4G7HA

Crystal structure of thermus thermophilus transcription initiation complex
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
226
structure length
226
Chain Sequence
SKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase subunit alpha
publication title Structural basis of transcription initiation.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Transcription, transferase/dna
total genus 48
structure length 226
sequence length 226
chains with identical sequence B, K, L
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2012-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01000 RNA_pol_A_bac RNA polymerase Rpb3/RpoA insert domain
A PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain
A PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.12 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 DNA-directed RNA polymerase, insert domain 4g7hA02
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 4g7hA01
4GZYA 3K7AK 3S2DC 3S2DK 3H3VD 2CW0A 5C4JC 4A3LC 5C4JK 4A3LK 3GTOC 3RZDC 2PPBA 3GTOK 1WCMK 3RZDK 4YFXA 4A3CC 2JA8C 2VUMC 3EQLA 4OIRA 2JA8K 2R92C 4YG2A 2VUMK 2R7ZC 2R92K 4Y52C 4Y52K 4A3KC 3HOVC 2A69A 5M3FK 4A3KK 3HOVK 3HKZL 4BBSK 1TWFC 3GTMC 4BBRC 3S2HC 2WAQL 4BBRK 3S2HK 4G7ZA 4LK0A 5C4XK 5FLMC 1IW7A 1I50C 2PA8D 5IP9C 3GTKC 4BXXC 3HOYC 1I50K 2A68A 1Y1WK 3HOYK 3PO2K 4BXXK 2PMZL 4AYBD 4QIWD 4QJVA 3K7AC 4X6AK 1R9TC 1TWAC 5C44C 1R9TK 1TWAK 4OIOA 5C44K 4Q4ZA 5TMFA 1WCMC 4A93C 4A3IK 3PO3K 5FJ8K 4A93K 5M5YK 4MQ9A 4G7HA 2JA7C 3GTGC 2JA7K 3GTGK 5M5WK 4OIPA 4LK1A 1TWGK 1Y1VC 1Y1VK 4BBSC 5D4DA 2O5IA 4QJVB 2WB1L 4Y7NC 3HOXC 4Y7NK 4A3JC 4C3JC 4KMUA 3HOXK 2NVTC 4C3JK 4A3JK 5C4XC 2NVTK 4YFKA 4MEXA 3H0GK 3HKZD 3GTPC 3PO2C 2O5JA 2WAQD 4XSXA 4BY1C 2NVXK 3GTJC 3GTPK 2BE5A 3S1RK 3GTJK 2JA5K 4BY1K 3S15C 3S15K 4A3BK 2PMZD 3S14K 1ZYRA 3S16C 2Y0SL 3S16K 1YNJA 3DXJA 4A3IC 3PO3C 2E2IC 2E2IK 3RZOC 3RZOK 2B63C 3HOUC 2B63K 3HOUK 1TWGC 1YNNA 2YU9C 3S17C 1SFOC 5C3EC 2YU9K 3S17K 1SFOK 5C3EK 4YFNA 5IYDC 1HQMA 2A6EA 4A3EC 2E2JC 4A3GK 4LJZA 4A3EK 2E2JK 5IYDK 5TMCA 5IYBC 4C2MK 3H0GC 5IYBK 3H3VL 2NVYC 1Y1WC 3M3YK 2NVYK 2WB1D 4A3BC 3S1MC 1TWCC 4C3HC 2NVXC 3FKIK 3S1RC 1TWCK 2JA5C 4C3HK 4MEYA 4A3MK 3HOZC 4C3IC 3S1MK 3CQZC 1I3QC 4C3IK 1I6HC 4ZH4A 1I3QK 3CQZK 3HOZK 3S1QC 1I6HK 3S1QK 5IYCC 1XPPA 3S14C 5IYCK 2A6HA 4JK1A 2NVQC 4G7OA 3I4MC 2NVQK 4A3CK 3GTLC 3I4MK 2JA6C 3M3YC 3GTLK 3GTQC 4KN4A 3I4NC 4OIQA 4X6AC 5M3MK 1TWHC 2JA6K 3GTQK 3I4NK 5IP7C 1BDFA 2E2HC 4BY7C 1TWHK 5IP7K 2E2HK 1SMYA 2R7ZK 4XSZA 4BY7K 2PA8L 2Y0SD 3S1NC 2R93C 2R93K 1I6VA 1TWFK 3S1NK 3GTMK 4KN7A 4AYBL 4NOIA 4XLPA 4A3FC 3M4OC 4A3FK 4QIWL 5FLMK 4A3DC 4XLNA 3GTKK 5IP9K 3M4OK 4Q5SA 3HOWC 4A3GC 4A3DK 3HOWK 1K83C 4C2MC 1K83K 4LLGA 4OINA 3WODA 3FKIC 5M5XK 4A3MC
