1YNJA

Taq rna polymerase-sorangicin complex
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
230
structure length
230
Chain Sequence
LKAPVFTATTQGDHYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLDPKMASTTLILRAEGPKEVRAGDFTPSADVEIMNPDLHIATLEEGGKLYMEVRVDRGVGYVPAERHGIKDRINAIPVDAIFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVAILKEHLNYFANPEASLLPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase alpha chain
publication title Structural, functional, and genetic analysis of sorangicin inhibition of bacterial RNA polymerase
pubmed doi rcsb
molecule tags Transferase
total genus 43
structure length 230
sequence length 230
chains with identical sequence B
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2005-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01000 RNA_pol_A_bac RNA polymerase Rpb3/RpoA insert domain
A PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain
A PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.12 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 DNA-directed RNA polymerase, insert domain 1ynjA02
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 1ynjA01
1IW7A 2B63C 1I6VA 1I3QK 4BBRK 4A3EK 4A3LK 2Y0SD 3H0GK 2R93K 4JK1A 3GTJK 3FKIK 3GTLK 3HOWC 4MEYA 4A3KK 4A3JK 3HOVK 3M3YK 1I6HK 4Q4ZA 5IYBC 3GTOC 2O5IA 4G7HA 3PO3K 4KMUA 3FKIC 5M3MK 4QIWD 4BXXC 2R92K 2VUMC 5IYCC 4A3DC 5C3EC 3S17C 3CQZK 2E2HK 2JA6K 3PO2K 4XSXA 4A3IC 5IP9K 2E2JC 2PMZD 5FJ8K 4BY7K 4QJVA 3S15C 4X6AK 2WAQD 4C3JK 3I4MK 3S1MC 5IP9C 1K83C 4LK1A 3HOZK 3S14C 4BY1K 3S1NC 4BXXK 4Y7NC 4A3CC 1SFOC 2Y0SL 1TWGC 3S1QK 1Y1WC 2PA8D 5IYDK 1ZYRA 1I50C 4LK0A 5C44C 2R92C 4A3GK 3S2DC 2NVQK 4OINA 2E2IK 4OIQA 1I3QC 1BDFA 4BBRC 4A3EC 4A3LC 2A68A 3H0GC 4QIWL 2R93C 4C2MK 2JA7K 3GTJC 4YFXA 3GTLC 4A3KC 2PPBA 3HOVC 4A3JC 3M3YC 1I6HC 1SMYA 2E2IC 3GTPK 3RZOK 5D4DA 4A3FK 3GTQK 4A93K 3PO3C 5M3FK 4MEXA 2PMZL 4C3IK 2BE5A 2NVTK 3CQZC 3S16K 2E2HC 2WAQL 4C3HK 1TWHK 3HOXK 1R9TK 4Y52K 4AYBL 3H3VD 2JA6C 3PO2C 4KN4A 4BBSK 5TMCA 5M5WK 1YNJA 2R7ZK 4AYBD 3RZDK 4Q5SA 3I4NK 4BY7C 2JA5K 4C3JC 4G7ZA 3I4MC 5IP7K 5C4JK 4A3MK 2PA8L 3HOYK 3HKZD 5C4XK 3HOZC 3GTGK 2NVXK 4BY1C 2O5JA 4GZYA 5C4JC 2NVYK 1Y1VK 2A69A 3S1RK 3S1QC 2WB1D 3GTGC 1WCMK 5M5XK 3GTMK 5IYDC 1TWFK 5FLMK 4YFNA 2YU9K 1Y1VC 2JA8K 4A3GC 1TWAC 3WODA 2NVQC 4ZH4A 3GTMC 3M4OK 4C2MC 3S2HC 2JA7C 3GTKK 4XLPA 2NVXC 3K7AK 4X6AC 4OIPA 3GTPC 3RZOC 1K83K 1TWAK 4A3FC 1TWCK 3H3VL 