1YNJA

Taq rna polymerase-sorangicin complex
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
230
structure length
230
Chain Sequence
LKAPVFTATTQGDHYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLDPKMASTTLILRAEGPKEVRAGDFTPSADVEIMNPDLHIATLEEGGKLYMEVRVDRGVGYVPAERHGIKDRINAIPVDAIFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVAILKEHLNYFANPEASLLPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords DNA-directed RNA polymerase alpha chain
publication title Structural, functional, and genetic analysis of sorangicin inhibition of bacterial RNA polymerase
pubmed doi rcsb
total genus 43
structure length 230
sequence length 230
chains with identical sequence B
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2005-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01000 RNA_pol_A_bac RNA polymerase Rpb3/RpoA insert domain
A PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain
A PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.12 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 DNA-directed RNA polymerase, insert domain 1ynjA02
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 1ynjA01
1TWHK 3GTJK 4A3MC 3HOZC 3GTLC 3FKIC 4A3JK 3CQZK 2JA7K 3GTQK 3HOWC 1WCMK 5IYCC 1TWGK 1R9TK 1ZYRA 2PMZL 1XPPA 5C3EK 4LK1A 5IYDC 1Y1VK 4G7ZA 3PO2K 1TWCK 4C2MC 2JA8K 3HOVK 3HOYK 4A3LC 2NVXC 1SFOC 3I4NC 3H0GK 3S1NC 2E2HC 1I6HC 2WAQD 1Y1WC 4BBRK 3S15C 3K7AC 3M3YC 2R7ZK 5FLMC 3S14K 1R9TC 4C3JC 4Y7NK 4A3MK 3HOZK 4GZYA 3FKIK 3GTLK 1YNNA 2NVQK 4Y52K 5IYCK 3GTOC 5M3MK 3S17C 5C4JC 4BXXC 4KN4A 5D4DA 4A3BC 4G7HA 5IYDK 3WODA 1I50C 3RZOC 4A93C 4Q5SA 2NVXK 4A3LK 5IP9C 1SFOK 3I4NK 2PPBA 2BE5A 3S1NK 2E2HK 1I6HK 3GTMC 1Y1WK 2NVQC 4A3CC 3S15K 4Y52C 4YFNA 3GTGC 1I3QK 3K7AK 4OINA 5FLMK 3M3YK 4C3JK 4YFXA 1TWAC 1IW7A 1TWFC 2A68A 1BDFA 4A3IC 4X6AK 4YFKA 3HKZL 4XSZA 4ZH4A 3GTOK 3S17K 2Y0SL 5C4JK 4BXXK 3HOXC 4A3KC 5C4XC 4A3BK 3I4MC 2YU9C 1I3QC 3RZOK 1I50K 4A93K 5FJ8K 5IP9K 1K83K 4AYBL 3GTMK 2E2JC 4A3CK 4X6AC 3GTPC 3GTGK 2WB1L 2PA8L 2JA5C 1TWAK 4Y7NC 4XLNA 4LLGA 1TWFK 5IYBC 5C44C 4A3IK 3GTKK 4A3GC 4MEYA 4QIWD 2B63C 1K83C 3HOXK 5TMCA 5C4XK 4A3KK 4A3DC 1HQMA 4XLPA 2A69A 2YU9K 3H3VL 3I4MK 4A3FC 4LK0A 4QJVB 4C3IK 2CW0A 3HOUC 5IP7C 1SMYA 4KMUA 2E2JK 4OIQA 3GTKC 4G7OA 3GTPK 3S2DC 2JA5K 4A3EC 2PMZD 4Q4ZA 3S14C 1YNJA 4QJVA 2O5IA 2JA6C 4OIOA 5IYBK 2R93C 5C44K 3RZDC 3M4OC 3HKZD 4A3GK 4C3IC 2B63K 4BY7K 2Y0SD 3S1QC 4A3DK 5TMFA 