chains in the Genus database with same CATH superfamily
5DM7S 4LOWA 1USOA 1B4BA 1R9TA 1WCMK 3BUEA 1XZQA 3GTOA 4A3CC 3EQLA 1XZPA 3S0XA 3LAPA 1EK8A 3L4KA 5IOSA 3HOVC 3HOVK 1TWFC 3CAGA 4KDDA 2KQ1A 4LK0A 1I50C 3GTKC 1I50K 4BXXC 1GE9A 3DLLS 4BXXK 4WFNS 3JSTA 4GTLA 4QIWD 3K7AC 1TWAC 5L46A 1O27A 1TWAK 3TFHA 2RH6A 3PO3K 5IOTA 4MQ9A 4P9SA 2E2IA 4G7HA 1EQRA 2JH3A 5M5WK 4OIPA 3AD9C 4WFAS 1PJ5A 1X31C 4QJVB 2O5IA 1SFOA 4A3JC 4KMUA 4A3JK 2NVTC 5C4XC 2GSNA 2NVTK 4MEXA 4WJ3M 3IPJA 2O5JA 5HL8A 3H0GA 2WAQD 4XSXA 2NVXK 3GTJC 1ZXOA 3GTJK 2JA5K 4AH6A 2FQTA 3CQZA 3S14K 1O28A 1ZYRA 1YX2A 2Y0SL 4KMHA 3RZOC 3RZOK 1KQ4A 1UV7A 3TFIA 4BLBA 3S17C 3AQPA 5C3EC 3S17K 5C3EK 4YFNA 4LJZA 3FKIK 1TWCC 4C3HC 4WJ4A 3AH5A 1TWCK 4C3HK 1IQ0A 4ZH4A 3S1QC 3S1QK 5IYCC 1VGXA 3L4JA 4PABA 5IYCK 1BGWA 2NVQC 2NVQK 2JA6C 1HI9A 2JA6K 4OIQA 1TWHC 4GTFA 1TWHK 1BDFA 4BY7C 4BY7K 1SMYA 4LQYA 4WILA 4KASA 1I6VA 3GTMK 4KN7A 2R93A 1TWFA 3GEHA 1XXCA 4GTAA 5FLMK 5IP9K 3G4CA 1I50A 3GTKA 1K83C 5JFEA 1K83K 4KB4A 4FM9A 5JVGS 3H3VD 3V4GA 2ZUEA 2CW0A 1FEUA 1TWAA 4DDQA 4YFXA 3TTGA 1INNA 4KC6A 1IL2A 2R7ZC 4Y52C 1USMA 2VUMA 4Y52K 1XXAA 5M3FK 3HKZL 4BBRC 2ZJQS 4GTBA 4BBRK 1IW7A 2PA8D 5IOQA 3A8JA 3PO2K 3LYWA 3VA7A 3GSIA 2V6SA 4GFQA 3GIRA 3A8KA 1DCPA 2W7VA 1WCMC 3QX3A 5FJ8K 5E68A 3GTGC 3BP8C 3GTGK 1TWGK 2ZUFA 1Y1VC 1Y1VK 2P8TA 4WCES 1V5VA 2PHCB 3HOXC 3HOXK 4C45A 3GTPC 3GTPK 3S1RK 5EGEA 1DCOA 1VH2A 3T01A 3T00A 4GTDA 1EI6A 1J98A 2L3UA 3DXJA 3PO3C 2JA6A 2RGRA 1TWHA 4KATA 1YNNA 2CFAA 1WOSA 3TFJA 5IYDC 1HQMA 5DM6S 3N0CA 5IYDK 5IYBC 5IYBK 2NVYC 1K83A 2NVYK 2NVXC 5HL7S 2JA5C 4A3MK 1O29A 3S14C 1O2FB 3I4MC 3I4MK 3GTQC 3GTQK 1J6XA 4BLAA 2R7ZA 1WIHA 2Y0SD 1G51A 1RU0A 1O24A 3NUHA 1ZBSA 1DD5A 4GTEA 1AB4A 4AYBL 4NOIA 4A3FC 4A3FK 1C0AA 5EGHA 5CJ9A 4LLGA 3FKIC 1PJ6A 3S2DC 1JQWA 3S2DK 3GTOC 3FOFA 3RZDC 2PPBA 1BS2A 3GTOK 3RZDK 1WCMA 3LPXA 4OIRA 3GTGA 1O2AA 5IORA 4A3KC 4LR2A 4A3KK 1Y1VA 3FHZA 4BBSK 3GTMC 3S2HC 4IOCS 3S2HK 4G7ZA 5FLMC 4GTCA 5IP9C 2KWAA 3HOYC 4ILDA 3HOYK 1XZQB 2PMZL 4KARA 4WF9S 4KMAA 1XZPB 4QJVA 5C44C 5C44K 3HXAA 3OEPA 2XCOA 4J3NA 