4XLNA 3GTQC 4A93C 2B63K 4G7OA 4C3IC 4YG2A 3HOWK 2NVTC 4Y52C 3S16C 4C3HC 1TWHC 3HOXC 1R9TC 1XPPA 5IYBK 3GTOK 3HKZL 4XSZA 4A3BK 4BBSC 2R7ZC 3EQLA 3RZDC 2VUMK 5IYCK 3I4NC 3DXJA 5C3EK 2JA5C 3S17K 4A3DK 4NOIA 4LJZA 4A3BC 3S2HK 5IP7C 2WB1L 4A3MC 3HOYC 5C4XC 4A3IK 2E2JK 2A6HA 4MQ9A 2NVYC 3S15K 4KN7A 5TMFA 3HOUK 1HQMA 3S1RC 3S1MK 1WCMC 4OIOA 4QJVB 1TWFC 5FLMC 2YU9C 3S14K 2JA8C 3S1NK 3HOUC 4Y7NK 4A3CK 2CW0A 5M5YK 1SFOK 3M4OC 2A6EA 4YFKA 1TWGK 1Y1WK 3GTKC 3K7AC 4LLGA 1I50K 5C44K 4OIRA 1YNNA 3S2DK 1TWCC
chains in the Genus database with same CATH superfamily
1IL2A 2KXYA 2B63C 3H0GK 2KQ1A 2R93K 5TJ3A 3GTLK 3HOWC 4A3KK 4A3JK 1PJ7A 3TTGA 4BXXC 2VUMC 5IYCC 5C3EC 1WSRA 4IO9S 2E2HK 4KB2A 1EFWA 2YU9A 1F7VA 3LYWA 4LQYA 4XSXA 1KQ4A 2W7VA 4BY7K 2GSOA 4QJVA 3S1MC 1F7UA 5IOSA 4LK1A 1F93A 1K83A 1IBAA 3S14C 1TWGA 4KARA 3S1NC 1Y1WA 2B63A 1O28A 1GE9A 4Y7NC 1SFOC 1O25A 3OEPA 1I50C 4LK0A 4WJ3M 4U67S 2NVQK 2D6FC 4OIQA 1BDFA 4BBRC 4A3EC 4QIWL 4YFXA 3GTPK 3RZOK 5D4DA 4A3FK 4MEXA 3OREA 4KMAA 4Y52K 4C3HK 1TWHK 2P5MA 4AYBL 2JA6C 4KN4A 2R7ZK 2XCQA 3AQOA 1SFOA 3JSTA 4C3JC 3I4MC 5IP7K 1C0AA 2PA8L 1USOA 3L4JA 2A69A 1DCPA 2WB1D 5IYDC 4A3GC 3LPXA 1XZQA 5IOQA 3S2HC 1VH2A 3K7AK 4LOWA 3L4KA 3GTKK 3A8IA 3IPJA 5IOTA 5EGHA 1VJEA 3N0CA 2JA6A 3H3VL 4XLNA 3GTQC 4A93C 4G7OA 1TWHA 1JVIA 5L46A 1XPPA 3HOXC 4C45A 1WQFA 3HKZL 1AB4A 3RZDC 3I4NC 2JA5C 3S17K 4NOIA 5JVHS 4KM9A 1WSVA 2E2JK 3QX3A 4KN7A 5TMFA 1O24A 4QJVB 1TWFC 1USMA 4GTAA 4P9SA 1YX2A 3M4OC 2A6EA 4YFKA 4WILA 4LLGA 5EGEA 4OIRA 2R92K 1TWAC 4DDQA 3S2DK 1J98A 4A3LK 1EI6A 1X31C 2JA5A 4JK1A 3GTJK 3M3YK 4WJ4A 3FHZA 3HOVK 3GTOC 4G7HA 4KASA 4KMUA 4QIWD 3VA7A 1TWFA 4A3IC 5IP9K 5FJ8K 3S15C 4KAWX 5DM7S 5IP9C 1TWAA 3SZZA 3HOZK 4G0VA 4KMHA 3N0BA 2R92A 1TWGC 3S1QK 1Y1WC 2PA8D 3GTOA 5C44C 1B4AA 3GTJA 4WCES 2A68A 3H0GC 3AD7C 2R93C 4C2MK 2JA7K 1JQWA 3GTLC 2NVXK 4A3KC 1XZQB 4X6AK 4A3JC 4IOAS 3BP3A 5M3FK 3TFHA 2BE5A 5HL8A 1ZVUA 2E2HC 2L5NA 2WAQL 1R9TK 3H3VD 3G4CA 3FOFA 5TMCA 4P5AA 4BY7C 1WQGA 1RU0A 3PIPS 4A3MK 3HKZD 4GTFA 1XXCA 2KWAA 2NVYK 3G4AA 3H0GA 2R93A 2Y3PA 3GTLA 5JVGS 2CFAB 3S1RK 1DCHA 1WCMK 4FZBA 3V4GA 2NVQC 1O27A 2E2HA 4WF9S 3GTPC 3RZOC 4KATA 4A3FC 1TWCK 1O2FB 1B4BA 4Y52C 4C3HC 1TWHC 5IYBK 4XSZA 3DLLS 2R7ZC 4A3DK 2ZUEA 4XCHA 1EK8A 4LJZA 3OPFA 5IP7C 1O29A 1BJTA 4MQ9A 3GEHA 3HOUK 3GTPA 4OIOA 2RH6A 3HOUC 4A3CK 3GSIA 1WOPA 3GTKC 3K7AC 1XXAA 1YNNA 1IW7A 2R7ZA 1ZBSA 1I3QK 3AD9C 4KDDA 2EBBA 3FKIK 3BP8C 4GTDA 1I6HK 