1YNJA

Taq rna polymerase-sorangicin complex
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
230
structure length
230
Chain Sequence
LKAPVFTATTQGDHYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLDPKMASTTLILRAEGPKEVRAGDFTPSADVEIMNPDLHIATLEEGGKLYMEVRVDRGVGYVPAERHGIKDRINAIPVDAIFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVAILKEHLNYFANPEASLLPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural, functional, and genetic analysis of sorangicin inhibition of bacterial RNA polymerase
pubmed doi rcsb
molecule tags Transferase
molecule keywords DNA-directed RNA polymerase alpha chain
total genus 43
structure length 230
sequence length 230
chains with identical sequence B
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2005-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01000 RNA_pol_A_bac RNA polymerase Rpb3/RpoA insert domain
A PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain
A PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.12 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 DNA-directed RNA polymerase, insert domain 1ynjA02
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 1ynjA01
4A3GC 2A69A 3PO3C 4LK0A 3H0GK 4G7HA 3GTOK 5IP9C 2PA8L 2JA5C 3I4NC 4C2MK 4LLGA 4NOIA 4A3CC 4XLNA 1TWHC 4QJVA 3RZDC 4BXXC 2E2IK 1TWCC 2PPBA 4Q4ZA 3FKIK 1I50K 3S2HK 5C3EC 4YFKA 1WCMK 5C4XK 2B63C 3M4OK 1TWGC 2A6HA 1YNNA 4X6AK 3M3YC 3HOYC 2JA6K 1BDFA 4BBSC 2E2HC 4C3HK 4C3JC 3GTKK 4BBRK 4A3FK 3PO2K 5TMFA 3GTLC 2A68A 2PMZD 2PA8D 4A3BK 2JA7C 3I4MK 2JA7K 3HOWK 4A3BC 3GTMC 5FJ8K 3GTLK 3PO2C 5M5XK 3S16K 3S2DK 3HOVK 1I6HK 4XSZA 4C3HC 4AYBL 3GTJC 2JA6C 5IYDC 4C3IK 3GTQC 3HOYK 3M3YK 4X6AC 4KMUA 3S1RC 4LK1A 2B63K 2NVXC 1Y1WC 4XLPA 5C44C 5C3EK 3FKIC 2Y0SD 1TWCK 5D4DA 4OIQA 2WAQL 5IYCK 1TWHK 1I6VA 2A6EA 2VUMC 1I3QC 5IP7C 4MQ9A 2R7ZC 4C2MC 2R7ZK 5IP7K 1HQMA 2JA5K 1I3QK 2VUMK 5IP9K 4OINA 3GTOC 2CW0A 3H0GC 3PO3K 3H3VL 5IYCC 1IW7A 4KN7A 4A3JK 1XPPA 4KN4A 5C44K 4A3FC 4GZYA 3DXJA 3GTGC 4QJVB 1Y1WK 2NVXK 3GTPK 3S1RK 4JK1A 1K83C 5FLMK 3H3VD 4A3EK 3GTQK 4C3IC 3GTJK 5IYDK 3S15C 4XSXA 3EQLA 4A3DK 3S14K 3HOVC 2R92C 4A3MC 3S2DC 1I6HC 1TWFK 1TWAK 3S16C 4Y7NC 1SFOK 5IYBC 2JA8K 3GTMK 3HOUK 3S1QK 3HOWC 4BY1K 3S1MC 3I4MC 3WODA 3HKZD 4AYBD 1ZYRA 4YFNA 2NVTC 4Y52K 5M5YK 1YNJA 2E2JK 2R93C 5M3FK 2NVYK 4BBRC 3CQZC 2BE5A 5M5WK 4MEXA 4QIWD 5C4JC 4G7ZA 3S1NC 3GTKC 3K7AK 4C3JK 2Y0SL 5M3MK 2E2HK 4A3IC 4BBSK 4YG2A 4ZH4A 