4OIQA

Crystal structure of thermus thermophilus transcription initiation complex soaked with ge23077 and rifampicin
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
231
structure length
231
Chain Sequence
SKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQAAAVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase subunit alpha
publication title GE23077 binds to the RNA polymerase 'i' and 'i+1' sites and prevents the binding of initiating nucleotides.
pubmed rcsb
source organism Thermus thermophilus
molecule tags Transcription, transferase/antibiotic
total genus 55
structure length 231
sequence length 231
chains with identical sequence B
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2014-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01000 RNA_pol_A_bac RNA polymerase Rpb3/RpoA insert domain
A PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain
A PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.12 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 DNA-directed RNA polymerase, insert domain 4oiqA02
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 4oiqA01
2R92C 4BXXK 2JA8K 3GTKK 3HOXK 2A6EA 3S15C 1R9TK 2NVYK 2NVTC 4BY1C 4QJVA 3S2DC 2WB1D 2PMZL 4A93C 2BE5A 3RZDC 1Y1WC 3GTJC 5D4DA 4A3FC 4Y52C 3GTLK 3H0GK 4C3JC 3S17K 3S1MK 2JA5K 3CQZK 1XPPA 4C2MK 3M4OK 3GTGK 4Y7NC 4C3HC 2NVQK 2R93C 3S1NC 3HOYK 3S1RK 1K83C 4MEXA 1ZYRA 4A3BC 4ZH4A 1TWAK 3GTOC 4YFKA 4A3LC 4JK1A 4A3GC 4A3JC 3H3VL 4YFNA 5IP7C 3I4MC 5IYDK 3WODA 1HQMA 1IW7A 2NVXC 2JA6K 1Y1VK 3GTQK 5TMFA 4XLNA 5FLMK 3S1QK 5C4XC 3GTPC 5M5YK 2R92K 4LJZA 2NVTK 4BY1K 3HKZL 3HOZC 3S2DK 3I4NC 1YNJA 4LK0A 3RZOC 3RZDK 5IP9C 4A93K 5IYBC 3GTJK 3HOUC 4A3FK 1Y1WK 4Y52K 4C3JK 4A3KC 4KN7A 4QIWD 2E2JC 3S2HC 5C4JC 4A3DC 4C3IC 1TWHC 3GTMK 2R7ZC 1TWGC 4Y7NK 4C3HK 2PA8D 2R93K 3S1NK 5IYCC 2CW0A 1K83K 5M5WK 2WB1L 2Y0SD 3PO3C 4XSZA 4YFXA 4AYBL 1TWFC 3DXJA 3GTOK 4A3MC 1SFOK 4A3LK 4OIOA 4A3GK 1I50C 3HOWC 4Q5SA 4OIRA 4A3JK 4BY7C 4BBSC 2E2HK 3K7AC 5IP7K 3HOXC 4A3EC 3I4MK 2YU9C 4BBRC 4XSXA 4A3CC 3FKIC 4X6AC 2O5JA 5C4XK 3GTPK 3M3YC 1I6HC 4Q4ZA 2VUMC 3S15K 3H0GC 5M3FK 3HOZK 4A3CK 3S17C 3S16C 3S1MC 3H3VD 3HOVC 5IP9K 3I4NK 5IYBK 3RZOK 3HOUK 2WAQL 1I6VA 4A3KK 2O5IA 2E2JK 4A3DK 3S2HK 5C4JK 4C3IK 2A69A 1TWHK 5C3EC 3HKZD 1TWGK 2R7ZK 2PMZD 4G7ZA 5FJ8K 1I3QC 2JA7C 4OIQA 4A3BK 4QJVB 4XLPA 5C44C 3PO2C 3PO3K 4LK1A 1TWFK 3S14C 4A3IC 1BDFA 4YG2A 1WCMC 1I50K 