4G7HA

Crystal structure of thermus thermophilus transcription initiation complex
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
226
structure length
226
Chain Sequence
SKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of transcription initiation.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Transcription, transferase/dna
molecule keywords DNA-directed RNA polymerase subunit alpha
total genus 48
structure length 226
sequence length 226
chains with identical sequence B, K, L
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2012-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01000 RNA_pol_A_bac RNA polymerase Rpb3/RpoA insert domain
A PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain
A PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.12 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 DNA-directed RNA polymerase, insert domain 4g7hA02
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 4g7hA01
3S17C 2WAQD 2E2JC 3HKZD 1R9TC 3S1RC 3HOZK 3S16C 3HOVC 4LK1A 4QJVA 1HQMA 3H0GC 1I3QC 1YNNA 4KN7A 4YFXA 1SFOC 2NVXC 4Y52C 2JA7C 3S1NC 3GTJK 5IYDK 2A6HA 2JA8C 2JA6C 2BE5A 2JA5K 2A6EA 3M3YC 1I50K 1TWHK 1YNJA 4BBRC 2YU9K 3S2HK 4OIRA 1Y1VC 4LK0A 3I4MC 3RZOK 3S16K 2JA8K 5D4DA 3GTGK 4YFNA 4OIOA 3HKZL 4Y7NC 5M5XK 3HOVK 1I3QK 2JA7K 2E2JK 1BDFA 2Y0SL 2A68A 2NVYK 3S1RK 5M5WK 4A3MK 3M4OK 4JK1A 4LLGA 5C4XK 3S17K 3EQLA 4C3IC 3FKIC 3PO2C 3K7AK 1TWGC 4YG2A 3DXJA 2O5IA 5M5YK 4Q4ZA 4A3CK 4A3LC 3RZOC 3GTOK 3I4MK 1I6HK 1TWAC 3HOXC 1TWHC 1TWFC 5C4JC 2R7ZK 3GTPC 4BY7K 3GTQC 4AYBD 2VUMK 4C3JC 4A3IK 3RZDK 3S1MK 4MQ9A 4A3CC 4A3EK 4A3LK 3WODA 3I4NC 1WCMK 5IYBK 3HOYK 2B63C 4BXXK 4GZYA 2PA8L 3HOZC 1R9TK 2R92K 3HOUK 4OINA 5C4XC 5TMFA 4C2MC 3S15C 4X6AK 3HOYC 4BXXC 2NVTK 4XLNA 3CQZC 4G7OA 4XLPA 2PMZD 4A3KC 3GTLK 3HOWK 4C3HC 2R92C 3S14C 1K83C 4BBRK 4Y7NK 1TWCK 4C3JK 4OIQA 5IP7K 4G7ZA 3S1MC 1Y1VK 2WB1L 4XSXA 2PA8D 3PO3C 2NVQC 1Y1WC 3GTKK 2R7ZC 3S2HC 2WB1D 3H0GK 5C4JK 4A3BK 5C44C 4LJZA 3S2DK 2E2IC 4A3IC 4KMUA 3S1NK 5IP7C 3GTMC 2PMZL 4C3HK 3S14K 4BBSK 4A3DC 1TWCC 4A3GK 