2E2IK 4YG2A 4XSXA 3S1RC 4MQ9A 4A3FK 4C3HK 3EQLA 4LJZA 3S1MC 2NVTK 3HOUK 5IP7K 4AYBD 4NOIA 2VUMC 3S2HC 2O5JA 3S16C 3S2DK 3PO3C 2WB1D 2PA8D 4A3EK 2NVYC 2R92C 4BY7C 2WAQL 5M5WK 2JA6K 2E2IC 4KN7A 2R93K 2A6EA 4C3HC 3RZDK 1TWHC 3M4OK 3GTJC 4A3JC 3GTQC 2JA7C 3CQZC 2NVTC 4BBSK 3S1QK 1WCMC 4OIRA 4BY1K 1TWGC 3H3VD 3S1RK 5C3EC 1Y1VC 3S1MK 3PO2C 5M3FK 1TWCC 2JA8C 3HOWK 5M5XK 3HOVC 3HOYC 2VUMK 3S2HK 3S16K 4QIWL 4MEXA 3H0GC 1I6VA 3DXJA 4BBSC 5M5YK 3PO3K 2NVYK 4OIPA 2R92K 4BBRC 4C2MK 2R7ZC 4BY1C 4JK1A 2A6HA
chains in the Genus database with same CATH superfamily
4A3MC 4G0WA 4A3JK 3GTQK 1XXBA 1WCMK 2ZUEA 1WOSA 4LK1A 3G4AA 4G7ZA 3PO2K 4KMAA 3GTKA 4C2MC 3HOYK 1IS1A 5DM6S 1SFOC 3S15C 3K7AC 4FZBA 2R7ZK 4C3JC 4FM9A 3A8IA 1DD5A 3GTPA 2PHCB 3GTOC 3S17C 3L4KA 5IYDK 5D4DA 3WODA 4Q5SA 2B63A 4GTDA 2E2IA 4G0VA 1Y1WK 4YFNA 5FLMK 4GTCA 4YFXA 3LYWA 2A68A 3HKZL 4KM9A 1IE0A 4RMFA 3SZYA 3HOXC 4A3KC 1WOPA 4A3BK 2R93A 3I4MC 5JVOA 1I50K 3OREA 4AYBL 4WJ4A 2E2JC 4A3CK 1VGXA 3GTPC 4WFAS 3A8JA 3AH5A 1TWAK 1TWFK 1WIHA 2B63C 3LAPA 2FQTA 1HQMA 2YU9K 3GTJA 3CQZA 4WFNS 4LK0A 1XZQB 4C3IK 1EH1A 1R9TA 2JA5K 1TWCA 4Q4ZA 2O5IA 2R93C 5C44K 4C3IC 1ZVUA 4WILA 3ERED 4BY7K 5TMFA 1O2AA 4MQ9A 4A3FK 3GTLA 2KQ1A 4NOIA 3Q3QA 4BY7C 2JA6K 2NVXA 4WCES 1BS2A 4KDDA 3GTJC 3CQZC 1WQGA 3S1QK 1YCLA 3N0BA 2GAGC 3S0XA 3S1MK 1TWCC 2KPUA 3OPFA 5M5XK 3HOVC 3AQOA 1I6VA 2CFAA 5EGEA 1DCOA 1USOA 2D6FC 1K83A 1TWHK 3GTMA 3GEHA 3HOZC 3GTLC 2JA7K 5IYCC 3GIRA 5C3EK 2PMZL 1Y1VK 1INNA 3CAGA 1EQRA 4P9SA 4AH6A 2JA8K 1O26A 4GTLA 2NVXC 1J6XA 3T00A 2RGRA 4Y7NK 3TFIA 5IOQA 4A3MK 3GEEA 4ILDA 1YNNA 2ZJPS 2NVQK 4Y52K 1HI9A 2ZJRS 4KB4A 3FOEA 4BXXC 4G7HA 1ZXOA 5IP9C 1SFOK 3GTMC 2NVQC 3S15K 4Y52C 3K7AK 1I3QK 4KM8A 4OINA 1JVIA 1PJ6A 4C3JK 1O29A 4YFKA 4XSZA 3GTOK 3S17K 1WSVA 1VRQC 1I3QC 1JOEA 1O27A 2W7VA 1EFWA 3AD9C 1IBAA 4GTEA 3G4CA 2VUMA 4XLNA 4LLGA 4KASA 3GTKK 4A3GC 4MEYA 3HOXK 4A3KK 3S14K 4LR2A 4A3DC 4KMHA 3I4MK 5HQHA 4BKWA 3TFHA 2Y3PA 3HOUC 4KMUA 1TWGA 2E2JK 4OIQA 3GTKC 4G7OA 1WORA 3JSTA 3GTPK 2KXYA 4A3EC 2PMZD 1XZPB 2L5NA 3S14C 3GDZA 3AD7C 3L4JA 3H0GA 3RZDC 2B63K 4IOAS 1YX2A 2E2IK 4XSXA 3FKIA 1F7VA 3NUHA 3EQLA 4LJZA 5HL8A 2VUMC 4LQYA 3PO3C 3BP3A 2PA8D 2XCRB 1ZBSA 1B4AA 5CHPA 2E2IC 4KN7A 3MMLB 4M1XA 2R93K 1WSRA 2E2HA 4BBSK 1J98A 5CJ9A 4OIRA 1TWGC 3H3VD 5M3FK 2P8TA 3HOWK 5IORA 4QIWL 3A8KA 3H0GC 3DXJA 5JFEA 4BBSC 3ADAC 5M5YK 1C0AA 4BBRC 1ISEA 2A6HA 3GTJK 3FKIC 3CQZK 3GTGA 3HOWC 1R9TK 1WOOA 1XPPA 