3HOWK 2E2IC 1TWCC 3EQLA 2B63C 3GTQC 4BY7K 4BBSK 4NOIA 4BXXC 3K7AK 2JA8C 2A6HA 3GTKC 1R9TC 4BBRK 4A3EK 2A68A 2NVYC 3FKIK 2NVXK 2YU9K 5M5XK 2PPBA 2PA8L 4X6AK 4KN4A 3M3YK 4AYBD 1I6HK 2VUMK 3GTLC 1YNNA 3S16K 2Y0SL 3HOVK 2JA5C 3CQZC 4C2MC 3GTMC 3GTGC 3M4OC 4G7HA 2NVQC 4KMUA 3HOYC 3S1RC 5C3EK 4QIWL 4LLGA 5M3MK 1SMYA 1TWAC 5IYCK 2WAQD 1I3QK 4MEYA 1SFOC 4MQ9A 2JA7K 4OIPA 5C44K 3PO2K 2E2HC 4GZYA 4G7OA 5TMCA 4A3IK 4OINA 1WCMK 5IYDC 4A3MK 3S14K 2E2IK 1TWCK 2B63K 3S1QC 2JA6C 1Y1VC 5FLMC
chains in the Genus database with same CATH superfamily
1KQ4A 2R92C 4BXXK 4BLAA 1F9NA 3TFIA 4QJVA 4DDQA 1EK8A 3GTLK 4BKWA 3H0GK 3S0XA 3AD9C 3CQZA 3A8IA 4C3HC 3GTGA 4A3BC 4KASA 4ZH4A 4A3GC 5IP7C 5IYDK 3GTQK 3AH5A 2NVTK 3HKZL 4A93K 3G4CA 1Y1WK 4A3FK 1J6WA 4WF9S 4KN7A 1ISEA 4WFNS 3N0CA 5C4JC 2V6TA 1TWGC 2GSUA 2ZUEA 3S1NK 2R93A 2Y3PA 4C45A 3PO3C 4KDDA 4LOWA 3DXJA 3DLLS 3QX3A 4A3LK 4OIOA 1I50C 3HOWC 4A3JK 5EGHA 3TTGA 5DM6S 2D6FC 3FKIC 4X6AC 4IO9S 3M3YC 1UV7A 3GTPA 1DCPA 3S15K 3H0GC 5M3FK 3HOZK 4LR2A 3OREA 5IYBK 3FOEA 2WAQL 1I6VA 4A3KK 2E2JK 3LPXA 3S2HK 3L4KA 4KMHA 3HKZD 2JA7C 1HI9A 4QJVB 4LK1A 3S14C 1TWCC 3GTQC 4BY7K 4NOIA 3K7AK 2JA8C 3GTKC 4A3EK 1B4BA 4BBRK 1F7VA 2YU9K 4A3CK 3GIRA 2NVYA 1JVIA 2PA8L 1I6HK 3NUHA 4GTCA 4GTAA 2Y0SL 4M1XA 4GFQA 1IL2A 5TJ3A 3CQZC 3FHZA 3M4OC 3GTGC 4KMDA 4G7HA 3ERED 4KMUA 1TWAC 5IYCK 5JVOA 2WAQD 4MEYA 4OIPA 1WORA 4GZYA 3A8KA 3LAPA 1WCMK 4J3NA 4PABA 3CF5S 4GTBA 4QIWL 4G0UA 2A6EA 3S15C 2NVYK 3S2DC 2XCRB 5EGEA 3GTJC 4Y52C 3GTLA 3S17K 2JA5K 4C2MK 4Y7NC 2R93C 4GTLA 3HOYK 3S1RK 4MEXA 3N3YA 4KB4A 2GAGC 1FEUA 3GTOA 4FZBA 3H3VL 4P5BA 3I4MC 1PJ6A 1HQMA 1IW7A 2JA6K 1Y1VK 1IBAA 4XLNA 3GTPC 2P8TA 5JFEA 4BY1K 1YNJA 4LK0A 3RZDK 5IP9C 1JQWA 3HOUC 1Y1WA 3T00A 4C3JK 2EBBA 4KC6A 1J6XA 1BJTA 4QIWD 1TWHA 2R7ZC 5IYCC 2CW0A 2V6SA 3L4JA 1K83K 2WB1L 4P5AA 4YFXA 3GTOK 3V4GA 1TWFA 3OPFA 1ZVUA 4OIRA 4IOCS 5IOQA 4KB2A 2GAHC 2O5JA 1WQHA 4ILDA 2NVXA 5C4XK 4KMAA 4Q4ZA 2KQ1A 1JOEA 3S17C 3S16C 3I4NK 3H3VD 5HL7S 3HOVC 3RZOK 1WIHA 4U67S 2O5IA 1C0AA 4A3DK 4C3IK 1TWHK 2KWAA 5L46A 1ZQ1C 4G7ZA 1I3QC 1VJEA 5C44C 1TWFK 4YG2A 3GEEA 2E2IC 3EQLA 4BBSK 4BXXC 3BP3A 1R9TA 2NVXK 2YU9A 2PPBA 4KN4A 1O29A 1O2BA 2VUMK 5JVGS 3GTLC 1YNNA 3AD7C 1EFWA 2PHCB 4RMFA 3A8JA 5CHPA 1WQFA 1G51A 5C3EK 2CFAB 5M3MK 3HXAA 5HL8A 2KXYA 2KPUA 3PO2K 2RH6A 4G7OA 4A3IK 4OINA 5IYDC 1WCMA 2B63K 1YCLA 3HOXK 1R9TK 2NVTC 5DM7S 2PMZL 4A93C 1Y1WC 4A3FC 5IOSA 3S1MK 3BP8C 2JA5A 1XPPA 4WJ4A 