4OIQA

Crystal structure of thermus thermophilus transcription initiation complex soaked with ge23077 and rifampicin
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
231
structure length
231
Chain Sequence
SKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQAAAVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title GE23077 binds to the RNA polymerase 'i' and 'i+1' sites and prevents the binding of initiating nucleotides.
pubmed rcsb
source organism Thermus thermophilus
molecule tags Transcription, transferase/antibiotic
molecule keywords DNA-directed RNA polymerase subunit alpha
total genus 55
structure length 231
sequence length 231
chains with identical sequence B
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2014-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01000 RNA_pol_A_bac RNA polymerase Rpb3/RpoA insert domain
A PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain
A PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.12 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 DNA-directed RNA polymerase, insert domain 4oiqA02
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 4oiqA01
3RZDC 3M4OC 4C3IC 1TWAK 3S2HC 1WCMK 2Y0SL 3HOUK 4A3FK 2A6HA 5FLMC 1TWCC 4A3JC 4A3EK 4A3KC 3S17K 4QJVA 3H0GC 3GTQC 5IP9C 4OIPA 1TWHC 3HKZD 2JA6C 5D4DA 1HQMA 1R9TC 3S16C 3EQLA 3PO3K 5C4JK 1Y1VK 4BBRK 4Y7NK 2E2HK 2YU9K 1I50C 1YNJA 2R92C 5IYDC 4QJVB 3S2DK 3DXJA 4QIWD 3M3YC 3S1QK 1SFOC 3HOWK 2NVYC 5C3EC 1TWFK 4A3MK 3M3YK 2A68A 4A3CK 1TWGK 4GZYA 3CQZK 3GTMK 2R93K 2B63K 4QIWL 2VUMC 3HOVC 4A3IK 3HOYC 2NVQK 3GTMC 4OIOA 3S17C 4A3JK 5M3MK 3H3VD 2A69A 4A3FC 1YNNA 5IP9K 4AYBL 3S1RK 2JA5K 4BY7K 4A3KK 2E2JK 3S1MC 3GTLK 1Y1VC 1TWHK 3H3VL 2PMZL 1R9TK 4X6AK 4Y52K 3PO3C 3HOXK 2PA8L 4Y7NC 1TWFC 3S14C 1BDFA 3I4MC 5IYDK 3M4OK 3RZOC 4C3JK 5IYBK 2R7ZK 3GTOK 1WCMC 4LK1A 2CW0A 3WODA 3HOWC 1SFOK 4C3IK 4A3DK 5IYBC 2NVXC 4A93K 4A3DC 1K83C 3HKZL 4XLPA 4A93C 3GTPK 3H0GK 4YFKA 2PA8D 4C2MC 3PO2K 2PMZD 3GTJK 3S1NC 3S1MK 1I6VA 4OINA 3PO2C 4G7HA 2BE5A 4G7OA 5C4XK 5FJ8K 5IYCK 5TMFA 4AYBD 2PPBA 3GTKC 4BXXK 3HOYK 1IW7A 2WAQD 4C3JC 4XLNA 2R7ZC 2NVXK 2B63C 4BBSK 2O5JA 1TWGC 3S15K 4KMUA 1Y1WK 2NVYK 5C3EK 3HOZC 4A3BC 4A3GK 2JA8C 4BY7C 5IP7C 3I4NK 3GTLC 4BY1C 3GTGC 2E2JC 3S1RC 2JA5C 2NVQC 3K7AC 2WB1D 4XSXA 5C44K 3GTGK 4A3LK 3HOXC 2JA6K 2NVTK 1I3QK 4Y52C 4X6AC 2JA7C 5C4JC 2E2HC 4C3HK 4YFNA 4MEXA 2NVTC 2JA7K 4KN7A 5M5XK 3CQZC 