5HQHA

1.32 angstrom crystal structure of ybbr like domain of lmo2119 protein from listeria monocytogenes.
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
96
structure length
96
Chain Sequence
SDSEVIENVPVKVYYDKTNLYISGIPETVTVTLSGPRSIVQSAKAQQDFTVYADLKNASIGTQEVKLQVKDVSDRLKVKVNPATVNVNVQEKVTKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lmo2119 protein
publication title 1.32 Angstrom Crystal Structure of Ybbr like Domain of lmo2119 Protein from Listeria monocytogenes.
rcsb
source organism Listeria monocytogenes serovar 1/2a
molecule tags Unknown function
total genus 18
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2016-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07949 YbbR YbbR-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.30 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 RNA Polymerase Alpha Subunit; Chain A, domain 2 5hqhA00
2L3UA 2L5NA 2KQ1A 3LYWA 5HQHA 2KPUA
chains in the Genus database with same CATH superfamily
4A3CC 1ZYRA 1I6VA 4A3IC 4BXXC 4LLGA 4XLPA 3DXJA 3PIOS 4BY1C 3M3YC 5TMFA 4A3MC 2ZJRS 2L5NA 2PPBA 5C4XC 1TWGC 4OINA 2R92C 4AYBD 4QJVA 1K83C 2A68A 4OIPA 3S1MC 1HQMA 2WB1D 4XSZA 2A6HA 5DM6S 2R7ZC 3HOUC 3H3VD 4A3BC 3GTJC 3S16C 3FKIC 4YFNA 3PO3C 3HKZD 2PMZD 4GZYA 1Y1WC 4MEYA 4BBSC 5IYDC 2JA7C 3GTGC 1I3QC 5C3EC 2B63C 4Q5SA 5D4DA 5C44C 4A3DC 3M4OC 2BE5A 3RZDC 2JA8C 3GTLC 3HOZC 4WFAS 4ZH4A 4XSXA 3S1QC 4G7OA 3GTMC 4BBRC 5TMCA 2E2IC 4G7HA 2E2HC 4OIQA 3GTKC 2KXYA 5DM7S 5JVGS 3HOXC 2ZJPS 3CF5S 2YU9C 4A93C 2KPUA 3DLLS 4A3JC 4NOIA 4MEXA 1R9TC 2A6EA 2O5JA 4OIOA 5IP9C 4C3HC 5HL7S 4LK0A 4Y52C 4A3FC 4A3GC 1Y1VC 3HOVC 2NVTC 3GTQC 4IOAS 4G7ZA 4WFNS 4KMUA 3WODA 5JVHS 3S2HC 3S17C 2NVYC 2ZJQS 4A3KC 1YNNA 4IO9S 4KN7A 2Y0SD 2VUMC 4A3LC 1I6HC 5IYBC 2L3UA 2R93C 1SFOC 1FEUA 2WAQD 4LK1A 4KN4A 3GTOC 3HOWC 4XLNA 4LJZA 3S2DC 3S1RC 4U67S 1IW7A 4QIWD 1TWHC 4YG2A 5HQHA 4WFBS 5IYCC 3HOYC 3S15C 3I4NC 5IP7C 5C4JC 4Y7NC 4MQ9A 4WCES 4YFXA 4Q4ZA 3RZOC 3GTPC 2KQ1A 4C3JC 4C2MC 3PIPS 1TWCC 2E2JC 1WCMC 1SMYA 3EQLA 3S14C 3PO2C 4BY7C 2O5IA 3K7AC 2JA6C 3H0GC 1I50C 3S1NC 2A69A 2NVQC 5FLMC 4C3IC 3CQZC 4A3EC 3I4MC 4IOCS 4WF9S 1YNJA 2JA5C 3LYWA 1TWFC 4X6AC 2CW0A 4JK1A 4YFKA 1BDFA 1TWAC 2NVXC 4OIRA 2PA8D