2RGRA 2L5NA 2NVQK 3S1NC 1O2AA 1ZYRA 1XXBA 4A3LC 4JK1A 4KATA 4A3JC 1O26A 1O28A 1EI6A 2E2HA 3GEHA 1IQ0A 3WODA 2NVXC 1O27A 4BLBA 3S1QK 5FLMK 2JA6A 1Y1VA 2R92K 5M5YK 3HOZC 3LAJA 2XCQA 5IYBC 4GTEA 5CJ9A 2JH3A 4A3KC 1PJ7A 2E2JC 3S2HC 1AB4A 4WILA 3IPJA 3JSTA 2PA8D 1TWGA 4C3HK 3SZZA 5M5WK 1K83A 1VGXA 2Y0SD 4XSZA 4WFAS 2V6UA 4A3GK 4XCHA 4BY7C 2E2HK 3K7AC 5IP7K 3HOXC 4A3EC 2YU9C 4BBRC 4XSXA 4A3CC 1USOA 1WOSA 2CFAA 3FKIA 2W7VA 4GTFA 1I6HC 2P5MA 3AD8C 3S1MC 4PAAA 1VRQC 2ZJQS 3MMLB 1VLOA 3BUEA 4WJ3M 4AH6A 5C4JK 2A69A 2ZFZA 1EQRA 1TWGK 3TFJA 1ZBSA 5FJ8K 2JA7A 2L3UA 3PO3K 1WCMC 1I50K 3HOWK 4IOAS 3GTKA 2A68A 2NVYC 3FKIK 4X6AK 3M3YK 2VUMA 1L0WA 5IORA 2JA5C 1F7UA 1GE9A 4C2MC 4WFBS 2GSOA 3HOYC 3S1RC 4LLGA 1TWAA 2JA7K 3LYWA 3AQOA 1XZPB 1BS2A 2E2HC 3S14K 5TMCA 3ADAC 4A3MK 1TWCK 4KM8A 1J6VA 2JA6C 1Y1VC 1DD5A 2B63A 2JA8K 1IE0A 3GTKK 4WCES 4BY1C 2WB1D 2BE5A 3RZDC 1XZQA 5D4DA 3GDZA 3GTJA 1YX2A 4C3JC 5IOTA 3CQZK 3M4OK 3GTGK 3GTMA 3T02A 3AQPA 4O2DA 1K83C 1WSVA 3FOFA 1WOOA 4G0VA 1TWAK 3GTOC 2ZJRS 1B4AA 4YFKA 3PIPS 1SFOA 3T01A 4YFNA 4KARA 5TMFA 1XXAA 2GSNA 4KAWX 5C4XC 2XCOA 4FM9A 5HQHA 2R92A 4LJZA 2FQTA 4KM9A 3S2DK 3I4NC 3RZOC 3GTJK 4Y52K 4P9SA 1O24A 1J98A 4A3DC 4C3IC 1TWHC 3GTMK 4Y7NK 2R7ZA 1WSRA 1V5VA 2R93K 5E68A 4AYBL 1TWFC 5JVHS 4A3MC 1SFOK 4Q5SA 4BBSC 3I4MK 1EH1A 1XXCA 3GTPK 2VUMC 3GEIA 2ZJPS 1XZPA 3VA7A 5IP9K 3GSIA 3HOUK 3Q3QA 3TFHA 1WQGA 3PIOS 1DCOA 1USMA 5C3EC 3SZYA 2ZUFA 2R7ZK 1BGWA 2PMZD 1INNA 1F93A 1I3QA 4OIQA 4A3BK 4XLPA 3PO2C 4A3IC 1BDFA 1XZQB 3N0BA 3CAGA 1DCHA 3G4AA 2B63C 1I50A 2E2IA 2A6HA 1R9TC 5M5XK 2FQOA 4GT9A 4AYBD 1WOPA 3H0GA 3S16K 1VH2A 3HOVK 4GTDA 4LQYA 1X31C 3GTMC 1PJ5A 3OEPA 2NVQC 1O2FB 1RU0A 1SMYA 1IS1A 1O25A 1I3QK 1SFOC 4MQ9A 5C44K 4G0WA 1ZXOA 2E2IK 3S1QC 1TWCA 3GTQA 5FLMC
chains in the Genus database with same CATH topology
2R92C 4BXXK 2JA8K 3GTKK 3HOXK 2A6EA 3S15C 1R9TK 2NVYK 2NVTC 4BY1C 4QJVA 3S2DC 2WB1D 2PMZL 4A93C 2BE5A 3RZDC 1Y1WC 3GTJC 5D4DA 4A3FC 4Y52C 3GTLK 3H0GK 4C3JC 3S17K 3S1MK 2JA5K 3CQZK 1XPPA 4C2MK 3M4OK 3GTGK 4Y7NC 4C3HC 2NVQK 2R93C 3S1NC 3HOYK 3S1RK 1K83C 4MEXA 1ZYRA 4A3BC 4ZH4A 1TWAK 3GTOC 4YFKA 4A3LC 4JK1A 4A3GC 4A3JC 3H3VL 4YFNA 5IP7C 3I4MC 5IYDK 3WODA 1HQMA 1IW7A 2NVXC 2JA6K 1Y1VK 3GTQK 5TMFA 4XLNA 5FLMK 3S1QK 5C4XC 3GTPC 5M5YK 2R92K 4LJZA 2NVTK 4BY1K 3HKZL 3HOZC 3S2DK 3I4NC 1YNJA 4LK0A 3RZOC 3RZDK 5IP9C 4A93K 5IYBC 3GTJK 3HOUC 4A3FK 1Y1WK 4Y52K 4C3JK 4A3KC 4KN7A 4QIWD 2E2JC 3S2HC 