3ADAC 4Q4ZA 2O5IA 3PO3K 3FKIC 1YCLA 5M3MK 3S17C 3CQZK 2CFAA 2JH3A 3GIRA 4GT9A 3PO2K 2E2JC 1F9NA 1UV7A 3GTKA 2WAQD 4GTLA 4BY1K 4PAAA 4BKWA 4WFAS 2Y0SL 2GSNA 2R92C 2GSUA 3S2DC 3FKIA 3NUHA 4OINA 2E2IK 4A3LC 3GTMK 3GTJC 3M3YC 2PPBA 3HOVC 2E2IC 1BS2A 1J6WA 5JFEA 2PMZL 4C3IK 2L3UA 5HL7S 1ZQ1C 4IOCS 2NVTK 3S16K 3A8JA 4BBSK 4AYBD 3Q3QA 1PJ6A 4BLAA 2V6SA 3GEEA 5C4JK 2XCOA 3HOYK 4FM9A 5C4XK 3AH5A 3CF5S 3HOZC 1HI9A 2FQOA 4KMDA 2O5JA 5C4JC 3S1QC 5M5XK 2E2IA 1XZPB 2GAGC 5FLMK 2YU9K 3GTMA 2JA8K 5DM6S 2ZJPS 3WODA 1WQHA 4M1XA 1XXBA 4C2MC 2JA7C 4XLPA 2NVXC 4GTCA 4X6AC 1L0WA 4OIPA 3T02A 1G51A 1K83K 2V6TA 2B63K 4YG2A 3HOWK 1V5VA 1R9TC 4A3BK 3TFJA 1FEUA 3EQLA 3GEIA 2VUMK 5IYCK 4BXXK 3DXJA 5C3EK 4KM8A 3AQPA 4A3BC 4BLBA 4A3MC 2RGRA 2A6HA 2NVYC 1EH1A 2JA7A 5CHPA 3S0XA 2NVXA 1HQMA 3S1RC 3S1MK 1WCMC 4RMFA 3S14K 3S1NK 3CAGA 3HXAA 4G0WA 4J3NA 4Y7NK 2CW0A 1J6VA 1IQ0A 1SFOK 1R9TA 1I50K 1TWCC 2ZUFA 1VRQC 4O2DA 1I6VA 4BBRK 4A3EK 1WORA 2Y0SD 4MEYA 1ISEA 5IYBC 2VUMA 5HQHA 4WFBS 3MMLB 2NVYA 4A3DC 4P5BA 1WCMA 1XZPA 2JA6K 4PABA 2PMZD 3N3YA 1DD5A 4C3JK 3A8KA 3I4MK 1TWCA 1IE0A 3LAJA 4A3CC 1I50A 1O2AA 4ILDA 1INNA 2KPUA 2P8TA 5IYDK 1ZYRA 3PIOS 4A3GK 1O26A 3ERED 1I3QC 3S2HK 1I6HC 1SMYA 1EQRA 2GAHC 3GTQK 4A93K 1BGWA 3PO3C 4GTBA 3BUEA 1VLOA 3CQZC 3HOXK 2PHCB 5E68A 3T01A 3FOEA 3PO2C 1IS1A 5M5WK 1YNJA 3RZDK 4Q5SA 4LR2A 3I4NK 2JA5K 4G7ZA 4GTEA 3GTGK 4BY1C 4GZYA 1I3QA 1Y1VK 3GTGC 2ZJQS 1TWFK 4GFQA 4YFNA 1Y1VC 2V6UA 4ZH4A 3GTMC 3LAPA 3TFIA 3M4OK 1O2BA 3CQZA 3GTQA 5CJ9A 1J6XA 1TWAK 4KB4A 1WOSA 4AH6A 1ZXOA 4C3IC 3GDZA 2NVTC 3AD8C 3S16C 2XCRB 3GTOK 4BBSC 5IORA 1VGXA 4WFNS 3SZYA 3GTGA 2WB1L 2ZFZA 5JVOA 1DCOA 3HOYC 1JOEA 1Y1VA 5C4XC 4KC6A 4A3IK 3S15K 1PJ5A 4G0UA 1WIHA 5FLMC 2YU9C 2ZJRS 2JA8C 2FQTA 5M5YK 1TWGK 3T00A 1Y1WK 5C44K 1WOOA 1K83C
chains in the Genus database with same CATH topology
1IW7A 2B63C 1I6VA 1I3QK 4BBRK 4A3EK 4A3LK 2Y0SD 3H0GK 2R93K 4JK1A 3GTJK 3FKIK 3GTLK 3HOWC 4MEYA 4A3KK 4A3JK 3HOVK 3M3YK 1I6HK 4Q4ZA 5IYBC 3GTOC 2O5IA 4G7HA 3PO3K 4KMUA 3FKIC 5M3MK 4QIWD 4BXXC 2R92K 2VUMC 5IYCC 4A3DC 5C3EC 3S17C 3CQZK 2E2HK 2JA6K 3PO2K 4XSXA 4A3IC 5IP9K 2E2JC 2PMZD 5FJ8K 4BY7K 4QJVA 3S15C 4X6AK 2WAQD 4C3JK 3I4MK 3S1MC 5IP9C 1K83C 4LK1A 3HOZK 3S14C 4BY1K 3S1NC 4BXXK 4Y7NC 4A3CC 1SFOC 2Y0SL 1TWGC 3S1QK 1Y1WC 2PA8D 5IYDK 1ZYRA 1I50C 4LK0A 5C44C 2R92C 4A3GK 3S2DC 2NVQK 4OINA 2E2IK 4OIQA 1I3QC 1BDFA 4BBRC 4A3EC 4A3LC 2A68A 3H0GC 4QIWL 2R93C 4C2MK 2JA7K 3GTJC 