5HQHA

1.32 angstrom crystal structure of ybbr like domain of lmo2119 protein from listeria monocytogenes.
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
96
structure length
96
Chain Sequence
SDSEVIENVPVKVYYDKTNLYISGIPETVTVTLSGPRSIVQSAKAQQDFTVYADLKNASIGTQEVKLQVKDVSDRLKVKVNPATVNVNVQEKVTKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords Lmo2119 protein
publication title 1.32 Angstrom Crystal Structure of Ybbr like Domain of lmo2119 Protein from Listeria monocytogenes.
rcsb
source organism Listeria monocytogenes serovar 1/2a
total genus 18
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2016-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07949 YbbR YbbR-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.30 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 RNA Polymerase Alpha Subunit; Chain A, domain 2 5hqhA00
2L3UA 2KQ1A 5HQHA 2L5NA 2KPUA 3LYWA
chains in the Genus database with same CATH superfamily
5C4JC 5IYDC 1ZYRA 3GTOC 2CW0A 5IYCC 5HQHA 2WAQD 4LLGA 4IOAS 4LK1A 4XSXA 1YNJA 3GTMC 4ZH4A 5C3EC 4LJZA 2JA8C 4A3FC 4GZYA 4Q5SA 4G7OA 2JA7C 3S14C 1TWFC 4A3GC 4YFNA 4A3LC 4C3HC 3EQLA 4KN7A 4BY7C 4WCES 5JVGS 3S2DC 2R93C 4WFNS 5TMCA 2A69A 4A3JC 2E2IC 5DM6S 2JA5C 3I4MC 1I50C 4OIPA 3M4OC 1FEUA 2A6EA 4YFXA 3FKIC 4OIOA 4Q4ZA 1Y1WC 1R9TC 5IYBC 2B63C 2NVTC 4A93C 3DLLS 3HOWC 4U67S 2PPBA 4AYBD 3RZOC 2VUMC 4BBRC 3H3VD 2YU9C 4KN4A 4IOCS 4XLPA 3HOZC 2WB1D 4A3EC 3S1QC 3S15C 3PIOS 3S1RC 5C4XC 4BY1C 1TWGC 1HQMA 2PA8D 3CF5S 4MQ9A 5JVHS 1SMYA 4BXXC 2KXYA 4IO9S 4A3IC 2O5IA 3K7AC 5C44C 3GTKC 4C3JC 2NVYC 3WODA 4XSZA 4QIWD 5IP9C 4WF9S 3PO3C 1TWAC 4G7HA 2A68A 5DM7S 5FLMC 4MEYA 2L5NA 3GTQC 5HL7S 3RZDC 3S1MC 2NVXC 2PMZD 3HKZD 2ZJRS 3GTLC 4XLNA 2L3UA 5D4DA 4A3BC 4A3CC 3S2HC 2E2HC 4MEXA 4KMUA 3S17C 4Y52C 2R92C 2Y0SD 4WFAS 3HOYC 1YNNA 1I3QC 2ZJPS 3H0GC 2BE5A 2R7ZC 3M3YC 3CQZC 3GTJC 1I6VA 2ZJQS 2A6HA 2KPUA 4C3IC 4WFBS 3PIPS 4OIQA 4YFKA 1SFOC 2NVQC 3S16C 1Y1VC 4LK0A 4G7ZA 4YG2A 4A3MC 4Y7NC 3HOVC 3LYWA 3I4NC 1BDFA 4C2MC 3DXJA 5IP7C 3HOUC 4NOIA 3HOXC 1IW7A 1K83C 2E2JC 3S1NC 3PO2C 1TWCC 4BBSC 4OIRA 1TWHC 2KQ1A 5TMFA 4A3KC 4OINA 4QJVA 1I6HC 4X6AC 2JA6C 4A3DC 2O5JA 3GTPC 3GTGC 1WCMC 4JK1A
chains in the Genus database with same CATH topology