1R9TK 1TWGK 1R9TC 3S17C 3M4OC 5C4XC 3S17K 1WCMC 4YFXA 3S2HC 1I50C 4A3IK 2E2IC 3K7AC 4G7OA 5C4JK 3RZDK 3S1NK 4BXXK 2WB1D 4OIRA 3CQZK 2NVYC 4A3CK 3HKZL 3I4NK 4BY7K 2R93K 2E2JC 2WAQD 4Y52C 2NVTK 3S1MK 2O5IA 4BY1C 1SMYA 4OIOA 2WB1L 4A3LK 4A3GK 3S1QC 2JA8C 3HOUC 5IYBK 2NVQC 4A93K 1SFOC 3HOXC 1TWAC 4Q5SA 1TWFC 4Y7NK 4MEYA 2PMZL 4OIPA 4A3MK 2R92K 1Y1VC 4A3KC 3S14C 3RZOK 2YU9C 4A3DC 3HOZK 5TMCA 3S15K 2O5JA 3HOZC 4A3EC 2YU9K 5FLMC 1K83K 1Y1VK 4A3KK 3RZOC 4A3LC 3HOXK 4A93C 3GTGK 2NVQK 3GTPC 4BY7C 4LJZA 4A3JC 4QIWL
chains in the Genus database with same CATH superfamily
3PO3C 3H0GK 3GSIA 3GTPA 2PA8L 2V6UA 5JFEA 1XXBA 2ZJPS 1JVIA 4WFAS 4BXXC 2R7ZA 2PHCB 2D6FC 1O2AA 1WCMK 5C4XK 5IOQA 3N0CA 5HL8A 4KM8A 4KARA 4BBSC 2E2HC 4DDQA 3GTMA 4BBRK 1WCMA 5TMFA 2P8TA 2A68A 1O2BA 2ZFZA 4GTBA 3L4KA 1IQ0A 1WORA 2ZJRS 2GAGC 5FJ8K 2JA7A 5JVOA 1DD5A 1VGXA 4C3IK 4KMUA 3GTKA 3GEIA 5C44C 5D4DA 2L3UA 1HQMA 1XXAA 1TWAA 1I3QK 5IP9K 4OINA 5IYCC 3OPFA 4WCES 4WJ4A 1IW7A 5C44K 4A3FC 3FOEA 3GTPK 4QJVB 1IL2A 4WFBS 3GTQK 3GTJK 2FQTA 3S15C 3FHZA 3EQLA 4A3DK 3S14K 4C45A 1I6HC 1TWAK 3GTMK 1BGWA 4YFNA 2KXYA 2E2JK 2RGRA 2NVYK 4BBRC 2BE5A 2XCRB 4G7ZA 1WQGA 4C3JK 2E2HK 3VA7A 3HXAA 1TWGK 1R9TC 3S17C 2E2IA 5C4XC 5DM7S 3CQZA 2GAHC 1I50C 2ZUEA 4M1XA 4A3IK 3DLLS 4G7OA 1X31C 3GDZA 1DCPA 3AQOA 2NVYC 4RMFA 3I4NK 2E2JC 1TWGA 2ZJQS 2NVTK 1UV7A 2O5IA 1SMYA 3S1QC 2JA8C 3HOUC 4A93K 3HOXC 1TWAC 4FM9A 4MEYA 4A3MK 4OIPA 3T01A 1Y1VC 4A3KC 4A3DC 2YU9K 1K83K 3AD8C 1HI9A 3GTPC 5IORA 3MMLB 4A3FK 4QIWL 3GTQA 3CF5S 1B4BA 1USMA 4GTLA 4WILA 4KDDA 5IP9C 2L5NA 4LLGA 4A3CC 4BLBA 1JOEA 3N0BA 3RZDC 1R9TA 2PPBA 3FKIK 4ILDA 1TWHA 1RU0A 3A8KA 3TFHA 2R92A 3GTKK 4PABA 3V4GA 1WSVA 4P9SA 1J6XA 1PJ5A 4A3BC 1EI6A 3S2DK 2V6SA 4BLAA 2CFAA 3GTLA 4GT9A 4C3HC 4KB4A 5IOTA 1O29A 2KPUA 4X6AC 3S1RC 5CHPA 1TWCK 4LOWA 4OIQA 1XZPB 2A6EA 4P5BA 4C2MC 2R7ZK 3OEPA 2JH3A 2P5MA 5IP7K 4KASA 2R93A 3GTOC 3S0XA 2CW0A 3H0GC 3PO3K 3H3VL 1O2FB 4A3JK 1TWFA 4GZYA 3DXJA 3GTGC 2KWAA 1XZPA 1Y1WK 2NVXK 4GTDA 1EH1A 3BP3A 2ZUFA 4G0WA 2FQOA 3HOVC 1VH2A 1TWFK 3GEEA 4Y7NC 1SFOK 3HOWC 5JVGS 2JA6A 3WODA 3HKZD 1O25A 1BS2A 1L0WA 4QIWD 1BJTA 5C4JC 3S1NC 3K7AK 4YG2A 3BP8C 3PIOS 4KAWX 4ZH4A 4KC6A 4U67S 3S2HC 1O28A 5HL7S 3JSTA 2E2IC 2GSOA 1C0AA 4GFQA 1GE9A 4OIRA 3ADAC 1IE0A 3CQZK 1Y1VA 4Y52C 4BY1C 4A3GK 4OIOA 3AH5A 2W7VA 1I3QA 5IYBK 3LAJA 4Q5SA 4G0UA 3RZOK 1PJ7A 1VRQC 3HOZK 5TMCA 1USOA 5CJ9A 4XCHA 4A3EC 5FLMC 3A8IA 5L46A 3AQPA 4A3LC 