4G7HA

Crystal structure of thermus thermophilus transcription initiation complex
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
226
structure length
226
Chain Sequence
SKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription, transferase/dna
molecule keywords DNA-directed RNA polymerase subunit alpha
publication title Structural basis of transcription initiation.
pubmed doi rcsb
source organism Thermus thermophilus
total genus 48
structure length 226
sequence length 226
chains with identical sequence B, K, L
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2012-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01000 RNA_pol_A_bac RNA polymerase Rpb3/RpoA insert domain
A PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain
A PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.12 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 DNA-directed RNA polymerase, insert domain 4g7hA02
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 4g7hA01
1TWGC 5IYCK 2B63C 2Y0SD 4XLNA 4XLPA 5C3EK 2WAQD 4MEXA 4C3IK 2E2HK 2Y0SL 1YNNA 2NVQC 2E2IC 2WAQL 4A3GK 3HOWK 1Y1VC 5IP9K 1TWHK 1I50K 3HOZK 3M4OK 4OINA 2R7ZC 3GTJK 3HOUC 2YU9K 2R93K 5IYDK 4BBSC 4YFKA 1I6HC 4A3BK 5M5YK 1TWAK 4LJZA 4QIWD 4BBRK 4A3IC 3RZDK 4QIWL 4G7OA 3WODA 4BXXK 4Y7NK 4A3CK 4Q5SA 3GTMK 3HOYC 4A3DC 3S1RC 2JA5C 3EQLA 5IYBC 2VUMC 5FJ8K 3GTQK 1K83K 3FKIC 4C3HC 3H0GK 3S1MK 2O5JA 3I4MC 1R9TK 4A93C 3HKZD 4A3KK 1Y1WC 4A3JC 2R92C 4Y52C 3HKZL 4A3EK 5C44C 3GTGC 3S14C 2JA7C 3GTOC 1WCMK 3S1NK 1TWFC 4LK1A 4G7HA 3GTKC 4X6AC 4Q4ZA 5C4JK 3HOVC 4A3DK 3S2HK 2A6HA 2NVYK 1I3QK 1ZYRA 2NVTC 2CW0A 4XSXA 4OIPA 4YFXA 4C3JK 4KN4A 3S17K 5D4DA 3PO3K 4XSZA 1IW7A 2A68A 4A3MC 4ZH4A 3GTPC 3K7AC 3S1QC 4OIQA 5IP7K 2JA8K 1TWGK 2B63K 1BDFA 4GZYA 4OIOA 4C2MC 2PPBA 4BY1C 3PO2C 2PMZD 2E2JC 2NVQK 3S16C 5FLMC 3H3VD 2JA6C 4A3LC 3HOXC 3RZOC 4OIRA 2E2IK 1TWCC 4G7ZA 4BY7C 1Y1VK 2PMZL 3H3VL 3GTKK 2A69A 4KMUA 2R7ZK 3GTLC 3HOUK 3CQZC 1SFOC 4BBSK 4JK1A 1I6HK 4LLGA 5M5WK 5C4XC 4A3IK 3S15C 3S2DC 2O5IA 4A3FC 3M3YC 4A3KC 5IYCC 3HOYK 5C3EC 4C3IC 3S1RK 2BE5A 2JA5K 4A3GC 4MEYA 5IYBK 2VUMK 5TMFA 3HOWC 3FKIK 4C3HK 5IP9C 1TWHC 1I50C 3I4MK 3HOZC 3I4NC 3CQZK 3M4OC 4A93K 2R93C 3DXJA 3GTJC 2YU9C 5M3MK 1Y1WK 5IYDC 4A3JK 2R92K 4Y52K 4A3BC 2NVXC 5C44K 3GTGK 1TWAC 2JA7K 3GTOK 4BBRC 1TWFK 4X6AK 2PA8D 3RZDC 3HOVK 4BXXC 4Y7NC 4A3CC 3GTMC 2WB1D 4MQ9A 2PA8L 4QJVA 2NVTK 1SMYA 