1B4AA 4A3IK 5M5YK 2ZFZA 5JVOA 2JA7C 2JA7K 4P5BA 2ZJPS 2WB1L 4C3JC 4C3JK 4YFKA 1O2BA 3H0GK 3HKZD 4XCHA 3PO2C 3PIPS 2NVYA 2NVXA 4IO9S 3GTJA 2JA5A 3ERED 1WOPA 1JOEA 3S16C 3SZYA 3S16K 1WSVA 3GTQA 4IOAS 4G0UA 2B63C 2B63K 1TWGC 2YU9C 2ZJRS 1F93A 2YU9K 1ZQ1C 4A3EC 2E2JC 1JVIA 4A3GK 4A3EK 2E2JK 5TMCA 4C2MK 1Y1WC 1Y1WK 3S1MC 2XCQA 3S1MK 5JVHS 3S1RC 3FKIA 3HOZC 4C3IC 1TWCA 4WFBS 1J6VA 1I3QC 1O26A 3ADAC 3AQOA 1I3QK 4C3IK 4G0VA 3HOZK 1WSRA 3LAJA 2A6HA 4JK1A 4G7OA 3GTLC 3M3YC 1F7VA 3GTLK 4A3CK 4KN4A 3M3YK 1IE0A 5M3MK 5IP7C 2E2HC 5IP7K 2E2HK 2GSUA 2R93C 3S1NC 2GAGC 2R93K 1TWFK 3S1NK 4KAWX 1F7UA 3GTMA 4QIWL 4A3DC 3GTKK 4A3DK 3HOWC 2EBBA 3HOWK 1PJ7A 5HQHA 4KM8A 4OINA 3WODA 1ZVUA 5TJ3A 2Y3PA 4A3MC 4GT9A 4GZYA 3K7AK 2GSOA 1WQFA 1IS1A 5C4JC 4A3LC 5C4JK 4A3LK 2KPUA 2D6FC 1VRQC 2JA8C 2VUMC 2JA8K 2R92C 4YG2A 2VUMK 3N0BA 2R92K 2JA7A 1L0WA 2A69A 3GEEA 1WQHA 2V6UA 3OREA 2WAQL 1BJTA 1VLOA 1EH1A 2V6TA 5C4XK 2A68A 3A8IA 4AYBD 2FQOA 1R9TC 1R9TK 1F9NA 4OIOA 5CHPA 3OPFA 4Q4ZA 5TMFA 4A93C 3BP3A 4RMFA 4A93K 1YCLA 3T02A 1VJEA 2P5MA 4KB2A 4LK1A 2B63A 1TWGA 2YU9A 4BBSC 5D4DA 4BKWA 3G4AA 4Y7NC 4Y7NK 4BY1C 4M1XA 1Y1WA 2BE5A 4BY1K 3GTPA 3S15C 3N3YA 3S15K 3CF5S 1I3QA 3PIOS 2PMZD 3AD7C 3GTLA 1YNJA 4A3IC 2KXYA 1WORA 2E2IC 2E2IK 2L5NA 2E2HA 3HOUC 4KM9A 4U67S 3HOUK 1WOOA 4O2DA 1SFOC 1ISEA 1SFOK 3GDZA 2A6EA 3H3VL 3H0GC 4P5AA 4G0WA 2WB1D 4A3BC 3AD8C 4FZBA 4A3BK 4MEYA 1WQGA 3SZZA 3CQZC 1I6HC 1J6WA 3CQZK 3MMLB 1DCHA 1I6HK 1XXBA 1XPPA 2CFAB 4PAAA 4X6AC 2XCRB 3I4NC 4X6AK 3I4NK 2R7ZK 2R92A 4XSZA 1IBAA 2PA8L 3GEIA 3FOEA 1EFWA 4XLPA 3M4OC 3Q3QA 3M4OK 4XLNA 1O25A 4Q5SA 4A3GC 2GAHC 4C2MC 5M5XK 4KMDA
chains in the Genus database with same CATH topology
4GZYA 3K7AK 3S2DC 3S2DK 3H3VD 2CW0A 5C4JC 4A3LC 5C4JK 4A3LK 3GTOC 3RZDC 2PPBA 3GTOK 1WCMK 3RZDK 4YFXA 4A3CC 2JA8C 2VUMC 3EQLA 4OIRA 2JA8K 2R92C 4YG2A 2VUMK 2R7ZC 2R92K 4Y52C 4Y52K 4A3KC 3HOVC 2A69A 5M3FK 4A3KK 3HOVK 3HKZL 4BBSK 1TWFC 3GTMC 4BBRC 3S2HC 2WAQL 4BBRK 3S2HK 4G7ZA 4LK0A 5C4XK 5FLMC 1IW7A 1I50C 2PA8D 5IP9C 3GTKC 4BXXC 3HOYC 1I50K 2A68A 1Y1WK 3HOYK 3PO2K 4BXXK 2PMZL 4AYBD 4QIWD 4QJVA 3K7AC 4X6AK 1R9TC 1TWAC 5C44C 1R9TK 1TWAK 4OIOA 5C44K 4Q4ZA 5TMFA 1WCMC 4A93C 4A3IK 3PO3K 5FJ8K 4A93K 5M5YK 4MQ9A 4G7HA 2JA7C 3GTGC 2JA7K 3GTGK 5M5WK 4OIPA 4LK1A 1TWGK 1Y1VC 1Y1VK 4BBSC 5D4DA 2O5IA 4QJVB 2WB1L 4Y7NC 3HOXC 4Y7NK 4A3JC 4C3JC 4KMUA 3HOXK 2NVTC 4C3JK 4A3JK 5C4XC 2NVTK 4YFKA 4MEXA 