rcsb
molecule tags Transferase
total genus 43
structure length 230
sequence length 230
chains with identical sequence B
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2005-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01000 RNA_pol_A_bac RNA polymerase Rpb3/RpoA insert domain
A PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain
A PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.12 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 DNA-directed RNA polymerase, insert domain 1ynjA02
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 1ynjA01
4BBSK 4G7ZA 3S2DK 4G7HA 2NVXC 2NVQC 4OIQA 5C4JK 3M3YK 3M4OK 4LK0A 2Y0SL 2R92K 5IYCC 4Q4ZA 3S1MC 4LK1A 3CQZK 5FLMC 5M5XK 4C3HK 3GTKC 4BBRK 2JA6C 4A3DC 2A69A 1SFOK 4A3GK 3H3VD 4A3FK 4A3BC 3EQLA 3RZDC 4A3EC 3S1QC 3FKIC 4NOIA 5IP9C 3HOUC 3K7AC 1R9TK 3S17K 4A93K 3GTMK 2NVTK 2A6HA 3WODA 3HOWK 3S1RC 4BY1C 1I50K 2Y0SD 4QIWD 1XPPA 1I3QK 3DXJA 5TMFA 2A68A 2O5IA 4G7OA 4MEXA 4XSXA 1Y1WK 4BY7K 4X6AK 3S1NC 3HOYC 1I6HC 5C44C 4A3KK 1ZYRA 3GTPK 3S15K 1WCMK 4MQ9A 3S1MK 4OIPA 3S14C 1TWHK 4C2MK 4Y7NC 3GTKK 4Q5SA 4KN4A 4A3DK 4KN7A 3HOZC 3GTOC 3PO3C 3PO2K 4YFNA 1SMYA 4YFXA 4QIWL 1TWAC 4JK1A 4C3JC 1Y1VC 3K7AK 4C3IC 1BDFA 2YU9C 1TWCC 2JA5C 1TWFK 2NVYC 3S1RK 2E2HK 4XLPA 3I4NC 4A3CK 1K83K 2R93K 3GTJC 3GTGC 2JA8C 2B63K 5C4XC 2PA8D 4A3JK 3GTLC 3HOXK 2R7ZC 1I6VA 4A3LC 3H0GK 4OIRA 2E2IC 4Y52K 5IYDC 4BXXC 3RZOK 5D4DA 4XSZA 2O5JA 5C3EC 5IP7C 2E2JC 5M5WK 2JA7C 2PPBA 5IYBC 4A3IC 3HKZL 2NVXK 2NVQK 3S2HC 2VUMC 3HOVC 5IYCK 4A3MC 3S16C 5FLMK 5M5YK 2JA5K 4AYBL 3S2DC 2PA8L 2JA6K 3I4MC 4A3BK 4QJVB 3RZDK 4A3EK 3S1QK 3FKIK 5IP9K 3HOUK 2R92C 3HKZD 3GTQC 3CQZC 3GTLK 5M3FK 4C3HC 2R7ZK 4KMUA 4BBRC 4BY1K 4GZYA 5FJ8K 1SFOC 1TWGC 4A3GC 4A3FC 2WB1D 4AYBD 1R9TC 3S17C 1YNJA 4A93C 3GTMC 5M3MK 3S1NK 2NVTC 3HOYK 1I6HK 5C44K 4OINA 4MEYA 3HOWC 1I50C 3S2HK 4XLNA 1YNNA 2VUMK 1I3QC 4QJVA 4LJZA 1Y1WC 4BY7C 4X6AC 3S14K 4Y7NK 4YFKA 3HOZK 3PO3K 3GTPC 3GTOK 4A3KC 3I4MK 3S15C 1WCMC 2CW0A 1TWAK 4C3JK 1Y1VK 3GTQK 1HQMA 2WAQD 4BBSC 2WB1L 4C3IK 2YU9K 2PMZD 1TWHC 4C2MC 1TWCK 2NVYK 5C4JC 3M3YC 3PO2C 1TWGK 3I4NK 3M4OC 3GTJK 5TMCA 3GTGK 2JA8K 5C4XK 2BE5A 4OIOA 1TWFC 2E2HC 4A3LK 2A6EA 2E2IK 4BXXK 5IYDK 4A3CC 1K83C 4LLGA 2R93C 5C3EK 4YG2A 5IP7K 2E2JK 2JA7K 2B63C 4A3JC 5IYBK 3HOXC 4A3IK 2WAQL 1IW7A 2PMZL 3H0GC 3HOVK 4Y52C 3RZOC 4ZH4A 4A3MK 3S16K 3H3VL
