4OIQA

Crystal structure of thermus thermophilus transcription initiation complex soaked with ge23077 and rifampicin
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
231
structure length
231
Chain Sequence
SKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQAAAVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription, transferase/antibiotic
molecule keywords DNA-directed RNA polymerase subunit alpha
publication title GE23077 binds to the RNA polymerase 'i' and 'i+1' sites and prevents the binding of initiating nucleotides.
pubmed rcsb
source organism Thermus thermophilus
total genus 55
structure length 231
sequence length 231
chains with identical sequence B
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2014-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01000 RNA_pol_A_bac RNA polymerase Rpb3/RpoA insert domain
A PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain
A PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.12 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 DNA-directed RNA polymerase, insert domain 4oiqA02
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 4oiqA01
3S17K 1Y1WC 3GTJC 4C3IK 3M4OK 1TWHK 4YFXA 4Y7NK 1TWFK 1Y1WK 2E2HC 2NVYK 4BY1K 4A3KC 4YFNA 3FKIC 2JA8C 5C44C 4A3JC 2B63C 2JA7C 3S15C 1R9TK 2E2HK 4G7OA 3GTPK 2Y0SD 4A3KK 3S15K 4A3FC 2PPBA 3M3YC 5C44K 5M5XK 4A3IK 4A93C 4OIQA 4Q5SA 4A3JK 4A3MC 2B63K 1I3QC 4Y7NC 3S1QC 5IYBK 4A3FK 3M3YK 2VUMC 3S14C 4C2MK 4C3HC 3RZOK 1I3QK 3S16C 3S1QK 1IW7A 2VUMK 2JA6C 3GTQC 4QIWL 3PO2C 4BBSC 1K83K 2A68A 2WB1D 2JA5C 2E2IC 4Y52C 2NVQK 4AYBD 3PO2K 4BBSK 4JK1A 2JA5K 2E2IK 3HKZL 3M4OC 2PA8D 3S1NC 3GTGK 2NVYC 2WAQL 4BY1C 3S1NK 4AYBL 1Y1VK 2A6EA 1R9TC 3GTPC 5IP9K 2O5IA 2A6HA 2JA7K 5C4JC 3RZDC 4A3IC 4C3JK 4OIPA 4A3BC 5C4JK 5IYBC 1XPPA 3RZDK 3HOUK 4G7HA 4C2MC 3H0GK 2R93K 3HOWC 3EQLA 3WODA 3RZOC 3DXJA 4LLGA 4LK1A 4KN4A 3HOWK 1TWGK 4OIOA 1K83C 2NVQC 3GTKC 2Y0SL 2PMZD 2YU9K 4KMUA 2A69A 3GTKK 4XLNA 4QJVB 3GTMK 3H3VD 2R92C 4A3GK 4MEXA 2NVXK 5M5YK 4YG2A 3GTGC 2R92K 4BXXC 5IYDK 1Y1VC 5IP9C 1YNJA 3HOZC 2O5JA 2WB1L 5C3EK 5M5WK 4BXXK 5D4DA 3GTLC 4C3JC 3S2DK 4OIRA 3HOZK 4KN7A 3HOUC 1SMYA 5FLMK 3GTLK 3H0GC 2R93C 5C4XK 3S2HK 3K7AC 4Q4ZA 5TMFA 2E2JC 3PO3C 2PA8L 3I4NK 1WCMC 4A3CC 5FJ8K 3S1RK 3K7AK 3PO3K 1TWGC 2E2JK 3S1MC 4X6AC 5IP7K 4A3BK 1WCMK 4BBRC 4XSZA 4A3CK 4A3EK 3HOVK 3S1MK 2YU9C 4X6AK 1TWCC 4BBRK 4OINA 3HOYK 3CQZC 4XLPA 3GTMC 