5HQHA

1.32 angstrom crystal structure of ybbr like domain of lmo2119 protein from listeria monocytogenes.
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
96
structure length
96
Chain Sequence
b'SDSEVIENVPVKVYYDKTNLYISGIPETVTVTLSGPRSIVQSAKAQQDFTVYADLKNASIGTQEVKLQVKDVSDRLKVKVNPATVNVNVQEKVTKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lmo2119 protein
publication title 1.32 Angstrom Crystal Structure of Ybbr like Domain of lmo2119 Protein from Listeria monocytogenes.
rcsb
source organism Listeria monocytogenes serovar 1/2a
molecule tags Unknown function
total genus 18
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2016-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07949 YbbR YbbR-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.30 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 RNA Polymerase Alpha Subunit; Chain A, domain 2 5hqhA00
2L5NA 5HQHA 2KPUA 2KQ1A 3LYWA 2L3UA
chains in the Genus database with same CATH superfamily
4JK1A 2A6HA 4AYBD 4Q5SA 3GTGC 4XSXA 3DLLS 3WODA 1I50C 3M4OC 2JA5C 1YNNA 2JA7C 3M3YC 2ZJQS 4C2MC 3CF5S 4KN4A 3S1MC 2E2JC 4BY7C 4IOAS 5DM6S 4MEYA 2NVXC 4A3DC 3H3VD 4G7HA 3HOUC 4YFKA 3GTMC 2ZJPS 3S2HC 3S1QC 4BY1C 4A3CC 5JVGS 4MEXA 3PO2C 3S17C 4Q4ZA 4WFNS 4LJZA 5C4JC 3HOXC 2KXYA 2PA8D 2Y0SD 2E2IC 2B63C 5D4DA 3RZOC 2A68A 5HL7S 4KN7A 5C3EC 3PIOS 4IO9S 2YU9C 2JA6C 5C44C 2WAQD 4A3MC 3GTOC 3PO3C 4A3KC 4OIRA 4LLGA 1SFOC 4A3LC 2R93C 3S1NC 1I6VA 1WCMC 3CQZC 4A3GC 1TWHC 1BDFA 1TWFC 3K7AC 2WB1D 1SMYA 3HKZD 3S15C 2R92C 3HOVC 4WFBS 4A3FC 4X6AC 4A3IC 2O5JA 4YG2A 1Y1WC 4C3JC 5C4XC 4XLNA 1TWCC 4OIQA 2NVQC 3HOZC 4LK0A 3HOYC 3GTKC 2NVTC 2NVYC 5FLMC 4IOCS 4OINA 3GTPC 3RZDC 2A69A 4A3EC 3PIPS 5TMCA 4BXXC 1YNJA 5JVHS 3GTLC 4ZH4A 4OIPA 2ZJRS 3GTQC 3I4NC 4A3JC 1TWAC 3DXJA 2R7ZC 4A3BC 4WFAS 4WCES 4A93C 1FEUA 5IP7C 1R9TC 3H0GC 4Y52C 4YFNA 2E2HC 1I3QC 2L5NA 1I6HC 2JA8C 4C3IC 5TMFA 4OIOA 4GZYA 5IYCC 2PPBA 3I4MC 4XSZA 2VUMC 4QIWD 4U67S 1ZYRA 4Y7NC 3GTJC 5IP9C 4QJVA 5HQHA 3FKIC 2O5IA 5IYDC 1IW7A 3S14C 4G7ZA 2A6EA 1Y1VC 2KQ1A 4MQ9A 3S16C 2CW0A 4WF9S 2BE5A 4BBRC 3HOWC 5IYBC 4C3HC 2KPUA 1TWGC 4YFXA 4LK1A 2L3UA 5DM7S 3S1RC 4G7OA 1HQMA 4NOIA 2PMZD 4BBSC 3EQLA 3LYWA 3S2DC 1K83C 4XLPA 4KMUA