chains in the Genus database with same CATH superfamily
4G7ZA 5CHPA 3OPFA 4G7HA 2NVXC 5C4JK 4OIQA 4WJ4A 1C0AA 5HL7S 4LK1A 3AD8C 3GEIA 2ZFZA 1SFOK 4FZBA 3GTOA 2RH6A 4LQYA 4PABA 4A93K 3GTMK 1L0WA 2A6HA 3DLLS 1XPPA 1I3QK 4G7OA 2O5IA 3FKIA 4AH6A 4MEXA 4XSXA 4KAWX 1Y1WK 4LOWA 3GTLA 3G4CA 1J6XA 2E2IA 3S15K 1WCMK 4KASA 3IPJA 4G0UA 1J98A 3S14C 3HOZC 3GTOC 2GAGC 1J6WA 3K7AK 1TWFK 2NVYC 5JVGS 4A3CK 1TWAA 1Y1VA 1WOPA 2JH3A 2B63K 3CQZA 4A3JK 3GTLC 1I6VA 3LYWA 2V6SA 4OIRA 2E2IC 4Y52K 5IYDC 4BXXC 3GTGA 2O5JA 4P9SA 5M5WK 3CAGA 2PHCB 3HKZL 5M5YK 3S2DC 4KM8A 4WILA 2KXYA 4QJVB 4GTEA 5IP9K 3HOUK 4J3NA 3TFJA 3CQZC 2R7ZK 4KMUA 4BBRC 4GZYA 5FJ8K 4A3GC 1YX2A 4A3FC 1YNJA 1VJEA 3S1NK 1WSRA 1XZPB 3HOYK 1I6HK 3HOWC 4MEYA 3N0BA 3S2HK 4XLNA 2VUMK 3Q3QA 4QJVA 2Y3PA 1R9TA 3GIRA 4BY7C 3AD9C 1O28A 1I50A 4A3KC 4DDQA 1WQFA 2CW0A 3AH5A 3N3YA 1WSVA 2W7VA 4C2MC 2P8TA 2V6TA 1J6VA 1XZPA 3PO2C 1TWGK 3OEPA 3M4OC 5TMCA 2JA8K 4WFNS 4KB2A 4A3LK 2A6EA 1WORA 2V6UA 5C3EK 4YG2A 5IP7K 2E2JK 2JA7K 4A3IK 5HL8A 3V4GA 1O29A 1IW7A 1JVIA 1WIHA 3ERED 5IOSA 4IO9S 1K83A 2R93A 3H3VL 3T00A 3H0GA 2NVQC 3FOFA 4LK0A 1JOEA 2R92K 5IYCC 3S1MC 3L4KA 5FLMC 4C3HK 3A8IA 3GSIA 2JA6C 2NVXA 4A3DC 2FQOA 3EQLA 3RZDC 4G0WA 1VRQC 2YU9A 1TWCA 3WODA 3N0CA 3S1RC 4BY1C 4KATA 3DXJA 5TMFA 3GTJA 1IBAA 2ZUFA 4X6AK 3BP3A 3GTPK 5C44C 4WFAS 1PJ5A 4KDDA 4OIPA 1TWHK 1EFWA 2ZJRS 1DD5A 4Q5SA 4KN7A 2CFAB 4GTFA 2FQTA 4YFXA 4PAAA 4C3JC 3SZYA 2YU9C 1TWCC 2E2HK 1HI9A 3GEEA 3GTJC 3NUHA 5C4XC 2PA8D 3HOXK 1ZBSA 3S0XA 2NVYA 1IS1A 1IQ0A 2CFAA 3RZOK 3AQPA 5IYBC 4WCES 3T01A 1FEUA 4IOCS 1ZXOA 3S16C 1EQRA 3PIPS 1RU0A 2PA8L 3I4MC 4A3BK 4A3EK 3S1QK 4KMDA 3FKIK 3HKZD 2GSOA 5JFEA 3GTLK 1SFOC 4IOAS 4A93C 3GTMC 1TWFA 4GT9A 4OINA 2KWAA 1YNNA 1I3QC 1Y1WC 1WQGA 4Y7NK 4YFKA 1O2BA 3PO3K 3S15C 1WCMC 3A8JA 1TWAK 1Y1VK 3LAPA 1HQMA 4BBSC 4C3IK 2PMZD 1WQHA 3M3YC 3I4NK 3GTGK 1DCPA 3GTKA 5DM7S 4OIOA 1TWFC 1BGWA 4A3CC 1PJ6A 2B63C 4A3JC 3G4AA 3PIOS 5E68A 2PMZL 3HOVK 4Y52C 1EH1A 4U67S 4A3MK 1GE9A 4GTDA 3M4OK 1O2FB 2Y0SL 4BLAA 3FHZA 4WJ3M 3GTKC 2EBBA 4GFQA 1X31C 2A69A 3FOEA 3H3VD 1IL2A 4G0VA 4NOIA 5IP9C 3HOUC 1R9TK 3S17K 2KPUA 2NVTK 2JA5A 2JA6A 1I50K 1USOA 1IE0A 1PJ7A 5EGHA 3S1NC 3HOYC 1I6HC 1XXBA 2D6FC 4MQ9A 3S1MK 5DM6S 4KMAA 3HXAA 4A3DK 4JK1A 2JA5C 4XCHA 3S1RK 5HQHA 4C45A 3BP8C 1K83K 2R93K 3GTQA 2JA8C 1AB4A 3JSTA 4P5AA 1B4BA 4A3LC 4BLBA 3H0GK 4KC6A 