1I50A 4BY7C 4GTFA 4A3GC 1EK8A 4LK0A 4G7HA 2NVXA 2JA5C 1FEUA 4NOIA 3H0GA 4XLNA 1TWHC 4QJVA 5E68A 2V6TA 2E2IK 1ZQ1C 5C3EC 2B63C 3M4OK 1PJ6A 2A6HA 3M3YC 3HOYC 2JA6K 4KMAA 4BKWA 3GEHA 5TJ3A 3GTLC 1VJEA 4KB2A 2PA8D 3I4MK 1WSRA 2JA7K 4GTCA 3PO2C 5M5XK 3S16K 3AD7C 3GTJA 3HOVK 5IYDC 3HOYK 4LK1A 3GIRA 2NVXC 1Y1WC 4XLPA 1F9NA 1WQFA 2YU9A 2WAQL 4KM9A 4P5AA 4KATA 2VUMC 2R7ZC 1JQWA 2JA5K 2VUMK 1AB4A 1ISEA 3LPXA 5EGEA 4KN7A 1XPPA 4KN4A 3GTOA 3S1RK 4JK1A 5FLMK 1VLOA 3H3VD 5IYDK 2R92C 3S2DC 3S16C 1WOSA 3AD9C 5IYBC 3LYWA 1K83A 4BY1K 3S1MC 3I4MC 4LR2A 4AYBD 5M5YK 1ZXOA 2R93C 5M3FK 1J98A 3GTKC 2Y0SL 4PAAA 3M4OC 1O27A 1F7UA 1WOPA 1WIHA 3RZDK 3A8JA 2WB1D 2CFAB 4AH6A 2R93K 3G4AA 1F93A 3S1MK 1TWFC 4LQYA 4A3LK 2R92K 2XCOA 4GTAA 1F7VA 1WOOA 1SFOA 3HOZC 1Y1VK 4A3KK 3RZOC 4A93C 3GTGK 4A3JC 2KQ1A 4WF9S 2A69A 3GTOK 1G51A 3Q3QA 3I4NC 4C2MK 3IPJA 1TWCC 4Q4ZA 2EBBA 1I50K 5EGHA 3S2HK 4YFKA 2RH6A 1TWGC 4X6AK 1YNNA 1IBAA 1BDFA 5IOSA 4C3HK 4C3JC 2XCQA 3PO2K 1IS1A 2B63A 3T02A 2PMZD 3TFJA 4A3BK 2JA7C 3HOWK 3NUHA 4KMDA 3GTMC 3GTLK 4WJ3M 3CAGA 4XSZA 4AYBL 3GTJC 2JA6C 3GTQC 3M3YK 3LAPA 3OREA 2GSNA 2B63K 1YCLA 5C3EK 3FKIC 3TTGA 4IOAS 2Y0SD 4IOCS 5IYCK 1XZQA 1TWHK 1I6VA 2NVQK 5HQHA 1I3QC 5IP7C 4MQ9A 1TWCA 1O26A 4IO9S 3T00A 4BY7K 4FZBA 1DCOA 5JVHS 1K83C 1J6VA 4A3EK 4C3IC 3G4CA 4G0VA 4XSXA 2E2HA 4A3MC 3FOFA 2JA5A 1ZBSA 3L4JA 4O2DA 2JA8K 3HOUK 3SZYA 2NVYA 3S1QK 2NVTC 4WFNS 1ZYRA 4Y52K 1YNJA 1XXCA 5DM6S 3CQZC 3FKIA 5M5WK 4MEXA 5M3MK 1EFWA 4A3IC 4BBSK 4J3NA 1R9TK 2GSUA 3S17K 1WCMC 4YFXA 4KMHA 3SZZA 3QX3A 4GTEA 1Y1WA 4BXXK 3K7AC 3S1NK 5C4JK 3GTGA 1J6WA 4A3CK 1YX2A 3HKZL 2VUMA 2WAQD 1O24A 3TFIA 2WB1L 1DCHA 2NVQC 1B4AA 1SFOC 4Y7NK 3PIPS 1ZVUA 1I6HK 2PMZL 1INNA 3S14C 2YU9C 1KQ4A 1WQHA 3S15K 3N3YA 2O5JA 3ERED 3BUEA 1V5VA 3HOXK 1XZQB 1EQRA 4LJZA 2Y3PA
chains in the Genus database with same CATH topology
4A3GC 2A69A 3PO3C 4LK0A 3H0GK 4G7HA 3GTOK 5IP9C 2PA8L 2JA5C 3I4NC 4C2MK 4LLGA 4NOIA 4A3CC 4XLNA 1TWHC 4QJVA 3RZDC 4BXXC 2E2IK 1TWCC 2PPBA 4Q4ZA 3FKIK 1I50K 3S2HK 5C3EC 4YFKA 1WCMK 5C4XK 2B63C 3M4OK 1TWGC 2A6HA 1YNNA 4X6AK 3M3YC 3HOYC 2JA6K 1BDFA 4BBSC 2E2HC 4C3HK 4C3JC 3GTKK 4BBRK 4A3FK 3PO2K 5TMFA 3GTLC 2A68A 2PMZD 2PA8D 4A3BK 2JA7C 3I4MK 2JA7K 3HOWK 4A3BC 3GTMC 5FJ8K 3GTLK 3PO2C 5M5XK 3S16K 3S2DK 3HOVK 1I6HK 4XSZA 4C3HC 4AYBL 3GTJC 2JA6C 5IYDC 4C3IK 3GTQC 3HOYK 3M3YK 4X6AC 4KMUA 3S1RC 4LK1A 2B63K 2NVXC 1Y1WC 4XLPA 5C44C 5C3EK 3FKIC 2Y0SD 1TWCK 5D4DA 4OIQA 