1YNJA

Taq rna polymerase-sorangicin complex
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
230
structure length
230
Chain Sequence
b'LKAPVFTATTQGDHYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLDPKMASTTLILRAEGPKEVRAGDFTPSADVEIMNPDLHIATLEEGGKLYMEVRVDRGVGYVPAERHGIKDRINAIPVDAIFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVAILKEHLNYFANPEASLLPT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase alpha chain
publication title Structural, functional, and genetic analysis of sorangicin inhibition of bacterial RNA polymerase
pubmed doi rcsb
molecule tags Transferase
total genus 43
structure length 230
sequence length 230
chains with identical sequence B
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2005-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01000 RNA_pol_A_bac RNA polymerase Rpb3/RpoA insert domain
A PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain
A PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.12 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 DNA-directed RNA polymerase, insert domain 1ynjA02
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 1ynjA01
3S17C 4X6AK 3GTGK 3RZDK 3S2DC 2JA5K 4C3JC 4KMUA 3PO2K 4BBSC 4XSXA 3HOXK 2JA6K 4A3DK 4A3EC 4KN4A 4C3IC 4A3FC 3DXJA 5C4XC 3HOWC 1YNNA 3GTMC 2BE5A 4A3JC 3FKIK 5C4JK 4LK1A 4BXXC 4YFKA 4QJVA 4OIPA 5FLMC 2JA8C 1SFOC 2O5JA 2Y0SD 3RZOC 4BBRK 1R9TC 1I50C 5IYCC 2NVTC 4A3GC 4A3CC 5M5YK 2NVQK 3HOVC 3I4NC 4JK1A 3S17K 5M5XK 3M3YK 4C2MK 3S2DK 3H3VD 5C3EC 3S1QK 4XLNA 3S1RC 3M4OK 4G7OA 1TWGC 1HQMA 3S2HC 4LK0A 2O5IA 4YFNA 3S1NC 5C4XK 4C3IK 1TWFK 2R7ZC 3HOWK 5C44C 3HOUC 4A93C 4A3JK 3S1MK 2YU9C 1TWCK 5IP7C 3S14C 2NVXC 3HOYC 5FLMK 4ZH4A 5IP9K 4A3LC 1SFOK 3GTOK 5IYCK 4A3IK 1K83C 1Y1WC 1TWAK 3GTPK 1Y1VC 2A69A 2A6EA 4A3MC 2E2JK 1BDFA 4Y7NC 3I4MC 1WCMK 2Y0SL 4BY7K 4A3KK 3S15C 3WODA 2E2HC 4C3HK 3GTLC 2NVYK 5C3EK 2PMZD 1I6VA 2VUMK 3S1RK 4OIQA 2R93C 3S1NK 3S2HK 2JA7C 4G7HA 4BY1C 3GTKK 3S16C 2E2IK 2B63C 2R7ZK 3H3VL 3EQLA 3CQZC 3K7AC 1I3QC 5IYDC 3GTQC 4MEXA 5C44K 1TWHC 4XSZA 4G7ZA 5IP7K 5M3MK 2YU9K 4C3JK 3PO3C 4QIWD 3HOYK 4BBSK 4OIRA 4A3EK 3H0GC 4A3FK 3GTMK 4MEYA 2A6HA 4BXXK 4AYBD 4LJZA 4X6AC 3I4MK 3RZDC 2JA8K 5TMCA 2JA5C 3S15K 2WAQD 3RZOK 3PO2C 1R9TK 1I50K 2NVTK 2JA6C 4A3DC 4A3GK 3HOZC 4A3CK 3HOVK 4BY1K 2WB1D 3I4NK 3FKIC 2PMZL 4XLPA 2R92C 1IW7A 5M5WK 1TWGK 4KN7A 5IYBC 1YNJA 4YG2A 2PA8D 5FJ8K 4QIWL 3HKZD 3HOUK 4Y52C 