3H0GK 3HKZD 3GTPC 3PO2C 2O5JA 2WAQD 4XSXA 4BY1C 2NVXK 3GTJC 3GTPK 2BE5A 3S1RK 3GTJK 2JA5K 4BY1K 3S15C 3S15K 4A3BK 2PMZD 3S14K 1ZYRA 3S16C 2Y0SL 3S16K 1YNJA 3DXJA 4A3IC 3PO3C 2E2IC 2E2IK 3RZOC 3RZOK 2B63C 3HOUC 2B63K 3HOUK 1TWGC 1YNNA 2YU9C 3S17C 1SFOC 5C3EC 2YU9K 3S17K 1SFOK 5C3EK 4YFNA 5IYDC 1HQMA 2A6EA 4A3EC 2E2JC 4A3GK 4LJZA 4A3EK 2E2JK 5IYDK 5TMCA 5IYBC 4C2MK 3H0GC 5IYBK 3H3VL 2NVYC 1Y1WC 3M3YK 2NVYK 2WB1D 4A3BC 3S1MC 1TWCC 4C3HC 2NVXC 3FKIK 3S1RC 1TWCK 2JA5C 4C3HK 4MEYA 4A3MK 3HOZC 4C3IC 3S1MK 3CQZC 1I3QC 4C3IK 1I6HC 4ZH4A 1I3QK 3CQZK 3HOZK 3S1QC 1I6HK 3S1QK 5IYCC 1XPPA 3S14C 5IYCK 2A6HA 4JK1A 2NVQC 4G7OA 3I4MC 2NVQK 4A3CK 3GTLC 3I4MK 2JA6C 3M3YC 3GTLK 3GTQC 4KN4A 3I4NC 4OIQA 4X6AC 5M3MK 1TWHC 2JA6K 3GTQK 3I4NK 5IP7C 1BDFA 2E2HC 4BY7C 1TWHK 5IP7K 2E2HK 1SMYA 2R7ZK 4XSZA 4BY7K 2PA8L 2Y0SD 3S1NC 2R93C 2R93K 1I6VA 1TWFK 3S1NK 3GTMK 4KN7A 4AYBL 4NOIA 4XLPA 4A3FC 3M4OC 4A3FK 4QIWL 5FLMK 4A3DC 4XLNA 3GTKK 5IP9K 3M4OK 4Q5SA 3HOWC 4A3GC 4A3DK 3HOWK 1K83C 4C2MC 1K83K 4LLGA 4OINA 3WODA 3FKIC 5M5XK 4A3MC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GZY A;  3K7A K;  3S2D C;  3S2D K;  3H3V D;  2CW0 A;  5C4J C;  4A3L C;  5C4J K;  4A3L K;  3GTO C;  3RZD C;  2PPB A;  3GTO K;  1WCM K;  3RZD K;  4YFX A;  4A3C C;  2JA8 C;  2VUM C;  3EQL A;  4OIR A;  2JA8 K;  2R92 C;  4YG2 A;  2VUM K;  2R7Z C;  2R92 K;  4Y52 C;  4Y52 K;  4A3K C;  3HOV C;  2A69 A;  5M3F K;  4A3K K;  3HOV K;  3HKZ L;  4BBS K;  1TWF C;  3GTM C;  4BBR C;  3S2H C;  2WAQ L;  4BBR K;  3S2H K;  4G7Z A;  4LK0 A;  5C4X K;  5FLM C;  1IW7 A;  1I50 C;  2PA8 D;  5IP9 C;  3GTK C;  4BXX C;  3HOY C;  1I50 K;  2A68 A;  1Y1W K;  3HOY K;  3PO2 K;  4BXX K;  2PMZ L;  4AYB D;  4QIW D;  4QJV A;  3K7A C;  4X6A K;  1R9T C;  1TWA C;  5C44 C;  1R9T K;  1TWA K;  4OIO A;  5C44 K;  4Q4Z A;  5TMF A;  1WCM C;  4A93 C;  4A3I K;  3PO3 K;  5FJ8 K;  4A93 K;  5M5Y K;  4MQ9 A;  4G7H A;  2JA7 C;  3GTG C;  2JA7 K;  3GTG K;  5M5W K;  4OIP A;  4LK1 A;  1TWG K;  1Y1V C;  1Y1V K;  4BBS C;  5D4D A;  2O5I A;  4QJV B;  2WB1 L;  4Y7N C;  3HOX C;  4Y7N K;  4A3J C;  4C3J C;  4KMU A;  3HOX K;  2NVT C;  4C3J K;  4A3J K;  5C4X C;  2NVT K;  4YFK A;  4MEX A;  3H0G K;  3HKZ D;  3GTP C;  3PO2 C;  2O5J A;  2WAQ D;  4XSX A;  4BY1 C;  2NVX K;  3GTJ C;  3GTP K;  2BE5 A;  3S1R K;  3GTJ K;  2JA5 K;  4BY1 K;  3S15 C;  3S15 K;  4A3B K;  2PMZ D;  3S14 K;  1ZYR A;  3S16 C;  2Y0S L;  3S16 