4C3HC 4YFXA 4OIQA 1I50K 4KN4A 2R92K 4YG2A 4ZH4A 5M3FK 2E2IK 3S1QC 4A3CC 2R93C 2WAQL 3S2DC 4A3MC 1XPPA 2E2IC 3HOZK 5M5WK 2JA8K 4A3IC 3HOVK 4A3BK 4BBSC 4LJZA 4Q4ZA 1TWAC 1Y1WC 1ZYRA 4JK1A 3GTPC 3S15C 3GTKK 4MQ9A 4A3GC 5C44C 4NOIA 4XSZA 4A3LC 3K7AK 3RZDK 2VUMK 4C2MK 4BY1K 5FLMK 1I3QC 3S2HK 2WB1L 4OIRA 3I4NC 5IP7K 2A6EA 3HOUC 5TMCA 5C4XC 4A3EC 1TWCK 4LK0A 5M5YK 3GTJC 3GTQK 4BBRC 2YU9C 3FKIK 1SMYA 2O5IA 1I6HC 3S16K 1K83K 3FKIC 3S1NK 5IYCC 3RZOK 4LLGA 2Y0SD 4MEYA 1I6HK 4G7ZA 3I4MK 4BXXC 3S14K 4Q5SA 3GTOC
chains in the Genus database with same CATH superfamily
2ZJQS 3FKIA 3M4OC 3S2HC 1O2AA 4A3FK 2A6HA 5FLMC 4A3EK 4A3JC 4WILA 5E68A 3H0GC 5TJ3A 5HL8A 1R9TC 2E2HK 1EQRA 1TWAA 3FOFA 4QIWD 1SFOC 3N3YA 5C3EC 1WOPA 3M3YK 2A68A 4A3CK 2R93K 4GZYA 1XXCA 2B63K 5EGEA 3HOVC 2GSNA 3GTMC 3S17C 4KB2A 5IP9K 3PIPS 3S1MC 1JVIA 4KM9A 1Y1VC 1Y1VA 1TWHK 4XCHA 3GTLK 3L4JA 2PMZL 4Y52K 4KMHA 3PO3C 3A8JA 2PA8L 4IO9S 4WF9S 4KARA 3GTMA 3M4OK 2PHCB 5IYBK 1SFOK 1IQ0A 1SFOA 2ZFZA 4A3DC 1IBAA 4A93C 3GTPK 3H0GK 1R9TA 4YFKA 2PA8D 3PO2K 3GTQA 2PMZD 3JSTA 3S1MK 1I6VA 5FJ8K 1DCPA 2PPBA 2ZJPS 4BXXK 1IW7A 4C3JC 1F9NA 2B63C 2O5JA 4WJ3M 2ZJRS 3HOZC 2JA8C 3QX3A 3GTLC 2YU9A 1DCOA 2NVQC 3L4KA 4A3LK 2CFAA 3OPFA 2NVTK 4Y52C 1JQWA 5C4JC 4C3HK 1O2FB 2V6UA 3CQZC 3GEIA 2R92K 2CFAB 4YG2A 1INNA 2E2IK 3GTOA 3S1QC 2ZUEA 4BLBA 3S2DC 3G4CA 4C45A 2E2IA 2KWAA 1O2BA 1J98A 1I50A 2L5NA 4JK1A 3GTPC 1UV7A 5C44C 4XSZA 1VRQC 2XCQA 2W7VA 1VH2A 3AQOA 4FM9A 4LOWA 2ZUFA 1I3QC 4BY1K 1TWHA 1IL2A 4OIRA 3S2HK 1WQGA 1HI9A 5TMCA 4A3EC 3N0CA 3GTJC 4RMFA 1WQHA 2XCOA 4BKWA 1Y1WA 5IYCC 4LLGA 1I6HK 3DLLS 3I4MK 5JVGS 3GTKK 4Q5SA 3TFJA 4C3IC 1TWAK 1O26A 2E2HA 3S17K 4A3KC 5IP9C 3T00A 4KC6A 3S16C 3GTGA 1USMA 1KQ4A 1Y1VK 3T01A 4BBRK 4Y7NK 1EFWA 2R92C 2D6FC 5IYDC 3AQPA 3S2DK 3DXJA 3M3YC 3S1QK 1TWGK 5DM6S 3GTMK 4A3IK 5CJ9A 3TFIA 2A69A 4AYBL 3S1RK 3GDZA 3AD8C 4DDQA 4WFBS 3TTGA 3HOXK 1AB4A 4P9SA 4GTFA 4KMAA 3OEPA 3I4MC 4G0WA 5IYDK 3RZOC 3A8IA 1ZQ1C 2V6SA 4C3IK 4A3DK 5IOQA 1L0WA 4A93K 1K83C 3HKZL 4XLPA 3MMLB 2P5MA 1TWCA 3FOEA 4G7OA 5C4XK 4GT9A 2R7ZC 2NVXK 4WFNS 1JOEA 3S15K 1Y1WK 5C3EK 5IP7C 5HL7S 2JA5C 1RU0A 3GTJA 5C44K 3N0BA 3HOXC 3OREA 5JFEA 1I3QK 3CAGA 2E2HC 1DD5A 4MEXA 1I3QA 2GAGC 3GIRA 5M5XK 4YFXA 4OIQA 1I50K 4KN4A 4G0VA 4ZH4A 2JH3A 4A3CC 2R93C 4KM8A 1GE9A 3A8KA 3LYWA 4A3MC 1XPPA 5M5WK 4A3BK 3HOVK 3GTKA 3S15C 4MQ9A 4A3GC 3AD7C 5FLMK 1PJ6A 2WB1L 5IP7K 2A6EA 5C4XC 4GTBA 1SMYA 3GTPA 1I6HC 3S16K 