1I50K 1TWCK 4A3GC 5IYCK 4A3DK 4BY7C 2NVXC 3GTOK 3CQZK 1YNNA 4ZH4A 1I6HC 2R7ZK 4BY7K 5M3MK 5IYDC 2NVTC 3GTJK 1I6HK 1HQMA 5C3EC 2PMZL 2NVTK 4G7ZA 4MEYA 3I4MC 4QIWD 3S2DC 5FLMC 2JA8K 1SFOC 4GZYA 5C4XC 3S2HC 4A3LC 3FKIK 2CW0A 1I6VA 4LJZA 5M3FK 3H3VL 3I4MK 3I4NC 4LK0A 1SFOK 4MQ9A 2BE5A 4NOIA 3S1RC 4A3LK 5TMCA 4A93K 4A3MK 3HKZD 4YFKA 3S14K 4A3EC 3HOXC 4C3HK 3HOVC 3S16K 1BDFA 2JA6K 3GTQK 4QJVA 3HOXK 2WAQD 1TWAC 3HOYC 5IYCC 1I50C 1ZYRA 4A3DC 5IP7C 4XSXA 1TWAK 3GTOC 4Y52K 3S17C 4C3IC 1TWHC 2R7ZC 1TWFC
chains in the Genus database with same CATH superfamily
4YFXA 3LAPA 1Y1WK 4KAWX 3CF5S 4BY1K 2L3UA 1XXBA 4YFNA 3GSIA 3DLLS 1R9TK 1IQ0A 1J6XA 5JVOA 4A3KK 2PPBA 4A3JK 1WSRA 1I3QC 3S14C 1UV7A 1VH2A 4KMHA 4C3HC 3GTOA 2V6SA 2R7ZA 2XCOA 4BBSK 2JH3A 2E2IK 2RH6A 3T00A 2GSUA 4BY1C 3S1NK 1ZQ1C 2A6EA 1R9TC 2O5IA 2A6HA 5C4JC 1I3QA 3ADAC 4KC6A 1VLOA 4G0UA 3VA7A 4LLGA 4LK1A 1TWGK 1JVIA 4WFBS 3FOEA 2Y0SL 2PMZD 4KMUA 2A69A 1USOA 2GSNA 3A8IA 4LOWA 5M5YK 3G4AA 2R92K 1R9TA 1RU0A 2L5NA 1XZPA 2WB1L 4BXXK 2XCQA 4GTAA 3S2DK 3PIPS 1AB4A 4J3NA 5FLMK 4A3CC 5FJ8K 3N0BA 3S1RK 3PO3K 1TWGC 2E2JK 1WCMK 4BBRC 1O27A 3OREA 4G0WA 4KASA 4XLPA 1USMA 5HL8A 4GTLA 4BLBA 2GSOA 1YNNA 4ZH4A 4BY7K 1EH1A 3GTJK 1I6HK 4G7ZA 3S2DC 3I4MC 4QIWD 1HI9A 3A8JA 5FLMC 1V5VA 3FKIK 4GZYA 2JA7K 4A3LC 3H3VL 1TWGA 2BE5A 3S1RC 3HKZD 3S16K 3GTQK 3FHZA 1WSVA 3HOXK 2KQ1A 2FQOA 5IP7C 4Y52K 3S17C 3N3YA 3PIOS 5EGEA 4C3IK 3GTJC 4PABA 2E2HC 2EBBA 3FKIC 2JA7C 5C44C 3S15C 3TFHA 4G7OA 3M3YC 1INNA 4A3IK 3S1QC 5IYBK 2VUMC 4C2MK 3GIRA 1I3QK 3S16C 3BUEA 1IW7A 3GTQC 2ZUFA 3QX3A 1XXAA 3PO2C 2JA5C 4Y52C 4GTCA 3GTJA 1WQHA 5JVGS 2E2HA 2PA8D 3Q3QA 1J6VA 3FKIA 2JA7A 2WAQL 2CFAB 5IOQA 1L0WA 3RZDC 4A3IC 2VUMA 5C4JK 5IYBC 3HOUK 3GDZA 4C2MC 2R93K 3GTQA 3WODA 4KMAA 2JA5A 4OIOA 4GTDA 2YU9K 4C45A 3N0CA 4XLNA 4A3GK 1G51A 1B4BA 1PJ7A 2V6TA 3HOZC 3AD9C 4OIRA 1DCOA 3HOUC 1SMYA 2R93C 5C4XK 3T02A 5TMFA 3I4NK 3S1MC 4X6AC 4A3CK 5IORA 1J98A 4A3EK 2YU9C 4BBRK 2V6UA 3HOYK 3CQZC 1C0AA 4A3GC 2CFAA 5M3MK 2NVTC 1F9NA 1IBAA 4KMDA 2PMZL 3L4KA 1J6WA 4MEYA 2R93A 1XZQB 1SFOC 5C4XC 3I4MK 2CW0A 4GFQA 3I4NC 4A3LK 4NOIA 4A93K 5TMCA 1WOSA 2YU9A 4A3EC 4G0VA 1BDFA 3CQZA 3CAGA 3HOYC 1PJ5A 3HXAA 4Y7NC 1TWHC 1TWFC 5IP7K 1O24A 3OEPA 3S17K 3M4OK 5HL7S 4GTEA 1EI6A 1SFOA 2NVYK 4WILA 4WFAS 2JA8C 2B63C 2E2HK 4A3FC 5C44K 3S15K 4KB4A 4A93C 4OIQA 4A3BK 3M3YK 4KATA 1O2BA 3S1QK 2FQTA 2VUMK 4WF9S 4QIWL 1F93A 1TWHA 1TWFA 1O28A 2NVQK 4BKWA 4KM9A 