5D4DA 4XSZA 5C3EC 1BS2A 4GTCA 5IP7C 2E2JC 2JA7C 2PPBA 4A3IC 2NVXK 2XCOA 4AYBL 1O2AA 2R92C 3GTQC 4GTBA 1O25A 1USMA 4C3HC 3OREA 1O26A 2P5MA 3LPXA 1BJTA 2ZUEA 3LAJA 3BUEA 1SFOA 3TFHA 2RGRA 3GTMA 4X6AC 3S14K 1O27A 3HOZK 1F7UA 3GTPC 3GTOK 3I4MK 1I3QA 1UV7A 1VLOA 1Y1WA 1F93A 2WAQD 1TWHC 3SZZA 2NVYK 5C4JC 1VGXA 1WCMA 1ISEA 2E2HC 1WOSA 2E2IK 4BXXK 5IYDK 3GDZA 4BKWA 4LR2A 3HOXC 1B4AA 2WAQL 1DCHA 4KARA 3RZOC 4ZH4A 5JVHS 2B63A 4BBSK 2GAHC 3S2DK 4RMFA 3M3YK 1KQ4A 4Q4ZA 3CQZK 5M5XK 4WF9S 4BBRK 4M1XA 4ILDA 4A3GK 4A3FK 5CJ9A 4A3BC 4A3EC 3S1QC 3FKIC 3K7AC 3HOWK 2L5NA 2Y0SD 4QIWD 4P5BA 1JQWA 2A68A 2XCQA 4BY7K 2R7ZA 1ZVUA 1ZYRA 3CF5S 4A3KK 1XXCA 1XZQB 4C2MK 3GTKK 4Y7NC 4KN4A 3PO2K 3PO3C 3VA7A 2VUMA 4YFNA 1SMYA 3S16K 4QIWL 1TWAC 1Y1VC 4O2DA 4C3IC 1BDFA 4KMHA 2GSUA 5EGEA 5JVOA 2XCRB 4XLPA 3I4NC 2L3UA 3GTGC 1INNA 4WFBS 1F7VA 2ZJPS 2R7ZC 1XZQA 1TWGA 1F9NA 1YCLA 4GTAA 5IOTA 3GEHA 5IORA 2NVQK 3S2HC 2VUMC 3HOVC 5IYCK 1WOOA 4A3MC 4KM9A 2JA7A 5FLMK 2JA5K 2JA6K 1V5VA 3L4JA 3RZDK 5IOQA 5M3FK 1VH2A 4BY1K 5TJ3A 1TWGC 1DCOA 3AD7C 2WB1D 2R92A 4AYBD 5L46A 1R9TC 3S17C 5M3MK 3A8KA 1EK8A 2NVTC 1ZQ1C 5C44K 3TTGA 1I50C 4GTLA 4LJZA 3QX3A 4C3JK 3GTQK 2WB1L 2YU9K 1TWCK 3GTPA 1O24A 2ZJQS 3GTJK 5C4XK 2BE5A 2KQ1A 1TWHA 3MMLB 1G51A 1XXAA 1K83C 4LLGA 2R93C 5IYBK 2E2HA 3T02A 3TFIA 2GSNA 3H0GC 4KB4A 3AQOA 4FM9A 1EI6A 3ADAC
chains in the Genus database with same CATH topology
4BBSK 4G7ZA 3S2DK 4G7HA 2NVXC 2NVQC 4OIQA 5C4JK 3M3YK 3M4OK 4LK0A 2Y0SL 2R92K 5IYCC 4Q4ZA 3S1MC 4LK1A 3CQZK 5FLMC 5M5XK 4C3HK 3GTKC 4BBRK 2JA6C 4A3DC 2A69A 1SFOK 4A3GK 3H3VD 4A3FK 4A3BC 3EQLA 3RZDC 4A3EC 3S1QC 3FKIC 4NOIA 5IP9C 3HOUC 3K7AC 1R9TK 3S17K 4A93K 3GTMK 2NVTK 2A6HA 3WODA 3HOWK 3S1RC 4BY1C 1I50K 2Y0SD 4QIWD 1XPPA 1I3QK 3DXJA 5TMFA 2A68A 2O5IA 4G7OA 4MEXA 4XSXA 1Y1WK 4BY7K 4X6AK 3S1NC 3HOYC 1I6HC 5C44C 4A3KK 1ZYRA 3GTPK 3S15K 1WCMK 4MQ9A 3S1MK 4OIPA 3S14C 1TWHK 4C2MK 4Y7NC 3GTKK 4Q5SA 4KN4A 4A3DK 4KN7A 3HOZC 3GTOC 3PO3C 3PO2K 4YFNA 1SMYA 4YFXA 4QIWL 1TWAC 4JK1A 4C3JC 1Y1VC 3K7AK 4C3IC 1BDFA 2YU9C 1TWCC 2JA5C 1TWFK 2NVYC 3S1RK 2E2HK 4XLPA 3I4NC 4A3CK 1K83K 2R93K 3GTJC 3GTGC 2JA8C 2B63K 5C4XC 2PA8D 4A3JK 3GTLC 3HOXK 2R7ZC 1I6VA 4A3LC 3H0GK 4OIRA 2E2IC 4Y52K 5IYDC 4BXXC 3RZOK 5D4DA 4XSZA 2O5JA 5C3EC 5IP7C 2E2JC 5M5WK 2JA7C 2PPBA 5IYBC 4A3IC 3HKZL 2NVXK 2NVQK 3S2HC 2VUMC 3HOVC 5IYCK 4A3MC 3S16C 5FLMK 5M5YK 