2WAQL 5IYCK 1TWHK 1I6VA 2A6EA 2VUMC 1I3QC 5IP7C 4MQ9A 2R7ZC 4C2MC 2R7ZK 5IP7K 1HQMA 2JA5K 1I3QK 2VUMK 5IP9K 4OINA 3GTOC 2CW0A 3H0GC 3PO3K 3H3VL 5IYCC 1IW7A 4KN7A 4A3JK 1XPPA 4KN4A 5C44K 4A3FC 4GZYA 3DXJA 3GTGC 4QJVB 1Y1WK 2NVXK 3GTPK 3S1RK 4JK1A 1K83C 5FLMK 3H3VD 4A3EK 3GTQK 4C3IC 3GTJK 5IYDK 3S15C 4XSXA 3EQLA 4A3DK 3S14K 3HOVC 2R92C 4A3MC 3S2DC 1I6HC 1TWFK 1TWAK 3S16C 4Y7NC 1SFOK 5IYBC 2JA8K 3GTMK 3HOUK 3S1QK 3HOWC 4BY1K 3S1MC 3I4MC 3WODA 3HKZD 4AYBD 1ZYRA 4YFNA 2NVTC 4Y52K 5M5YK 1YNJA 2E2JK 2R93C 5M3FK 2NVYK 4BBRC 3CQZC 2BE5A 5M5WK 4MEXA 4QIWD 5C4JC 4G7ZA 3S1NC 3GTKC 3K7AK 4C3JK 2Y0SL 5M3MK 2E2HK 4A3IC 4BBSK 4YG2A 4ZH4A 1R9TK 1TWGK 1R9TC 3S17C 3M4OC 5C4XC 3S17K 1WCMC 4YFXA 3S2HC 1I50C 4A3IK 2E2IC 3K7AC 4G7OA 5C4JK 3RZDK 3S1NK 4BXXK 2WB1D 4OIRA 3CQZK 2NVYC 4A3CK 3HKZL 3I4NK 4BY7K 2R93K 2E2JC 2WAQD 4Y52C 2NVTK 3S1MK 2O5IA 4BY1C 1SMYA 4OIOA 2WB1L 4A3LK 4A3GK 3S1QC 2JA8C 3HOUC 5IYBK 2NVQC 4A93K 1SFOC 3HOXC 1TWAC 4Q5SA 1TWFC 4Y7NK 4MEYA 2PMZL 4OIPA 4A3MK 2R92K 1Y1VC 4A3KC 3S14C 3RZOK 2YU9C 4A3DC 3HOZK 5TMCA 3S15K 2O5JA 3HOZC 4A3EC 2YU9K 5FLMC 1K83K 1Y1VK 4A3KK 3RZOC 4A3LC 3HOXK 4A93C 3GTGK 2NVQK 3GTPC 4BY7C 4LJZA 4A3JC 4QIWL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A3G C;  2A69 A;  3PO3 C;  4LK0 A;  3H0G K;  4G7H A;  3GTO K;  5IP9 C;  2PA8 L;  2JA5 C;  3I4N C;  4C2M K;  4LLG A;  4NOI A;  4A3C C;  4XLN A;  1TWH C;  4QJV A;  3RZD C;  4BXX C;  2E2I K;  1TWC C;  2PPB A;  4Q4Z A;  3FKI K;  1I50 K;  3S2H K;  5C3E C;  4YFK A;  1WCM K;  5C4X K;  2B63 C;  3M4O K;  1TWG C;  2A6H A;  1YNN A;  4X6A K;  3M3Y C;  3HOY C;  2JA6 K;  1BDF A;  4BBS C;  2E2H C;  4C3H K;  4C3J C;  3GTK K;  4BBR K;  4A3F K;  3PO2 K;  5TMF A;  3GTL C;  2A68 A;  2PMZ D;  2PA8 D;  4A3B K;  2JA7 C;  3I4M K;  2JA7 K;  3HOW K;  4A3B C;  3GTM C;  5FJ8 K;  3GTL K;  3PO2 C;  5M5X K;  3S16 K;  3S2D K;  3HOV K;  1I6H K;  4XSZ A;  4C3H C;  4AYB L;  3GTJ C;  2JA6 C;  5IYD C;  4C3I K;  3GTQ C;  3HOY K;  3M3Y K;  4X6A C;  4KMU A;  3S1R C;  4LK1 A;  2B63 K;  2NVX C;  1Y1W C;  4XLP A;  5C44 C;  5C3E K;  3FKI C;  2Y0S D;  1TWC K;  5D4D A;  4OIQ A;  2WAQ L;  5IYC K;  1TWH K;  1I6V A;  2A6E A;  2VUM C;  1I3Q C;  5IP7 C;  4MQ9 A;  2R7Z C;  4C2M C;  2R7Z K;  5IP7 K;  1HQM A;  2JA5 K;  1I3Q K;  2VUM K;  5IP9 K;  4OIN A;  3GTO C;  2CW0 A;  3H0G C;  3PO3 K;  3H3V L;  5IYC C;  1IW7 A;  4KN7 A;  4A3J K;  1XPP A;  4KN4 A;  5C44 K;  4A3F C;  4GZY A;  3DXJ A;  