3PO2K 2JA5K 3HKZL 1GE9A 3M4OC 5E68A 4IOCS 1VRQC 1XZQA 2B63A 2NVYC 1B4AA 4KDDA 5IP9K 1IS1A 4OIPA 3GEHA 4A3BC 3BP3A 3LYWA 3RZDK 3HOWC 3EQLA 4PAAA 2RGRA 4AH6A 4GTBA 1YCLA 2NVQC 3GTKC 2PHCB 2ZJQS 3GTMK 4MEXA 2NVYA 5DM7S 4YG2A 4WCES 5IP9C 3GEIA 5C3EK 5M5WK 5D4DA 3GTLC 2GAGC 2XCRB 2KPUA 3HOZK 3S2HK 3G4CA 3K7AC 4Q4ZA 1EQRA 2PA8L 3T01A 1VGXA 1JQWA 3GTKA 1X31C 3LPXA 3S1MK 1KQ4A 4X6AK 4WFNS 1TWCC 4BLAA 1ZVUA 3MMLB 3GTMC 1I50K 1EK8A 1VJEA 3TTGA 3CQZK 1BGWA 2W7VA 3SZYA 3GTLA 5C3EC 3BP8C 2NVTK 5EGHA 1WORA 1XZPB 2P8TA 3S2HC 4FZBA 4LJZA 1I6VA 1WOOA 1JOEA 4LK0A 1SFOK 4MQ9A 4A3MK 4WJ4A 3A8KA 1TWCA 4P5AA 2P5MA 3L4JA 3TFIA 2JA6K 3GTMA 1TWAC 1I50C 5DM6S 3GEEA 4FM9A 4XSXA 5CJ9A 1DCPA 1Y1WC 1TWHK 4Y7NK 2ZJPS 1TWFK 3IPJA 3ERED 4A3KC 2KWAA 4A3JC 3GTPK 2Y0SD 1ZXOA 3S0XA 5M5XK 2JA8K 2B63K 1DD5A 4Q5SA 4A3MC 4A3FK 4IO9S 3AQOA 3TFJA 3RZOK 1ZBSA 1TWAA 4KB2A 5HQHA 2JA6C 1I50A 1O2AA 2KXYA 2Y3PA 4BBSC 1K83K 2A68A 2WB1D 2E2IC 4AYBD 2GAHC 1Y1WA 4U67S 4JK1A 3LAJA 4ILDA 4XCHA 3S1NC 1O2FB 3GTGK 4M1XA 5CHPA 1DCHA 4AYBL 1Y1VK 3GTPC 4P9SA 4C3JK 4RMFA 1WQGA 1XPPA 3OPFA 4G7HA 3H0GK 3V4GA 3RZOC 2JA6A 3DXJA 4KN4A 1EFWA 3HOWK 4IOAS 2E2IA 1K83C 5IOSA 4LR2A 4LQYA 3GTKK 4QJVB 3H3VD 2R92C 3AD8C 2NVXK 5JVHS 5JFEA 2ZJRS 3GTGC 3AQPA 3JSTA 3GTPA 4BXXC 3SZZA 1Y1VC 5IYDK 1YNJA 1BS2A 1YX2A 4C3JC 5L46A 3AH5A 4KN7A 3GTLK 3H0GC 3PO3C 2E2JC 1WCMC 1O29A 1K83A 3K7AK 4XSZA 3HOVK 1WIHA 1ISEA 4OINA 2R92A 5IYCK 1TWCK 5IOTA 4A3DK 4WJ3M 4BY7C 2NVXC 3GTGA 4KARA 1PJ6A 3GTOK 1IE0A 1BJTA 1I6HC 1Y1VA 4DDQA 2R7ZK 2ZUEA 5IYDC 4KM8A 1XXCA 1HQMA 1FEUA 1F7UA 1WOPA 4P5BA 3AD7C 3H0GA 3NUHA 4GTFA 1O26A 1F7VA 1WCMA 5M3FK 1IL2A 4YFKA 3S14K 4C3HK 3HOXC 3HOVC 4GT9A 5TJ3A 4QJVA 4O2DA 3FOFA 2WAQD 1O25A 2NVXA 5IYCC 2ZFZA 1ZYRA 4A3DC 2D6FC 1TWAK 3GTOC 4C3IC 1WQFA 2O5JA 2R7ZC
chains in the Genus database with same CATH topology
3S17K 1Y1WC 3GTJC 4C3IK 3M4OK 1TWHK 4YFXA 4Y7NK 1TWFK 1Y1WK 2E2HC 2NVYK 4BY1K 4A3KC 4YFNA 3FKIC 2JA8C 5C44C 4A3JC 2B63C 2JA7C 3S15C 1R9TK 2E2HK 4G7OA 3GTPK 2Y0SD 4A3KK 3S15K 4A3FC 2PPBA 3M3YC 5C44K 5M5XK 4A3IK 4A93C 4OIQA 4Q5SA 4A3JK 4A3MC 2B63K 1I3QC 4Y7NC 3S1QC 5IYBK 4A3FK 3M3YK 2VUMC 3S14C 4C2MK 4C3HC 3RZOK 1I3QK 3S16C 3S1QK 1IW7A 2VUMK 2JA6C 3GTQC 4QIWL 3PO2C 4BBSC 1K83K 2A68A 2WB1D 2JA5C 2E2IC 4Y52C 2NVQK 4AYBD 3PO2K 4BBSK 4JK1A 2JA5K 2E2IK 3HKZL 3M4OC 2PA8D 3S1NC 3GTGK 2NVYC 2WAQL 4BY1C 3S1NK 4AYBL 1Y1VK 2A6EA 1R9TC 3GTPC 5IP9K 2O5IA 2A6HA 2JA7K 5C4JC 3RZDC 4A3IC 