2CW0A 4A93K 1I6HC 3S14K 2NVXK 3M3YC 4C2MC 3S1QC 5M3FK 4A3LK 1ZYRA 4MQ9A 4A3BC 4NOIA 3M4OC 3GTJC 4AYBL 1SMYA 5TMFA 1K83K 3HOZK 1Y1WK 2A68A 1TWFC 1Y1VK 4A3MK 2WAQL 4Y7NK 3S1MC 3GTGC 1TWCC 2R92K 2E2HK 3GTLK 5IP9C 5D4DA 3GTOC 3HOXC 2PPBA 4Q5SA 2WB1L 1XPPA 5IYBK 2R93K 2JA7K 4LLGA 4GZYA 3S16K 4A3IC 2B63K 5IYDK 3CQZK 3K7AK 1TWAC 3GTPC 1I3QK 5C4JC 2E2JC 1TWHK 3GTQK 4Y52K 4YFXA 4Q4ZA 4BY7C 1WCMC 1I6HK 4OINA 3PO3K 4A3KC 2PA8L 4C3HC 2NVYC 4A3BK 4BBRC 3HKZL 2VUMC 3H0GK 3GTJK 4OIOA 2NVQC 4QJVB 3GTKC 2E2IC
chains in the Genus database with same CATH superfamily
1VLOA 3PIOS 3N3YA 4X6AK 3RZDK 2JA5K 5DM7S 2NVXA 3PO2K 4A3EC 4A3FC 1DD5A 4QJVA 3NUHA 3A8KA 3FKIA 4LQYA 2JA8C 1SFOC 2XCRB 2Y0SD 2GSOA 1R9TC 5IYCC 4WILA 5M5YK 2XCQA 4P5BA 3I4NC 1JQWA 4JK1A 3S0XA 1B4AA 2XCOA 4G0UA 4XLNA 4BLAA 3S1NC 4LK0A 2V6TA 4YFNA 1O2FB 5C4XK 3H0GA 4C3IK 1TWFK 4J3NA 4GFQA 3HOWK 3HOUC 4A3JK 1TWCK 2FQOA 3S14C 2D6FC 5IP9K 4A3LC 4GTAA 4A3MC 1XZQA 4Y7NC 3I4MC 3GTPA 5DM6S 1WOOA 3S15C 3WODA 5HL8A 4A3KK 1WCMA 2CFAA 2VUMK 4OIQA 1G51A 4FZBA 2JA7C 3VA7A 3S16C 2R7ZK 3EQLA 1I3QC 4WFBS 5C44K 3GTKA 2YU9K 5IP7K 3TFJA 2FQTA 1HI9A 2A6HA 4AYBD 1XXCA 2V6UA 3RZOK 2NVTK 4ILDA 3HOVK 3AQOA 4BY1K 2PMZL 1JOEA 5M5WK 4KN7A 5IYBC 2VUMA 1TWGA 5FJ8K 5IORA 4QIWL 4Y52C 2R7ZA 2KXYA 1O27A 4KM8A 4G0WA 3CF5S 2YU9A 4A3BC 4U67S 4GTLA 1F7VA 4NOIA 4GT9A 1SMYA 1Y1WK 2PHCB 1EI6A 1K83A 4IOCS 1Y1VA 3BUEA 1J98A 5JFEA 5D4DA 3GTOC 2E2HA 2R93K 1EQRA 4GZYA 1BGWA 5IYDK 2KQ1A 1TWHK 3CQZA 4OINA 4C3HC 1F7UA 4BBRC 3AH5A 3G4CA 3GTJK 1FEUA 4OIOA 2NVQC 3SZZA 2GSUA 2E2IC 1DCHA 3CAGA 4KB4A 3S17C 3GTGK 2RGRA 4C3JC 1EFWA 1L0WA 4KN4A 1YNNA 3GTMC 2JA6A 2BE5A 3FKIK 5C4JK 5FLMC 5E68A 2O5JA 4RMFA 1I50C 3L4KA 3MMLB 4A3CC 3FOFA 2ZUEA 1TWHA 4C2MK 1IS1A 3S1RC 1DCOA 3QX3A 3L4JA 1WSVA 3GTJA 4KARA 4A93C 2EBBA 4WF9S 2NVXC 3GTGA 1O26A 4ZH4A 3AD9C 1SFOK 2Y3PA 3LAJA 2KWAA 5IYCK 4A3IK 4BLBA 3ERED 3GTPK 2A6EA 1J6VA 5JVOA 5CJ9A 2E2JK 1BDFA 1J6WA 4BY7K 1WCMK 1TWAA 3BP3A 3GTLC 2NVYK 4KB2A 2PMZD 1C0AA 1WORA 3S1NK 2L5NA 3GTKK 2B63C 3H3VL 3GTQC 3HXAA 1XZPB 4XSZA 1BS2A 4QIWD 4BBSK 5HL7S 1ZXOA 3H0GC 4KASA 3PIPS 1YX2A 3LAPA 4BXXK 4X6AC 3I4MK 3RZDC 3S15K 2JA5C 2ZJPS 1O29A 3PO2C 1SFOA 3LPXA 4LR2A 4A3GK 3HOZC 3IPJA 1R9TA 2RH6A 1JVIA 4XLPA 2R92C 1B4BA 3SZYA 4BKWA 1TWGK 4KMHA 2NVYA 1YNJA 4YG2A 2CW0A 3DLLS 1IBAA 5M3FK 4PABA 3TFIA 1K83K 2A68A 1TWFC 1Y1VK 4KMAA 2ZJQS 4KDDA 1TWCC 2P8TA 3GEIA 2E2HK 5IP9C 1F9NA 3HOXC 2PPBA 1XPPA 5IYBK 4G0VA 