2RH6A 1TWCK 5JVGS 3HOVK 4A3LC 3I4NC 3S1NC 2P5MA 2E2HC 1I6HC 2EBBA 2ZJQS 5E68A 3M3YC 2L3UA 3BUEA 1R9TC 3HOZK 3GTLK 5HL7S 1F93A 5IYCK 5M3MK 5C4JC 2JH3A 4KMDA 4KN4A 3DLLS 3RZOC 4A93C 5IOSA 2NVXK 2PPBA 2BE5A 1USMA 1XXCA 3GTGC 1J6WA 2JA7A 1JQWA 1IW7A 4KC6A 1BDFA 4A3IC 4ZH4A 4BXXK 5C4XC 2KWAA 4DDQA 1AB4A 5IP9K 1K83K 3GTMK 3N0CA 2PA8L 5IYBC 2NVYA 3HXAA 1WQHA 2R92A 4QIWD 1F9NA 1K83C 5TMCA 3H3VL 5IOTA 3GTQA 2V6UA 4QJVB 1G51A 1WCMA 5IP7C 3PIPS 4LOWA 2CFAB 3S2DC 4BLBA 4IO9S 1YNJA 3M4OC 4A3GK 5DM7S 1ZQ1C 2Y0SD 4GTBA 2R7ZA 4A3DK 3S1RC 5TJ3A 4C3HK 4BLAA 1B4BA 4KB2A 4GT9A 2GAHC 3HOUK 3S2HC 2O5JA 3S16C 2WB1D 4A3EK 2NVYC 2R92C 4XCHA 5M5WK 1O24A 4KATA 2A6EA 4C3HC 3RZDK 1Y1WA 4A3JC 3GTQC 3LAJA 3N3YA 1WCMC 4BY1K 4P5BA 3PO2C 1VLOA 1XZQA 3T01A 1L0WA 3FOFA 3HOYC 3QX3A 2VUMK 1DCPA 4MEXA 3PO3K 4KAWX 1I50A 2R7ZC 4BY1C 4JK1A 4P5AA 3BP8C 4GTAA 3CF5S 1TWGK 1TWAA 1ZYRA 1TWFA 1J6VA 2GSOA 5IYDC 1O2BA 1O25A 3H0GK 2YU9A 2WAQD 1Y1WC 1XXAA 4BBRK 5FLMC 1VJEA 1BGWA 4GZYA 3FKIK 4GFQA 2JA5A 2V6SA 4A3BC 3GEIA 1I50C 5JVHS 1EI6A 4G0UA 4A3LK 3I4NK 3S1NK 2E2HK 1I6HK 4A3CC 3M3YK 3T02A 2GSNA 1BJTA 1TWAC 1TWFC 4X6AK 1KQ4A 2FQOA 4PAAA 2JA6A 2Y0SL 5C4JK 2YU9C 3FHZA 1IL2A 3RZOK 4A93K 5FJ8K 1UV7A 4O2DA 4WFBS 3TFJA 4X6AC 3AQPA 3GTGK 3TTGA 4U67S 2WB1L 2JA5C 4IOCS 1WQFA 5C44C 4A3IK 1O28A 3GSIA 5C4XK 4XLPA 2A69A 1TWHA 5L46A 4A3FC 2ZFZA 3SZZA 2CW0A 1SMYA 2XCQA 1F7UA 1Y1VA 4KARA 1IQ0A 2JA6C 4QJVA 4OIOA 5IYBK 1V5VA 3HKZD 1EK8A 1GE9A 1RU0A 3LPXA 5EGHA 3S1QC 4WF9S 4C45A 4YG2A 2GSUA 3S1MC 3OEPA 2NVTK 1FEUA 5IP7K 4AYBD 3VA7A 3S2DK 2WAQL 2V6TA 1DCHA 1SFOA 1TWHC 3M4OK 2JA7C 2NVTC 1PJ7A 1O2FB 2XCOA 1I3QA 3S1RK 2ZUFA 5C3EC 3V4GA 1Y1VC 3PIOS 1PJ5A 4WJ3M 2JA8C 4GTFA 3GTOA 3S2HK 1X31C 3S16K 4PABA 3AD8C 2NVYK 4OIPA 3IPJA 2R92K 4J3NA 1XZPA 4C2MK 1VH2A 4Y7NC
chains in the Genus database with same CATH topology
1TWHK 3GTJK 4A3MC 3HOZC 3GTLC 3FKIC 4A3JK 3CQZK 2JA7K 3GTQK 3HOWC 1WCMK 5IYCC 1TWGK 1R9TK 1ZYRA 2PMZL 1XPPA 5C3EK 4LK1A 5IYDC 1Y1VK 4G7ZA 3PO2K 1TWCK 4C2MC 2JA8K 3HOVK 3HOYK 4A3LC 2NVXC 1SFOC 3I4NC 3H0GK 3S1NC 2E2HC 1I6HC 2WAQD 1Y1WC 4BBRK 3S15C 3K7AC 3M3YC 2R7ZK 5FLMC 3S14K 1R9TC 4C3JC 4Y7NK 4A3MK 3HOZK 4GZYA 3FKIK 3GTLK 1YNNA 2NVQK 4Y52K 5IYCK 3GTOC 5M3MK 3S17C 5C4JC 4BXXC 4KN4A 5D4DA 4A3BC 4G7HA 5IYDK 3WODA 1I50C 3RZOC 4A93C 4Q5SA 2NVXK 4A3LK 5IP9C 1SFOK 3I4NK 2PPBA 2BE5A 3S1NK 2E2HK 1I6HK 3GTMC 1Y1WK 2NVQC 4A3CC 3S15K 4Y52C 4YFNA 3GTGC 1I3QK 3K7AK 4OINA 5FLMK 