4YFXA 3GTLC 4A3KC 2PPBA 3HOVC 4A3JC 3M3YC 1I6HC 1SMYA 2E2IC 3GTPK 3RZOK 5D4DA 4A3FK 3GTQK 4A93K 3PO3C 5M3FK 4MEXA 2PMZL 4C3IK 2BE5A 2NVTK 3CQZC 3S16K 2E2HC 2WAQL 4C3HK 1TWHK 3HOXK 1R9TK 4Y52K 4AYBL 3H3VD 2JA6C 3PO2C 4KN4A 4BBSK 5TMCA 5M5WK 1YNJA 2R7ZK 4AYBD 3RZDK 4Q5SA 3I4NK 4BY7C 2JA5K 4C3JC 4G7ZA 3I4MC 5IP7K 5C4JK 4A3MK 2PA8L 3HOYK 3HKZD 5C4XK 3HOZC 3GTGK 2NVXK 4BY1C 2O5JA 4GZYA 5C4JC 2NVYK 1Y1VK 2A69A 3S1RK 3S1QC 2WB1D 3GTGC 1WCMK 5M5XK 3GTMK 5IYDC 1TWFK 5FLMK 4YFNA 2YU9K 1Y1VC 2JA8K 4A3GC 1TWAC 3WODA 2NVQC 4ZH4A 3GTMC 3M4OK 4C2MC 3S2HC 2JA7C 3GTKK 4XLPA 2NVXC 3K7AK 4X6AC 4OIPA 3GTPC 3RZOC 1K83K 1TWAK 4A3FC 1TWCK 3H3VL 4XLNA 3GTQC 4A93C 2B63K 4G7OA 4C3IC 4YG2A 3HOWK 2NVTC 4Y52C 3S16C 4C3HC 1TWHC 3HOXC 1R9TC 1XPPA 5IYBK 3GTOK 3HKZL 4XSZA 4A3BK 4BBSC 2R7ZC 3EQLA 3RZDC 2VUMK 5IYCK 3I4NC 3DXJA 5C3EK 2JA5C 3S17K 4A3DK 4NOIA 4LJZA 4A3BC 3S2HK 5IP7C 2WB1L 4A3MC 3HOYC 5C4XC 4A3IK 2E2JK 2A6HA 4MQ9A 2NVYC 3S15K 4KN7A 5TMFA 3HOUK 1HQMA 3S1RC 3S1MK 1WCMC 4OIOA 4QJVB 1TWFC 5FLMC 2YU9C 3S14K 2JA8C 3S1NK 3HOUC 4Y7NK 4A3CK 2CW0A 5M5YK 1SFOK 3M4OC 2A6EA 4YFKA 1TWGK 1Y1WK 3GTKC 3K7AC 4LLGA 1I50K 5C44K 4OIRA 1YNNA 3S2DK 1TWCC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IW7 A;  2B63 C;  1I6V A;  1I3Q K;  4BBR K;  4A3E K;  4A3L K;  2Y0S D;  3H0G K;  2R93 K;  4JK1 A;  3GTJ K;  3FKI K;  3GTL K;  3HOW C;  4MEY A;  4A3K K;  4A3J K;  3HOV K;  3M3Y K;  1I6H K;  4Q4Z A;  5IYB C;  3GTO C;  2O5I A;  4G7H A;  3PO3 K;  4KMU A;  3FKI C;  5M3M K;  4QIW D;  4BXX C;  2R92 K;  2VUM C;  5IYC C;  4A3D C;  5C3E C;  3S17 C;  3CQZ K;  2E2H K;  2JA6 K;  3PO2 K;  4XSX A;  4A3I C;  5IP9 K;  2E2J C;  2PMZ D;  5FJ8 K;  4BY7 K;  4QJV A;  3S15 C;  4X6A K;  2WAQ D;  4C3J K;  3I4M K;  3S1M C;  5IP9 C;  1K83 C;  4LK1 A;  3HOZ K;  3S14 C;  4BY1 K;  3S1N C;  4BXX K;  4Y7N C;  4A3C C;  1SFO C;  2Y0S L;  1TWG C;  3S1Q K;  1Y1W C;  2PA8 D;  5IYD K;  1ZYR A;  1I50 C;  4LK0 A;  5C44 C;  2R92 C;  4A3G K;  3S2D C;  2NVQ K;  4OIN A;  2E2I K;  4OIQ A;  1I3Q C;  1BDF A;  4BBR C;  4A3E C;  4A3L C;  2A68 A;  3H0G C;  4QIW L;  2R93 C;  4C2M K;  2JA7 K;  3GTJ C;  4YFX A;  3GTL C;  4A3K C;  2PPB A;  3HOV C;  4A3J C;  3M3Y C;  1I6H C;  1SMY A;  2E2I C;  3GTP K;  3RZO K;  5D4D A;  4A3F K;  3GTQ K;  4A93 K;  3PO3 C;  5M3F K;  4MEX A;  2PMZ L;  4C3I K;  2BE5 A;  2NVT K;  3CQZ C;  3S16 K;  2E2H C;  2WAQ L;  4C3H K;  1TWH K;  3HOX K;  1R9T K;  4Y52 K;  4AYB L;  