2JA5K 4AYBL 3S2DC 2PA8L 2JA6K 3I4MC 4A3BK 4QJVB 3RZDK 4A3EK 3S1QK 3FKIK 5IP9K 3HOUK 2R92C 3HKZD 3GTQC 3CQZC 3GTLK 5M3FK 4C3HC 2R7ZK 4KMUA 4BBRC 4BY1K 4GZYA 5FJ8K 1SFOC 1TWGC 4A3GC 4A3FC 2WB1D 4AYBD 1R9TC 3S17C 1YNJA 4A93C 3GTMC 5M3MK 3S1NK 2NVTC 3HOYK 1I6HK 5C44K 4OINA 4MEYA 3HOWC 1I50C 3S2HK 4XLNA 1YNNA 2VUMK 1I3QC 4QJVA 4LJZA 1Y1WC 4BY7C 4X6AC 3S14K 4Y7NK 4YFKA 3HOZK 3PO3K 3GTPC 3GTOK 4A3KC 3I4MK 3S15C 1WCMC 2CW0A 1TWAK 4C3JK 1Y1VK 3GTQK 1HQMA 2WAQD 4BBSC 2WB1L 4C3IK 2YU9K 2PMZD 1TWHC 4C2MC 1TWCK 2NVYK 5C4JC 3M3YC 3PO2C 1TWGK 3I4NK 3M4OC 3GTJK 5TMCA 3GTGK 2JA8K 5C4XK 2BE5A 4OIOA 1TWFC 2E2HC 4A3LK 2A6EA 2E2IK 4BXXK 5IYDK 4A3CC 1K83C 4LLGA 2R93C 5C3EK 4YG2A 5IP7K 2E2JK 2JA7K 2B63C 4A3JC 5IYBK 3HOXC 4A3IK 2WAQL 1IW7A 2PMZL 3H0GC 3HOVK 4Y52C 3RZOC 4ZH4A 4A3MK 3S16K 3H3VL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BBS K;  4G7Z A;  3S2D K;  4G7H A;  2NVX C;  2NVQ C;  4OIQ A;  5C4J K;  3M3Y K;  3M4O K;  4LK0 A;  2Y0S L;  2R92 K;  5IYC C;  4Q4Z A;  3S1M C;  4LK1 A;  3CQZ K;  5FLM C;  5M5X K;  4C3H K;  3GTK C;  4BBR K;  2JA6 C;  4A3D C;  2A69 A;  1SFO K;  4A3G K;  3H3V D;  4A3F K;  4A3B C;  3EQL A;  3RZD C;  4A3E C;  3S1Q C;  3FKI C;  4NOI A;  5IP9 C;  3HOU C;  3K7A C;  1R9T K;  3S17 K;  4A93 K;  3GTM K;  2NVT K;  2A6H A;  3WOD A;  3HOW K;  3S1R C;  4BY1 C;  1I50 K;  2Y0S D;  4QIW D;  1XPP A;  1I3Q K;  3DXJ A;  5TMF A;  2A68 A;  2O5I A;  4G7O A;  4MEX A;  4XSX A;  1Y1W K;  4BY7 K;  4X6A K;  3S1N C;  3HOY C;  1I6H C;  5C44 C;  4A3K K;  1ZYR A;  3GTP K;  3S15 K;  1WCM K;  4MQ9 A;  3S1M K;  4OIP A;  3S14 C;  1TWH K;  4C2M K;  4Y7N C;  3GTK K;  4Q5S A;  4KN4 A;  4A3D K;  4KN7 A;  3HOZ C;  3GTO C;  3PO3 C;  3PO2 K;  4YFN A;  1SMY A;  4YFX A;  4QIW L;  1TWA C;  4JK1 A;  4C3J C;  1Y1V C;  3K7A K;  4C3I C;  1BDF A;  2YU9 C;  1TWC C;  2JA5 C;  1TWF K;  2NVY C;  3S1R K;  2E2H K;  4XLP A;  3I4N C;  4A3C K;  1K83 K;  2R93 K;  3GTJ C;  3GTG C;  2JA8 C;  2B63 K;  5C4X C;  2PA8 D;  4A3J K;  3GTL C;  3HOX K;  2R7Z C;  1I6V A;  4A3L C;  3H0G K;  4OIR A;  2E2I C;  4Y52 K;  5IYD C;  4BXX C;  3RZO K;  5D4D A;  4XSZ A;  2O5J A;  5C3E C;  5IP7 C;  2E2J C;  5M5W K;  2JA7 C;  2PPB A;  5IYB C;  4A3I C;  3HKZ L;  2NVX K;  2NVQ K;  3S2H C;  2VUM C;  3HOV C;  5IYC K;  4A3M C;  3S16 C;  5FLM K;  5M5Y K;  2JA5 K;  4AYB L;  3S2D C;  2PA8 L;  2JA6 K;  3I4M C;  