3M3YK 4C3JK 4YFXA 1TWAC 1IW7A 1TWFC 2A68A 1BDFA 4A3IC 4X6AK 4YFKA 3HKZL 4XSZA 4ZH4A 3GTOK 3S17K 2Y0SL 5C4JK 4BXXK 3HOXC 4A3KC 5C4XC 4A3BK 3I4MC 2YU9C 1I3QC 3RZOK 1I50K 4A93K 5FJ8K 5IP9K 1K83K 4AYBL 3GTMK 2E2JC 4A3CK 4X6AC 3GTPC 3GTGK 2WB1L 2PA8L 2JA5C 1TWAK 4Y7NC 4XLNA 4LLGA 1TWFK 5IYBC 5C44C 4A3IK 3GTKK 4A3GC 4MEYA 4QIWD 2B63C 1K83C 3HOXK 5TMCA 5C4XK 4A3KK 4A3DC 1HQMA 4XLPA 2A69A 2YU9K 3H3VL 3I4MK 4A3FC 4LK0A 4QJVB 4C3IK 2CW0A 3HOUC 5IP7C 1SMYA 4KMUA 2E2JK 4OIQA 3GTKC 4G7OA 3GTPK 3S2DC 2JA5K 4A3EC 2PMZD 4Q4ZA 3S14C 1YNJA 4QJVA 2O5IA 2JA6C 4OIOA 5IYBK 2R93C 5C44K 3RZDC 3M4OC 3HKZD 4A3GK 4C3IC 2B63K 4BY7K 2Y0SD 3S1QC 4A3DK 5TMFA 2E2IK 4YG2A 4XSXA 3S1RC 4MQ9A 4A3FK 4C3HK 3EQLA 4LJZA 3S1MC 2NVTK 3HOUK 5IP7K 4AYBD 4NOIA 2VUMC 3S2HC 2O5JA 3S16C 3S2DK 3PO3C 2WB1D 2PA8D 4A3EK 2NVYC 2R92C 4BY7C 2WAQL 5M5WK 2JA6K 2E2IC 4KN7A 2R93K 2A6EA 4C3HC 3RZDK 1TWHC 3M4OK 3GTJC 4A3JC 3GTQC 2JA7C 3CQZC 2NVTC 4BBSK 3S1QK 1WCMC 4OIRA 4BY1K 1TWGC 3H3VD 3S1RK 5C3EC 1Y1VC 3S1MK 3PO2C 5M3FK 1TWCC 2JA8C 3HOWK 5M5XK 3HOVC 3HOYC 2VUMK 3S2HK 3S16K 4QIWL 4MEXA 3H0GC 1I6VA 3DXJA 4BBSC 5M5YK 3PO3K 2NVYK 4OIPA 2R92K 4BBRC 4C2MK 2R7ZC 4BY1C 4JK1A 2A6HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TWH K;  3GTJ K;  4A3M C;  3HOZ C;  3GTL C;  3FKI C;  4A3J K;  3CQZ K;  2JA7 K;  3GTQ K;  3HOW C;  1WCM K;  5IYC C;  1TWG K;  1R9T K;  1ZYR A;  2PMZ L;  1XPP A;  5C3E K;  4LK1 A;  5IYD C;  1Y1V K;  4G7Z A;  3PO2 K;  1TWC K;  4C2M C;  2JA8 K;  3HOV K;  3HOY K;  4A3L C;  2NVX C;  1SFO C;  3I4N C;  3H0G K;  3S1N C;  2E2H C;  1I6H C;  2WAQ D;  1Y1W C;  4BBR K;  3S15 C;  3K7A C;  3M3Y C;  2R7Z K;  5FLM C;  3S14 K;  1R9T C;  4C3J C;  4Y7N K;  4A3M K;  3HOZ K;  4GZY A;  3FKI K;  3GTL K;  1YNN A;  2NVQ K;  4Y52 K;  5IYC K;  3GTO C;  5M3M K;  3S17 C;  5C4J C;  4BXX C;  4KN4 A;  5D4D A;  4A3B C;  4G7H A;  5IYD K;  3WOD A;  1I50 C;  3RZO C;  4A93 C;  4Q5S A;  2NVX K;  4A3L K;  5IP9 C;  1SFO K;  3I4N K;  2PPB A;  2BE5 A;  3S1N K;  2E2H K;  1I6H K;  3GTM C;  1Y1W K;  2NVQ C;  4A3C C;  3S15 K;  4Y52 C;  4YFN A;  3GTG C;  1I3Q K;  3K7A K;  4OIN A;  5FLM K;  3M3Y K;  4C3J K;  4YFX A;  1TWA C;  1IW7 A;  1TWF C;  2A68 A;  1BDF A;  4A3I C;  4X6A K;  4YFK A;  3HKZ L;  4XSZ A;  4ZH4 A;  3GTO K;  3S17 K;  2Y0S L;  5C4J K;  4BXX K;  3HOX C;  4A3K C;  5C4X C;  4A3B K;  3I4M C;  2YU9 C;  1I3Q C;  3RZO K;  1I50 K;  4A93 K;  5FJ8 K;  5IP9 K;  1K83 K;  4AYB L;  3GTM K;  