4C3IK 3GTLC 2R93K 4QJVB 3HOWC 1ZYRA 3HOUC 2WAQL 2PPBA 4BY1C 4YFKA 2NVYC 2A69A 1I6VA 4A3GC 5FLMK 5M3FK 2R93C 3GTMK 3M4OC 5FJ8K 5IP9C 4A3DK 4ZH4A 3S2DC 3I4NK 3H3VL 4A3JC 3RZDC 4A93C 1Y1WK 2Y0SD 3HOXK 1TWFK 1I50C 5C44K 3S1QC 2E2IK 2VUMC 3GTQK 4A3JK 5IYCK 1I6HC 2JA5C 2B63K 1K83K 4X6AC 4C2MK 3S15K 4KN4A 4QIWD 4A3KK 3FKIK 5M3MK 4A3MC 4AYBL 4BY1K 5IYBC 5TMCA 4XSZA 5C3EC 1XPPA 3GTGC 4BBSC 4A3FC 3H3VD 4MEXA 4A3BC 2E2HK 4A93K 5IYCC 4A3EC 2CW0A 3GTKC 4QIWL 2NVQK 1TWAK 2YU9C 3M3YK 3S1QK 4BY7C 3GTPK 5IYDC 2E2HC 4NOIA 3GTJC 4A3FK 3PO3K 3GTOC 4Y52K 3K7AC 3PO2K 4Q5SA 1TWGK 2JA6K 2O5JA 4MEYA 5IP9K 1SFOK 2NVXK 1IW7A 5C3EK 4G7HA 2NVTC 1SMYA 5FLMC 3CQZK 4OIPA 1WCMC
chains in the Genus database with same CATH superfamily
2WAQD 3HKZD 3S1RC 1O29A 3GTJA 5IYDK 3S0XA 4Y52C 3A8KA 2KXYA 2JA6C 1BGWA 3M3YC 3BP8C 2JA7A 2L5NA 1DCPA 2L3UA 1Y1VC 1WOOA 1PJ7A 5D4DA 4WFAS 1TWHA 2E2JK 1BDFA 2JA5A 1TWGA 3OEPA 3OREA 5EGHA 4JK1A 5IOSA 3S17K 4GTBA 1O2FB 1VJEA 5M5YK 4Q4ZA 3HXAA 1I6HK 3HOXC 2R7ZK 4BY7K 4KM8A 2P5MA 1IBAA 5DM6S 3WODA 3GTPA 3I4NC 4BXXK 3LPXA 3HOZC 1R9TK 1WORA 1V5VA 2NVXA 4OINA 1WQHA 4BXXC 1B4BA 4A3KC 3S14C 4Y7NK 4XCHA 4C3JK 3S1MC 3FKIA 4PABA 3PO3C 4KATA 3CF5S 5C4JK 4LJZA 3SZZA 4A3IC 4FZBA 3G4AA 4DDQA 4GTDA 3S14K 1ZQ1C 4A3GK 1VLOA 4LQYA 5IOQA 3GTLC 2R93K 2GSNA 1JOEA 2PPBA 4RMFA 4BY1C 4P5AA 4A3GC 2NVYC 5HQHA 1HI9A 2PHCB 2R93C 3GTQA 1BJTA 4BKWA 1WCMA 1Y1WK 1IS1A 1TWFK 3S1QC 3GTQK 2ZJPS 1VRQC 1K83K 3N0BA 4G0UA 1IL2A 2R93A 4A3MC 5IOTA 1XPPA 1YX2A 2GAHC 2RH6A 4A93K 2NVQK 1TWAK 3GTGA 3M3YK 3GTPK 5TJ3A 5IYDC 1VH2A 4Y52K 3GTOC 2JA6K 1F7VA 2ZUEA 1SFOK 4U67S 1IW7A 5C3EK 4OIPA 3S17C 2V6SA 2E2JC 1O2BA 1HQMA 3H0GC 1I3QC 1SFOC 5E68A 4FM9A 2D6FC 1L0WA 2JA5K 2A6EA 2YU9K 3S2HK 1YNJA 4BBRC 3SZYA 1USOA 4LK0A 3AQOA 4Y7NC 4J3NA 5M5XK 1I3QK 2A68A 1EFWA 1IE0A 3M4OK 4LLGA 1O25A 4GTLA 3T02A 3EQLA 3FKIC 1TWGC 4A3LC 4KAWX 3I4MK 2FQOA 1TWHC 5C4JC 1XXAA 1IQ0A 2VUMK 4C3JC 4A3IK 3RZDK 3S1MK 4MQ9A 4A3EK 4A3LK 1DCOA 1WCMK 5IYBK 2PA8L 3L4KA 3GTMA 2NVTK 3GTLK 4XLNA 2PMZD 4C3HC 1K83C 2FQTA 1TWCK 4G7ZA 1Y1WC 2E2HA 2V6UA 3QX3A 4C3HK 