4A3B K;  4QJV B;  3RZD K;  4A3E K;  3S1Q K;  3FKI K;  5IP9 K;  3HOU K;  2R92 C;  3HKZ D;  3GTQ C;  3CQZ C;  3GTL K;  5M3F K;  4C3H C;  2R7Z K;  4KMU A;  4BBR C;  4BY1 K;  4GZY A;  5FJ8 K;  1SFO C;  1TWG C;  4A3G C;  4A3F C;  2WB1 D;  4AYB D;  1R9T C;  3S17 C;  1YNJ A;  4A93 C;  3GTM C;  5M3M K;  3S1N K;  2NVT C;  3HOY K;  1I6H K;  5C44 K;  4OIN A;  4MEY A;  3HOW C;  1I50 C;  3S2H K;  4XLN A;  1YNN A;  2VUM K;  1I3Q C;  4QJV A;  4LJZ A;  1Y1W C;  4BY7 C;  4X6A C;  3S14 K;  4Y7N K;  4YFK A;  3HOZ K;  3PO3 K;  3GTP C;  3GTO K;  4A3K C;  3I4M K;  3S15 C;  1WCM C;  2CW0 A;  1TWA K;  4C3J K;  1Y1V K;  3GTQ K;  1HQM A;  2WAQ D;  4BBS C;  2WB1 L;  4C3I K;  2YU9 K;  2PMZ D;  1TWH C;  4C2M C;  1TWC K;  2NVY K;  5C4J C;  3M3Y C;  3PO2 C;  1TWG K;  3I4N K;  3M4O C;  3GTJ K;  5TMC A;  3GTG K;  2JA8 K;  5C4X K;  2BE5 A;  4OIO A;  1TWF C;  2E2H C;  4A3L K;  2A6E A;  2E2I K;  4BXX K;  5IYD K;  4A3C C;  1K83 C;  4LLG A;  2R93 C;  5C3E K;  4YG2 A;  5IP7 K;  2E2J K;  2JA7 K;  2B63 C;  4A3J C;  5IYB K;  3HOX C;  4A3I K;  2WAQ L;  1IW7 A;  2PMZ L;  3H0G C;  3HOV K;  4Y52 C;  3RZO C;  4ZH4 A;  4A3M K;  3S16 K;  3H3V L; 
#chains in the Genus database with same CATH topology
 4G7Z A;  5CHP A;  3OPF A;  4G7H A;  2NVX C;  5C4J K;  4OIQ A;  4WJ4 A;  1C0A A;  5HL7 S;  4LK1 A;  3AD8 C;  3GEI A;  2ZFZ A;  1SFO K;  4FZB A;  3GTO A;  2RH6 A;  4LQY A;  4PAB A;  4A93 K;  3GTM K;  1L0W A;  2A6H A;  3DLL S;  1XPP A;  1I3Q K;  4G7O A;  2O5I A;  3FKI A;  4AH6 A;  4MEX A;  4XSX A;  4KAW X;  1Y1W K;  4LOW A;  3GTL A;  3G4C A;  1J6X A;  2E2I A;  3S15 K;  1WCM K;  4KAS A;  3IPJ A;  4G0U A;  1J98 A;  3S14 C;  3HOZ C;  3GTO C;  2GAG C;  1J6W A;  3K7A K;  1TWF K;  2NVY C;  5JVG S;  4A3C K;  1TWA A;  1Y1V A;  1WOP A;  2JH3 A;  2B63 K;  3CQZ A;  4A3J K;  3GTL C;  1I6V A;  3LYW A;  2V6S A;  4OIR A;  2E2I C;  4Y52 K;  5IYD C;  4BXX C;  3GTG A;  2O5J A;  4P9S A;  5M5W K;  3CAG A;  2PHC B;  3HKZ L;  5M5Y K;  3S2D C;  4KM8 A;  4WIL A;  2KXY A;  4QJV B;  4GTE A;  5IP9 K;  3HOU K;  4J3N A;  3TFJ A;  3CQZ C;  2R7Z K;  4KMU A;  4BBR C;  4GZY A;  5FJ8 K;  4A3G C;  1YX2 A;  4A3F C;  1YNJ A;  1VJE A;  3S1N K;  1WSR A;  1XZP B;  3HOY K;  1I6H K;  3HOW C;  4MEY A;  3N0B A;  3S2H K;  4XLN A;  2VUM K;  3Q3Q A;  4QJV A;  2Y3P A;  1R9T A;  3GIR A;  4BY7 C;  3AD9 C;  1O28 A;  1I50 A;  4A3K C;  4DDQ A;  1WQF A;  2CW0 A;  3AH5 A;  3N3Y A;  1WSV A;  2W7V A;  4C2M C;  2P8T A;  2V6T A;  1J6V A;  1XZP A;  3PO2 C;  1TWG K;  3OEP A;  3M4O C;  5TMC A;  2JA8 K;  4WFN S;  4KB2 A;  4A3L K;  2A6E A;  1WOR A;  2V6U A;  5C3E K;  4YG2 A;  5IP7 K;  2E2J K;  2JA7 K;  4A3I K;  5HL8 A;  3V4G A;  1O29 A;  1IW7 A;  1JVI A;  1WIH A;  3ERE D;  5IOS A;  4IO9 S;  1K83 A;  2R93 A;  3H3V L;  3T00 A;  3H0G A;  2NVQ C;  3FOF A;  4LK0 A;  1JOE A;  2R92 K;  5IYC C;  3S1M C;  3L4K A;  5FLM C;  4C3H K;  3A8I A;  3GSI A;  2JA6 C;  2NVX A;  4A3D C;  2FQO A;  3EQL A;  3RZD C;  4G0W A;  1VRQ C;  2YU9 A;  1TWC A;  3WOD A;  3N0C A;  3S1R C;  4BY1 C;  4KAT A;  3DXJ A;  5TMF A;  3GTJ A;  1IBA A;  2ZUF A;  4X6A K;  3BP3 A;  3GTP K;  5C44 C;  4WFA S;  1PJ5 A;  4KDD A;  4OIP A;  1TWH K;  1EFW A;  2ZJR S;  1DD5 A;  4Q5S A;  4KN7 A;  2CFA B;  4GTF A;  2FQT A;  4YFX A;  4PAA A;  4C3J C;  3SZY A;  2YU9 C;  1TWC C;  2E2H K;  1HI9 A;  3GEE A;  3GTJ C;  3NUH A;  5C4X C;  2PA8 D;  3HOX K;  1ZBS A;  3S0X A;  2NVY A;  1IS1 A;  1IQ0 A;  2CFA A;  3RZO K;  3AQP A;  5IYB C;  4WCE S;  3T01 A;  1FEU A;  4IOC S;  1ZXO A;  3S16 C;  1EQR A;  3PIP S;  1RU0 A;  2PA8 L;  3I4M C;  4A3B K;  4A3E K;  3S1Q K;  4KMD A;  3FKI K;  3HKZ D;  2GSO A;  5JFE A;  3GTL K;  1SFO C;  4IOA S;  4A93 C;  3GTM C;  1TWF A;  4GT9 A;  4OIN A;  2KWA A;  1YNN A;  1I3Q C;  1Y1W C;  1WQG A;  4Y7N K;  4YFK A;  1O2B A;  3PO3 K;  3S15 C;  1WCM C;  3A8J A;  1TWA K;  1Y1V K;  3LAP A;  1HQM A;  4BBS C;  4C3I K;  2PMZ D;  1WQH A;  3M3Y C;  3I4N K;  3GTG K;  1DCP A;  3GTK A;  5DM7 S;  4OIO A;  1TWF C;  1BGW A;  4A3C C;  1PJ6 A;  2B63 C;  4A3J C;  3G4A A;  3PIO S;  5E68 A;  2PMZ L;  3HOV K;  4Y52 C;  1EH1 A;  4U67 S;  4A3M K;  1GE9 A;  4GTD A;  3M4O K;  1O2F B;  2Y0S L;  4BLA A;  3FHZ A;  4WJ3 M;  3GTK C;  2EBB A;  4GFQ A;  1X31 C;  2A69 A;  3FOE A;  3H3V D;  1IL2 A;  4G0V A;  4NOI A;  5IP9 C;  3HOU C;  1R9T K;  3S17 K;  2KPU A;  2NVT K;  2JA5 A;  2JA6 A;  1I50 K;  1USO A;  1IE0 A;  1PJ7 A;  5EGH A;  3S1N C;  3HOY C;  1I6H C;  1XXB A;  2D6F C;  4MQ9 A;  3S1M K;  5DM6 S;  4KMA A;  3HXA A;  4A3D K;  4JK1 A;  2JA5 C;  4XCH A;  3S1R K;  5HQH A;  4C45 A;  3BP8 C;  1K83 K;  2R93 K;  3GTQ A;  2JA8 C;  1AB4 A;  3JST A;  4P5A A;  1B4B A;  4A3L C;  4BLB A;  3H0G K;  4KC6 A;  5D4D A;  4XSZ A;  5C3E C;  1BS2 A;  4GTC A;  5IP7 C;  2E2J C;  