5C4JC 4A3DC 4C3IC 1TWHC 3GTMK 2R7ZC 1TWGC 4Y7NK 4C3HK 2PA8D 2R93K 3S1NK 5IYCC 2CW0A 1K83K 5M5WK 2WB1L 2Y0SD 3PO3C 4XSZA 4YFXA 4AYBL 1TWFC 3DXJA 3GTOK 4A3MC 1SFOK 4A3LK 4OIOA 4A3GK 1I50C 3HOWC 4Q5SA 4OIRA 4A3JK 4BY7C 4BBSC 2E2HK 3K7AC 5IP7K 3HOXC 4A3EC 3I4MK 2YU9C 4BBRC 4XSXA 4A3CC 3FKIC 4X6AC 2O5JA 5C4XK 3GTPK 3M3YC 1I6HC 4Q4ZA 2VUMC 3S15K 3H0GC 5M3FK 3HOZK 4A3CK 3S17C 3S16C 3S1MC 3H3VD 3HOVC 5IP9K 3I4NK 5IYBK 3RZOK 3HOUK 2WAQL 1I6VA 4A3KK 2O5IA 2E2JK 4A3DK 3S2HK 5C4JK 4C3IK 2A69A 1TWHK 5C3EC 3HKZD 1TWGK 2R7ZK 2PMZD 4G7ZA 5FJ8K 1I3QC 2JA7C 4OIQA 4A3BK 4QJVB 4XLPA 5C44C 3PO2C 3PO3K 4LK1A 1TWFK 3S14C 4A3IC 1BDFA 4YG2A 1WCMC 1I50K 3HOWK 2E2IC 1TWCC 3EQLA 2B63C 3GTQC 4BY7K 4BBSK 4NOIA 4BXXC 3K7AK 2JA8C 2A6HA 3GTKC 1R9TC 4BBRK 4A3EK 2A68A 2NVYC 3FKIK 2NVXK 2YU9K 5M5XK 2PPBA 2PA8L 4X6AK 4KN4A 3M3YK 4AYBD 1I6HK 2VUMK 3GTLC 1YNNA 3S16K 2Y0SL 3HOVK 2JA5C 3CQZC 4C2MC 3GTMC 3GTGC 3M4OC 4G7HA 2NVQC 4KMUA 3HOYC 3S1RC 5C3EK 4QIWL 4LLGA 5M3MK 1SMYA 1TWAC 5IYCK 2WAQD 1I3QK 4MEYA 1SFOC 4MQ9A 2JA7K 4OIPA 5C44K 3PO2K 2E2HC 4GZYA 4G7OA 5TMCA 4A3IK 4OINA 1WCMK 5IYDC 4A3MK 3S14K 2E2IK 1TWCK 2B63K 3S1QC 2JA6C 1Y1VC 5FLMC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R92 C;  4BXX K;  2JA8 K;  3GTK K;  3HOX K;  2A6E A;  3S15 C;  1R9T K;  2NVY K;  2NVT C;  4BY1 C;  4QJV A;  3S2D C;  2WB1 D;  2PMZ L;  4A93 C;  2BE5 A;  3RZD C;  1Y1W C;  3GTJ C;  5D4D A;  4A3F C;  4Y52 C;  3GTL K;  3H0G K;  4C3J C;  3S17 K;  3S1M K;  2JA5 K;  3CQZ K;  1XPP A;  4C2M K;  3M4O K;  3GTG K;  4Y7N C;  4C3H C;  2NVQ K;  2R93 C;  3S1N C;  3HOY K;  3S1R K;  1K83 C;  4MEX A;  1ZYR A;  4A3B C;  4ZH4 A;  1TWA K;  3GTO C;  4YFK A;  4A3L C;  4JK1 A;  4A3G C;  4A3J C;  3H3V L;  4YFN A;  5IP7 C;  3I4M C;  5IYD K;  3WOD A;  1HQM A;  1IW7 A;  2NVX C;  2JA6 K;  1Y1V K;  3GTQ K;  5TMF A;  4XLN A;  5FLM K;  3S1Q K;  5C4X C;  3GTP C;  5M5Y K;  2R92 K;  4LJZ A;  2NVT K;  4BY1 K;  3HKZ L;  3HOZ C;  3S2D K;  3I4N C;  1YNJ A;  4LK0 A;  3RZO C;  3RZD K;  5IP9 C;  4A93 K;  5IYB C;  3GTJ K;  3HOU C;  4A3F K;  1Y1W K;  4Y52 K;  4C3J K;  4A3K C;  4KN7 A;  4QIW D;  2E2J C;  3S2H C;  5C4J C;  4A3D C;  4C3I C;  1TWH C;  3GTM K;  2R7Z C;  1TWG C;  4Y7N K;  4C3H K;  2PA8 D;  2R93 K;  3S1N K;  5IYC C;  2CW0 A;  1K83 K;  5M5W K;  2WB1 L;  2Y0S D;  3PO3 C;  4XSZ A;  4YFX A;  4AYB L;  1TWF C;  3DXJ A;  3GTO K;  4A3M C;  1SFO K;  4A3L K;  4OIO A;  4A3G K;  1I50 C;  3HOW C;  