chains in the Genus database with same CATH topology
2L3UA 2KXYA 2L5NA 2KQ1A 3LYWA 5HQHA 2KPUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L3U A;  2L5N A;  2KQ1 A;  3LYW A;  5HQH A;  2KPU A; 
#chains in the Genus database with same CATH topology
 4A3C C;  1ZYR A;  1I6V A;  4A3I C;  4BXX C;  4LLG A;  4XLP A;  3DXJ A;  3PIO S;  4BY1 C;  3M3Y C;  5TMF A;  4A3M C;  2ZJR S;  2L5N A;  2PPB A;  5C4X C;  1TWG C;  4OIN A;  2R92 C;  4AYB D;  4QJV A;  1K83 C;  2A68 A;  4OIP A;  3S1M C;  1HQM A;  2WB1 D;  4XSZ A;  2A6H A;  5DM6 S;  2R7Z C;  3HOU C;  3H3V D;  4A3B C;  3GTJ C;  3S16 C;  3FKI C;  4YFN A;  3PO3 C;  3HKZ D;  2PMZ D;  4GZY A;  1Y1W C;  4MEY A;  4BBS C;  5IYD C;  2JA7 C;  3GTG C;  1I3Q C;  5C3E C;  2B63 C;  4Q5S A;  5D4D A;  5C44 C;  4A3D C;  3M4O C;  2BE5 A;  3RZD C;  2JA8 C;  3GTL C;  3HOZ C;  4WFA S;  4ZH4 A;  4XSX A;  3S1Q C;  4G7O A;  3GTM C;  4BBR C;  5TMC A;  2E2I C;  4G7H A;  2E2H C;  4OIQ A;  3GTK C;  2KXY A;  5DM7 S;  5JVG S;  3HOX C;  2ZJP S;  3CF5 S;  2YU9 C;  4A93 C;  2KPU A;  3DLL S;  4A3J C;  4NOI A;  4MEX A;  1R9T C;  2A6E A;  2O5J A;  4OIO A;  5IP9 C;  4C3H C;  5HL7 S;  4LK0 A;  4Y52 C;  4A3F C;  4A3G C;  1Y1V C;  3HOV C;  2NVT C;  3GTQ C;  4IOA S;  4G7Z A;  4WFN S;  4KMU A;  3WOD A;  5JVH S;  3S2H C;  3S17 C;  2NVY C;  2ZJQ S;  4A3K C;  1YNN A;  4IO9 S;  4KN7 A;  2Y0S D;  2VUM C;  4A3L C;  1I6H C;  5IYB C;  2L3U A;  2R93 C;  1SFO C;  1FEU A;  2WAQ D;  4LK1 A;  4KN4 A;  3GTO C;  3HOW C;  4XLN A;  4LJZ A;  3S2D C;  3S1R C;  4U67 S;  1IW7 A;  4QIW D;  1TWH C;  4YG2 A;  5HQH A;  4WFB S;  5IYC C;  3HOY C;  3S15 C;  3I4N C;  5IP7 C;  5C4J C;  4Y7N C;  4MQ9 A;  4WCE S;  4YFX A;  4Q4Z A;  3RZO C;  3GTP C;  2KQ1 A;  4C3J C;  4C2M C;  3PIP S;  1TWC C;  2E2J C;  1WCM C;  1SMY A;  3EQL A;  3S14 C;  3PO2 C;  4BY7 C;  2O5I A;  3K7A C;  2JA6 C;  3H0G C;  1I50 C;  3S1N C;  2A69 A;  2NVQ C;  5FLM C;  4C3I C;  3CQZ C;  4A3E C;  3I4M C;  4IOC S;  4WF9 S;  1YNJ A;  2JA5 C;  3LYW A;  1TWF C;  4X6A C;  2CW0 A;  4JK1 A;  4YFK A;  1BDF A;  1TWA C;  2NVX C;  4OIR A;  2PA8 D; 
#chains in the Genus database with same CATH homology
 2L3U A;  2KXY A;  2L5N A;  2KQ1 A;  3LYW A;  5HQH A;  2KPU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...