1ZBSA 4MEYA 4G7ZA 1EI6A 4FZBA 3CF5S 3GTOC 3RZDC 1WOSA 1WCMA 1WCMK 3HOUK 4KASA 4QJVA 3GTQC 4O2DA 1TWHC 3T02A 2JA6C 3VA7A 5D4DA 1HQMA 3EQLA 3PO3K 3GTLA 2YU9K 1I50C 1YNJA 3GEHA 4QJVB 1XZPB 1WSRA 1WOOA 1WIHA 4PABA 2NVYC 4A3MK 3CQZK 1G51A 4PAAA 4QIWL 3HOYC 1XZPA 3CQZA 3ERED 4OIOA 5M3MK 5HQHA 3H3VD 2KPUA 1O24A 4A3FC 1YNNA 1TWFA 1O25A 1ISEA 1WQFA 1IS1A 1WORA 4M1XA 3H3VL 3NUHA 3H0GA 1R9TK 3TFHA 4BLAA 1TWFC 5IORA 3IPJA 1BDFA 1BGWA 2B63A 2Y3PA 4C3JK 3GTOK 1WCMC 2CW0A 5IOSA 4AH6A 5JVHS 4IOAS 2NVXC 3S0XA 1ZXOA 1EK8A 1IE0A 4LQYA 3GTJK 3S1NC 2EBBA 2KQ1A 5IYCK 5TMFA 2KXYA 2FQTA 3GTKC 3HOYK 4BBSK 4XLNA 1F93A 1PJ5A 2R93A 4A3BC 1YCLA 4P5BA 4GTLA 4BY1C 4GTCA 3LAJA 2WB1D 4XSXA 4J3NA 3GTGK 1ZVUA 4YFNA 2JA7K 4KN7A 2L3UA 2WAQL 2NVYA 4KATA 3BUEA 4A3IC 4BBSC 2R7ZA 4LJZA 1TWAC 3K7AK 3RZDK 2VUMK 3Q3QA 2JA6A 4GFQA 1XXAA 3HOUC 2GSOA 3FHZA 4LK0A 4KDDA 5L46A 3ADAC 2JA5A 3GTQK 4BBRC 2O5IA 1K83K 5IOTA 3FKIC 3LAPA 3RZOK 4BXXC 3S14K 1XZQA 4KMDA 2RH6A 1X31C 2XCRB 2Y0SL 5JVOA 2RGRA 1USOA 1B4BA 1TWCC 2JA7A 1DCHA 4OIPA 3HKZD 4KB4A 1XXBA 5C4JK 3HOWK 1TWFK 2VUMA 2VUMC 3SZYA 2NVQK 4A3JK 1F7VA 4BY7K 2JA5K 1FEUA 4A3KK 2E2JK 1J6WA 5CHPA 3BP8C 4GTEA 4X6AK 1B4AA 1K83A 4Y7NC 4GTAA 3S14C 1BS2A 1TWGA 1C0AA 3LPXA 1V5VA 4LR2A 4IOCS 2R7ZK 3BP3A 4LK1A 3HOWC 3WODA 2V6TA 5IYBC 3HXAA 1VJEA 3SZZA 1J6XA 4C2MC 4WJ4A 4OINA 3PO2C 2FQOA 4G7HA 2BE5A 3GEEA 4AYBD 4G0UA 3G4AA 2WAQD 4GTDA 3GSIA 1TWGC 4KMUA 2P8TA 2NVYK 4A3GK 4BY7C 3I4NK 3GTGC 2E2JC 3S1RC 3K7AC 1XZQB 1O29A 2JA6K 4KAWX 4X6AC 2JA7C 4P5AA 2NVTC 4WFAS 4WCES 4C3HC 5M3FK 5DM7S 1VGXA 1VLOA 2E2IC 3HOZK 2JA8K 4Q4ZA 1Y1WC 2R92A 1ZYRA 4A3LC 4NOIA 3AD9C 1F7UA 4C2MK 1J6VA 1WSVA 3I4NC 2GAHC 1O27A 1TWCK 5M5YK 5EGHA 1O28A 1EH1A 3PIOS 2YU9C 3FKIK 4ILDA 1YX2A 2GSUA 3AH5A 3V4GA 3S1NK 4U67S 2Y0SD 1BJTA 2NVXA 1PJ7A
chains in the Genus database with same CATH topology
3RZDC 3M4OC 4C3IC 1TWAK 3S2HC 1WCMK 2Y0SL 3HOUK 4A3FK 2A6HA 5FLMC 1TWCC 4A3JC 4A3EK 4A3KC 3S17K 4QJVA 3H0GC 3GTQC 5IP9C 4OIPA 1TWHC 3HKZD 2JA6C 5D4DA 1HQMA 1R9TC 3S16C 3EQLA 3PO3K 5C4JK 1Y1VK 4BBRK 4Y7NK 2E2HK 2YU9K 1I50C 1YNJA 2R92C 5IYDC 4QJVB 3S2DK 3DXJA 4QIWD 3M3YC 3S1QK 1SFOC 3HOWK 2NVYC 5C3EC 1TWFK 4A3MK 3M3YK 2A68A 4A3CK 1TWGK 4GZYA 3CQZK 3GTMK 2R93K 2B63K 4QIWL 2VUMC 3HOVC 4A3IK 3HOYC 2NVQK 3GTMC 4OIOA 3S17C 4A3JK 5M3MK 3H3VD 2A69A 4A3FC 1YNNA 5IP9K 4AYBL 3S1RK 2JA5K 4BY7K 4A3KK 2E2JK 3S1MC 3GTLK 1Y1VC 1TWHK 3H3VL 2PMZL 1R9TK 4X6AK 4Y52K 3PO3C 3HOXK 2PA8L 