4KMDA 4AH6A 2KPUA 3CQZK 3K7AK 2JA7A 4Y52K 1O2BA 1I3QA 4IO9S 4A3KC 2PA8L 1RU0A 3PO3K 1WQFA 1XXAA 4A3BK 3HKZL 3N0BA 2VUMC 1EH1A 5EGEA 4QJVB 1USMA 5IOQA 4P5AA 3OREA 3S2DC 4IOAS 4KMUA 4LOWA 4XSXA 2JA6K 4A3DK 3DXJA 3Q3QA 4WJ4A 4LK1A 4YFKA 1UV7A 3RZOC 4BBRK 1PJ5A 2NVTC 2NVQK 3HOVC 3S17K 1WQHA 3M3YK 3S1QK 3H3VD 5C3EC 3M4OK 4G7OA 3S2HC 1XZQB 3OEPA 1BJTA 1USOA 3S1MK 2CFAB 1O25A 4KAWX 3HOYC 5FLMK 4GTCA 4GTEA 4C45A 3GTOA 2GSNA 1F93A 2JH3A 5EGHA 4FM9A 1Y1WC 1TWAK 3FOEA 2A69A 3GEEA 1IL2A 1VGXA 4KATA 1VRQC 4GTFA 1I6VA 3AD7C 3TTGA 3S1RK 2GAGC 2R93C 4G7HA 5IYDC 1WQGA 4MEXA 2E2IA 1TWHC 5M3MK 5HQHA 3GSIA 1V5VA 2P5MA 1IQ0A 1O28A 4OIRA 4A3EK 4A3FK 4MEYA 1ZVUA 2JA8K 5TMCA 5IOTA 1DCPA 3G4AA 1R9TK 2ZFZA 1AB4A 1I50A 3I4NK 3FKIC 1IW7A 5TJ3A 3OPFA 3N0CA 3T00A 3AQPA 2PA8D 1X31C 3HKZD 3HOUK 3FHZA 1I6HC 3S14K 4WCES 4C2MC 4A3LK 4MQ9A 5CHPA 3HOZK 1PJ6A 1VH2A 2ZUFA 4A3MK 2WAQL 4Y7NK 2R92K 5JVGS 2WB1L 4O2DA 3GTLA 3TFHA 2JA7K 2ZJRS 3S16K 4A3IC 1I3QK 3GTPC 2E2JC 1VJEA 2B63A 4BY7C 1WCMC 3GTQA 2GAHC 1ZBSA 2NVYC 1WIHA 3GTKC 1INNA 3T01A 4BBSC 2JA5A 3HOXK 5C4XC 4C3IC 5L46A 3HOWC 3A8IA 4WFNS 4A3JC 4KC6A 3BP8C 4BXXC 4KM9A 5JVHS 4OIPA 2R92A 3LYWA 4A3GC 4DDQA 4PAAA 5M5XK 3S2DK 4XCHA 1TWGC 1HQMA 2O5IA 2R7ZC 5C44C 1TWFA 2YU9C 5IP7C 3JSTA 1TWCA 3GDZA 3GEHA 3GTOK 1K83C 1Y1VC 2Y0SL 4GTBA 2E2HC 1PJ7A 4C3HK 5C3EK 3S2HK 2W7VA 4BY1C 1WSRA 1WOPA 2E2IK 3CQZC 3K7AC 1XXBA 1J6XA 1ISEA 4G7ZA 2L3UA 4C3JK 3PO3C 3HOYK 3GIRA 3ADAC 1WOSA 3GTMK 3T02A 1IE0A 4LJZA 1GE9A 2WAQD 1XZPA 1ZQ1C 3AD8C 3A8JA 1I50K 2JA6C 4A3DC 4A3CK 2WB1D 2V6SA 4M1XA 1YCLA 4WFAS 4A93K 2NVXK 3V4GA 1EK8A 4WJ3M 3M3YC 3S1QC 1ZYRA 3M4OC 3GTJC 4AYBL 5TMFA 4GTDA 3GTMA 4P9SA 5IOSA 3S1MC 3GTGC 1Y1WA 1KQ4A 3GTLK 4Q5SA 4LLGA 1O2AA 2R93A 2B63K 3GTQK 1TWAC 5C4JC 4YFXA 4Q4ZA 1I6HK 1O24A 3H0GK
chains in the Genus database with same CATH topology
3S17C 4X6AK 3GTGK 3RZDK 3S2DC 2JA5K 4C3JC 4KMUA 3PO2K 4BBSC 4XSXA 3HOXK 2JA6K 4A3DK 4A3EC 4KN4A 4C3IC 4A3FC 3DXJA 5C4XC 3HOWC 1YNNA 3GTMC 2BE5A 4A3JC 3FKIK 5C4JK 4LK1A 4BXXC 4YFKA 4QJVA 4OIPA 5FLMC 2JA8C 1SFOC 2O5JA 2Y0SD 3RZOC 4BBRK 1R9TC 1I50C 5IYCC 2NVTC 4A3GC 4A3CC 5M5YK 2NVQK 3HOVC 3I4NC 4JK1A 3S17K 5M5XK 3M3YK 4C2MK 3S2DK 3H3VD 5C3EC 3S1QK 4XLNA 3S1RC 3M4OK 4G7OA 1TWGC 1HQMA 3S2HC 4LK0A 2O5IA 4YFNA 3S1NC 5C4XK 4C3IK 1TWFK 2R7ZC 3HOWK 5C44C 3HOUC 4A93C 4A3JK 3S1MK 2YU9C 1TWCK 5IP7C 3S14C 2NVXC 3HOYC 5FLMK 4ZH4A 5IP9K 4A3LC 1SFOK 3GTOK 5IYCK 4A3IK 1K83C 1Y1WC 