4C3JK 4OIPA 4A3BC 5C4JK 5IYBC 1XPPA 3RZDK 3HOUK 4G7HA 4C2MC 3H0GK 2R93K 3HOWC 3EQLA 3WODA 3RZOC 3DXJA 4LLGA 4LK1A 4KN4A 3HOWK 1TWGK 4OIOA 1K83C 2NVQC 3GTKC 2Y0SL 2PMZD 2YU9K 4KMUA 2A69A 3GTKK 4XLNA 4QJVB 3GTMK 3H3VD 2R92C 4A3GK 4MEXA 2NVXK 5M5YK 4YG2A 3GTGC 2R92K 4BXXC 5IYDK 1Y1VC 5IP9C 1YNJA 3HOZC 2O5JA 2WB1L 5C3EK 5M5WK 4BXXK 5D4DA 3GTLC 4C3JC 3S2DK 4OIRA 3HOZK 4KN7A 3HOUC 1SMYA 5FLMK 3GTLK 3H0GC 2R93C 5C4XK 3S2HK 3K7AC 4Q4ZA 5TMFA 2E2JC 3PO3C 2PA8L 3I4NK 1WCMC 4A3CC 5FJ8K 3S1RK 3K7AK 3PO3K 1TWGC 2E2JK 3S1MC 4X6AC 5IP7K 4A3BK 1WCMK 4BBRC 4XSZA 4A3CK 4A3EK 3HOVK 3S1MK 2YU9C 4X6AK 1TWCC 4BBRK 4OINA 3HOYK 3CQZC 4XLPA 3GTMC 1I50K 1TWCK 4A3GC 5IYCK 4A3DK 4BY7C 2NVXC 3GTOK 3CQZK 1YNNA 4ZH4A 1I6HC 2R7ZK 4BY7K 5M3MK 5IYDC 2NVTC 3GTJK 1I6HK 1HQMA 5C3EC 2PMZL 2NVTK 4G7ZA 4MEYA 3I4MC 4QIWD 3S2DC 5FLMC 2JA8K 1SFOC 4GZYA 5C4XC 3S2HC 4A3LC 3FKIK 2CW0A 1I6VA 4LJZA 5M3FK 3H3VL 3I4MK 3I4NC 4LK0A 1SFOK 4MQ9A 2BE5A 4NOIA 3S1RC 4A3LK 5TMCA 4A93K 4A3MK 3HKZD 4YFKA 3S14K 4A3EC 3HOXC 4C3HK 3HOVC 3S16K 1BDFA 2JA6K 3GTQK 4QJVA 3HOXK 2WAQD 1TWAC 3HOYC 5IYCC 1I50C 1ZYRA 4A3DC 5IP7C 4XSXA 1TWAK 3GTOC 4Y52K 3S17C 4C3IC 1TWHC 2R7ZC 1TWFC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S17 K;  1Y1W C;  3GTJ C;  4C3I K;  3M4O K;  1TWH K;  4YFX A;  4Y7N K;  1TWF K;  1Y1W K;  2E2H C;  2NVY K;  4BY1 K;  4A3K C;  4YFN A;  3FKI C;  2JA8 C;  5C44 C;  4A3J C;  2B63 C;  2JA7 C;  3S15 C;  1R9T K;  2E2H K;  4G7O A;  3GTP K;  2Y0S D;  4A3K K;  3S15 K;  4A3F C;  2PPB A;  3M3Y C;  5C44 K;  5M5X K;  4A3I K;  4A93 C;  4OIQ A;  4Q5S A;  4A3J K;  4A3M C;  2B63 K;  1I3Q C;  4Y7N C;  3S1Q C;  5IYB K;  4A3F K;  3M3Y K;  2VUM C;  3S14 C;  4C2M K;  4C3H C;  3RZO K;  1I3Q K;  3S16 C;  3S1Q K;  1IW7 A;  2VUM K;  2JA6 C;  3GTQ C;  4QIW L;  3PO2 C;  4BBS C;  1K83 K;  2A68 A;  2WB1 D;  2JA5 C;  2E2I C;  4Y52 C;  2NVQ K;  4AYB D;  3PO2 K;  4BBS K;  4JK1 A;  2JA5 K;  2E2I K;  3HKZ L;  3M4O C;  2PA8 D;  3S1N C;  3GTG K;  2NVY C;  2WAQ L;  4BY1 C;  3S1N K;  4AYB L;  1Y1V K;  2A6E A;  1R9T C;  3GTP C;  5IP9 K;  2O5I A;  2A6H A;  2JA7 K;  5C4J C;  3RZD C;  4A3I C;  4C3J K;  4OIP A;  4A3B C;  5C4J K;  5IYB C;  1XPP A;  3RZD K;  3HOU K;  4G7H A;  4C2M C;  3H0G K;  2R93 K;  3HOW C;  3EQL A;  3WOD A;  3RZO C;  3DXJ A;  4LLG A;  4LK1 A;  4KN4 A;  3HOW K;  1TWG K;  4OIO A;  1K83 C;  2NVQ C;  3GTK C;  2Y0S L;  2PMZ D;  2YU9 K;  4KMU A;  2A69 A;  3GTK K;  4XLN A;  