K;  1YNJ A;  3DXJ A;  4A3I C;  3PO3 C;  2E2I C;  2E2I K;  3RZO C;  3RZO K;  2B63 C;  3HOU C;  2B63 K;  3HOU K;  1TWG C;  1YNN A;  2YU9 C;  3S17 C;  1SFO C;  5C3E C;  2YU9 K;  3S17 K;  1SFO K;  5C3E K;  4YFN A;  5IYD C;  1HQM A;  2A6E A;  4A3E C;  2E2J C;  4A3G K;  4LJZ A;  4A3E K;  2E2J K;  5IYD K;  5TMC A;  5IYB C;  4C2M K;  3H0G C;  5IYB K;  3H3V L;  2NVY C;  1Y1W C;  3M3Y K;  2NVY K;  2WB1 D;  4A3B C;  3S1M C;  1TWC C;  4C3H C;  2NVX C;  3FKI K;  3S1R C;  1TWC K;  2JA5 C;  4C3H K;  4MEY A;  4A3M K;  3HOZ C;  4C3I C;  3S1M K;  3CQZ C;  1I3Q C;  4C3I K;  1I6H C;  4ZH4 A;  1I3Q K;  3CQZ K;  3HOZ K;  3S1Q C;  1I6H K;  3S1Q K;  5IYC C;  1XPP A;  3S14 C;  5IYC K;  2A6H A;  4JK1 A;  2NVQ C;  4G7O A;  3I4M C;  2NVQ K;  4A3C K;  3GTL C;  3I4M K;  2JA6 C;  3M3Y C;  3GTL K;  3GTQ C;  4KN4 A;  3I4N C;  4OIQ A;  4X6A C;  5M3M K;  1TWH C;  2JA6 K;  3GTQ K;  3I4N K;  5IP7 C;  1BDF A;  2E2H C;  4BY7 C;  1TWH K;  5IP7 K;  2E2H K;  1SMY A;  2R7Z K;  4XSZ A;  4BY7 K;  2PA8 L;  2Y0S D;  3S1N C;  2R93 C;  2R93 K;  1I6V A;  1TWF K;  3S1N K;  3GTM K;  4KN7 A;  4AYB L;  4NOI A;  4XLP A;  4A3F C;  3M4O C;  4A3F K;  4QIW L;  5FLM K;  4A3D C;  4XLN A;  3GTK K;  5IP9 K;  3M4O K;  4Q5S A;  3HOW C;  4A3G C;  4A3D K;  3HOW K;  1K83 C;  4C2M C;  1K83 K;  4LLG A;  4OIN A;  3WOD A;  3FKI C;  5M5X K;  4A3M C; 
#chains in the Genus database with same CATH topology
 5DM7 S;  4LOW A;  1USO A;  1B4B A;  1R9T A;  1WCM K;  3BUE A;  1XZQ A;  3GTO A;  4A3C C;  3EQL A;  1XZP A;  3S0X A;  3LAP A;  1EK8 A;  3L4K A;  5IOS A;  3HOV C;  3HOV K;  1TWF C;  3CAG A;  4KDD A;  2KQ1 A;  4LK0 A;  1I50 C;  3GTK C;  1I50 K;  4BXX C;  1GE9 A;  3DLL S;  4BXX K;  4WFN S;  3JST A;  4GTL A;  4QIW D;  3K7A C;  1TWA C;  5L46 A;  1O27 A;  1TWA K;  3TFH A;  2RH6 A;  3PO3 K;  5IOT A;  4MQ9 A;  4P9S A;  2E2I A;  4G7H A;  1EQR A;  2JH3 A;  5M5W K;  4OIP A;  3AD9 C;  4WFA S;  1PJ5 A;  1X31 C;  4QJV B;  2O5I A;  1SFO A;  4A3J C;  4KMU A;  4A3J K;  2NVT C;  5C4X C;  2GSN A;  2NVT K;  4MEX A;  4WJ3 M;  3IPJ A;  2O5J A;  5HL8 A;  3H0G A;  2WAQ D;  4XSX A;  2NVX K;  3GTJ C;  1ZXO A;  3GTJ K;  2JA5 K;  4AH6 A;  2FQT A;  3CQZ A;  3S14 K;  1O28 A;  1ZYR A;  1YX2 A;  2Y0S L;  4KMH A;  3RZO C;  3RZO K;  1KQ4 A;  1UV7 A;  3TFI A;  4BLB A;  3S17 C;  3AQP A;  5C3E C;  3S17 K;  5C3E K;  4YFN A;  4LJZ A;  3FKI K;  1TWC C;  4C3H C;  4WJ4 A;  3AH5 A;  1TWC K;  