4Q5S A;  4OIR A;  4A3J K;  4BY7 C;  4BBS C;  2E2H K;  3K7A C;  5IP7 K;  3HOX C;  4A3E C;  3I4M K;  2YU9 C;  4BBR C;  4XSX A;  4A3C C;  3FKI C;  4X6A C;  2O5J A;  5C4X K;  3GTP K;  3M3Y C;  1I6H C;  4Q4Z A;  2VUM C;  3S15 K;  3H0G C;  5M3F K;  3HOZ K;  4A3C K;  3S17 C;  3S16 C;  3S1M C;  3H3V D;  3HOV C;  5IP9 K;  3I4N K;  5IYB K;  3RZO K;  3HOU K;  2WAQ L;  1I6V A;  4A3K K;  2O5I A;  2E2J K;  4A3D K;  3S2H K;  5C4J K;  4C3I K;  2A69 A;  1TWH K;  5C3E C;  3HKZ D;  1TWG K;  2R7Z K;  2PMZ D;  4G7Z A;  5FJ8 K;  1I3Q C;  2JA7 C;  4OIQ A;  4A3B K;  4QJV B;  4XLP A;  5C44 C;  3PO2 C;  3PO3 K;  4LK1 A;  1TWF K;  3S14 C;  4A3I C;  1BDF A;  4YG2 A;  1WCM C;  1I50 K;  3HOW K;  2E2I C;  1TWC C;  3EQL A;  2B63 C;  3GTQ C;  4BY7 K;  4BBS K;  4NOI A;  4BXX C;  3K7A K;  2JA8 C;  2A6H A;  3GTK C;  1R9T C;  4BBR K;  4A3E K;  2A68 A;  2NVY C;  3FKI K;  2NVX K;  2YU9 K;  5M5X K;  2PPB A;  2PA8 L;  4X6A K;  4KN4 A;  3M3Y K;  4AYB D;  1I6H K;  2VUM K;  3GTL C;  1YNN A;  3S16 K;  2Y0S L;  3HOV K;  2JA5 C;  3CQZ C;  4C2M C;  3GTM C;  3GTG C;  3M4O C;  4G7H A;  2NVQ C;  4KMU A;  3HOY C;  3S1R C;  5C3E K;  4QIW L;  4LLG A;  5M3M K;  1SMY A;  1TWA C;  5IYC K;  2WAQ D;  1I3Q K;  4MEY A;  1SFO C;  4MQ9 A;  2JA7 K;  4OIP A;  5C44 K;  3PO2 K;  2E2H C;  4GZY A;  4G7O A;  5TMC A;  4A3I K;  4OIN A;  1WCM K;  5IYD C;  4A3M K;  3S14 K;  2E2I K;  1TWC K;  2B63 K;  3S1Q C;  2JA6 C;  1Y1V C;  5FLM C; 
#chains in the Genus database with same CATH topology
 1KQ4 A;  2R92 C;  4BXX K;  4BLA A;  1F9N A;  3TFI A;  4QJV A;  4DDQ A;  1EK8 A;  3GTL K;  4BKW A;  3H0G K;  3S0X A;  3AD9 C;  3CQZ A;  3A8I A;  4C3H C;  3GTG A;  4A3B C;  4KAS A;  4ZH4 A;  4A3G C;  5IP7 C;  5IYD K;  3GTQ K;  3AH5 A;  2NVT K;  3HKZ L;  4A93 K;  3G4C A;  1Y1W K;  4A3F K;  1J6W A;  4WF9 S;  4KN7 A;  1ISE A;  4WFN S;  3N0C A;  5C4J C;  2V6T A;  1TWG C;  2GSU A;  2ZUE A;  3S1N K;  2R93 A;  2Y3P A;  4C45 A;  3PO3 C;  4KDD A;  4LOW A;  3DXJ A;  3DLL S;  3QX3 A;  4A3L K;  4OIO A;  1I50 C;  3HOW C;  4A3J K;  5EGH A;  3TTG A;  5DM6 S;  2D6F C;  3FKI C;  4X6A C;  4IO9 S;  3M3Y C;  1UV7 A;  3GTP A;  1DCP A;  3S15 K;  3H0G C;  5M3F K;  3HOZ K;  4LR2 A;  3ORE A;  5IYB K;  3FOE A;  2WAQ L;  1I6V A;  4A3K K;  2E2J K;  3LPX A;  3S2H K;  3L4K A;  4KMH A;  3HKZ D;  2JA7 C;  1HI9 A;  4QJV B;  4LK1 A;  3S14 C;  1TWC C;  3GTQ C;  4BY7 K;  4NOI A;  3K7A K;  2JA8 C;  3GTK C;  4A3E K;  1B4B A;  