4Y7NC 1TWFC 3S14C 1BDFA 3I4MC 5IYDK 3M4OK 3RZOC 4C3JK 5IYBK 2R7ZK 3GTOK 1WCMC 4LK1A 2CW0A 3WODA 3HOWC 1SFOK 4C3IK 4A3DK 5IYBC 2NVXC 4A93K 4A3DC 1K83C 3HKZL 4XLPA 4A93C 3GTPK 3H0GK 4YFKA 2PA8D 4C2MC 3PO2K 2PMZD 3GTJK 3S1NC 3S1MK 1I6VA 4OINA 3PO2C 4G7HA 2BE5A 4G7OA 5C4XK 5FJ8K 5IYCK 5TMFA 4AYBD 2PPBA 3GTKC 4BXXK 3HOYK 1IW7A 2WAQD 4C3JC 4XLNA 2R7ZC 2NVXK 2B63C 4BBSK 2O5JA 1TWGC 3S15K 4KMUA 1Y1WK 2NVYK 5C3EK 3HOZC 4A3BC 4A3GK 2JA8C 4BY7C 5IP7C 3I4NK 3GTLC 4BY1C 3GTGC 2E2JC 3S1RC 2JA5C 2NVQC 3K7AC 2WB1D 4XSXA 5C44K 3GTGK 4A3LK 3HOXC 2JA6K 2NVTK 1I3QK 4Y52C 4X6AC 2JA7C 5C4JC 2E2HC 4C3HK 4YFNA 4MEXA 2NVTC 2JA7K 4KN7A 5M5XK 3CQZC 4C3HC 4YFXA 4OIQA 1I50K 4KN4A 2R92K 4YG2A 4ZH4A 5M3FK 2E2IK 3S1QC 4A3CC 2R93C 2WAQL 3S2DC 4A3MC 1XPPA 2E2IC 3HOZK 5M5WK 2JA8K 4A3IC 3HOVK 4A3BK 4BBSC 4LJZA 4Q4ZA 1TWAC 1Y1WC 1ZYRA 4JK1A 3GTPC 3S15C 3GTKK 4MQ9A 4A3GC 5C44C 4NOIA 4XSZA 4A3LC 3K7AK 3RZDK 2VUMK 4C2MK 4BY1K 5FLMK 1I3QC 3S2HK 2WB1L 4OIRA 3I4NC 5IP7K 2A6EA 3HOUC 5TMCA 5C4XC 4A3EC 1TWCK 4LK0A 5M5YK 3GTJC 3GTQK 4BBRC 2YU9C 3FKIK 1SMYA 2O5IA 1I6HC 3S16K 1K83K 3FKIC 3S1NK 5IYCC 3RZOK 4LLGA 2Y0SD 4MEYA 1I6HK 4G7ZA 3I4MK 4BXXC 3S14K 4Q5SA 3GTOC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RZD C;  3M4O C;  4C3I C;  1TWA K;  3S2H C;  1WCM K;  2Y0S L;  3HOU K;  4A3F K;  2A6H A;  5FLM C;  1TWC C;  4A3J C;  4A3E K;  4A3K C;  3S17 K;  4QJV A;  3H0G C;  3GTQ C;  5IP9 C;  4OIP A;  1TWH C;  3HKZ D;  2JA6 C;  5D4D A;  1HQM A;  1R9T C;  3S16 C;  3EQL A;  3PO3 K;  5C4J K;  1Y1V K;  4BBR K;  4Y7N K;  2E2H K;  2YU9 K;  1I50 C;  1YNJ A;  2R92 C;  5IYD C;  4QJV B;  3S2D K;  3DXJ A;  4QIW D;  3M3Y C;  3S1Q K;  1SFO C;  3HOW K;  2NVY C;  5C3E C;  1TWF K;  4A3M K;  3M3Y K;  2A68 A;  4A3C K;  1TWG K;  4GZY A;  3CQZ K;  3GTM K;  2R93 K;  2B63 K;  4QIW L;  2VUM C;  3HOV C;  4A3I K;  3HOY C;  2NVQ K;  3GTM C;  4OIO A;  3S17 C;  4A3J K;  5M3M K;  3H3V D;  2A69 A;  4A3F C;  1YNN A;  5IP9 K;  4AYB L;  3S1R K;  2JA5 K;  4BY7 K;  4A3K K;  2E2J K;  3S1M C;  3GTL K;  1Y1V C;  1TWH K;  3H3V L;  2PMZ L;  1R9T K;  4X6A K;  4Y52 K;  3PO3 C;  3HOX K;  2PA8 L;  4Y7N C;  1TWF C;  3S14 C;  1BDF A;  3I4M C;  5IYD K;  3M4O K;  3RZO C;  4C3J K;  5IYB K;  2R7Z K;  3GTO K;  1WCM C;  4LK1 A;  2CW0 A;  3WOD A;  3HOW C;  1SFO K;  4C3I K;  4A3D K;  5IYB C;  2NVX C;  4A93 K;  4A3D C;  1K83 C;  3HKZ L;  4XLP A;  4A93 C;  3GTP K;  3H0G K;  4YFK A;  2PA8 D;  4C2M C;  3PO2 