4QJV B;  3GTM K;  3H3V D;  2R92 C;  4A3G K;  4MEX A;  2NVX K;  5M5Y K;  4YG2 A;  3GTG C;  2R92 K;  4BXX C;  5IYD K;  1Y1V C;  5IP9 C;  1YNJ A;  3HOZ C;  2O5J A;  2WB1 L;  5C3E K;  5M5W K;  4BXX K;  5D4D A;  3GTL C;  4C3J C;  3S2D K;  4OIR A;  3HOZ K;  4KN7 A;  3HOU C;  1SMY A;  5FLM K;  3GTL K;  3H0G C;  2R93 C;  5C4X K;  3S2H K;  3K7A C;  4Q4Z A;  5TMF A;  2E2J C;  3PO3 C;  2PA8 L;  3I4N K;  1WCM C;  4A3C C;  5FJ8 K;  3S1R K;  3K7A K;  3PO3 K;  1TWG C;  2E2J K;  3S1M C;  4X6A C;  5IP7 K;  4A3B K;  1WCM K;  4BBR C;  4XSZ A;  4A3C K;  4A3E K;  3HOV K;  3S1M K;  2YU9 C;  4X6A K;  1TWC C;  4BBR K;  4OIN A;  3HOY K;  3CQZ C;  4XLP A;  3GTM C;  1I50 K;  1TWC K;  4A3G C;  5IYC K;  4A3D K;  4BY7 C;  2NVX C;  3GTO K;  3CQZ K;  1YNN A;  4ZH4 A;  1I6H C;  2R7Z K;  4BY7 K;  5M3M K;  5IYD C;  2NVT C;  3GTJ K;  1I6H K;  1HQM A;  5C3E C;  2PMZ L;  2NVT K;  4G7Z A;  4MEY A;  3I4M C;  4QIW D;  3S2D C;  5FLM C;  2JA8 K;  1SFO C;  4GZY A;  5C4X C;  3S2H C;  4A3L C;  3FKI K;  2CW0 A;  1I6V A;  4LJZ A;  5M3F K;  3H3V L;  3I4M K;  3I4N C;  4LK0 A;  1SFO K;  4MQ9 A;  2BE5 A;  4NOI A;  3S1R C;  4A3L K;  5TMC A;  4A93 K;  4A3M K;  3HKZ D;  4YFK A;  3S14 K;  4A3E C;  3HOX C;  4C3H K;  3HOV C;  3S16 K;  1BDF A;  2JA6 K;  3GTQ K;  4QJV A;  3HOX K;  2WAQ D;  1TWA C;  3HOY C;  5IYC C;  1I50 C;  1ZYR A;  4A3D C;  5IP7 C;  4XSX A;  1TWA K;  3GTO C;  4Y52 K;  3S17 C;  4C3I C;  1TWH C;  2R7Z C;  1TWF C; 
#chains in the Genus database with same CATH topology
 4YFX A;  3LAP A;  1Y1W K;  4KAW X;  3CF5 S;  4BY1 K;  2L3U A;  1XXB A;  4YFN A;  3GSI A;  3DLL S;  1R9T K;  1IQ0 A;  1J6X A;  5JVO A;  4A3K K;  2PPB A;  4A3J K;  1WSR A;  1I3Q C;  3S14 C;  1UV7 A;  1VH2 A;  4KMH A;  4C3H C;  3GTO A;  2V6S A;  2R7Z A;  2XCO A;  4BBS K;  2JH3 A;  2E2I K;  2RH6 A;  3T00 A;  2GSU A;  4BY1 C;  3S1N K;  1ZQ1 C;  2A6E A;  1R9T C;  2O5I A;  2A6H A;  5C4J C;  1I3Q A;  3ADA C;  4KC6 A;  1VLO A;  4G0U A;  3VA7 A;  4LLG A;  4LK1 A;  1TWG K;  1JVI A;  4WFB S;  3FOE A;  2Y0S L;  2PMZ D;  4KMU A;  2A69 A;  1USO A;  2GSN A;  3A8I A;  4LOW A;  5M5Y K;  3G4A A;  2R92 K;  1R9T A;  1RU0 A;  2L5N A;  1XZP A;  2WB1 L;  4BXX K;  2XCQ A;  4GTA A;  3S2D K;  3PIP S;  1AB4 A;  4J3N A;  5FLM K;  4A3C C;  5FJ8 K;  3N0B A;  3S1R K;  3PO3 K;  1TWG C;  2E2J K;  1WCM K;  4BBR C;  1O27 A;  3ORE A;  4G0W A;  4KAS A;  4XLP A;  1USM A;  5HL8 A;  4GTL A;  4BLB A;  2GSO A;  1YNN A;  