2WB1L 3S2DK 4A3MK 3GTPK 4YFNA 1K83C 3GTQC 3H0GC 3K7AK 3S1MC 5M5XK 4LK0A 3I4NK 3S1QK 1R9TC 1I6VA 4C2MK 4BY1K 3PO2K 2E2JK 2NVXK 3S16K 5FLMK 2E2HC 2JA6K 4A3EC 3HOXK 3RZOK 2A6EA 4QJVB 1TWCK 4A3LK 1WCMC 4BY7K 3S1NC 3S14K 5C4JC 4KN7A 1HQMA 4NOIA 4AYBD 5M3FK 3GTLK 1XPPA 3S2HC 1YNJA 2NVYC 1I3QC 1SFOK 4AYBL 4YG2A 4C3JC 3S17C 5TMCA 3PO3C 5C4XK 3S15K 5IP7C 4A3FK 3M3YK 2JA8C
chains in the Genus database with same CATH superfamily
5IYCK 5C3EK 1YNNA 3FKIA 1Y1VC 2V6SA 5IP9K 1WIHA 1TWHK 1I50K 3HOUC 2R92A 1HI9A 4BBSC 4YFKA 1I6HC 3GTOA 1TWAK 5L46A 1EI6A 4BBRK 2XCRB 4WJ3M 3RZDK 4Q5SA 3GTMK 1VJEA 1WOPA 1YCLA 2KPUA 1G51A 2JA5C 5FJ8K 1K83K 3GIRA 1AB4A 4FM9A 2JA6A 5IORA 1UV7A 4KM9A 3DLLS 3LAJA 1TWFC 4G7HA 4X6AC 4Q4ZA 3HOVC 1USMA 3CQZA 3BP3A 3S2HK 1O27A 4KAWX 4C3JK 3S17K 4KN4A 1IW7A 5IP7K 4PAAA 2JA8K 1TWGK 2GSUA 4J3NA 4GZYA 4BY1C 4GTEA 2PMZD 2E2JC 3LPXA 3S16C 2E2IK 1TWCC 2PMZL 1JVIA 2A69A 3GTLC 3T00A 1SFOC 2XCOA 2NVXA 4JK1A 2FQOA 5M5WK 5DM6S 1DCPA 3M3YC 1O25A 2CFAA 5HL7S 1WQHA 1WSVA 4KARA 3S1RK 3CF5S 3AD9C 3HOWC 3BP8C 3I4NC 2KWAA 3M4OC 2R93C 1Y1WK 4GTAA 2E2HA 2CFAB 3ERED 4KMDA 3GTGK 1I3QA 4A3CC 2KXYA 1INNA 4A3MK 3GTPK 1IE0A 3S1QK 3H0GC 1EQRA 3I4NK 3T01A 4LK0A 4WFAS 1EK8A 1I6VA 5DM7S 3HOXK 1BJTA 4BY7K 1PJ6A 4AYBD 3GEEA 1EFWA 1WQGA 4AYBL 3LAPA 4M1XA 5TMCA 2EBBA 5CJ9A 3G4CA 3TFIA 4A3KK 2B63C 4XLNA 3GEHA 3SZZA 2VUMA 4RMFA 4KB4A 4KMAA 1B4BA 3N3YA 3HOZK 2R7ZC 5IOSA 3GTJK 2YU9K 1DCOA 5IYDK 4C45A 4P5BA 1J6VA 2JA7A 2ZJPS 3HXAA 4G7OA 4Y7NK 3HOYC 2P8TA 3TFHA 3EQLA 5IYBC 3GTQK 3FKIC 1IL2A 4IOCS 3I4MC 1R9TK 4A93C 3A8KA 3HKZD 3CAGA 4P9SA 1O26A 4A3JC 2R92C 3HKZL 4A3EK 1WOSA 1WCMK 3GTOC 3S1NK 4G0WA 4LK1A 5C4JK 2A6HA 2NVYK 5E68A 1ZYRA 2V6UA 4XSXA 4YFXA 2Y3PA 3AD8C 3PO3K 4XSZA 2A68A 3K7AC 4OIQA 1BDFA 1J6WA 2PPBA 2KQ1A 3PO2C 2JA6C 1TWHA 1Y1VK 1I50A 1VGXA 1RU0A 4KMUA 3HOUK 1ZXOA 3CQZC 4BBSK 1I6HK 1TWAA 5C4XC 3S15C 3QX3A 3GTMA 4WFNS 2ZJQS 1BS2A 1O2BA 4C3IC 2JA5K 1K83A 4A3GC 5TMFA 1F7VA 1XZPA 3CQZK 4GTFA 4G0UA 3DXJA 5M3MK 2ZUEA 4A3BC 2NVXC 3IPJA 1TWFK 4X6AK 3HOVK 4BXXC 3N0CA 5IOTA 2WB1D 1XZPB 3VA7A 2JH3A 2WB1L 1VLOA 5M5XK 3S1MC 4DDQA 4BY1K 2W7VA 2E2IA 2E2JK 2NVXK 3S16K 2E2HC 1IS1A 2A6EA 1TWCK 5EGEA 1HQMA 1O28A 1XPPA 3FOEA 3GTLK 1I3QC 1O2FB 1SFOK 4G0VA 4YG2A 3LYWA 3M3YK 1XXBA 2ZJRS 4MEXA 2E2HK 2NVQC 3L4KA 3HOWK 4LOWA 1Y1WA 3M4OK 4OINA 2R93K 4BLBA 2GAHC 4KM8A 3GTGA 5M5YK 1WQFA 3GTKA 4XCHA 4A3IC 4ILDA 4A3CK 4A3DC 5JFEA 1GE9A 3GTPA 2VUMC 4WFBS 3V4GA 3H0GK 4C3HC 2O5JA 3FHZA 4GTBA 2L3UA 4Y52C 1YX2A 4BKWA 5C44C 3SZYA 2JA7C 1O24A 4WILA 4KC6A 2FQTA 3GDZA 4A3DK 2ZUFA 2NVTC 2CW0A 3ADAC 4ZH4A 2B63K 1J98A 4OIOA 4C2MC 4P5AA 4LR2A 5FLMC 3H3VD 4A3LC 3RZOC 4OIRA 3GEIA 1F9NA 3H3VL 1USOA 3GTJA 2YU9A 4GFQA 2R7ZK 4PABA 1O29A 1DCHA 1X31C 3S2DC 4A3FC 3TFJA 2GSNA 1VH2A 5EGHA 5IYCC 3A8IA 3HOYK 1ZBSA 5C3EC 2BE5A 3GTQA 1F93A 4MEYA 5IYBK 3FKIK 5IP9C 1R9TA 1TWHC 1I50C 2GSOA 3I4MK 1WORA 4A93K 1PJ5A 4AH6A 4A3JK 2R92K 1O2AA 1WCMA 1TWAC 3GTOK 4BBRC 3PIPS 3RZDC 2NVYA 3JSTA 3GTMC 3G4AA 1SMYA 1K83C 3K7AK 1IQ0A 3OREA 3PO2K 5JVOA 1ISEA 1Y1VA 1WOOA 2JA6K 4WJ4A 4KB2A 5HL8A 2D6FC 1JOEA 1JQWA 3S2HC 1F7UA 4C3JC 3S17C 5C4XK 3S0XA 3S15K 5IP7C 2JA8C 1TWGC 2Y0SD 4XLPA 2JA5A 2WAQD 4C3IK 2Y0SL 4BLAA 2E2IC 1V5VA 2WAQL 2RGRA 4A3GK 1IBAA 5IOQA 2L5NA 1TWGA 3AQPA 1BGWA 1XZQA 3Q3QA 4A3BK 1TWFA 4LJZA 4QIWD 1J6XA 4O2DA 4QIWL 1B4AA 3WODA 4BXXK 4FZBA 1DD5A 3S1RC 2ZFZA 4WCES 1VRQC 1XZQB 3S1MK 1PJ7A 1Y1WC 3A8JA 1TWCA 3GTGC 3S14C 3GTKC 5HQHA 3GTLA 5TJ3A 1SFOA 1I3QK 4OIPA 5CHPA 3OEPA 5D4DA 4KATA 4A3MC 3GTPC 3S1QC 3OPFA 5JVHS 2NVQK 3S14K 3HOXC 4BY7C 4G7ZA 4IOAS 3GTKK 2R93A 4KDDA 3AQOA 4WF9S 3MMLB 1XXAA 4LLGA 1WSRA 3GSIA 3TTGA 4A3IK 3T02A 2O5IA 2PHCB 1KQ4A 4GTLA 4A3KC 2GAGC 2V6TA 1L0WA 4GT9A 2VUMK 3H0GA 4C3HK 3HOZC 3GTJC 2YU9C 5IYDC 4Y52K 4U67S 3AD7C 5C44K 2JA7K 2P5MA 2PA8D 2XCQA 4Y7NC 4GTDA 4MQ9A 2PA8L 4QJVA 2NVTK 3L4JA 3N0BA 4YFNA 3GTQC 3NUHA 2B63A 2RH6A 1XXCA 4KASA 1R9TC 4LQYA 4C2MK 5FLMK 4A3LK 4GTCA 5JVGS 4A3EC 3RZOK 4QJVB 4KMHA 3FOFA 1WCMC 1ZQ1C 1ZVUA 3AH5A 3S1NC 1C0AA 2R7ZA 5C4JC 4KN7A 4NOIA 5M3FK 1YNJA 2NVYC 1EH1A 3BUEA 1FEUA 3PIOS 4IO9S 3PO3C 3S2DK 4A3FK
chains in the Genus database with same CATH topology
1TWGC 5IYCK 2B63C 2Y0SD 4XLNA 4XLPA 5C3EK 2WAQD 4MEXA 4C3IK 2E2HK 2Y0SL 1YNNA 2NVQC 2E2IC 2WAQL 4A3GK 3HOWK 1Y1VC 5IP9K 1TWHK 1I50K 3HOZK 3M4OK 4OINA 2R7ZC 3GTJK 3HOUC 2YU9K 2R93K 5IYDK 4BBSC 4YFKA 1I6HC 4A3BK 5M5YK 1TWAK 4LJZA 4QIWD 4BBRK 4A3IC 3RZDK 4QIWL 4G7OA 3WODA 4BXXK 4Y7NK 4A3CK 4Q5SA 3GTMK 3HOYC 4A3DC 3S1RC 2JA5C 3EQLA 5IYBC 2VUMC 5FJ8K 3GTQK 1K83K 3FKIC 4C3HC 3H0GK 3S1MK 2O5JA 3I4MC 1R9TK 4A93C 3HKZD 4A3KK 1Y1WC 4A3JC 2R92C 4Y52C 3HKZL 4A3EK 5C44C 3GTGC 3S14C 2JA7C 3GTOC 1WCMK 3S1NK 1TWFC 4LK1A 4G7HA 3GTKC 4X6AC 4Q4ZA 5C4JK 3HOVC 4A3DK 3S2HK 2A6HA 2NVYK 1I3QK 1ZYRA 2NVTC 2CW0A 4XSXA 4OIPA 4YFXA 4C3JK 4KN4A 3S17K 5D4DA 3PO3K 4XSZA 1IW7A 2A68A 4A3MC 