K;  2PMZ D;  3GTJ K;  3S1N C;  3S1M K;  1I6V A;  4OIN A;  3PO2 C;  4G7H A;  2BE5 A;  4G7O A;  5C4X K;  5FJ8 K;  5IYC K;  5TMF A;  4AYB D;  2PPB A;  3GTK C;  4BXX K;  3HOY K;  1IW7 A;  2WAQ D;  4C3J C;  4XLN A;  2R7Z C;  2NVX K;  2B63 C;  4BBS K;  2O5J A;  1TWG C;  3S15 K;  4KMU A;  1Y1W K;  2NVY K;  5C3E K;  3HOZ C;  4A3B C;  4A3G K;  2JA8 C;  4BY7 C;  5IP7 C;  3I4N K;  3GTL C;  4BY1 C;  3GTG C;  2E2J C;  3S1R C;  2JA5 C;  2NVQ C;  3K7A C;  2WB1 D;  4XSX A;  5C44 K;  3GTG K;  4A3L K;  3HOX C;  2JA6 K;  2NVT K;  1I3Q K;  4Y52 C;  4X6A C;  2JA7 C;  5C4J C;  2E2H C;  4C3H K;  4YFN A;  4MEX A;  2NVT C;  2JA7 K;  4KN7 A;  5M5X K;  3CQZ C;  4C3H C;  4YFX A;  4OIQ A;  1I50 K;  4KN4 A;  2R92 K;  4YG2 A;  4ZH4 A;  5M3F K;  2E2I K;  3S1Q C;  4A3C C;  2R93 C;  2WAQ L;  3S2D C;  4A3M C;  1XPP A;  2E2I C;  3HOZ K;  5M5W K;  2JA8 K;  4A3I C;  3HOV K;  4A3B K;  4BBS C;  4LJZ A;  4Q4Z A;  1TWA C;  1Y1W C;  1ZYR A;  4JK1 A;  3GTP C;  3S15 C;  3GTK K;  4MQ9 A;  4A3G C;  5C44 C;  4NOI A;  4XSZ A;  4A3L C;  3K7A K;  3RZD K;  2VUM K;  4C2M K;  4BY1 K;  5FLM K;  1I3Q C;  3S2H K;  2WB1 L;  4OIR A;  3I4N C;  5IP7 K;  2A6E A;  3HOU C;  5TMC A;  5C4X C;  4A3E C;  1TWC K;  4LK0 A;  5M5Y K;  3GTJ C;  3GTQ K;  4BBR C;  2YU9 C;  3FKI K;  1SMY A;  2O5I A;  1I6H C;  3S16 K;  1K83 K;  3FKI C;  3S1N K;  5IYC C;  3RZO K;  4LLG A;  2Y0S D;  4MEY A;  1I6H K;  4G7Z A;  3I4M K;  4BXX C;  3S14 K;  4Q5S A;  3GTO C; 
#chains in the Genus database with same CATH topology
 2ZJQ S;  3FKI A;  3M4O C;  3S2H C;  1O2A A;  4A3F K;  2A6H A;  5FLM C;  4A3E K;  4A3J C;  4WIL A;  5E68 A;  3H0G C;  5TJ3 A;  5HL8 A;  1R9T C;  2E2H K;  1EQR A;  1TWA A;  3FOF A;  4QIW D;  1SFO C;  3N3Y A;  5C3E C;  1WOP A;  3M3Y K;  2A68 A;  4A3C K;  2R93 K;  4GZY A;  1XXC A;  2B63 K;  5EGE A;  3HOV C;  2GSN A;  3GTM C;  3S17 C;  4KB2 A;  5IP9 K;  3PIP S;  3S1M C;  1JVI A;  4KM9 A;  1Y1V C;  1Y1V A;  1TWH K;  4XCH A;  3GTL K;  3L4J A;  2PMZ L;  4Y52 K;  4KMH A;  3PO3 C;  3A8J A;  2PA8 L;  4IO9 S;  4WF9 S;  4KAR A;  3GTM A;  3M4O K;  2PHC B;  5IYB K;  1SFO K;  1IQ0 A;  1SFO A;  2ZFZ A;  4A3D C;  1IBA A;  4A93 C;  3GTP K;  3H0G K;  1R9T A;  4YFK A;  2PA8 D;  3PO2 K;  3GTQ A;  2PMZ D;  3JST A;  3S1M K;  1I6V A;  5FJ8 K;  1DCP A;  2PPB A;  2ZJP S;  4BXX K;  1IW7 A;  4C3J C;  1F9N A;  2B63 C;  2O5J A;  4WJ3 M;  2ZJR S;  3HOZ C;  2JA8 C;  3QX3 A;  3GTL C;  2YU9 A;  1DCO A;  2NVQ C;  