1TWAK 3GTPK 1Y1VC 2A69A 2A6EA 4A3MC 2E2JK 1BDFA 4Y7NC 3I4MC 1WCMK 2Y0SL 4BY7K 4A3KK 3S15C 3WODA 2E2HC 4C3HK 3GTLC 2NVYK 5C3EK 2PMZD 1I6VA 2VUMK 3S1RK 4OIQA 2R93C 3S1NK 3S2HK 2JA7C 4G7HA 4BY1C 3GTKK 3S16C 2E2IK 2B63C 2R7ZK 3H3VL 3EQLA 3CQZC 3K7AC 1I3QC 5IYDC 3GTQC 4MEXA 5C44K 1TWHC 4XSZA 4G7ZA 5IP7K 5M3MK 2YU9K 4C3JK 3PO3C 4QIWD 3HOYK 4BBSK 4OIRA 4A3EK 3H0GC 4A3FK 3GTMK 4MEYA 2A6HA 4BXXK 4AYBD 4LJZA 4X6AC 3I4MK 3RZDC 2JA8K 5TMCA 2JA5C 3S15K 2WAQD 3RZOK 3PO2C 1R9TK 1I50K 2NVTK 2JA6C 4A3DC 4A3GK 3HOZC 4A3CK 3HOVK 4BY1K 2WB1D 3I4NK 3FKIC 2PMZL 4XLPA 2R92C 1IW7A 5M5WK 1TWGK 4KN7A 5IYBC 1YNJA 4YG2A 2PA8D 5FJ8K 4QIWL 3HKZD 3HOUK 4Y52C 2CW0A 4A93K 1I6HC 3S14K 2NVXK 3M3YC 4C2MC 3S1QC 5M3FK 4A3LK 1ZYRA 4MQ9A 4A3BC 4NOIA 3M4OC 3GTJC 4AYBL 1SMYA 5TMFA 1K83K 3HOZK 1Y1WK 2A68A 1TWFC 1Y1VK 4A3MK 2WAQL 4Y7NK 3S1MC 3GTGC 1TWCC 2R92K 2E2HK 3GTLK 5IP9C 5D4DA 3GTOC 3HOXC 2PPBA 4Q5SA 2WB1L 1XPPA 5IYBK 2R93K 2JA7K 4LLGA 4GZYA 3S16K 4A3IC 2B63K 5IYDK 3CQZK 3K7AK 1TWAC 3GTPC 1I3QK 5C4JC 2E2JC 1TWHK 3GTQK 4Y52K 4YFXA 4Q4ZA 4BY7C 1WCMC 1I6HK 4OINA 3PO3K 4A3KC 2PA8L 4C3HC 2NVYC 4A3BK 4BBRC 3HKZL 2VUMC 3H0GK 3GTJK 4OIOA 2NVQC 4QJVB 3GTKC 2E2IC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S17 C;  4X6A K;  3GTG K;  3RZD K;  3S2D C;  2JA5 K;  4C3J C;  4KMU A;  3PO2 K;  4BBS C;  4XSX A;  3HOX K;  2JA6 K;  4A3D K;  4A3E C;  4KN4 A;  4C3I C;  4A3F C;  3DXJ A;  5C4X C;  3HOW C;  1YNN A;  3GTM C;  2BE5 A;  4A3J C;  3FKI K;  5C4J K;  4LK1 A;  4BXX C;  4YFK A;  4QJV A;  4OIP A;  5FLM C;  2JA8 C;  1SFO C;  2O5J A;  2Y0S D;  3RZO C;  4BBR K;  1R9T C;  1I50 C;  5IYC C;  2NVT C;  4A3G C;  4A3C C;  5M5Y K;  2NVQ K;  3HOV C;  3I4N C;  4JK1 A;  3S17 K;  5M5X K;  3M3Y K;  4C2M K;  3S2D K;  3H3V D;  5C3E C;  3S1Q K;  4XLN A;  3S1R C;  3M4O K;  4G7O A;  1TWG C;  1HQM A;  3S2H C;  4LK0 A;  2O5I A;  4YFN A;  3S1N C;  5C4X K;  4C3I K;  1TWF K;  2R7Z C;  3HOW K;  5C44 C;  3HOU C;  4A93 C;  4A3J K;  3S1M K;  2YU9 C;  1TWC K;  5IP7 C;  3S14 C;  2NVX C;  3HOY C;  5FLM K;  4ZH4 A;  5IP9 K;  4A3L C;  1SFO K;  3GTO K;  5IYC K;  4A3I K;  1K83 C;  1Y1W C;  1TWA K;  3GTP K;  1Y1V C;  2A69 A;  2A6E A;  4A3M C;  2E2J K;  1BDF A;  4Y7N C;  3I4M C;  1WCM K;  2Y0S L;  4BY7 K;  4A3K K;  3S15 C;  3WOD A;  2E2H C;  4C3H K;  3GTL C;  2NVY K;  5C3E K;  2PMZ D;  1I6V A;  2VUM K;  3S1R K;  4OIQ A;  2R93 C;  3S1N K;  3S2H K;  2JA7 C;  4G7H A;  4BY1 C;  3GTK K;  3S16 C;  