2E2J C;  4A3C K;  4X6A C;  3GTP C;  3GTG K;  2WB1 L;  2PA8 L;  2JA5 C;  1TWA K;  4Y7N C;  4XLN A;  4LLG A;  1TWF K;  5IYB C;  5C44 C;  4A3I K;  3GTK K;  4A3G C;  4MEY A;  4QIW D;  2B63 C;  1K83 C;  3HOX K;  5TMC A;  5C4X K;  4A3K K;  4A3D C;  1HQM A;  4XLP A;  2A69 A;  2YU9 K;  3H3V L;  3I4M K;  4A3F C;  4LK0 A;  4QJV B;  4C3I K;  2CW0 A;  3HOU C;  5IP7 C;  1SMY A;  4KMU A;  2E2J K;  4OIQ A;  3GTK C;  4G7O A;  3GTP K;  3S2D C;  2JA5 K;  4A3E C;  2PMZ D;  4Q4Z A;  3S14 C;  1YNJ A;  4QJV A;  2O5I A;  2JA6 C;  4OIO A;  5IYB K;  2R93 C;  5C44 K;  3RZD C;  3M4O C;  3HKZ D;  4A3G K;  4C3I C;  2B63 K;  4BY7 K;  2Y0S D;  3S1Q C;  4A3D K;  5TMF A;  2E2I K;  4YG2 A;  4XSX A;  3S1R C;  4MQ9 A;  4A3F K;  4C3H K;  3EQL A;  4LJZ A;  3S1M C;  2NVT K;  3HOU K;  5IP7 K;  4AYB D;  4NOI A;  2VUM C;  3S2H C;  2O5J A;  3S16 C;  3S2D K;  3PO3 C;  2WB1 D;  2PA8 D;  4A3E K;  2NVY C;  2R92 C;  4BY7 C;  2WAQ L;  5M5W K;  2JA6 K;  2E2I C;  4KN7 A;  2R93 K;  2A6E A;  4C3H C;  3RZD K;  1TWH C;  3M4O K;  3GTJ C;  4A3J C;  3GTQ C;  2JA7 C;  3CQZ C;  2NVT C;  4BBS K;  3S1Q K;  1WCM C;  4OIR A;  4BY1 K;  1TWG C;  3H3V D;  3S1R K;  5C3E C;  1Y1V C;  3S1M K;  3PO2 C;  5M3F K;  1TWC C;  2JA8 C;  3HOW K;  5M5X K;  3HOV C;  3HOY C;  2VUM K;  3S2H K;  3S16 K;  4QIW L;  4MEX A;  3H0G C;  1I6V A;  3DXJ A;  4BBS C;  5M5Y K;  3PO3 K;  2NVY K;  4OIP A;  2R92 K;  4BBR C;  4C2M K;  2R7Z C;  4BY1 C;  4JK1 A;  2A6H A; 
#chains in the Genus database with same CATH topology
 4A3M C;  4G0W A;  4A3J K;  3GTQ K;  1XXB A;  1WCM K;  2ZUE A;  1WOS A;  4LK1 A;  3G4A A;  4G7Z A;  3PO2 K;  4KMA A;  3GTK A;  4C2M C;  3HOY K;  1IS1 A;  5DM6 S;  1SFO C;  3S15 C;  3K7A C;  4FZB A;  2R7Z K;  4C3J C;  4FM9 A;  3A8I A;  1DD5 A;  3GTP A;  2PHC B;  3GTO C;  3S17 C;  3L4K A;  5IYD K;  5D4D A;  3WOD A;  4Q5S A;  2B63 A;  4GTD A;  2E2I A;  4G0V A;  1Y1W K;  4YFN A;  5FLM K;  4GTC A;  4YFX A;  3LYW A;  2A68 A;  3HKZ L;  4KM9 A;  1IE0 A;  4RMF A;  3SZY A;  3HOX C;  4A3K C;  1WOP A;  4A3B K;  2R93 A;  3I4M C;  5JVO A;  1I50 K;  3ORE A;  4AYB L;  4WJ4 A;  2E2J C;  4A3C K;  1VGX A;  3GTP C;  4WFA S;  3A8J A;  3AH5 A;  1TWA K;  1TWF K;  1WIH A;  2B63 C;  3LAP A;  2FQT A;  1HQM A;  2YU9 K;  3GTJ A;  3CQZ A;  4WFN S;  4LK0 A;  1XZQ B;  4C3I K;  1EH1 A;  1R9T A;  2JA5 K;  1TWC A;  4Q4Z A;  2O5I A;  2R93 C;  5C44 K;  4C3I C;  1ZVU A;  4WIL A;  3ERE D;  4BY7 K;  5TMF A;  1O2A A;  