3L4K A;  4A3L K;  2CFA A;  3OPF A;  2NVT K;  4Y52 C;  1JQW A;  5C4J C;  4C3H K;  1O2F B;  2V6U A;  3CQZ C;  3GEI A;  2R92 K;  2CFA B;  4YG2 A;  1INN A;  2E2I K;  3GTO A;  3S1Q C;  2ZUE A;  4BLB A;  3S2D C;  3G4C A;  4C45 A;  2E2I A;  2KWA A;  1O2B A;  1J98 A;  1I50 A;  2L5N A;  4JK1 A;  3GTP C;  1UV7 A;  5C44 C;  4XSZ A;  1VRQ C;  2XCQ A;  2W7V A;  1VH2 A;  3AQO A;  4FM9 A;  4LOW A;  2ZUF A;  1I3Q C;  4BY1 K;  1TWH A;  1IL2 A;  4OIR A;  3S2H K;  1WQG A;  1HI9 A;  5TMC A;  4A3E C;  3N0C A;  3GTJ C;  4RMF A;  1WQH A;  2XCO A;  4BKW A;  1Y1W A;  5IYC C;  4LLG A;  1I6H K;  3DLL S;  3I4M K;  5JVG S;  3GTK K;  4Q5S A;  3TFJ A;  4C3I C;  1TWA K;  1O26 A;  2E2H A;  3S17 K;  4A3K C;  5IP9 C;  3T00 A;  4KC6 A;  3S16 C;  3GTG A;  1USM A;  1KQ4 A;  1Y1V K;  3T01 A;  4BBR K;  4Y7N K;  1EFW A;  2R92 C;  2D6F C;  5IYD C;  3AQP A;  3S2D K;  3DXJ A;  3M3Y C;  3S1Q K;  1TWG K;  5DM6 S;  3GTM K;  4A3I K;  5CJ9 A;  3TFI A;  2A69 A;  4AYB L;  3S1R K;  3GDZ A;  3AD8 C;  4DDQ A;  4WFB S;  3TTG A;  3HOX K;  1AB4 A;  4P9S A;  4GTF A;  4KMA A;  3OEP A;  3I4M C;  4G0W A;  5IYD K;  3RZO C;  3A8I A;  1ZQ1 C;  2V6S A;  4C3I K;  4A3D K;  5IOQ A;  1L0W A;  4A93 K;  1K83 C;  3HKZ L;  4XLP A;  3MML B;  2P5M A;  1TWC A;  3FOE A;  4G7O A;  5C4X K;  4GT9 A;  2R7Z C;  2NVX K;  4WFN S;  1JOE A;  3S15 K;  1Y1W K;  5C3E K;  5IP7 C;  5HL7 S;  2JA5 C;  1RU0 A;  3GTJ A;  5C44 K;  3N0B A;  3HOX C;  3ORE A;  5JFE A;  1I3Q K;  3CAG A;  2E2H C;  1DD5 A;  4MEX A;  1I3Q A;  2GAG C;  3GIR A;  5M5X K;  4YFX A;  4OIQ A;  1I50 K;  4KN4 A;  4G0V A;  4ZH4 A;  2JH3 A;  4A3C C;  2R93 C;  4KM8 A;  1GE9 A;  3A8K A;  3LYW A;  4A3M C;  1XPP A;  5M5W K;  4A3B K;  3HOV K;  3GTK A;  3S15 C;  4MQ9 A;  4A3G C;  3AD7 C;  5FLM K;  1PJ6 A;  2WB1 L;  5IP7 K;  2A6E A;  5C4X C;  4GTB A;  1SMY A;  3GTP A;  1I6H C;  3S16 K;  1ZBS A;  4MEY A;  4G7Z A;  1EI6 A;  4FZB A;  3CF5 S;  3GTO C;  3RZD C;  1WOS A;  1WCM A;  1WCM K;  3HOU K;  4KAS A;  4QJV A;  3GTQ C;  4O2D A;  1TWH C;  3T02 A;  2JA6 C;  3VA7 A;  5D4D A;  1HQM A;  3EQL A;  3PO3 K;  3GTL A;  2YU9 K;  1I50 C;  1YNJ A;  3GEH A;  4QJV B;  1XZP B;  1WSR A;  1WOO A;  1WIH A;  4PAB A;  2NVY C;  4A3M K;  3CQZ K;  1G51 A;  4PAA A;  4QIW L;  3HOY C;  1XZP A;  3CQZ A;  3ERE D;  4OIO A;  5M3M K;  5HQH A;  3H3V D;  2KPU A;  1O24 A;  4A3F C;  1YNN A;  1TWF A;  1O25 A;  1ISE A;  1WQF A;  1IS1 A;  1WOR A;  4M1X A;  3H3V L;  3NUH A;  