2E2I K;  2B63 C;  2R7Z K;  3H3V L;  3EQL A;  3CQZ C;  3K7A C;  1I3Q C;  5IYD C;  3GTQ C;  4MEX A;  5C44 K;  1TWH C;  4XSZ A;  4G7Z A;  5IP7 K;  5M3M K;  2YU9 K;  4C3J K;  3PO3 C;  4QIW D;  3HOY K;  4BBS K;  4OIR A;  4A3E K;  3H0G C;  4A3F K;  3GTM K;  4MEY A;  2A6H A;  4BXX K;  4AYB D;  4LJZ A;  4X6A C;  3I4M K;  3RZD C;  2JA8 K;  5TMC A;  2JA5 C;  3S15 K;  2WAQ D;  3RZO K;  3PO2 C;  1R9T K;  1I50 K;  2NVT K;  2JA6 C;  4A3D C;  4A3G K;  3HOZ C;  4A3C K;  3HOV K;  4BY1 K;  2WB1 D;  3I4N K;  3FKI C;  2PMZ L;  4XLP A;  2R92 C;  1IW7 A;  5M5W K;  1TWG K;  4KN7 A;  5IYB C;  1YNJ A;  4YG2 A;  2PA8 D;  5FJ8 K;  4QIW L;  3HKZ D;  3HOU K;  4Y52 C;  2CW0 A;  4A93 K;  1I6H C;  3S14 K;  2NVX K;  3M3Y C;  4C2M C;  3S1Q C;  5M3F K;  4A3L K;  1ZYR A;  4MQ9 A;  4A3B C;  4NOI A;  3M4O C;  3GTJ C;  4AYB L;  1SMY A;  5TMF A;  1K83 K;  3HOZ K;  1Y1W K;  2A68 A;  1TWF C;  1Y1V K;  4A3M K;  2WAQ L;  4Y7N K;  3S1M C;  3GTG C;  1TWC C;  2R92 K;  2E2H K;  3GTL K;  5IP9 C;  5D4D A;  3GTO C;  3HOX C;  2PPB A;  4Q5S A;  2WB1 L;  1XPP A;  5IYB K;  2R93 K;  2JA7 K;  4LLG A;  4GZY A;  3S16 K;  4A3I C;  2B63 K;  5IYD K;  3CQZ K;  3K7A K;  1TWA C;  3GTP C;  1I3Q K;  5C4J C;  2E2J C;  1TWH K;  3GTQ K;  4Y52 K;  4YFX A;  4Q4Z A;  4BY7 C;  1WCM C;  1I6H K;  4OIN A;  3PO3 K;  4A3K C;  2PA8 L;  4C3H C;  2NVY C;  4A3B K;  4BBR C;  3HKZ L;  2VUM C;  3H0G K;  3GTJ K;  4OIO A;  2NVQ C;  4QJV B;  3GTK C;  2E2I C; 
#chains in the Genus database with same CATH topology
 1VLO A;  3PIO S;  3N3Y A;  4X6A K;  3RZD K;  2JA5 K;  5DM7 S;  2NVX A;  3PO2 K;  4A3E C;  4A3F C;  1DD5 A;  4QJV A;  3NUH A;  3A8K A;  3FKI A;  4LQY A;  2JA8 C;  1SFO C;  2XCR B;  2Y0S D;  2GSO A;  1R9T C;  5IYC C;  4WIL A;  5M5Y K;  2XCQ A;  4P5B A;  3I4N C;  1JQW A;  4JK1 A;  3S0X A;  1B4A A;  2XCO A;  4G0U A;  4XLN A;  4BLA A;  3S1N C;  4LK0 A;  2V6T A;  4YFN A;  1O2F B;  5C4X K;  3H0G A;  4C3I K;  1TWF K;  4J3N A;  4GFQ A;  3HOW K;  3HOU C;  4A3J K;  1TWC K;  2FQO A;  3S14 C;  2D6F C;  5IP9 K;  4A3L C;  4GTA A;  4A3M C;  1XZQ A;  4Y7N C;  3I4M C;  3GTP A;  5DM6 S;  1WOO A;  3S15 C;  3WOD A;  5HL8 A;  4A3K K;  1WCM A;  2CFA A;  2VUM K;  4OIQ A;  1G51 A;  4FZB A;  2JA7 C;  3VA7 A;  3S16 C;  2R7Z K;  3EQL A;  1I3Q C;  4WFB S;  5C44 K;  3GTK A;  2YU9 K;  5IP7 K;  3TFJ A;  2FQT A;  1HI9 A;  2A6H A;  4AYB D;  1XXC A;  2V6U A;  3RZO K;  2NVT K;  4ILD A;  3HOV K;  3AQO A;  4BY1 K;  