4ZH4 A;  4BY7 K;  1EH1 A;  3GTJ K;  1I6H K;  4G7Z A;  3S2D C;  3I4M C;  4QIW D;  1HI9 A;  3A8J A;  5FLM C;  1V5V A;  3FKI K;  4GZY A;  2JA7 K;  4A3L C;  3H3V L;  1TWG A;  2BE5 A;  3S1R C;  3HKZ D;  3S16 K;  3GTQ K;  3FHZ A;  1WSV A;  3HOX K;  2KQ1 A;  2FQO A;  5IP7 C;  4Y52 K;  3S17 C;  3N3Y A;  3PIO S;  5EGE A;  4C3I K;  3GTJ C;  4PAB A;  2E2H C;  2EBB A;  3FKI C;  2JA7 C;  5C44 C;  3S15 C;  3TFH A;  4G7O A;  3M3Y C;  1INN A;  4A3I K;  3S1Q C;  5IYB K;  2VUM C;  4C2M K;  3GIR A;  1I3Q K;  3S16 C;  3BUE A;  1IW7 A;  3GTQ C;  2ZUF A;  3QX3 A;  1XXA A;  3PO2 C;  2JA5 C;  4Y52 C;  4GTC A;  3GTJ A;  1WQH A;  5JVG S;  2E2H A;  2PA8 D;  3Q3Q A;  1J6V A;  3FKI A;  2JA7 A;  2WAQ L;  2CFA B;  5IOQ A;  1L0W A;  3RZD C;  4A3I C;  2VUM A;  5C4J K;  5IYB C;  3HOU K;  3GDZ A;  4C2M C;  2R93 K;  3GTQ A;  3WOD A;  4KMA A;  2JA5 A;  4OIO A;  4GTD A;  2YU9 K;  4C45 A;  3N0C A;  4XLN A;  4A3G K;  1G51 A;  1B4B A;  1PJ7 A;  2V6T A;  3HOZ C;  3AD9 C;  4OIR A;  1DCO A;  3HOU C;  1SMY A;  2R93 C;  5C4X K;  3T02 A;  5TMF A;  3I4N K;  3S1M C;  4X6A C;  4A3C K;  5IOR A;  1J98 A;  4A3E K;  2YU9 C;  4BBR K;  2V6U A;  3HOY K;  3CQZ C;  1C0A A;  4A3G C;  2CFA A;  5M3M K;  2NVT C;  1F9N A;  1IBA A;  4KMD A;  2PMZ L;  3L4K A;  1J6W A;  4MEY A;  2R93 A;  1XZQ B;  1SFO C;  5C4X C;  3I4M K;  2CW0 A;  4GFQ A;  3I4N C;  4A3L K;  4NOI A;  4A93 K;  5TMC A;  1WOS A;  2YU9 A;  4A3E C;  4G0V A;  1BDF A;  3CQZ A;  3CAG A;  3HOY C;  1PJ5 A;  3HXA A;  4Y7N C;  1TWH C;  1TWF C;  5IP7 K;  1O24 A;  3OEP A;  3S17 K;  3M4O K;  5HL7 S;  4GTE A;  1EI6 A;  1SFO A;  2NVY K;  4WIL A;  4WFA S;  2JA8 C;  2B63 C;  2E2H K;  4A3F C;  5C44 K;  3S15 K;  4KB4 A;  4A93 C;  4OIQ A;  4A3B K;  3M3Y K;  4KAT A;  1O2B A;  3S1Q K;  2FQT A;  2VUM K;  4WF9 S;  4QIW L;  1F93 A;  1TWH A;  1TWF A;  1O28 A;  2NVQ K;  4BKW A;  4KM9 A;  3PO2 K;  2JA5 K;  3HKZ L;  1GE9 A;  3M4O C;  5E68 A;  4IOC S;  1VRQ C;  1XZQ A;  2B63 A;  2NVY C;  1B4A A;  4KDD A;  5IP9 K;  1IS1 A;  4OIP A;  3GEH A;  4A3B C;  3BP3 A;  3LYW A;  3RZD K;  3HOW C;  3EQL A;  4PAA A;  2RGR A;  4AH6 A;  4GTB A;  1YCL A;  2NVQ C;  3GTK C;  2PHC B;  2ZJQ S;  3GTM K;  4MEX A;  2NVY A;  5DM7 S;  4YG2 A;  4WCE S;  5IP9 C;  3GEI A;  5C3E K;  5M5W K;  5D4D A;  3GTL C;  2GAG C;  2XCR B;  2KPU A;  3HOZ K;  3S2H K;  3G4C A;  3K7A C;  4Q4Z A;  1EQR A;  2PA8 L;  3T01 A;  1VGX A;  1JQW A;  3GTK A;  1X31 C;  3LPX A;  3S1M K;  1KQ4 