4BBR K;  1F7V A;  2YU9 K;  4A3C K;  3GIR A;  2NVY A;  1JVI A;  2PA8 L;  1I6H K;  3NUH A;  4GTC A;  4GTA A;  2Y0S L;  4M1X A;  4GFQ A;  1IL2 A;  5TJ3 A;  3CQZ C;  3FHZ A;  3M4O C;  3GTG C;  4KMD A;  4G7H A;  3ERE D;  4KMU A;  1TWA C;  5IYC K;  5JVO A;  2WAQ D;  4MEY A;  4OIP A;  1WOR A;  4GZY A;  3A8K A;  3LAP A;  1WCM K;  4J3N A;  4PAB A;  3CF5 S;  4GTB A;  4QIW L;  4G0U A;  2A6E A;  3S15 C;  2NVY K;  3S2D C;  2XCR B;  5EGE A;  3GTJ C;  4Y52 C;  3GTL A;  3S17 K;  2JA5 K;  4C2M K;  4Y7N C;  2R93 C;  4GTL A;  3HOY K;  3S1R K;  4MEX A;  3N3Y A;  4KB4 A;  2GAG C;  1FEU A;  3GTO A;  4FZB A;  3H3V L;  4P5B A;  3I4M C;  1PJ6 A;  1HQM A;  1IW7 A;  2JA6 K;  1Y1V K;  1IBA A;  4XLN A;  3GTP C;  2P8T A;  5JFE A;  4BY1 K;  1YNJ A;  4LK0 A;  3RZD K;  5IP9 C;  1JQW A;  3HOU C;  1Y1W A;  3T00 A;  4C3J K;  2EBB A;  4KC6 A;  1J6X A;  1BJT A;  4QIW D;  1TWH A;  2R7Z C;  5IYC C;  2CW0 A;  2V6S A;  3L4J A;  1K83 K;  2WB1 L;  4P5A A;  4YFX A;  3GTO K;  3V4G A;  1TWF A;  3OPF A;  1ZVU A;  4OIR A;  4IOC S;  5IOQ A;  4KB2 A;  2GAH C;  2O5J A;  1WQH A;  4ILD A;  2NVX A;  5C4X K;  4KMA A;  4Q4Z A;  2KQ1 A;  1JOE A;  3S17 C;  3S16 C;  3I4N K;  3H3V D;  5HL7 S;  3HOV C;  3RZO K;  1WIH A;  4U67 S;  2O5I A;  1C0A A;  4A3D K;  4C3I K;  1TWH K;  2KWA A;  5L46 A;  1ZQ1 C;  4G7Z A;  1I3Q C;  1VJE A;  5C44 C;  1TWF K;  4YG2 A;  3GEE A;  2E2I C;  3EQL A;  4BBS K;  4BXX C;  3BP3 A;  1R9T A;  2NVX K;  2YU9 A;  2PPB A;  4KN4 A;  1O29 A;  1O2B A;  2VUM K;  5JVG S;  3GTL C;  1YNN A;  3AD7 C;  1EFW A;  2PHC B;  4RMF A;  3A8J A;  5CHP A;  1WQF A;  1G51 A;  5C3E K;  2CFA B;  5M3M K;  3HXA A;  5HL8 A;  2KXY A;  2KPU A;  3PO2 K;  2RH6 A;  4G7O A;  4A3I K;  4OIN A;  5IYD C;  1WCM A;  2B63 K;  1YCL A;  3HOX K;  1R9T K;  2NVT C;  5DM7 S;  2PMZ L;  4A93 C;  1Y1W C;  4A3F C;  5IOS A;  3S1M K;  3BP8 C;  2JA5 A;  1XPP A;  4WJ4 A;  2RGR A;  2L5N A;  2NVQ K;  3S1N C;  1O2A A;  1ZYR A;  1XXB A;  4A3L C;  4JK1 A;  4KAT A;  4A3J C;  1O26 A;  1O28 A;  1EI6 A;  2E2H A;  3GEH A;  1IQ0 A;  3WOD A;  2NVX C;  1O27 A;  4BLB A;  3S1Q K;  5FLM K;  2JA6 A;  1Y1V A;  2R92 K;  5M5Y K;  3HOZ C;  3LAJ A;  2XCQ A;  5IYB C;  4GTE A;  5CJ9 A;  2JH3 A;  4A3K C;  1PJ7 A;  2E2J C;  3S2H C;  1AB4 A;  4WIL A;  3IPJ A;  3JST A;  2PA8 D;  1TWG A;  4C3H K;  3SZZ A;  5M5W K;  1K83 A;  1VGX A;  2Y0S D;  4XSZ A;  4WFA S;  2V6U A;  4A3G K;  4XCH A;  4BY7 C;  2E2H K;  3K7A C;  5IP7 K;  