3GTG C;  4QJV B;  1Y1W K;  2NVX K;  3GTP K;  3S1R K;  4JK1 A;  1K83 C;  5FLM K;  3H3V D;  4A3E K;  3GTQ K;  4C3I C;  3GTJ K;  5IYD K;  3S15 C;  4XSX A;  3EQL A;  4A3D K;  3S14 K;  3HOV C;  2R92 C;  4A3M C;  3S2D C;  1I6H C;  1TWF K;  1TWA K;  3S16 C;  4Y7N C;  1SFO K;  5IYB C;  2JA8 K;  3GTM K;  3HOU K;  3S1Q K;  3HOW C;  4BY1 K;  3S1M C;  3I4M C;  3WOD A;  3HKZ D;  4AYB D;  1ZYR A;  4YFN A;  2NVT C;  4Y52 K;  5M5Y K;  1YNJ A;  2E2J K;  2R93 C;  5M3F K;  2NVY K;  4BBR C;  3CQZ C;  2BE5 A;  5M5W K;  4MEX A;  4QIW D;  5C4J C;  4G7Z A;  3S1N C;  3GTK C;  3K7A K;  4C3J K;  2Y0S L;  5M3M K;  2E2H K;  4A3I C;  4BBS K;  4YG2 A;  4ZH4 A;  1R9T K;  1TWG K;  1R9T C;  3S17 C;  3M4O C;  5C4X C;  3S17 K;  1WCM C;  4YFX A;  3S2H C;  1I50 C;  4A3I K;  2E2I C;  3K7A C;  4G7O A;  5C4J K;  3RZD K;  3S1N K;  4BXX K;  2WB1 D;  4OIR A;  3CQZ K;  2NVY C;  4A3C K;  3HKZ L;  3I4N K;  4BY7 K;  2R93 K;  2E2J C;  2WAQ D;  4Y52 C;  2NVT K;  3S1M K;  2O5I A;  4BY1 C;  1SMY A;  4OIO A;  2WB1 L;  4A3L K;  4A3G K;  3S1Q C;  2JA8 C;  3HOU C;  5IYB K;  2NVQ C;  4A93 K;  1SFO C;  3HOX C;  1TWA C;  4Q5S A;  1TWF C;  4Y7N K;  4MEY A;  2PMZ L;  4OIP A;  4A3M K;  2R92 K;  1Y1V C;  4A3K C;  3S14 C;  3RZO K;  2YU9 C;  4A3D C;  3HOZ K;  5TMC A;  3S15 K;  2O5J A;  3HOZ C;  4A3E C;  2YU9 K;  5FLM C;  1K83 K;  1Y1V K;  4A3K K;  3RZO C;  4A3L C;  3HOX K;  4A93 C;  3GTG K;  2NVQ K;  3GTP C;  4BY7 C;  4LJZ A;  4A3J C;  4QIW L; 
#chains in the Genus database with same CATH topology
 3PO3 C;  3H0G K;  3GSI A;  3GTP A;  2PA8 L;  2V6U A;  5JFE A;  1XXB A;  2ZJP S;  1JVI A;  4WFA S;  4BXX C;  2R7Z A;  2PHC B;  2D6F C;  1O2A A;  1WCM K;  5C4X K;  5IOQ A;  3N0C A;  5HL8 A;  4KM8 A;  4KAR A;  4BBS C;  2E2H C;  4DDQ A;  3GTM A;  4BBR K;  1WCM A;  5TMF A;  2P8T A;  2A68 A;  1O2B A;  2ZFZ A;  4GTB A;  3L4K A;  1IQ0 A;  1WOR A;  2ZJR S;  2GAG C;  5FJ8 K;  2JA7 A;  5JVO A;  1DD5 A;  1VGX A;  4C3I K;  4KMU A;  3GTK A;  3GEI A;  5C44 C;  5D4D A;  2L3U A;  1HQM A;  1XXA A;  1TWA A;  1I3Q K;  5IP9 K;  4OIN A;  5IYC C;  3OPF A;  4WCE S;  4WJ4 A;  1IW7 A;  5C44 K;  4A3F C;  3FOE A;  3GTP K;  4QJV B;  1IL2 A;  4WFB S;  3GTQ K;  3GTJ K;  2FQT A;  3S15 C;  3FHZ A;  3EQL A;  4A3D K;  3S14 K;  4C45 A;  1I6H C;  1TWA K;  3GTM K;  1BGW A;  4YFN A;  2KXY A;  2E2J K;  2RGR A;  2NVY K;  4BBR C;  2BE5 A;  2XCR B;  4G7Z A;  1WQG A;  4C3J K;  2E2H K;  3VA7 A;  3HXA A;  1TWG K;  1R9T