A;  4X6A K;  4WFN S;  1TWC C;  4BLA A;  1ZVU A;  3MML B;  3GTM C;  1I50 K;  1EK8 A;  1VJE A;  3TTG A;  3CQZ K;  1BGW A;  2W7V A;  3SZY A;  3GTL A;  5C3E C;  3BP8 C;  2NVT K;  5EGH A;  1WOR A;  1XZP B;  2P8T A;  3S2H C;  4FZB A;  4LJZ A;  1I6V A;  1WOO A;  1JOE A;  4LK0 A;  1SFO K;  4MQ9 A;  4A3M K;  4WJ4 A;  3A8K A;  1TWC A;  4P5A A;  2P5M A;  3L4J A;  3TFI A;  2JA6 K;  3GTM A;  1TWA C;  1I50 C;  5DM6 S;  3GEE A;  4FM9 A;  4XSX A;  5CJ9 A;  1DCP A;  1Y1W C;  1TWH K;  4Y7N K;  2ZJP S;  1TWF K;  3IPJ A;  3ERE D;  4A3K C;  2KWA A;  4A3J C;  3GTP K;  2Y0S D;  1ZXO A;  3S0X A;  5M5X K;  2JA8 K;  2B63 K;  1DD5 A;  4Q5S A;  4A3M C;  4A3F K;  4IO9 S;  3AQO A;  3TFJ A;  3RZO K;  1ZBS A;  1TWA A;  4KB2 A;  5HQH A;  2JA6 C;  1I50 A;  1O2A A;  2KXY A;  2Y3P A;  4BBS C;  1K83 K;  2A68 A;  2WB1 D;  2E2I C;  4AYB D;  2GAH C;  1Y1W A;  4U67 S;  4JK1 A;  3LAJ A;  4ILD A;  4XCH A;  3S1N C;  1O2F B;  3GTG K;  4M1X A;  5CHP A;  1DCH A;  4AYB L;  1Y1V K;  3GTP C;  4P9S A;  4C3J K;  4RMF A;  1WQG A;  1XPP A;  3OPF A;  4G7H A;  3H0G K;  3V4G A;  3RZO C;  2JA6 A;  3DXJ A;  4KN4 A;  1EFW A;  3HOW K;  4IOA S;  2E2I A;  1K83 C;  5IOS A;  4LR2 A;  4LQY A;  3GTK K;  4QJV B;  3H3V D;  2R92 C;  3AD8 C;  2NVX K;  5JVH S;  5JFE A;  2ZJR S;  3GTG C;  3AQP A;  3JST A;  3GTP A;  4BXX C;  3SZZ A;  1Y1V C;  5IYD K;  1YNJ A;  1BS2 A;  1YX2 A;  4C3J C;  5L46 A;  3AH5 A;  4KN7 A;  3GTL K;  3H0G C;  3PO3 C;  2E2J C;  1WCM C;  1O29 A;  1K83 A;  3K7A K;  4XSZ A;  3HOV K;  1WIH A;  1ISE A;  4OIN A;  2R92 A;  5IYC K;  1TWC K;  5IOT A;  4A3D K;  4WJ3 M;  4BY7 C;  2NVX C;  3GTG A;  4KAR A;  1PJ6 A;  3GTO K;  1IE0 A;  1BJT A;  1I6H C;  1Y1V A;  4DDQ A;  2R7Z K;  2ZUE A;  5IYD C;  4KM8 A;  1XXC A;  1HQM A;  1FEU A;  1F7U A;  1WOP A;  4P5B A;  3AD7 C;  3H0G A;  3NUH A;  4GTF A;  1O26 A;  1F7V A;  1WCM A;  5M3F K;  1IL2 A;  4YFK A;  3S14 K;  4C3H K;  3HOX C;  3HOV C;  4GT9 A;  5TJ3 A;  4QJV A;  4O2D A;  3FOF A;  2WAQ D;  1O25 A;  2NVX A;  5IYC C;  2ZFZ A;  1ZYR A;  4A3D C;  2D6F C;  1TWA K;  3GTO C;  4C3I C;  1WQF A;  2O5J A;  2R7Z C; 
#chains in the Genus database with same CATH homology