chains in the Genus database with same CATH topology
2L5NA 5HQHA 2KPUA 2KQ1A 3LYWA 2KXYA 2L3UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L5N A;  5HQH A;  2KPU A;  2KQ1 A;  3LYW A;  2L3U A; 
#chains in the Genus database with same CATH topology
 4JK1 A;  2A6H A;  4AYB D;  4Q5S A;  3GTG C;  4XSX A;  3DLL S;  3WOD A;  1I50 C;  3M4O C;  2JA5 C;  1YNN A;  2JA7 C;  3M3Y C;  2ZJQ S;  4C2M C;  3CF5 S;  4KN4 A;  3S1M C;  2E2J C;  4BY7 C;  4IOA S;  5DM6 S;  4MEY A;  2NVX C;  4A3D C;  3H3V D;  4G7H A;  3HOU C;  4YFK A;  3GTM C;  2ZJP S;  3S2H C;  3S1Q C;  4BY1 C;  4A3C C;  5JVG S;  4MEX A;  3PO2 C;  3S17 C;  4Q4Z A;  4WFN S;  4LJZ A;  5C4J C;  3HOX C;  2KXY A;  2PA8 D;  2Y0S D;  2E2I C;  2B63 C;  5D4D A;  3RZO C;  2A68 A;  5HL7 S;  4KN7 A;  5C3E C;  3PIO S;  4IO9 S;  2YU9 C;  2JA6 C;  5C44 C;  2WAQ D;  4A3M C;  3GTO C;  3PO3 C;  4A3K C;  4OIR A;  4LLG A;  1SFO C;  4A3L C;  2R93 C;  3S1N C;  1I6V A;  1WCM C;  3CQZ C;  4A3G C;  1TWH C;  1BDF A;  1TWF C;  3K7A C;  2WB1 D;  1SMY A;  3HKZ D;  3S15 C;  2R92 C;  3HOV C;  4WFB S;  4A3F C;  4X6A C;  4A3I C;  2O5J A;  4YG2 A;  1Y1W C;  4C3J C;  5C4X C;  4XLN A;  1TWC C;  4OIQ A;  2NVQ C;  3HOZ C;  4LK0 A;  3HOY C;  3GTK C;  2NVT C;  2NVY C;  5FLM C;  4IOC S;  4OIN A;  3GTP C;  3RZD C;  2A69 A;  4A3E C;  3PIP S;  5TMC A;  4BXX C;  1YNJ A;  5JVH S;  3GTL C;  4ZH4 A;  4OIP A;  2ZJR S;  3GTQ C;  3I4N C;  4A3J C;  1TWA C;  3DXJ A;  2R7Z C;  4A3B C;  4WFA S;  4WCE S;  4A93 C;  1FEU A;  5IP7 C;  1R9T C;  3H0G C;  4Y52 C;  4YFN A;  2E2H C;  1I3Q C;  2L5N A;  1I6H C;  2JA8 C;  4C3I C;  5TMF A;  4OIO A;  4GZY A;  5IYC C;  2PPB A;  3I4M C;  4XSZ A;  2VUM C;  4QIW D;  4U67 S;  1ZYR A;  4Y7N C;  3GTJ C;  5IP9 C;  4QJV A;  5HQH A;  3FKI C;  2O5I A;  5IYD C;  1IW7 A;  3S14 C;  4G7Z A;  2A6E A;  1Y1V C;  2KQ1 A;  4MQ9 A;  3S16 C;  2CW0 A;  4WF9 S;  2BE5 A;  4BBR C;  3HOW C;  5IYB C;  4C3H C;  2KPU A;  1TWG C;  4YFX A;  4LK1 A;  2L3U A;  5DM7 S;  3S1R C;  4G7O A;  1HQM A;  4NOI A;  2PMZ D;  4BBS C;  3EQL A;  3LYW A;  3S2D C;  1K83 C;  4XLP A;  4KMU A; 
#chains in the Genus database with same CATH homology
 2L5N A;  5HQH A;  2KPU A;  2KQ1 A;  3LYW A;  2KXY A;  2L3U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...