C;  3S17 C;  2E2I A;  5C4X C;  5DM7 S;  3CQZ A;  2GAH C;  1I50 C;  2ZUE A;  4M1X A;  4A3I K;  3DLL S;  4G7O A;  1X31 C;  3GDZ A;  1DCP A;  3AQO A;  2NVY C;  4RMF A;  3I4N K;  2E2J C;  1TWG A;  2ZJQ S;  2NVT K;  1UV7 A;  2O5I A;  1SMY A;  3S1Q C;  2JA8 C;  3HOU C;  4A93 K;  3HOX C;  1TWA C;  4FM9 A;  4MEY A;  4A3M K;  4OIP A;  3T01 A;  1Y1V C;  4A3K C;  4A3D C;  2YU9 K;  1K83 K;  3AD8 C;  1HI9 A;  3GTP C;  5IOR A;  3MML B;  4A3F K;  4QIW L;  3GTQ A;  3CF5 S;  1B4B A;  1USM A;  4GTL A;  4WIL A;  4KDD A;  5IP9 C;  2L5N A;  4LLG A;  4A3C C;  4BLB A;  1JOE A;  3N0B A;  3RZD C;  1R9T A;  2PPB A;  3FKI K;  4ILD A;  1TWH A;  1RU0 A;  3A8K A;  3TFH A;  2R92 A;  3GTK K;  4PAB A;  3V4G A;  1WSV A;  4P9S A;  1J6X A;  1PJ5 A;  4A3B C;  1EI6 A;  3S2D K;  2V6S A;  4BLA A;  2CFA A;  3GTL A;  4GT9 A;  4C3H C;  4KB4 A;  5IOT A;  1O29 A;  2KPU A;  4X6A C;  3S1R C;  5CHP A;  1TWC K;  4LOW A;  4OIQ A;  1XZP B;  2A6E A;  4P5B A;  4C2M C;  2R7Z K;  3OEP A;  2JH3 A;  2P5M A;  5IP7 K;  4KAS A;  2R93 A;  3GTO C;  3S0X A;  2CW0 A;  3H0G C;  3PO3 K;  3H3V L;  1O2F B;  4A3J K;  1TWF A;  4GZY A;  3DXJ A;  3GTG C;  2KWA A;  1XZP A;  1Y1W K;  2NVX K;  4GTD A;  1EH1 A;  3BP3 A;  2ZUF A;  4G0W A;  2FQO A;  3HOV C;  1VH2 A;  1TWF K;  3GEE A;  4Y7N C;  1SFO K;  3HOW C;  5JVG S;  2JA6 A;  3WOD A;  3HKZ D;  1O25 A;  1BS2 A;  1L0W A;  4QIW D;  1BJT A;  5C4J C;  3S1N C;  3K7A K;  4YG2 A;  3BP8 C;  3PIO S;  4KAW X;  4ZH4 A;  4KC6 A;  4U67 S;  3S2H C;  1O28 A;  5HL7 S;  3JST A;  2E2I C;  2GSO A;  1C0A A;  4GFQ A;  1GE9 A;  4OIR A;  3ADA C;  1IE0 A;  3CQZ K;  1Y1V A;  4Y52 C;  4BY1 C;  4A3G K;  4OIO A;  3AH5 A;  2W7V A;  1I3Q A;  5IYB K;  3LAJ A;  4Q5S A;  4G0U A;  3RZO K;  1PJ7 A;  1VRQ C;  3HOZ K;  5TMC A;  1USO A;  5CJ9 A;  4XCH A;  4A3E C;  5FLM C;  3A8I A;  5L46 A;  3AQP A;  4A3L C;  1I50 A;  4BY7 C;  4GTF A;  4A3G C;  1EK8 A;  4LK0 A;  4G7H A;  2NVX A;  2JA5 C;  1FEU A;  4NOI A;  3H0G A;  4XLN A;  1TWH C;  4QJV A;  5E68 A;  2V6T A;  2E2I K;  1ZQ1 C;  5C3E C;  2B63 C;  3M4O K;  1PJ6 A;  2A6H A;  3M3Y C;  3HOY C;  2JA6 K;  4KMA A;  4BKW A;  3GEH A;  5TJ3 A;  3GTL C;  1VJE A;  4KB2 A;  2PA8 D;  3I4M K;  1WSR A;  2JA7 K;  4GTC A;  3PO2 C;  5M5X K;  3S16 K;  3AD7 C;  3GTJ A;  3HOV K;  5IYD C;  3HOY K;  4LK1 A;  3GIR A;  2NVX C;  1Y1W C;  4XLP A;  1F9N A;  1WQF A;  2YU9 A;  2WAQ L;  4KM9 A;  4P5A A;  4KAT A;  2VUM C;  2R7Z C;  1JQW A;  2JA5 K;  