2PMZ L;  1JOE A;  5M5W K;  4KN7 A;  5IYB C;  2VUM A;  1TWG A;  5FJ8 K;  5IOR A;  4QIW L;  4Y52 C;  2R7Z A;  2KXY A;  1O27 A;  4KM8 A;  4G0W A;  3CF5 S;  2YU9 A;  4A3B C;  4U67 S;  4GTL A;  1F7V A;  4NOI A;  4GT9 A;  1SMY A;  1Y1W K;  2PHC B;  1EI6 A;  1K83 A;  4IOC S;  1Y1V A;  3BUE A;  1J98 A;  5JFE A;  5D4D A;  3GTO C;  2E2H A;  2R93 K;  1EQR A;  4GZY A;  1BGW A;  5IYD K;  2KQ1 A;  1TWH K;  3CQZ A;  4OIN A;  4C3H C;  1F7U A;  4BBR C;  3AH5 A;  3G4C A;  3GTJ K;  1FEU A;  4OIO A;  2NVQ C;  3SZZ A;  2GSU A;  2E2I C;  1DCH A;  3CAG A;  4KB4 A;  3S17 C;  3GTG K;  2RGR A;  4C3J C;  1EFW A;  1L0W A;  4KN4 A;  1YNN A;  3GTM C;  2JA6 A;  2BE5 A;  3FKI K;  5C4J K;  5FLM C;  5E68 A;  2O5J A;  4RMF A;  1I50 C;  3L4K A;  3MML B;  4A3C C;  3FOF A;  2ZUE A;  1TWH A;  4C2M K;  1IS1 A;  3S1R C;  1DCO A;  3QX3 A;  3L4J A;  1WSV A;  3GTJ A;  4KAR A;  4A93 C;  2EBB A;  4WF9 S;  2NVX C;  3GTG A;  1O26 A;  4ZH4 A;  3AD9 C;  1SFO K;  2Y3P A;  3LAJ A;  2KWA A;  5IYC K;  4A3I K;  4BLB A;  3ERE D;  3GTP K;  2A6E A;  1J6V A;  5JVO A;  5CJ9 A;  2E2J K;  1BDF A;  1J6W A;  4BY7 K;  1WCM K;  1TWA A;  3BP3 A;  3GTL C;  2NVY K;  4KB2 A;  2PMZ D;  1C0A A;  1WOR A;  3S1N K;  2L5N A;  3GTK K;  2B63 C;  3H3V L;  3GTQ C;  3HXA A;  1XZP B;  4XSZ A;  1BS2 A;  4QIW D;  4BBS K;  5HL7 S;  1ZXO A;  3H0G C;  4KAS A;  3PIP S;  1YX2 A;  3LAP A;  4BXX K;  4X6A C;  3I4M K;  3RZD C;  3S15 K;  2JA5 C;  2ZJP S;  1O29 A;  3PO2 C;  1SFO A;  3LPX A;  4LR2 A;  4A3G K;  3HOZ C;  3IPJ A;  1R9T A;  2RH6 A;  1JVI A;  4XLP A;  2R92 C;  1B4B A;  3SZY A;  4BKW A;  1TWG K;  4KMH A;  2NVY A;  1YNJ A;  4YG2 A;  2CW0 A;  3DLL S;  1IBA A;  5M3F K;  4PAB A;  3TFI A;  1K83 K;  2A68 A;  1TWF C;  1Y1V K;  4KMA A;  2ZJQ S;  4KDD A;  1TWC C;  2P8T A;  3GEI A;  2E2H K;  5IP9 C;  1F9N A;  3HOX C;  2PPB A;  1XPP A;  5IYB K;  4G0V A;  4KMD A;  4AH6 A;  2KPU A;  3CQZ K;  3K7A K;  2JA7 A;  4Y52 K;  1O2B A;  1I3Q A;  4IO9 S;  4A3K C;  2PA8 L;  1RU0 A;  3PO3 K;  1WQF A;  1XXA A;  4A3B K;  3HKZ L;  3N0B A;  2VUM C;  1EH1 A;  5EGE A;  4QJV B;  1USM A;  5IOQ A;  4P5A A;  3ORE A;  3S2D C;  4IOA S;  4KMU A;  4LOW A;  4XSX A;  2JA6 K;  4A3D K;  3DXJ A;  3Q3Q A;  4WJ4 A;  4LK1 A;  4YFK A;  1UV7 A;  3RZO C;  4BBR K;  1PJ5 A;  2NVT C;  2NVQ K;  3HOV C;  3S17 K;  1WQH A;  3M3Y K;  3S1Q K;  3H3V D;  5C3E C;  3M4O K;  4G7O A;  3S2H C;  1XZQ B;  3OEP A;  1BJT A;  1USO A;  3S1M K;  2CFA B;  1O25 