3H3V D;  2JA6 C;  3PO2 C;  4KN4 A;  4BBS K;  5TMC A;  5M5W K;  1YNJ A;  2R7Z K;  4AYB D;  3RZD K;  4Q5S A;  3I4N K;  4BY7 C;  2JA5 K;  4C3J C;  4G7Z A;  3I4M C;  5IP7 K;  5C4J K;  4A3M K;  2PA8 L;  3HOY K;  3HKZ D;  5C4X K;  3HOZ C;  3GTG K;  2NVX K;  4BY1 C;  2O5J A;  4GZY A;  5C4J C;  2NVY K;  1Y1V K;  2A69 A;  3S1R K;  3S1Q C;  2WB1 D;  3GTG C;  1WCM K;  5M5X K;  3GTM K;  5IYD C;  1TWF K;  5FLM K;  4YFN A;  2YU9 K;  1Y1V C;  2JA8 K;  4A3G C;  1TWA C;  3WOD A;  2NVQ C;  4ZH4 A;  3GTM C;  3M4O K;  4C2M C;  3S2H C;  2JA7 C;  3GTK K;  4XLP A;  2NVX C;  3K7A K;  4X6A C;  4OIP A;  3GTP C;  3RZO C;  1K83 K;  1TWA K;  4A3F C;  1TWC K;  3H3V L;  4XLN A;  3GTQ C;  4A93 C;  2B63 K;  4G7O A;  4C3I C;  4YG2 A;  3HOW K;  2NVT C;  4Y52 C;  3S16 C;  4C3H C;  1TWH C;  3HOX C;  1R9T C;  1XPP A;  5IYB K;  3GTO K;  3HKZ L;  4XSZ A;  4A3B K;  4BBS C;  2R7Z C;  3EQL A;  3RZD C;  2VUM K;  5IYC K;  3I4N C;  3DXJ A;  5C3E K;  2JA5 C;  3S17 K;  4A3D K;  4NOI A;  4LJZ A;  4A3B C;  3S2H K;  5IP7 C;  2WB1 L;  4A3M C;  3HOY C;  5C4X C;  4A3I K;  2E2J K;  2A6H A;  4MQ9 A;  2NVY C;  3S15 K;  4KN7 A;  5TMF A;  3HOU K;  1HQM A;  3S1R C;  3S1M K;  1WCM C;  4OIO A;  4QJV B;  1TWF C;  5FLM C;  2YU9 C;  3S14 K;  2JA8 C;  3S1N K;  3HOU C;  4Y7N K;  4A3C K;  2CW0 A;  5M5Y K;  1SFO K;  3M4O C;  2A6E A;  4YFK A;  1TWG K;  1Y1W K;  3GTK C;  3K7A C;  4LLG A;  1I50 K;  5C44 K;  4OIR A;  1YNN A;  3S2D K;  1TWC C; 
#chains in the Genus database with same CATH topology
 1IL2 A;  2KXY A;  2B63 C;  3H0G K;  2KQ1 A;  2R93 K;  5TJ3 A;  3GTL K;  3HOW C;  4A3K K;  4A3J K;  1PJ7 A;  3TTG A;  4BXX C;  2VUM C;  5IYC C;  5C3E C;  1WSR A;  4IO9 S;  2E2H K;  4KB2 A;  1EFW A;  2YU9 A;  1F7V A;  3LYW A;  4LQY A;  4XSX A;  1KQ4 A;  2W7V A;  4BY7 K;  2GSO A;  4QJV A;  3S1M C;  1F7U A;  5IOS A;  4LK1 A;  1F93 A;  1K83 A;  1IBA A;  3S14 C;  1TWG A;  4KAR A;  3S1N C;  1Y1W A;  2B63 A;  1O28 A;  1GE9 A;  4Y7N C;  1SFO C;  1O25 A;  3OEP A;  1I50 C;  4LK0 A;  4WJ3 M;  4U67 S;  2NVQ K;  2D6F C;  4OIQ A;  1BDF A;  4BBR C;  4A3E C;  4QIW L;  4YFX A;  3GTP K;  3RZO K;  5D4D A;  4A3F K;  4MEX A;  3ORE A;  4KMA A;  4Y52 K;  4C3H K;  1TWH K;  2P5M A;  4AYB L;  2JA6 C;  4KN4 A;  2R7Z K;  2XCQ A;  3AQO A;  1SFO A;  3JST A;  4C3J C;  3I4M C;  5IP7 K;  1C0A A;  2PA8 L;  1USO A;  3L4J A;  2A69 A;  1DCP A;  2WB1 D;  5IYD C;  4A3G C;  3LPX A;  1XZQ A;  5IOQ A;  3S2H C;  1VH2 A;  