4ZH4A 3GTPC 3K7AC 3S1QC 4OIQA 5IP7K 2JA8K 1TWGK 2B63K 1BDFA 4GZYA 4OIOA 4C2MC 2PPBA 4BY1C 3PO2C 2PMZD 2E2JC 2NVQK 3S16C 5FLMC 3H3VD 2JA6C 4A3LC 3HOXC 3RZOC 4OIRA 2E2IK 1TWCC 4G7ZA 4BY7C 1Y1VK 2PMZL 3H3VL 3GTKK 2A69A 4KMUA 2R7ZK 3GTLC 3HOUK 3CQZC 1SFOC 4BBSK 4JK1A 1I6HK 4LLGA 5M5WK 5C4XC 4A3IK 3S15C 3S2DC 2O5IA 4A3FC 3M3YC 4A3KC 5IYCC 3HOYK 5C3EC 4C3IC 3S1RK 2BE5A 2JA5K 4A3GC 4MEYA 5IYBK 2VUMK 5TMFA 3HOWC 3FKIK 4C3HK 5IP9C 1TWHC 1I50C 3I4MK 3HOZC 3I4NC 3CQZK 3M4OC 4A93K 2R93C 3DXJA 3GTJC 2YU9C 5M3MK 1Y1WK 5IYDC 4A3JK 2R92K 4Y52K 4A3BC 2NVXC 5C44K 3GTGK 1TWAC 2JA7K 3GTOK 4BBRC 1TWFK 4X6AK 2PA8D 3RZDC 3HOVK 4BXXC 4Y7NC 4A3CC 3GTMC 2WB1D 4MQ9A 2PA8L 4QJVA 2NVTK 1SMYA 2WB1L 3S2DK 4A3MK 3GTPK 4YFNA 1K83C 3GTQC 3H0GC 3K7AK 3S1MC 5M5XK 4LK0A 3I4NK 3S1QK 1R9TC 1I6VA 4C2MK 4BY1K 3PO2K 2E2JK 2NVXK 3S16K 5FLMK 2E2HC 2JA6K 4A3EC 3HOXK 3RZOK 2A6EA 4QJVB 1TWCK 4A3LK 1WCMC 4BY7K 3S1NC 3S14K 5C4JC 4KN7A 1HQMA 4NOIA 4AYBD 5M3FK 3GTLK 1XPPA 3S2HC 1YNJA 2NVYC 1I3QC 1SFOK 4AYBL 4YG2A 4C3JC 3S17C 5TMCA 3PO3C 5C4XK 3S15K 5IP7C 4A3FK 3M3YK 2JA8C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TWG C;  5IYC K;  2B63 C;  2Y0S D;  4XLN A;  4XLP A;  5C3E K;  2WAQ D;  4MEX A;  4C3I K;  2E2H K;  2Y0S L;  1YNN A;  2NVQ C;  2E2I C;  2WAQ L;  4A3G K;  3HOW K;  1Y1V C;  5IP9 K;  1TWH K;  1I50 K;  3HOZ K;  3M4O K;  4OIN A;  2R7Z C;  3GTJ K;  3HOU C;  2YU9 K;  2R93 K;  5IYD K;  4BBS C;  4YFK A;  1I6H C;  4A3B K;  5M5Y K;  1TWA K;  4LJZ A;  4QIW D;  4BBR K;  4A3I C;  3RZD K;  4QIW L;  4G7O A;  3WOD A;  4BXX K;  4Y7N K;  4A3C K;  4Q5S A;  3GTM K;  3HOY C;  4A3D C;  3S1R C;  2JA5 C;  3EQL A;  5IYB C;  2VUM C;  5FJ8 K;  3GTQ K;  1K83 K;  3FKI C;  4C3H C;  3H0G K;  3S1M K;  2O5J A;  3I4M C;  1R9T K;  4A93 C;  3HKZ D;  4A3K K;  1Y1W C;  4A3J C;  2R92 C;  4Y52 C;  3HKZ L;  4A3E K;  5C44 C;  3GTG C;  3S14 C;  2JA7 C;  3GTO C;  1WCM K;  3S1N K;  1TWF C;  4LK1 A;  4G7H A;  3GTK C;  4X6A C;  4Q4Z A;  5C4J K;  3HOV C;  4A3D K;  3S2H K;  2A6H A;  2NVY K;  1I3Q K;  1ZYR A;  2NVT C;  2CW0 A;  4XSX A;  4OIP A;  4YFX A;  4C3J K;  4KN4 A;  3S17 K;  5D4D A;  3PO3 K;  4XSZ A;  1IW7 A;  2A68 A;  4A3M C;  4ZH4 A;  3GTP C;  3K7A C;  3S1Q C;  4OIQ A;  5IP7 K;  2JA8 K;  1TWG K;  2B63 K;  1BDF A;  4GZY A;  4OIO A;  4C2M C;  2PPB A;  4BY1 C;  3PO2 C;  2PMZ D;  2E2J C;  2NVQ K;  3S16 C;  5FLM C;  3H3V D;  2JA6 C;  4A3L C;  3HOX C;  3RZO C;  4OIR