2VUM K;  1AB4 A;  1ISE A;  3LPX A;  5EGE A;  4KN7 A;  1XPP A;  4KN4 A;  3GTO A;  3S1R K;  4JK1 A;  5FLM K;  1VLO A;  3H3V D;  5IYD K;  2R92 C;  3S2D C;  3S16 C;  1WOS A;  3AD9 C;  5IYB C;  3LYW A;  1K83 A;  4BY1 K;  3S1M C;  3I4M C;  4LR2 A;  4AYB D;  5M5Y K;  1ZXO A;  2R93 C;  5M3F K;  1J98 A;  3GTK C;  2Y0S L;  4PAA A;  3M4O C;  1O27 A;  1F7U A;  1WOP A;  1WIH A;  3RZD K;  3A8J A;  2WB1 D;  2CFA B;  4AH6 A;  2R93 K;  3G4A A;  1F93 A;  3S1M K;  1TWF C;  4LQY A;  4A3L K;  2R92 K;  2XCO A;  4GTA A;  1F7V A;  1WOO A;  1SFO A;  3HOZ C;  1Y1V K;  4A3K K;  3RZO C;  4A93 C;  3GTG K;  4A3J C;  2KQ1 A;  4WF9 S;  2A69 A;  3GTO K;  1G51 A;  3Q3Q A;  3I4N C;  4C2M K;  3IPJ A;  1TWC C;  4Q4Z A;  2EBB A;  1I50 K;  5EGH A;  3S2H K;  4YFK A;  2RH6 A;  1TWG C;  4X6A K;  1YNN A;  1IBA A;  1BDF A;  5IOS A;  4C3H K;  4C3J C;  2XCQ A;  3PO2 K;  1IS1 A;  2B63 A;  3T02 A;  2PMZ D;  3TFJ A;  4A3B K;  2JA7 C;  3HOW K;  3NUH A;  4KMD A;  3GTM C;  3GTL K;  4WJ3 M;  3CAG A;  4XSZ A;  4AYB L;  3GTJ C;  2JA6 C;  3GTQ C;  3M3Y K;  3LAP A;  3ORE A;  2GSN A;  2B63 K;  1YCL A;  5C3E K;  3FKI C;  3TTG A;  4IOA S;  2Y0S D;  4IOC S;  5IYC K;  1XZQ A;  1TWH K;  1I6V A;  2NVQ K;  5HQH A;  1I3Q C;  5IP7 C;  4MQ9 A;  1TWC A;  1O26 A;  4IO9 S;  3T00 A;  4BY7 K;  4FZB A;  1DCO A;  5JVH S;  1K83 C;  1J6V A;  4A3E K;  4C3I C;  3G4C A;  4G0V A;  4XSX A;  2E2H A;  4A3M C;  3FOF A;  2JA5 A;  1ZBS A;  3L4J A;  4O2D A;  2JA8 K;  3HOU K;  3SZY A;  2NVY A;  3S1Q K;  2NVT C;  4WFN S;  1ZYR A;  4Y52 K;  1YNJ A;  1XXC A;  5DM6 S;  3CQZ C;  3FKI A;  5M5W K;  4MEX A;  5M3M K;  1EFW A;  4A3I C;  4BBS K;  4J3N A;  1R9T K;  2GSU A;  3S17 K;  1WCM C;  4YFX A;  4KMH A;  3SZZ A;  3QX3 A;  4GTE A;  1Y1W A;  4BXX K;  3K7A C;  3S1N K;  5C4J K;  3GTG A;  1J6W A;  4A3C K;  1YX2 A;  3HKZ L;  2VUM A;  2WAQ D;  1O24 A;  3TFI A;  2WB1 L;  1DCH A;  2NVQ C;  1B4A A;  1SFO C;  4Y7N K;  3PIP S;  1ZVU A;  1I6H K;  2PMZ L;  1INN A;  3S14 C;  2YU9 C;  1KQ4 A;  1WQH A;  3S15 K;  3N3Y A;  2O5J A;  3ERE D;  3BUE A;  1V5V A;  3HOX K;  1XZQ B;  1EQR A;  4LJZ A;  2Y3P A; 
#chains in the Genus database with same CATH homology