4MQ9 A;  4A3F K;  3GTL A;  2KQ1 A;  4NOI A;  3Q3Q A;  4BY7 C;  2JA6 K;  2NVX A;  4WCE S;  1BS2 A;  4KDD A;  3GTJ C;  3CQZ C;  1WQG A;  3S1Q K;  1YCL A;  3N0B A;  2GAG C;  3S0X A;  3S1M K;  1TWC C;  2KPU A;  3OPF A;  5M5X K;  3HOV C;  3AQO A;  1I6V A;  2CFA A;  5EGE A;  1DCO A;  1USO A;  2D6F C;  1K83 A;  1TWH K;  3GTM A;  3GEH A;  3HOZ C;  3GTL C;  2JA7 K;  5IYC C;  3GIR A;  5C3E K;  2PMZ L;  1Y1V K;  1INN A;  3CAG A;  1EQR A;  4P9S A;  4AH6 A;  2JA8 K;  1O26 A;  4GTL A;  2NVX C;  1J6X A;  3T00 A;  2RGR A;  4Y7N K;  3TFI A;  5IOQ A;  4A3M K;  3GEE A;  4ILD A;  1YNN A;  2ZJP S;  2NVQ K;  4Y52 K;  1HI9 A;  2ZJR S;  4KB4 A;  3FOE A;  4BXX C;  4G7H A;  1ZXO A;  5IP9 C;  1SFO K;  3GTM C;  2NVQ C;  3S15 K;  4Y52 C;  3K7A K;  1I3Q K;  4KM8 A;  4OIN A;  1JVI A;  1PJ6 A;  4C3J K;  1O29 A;  4YFK A;  4XSZ A;  3GTO K;  3S17 K;  1WSV A;  1VRQ C;  1I3Q C;  1JOE A;  1O27 A;  2W7V A;  1EFW A;  3AD9 C;  1IBA A;  4GTE A;  3G4C A;  2VUM A;  4XLN A;  4LLG A;  4KAS A;  3GTK K;  4A3G C;  4MEY A;  3HOX K;  4A3K K;  3S14 K;  4LR2 A;  4A3D C;  4KMH A;  3I4M K;  5HQH A;  4BKW A;  3TFH A;  2Y3P A;  3HOU C;  4KMU A;  1TWG A;  2E2J K;  4OIQ A;  3GTK C;  4G7O A;  1WOR A;  3JST A;  3GTP K;  2KXY A;  4A3E C;  2PMZ D;  1XZP B;  2L5N A;  3S14 C;  3GDZ A;  3AD7 C;  3L4J A;  3H0G A;  3RZD C;  2B63 K;  4IOA S;  1YX2 A;  2E2I K;  4XSX A;  3FKI A;  1F7V A;  3NUH A;  3EQL A;  4LJZ A;  5HL8 A;  2VUM C;  4LQY A;  3PO3 C;  3BP3 A;  2PA8 D;  2XCR B;  1ZBS A;  1B4A A;  5CHP A;  2E2I C;  4KN7 A;  3MML B;  4M1X A;  2R93 K;  1WSR A;  2E2H A;  4BBS K;  1J98 A;  5CJ9 A;  4OIR A;  1TWG C;  3H3V D;  5M3F K;  2P8T A;  3HOW K;  5IOR A;  4QIW L;  3A8K A;  3H0G C;  3DXJ A;  5JFE A;  4BBS C;  3ADA C;  5M5Y K;  1C0A A;  4BBR C;  1ISE A;  2A6H A;  3GTJ K;  3FKI C;  3CQZ K;  3GTG A;  3HOW C;  1R9T K;  1WOO A;  1XPP A;  2RH6 A;  1TWC K;  5JVG S;  3HOV K;  4A3L C;  3I4N C;  3S1N C;  2P5M A;  2E2H C;  1I6H C;  2EBB A;  2ZJQ S;  5E68 A;  3M3Y C;  2L3U A;  3BUE A;  1R9T C;  3HOZ K;  3GTL K;  5HL7 S;  1F93 A;  5IYC K;  5M3M K;  5C4J C;  2JH3 A;  4KMD A;  4KN4 A;  3DLL S;  3RZO C;  4A93 C;  5IOS A;  2NVX K;  2PPB A;  2BE5 A;  1USM A;  1XXC A;  3GTG C;  1J6W A;  2JA7 A;  1JQW A;  1IW7 A;  4KC6 A;  1BDF A;  4A3I C;  4ZH4 A;  4BXX K;  5C4X C;  2KWA A;  4DDQ A;  1AB4 A;  5IP9 K;  1K83 K;  3GTM K;  3N0C A;  2PA8 L;  5IYB C;  2NVY A;  3HXA A;  1WQH A;  2R92 A;  4QIW D;  