2JA7 C;  2PPB A;  4A3I C;  2NVX K;  2XCO A;  4AYB L;  1O2A A;  2R92 C;  3GTQ C;  4GTB A;  1O25 A;  1USM A;  4C3H C;  3ORE A;  1O26 A;  2P5M A;  3LPX A;  1BJT A;  2ZUE A;  3LAJ A;  3BUE A;  1SFO A;  3TFH A;  2RGR A;  3GTM A;  4X6A C;  3S14 K;  1O27 A;  3HOZ K;  1F7U A;  3GTP C;  3GTO K;  3I4M K;  1I3Q A;  1UV7 A;  1VLO A;  1Y1W A;  1F93 A;  2WAQ D;  1TWH C;  3SZZ A;  2NVY K;  5C4J C;  1VGX A;  1WCM A;  1ISE A;  2E2H C;  1WOS A;  2E2I K;  4BXX K;  5IYD K;  3GDZ A;  4BKW A;  4LR2 A;  3HOX C;  1B4A A;  2WAQ L;  1DCH A;  4KAR A;  3RZO C;  4ZH4 A;  5JVH S;  2B63 A;  4BBS K;  2GAH C;  3S2D K;  4RMF A;  3M3Y K;  1KQ4 A;  4Q4Z A;  3CQZ K;  5M5X K;  4WF9 S;  4BBR K;  4M1X A;  4ILD A;  4A3G K;  4A3F K;  5CJ9 A;  4A3B C;  4A3E C;  3S1Q C;  3FKI C;  3K7A C;  3HOW K;  2L5N A;  2Y0S D;  4QIW D;  4P5B A;  1JQW A;  2A68 A;  2XCQ A;  4BY7 K;  2R7Z A;  1ZVU A;  1ZYR A;  3CF5 S;  4A3K K;  1XXC A;  1XZQ B;  4C2M K;  3GTK K;  4Y7N C;  4KN4 A;  3PO2 K;  3PO3 C;  3VA7 A;  2VUM A;  4YFN A;  1SMY A;  3S16 K;  4QIW L;  1TWA C;  1Y1V C;  4O2D A;  4C3I C;  1BDF A;  4KMH A;  2GSU A;  5EGE A;  5JVO A;  2XCR B;  4XLP A;  3I4N C;  2L3U A;  3GTG C;  1INN A;  4WFB S;  1F7V A;  2ZJP S;  2R7Z C;  1XZQ A;  1TWG A;  1F9N A;  1YCL A;  4GTA A;  5IOT A;  3GEH A;  5IOR A;  2NVQ K;  3S2H C;  2VUM C;  3HOV C;  5IYC K;  1WOO A;  4A3M C;  4KM9 A;  2JA7 A;  5FLM K;  2JA5 K;  2JA6 K;  1V5V A;  3L4J A;  3RZD K;  5IOQ A;  5M3F K;  1VH2 A;  4BY1 K;  5TJ3 A;  1TWG C;  1DCO A;  3AD7 C;  2WB1 D;  2R92 A;  4AYB D;  5L46 A;  1R9T C;  3S17 C;  5M3M K;  3A8K A;  1EK8 A;  2NVT C;  1ZQ1 C;  5C44 K;  3TTG A;  1I50 C;  4GTL A;  4LJZ A;  3QX3 A;  4C3J K;  3GTQ K;  2WB1 L;  2YU9 K;  1TWC K;  3GTP A;  1O24 A;  2ZJQ S;  3GTJ K;  5C4X K;  2BE5 A;  2KQ1 A;  1TWH A;  3MML B;  1G51 A;  1XXA A;  1K83 C;  4LLG A;  2R93 C;  5IYB K;  2E2H A;  3T02 A;  3TFI A;  2GSN A;  3H0G C;  4KB4 A;  3AQO A;  4FM9 A;  1EI6 A;  3ADA C; 
#chains in the Genus database with same CATH homology