4C3H K;  1IQ0 A;  4ZH4 A;  3S1Q C;  3S1Q K;  5IYC C;  1VGX A;  3L4J A;  4PAB A;  5IYC K;  1BGW A;  2NVQ C;  2NVQ K;  2JA6 C;  1HI9 A;  2JA6 K;  4OIQ A;  1TWH C;  4GTF A;  1TWH K;  1BDF A;  4BY7 C;  4BY7 K;  1SMY A;  4LQY A;  4WIL A;  4KAS A;  1I6V A;  3GTM K;  4KN7 A;  2R93 A;  1TWF A;  3GEH A;  1XXC A;  4GTA A;  5FLM K;  5IP9 K;  3G4C A;  1I50 A;  3GTK A;  1K83 C;  5JFE A;  1K83 K;  4KB4 A;  4FM9 A;  5JVG S;  3H3V D;  3V4G A;  2ZUE A;  2CW0 A;  1FEU A;  1TWA A;  4DDQ A;  4YFX A;  3TTG A;  1INN A;  4KC6 A;  1IL2 A;  2R7Z C;  4Y52 C;  1USM A;  2VUM A;  4Y52 K;  1XXA A;  5M3F K;  3HKZ L;  4BBR C;  2ZJQ S;  4GTB A;  4BBR K;  1IW7 A;  2PA8 D;  5IOQ A;  3A8J A;  3PO2 K;  3LYW A;  3VA7 A;  3GSI A;  2V6S A;  4GFQ A;  3GIR A;  3A8K A;  1DCP A;  2W7V A;  1WCM C;  3QX3 A;  5FJ8 K;  5E68 A;  3GTG C;  3BP8 C;  3GTG K;  1TWG K;  2ZUF A;  1Y1V C;  1Y1V K;  2P8T A;  4WCE S;  1V5V A;  2PHC B;  3HOX C;  3HOX K;  4C45 A;  3GTP C;  3GTP K;  3S1R K;  5EGE A;  1DCO A;  1VH2 A;  3T01 A;  3T00 A;  4GTD A;  1EI6 A;  1J98 A;  2L3U A;  3DXJ A;  3PO3 C;  2JA6 A;  2RGR A;  1TWH A;  4KAT A;  1YNN A;  2CFA A;  1WOS A;  3TFJ A;  5IYD C;  1HQM A;  5DM6 S;  3N0C A;  5IYD K;  5IYB C;  5IYB K;  2NVY C;  1K83 A;  2NVY K;  2NVX C;  5HL7 S;  2JA5 C;  4A3M K;  1O29 A;  3S14 C;  1O2F B;  3I4M C;  3I4M K;  3GTQ C;  3GTQ K;  1J6X A;  4BLA A;  2R7Z A;  1WIH A;  2Y0S D;  1G51 A;  1RU0 A;  1O24 A;  3NUH A;  1ZBS A;  1DD5 A;  4GTE A;  1AB4 A;  4AYB L;  4NOI A;  4A3F C;  4A3F K;  1C0A A;  5EGH A;  5CJ9 A;  4LLG A;  3FKI C;  1PJ6 A;  3S2D C;  1JQW A;  3S2D K;  3GTO C;  3FOF A;  3RZD C;  2PPB A;  1BS2 A;  3GTO K;  3RZD K;  1WCM A;  3LPX A;  4OIR A;  3GTG A;  1O2A A;  5IOR A;  4A3K C;  4LR2 A;  4A3K K;  1Y1V A;  3FHZ A;  4BBS K;  3GTM C;  3S2H C;  4IOC S;  3S2H K;  4G7Z A;  5FLM C;  4GTC A;  5IP9 C;  2KWA A;  3HOY C;  4ILD A;  3HOY K;  1XZQ B;  2PMZ L;  4KAR A;  4WF9 S;  4KMA A;  1XZP B;  4QJV A;  5C44 C;  5C44 K;  3HXA A;  3OEP A;  2XCO A;  4J3N A;  1B4A A;  4A3I K;  5M5Y K;  2ZFZ A;  5JVO A;  2JA7 C;  2JA7 K;  4P5B A;  2ZJP S;  2WB1 L;  4C3J C;  4C3J K;  4YFK A;  1O2B A;  3H0G K;  3HKZ D;  4XCH A;  3PO2 C;  3PIP S;  2NVY A;  2NVX A;  4IO9 S;  3GTJ A;  2JA5 A;  3ERE D;  1WOP A;  1JOE A;  3S16 C;  3SZY A;  3S16 K;  1WSV A;  3GTQ A;  4IOA S;  4G0U A;  2B63 C;  2B63 K;  1TWG C;  2YU9 C;  2ZJR S;  1F93 A;  2YU9 K;  1ZQ1 C;  4A3E