3H0G A;  1R9T K;  3TFH A;  4BLA A;  1TWF C;  5IOR A;  3IPJ A;  1BDF A;  1BGW A;  2B63 A;  2Y3P A;  4C3J K;  3GTO K;  1WCM C;  2CW0 A;  5IOS A;  4AH6 A;  5JVH S;  4IOA S;  2NVX C;  3S0X A;  1ZXO A;  1EK8 A;  1IE0 A;  4LQY A;  3GTJ K;  3S1N C;  2EBB A;  2KQ1 A;  5IYC K;  5TMF A;  2KXY A;  2FQT A;  3GTK C;  3HOY K;  4BBS K;  4XLN A;  1F93 A;  1PJ5 A;  2R93 A;  4A3B C;  1YCL A;  4P5B A;  4GTL A;  4BY1 C;  4GTC A;  3LAJ A;  2WB1 D;  4XSX A;  4J3N A;  3GTG K;  1ZVU A;  4YFN A;  2JA7 K;  4KN7 A;  2L3U A;  2WAQ L;  2NVY A;  4KAT A;  3BUE A;  4A3I C;  4BBS C;  2R7Z A;  4LJZ A;  1TWA C;  3K7A K;  3RZD K;  2VUM K;  3Q3Q A;  2JA6 A;  4GFQ A;  1XXA A;  3HOU C;  2GSO A;  3FHZ A;  4LK0 A;  4KDD A;  5L46 A;  3ADA C;  2JA5 A;  3GTQ K;  4BBR C;  2O5I A;  1K83 K;  5IOT A;  3FKI C;  3LAP A;  3RZO K;  4BXX C;  3S14 K;  1XZQ A;  4KMD A;  2RH6 A;  1X31 C;  2XCR B;  2Y0S L;  5JVO A;  2RGR A;  1USO A;  1B4B A;  1TWC C;  2JA7 A;  1DCH A;  4OIP A;  3HKZ D;  4KB4 A;  1XXB A;  5C4J K;  3HOW K;  1TWF K;  2VUM A;  2VUM C;  3SZY A;  2NVQ K;  4A3J K;  1F7V A;  4BY7 K;  2JA5 K;  1FEU A;  4A3K K;  2E2J K;  1J6W A;  5CHP A;  3BP8 C;  4GTE A;  4X6A K;  1B4A A;  1K83 A;  4Y7N C;  4GTA A;  3S14 C;  1BS2 A;  1TWG A;  1C0A A;  3LPX A;  1V5V A;  4LR2 A;  4IOC S;  2R7Z K;  3BP3 A;  4LK1 A;  3HOW C;  3WOD A;  2V6T A;  5IYB C;  3HXA A;  1VJE A;  3SZZ A;  1J6X A;  4C2M C;  4WJ4 A;  4OIN A;  3PO2 C;  2FQO A;  4G7H A;  2BE5 A;  3GEE A;  4AYB D;  4G0U A;  3G4A A;  2WAQ D;  4GTD A;  3GSI A;  1TWG C;  4KMU A;  2P8T A;  2NVY K;  4A3G K;  4BY7 C;  3I4N K;  3GTG C;  2E2J C;  3S1R C;  3K7A C;  1XZQ B;  1O29 A;  2JA6 K;  4KAW X;  4X6A C;  2JA7 C;  4P5A A;  2NVT C;  4WFA S;  4WCE S;  4C3H C;  5M3F K;  5DM7 S;  1VGX A;  1VLO A;  2E2I C;  3HOZ K;  2JA8 K;  4Q4Z A;  1Y1W C;  2R92 A;  1ZYR A;  4A3L C;  4NOI A;  3AD9 C;  1F7U A;  4C2M K;  1J6V A;  1WSV A;  3I4N C;  2GAH C;  1O27 A;  1TWC K;  5M5Y K;  5EGH A;  1O28 A;  1EH1 A;  3PIO S;  2YU9 C;  3FKI K;  4ILD A;  1YX2 A;  2GSU A;  3AH5 A;  3V4G A;  3S1N K;  4U67 S;  2Y0S D;  1BJT A;  2NVX A;  1PJ7 A; 
#chains in the Genus database with same CATH homology