A;  4KAW X;  3HOY C;  5FLM K;  4GTC A;  4GTE A;  4C45 A;  3GTO A;  2GSN A;  1F93 A;  2JH3 A;  5EGH A;  4FM9 A;  1Y1W C;  1TWA K;  3FOE A;  2A69 A;  3GEE A;  1IL2 A;  1VGX A;  4KAT A;  1VRQ C;  4GTF A;  1I6V A;  3AD7 C;  3TTG A;  3S1R K;  2GAG C;  2R93 C;  4G7H A;  5IYD C;  1WQG A;  4MEX A;  2E2I A;  1TWH C;  5M3M K;  5HQH A;  3GSI A;  1V5V A;  2P5M A;  1IQ0 A;  1O28 A;  4OIR A;  4A3E K;  4A3F K;  4MEY A;  1ZVU A;  2JA8 K;  5TMC A;  5IOT A;  1DCP A;  3G4A A;  1R9T K;  2ZFZ A;  1AB4 A;  1I50 A;  3I4N K;  3FKI C;  1IW7 A;  5TJ3 A;  3OPF A;  3N0C A;  3T00 A;  3AQP A;  2PA8 D;  1X31 C;  3HKZ D;  3HOU K;  3FHZ A;  1I6H C;  3S14 K;  4WCE S;  4C2M C;  4A3L K;  4MQ9 A;  5CHP A;  3HOZ K;  1PJ6 A;  1VH2 A;  2ZUF A;  4A3M K;  2WAQ L;  4Y7N K;  2R92 K;  5JVG S;  2WB1 L;  4O2D A;  3GTL A;  3TFH A;  2JA7 K;  2ZJR S;  3S16 K;  4A3I C;  1I3Q K;  3GTP C;  2E2J C;  1VJE A;  2B63 A;  4BY7 C;  1WCM C;  3GTQ A;  2GAH C;  1ZBS A;  2NVY C;  1WIH A;  3GTK C;  1INN A;  3T01 A;  4BBS C;  2JA5 A;  3HOX K;  5C4X C;  4C3I C;  5L46 A;  3HOW C;  3A8I A;  4WFN S;  4A3J C;  4KC6 A;  3BP8 C;  4BXX C;  4KM9 A;  5JVH S;  4OIP A;  2R92 A;  3LYW A;  4A3G C;  4DDQ A;  4PAA A;  5M5X K;  3S2D K;  4XCH A;  1TWG C;  1HQM A;  2O5I A;  2R7Z C;  5C44 C;  1TWF A;  2YU9 C;  5IP7 C;  3JST A;  1TWC A;  3GDZ A;  3GEH A;  3GTO K;  1K83 C;  1Y1V C;  2Y0S L;  4GTB A;  2E2H C;  1PJ7 A;  4C3H K;  5C3E K;  3S2H K;  2W7V A;  4BY1 C;  1WSR A;  1WOP A;  2E2I K;  3CQZ C;  3K7A C;  1XXB A;  1J6X A;  1ISE A;  4G7Z A;  2L3U A;  4C3J K;  3PO3 C;  3HOY K;  3GIR A;  3ADA C;  1WOS A;  3GTM K;  3T02 A;  1IE0 A;  4LJZ A;  1GE9 A;  2WAQ D;  1XZP A;  1ZQ1 C;  3AD8 C;  3A8J A;  1I50 K;  2JA6 C;  4A3D C;  4A3C K;  2WB1 D;  2V6S A;  4M1X A;  1YCL A;  4WFA S;  4A93 K;  2NVX K;  3V4G A;  1EK8 A;  4WJ3 M;  3M3Y C;  3S1Q C;  1ZYR A;  3M4O C;  3GTJ C;  4AYB L;  5TMF A;  4GTD A;  3GTM A;  4P9S A;  5IOS A;  3S1M C;  3GTG C;  1Y1W A;  1KQ4 A;  3GTL K;  4Q5S A;  4LLG A;  1O2A A;  2R93 A;  2B63 K;  3GTQ K;  1TWA C;  5C4J C;  4YFX A;  4Q4Z A;  1I6H K;  1O24 A;  3H0G K; 
#chains in the Genus database with same CATH homology