3K7A K;  4LOW A;  3L4K A;  3GTK K;  3A8I A;  3IPJ A;  5IOT A;  5EGH A;  1VJE A;  3N0C A;  2JA6 A;  3H3V L;  4XLN A;  3GTQ C;  4A93 C;  4G7O A;  1TWH A;  1JVI A;  5L46 A;  1XPP A;  3HOX C;  4C45 A;  1WQF A;  3HKZ L;  1AB4 A;  3RZD C;  3I4N C;  2JA5 C;  3S17 K;  4NOI A;  5JVH S;  4KM9 A;  1WSV A;  2E2J K;  3QX3 A;  4KN7 A;  5TMF A;  1O24 A;  4QJV B;  1TWF C;  1USM A;  4GTA A;  4P9S A;  1YX2 A;  3M4O C;  2A6E A;  4YFK A;  4WIL A;  4LLG A;  5EGE A;  4OIR A;  2R92 K;  1TWA C;  4DDQ A;  3S2D K;  1J98 A;  4A3L K;  1EI6 A;  1X31 C;  2JA5 A;  4JK1 A;  3GTJ K;  3M3Y K;  4WJ4 A;  3FHZ A;  3HOV K;  3GTO C;  4G7H A;  4KAS A;  4KMU A;  4QIW D;  3VA7 A;  1TWF A;  4A3I C;  5IP9 K;  5FJ8 K;  3S15 C;  4KAW X;  5DM7 S;  5IP9 C;  1TWA A;  3SZZ A;  3HOZ K;  4G0V A;  4KMH A;  3N0B A;  2R92 A;  1TWG C;  3S1Q K;  1Y1W C;  2PA8 D;  3GTO A;  5C44 C;  1B4A A;  3GTJ A;  4WCE S;  2A68 A;  3H0G C;  3AD7 C;  2R93 C;  4C2M K;  2JA7 K;  1JQW A;  3GTL C;  2NVX K;  4A3K C;  1XZQ B;  4X6A K;  4A3J C;  4IOA S;  3BP3 A;  5M3F K;  3TFH A;  2BE5 A;  5HL8 A;  1ZVU A;  2E2H C;  2L5N A;  2WAQ L;  1R9T K;  3H3V D;  3G4C A;  3FOF A;  5TMC A;  4P5A A;  4BY7 C;  1WQG A;  1RU0 A;  3PIP S;  4A3M K;  3HKZ D;  4GTF A;  1XXC A;  2KWA A;  2NVY K;  3G4A A;  3H0G A;  2R93 A;  2Y3P A;  3GTL A;  5JVG S;  2CFA B;  3S1R K;  1DCH A;  1WCM K;  4FZB A;  3V4G A;  2NVQ C;  1O27 A;  2E2H A;  4WF9 S;  3GTP C;  3RZO C;  4KAT A;  4A3F C;  1TWC K;  1O2F B;  1B4B A;  4Y52 C;  4C3H C;  1TWH C;  5IYB K;  4XSZ A;  3DLL S;  2R7Z C;  4A3D K;  2ZUE A;  4XCH A;  1EK8 A;  4LJZ A;  3OPF A;  5IP7 C;  1O29 A;  1BJT A;  4MQ9 A;  3GEH A;  3HOU K;  3GTP A;  4OIO A;  2RH6 A;  3HOU C;  4A3C K;  3GSI A;  1WOP A;  3GTK C;  3K7A C;  1XXA A;  1YNN A;  1IW7 A;  2R7Z A;  1ZBS A;  1I3Q K;  3AD9 C;  4KDD A;  2EBB A;  3FKI K;  3BP8 C;  4GTD A;  1I6H K;  3ADA C;  4Q4Z A;  2O5I A;  3PO3 K;  3FKI C;  1YCL A;  5M3M K;  3S17 C;  3CQZ K;  2CFA A;  2JH3 A;  3GIR A;  4GT9 A;  3PO2 K;  2E2J C;  1F9N A;  1UV7 A;  3GTK A;  2WAQ D;  4GTL A;  4BY1 K;  4PAA A;  4BKW A;  4WFA S;  2Y0S L;  2GSN A;  2R92 C;  2GSU A;  3S2D C;  3FKI A;  3NUH A;  4OIN A;  2E2I K;  4A3L C;  3GTM K;  3GTJ C;  3M3Y C;  2PPB A;  3HOV C;  2E2I C;  1BS2 A;  1J6W A;  5JFE A;  2PMZ L;  4C3I K;  2L3U A;  5HL7 S;  1ZQ1 C;  4IOC S;  2NVT K;  3S16 K;  3A8J A;  4BBS K;  4AYB D;  3Q3Q A;  1PJ6 A;  4BLA A;  2V6S A;  3GEE A;  5C4J K;  2XCO A;  3HOY