 3S17 K;  1Y1W C;  3GTJ C;  4C3I K;  3M4O K;  1TWH K;  4YFX A;  4Y7N K;  1TWF K;  1Y1W K;  2E2H C;  2NVY K;  4BY1 K;  4A3K C;  4YFN A;  3FKI C;  2JA8 C;  5C44 C;  4A3J C;  2B63 C;  2JA7 C;  3S15 C;  1R9T K;  2E2H K;  4G7O A;  3GTP K;  2Y0S D;  4A3K K;  3S15 K;  4A3F C;  2PPB A;  3M3Y C;  5C44 K;  5M5X K;  4A3I K;  4A93 C;  4OIQ A;  4Q5S A;  4A3J K;  4A3M C;  2B63 K;  1I3Q C;  4Y7N C;  3S1Q C;  5IYB K;  4A3F K;  3M3Y K;  2VUM C;  3S14 C;  4C2M K;  4C3H C;  3RZO K;  1I3Q K;  3S16 C;  3S1Q K;  1IW7 A;  2VUM K;  2JA6 C;  3GTQ C;  4QIW L;  3PO2 C;  4BBS C;  1K83 K;  2A68 A;  2WB1 D;  2JA5 C;  2E2I C;  4Y52 C;  2NVQ K;  4AYB D;  3PO2 K;  4BBS K;  4JK1 A;  2JA5 K;  2E2I K;  3HKZ L;  3M4O C;  2PA8 D;  3S1N C;  3GTG K;  2NVY C;  2WAQ L;  4BY1 C;  3S1N K;  4AYB L;  1Y1V K;  2A6E A;  1R9T C;  3GTP C;  5IP9 K;  2O5I A;  2A6H A;  2JA7 K;  5C4J C;  3RZD C;  4A3I C;  4C3J K;  4OIP A;  4A3B C;  5C4J K;  5IYB C;  1XPP A;  3RZD K;  3HOU K;  4G7H A;  4C2M C;  3H0G K;  2R93 K;  3HOW C;  3EQL A;  3WOD A;  3RZO C;  3DXJ A;  4LLG A;  4LK1 A;  4KN4 A;  3HOW K;  1TWG K;  4OIO A;  1K83 C;  2NVQ C;  3GTK C;  2Y0S L;  2PMZ D;  2YU9 K;  4KMU A;  2A69 A;  3GTK K;  4XLN A;  4QJV B;  3GTM K;  3H3V D;  2R92 C;  4A3G K;  4MEX A;  2NVX K;  5M5Y K;  4YG2 A;  3GTG C;  2R92 K;  4BXX C;  5IYD K;  1Y1V C;  5IP9 C;  1YNJ A;  3HOZ C;  2O5J A;  2WB1 L;  5C3E K;  5M5W K;  4BXX K;  5D4D A;  3GTL C;  4C3J C;  3S2D K;  4OIR A;  3HOZ K;  4KN7 A;  3HOU C;  1SMY A;  5FLM K;  3GTL K;  3H0G C;  2R93 C;  5C4X K;  3S2H K;  3K7A C;  4Q4Z A;  5TMF A;  2E2J C;  3PO3 C;  2PA8 L;  3I4N K;  1WCM C;  4A3C C;  5FJ8 K;  3S1R K;  3K7A K;  3PO3 K;  1TWG C;  2E2J K;  3S1M C;  4X6A C;  5IP7 K;  4A3B K;  1WCM K;  4BBR C;  4XSZ A;  4A3C K;  4A3E K;  3HOV K;  3S1M K;  2YU9 C;  4X6A K;  1TWC C;  4BBR K;  4OIN A;  3HOY K;  3CQZ C;  4XLP A;  3GTM C;  1I50 K;  1TWC K;  4A3G C;  5IYC K;  4A3D K;  4BY7 C;  2NVX C;  3GTO K;  3CQZ K;  1YNN A;  4ZH4 A;  1I6H C;  2R7Z K;  4BY7 K;  5M3M K;  5IYD C;  2NVT C;  3GTJ K;  1I6H K;  1HQM A;  5C3E C;  2PMZ L;  2NVT K;  4G7Z A;  4MEY A;  3I4M C;  4QIW D;  3S2D C;  5FLM C;  2JA8 K;  1SFO C;  4GZY A;  5C4X C;  3S2H C;  4A3L C;  3FKI K;  2CW0 A;  1I6V A;  4LJZ A;  5M3F K;  3H3V L;  3I4M K;  3I4N C;  4LK0 A;  1SFO K;  4MQ9 A;  2BE5 A;  4NOI A;  3S1R C;  4A3L K;  5TMC A;  4A93 K;  4A3M K;  3HKZ D;  4YFK A;  3S14 K;  4A3E C;  3HOX C;  4C3H K;  3HOV C;  3S16 K;  1BDF A;  2JA6 K;  3GTQ K;  4QJV A;  3HOX K;  2WAQ D;  1TWA C;  3HOY C;  5IYC C;  1I50 C;  1ZYR A;  4A3D C;  5IP7 C;  4XSX A;  1TWA K;  3GTO C;  4Y52 K;  3S17 C;  4C3I C;  1TWH C;  2R7Z C;  1TWF C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...