C;  2E2J C;  1JVI A;  4A3G K;  4A3E K;  2E2J K;  5TMC A;  4C2M K;  1Y1W C;  1Y1W K;  3S1M C;  2XCQ A;  3S1M K;  5JVH S;  3S1R C;  3FKI A;  3HOZ C;  4C3I C;  1TWC A;  4WFB S;  1J6V A;  1I3Q C;  1O26 A;  3ADA C;  3AQO A;  1I3Q K;  4C3I K;  4G0V A;  3HOZ K;  1WSR A;  3LAJ A;  2A6H A;  4JK1 A;  4G7O A;  3GTL C;  3M3Y C;  1F7V A;  3GTL K;  4A3C K;  4KN4 A;  3M3Y K;  1IE0 A;  5M3M K;  5IP7 C;  2E2H C;  5IP7 K;  2E2H K;  2GSU A;  2R93 C;  3S1N C;  2GAG C;  2R93 K;  1TWF K;  3S1N K;  4KAW X;  1F7U A;  3GTM A;  4QIW L;  4A3D C;  3GTK K;  4A3D K;  3HOW C;  2EBB A;  3HOW K;  1PJ7 A;  5HQH A;  4KM8 A;  4OIN A;  3WOD A;  1ZVU A;  5TJ3 A;  2Y3P A;  4A3M C;  4GT9 A;  4GZY A;  3K7A K;  2GSO A;  1WQF A;  1IS1 A;  5C4J C;  4A3L C;  5C4J K;  4A3L K;  2KPU A;  2D6F C;  1VRQ C;  2JA8 C;  2VUM C;  2JA8 K;  2R92 C;  4YG2 A;  2VUM K;  3N0B A;  2R92 K;  2JA7 A;  1L0W A;  2A69 A;  3GEE A;  1WQH A;  2V6U A;  3ORE A;  2WAQ L;  1BJT A;  1VLO A;  1EH1 A;  2V6T A;  5C4X K;  2A68 A;  3A8I A;  4AYB D;  2FQO A;  1R9T C;  1R9T K;  1F9N A;  4OIO A;  5CHP A;  3OPF A;  4Q4Z A;  5TMF A;  4A93 C;  3BP3 A;  4RMF A;  4A93 K;  1YCL A;  3T02 A;  1VJE A;  2P5M A;  4KB2 A;  4LK1 A;  2B63 A;  1TWG A;  2YU9 A;  4BBS C;  5D4D A;  4BKW A;  3G4A A;  4Y7N C;  4Y7N K;  4BY1 C;  4M1X A;  1Y1W A;  2BE5 A;  4BY1 K;  3GTP A;  3S15 C;  3N3Y A;  3S15 K;  3CF5 S;  1I3Q A;  3PIO S;  2PMZ D;  3AD7 C;  3GTL A;  1YNJ A;  4A3I C;  2KXY A;  1WOR A;  2E2I C;  2E2I K;  2L5N A;  2E2H A;  3HOU C;  4KM9 A;  4U67 S;  3HOU K;  1WOO A;  4O2D A;  1SFO C;  1ISE A;  1SFO K;  3GDZ A;  2A6E A;  3H3V L;  3H0G C;  4P5A A;  4G0W A;  2WB1 D;  4A3B C;  3AD8 C;  4FZB A;  4A3B K;  4MEY A;  1WQG A;  3SZZ A;  3CQZ C;  1I6H C;  1J6W A;  3CQZ K;  3MML B;  1DCH A;  1I6H K;  1XXB A;  1XPP A;  2CFA B;  4PAA A;  4X6A C;  2XCR B;  3I4N C;  4X6A K;  3I4N K;  2R7Z K;  2R92 A;  4XSZ A;  1IBA A;  2PA8 L;  3GEI A;  3FOE A;  1EFW A;  4XLP A;  3M4O C;  3Q3Q A;  3M4O K;  4XLN A;  1O25 A;  4Q5S A;  4A3G C;  2GAH C;  4C2M C;  5M5X K;  4KMD A; 
#chains in the Genus database with same CATH homology