K;  4FM9 A;  5C4X K;  3AH5 A;  3CF5 S;  3HOZ C;  1HI9 A;  2FQO A;  4KMD A;  2O5J A;  5C4J C;  3S1Q C;  5M5X K;  2E2I A;  1XZP B;  2GAG C;  5FLM K;  2YU9 K;  3GTM A;  2JA8 K;  5DM6 S;  2ZJP S;  3WOD A;  1WQH A;  4M1X A;  1XXB A;  4C2M C;  2JA7 C;  4XLP A;  2NVX C;  4GTC A;  4X6A C;  1L0W A;  4OIP A;  3T02 A;  1G51 A;  1K83 K;  2V6T A;  2B63 K;  4YG2 A;  3HOW K;  1V5V A;  1R9T C;  4A3B K;  3TFJ A;  1FEU A;  3EQL A;  3GEI A;  2VUM K;  5IYC K;  4BXX K;  3DXJ A;  5C3E K;  4KM8 A;  3AQP A;  4A3B C;  4BLB A;  4A3M C;  2RGR A;  2A6H A;  2NVY C;  1EH1 A;  2JA7 A;  5CHP A;  3S0X A;  2NVX A;  1HQM A;  3S1R C;  3S1M K;  1WCM C;  4RMF A;  3S14 K;  3S1N K;  3CAG A;  3HXA A;  4G0W A;  4J3N A;  4Y7N K;  2CW0 A;  1J6V A;  1IQ0 A;  1SFO K;  1R9T A;  1I50 K;  1TWC C;  2ZUF A;  1VRQ C;  4O2D A;  1I6V A;  4BBR K;  4A3E K;  1WOR A;  2Y0S D;  4MEY A;  1ISE A;  5IYB C;  2VUM A;  5HQH A;  4WFB S;  3MML B;  2NVY A;  4A3D C;  4P5B A;  1WCM A;  1XZP A;  2JA6 K;  4PAB A;  2PMZ D;  3N3Y A;  1DD5 A;  4C3J K;  3A8K A;  3I4M K;  1TWC A;  1IE0 A;  3LAJ A;  4A3C C;  1I50 A;  1O2A A;  4ILD A;  1INN A;  2KPU A;  2P8T A;  5IYD K;  1ZYR A;  3PIO S;  4A3G K;  1O26 A;  3ERE D;  1I3Q C;  3S2H K;  1I6H C;  1SMY A;  1EQR A;  2GAH C;  3GTQ K;  4A93 K;  1BGW A;  3PO3 C;  4GTB A;  3BUE A;  1VLO A;  3CQZ C;  3HOX K;  2PHC B;  5E68 A;  3T01 A;  3FOE A;  3PO2 C;  1IS1 A;  5M5W K;  1YNJ A;  3RZD K;  4Q5S A;  4LR2 A;  3I4N K;  2JA5 K;  4G7Z A;  4GTE A;  3GTG K;  4BY1 C;  4GZY A;  1I3Q A;  1Y1V K;  3GTG C;  2ZJQ S;  1TWF K;  4GFQ A;  4YFN A;  1Y1V C;  2V6U A;  4ZH4 A;  3GTM C;  3LAP A;  3TFI A;  3M4O K;  1O2B A;  3CQZ A;  3GTQ A;  5CJ9 A;  1J6X A;  1TWA K;  4KB4 A;  1WOS A;  4AH6 A;  1ZXO A;  4C3I C;  3GDZ A;  2NVT C;  3AD8 C;  3S16 C;  2XCR B;  3GTO K;  4BBS C;  5IOR A;  1VGX A;  4WFN S;  3SZY A;  3GTG A;  2WB1 L;  2ZFZ A;  5JVO A;  1DCO A;  3HOY C;  1JOE A;  1Y1V A;  5C4X C;  4KC6 A;  4A3I K;  3S15 K;  1PJ5 A;  4G0U A;  1WIH A;  5FLM C;  2YU9 C;  2ZJR S;  2JA8 C;  2FQT A;  5M5Y K;  1TWG K;  3T00 A;  1Y1W K;  5C44 K;  1WOO A;  1K83 C; 
#chains in the Genus database with same CATH homology