1F9N A;  1K83 C;  5TMC A;  3H3V L;  5IOT A;  3GTQ A;  2V6U A;  4QJV B;  1G51 A;  1WCM A;  5IP7 C;  3PIP S;  4LOW A;  2CFA B;  3S2D C;  4BLB A;  4IO9 S;  1YNJ A;  3M4O C;  4A3G K;  5DM7 S;  1ZQ1 C;  2Y0S D;  4GTB A;  2R7Z A;  4A3D K;  3S1R C;  5TJ3 A;  4C3H K;  4BLA A;  1B4B A;  4KB2 A;  4GT9 A;  2GAH C;  3HOU K;  3S2H C;  2O5J A;  3S16 C;  2WB1 D;  4A3E K;  2NVY C;  2R92 C;  4XCH A;  5M5W K;  1O24 A;  4KAT A;  2A6E A;  4C3H C;  3RZD K;  1Y1W A;  4A3J C;  3GTQ C;  3LAJ A;  3N3Y A;  1WCM C;  4BY1 K;  4P5B A;  3PO2 C;  1VLO A;  1XZQ A;  3T01 A;  1L0W A;  3FOF A;  3HOY C;  3QX3 A;  2VUM K;  1DCP A;  4MEX A;  3PO3 K;  4KAW X;  1I50 A;  2R7Z C;  4BY1 C;  4JK1 A;  4P5A A;  3BP8 C;  4GTA A;  3CF5 S;  1TWG K;  1TWA A;  1ZYR A;  1TWF A;  1J6V A;  2GSO A;  5IYD C;  1O2B A;  1O25 A;  3H0G K;  2YU9 A;  2WAQ D;  1Y1W C;  1XXA A;  4BBR K;  5FLM C;  1VJE A;  1BGW A;  4GZY A;  3FKI K;  4GFQ A;  2JA5 A;  2V6S A;  4A3B C;  3GEI A;  1I50 C;  5JVH S;  1EI6 A;  4G0U A;  4A3L K;  3I4N K;  3S1N K;  2E2H K;  1I6H K;  4A3C C;  3M3Y K;  3T02 A;  2GSN A;  1BJT A;  1TWA C;  1TWF C;  4X6A K;  1KQ4 A;  2FQO A;  4PAA A;  2JA6 A;  2Y0S L;  5C4J K;  2YU9 C;  3FHZ A;  1IL2 A;  3RZO K;  4A93 K;  5FJ8 K;  1UV7 A;  4O2D A;  4WFB S;  3TFJ A;  4X6A C;  3AQP A;  3GTG K;  3TTG A;  4U67 S;  2WB1 L;  2JA5 C;  4IOC S;  1WQF A;  5C44 C;  4A3I K;  1O28 A;  3GSI A;  5C4X K;  4XLP A;  2A69 A;  1TWH A;  5L46 A;  4A3F C;  2ZFZ A;  3SZZ A;  2CW0 A;  1SMY A;  2XCQ A;  1F7U A;  1Y1V A;  4KAR A;  1IQ0 A;  2JA6 C;  4QJV A;  4OIO A;  5IYB K;  1V5V A;  3HKZ D;  1EK8 A;  1GE9 A;  1RU0 A;  3LPX A;  5EGH A;  3S1Q C;  4WF9 S;  4C45 A;  4YG2 A;  2GSU A;  3S1M C;  3OEP A;  2NVT K;  1FEU A;  5IP7 K;  4AYB D;  3VA7 A;  3S2D K;  2WAQ L;  2V6T A;  1DCH A;  1SFO A;  1TWH C;  3M4O K;  2JA7 C;  2NVT C;  1PJ7 A;  1O2F B;  2XCO A;  1I3Q A;  3S1R K;  2ZUF A;  5C3E C;  3V4G A;  1Y1V C;  3PIO S;  1PJ5 A;  4WJ3 M;  2JA8 C;  4GTF A;  3GTO A;  3S2H K;  1X31 C;  3S16 K;  4PAB A;  3AD8 C;  2NVY K;  4OIP A;  3IPJ A;  2R92 K;  4J3N A;  1XZP A;  4C2M K;  1VH2 A;  4Y7N C; 
#chains in the Genus database with same CATH homology