 4GZY A;  3K7A K;  3S2D C;  3S2D K;  3H3V D;  2CW0 A;  5C4J C;  4A3L C;  5C4J K;  4A3L K;  3GTO C;  3RZD C;  2PPB A;  3GTO K;  1WCM K;  3RZD K;  4YFX A;  4A3C C;  2JA8 C;  2VUM C;  3EQL A;  4OIR A;  2JA8 K;  2R92 C;  4YG2 A;  2VUM K;  2R7Z C;  2R92 K;  4Y52 C;  4Y52 K;  4A3K C;  3HOV C;  2A69 A;  5M3F K;  4A3K K;  3HOV K;  3HKZ L;  4BBS K;  1TWF C;  3GTM C;  4BBR C;  3S2H C;  2WAQ L;  4BBR K;  3S2H K;  4G7Z A;  4LK0 A;  5C4X K;  5FLM C;  1IW7 A;  1I50 C;  2PA8 D;  5IP9 C;  3GTK C;  4BXX C;  3HOY C;  1I50 K;  2A68 A;  1Y1W K;  3HOY K;  3PO2 K;  4BXX K;  2PMZ L;  4AYB D;  4QIW D;  4QJV A;  3K7A C;  4X6A K;  1R9T C;  1TWA C;  5C44 C;  1R9T K;  1TWA K;  4OIO A;  5C44 K;  4Q4Z A;  5TMF A;  1WCM C;  4A93 C;  4A3I K;  3PO3 K;  5FJ8 K;  4A93 K;  5M5Y K;  4MQ9 A;  4G7H A;  2JA7 C;  3GTG C;  2JA7 K;  3GTG K;  5M5W K;  4OIP A;  4LK1 A;  1TWG K;  1Y1V C;  1Y1V K;  4BBS C;  5D4D A;  2O5I A;  4QJV B;  2WB1 L;  4Y7N C;  3HOX C;  4Y7N K;  4A3J C;  4C3J C;  4KMU A;  3HOX K;  2NVT C;  4C3J K;  4A3J K;  5C4X C;  2NVT K;  4YFK A;  4MEX A;  3H0G K;  3HKZ D;  3GTP C;  3PO2 C;  2O5J A;  2WAQ D;  4XSX A;  4BY1 C;  2NVX K;  3GTJ C;  3GTP K;  2BE5 A;  3S1R K;  3GTJ K;  2JA5 K;  4BY1 K;  3S15 C;  3S15 K;  4A3B K;  2PMZ D;  3S14 K;  1ZYR A;  3S16 C;  2Y0S L;  3S16 K;  1YNJ A;  3DXJ A;  4A3I C;  3PO3 C;  2E2I C;  2E2I K;  3RZO C;  3RZO K;  2B63 C;  3HOU C;  2B63 K;  3HOU K;  1TWG C;  1YNN A;  2YU9 C;  3S17 C;  1SFO C;  5C3E C;  2YU9 K;  3S17 K;  1SFO K;  5C3E K;  4YFN A;  5IYD C;  1HQM A;  2A6E A;  4A3E C;  2E2J C;  4A3G K;  4LJZ A;  4A3E K;  2E2J K;  5IYD K;  5TMC A;  5IYB C;  4C2M K;  3H0G C;  5IYB K;  3H3V L;  2NVY C;  1Y1W C;  3M3Y K;  2NVY K;  2WB1 D;  4A3B C;  3S1M C;  1TWC C;  4C3H C;  2NVX C;  3FKI K;  3S1R C;  1TWC K;  2JA5 C;  4C3H K;  4MEY A;  4A3M K;  3HOZ C;  4C3I C;  3S1M K;  3CQZ C;  1I3Q C;  4C3I K;  1I6H C;  4ZH4 A;  1I3Q K;  3CQZ K;  3HOZ K;  3S1Q C;  1I6H K;  3S1Q K;  5IYC C;  1XPP A;  3S14 C;  5IYC K;  2A6H A;  4JK1 A;  2NVQ C;  4G7O A;  3I4M C;  2NVQ K;  4A3C K;  3GTL C;  3I4M K;  2JA6 C;  3M3Y C;  3GTL K;  3GTQ C;  4KN4 A;  3I4N C;  4OIQ A;  4X6A C;  5M3M K;  1TWH C;  2JA6 K;  3GTQ K;  3I4N K;  5IP7 C;  1BDF A;  2E2H C;  4BY7 C;  1TWH K;  5IP7 K;  2E2H K;  1SMY A;  2R7Z K;  4XSZ A;  4BY7 K;  2PA8 L;  2Y0S D;  3S1N C;  2R93 C;  2R93 K;  1I6V A;  1TWF K;  3S1N K;  3GTM K;  4KN7 A;  4AYB L;  4NOI A;  4XLP A;  4A3F C;  3M4O C;  4A3F K;  4QIW L;  5FLM K;  4A3D C;  4XLN A;  3GTK K;  5IP9 K;  3M4O K;  4Q5S A;  3HOW C;  4A3G C;  4A3D K;  3HOW K;  1K83 C;  4C2M C;  1K83 K;  4LLG A;  4OIN A;  3WOD A;  3FKI C;  5M5X K;  4A3M C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...