 3RZD C;  3M4O C;  4C3I C;  1TWA K;  3S2H C;  1WCM K;  2Y0S L;  3HOU K;  4A3F K;  2A6H A;  5FLM C;  1TWC C;  4A3J C;  4A3E K;  4A3K C;  3S17 K;  4QJV A;  3H0G C;  3GTQ C;  5IP9 C;  4OIP A;  1TWH C;  3HKZ D;  2JA6 C;  5D4D A;  1HQM A;  1R9T C;  3S16 C;  3EQL A;  3PO3 K;  5C4J K;  1Y1V K;  4BBR K;  4Y7N K;  2E2H K;  2YU9 K;  1I50 C;  1YNJ A;  2R92 C;  5IYD C;  4QJV B;  3S2D K;  3DXJ A;  4QIW D;  3M3Y C;  3S1Q K;  1SFO C;  3HOW K;  2NVY C;  5C3E C;  1TWF K;  4A3M K;  3M3Y K;  2A68 A;  4A3C K;  1TWG K;  4GZY A;  3CQZ K;  3GTM K;  2R93 K;  2B63 K;  4QIW L;  2VUM C;  3HOV C;  4A3I K;  3HOY C;  2NVQ K;  3GTM C;  4OIO A;  3S17 C;  4A3J K;  5M3M K;  3H3V D;  2A69 A;  4A3F C;  1YNN A;  5IP9 K;  4AYB L;  3S1R K;  2JA5 K;  4BY7 K;  4A3K K;  2E2J K;  3S1M C;  3GTL K;  1Y1V C;  1TWH K;  3H3V L;  2PMZ L;  1R9T K;  4X6A K;  4Y52 K;  3PO3 C;  3HOX K;  2PA8 L;  4Y7N C;  1TWF C;  3S14 C;  1BDF A;  3I4M C;  5IYD K;  3M4O K;  3RZO C;  4C3J K;  5IYB K;  2R7Z K;  3GTO K;  1WCM C;  4LK1 A;  2CW0 A;  3WOD A;  3HOW C;  1SFO K;  4C3I K;  4A3D K;  5IYB C;  2NVX C;  4A93 K;  4A3D C;  1K83 C;  3HKZ L;  4XLP A;  4A93 C;  3GTP K;  3H0G K;  4YFK A;  2PA8 D;  4C2M C;  3PO2 K;  2PMZ D;  3GTJ K;  3S1N C;  3S1M K;  1I6V A;  4OIN A;  3PO2 C;  4G7H A;  2BE5 A;  4G7O A;  5C4X K;  5FJ8 K;  5IYC K;  5TMF A;  4AYB D;  2PPB A;  3GTK C;  4BXX K;  3HOY K;  1IW7 A;  2WAQ D;  4C3J C;  4XLN A;  2R7Z C;  2NVX K;  2B63 C;  4BBS K;  2O5J A;  1TWG C;  3S15 K;  4KMU A;  1Y1W K;  2NVY K;  5C3E K;  3HOZ C;  4A3B C;  4A3G K;  2JA8 C;  4BY7 C;  5IP7 C;  3I4N K;  3GTL C;  4BY1 C;  3GTG C;  2E2J C;  3S1R C;  2JA5 C;  2NVQ C;  3K7A C;  2WB1 D;  4XSX A;  5C44 K;  3GTG K;  4A3L K;  3HOX C;  2JA6 K;  2NVT K;  1I3Q K;  4Y52 C;  4X6A C;  2JA7 C;  5C4J C;  2E2H C;  4C3H K;  4YFN A;  4MEX A;  2NVT C;  2JA7 K;  4KN7 A;  5M5X K;  3CQZ C;  4C3H C;  4YFX A;  4OIQ A;  1I50 K;  4KN4 A;  2R92 K;  4YG2 A;  4ZH4 A;  5M3F K;  2E2I K;  3S1Q C;  4A3C C;  2R93 C;  2WAQ L;  3S2D C;  4A3M C;  1XPP A;  2E2I C;  3HOZ K;  5M5W K;  2JA8 K;  4A3I C;  3HOV K;  4A3B K;  4BBS C;  4LJZ A;  4Q4Z A;  1TWA C;  1Y1W C;  1ZYR A;  4JK1 A;  3GTP C;  3S15 C;  3GTK K;  4MQ9 A;  4A3G C;  5C44 C;  4NOI A;  4XSZ A;  4A3L C;  3K7A K;  3RZD K;  2VUM K;  4C2M K;  4BY1 K;  5FLM K;  1I3Q C;  3S2H K;  2WB1 L;  4OIR A;  3I4N C;  5IP7 K;  2A6E A;  3HOU C;  5TMC A;  5C4X C;  4A3E C;  1TWC K;  4LK0 A;  5M5Y K;  3GTJ C;  3GTQ K;  4BBR C;  2YU9 C;  3FKI K;  1SMY A;  2O5I A;  1I6H C;  3S16 K;  1K83 K;  3FKI C;  3S1N K;  5IYC C;  3RZO K;  4LLG A;  2Y0S D;  4MEY A;  1I6H K;  4G7Z A;  3I4M K;  4BXX C;  3S14 K;  4Q5S A;  3GTO C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...