 4BBS K;  4G7Z A;  3S2D K;  4G7H A;  2NVX C;  2NVQ C;  4OIQ A;  5C4J K;  3M3Y K;  3M4O K;  4LK0 A;  2Y0S L;  2R92 K;  5IYC C;  4Q4Z A;  3S1M C;  4LK1 A;  3CQZ K;  5FLM C;  5M5X K;  4C3H K;  3GTK C;  4BBR K;  2JA6 C;  4A3D C;  2A69 A;  1SFO K;  4A3G K;  3H3V D;  4A3F K;  4A3B C;  3EQL A;  3RZD C;  4A3E C;  3S1Q C;  3FKI C;  4NOI A;  5IP9 C;  3HOU C;  3K7A C;  1R9T K;  3S17 K;  4A93 K;  3GTM K;  2NVT K;  2A6H A;  3WOD A;  3HOW K;  3S1R C;  4BY1 C;  1I50 K;  2Y0S D;  4QIW D;  1XPP A;  1I3Q K;  3DXJ A;  5TMF A;  2A68 A;  2O5I A;  4G7O A;  4MEX A;  4XSX A;  1Y1W K;  4BY7 K;  4X6A K;  3S1N C;  3HOY C;  1I6H C;  5C44 C;  4A3K K;  1ZYR A;  3GTP K;  3S15 K;  1WCM K;  4MQ9 A;  3S1M K;  4OIP A;  3S14 C;  1TWH K;  4C2M K;  4Y7N C;  3GTK K;  4Q5S A;  4KN4 A;  4A3D K;  4KN7 A;  3HOZ C;  3GTO C;  3PO3 C;  3PO2 K;  4YFN A;  1SMY A;  4YFX A;  4QIW L;  1TWA C;  4JK1 A;  4C3J C;  1Y1V C;  3K7A K;  4C3I C;  1BDF A;  2YU9 C;  1TWC C;  2JA5 C;  1TWF K;  2NVY C;  3S1R K;  2E2H K;  4XLP A;  3I4N C;  4A3C K;  1K83 K;  2R93 K;  3GTJ C;  3GTG C;  2JA8 C;  2B63 K;  5C4X C;  2PA8 D;  4A3J K;  3GTL C;  3HOX K;  2R7Z C;  1I6V A;  4A3L C;  3H0G K;  4OIR A;  2E2I C;  4Y52 K;  5IYD C;  4BXX C;  3RZO K;  5D4D A;  4XSZ A;  2O5J A;  5C3E C;  5IP7 C;  2E2J C;  5M5W K;  2JA7 C;  2PPB A;  5IYB C;  4A3I C;  3HKZ L;  2NVX K;  2NVQ K;  3S2H C;  2VUM C;  3HOV C;  5IYC K;  4A3M C;  3S16 C;  5FLM K;  5M5Y K;  2JA5 K;  4AYB L;  3S2D C;  2PA8 L;  2JA6 K;  3I4M C;  4A3B K;  4QJV B;  3RZD K;  4A3E K;  3S1Q K;  3FKI K;  5IP9 K;  3HOU K;  2R92 C;  3HKZ D;  3GTQ C;  3CQZ C;  3GTL K;  5M3F K;  4C3H C;  2R7Z K;  4KMU A;  4BBR C;  4BY1 K;  4GZY A;  5FJ8 K;  1SFO C;  1TWG C;  4A3G C;  4A3F C;  2WB1 D;  4AYB D;  1R9T C;  3S17 C;  1YNJ A;  4A93 C;  3GTM C;  5M3M K;  3S1N K;  2NVT C;  3HOY K;  1I6H K;  5C44 K;  4OIN A;  4MEY A;  3HOW C;  1I50 C;  3S2H K;  4XLN A;  1YNN A;  2VUM K;  1I3Q C;  4QJV A;  4LJZ A;  1Y1W C;  4BY7 C;  4X6A C;  3S14 K;  4Y7N K;  4YFK A;  3HOZ K;  3PO3 K;  3GTP C;  3GTO K;  4A3K C;  3I4M K;  3S15 C;  1WCM C;  2CW0 A;  1TWA K;  4C3J K;  1Y1V K;  3GTQ K;  1HQM A;  2WAQ D;  4BBS C;  2WB1 L;  4C3I K;  2YU9 K;  2PMZ D;  1TWH C;  4C2M C;  1TWC K;  2NVY K;  5C4J C;  3M3Y C;  3PO2 C;  1TWG K;  3I4N K;  3M4O C;  3GTJ K;  5TMC A;  3GTG K;  2JA8 K;  5C4X K;  2BE5 A;  4OIO A;  1TWF C;  2E2H C;  4A3L K;  2A6E A;  2E2I K;  4BXX K;  5IYD K;  4A3C C;  1K83 C;  4LLG A;  2R93 C;  5C3E K;  4YG2 A;  5IP7 K;  2E2J K;  2JA7 K;  2B63 C;  4A3J C;  5IYB K;  3HOX C;  4A3I K;  2WAQ L;  1IW7 A;  2PMZ L;  3H0G C;  3HOV K;  4Y52 C;  3RZO C;  4ZH4 A;  4A3M K;  3S16 K;  3H3V L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...