A;  2E2I K;  1TWC C;  4G7Z A;  4BY7 C;  1Y1V K;  2PMZ L;  3H3V L;  3GTK K;  2A69 A;  4KMU A;  2R7Z K;  3GTL C;  3HOU K;  3CQZ C;  1SFO C;  4BBS K;  4JK1 A;  1I6H K;  4LLG A;  5M5W K;  5C4X C;  4A3I K;  3S15 C;  3S2D C;  2O5I A;  4A3F C;  3M3Y C;  4A3K C;  5IYC C;  3HOY K;  5C3E C;  4C3I C;  3S1R K;  2BE5 A;  2JA5 K;  4A3G C;  4MEY A;  5IYB K;  2VUM K;  5TMF A;  3HOW C;  3FKI K;  4C3H K;  5IP9 C;  1TWH C;  1I50 C;  3I4M K;  3HOZ C;  3I4N C;  3CQZ K;  3M4O C;  4A93 K;  2R93 C;  3DXJ A;  3GTJ C;  2YU9 C;  5M3M K;  1Y1W K;  5IYD C;  4A3J K;  2R92 K;  4Y52 K;  4A3B C;  2NVX C;  5C44 K;  3GTG K;  1TWA C;  2JA7 K;  3GTO K;  4BBR C;  1TWF K;  4X6A K;  2PA8 D;  3RZD C;  3HOV K;  4BXX C;  4Y7N C;  4A3C C;  3GTM C;  2WB1 D;  4MQ9 A;  2PA8 L;  4QJV A;  2NVT K;  1SMY A;  2WB1 L;  3S2D K;  4A3M K;  3GTP K;  4YFN A;  1K83 C;  3GTQ C;  3H0G C;  3K7A K;  3S1M C;  5M5X K;  4LK0 A;  3I4N K;  3S1Q K;  1R9T C;  1I6V A;  4C2M K;  4BY1 K;  3PO2 K;  2E2J K;  2NVX K;  3S16 K;  5FLM K;  2E2H C;  2JA6 K;  4A3E C;  3HOX K;  3RZO K;  2A6E A;  4QJV B;  1TWC K;  4A3L K;  1WCM C;  4BY7 K;  3S1N C;  3S14 K;  5C4J C;  4KN7 A;  1HQM A;  4NOI A;  4AYB D;  5M3F K;  3GTL K;  1XPP A;  3S2H C;  1YNJ A;  2NVY C;  1I3Q C;  1SFO K;  4AYB L;  4YG2 A;  4C3J C;  3S17 C;  5TMC A;  3PO3 C;  5C4X K;  3S15 K;  5IP7 C;  4A3F K;  3M3Y K;  2JA8 C; 
#chains in the Genus database with same CATH topology
 5IYC K;  5C3E K;  1YNN A;  3FKI A;  1Y1V C;  2V6S A;  5IP9 K;  1WIH A;  1TWH K;  1I50 K;  3HOU C;  2R92 A;  1HI9 A;  4BBS C;  4YFK A;  1I6H C;  3GTO A;  1TWA K;  5L46 A;  1EI6 A;  4BBR K;  2XCR B;  4WJ3 M;  3RZD K;  4Q5S A;  3GTM K;  1VJE A;  1WOP A;  1YCL A;  2KPU A;  1G51 A;  2JA5 C;  5FJ8 K;  1K83 K;  3GIR A;  1AB4 A;  4FM9 A;  2JA6 A;  5IOR A;  1UV7 A;  4KM9 A;  3DLL S;  3LAJ A;  1TWF C;  4G7H A;  4X6A C;  4Q4Z A;  3HOV C;  1USM A;  3CQZ A;  3BP3 A;  3S2H K;  1O27 A;  4KAW X;  4C3J K;  3S17 K;  4KN4 A;  1IW7 A;  5IP7 K;  4PAA A;  2JA8 K;  1TWG K;  2GSU A;  4J3N A;  4GZY A;  4BY1 C;  4GTE A;  2PMZ D;  2E2J C;  3LPX A;  3S16 C;  2E2I K;  1TWC C;  2PMZ L;  1JVI A;  2A69 A;  3GTL C;  3T00 A;  1SFO C;  2XCO A;  2NVX A;  4JK1 A;  2FQO A;  5M5W K;  5DM6 S;  1DCP A;  3M3Y C;  1O25 A;  2CFA A;  5HL7 S;  1WQH A;  1WSV A;  4KAR A;  3S1R K;  3CF5 S;  3AD9 C;  3HOW C;  3BP8 C;  3I4N C;  2KWA A;  3M4O C;  2R93 C;  1Y1W K;  4GTA A;  2E2H A;  2CFA