 1IW7 A;  2B63 C;  1I6V A;  1I3Q K;  4BBR K;  4A3E K;  4A3L K;  2Y0S D;  3H0G K;  2R93 K;  4JK1 A;  3GTJ K;  3FKI K;  3GTL K;  3HOW C;  4MEY A;  4A3K K;  4A3J K;  3HOV K;  3M3Y K;  1I6H K;  4Q4Z A;  5IYB C;  3GTO C;  2O5I A;  4G7H A;  3PO3 K;  4KMU A;  3FKI C;  5M3M K;  4QIW D;  4BXX C;  2R92 K;  2VUM C;  5IYC C;  4A3D C;  5C3E C;  3S17 C;  3CQZ K;  2E2H K;  2JA6 K;  3PO2 K;  4XSX A;  4A3I C;  5IP9 K;  2E2J C;  2PMZ D;  5FJ8 K;  4BY7 K;  4QJV A;  3S15 C;  4X6A K;  2WAQ D;  4C3J K;  3I4M K;  3S1M C;  5IP9 C;  1K83 C;  4LK1 A;  3HOZ K;  3S14 C;  4BY1 K;  3S1N C;  4BXX K;  4Y7N C;  4A3C C;  1SFO C;  2Y0S L;  1TWG C;  3S1Q K;  1Y1W C;  2PA8 D;  5IYD K;  1ZYR A;  1I50 C;  4LK0 A;  5C44 C;  2R92 C;  4A3G K;  3S2D C;  2NVQ K;  4OIN A;  2E2I K;  4OIQ A;  1I3Q C;  1BDF A;  4BBR C;  4A3E C;  4A3L C;  2A68 A;  3H0G C;  4QIW L;  2R93 C;  4C2M K;  2JA7 K;  3GTJ C;  4YFX A;  3GTL C;  4A3K C;  2PPB A;  3HOV C;  4A3J C;  3M3Y C;  1I6H C;  1SMY A;  2E2I C;  3GTP K;  3RZO K;  5D4D A;  4A3F K;  3GTQ K;  4A93 K;  3PO3 C;  5M3F K;  4MEX A;  2PMZ L;  4C3I K;  2BE5 A;  2NVT K;  3CQZ C;  3S16 K;  2E2H C;  2WAQ L;  4C3H K;  1TWH K;  3HOX K;  1R9T K;  4Y52 K;  4AYB L;  3H3V D;  2JA6 C;  3PO2 C;  4KN4 A;  4BBS K;  5TMC A;  5M5W K;  1YNJ A;  2R7Z K;  4AYB D;  3RZD K;  4Q5S A;  3I4N K;  4BY7 C;  2JA5 K;  4C3J C;  4G7Z A;  3I4M C;  5IP7 K;  5C4J K;  4A3M K;  2PA8 L;  3HOY K;  3HKZ D;  5C4X K;  3HOZ C;  3GTG K;  2NVX K;  4BY1 C;  2O5J A;  4GZY A;  5C4J C;  2NVY K;  1Y1V K;  2A69 A;  3S1R K;  3S1Q C;  2WB1 D;  3GTG C;  1WCM K;  5M5X K;  3GTM K;  5IYD C;  1TWF K;  5FLM K;  4YFN A;  2YU9 K;  1Y1V C;  2JA8 K;  4A3G C;  1TWA C;  3WOD A;  2NVQ C;  4ZH4 A;  3GTM C;  3M4O K;  4C2M C;  3S2H C;  2JA7 C;  3GTK K;  4XLP A;  2NVX C;  3K7A K;  4X6A C;  4OIP A;  3GTP C;  3RZO C;  1K83 K;  1TWA K;  4A3F C;  1TWC K;  3H3V L;  4XLN A;  3GTQ C;  4A93 C;  2B63 K;  4G7O A;  4C3I C;  4YG2 A;  3HOW K;  2NVT C;  4Y52 C;  3S16 C;  4C3H C;  1TWH C;  3HOX C;  1R9T C;  1XPP A;  5IYB K;  3GTO K;  3HKZ L;  4XSZ A;  4A3B K;  4BBS C;  2R7Z C;  3EQL A;  3RZD C;  2VUM K;  5IYC K;  3I4N C;  3DXJ A;  5C3E K;  2JA5 C;  3S17 K;  4A3D K;  4NOI A;  4LJZ A;  4A3B C;  3S2H K;  5IP7 C;  2WB1 L;  4A3M C;  3HOY C;  5C4X C;  4A3I K;  2E2J K;  2A6H A;  4MQ9 A;  2NVY C;  3S15 K;  4KN7 A;  5TMF A;  3HOU K;  1HQM A;  3S1R C;  3S1M K;  1WCM C;  4OIO A;  4QJV B;  1TWF C;  5FLM C;  2YU9 C;  3S14 K;  2JA8 C;  3S1N K;  3HOU C;  4Y7N K;  4A3C K;  2CW0 A;  5M5Y K;  1SFO K;  3M4O C;  2A6E A;  4YFK A;  1TWG K;  1Y1W K;  3GTK C;  3K7A C;  4LLG A;  1I50 K;  5C44 K;  4OIR A;  1YNN A;  3S2D K;  1TWC C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...