3HOX C;  4A3E C;  2YU9 C;  4BBR C;  4XSX A;  4A3C C;  1USO A;  1WOS A;  2CFA A;  3FKI A;  2W7V A;  4GTF A;  1I6H C;  2P5M A;  3AD8 C;  3S1M C;  4PAA A;  1VRQ C;  2ZJQ S;  3MML B;  1VLO A;  3BUE A;  4WJ3 M;  4AH6 A;  5C4J K;  2A69 A;  2ZFZ A;  1EQR A;  1TWG K;  3TFJ A;  1ZBS A;  5FJ8 K;  2JA7 A;  2L3U A;  3PO3 K;  1WCM C;  1I50 K;  3HOW K;  4IOA S;  3GTK A;  2A68 A;  2NVY C;  3FKI K;  4X6A K;  3M3Y K;  2VUM A;  1L0W A;  5IOR A;  2JA5 C;  1F7U A;  1GE9 A;  4C2M C;  4WFB S;  2GSO A;  3HOY C;  3S1R C;  4LLG A;  1TWA A;  2JA7 K;  3LYW A;  3AQO A;  1XZP B;  1BS2 A;  2E2H C;  3S14 K;  5TMC A;  3ADA C;  4A3M K;  1TWC K;  4KM8 A;  1J6V A;  2JA6 C;  1Y1V C;  1DD5 A;  2B63 A;  2JA8 K;  1IE0 A;  3GTK K;  4WCE S;  4BY1 C;  2WB1 D;  2BE5 A;  3RZD C;  1XZQ A;  5D4D A;  3GDZ A;  3GTJ A;  1YX2 A;  4C3J C;  5IOT A;  3CQZ K;  3M4O K;  3GTG K;  3GTM A;  3T02 A;  3AQP A;  4O2D A;  1K83 C;  1WSV A;  3FOF A;  1WOO A;  4G0V A;  1TWA K;  3GTO C;  2ZJR S;  1B4A A;  4YFK A;  3PIP S;  1SFO A;  3T01 A;  4YFN A;  4KAR A;  5TMF A;  1XXA A;  2GSN A;  4KAW X;  5C4X C;  2XCO A;  4FM9 A;  5HQH A;  2R92 A;  4LJZ A;  2FQT A;  4KM9 A;  3S2D K;  3I4N C;  3RZO C;  3GTJ K;  4Y52 K;  4P9S A;  1O24 A;  1J98 A;  4A3D C;  4C3I C;  1TWH C;  3GTM K;  4Y7N K;  2R7Z A;  1WSR A;  1V5V A;  2R93 K;  5E68 A;  4AYB L;  1TWF C;  5JVH S;  4A3M C;  1SFO K;  4Q5S A;  4BBS C;  3I4M K;  1EH1 A;  1XXC A;  3GTP K;  2VUM C;  3GEI A;  2ZJP S;  1XZP A;  3VA7 A;  5IP9 K;  3GSI A;  3HOU K;  3Q3Q A;  3TFH A;  1WQG A;  3PIO S;  1DCO A;  1USM A;  5C3E C;  3SZY A;  2ZUF A;  2R7Z K;  1BGW A;  2PMZ D;  1INN A;  1F93 A;  1I3Q A;  4OIQ A;  4A3B K;  4XLP A;  3PO2 C;  4A3I C;  1BDF A;  1XZQ B;  3N0B A;  3CAG A;  1DCH A;  3G4A A;  2B63 C;  1I50 A;  2E2I A;  2A6H A;  1R9T C;  5M5X K;  2FQO A;  4GT9 A;  4AYB D;  1WOP A;  3H0G A;  3S16 K;  1VH2 A;  3HOV K;  4GTD A;  4LQY A;  1X31 C;  3GTM C;  1PJ5 A;  3OEP A;  2NVQ C;  1O2F B;  1RU0 A;  1SMY A;  1IS1 A;  1O25 A;  1I3Q K;  1SFO C;  4MQ9 A;  5C44 K;  4G0W A;  1ZXO A;  2E2I K;  3S1Q C;  1TWC A;  3GTQ A;  5FLM C; 
#chains in the Genus database with same CATH homology