2KXYA 2L3UA 2KQ1A 5HQHA 2L5NA 2KPUA 3LYWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L3U A;  2KQ1 A;  5HQH A;  2L5N A;  2KPU A;  3LYW A; 
#chains in the Genus database with same CATH topology
 5C4J C;  5IYD C;  1ZYR A;  3GTO C;  2CW0 A;  5IYC C;  5HQH A;  2WAQ D;  4LLG A;  4IOA S;  4LK1 A;  4XSX A;  1YNJ A;  3GTM C;  4ZH4 A;  5C3E C;  4LJZ A;  2JA8 C;  4A3F C;  4GZY A;  4Q5S A;  4G7O A;  2JA7 C;  3S14 C;  1TWF C;  4A3G C;  4YFN A;  4A3L C;  4C3H C;  3EQL A;  4KN7 A;  4BY7 C;  4WCE S;  5JVG S;  3S2D C;  2R93 C;  4WFN S;  5TMC A;  2A69 A;  4A3J C;  2E2I C;  5DM6 S;  2JA5 C;  3I4M C;  1I50 C;  4OIP A;  3M4O C;  1FEU A;  2A6E A;  4YFX A;  3FKI C;  4OIO A;  4Q4Z A;  1Y1W C;  1R9T C;  5IYB C;  2B63 C;  2NVT C;  4A93 C;  3DLL S;  3HOW C;  4U67 S;  2PPB A;  4AYB D;  3RZO C;  2VUM C;  4BBR C;  3H3V D;  2YU9 C;  4KN4 A;  4IOC S;  4XLP A;  3HOZ C;  2WB1 D;  4A3E C;  3S1Q C;  3S15 C;  3PIO S;  3S1R C;  5C4X C;  4BY1 C;  1TWG C;  1HQM A;  2PA8 D;  3CF5 S;  4MQ9 A;  5JVH S;  1SMY A;  4BXX C;  2KXY A;  4IO9 S;  4A3I C;  2O5I A;  3K7A C;  5C44 C;  3GTK C;  4C3J C;  2NVY C;  3WOD A;  4XSZ A;  4QIW D;  5IP9 C;  4WF9 S;  3PO3 C;  1TWA C;  4G7H A;  2A68 A;  5DM7 S;  5FLM C;  4MEY A;  2L5N A;  3GTQ C;  5HL7 S;  3RZD C;  3S1M C;  2NVX C;  2PMZ D;  3HKZ D;  2ZJR S;  3GTL C;  4XLN A;  2L3U A;  5D4D A;  4A3B C;  4A3C C;  3S2H C;  2E2H C;  4MEX A;  4KMU A;  3S17 C;  4Y52 C;  2R92 C;  2Y0S D;  4WFA S;  3HOY C;  1YNN A;  1I3Q C;  2ZJP S;  3H0G C;  2BE5 A;  2R7Z C;  3M3Y C;  3CQZ C;  3GTJ C;  1I6V A;  2ZJQ S;  2A6H A;  2KPU A;  4C3I C;  4WFB S;  3PIP S;  4OIQ A;  4YFK A;  1SFO C;  2NVQ C;  3S16 C;  1Y1V C;  4LK0 A;  4G7Z A;  4YG2 A;  4A3M C;  4Y7N C;  3HOV C;  3LYW A;  3I4N C;  1BDF A;  4C2M C;  3DXJ A;  5IP7 C;  3HOU C;  4NOI A;  3HOX C;  1IW7 A;  1K83 C;  2E2J C;  3S1N C;  3PO2 C;  1TWC C;  4BBS C;  4OIR A;  1TWH C;  2KQ1 A;  5TMF A;  4A3K C;  4OIN A;  4QJV A;  1I6H C;  4X6A C;  2JA6 C;  4A3D C;  2O5J A;  3GTP C;  3GTG C;  1WCM C;  4JK1 A; 
#chains in the Genus database with same CATH homology
 2KXY A;  2L3U A;  2KQ1 A;  5HQH A;  2L5N A;  2KPU A;  3LYW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...