B;  3ERE D;  4KMD A;  3GTG K;  1I3Q A;  4A3C C;  2KXY A;  1INN A;  4A3M K;  3GTP K;  1IE0 A;  3S1Q K;  3H0G C;  1EQR A;  3I4N K;  3T01 A;  4LK0 A;  4WFA S;  1EK8 A;  1I6V A;  5DM7 S;  3HOX K;  1BJT A;  4BY7 K;  1PJ6 A;  4AYB D;  3GEE A;  1EFW A;  1WQG A;  4AYB L;  3LAP A;  4M1X A;  5TMC A;  2EBB A;  5CJ9 A;  3G4C A;  3TFI A;  4A3K K;  2B63 C;  4XLN A;  3GEH A;  3SZZ A;  2VUM A;  4RMF A;  4KB4 A;  4KMA A;  1B4B A;  3N3Y A;  3HOZ K;  2R7Z C;  5IOS A;  3GTJ K;  2YU9 K;  1DCO A;  5IYD K;  4C45 A;  4P5B A;  1J6V A;  2JA7 A;  2ZJP S;  3HXA A;  4G7O A;  4Y7N K;  3HOY C;  2P8T A;  3TFH A;  3EQL A;  5IYB C;  3GTQ K;  3FKI C;  1IL2 A;  4IOC S;  3I4M C;  1R9T K;  4A93 C;  3A8K A;  3HKZ D;  3CAG A;  4P9S A;  1O26 A;  4A3J C;  2R92 C;  3HKZ L;  4A3E K;  1WOS A;  1WCM K;  3GTO C;  3S1N K;  4G0W A;  4LK1 A;  5C4J K;  2A6H A;  2NVY K;  5E68 A;  1ZYR A;  2V6U A;  4XSX A;  4YFX A;  2Y3P A;  3AD8 C;  3PO3 K;  4XSZ A;  2A68 A;  3K7A C;  4OIQ A;  1BDF A;  1J6W A;  2PPB A;  2KQ1 A;  3PO2 C;  2JA6 C;  1TWH A;  1Y1V K;  1I50 A;  1VGX A;  1RU0 A;  4KMU A;  3HOU K;  1ZXO A;  3CQZ C;  4BBS K;  1I6H K;  1TWA A;  5C4X C;  3S15 C;  3QX3 A;  3GTM A;  4WFN S;  2ZJQ S;  1BS2 A;  1O2B A;  4C3I C;  2JA5 K;  1K83 A;  4A3G C;  5TMF A;  1F7V A;  1XZP A;  3CQZ K;  4GTF A;  4G0U A;  3DXJ A;  5M3M K;  2ZUE A;  4A3B C;  2NVX C;  3IPJ A;  1TWF K;  4X6A K;  3HOV K;  4BXX C;  3N0C A;  5IOT A;  2WB1 D;  1XZP B;  3VA7 A;  2JH3 A;  2WB1 L;  1VLO A;  5M5X K;  3S1M C;  4DDQ A;  4BY1 K;  2W7V A;  2E2I A;  2E2J K;  2NVX K;  3S16 K;  2E2H C;  1IS1 A;  2A6E A;  1TWC K;  5EGE A;  1HQM A;  1O28 A;  1XPP A;  3FOE A;  3GTL K;  1I3Q C;  1O2F B;  1SFO K;  4G0V A;  4YG2 A;  3LYW A;  3M3Y K;  1XXB A;  2ZJR S;  4MEX A;  2E2H K;  2NVQ C;  3L4K A;  3HOW K;  4LOW A;  1Y1W A;  3M4O K;  4OIN A;  2R93 K;  4BLB A;  2GAH C;  4KM8 A;  3GTG A;  5M5Y K;  1WQF A;  3GTK A;  4XCH A;  4A3I C;  4ILD A;  4A3C K;  4A3D C;  5JFE A;  1GE9 A;  3GTP A;  2VUM C;  4WFB S;  3V4G A;  3H0G K;  4C3H C;  2O5J A;  3FHZ A;  4GTB A;  2L3U A;  4Y52 C;  1YX2 A;  4BKW A;  5C44 C;  3SZY A;  2JA7 C;  1O24 A;  4WIL A;  4KC6 A;  2FQT A;  3GDZ A;  4A3D K;  2ZUF A;  2NVT C;  2CW0 A;  3ADA C;  4ZH4 A;  2B63 K;  1J98 A;  4OIO A;  4C2M C;  4P5A A;  4LR2 A;  5FLM C;  3H3V D;  4A3L C;  3RZO C;  4OIR A;  3GEI A;  1F9N A;  3H3V L;  1USO A;  3GTJ A;  2YU9 A;  4GFQ A;  2R7Z K;  4PAB A;  1O29 