 4A3G C;  2A69 A;  3PO3 C;  4LK0 A;  3H0G K;  4G7H A;  3GTO K;  5IP9 C;  2PA8 L;  2JA5 C;  3I4N C;  4C2M K;  4LLG A;  4NOI A;  4A3C C;  4XLN A;  1TWH C;  4QJV A;  3RZD C;  4BXX C;  2E2I K;  1TWC C;  2PPB A;  4Q4Z A;  3FKI K;  1I50 K;  3S2H K;  5C3E C;  4YFK A;  1WCM K;  5C4X K;  2B63 C;  3M4O K;  1TWG C;  2A6H A;  1YNN A;  4X6A K;  3M3Y C;  3HOY C;  2JA6 K;  1BDF A;  4BBS C;  2E2H C;  4C3H K;  4C3J C;  3GTK K;  4BBR K;  4A3F K;  3PO2 K;  5TMF A;  3GTL C;  2A68 A;  2PMZ D;  2PA8 D;  4A3B K;  2JA7 C;  3I4M K;  2JA7 K;  3HOW K;  4A3B C;  3GTM C;  5FJ8 K;  3GTL K;  3PO2 C;  5M5X K;  3S16 K;  3S2D K;  3HOV K;  1I6H K;  4XSZ A;  4C3H C;  4AYB L;  3GTJ C;  2JA6 C;  5IYD C;  4C3I K;  3GTQ C;  3HOY K;  3M3Y K;  4X6A C;  4KMU A;  3S1R C;  4LK1 A;  2B63 K;  2NVX C;  1Y1W C;  4XLP A;  5C44 C;  5C3E K;  3FKI C;  2Y0S D;  1TWC K;  5D4D A;  4OIQ A;  2WAQ L;  5IYC K;  1TWH K;  1I6V A;  2A6E A;  2VUM C;  1I3Q C;  5IP7 C;  4MQ9 A;  2R7Z C;  4C2M C;  2R7Z K;  5IP7 K;  1HQM A;  2JA5 K;  1I3Q K;  2VUM K;  5IP9 K;  4OIN A;  3GTO C;  2CW0 A;  3H0G C;  3PO3 K;  3H3V L;  5IYC C;  1IW7 A;  4KN7 A;  4A3J K;  1XPP A;  4KN4 A;  5C44 K;  4A3F C;  4GZY A;  3DXJ A;  3GTG C;  4QJV B;  1Y1W K;  2NVX K;  3GTP K;  3S1R K;  4JK1 A;  1K83 C;  5FLM K;  3H3V D;  4A3E K;  3GTQ K;  4C3I C;  3GTJ K;  5IYD K;  3S15 C;  4XSX A;  3EQL A;  4A3D K;  3S14 K;  3HOV C;  2R92 C;  4A3M C;  3S2D C;  1I6H C;  1TWF K;  1TWA K;  3S16 C;  4Y7N C;  1SFO K;  5IYB C;  2JA8 K;  3GTM K;  3HOU K;  3S1Q K;  3HOW C;  4BY1 K;  3S1M C;  3I4M C;  3WOD A;  3HKZ D;  4AYB D;  1ZYR A;  4YFN A;  2NVT C;  4Y52 K;  5M5Y K;  1YNJ A;  2E2J K;  2R93 C;  5M3F K;  2NVY K;  4BBR C;  3CQZ C;  2BE5 A;  5M5W K;  4MEX A;  4QIW D;  5C4J C;  4G7Z A;  3S1N C;  3GTK C;  3K7A K;  4C3J K;  2Y0S L;  5M3M K;  2E2H K;  4A3I C;  4BBS K;  4YG2 A;  4ZH4 A;  1R9T K;  1TWG K;  1R9T C;  3S17 C;  3M4O C;  5C4X C;  3S17 K;  1WCM C;  4YFX A;  3S2H C;  1I50 C;  4A3I K;  2E2I C;  3K7A C;  4G7O A;  5C4J K;  3RZD K;  3S1N K;  4BXX K;  2WB1 D;  4OIR A;  3CQZ K;  2NVY C;  4A3C K;  3HKZ L;  3I4N K;  4BY7 K;  2R93 K;  2E2J C;  2WAQ D;  4Y52 C;  2NVT K;  3S1M K;  2O5I A;  4BY1 C;  1SMY A;  4OIO A;  2WB1 L;  4A3L K;  4A3G K;  3S1Q C;  2JA8 C;  3HOU C;  5IYB K;  2NVQ C;  4A93 K;  1SFO C;  3HOX C;  1TWA C;  4Q5S A;  1TWF C;  4Y7N K;  4MEY A;  2PMZ L;  4OIP A;  4A3M K;  2R92 K;  1Y1V C;  4A3K C;  3S14 C;  3RZO K;  2YU9 C;  4A3D C;  3HOZ K;  5TMC A;  3S15 K;  2O5J A;  3HOZ C;  4A3E C;  2YU9 K;  5FLM C;  1K83 K;  1Y1V K;  4A3K K;  3RZO C;  4A3L C;  3HOX K;  4A93 C;  3GTG K;  2NVQ K;  3GTP C;  4BY7 C;  4LJZ A;  4A3J C;  4QIW L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...