 1TWH K;  3GTJ K;  4A3M C;  3HOZ C;  3GTL C;  3FKI C;  4A3J K;  3CQZ K;  2JA7 K;  3GTQ K;  3HOW C;  1WCM K;  5IYC C;  1TWG K;  1R9T K;  1ZYR A;  2PMZ L;  1XPP A;  5C3E K;  4LK1 A;  5IYD C;  1Y1V K;  4G7Z A;  3PO2 K;  1TWC K;  4C2M C;  2JA8 K;  3HOV K;  3HOY K;  4A3L C;  2NVX C;  1SFO C;  3I4N C;  3H0G K;  3S1N C;  2E2H C;  1I6H C;  2WAQ D;  1Y1W C;  4BBR K;  3S15 C;  3K7A C;  3M3Y C;  2R7Z K;  5FLM C;  3S14 K;  1R9T C;  4C3J C;  4Y7N K;  4A3M K;  3HOZ K;  4GZY A;  3FKI K;  3GTL K;  1YNN A;  2NVQ K;  4Y52 K;  5IYC K;  3GTO C;  5M3M K;  3S17 C;  5C4J C;  4BXX C;  4KN4 A;  5D4D A;  4A3B C;  4G7H A;  5IYD K;  3WOD A;  1I50 C;  3RZO C;  4A93 C;  4Q5S A;  2NVX K;  4A3L K;  5IP9 C;  1SFO K;  3I4N K;  2PPB A;  2BE5 A;  3S1N K;  2E2H K;  1I6H K;  3GTM C;  1Y1W K;  2NVQ C;  4A3C C;  3S15 K;  4Y52 C;  4YFN A;  3GTG C;  1I3Q K;  3K7A K;  4OIN A;  5FLM K;  3M3Y K;  4C3J K;  4YFX A;  1TWA C;  1IW7 A;  1TWF C;  2A68 A;  1BDF A;  4A3I C;  4X6A K;  4YFK A;  3HKZ L;  4XSZ A;  4ZH4 A;  3GTO K;  3S17 K;  2Y0S L;  5C4J K;  4BXX K;  3HOX C;  4A3K C;  5C4X C;  4A3B K;  3I4M C;  2YU9 C;  1I3Q C;  3RZO K;  1I50 K;  4A93 K;  5FJ8 K;  5IP9 K;  1K83 K;  4AYB L;  3GTM K;  2E2J C;  4A3C K;  4X6A C;  3GTP C;  3GTG K;  2WB1 L;  2PA8 L;  2JA5 C;  1TWA K;  4Y7N C;  4XLN A;  4LLG A;  1TWF K;  5IYB C;  5C44 C;  4A3I K;  3GTK K;  4A3G C;  4MEY A;  4QIW D;  2B63 C;  1K83 C;  3HOX K;  5TMC A;  5C4X K;  4A3K K;  4A3D C;  1HQM A;  4XLP A;  2A69 A;  2YU9 K;  3H3V L;  3I4M K;  4A3F C;  4LK0 A;  4QJV B;  4C3I K;  2CW0 A;  3HOU C;  5IP7 C;  1SMY A;  4KMU A;  2E2J K;  4OIQ A;  3GTK C;  4G7O A;  3GTP K;  3S2D C;  2JA5 K;  4A3E C;  2PMZ D;  4Q4Z A;  3S14 C;  1YNJ A;  4QJV A;  2O5I A;  2JA6 C;  4OIO A;  5IYB K;  2R93 C;  5C44 K;  3RZD C;  3M4O C;  3HKZ D;  4A3G K;  4C3I C;  2B63 K;  4BY7 K;  2Y0S D;  3S1Q C;  4A3D K;  5TMF A;  2E2I K;  4YG2 A;  4XSX A;  3S1R C;  4MQ9 A;  4A3F K;  4C3H K;  3EQL A;  4LJZ A;  3S1M C;  2NVT K;  3HOU K;  5IP7 K;  4AYB D;  4NOI A;  2VUM C;  3S2H C;  2O5J A;  3S16 C;  3S2D K;  3PO3 C;  2WB1 D;  2PA8 D;  4A3E K;  2NVY C;  2R92 C;  4BY7 C;  2WAQ L;  5M5W K;  2JA6 K;  2E2I C;  4KN7 A;  2R93 K;  2A6E A;  4C3H C;  3RZD K;  1TWH C;  3M4O K;  3GTJ C;  4A3J C;  3GTQ C;  2JA7 C;  3CQZ C;  2NVT C;  4BBS K;  3S1Q K;  1WCM C;  4OIR A;  4BY1 K;  1TWG C;  3H3V D;  3S1R K;  5C3E C;  1Y1V C;  3S1M K;  3PO2 C;  5M3F K;  1TWC C;  2JA8 C;  3HOW K;  5M5X K;  3HOV C;  3HOY C;  2VUM K;  3S2H K;  3S16 K;  4QIW L;  4MEX A;  3H0G C;  1I6V A;  3DXJ A;  4BBS C;  5M5Y K;  3PO3 K;  2NVY K;  4OIP A;  2R92 K;  4BBR C;  4C2M K;  2R7Z C;  4BY1 C;  4JK1 A;  2A6H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...