 2R92 C;  4BXX K;  2JA8 K;  3GTK K;  3HOX K;  2A6E A;  3S15 C;  1R9T K;  2NVY K;  2NVT C;  4BY1 C;  4QJV A;  3S2D C;  2WB1 D;  2PMZ L;  4A93 C;  2BE5 A;  3RZD C;  1Y1W C;  3GTJ C;  5D4D A;  4A3F C;  4Y52 C;  3GTL K;  3H0G K;  4C3J C;  3S17 K;  3S1M K;  2JA5 K;  3CQZ K;  1XPP A;  4C2M K;  3M4O K;  3GTG K;  4Y7N C;  4C3H C;  2NVQ K;  2R93 C;  3S1N C;  3HOY K;  3S1R K;  1K83 C;  4MEX A;  1ZYR A;  4A3B C;  4ZH4 A;  1TWA K;  3GTO C;  4YFK A;  4A3L C;  4JK1 A;  4A3G C;  4A3J C;  3H3V L;  4YFN A;  5IP7 C;  3I4M C;  5IYD K;  3WOD A;  1HQM A;  1IW7 A;  2NVX C;  2JA6 K;  1Y1V K;  3GTQ K;  5TMF A;  4XLN A;  5FLM K;  3S1Q K;  5C4X C;  3GTP C;  5M5Y K;  2R92 K;  4LJZ A;  2NVT K;  4BY1 K;  3HKZ L;  3HOZ C;  3S2D K;  3I4N C;  1YNJ A;  4LK0 A;  3RZO C;  3RZD K;  5IP9 C;  4A93 K;  5IYB C;  3GTJ K;  3HOU C;  4A3F K;  1Y1W K;  4Y52 K;  4C3J K;  4A3K C;  4KN7 A;  4QIW D;  2E2J C;  3S2H C;  5C4J C;  4A3D C;  4C3I C;  1TWH C;  3GTM K;  2R7Z C;  1TWG C;  4Y7N K;  4C3H K;  2PA8 D;  2R93 K;  3S1N K;  5IYC C;  2CW0 A;  1K83 K;  5M5W K;  2WB1 L;  2Y0S D;  3PO3 C;  4XSZ A;  4YFX A;  4AYB L;  1TWF C;  3DXJ A;  3GTO K;  4A3M C;  1SFO K;  4A3L K;  4OIO A;  4A3G K;  1I50 C;  3HOW C;  4Q5S A;  4OIR A;  4A3J K;  4BY7 C;  4BBS C;  2E2H K;  3K7A C;  5IP7 K;  3HOX C;  4A3E C;  3I4M K;  2YU9 C;  4BBR C;  4XSX A;  4A3C C;  3FKI C;  4X6A C;  2O5J A;  5C4X K;  3GTP K;  3M3Y C;  1I6H C;  4Q4Z A;  2VUM C;  3S15 K;  3H0G C;  5M3F K;  3HOZ K;  4A3C K;  3S17 C;  3S16 C;  3S1M C;  3H3V D;  3HOV C;  5IP9 K;  3I4N K;  5IYB K;  3RZO K;  3HOU K;  2WAQ L;  1I6V A;  4A3K K;  2O5I A;  2E2J K;  4A3D K;  3S2H K;  5C4J K;  4C3I K;  2A69 A;  1TWH K;  5C3E C;  3HKZ D;  1TWG K;  2R7Z K;  2PMZ D;  4G7Z A;  5FJ8 K;  1I3Q C;  2JA7 C;  4OIQ A;  4A3B K;  4QJV B;  4XLP A;  5C44 C;  3PO2 C;  3PO3 K;  4LK1 A;  1TWF K;  3S14 C;  4A3I C;  1BDF A;  4YG2 A;  1WCM C;  1I50 K;  3HOW K;  2E2I C;  1TWC C;  3EQL A;  2B63 C;  3GTQ C;  4BY7 K;  4BBS K;  4NOI A;  4BXX C;  3K7A K;  2JA8 C;  2A6H A;  3GTK C;  1R9T C;  4BBR K;  4A3E K;  2A68 A;  2NVY C;  3FKI K;  2NVX K;  2YU9 K;  5M5X K;  2PPB A;  2PA8 L;  4X6A K;  4KN4 A;  3M3Y K;  4AYB D;  1I6H K;  2VUM K;  3GTL C;  1YNN A;  3S16 K;  2Y0S L;  3HOV K;  2JA5 C;  3CQZ C;  4C2M C;  3GTM C;  3GTG C;  3M4O C;  4G7H A;  2NVQ C;  4KMU A;  3HOY C;  3S1R C;  5C3E K;  4QIW L;  4LLG A;  5M3M K;  1SMY A;  1TWA C;  5IYC K;  2WAQ D;  1I3Q K;  4MEY A;  1SFO C;  4MQ9 A;  2JA7 K;  4OIP A;  5C44 K;  3PO2 K;  2E2H C;  4GZY A;  4G7O A;  5TMC A;  4A3I K;  4OIN A;  1WCM K;  5IYD C;  4A3M K;  3S14 K;  2E2I K;  1TWC K;  2B63 K;  3S1Q C;  2JA6 C;  1Y1V C;  5FLM C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...