A;  1DCH A;  1X31 C;  3S2D C;  4A3F C;  3TFJ A;  2GSN A;  1VH2 A;  5EGH A;  5IYC C;  3A8I A;  3HOY K;  1ZBS A;  5C3E C;  2BE5 A;  3GTQ A;  1F93 A;  4MEY A;  5IYB K;  3FKI K;  5IP9 C;  1R9T A;  1TWH C;  1I50 C;  2GSO A;  3I4M K;  1WOR A;  4A93 K;  1PJ5 A;  4AH6 A;  4A3J K;  2R92 K;  1O2A A;  1WCM A;  1TWA C;  3GTO K;  4BBR C;  3PIP S;  3RZD C;  2NVY A;  3JST A;  3GTM C;  3G4A A;  1SMY A;  1K83 C;  3K7A K;  1IQ0 A;  3ORE A;  3PO2 K;  5JVO A;  1ISE A;  1Y1V A;  1WOO A;  2JA6 K;  4WJ4 A;  4KB2 A;  5HL8 A;  2D6F C;  1JOE A;  1JQW A;  3S2H C;  1F7U A;  4C3J C;  3S17 C;  5C4X K;  3S0X A;  3S15 K;  5IP7 C;  2JA8 C;  1TWG C;  2Y0S D;  4XLP A;  2JA5 A;  2WAQ D;  4C3I K;  2Y0S L;  4BLA A;  2E2I C;  1V5V A;  2WAQ L;  2RGR A;  4A3G K;  1IBA A;  5IOQ A;  2L5N A;  1TWG A;  3AQP A;  1BGW A;  1XZQ A;  3Q3Q A;  4A3B K;  1TWF A;  4LJZ A;  4QIW D;  1J6X A;  4O2D A;  4QIW L;  1B4A A;  3WOD A;  4BXX K;  4FZB A;  1DD5 A;  3S1R C;  2ZFZ A;  4WCE S;  1VRQ C;  1XZQ B;  3S1M K;  1PJ7 A;  1Y1W C;  3A8J A;  1TWC A;  3GTG C;  3S14 C;  3GTK C;  5HQH A;  3GTL A;  5TJ3 A;  1SFO A;  1I3Q K;  4OIP A;  5CHP A;  3OEP A;  5D4D A;  4KAT A;  4A3M C;  3GTP C;  3S1Q C;  3OPF A;  5JVH S;  2NVQ K;  3S14 K;  3HOX C;  4BY7 C;  4G7Z A;  4IOA S;  3GTK K;  2R93 A;  4KDD A;  3AQO A;  4WF9 S;  3MML B;  1XXA A;  4LLG A;  1WSR A;  3GSI A;  3TTG A;  4A3I K;  3T02 A;  2O5I A;  2PHC B;  1KQ4 A;  4GTL A;  4A3K C;  2GAG C;  2V6T A;  1L0W A;  4GT9 A;  2VUM K;  3H0G A;  4C3H K;  3HOZ C;  3GTJ C;  2YU9 C;  5IYD C;  4Y52 K;  4U67 S;  3AD7 C;  5C44 K;  2JA7 K;  2P5M A;  2PA8 D;  2XCQ A;  4Y7N C;  4GTD A;  4MQ9 A;  2PA8 L;  4QJV A;  2NVT K;  3L4J A;  3N0B A;  4YFN A;  3GTQ C;  3NUH A;  2B63 A;  2RH6 A;  1XXC A;  4KAS A;  1R9T C;  4LQY A;  4C2M K;  5FLM K;  4A3L K;  4GTC A;  5JVG S;  4A3E C;  3RZO K;  4QJV B;  4KMH A;  3FOF A;  1WCM C;  1ZQ1 C;  1ZVU A;  3AH5 A;  3S1N C;  1C0A A;  2R7Z A;  5C4J C;  4KN7 A;  4NOI A;  5M3F K;  1YNJ A;  2NVY C;  1EH1 A;  3BUE A;  1FEU A;  3PIO S;  4IO9 S;  3PO3 C;  3S2D K;  4A3F K; 
#chains in the Genus database with same CATH homology