 3S17 C;  4X6A K;  3GTG K;  3RZD K;  3S2D C;  2JA5 K;  4C3J C;  4KMU A;  3PO2 K;  4BBS C;  4XSX A;  3HOX K;  2JA6 K;  4A3D K;  4A3E C;  4KN4 A;  4C3I C;  4A3F C;  3DXJ A;  5C4X C;  3HOW C;  1YNN A;  3GTM C;  2BE5 A;  4A3J C;  3FKI K;  5C4J K;  4LK1 A;  4BXX C;  4YFK A;  4QJV A;  4OIP A;  5FLM C;  2JA8 C;  1SFO C;  2O5J A;  2Y0S D;  3RZO C;  4BBR K;  1R9T C;  1I50 C;  5IYC C;  2NVT C;  4A3G C;  4A3C C;  5M5Y K;  2NVQ K;  3HOV C;  3I4N C;  4JK1 A;  3S17 K;  5M5X K;  3M3Y K;  4C2M K;  3S2D K;  3H3V D;  5C3E C;  3S1Q K;  4XLN A;  3S1R C;  3M4O K;  4G7O A;  1TWG C;  1HQM A;  3S2H C;  4LK0 A;  2O5I A;  4YFN A;  3S1N C;  5C4X K;  4C3I K;  1TWF K;  2R7Z C;  3HOW K;  5C44 C;  3HOU C;  4A93 C;  4A3J K;  3S1M K;  2YU9 C;  1TWC K;  5IP7 C;  3S14 C;  2NVX C;  3HOY C;  5FLM K;  4ZH4 A;  5IP9 K;  4A3L C;  1SFO K;  3GTO K;  5IYC K;  4A3I K;  1K83 C;  1Y1W C;  1TWA K;  3GTP K;  1Y1V C;  2A69 A;  2A6E A;  4A3M C;  2E2J K;  1BDF A;  4Y7N C;  3I4M C;  1WCM K;  2Y0S L;  4BY7 K;  4A3K K;  3S15 C;  3WOD A;  2E2H C;  4C3H K;  3GTL C;  2NVY K;  5C3E K;  2PMZ D;  1I6V A;  2VUM K;  3S1R K;  4OIQ A;  2R93 C;  3S1N K;  3S2H K;  2JA7 C;  4G7H A;  4BY1 C;  3GTK K;  3S16 C;  2E2I K;  2B63 C;  2R7Z K;  3H3V L;  3EQL A;  3CQZ C;  3K7A C;  1I3Q C;  5IYD C;  3GTQ C;  4MEX A;  5C44 K;  1TWH C;  4XSZ A;  4G7Z A;  5IP7 K;  5M3M K;  2YU9 K;  4C3J K;  3PO3 C;  4QIW D;  3HOY K;  4BBS K;  4OIR A;  4A3E K;  3H0G C;  4A3F K;  3GTM K;  4MEY A;  2A6H A;  4BXX K;  4AYB D;  4LJZ A;  4X6A C;  3I4M K;  3RZD C;  2JA8 K;  5TMC A;  2JA5 C;  3S15 K;  2WAQ D;  3RZO K;  3PO2 C;  1R9T K;  1I50 K;  2NVT K;  2JA6 C;  4A3D C;  4A3G K;  3HOZ C;  4A3C K;  3HOV K;  4BY1 K;  2WB1 D;  3I4N K;  3FKI C;  2PMZ L;  4XLP A;  2R92 C;  1IW7 A;  5M5W K;  1TWG K;  4KN7 A;  5IYB C;  1YNJ A;  4YG2 A;  2PA8 D;  5FJ8 K;  4QIW L;  3HKZ D;  3HOU K;  4Y52 C;  2CW0 A;  4A93 K;  1I6H C;  3S14 K;  2NVX K;  3M3Y C;  4C2M C;  3S1Q C;  5M3F K;  4A3L K;  1ZYR A;  4MQ9 A;  4A3B C;  4NOI A;  3M4O C;  3GTJ C;  4AYB L;  1SMY A;  5TMF A;  1K83 K;  3HOZ K;  1Y1W K;  2A68 A;  1TWF C;  1Y1V K;  4A3M K;  2WAQ L;  4Y7N K;  3S1M C;  3GTG C;  1TWC C;  2R92 K;  2E2H K;  3GTL K;  5IP9 C;  5D4D A;  3GTO C;  3HOX C;  2PPB A;  4Q5S A;  2WB1 L;  1XPP A;  5IYB K;  2R93 K;  2JA7 K;  4LLG A;  4GZY A;  3S16 K;  4A3I C;  2B63 K;  5IYD K;  3CQZ K;  3K7A K;  1TWA C;  3GTP C;  1I3Q K;  5C4J C;  2E2J C;  1TWH K;  3GTQ K;  4Y52 K;  4YFX A;  4Q4Z A;  4BY7 C;  1WCM C;  1I6H K;  4OIN A;  3PO3 K;  4A3K C;  2PA8 L;  4C3H C;  2NVY C;  4A3B K;  4BBR C;  3HKZ L;  2VUM C;  3H0G K;  3GTJ K;  4OIO A;  2NVQ C;  4QJV B;  3GTK C;  2E2I C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...