 1TWG C;  5IYC K;  2B63 C;  2Y0S D;  4XLN A;  4XLP A;  5C3E K;  2WAQ D;  4MEX A;  4C3I K;  2E2H K;  2Y0S L;  1YNN A;  2NVQ C;  2E2I C;  2WAQ L;  4A3G K;  3HOW K;  1Y1V C;  5IP9 K;  1TWH K;  1I50 K;  3HOZ K;  3M4O K;  4OIN A;  2R7Z C;  3GTJ K;  3HOU C;  2YU9 K;  2R93 K;  5IYD K;  4BBS C;  4YFK A;  1I6H C;  4A3B K;  5M5Y K;  1TWA K;  4LJZ A;  4QIW D;  4BBR K;  4A3I C;  3RZD K;  4QIW L;  4G7O A;  3WOD A;  4BXX K;  4Y7N K;  4A3C K;  4Q5S A;  3GTM K;  3HOY C;  4A3D C;  3S1R C;  2JA5 C;  3EQL A;  5IYB C;  2VUM C;  5FJ8 K;  3GTQ K;  1K83 K;  3FKI C;  4C3H C;  3H0G K;  3S1M K;  2O5J A;  3I4M C;  1R9T K;  4A93 C;  3HKZ D;  4A3K K;  1Y1W C;  4A3J C;  2R92 C;  4Y52 C;  3HKZ L;  4A3E K;  5C44 C;  3GTG C;  3S14 C;  2JA7 C;  3GTO C;  1WCM K;  3S1N K;  1TWF C;  4LK1 A;  4G7H A;  3GTK C;  4X6A C;  4Q4Z A;  5C4J K;  3HOV C;  4A3D K;  3S2H K;  2A6H A;  2NVY K;  1I3Q K;  1ZYR A;  2NVT C;  2CW0 A;  4XSX A;  4OIP A;  4YFX A;  4C3J K;  4KN4 A;  3S17 K;  5D4D A;  3PO3 K;  4XSZ A;  1IW7 A;  2A68 A;  4A3M C;  4ZH4 A;  3GTP C;  3K7A C;  3S1Q C;  4OIQ A;  5IP7 K;  2JA8 K;  1TWG K;  2B63 K;  1BDF A;  4GZY A;  4OIO A;  4C2M C;  2PPB A;  4BY1 C;  3PO2 C;  2PMZ D;  2E2J C;  2NVQ K;  3S16 C;  5FLM C;  3H3V D;  2JA6 C;  4A3L C;  3HOX C;  3RZO C;  4OIR A;  2E2I K;  1TWC C;  4G7Z A;  4BY7 C;  1Y1V K;  2PMZ L;  3H3V L;  3GTK K;  2A69 A;  4KMU A;  2R7Z K;  3GTL C;  3HOU K;  3CQZ C;  1SFO C;  4BBS K;  4JK1 A;  1I6H K;  4LLG A;  5M5W K;  5C4X C;  4A3I K;  3S15 C;  3S2D C;  2O5I A;  4A3F C;  3M3Y C;  4A3K C;  5IYC C;  3HOY K;  5C3E C;  4C3I C;  3S1R K;  2BE5 A;  2JA5 K;  4A3G C;  4MEY A;  5IYB K;  2VUM K;  5TMF A;  3HOW C;  3FKI K;  4C3H K;  5IP9 C;  1TWH C;  1I50 C;  3I4M K;  3HOZ C;  3I4N C;  3CQZ K;  3M4O C;  4A93 K;  2R93 C;  3DXJ A;  3GTJ C;  2YU9 C;  5M3M K;  1Y1W K;  5IYD C;  4A3J K;  2R92 K;  4Y52 K;  4A3B C;  2NVX C;  5C44 K;  3GTG K;  1TWA C;  2JA7 K;  3GTO K;  4BBR C;  1TWF K;  4X6A K;  2PA8 D;  3RZD C;  3HOV K;  4BXX C;  4Y7N C;  4A3C C;  3GTM C;  2WB1 D;  4MQ9 A;  2PA8 L;  4QJV A;  2NVT K;  1SMY A;  2WB1 L;  3S2D K;  4A3M K;  3GTP K;  4YFN A;  1K83 C;  3GTQ C;  3H0G C;  3K7A K;  3S1M C;  5M5X K;  4LK0 A;  3I4N K;  3S1Q K;  1R9T C;  1I6V A;  4C2M K;  4BY1 K;  3PO2 K;  2E2J K;  2NVX K;  3S16 K;  5FLM K;  2E2H C;  2JA6 K;  4A3E C;  3HOX K;  3RZO K;  2A6E A;  4QJV B;  1TWC K;  4A3L K;  1WCM C;  4BY7 K;  3S1N C;  3S14 K;  5C4J C;  4KN7 A;  1HQM A;  4NOI A;  4AYB D;  5M3F K;  3GTL K;  1XPP A;  3S2H C;  1YNJ A;  2NVY C;  1I3Q C;  1SFO K;  4AYB L;  4YG2 A;  4C3J C;  3S17 C;  5TMC A;  3PO3 C;  5C4X K;  3S15 K;  5IP7 C;  4A3F K;  3M3Y K;  2JA8 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...