4GT9A 1TWCC 1F9NA 4C3IK 3GDZA 1G51A 1WOSA 4QJVB 2ZUFA 2WAQL 2KWAA 3AD9C 4WFNS 3LAJA 4YFKA 2A69A 1I6VA 5FLMK 3LYWA 3G4CA 4LR2A 4A93C 4IOCS 5C44K 2E2IK 3GEIA 1B4AA 1I6HC 4X6AC 1EK8A 4C2MK 3S15K 3ADAC 3V4GA 3GEEA 1Y1VA 4AYBL 1XZQB 5CHPA 1GE9A 4XSZA 5JVHS 5C3EC 1FEUA 1J98A 2KPUA 1ZBSA 5HL7S 4A3BC 3AQPA 1R9TA 3GTKC 4QIWL 2YU9C 4BY7C 1WQGA 3N0CA 3PO3K 1TWGK 3JSTA 2NVXK 3CAGA 2P8TA 3CQZK 3GTOA 3VA7A 1J6WA 1R9TC 3HOZK 1I50A 3S16C 3OPFA 4LK1A 1XZQA 4WJ3M 4ILDA 1YNNA 4YFXA 2NVXC 2JA7C 4G0VA 3GTJK 3S1NC 2A6HA 2JA8C 4IOAS 1I50K 1TWHK 2XCRB 3I4MC 3S16K 2JA8K 1UV7A 2XCOA 1ZVUA 1PJ5A 2JA7K 1WOPA 2Y0SL 4WCES 5M5WK 4KC6A 3K7AK 4GTCA 3BUEA 3TFJA 1F93A 4A3CK 3RZOC 4GFQA 1EI6A 4KDDA 1TWFC 1WQFA 3GTQC 4A3CC 3TFIA 4BLAA 2B63C 3T01A 5C4XC 5TMFA 1O2AA 5L46A 1BS2A 4OIQA 5IP7K 2WB1L 1Y1VK 2B63K 2NVQC 2GSOA 3N3YA 2WB1D 3H0GK 2RGRA 1K83A 5C44C 2E2IC 4KMUA 5IP7C 1JQWA 3GTMC 4A3DC 4KB2A 3TFHA 3HOWC 3HOUC 3GTLA 5JVGS 4P5BA 3GTMK 3M4OC 5FJ8K 1WIHA 4A3DK 1WSRA 4ZH4A 3S2DC 3H3VL 1XZPB 4WF9S 3HOXK 1F7UA 2R7ZA 2JA5C 4KN4A 4KMDA 4G0WA 2GAGC 4A3KK 4C45A 5IYBC 3AD7C 3Q3QA 1JVIA 2EBBA 3A8JA 4BBSC 5JFEA 4GTFA 2E2HK 4MEXA 5IYCC 2CW0A 1O24A 1KQ4A 4WJ4A 2CFAA 3MMLB 2E2HC 4NOIA 3GTJC 4WILA 3K7AC 4O2DA 2O5JA 5IP9K 2VUMA 5DM7S 1O26A 4IO9S 3LAPA 1WCMC 1VGXA 4PAAA 5EGEA 2YU9A 3HOVC 1ISEA 4QJVA 4KN7A 1DD5A 5IORA 2BE5A 1YCLA 1I3QA 2Y3PA 4OIRA 3RZOK 3HOVK 1TWAA 4YFNA 4OIOA 3HKZL 4WFBS 3GTGK 2NVYK 3FOFA 1J6VA 3S1RK 4KARA 4A3MK 1XXBA 2KQ1A 5C4XK 1DCHA 3GEHA 4C3IC 2ZJQS 3PO2C 1XXCA 4YG2A 4KMAA 3DXJA 3GIRA 2O5IA 1RU0A 5HL8A 3CQZA 3GTOK 1PJ6A 1TWAC 1USMA 3PIPS 3GTPC 3GSIA 4AYBD 4A3BK 2JA6A 3AH5A 1X31C 3HOYK 4GZYA 4M1XA 4KMHA 2R92K 3HOUK 1SFOA 3PIOS 4C2MC 3S15C 4X6AK 3HOYC 4LOWA 3CQZC 4G7OA 4XLPA 1TWFA 3HOWK 3A8IA 2R92C 1Y1WA 4BBRK 1EQRA 4XSXA 2PA8D 3NUHA 3GTKK 4KB4A 2R7ZC 3S2HC 3L4JA 3S2DK 3S1NK 2PMZL 3IPJA 3GTKA 4BBSK 1O28A 3BP3A 2XCQA 5CJ9A 1ZYRA 1WSVA 4KM9A 3H0GA 5M3FK 3ERED 5IP9C 2E2IA 1XZPA 3I4NK 1INNA 1EH1A 4A3JC 3RZDC 3TTGA 2Y0SD 1I50C 2VUMC 4A3JK 5IYCK 4BLBA 1ZXOA 2W7VA 3FOEA 4QIWD 3T00A 3FKIK 5M3MK 2B63A 4BY1K 3DLLS 5TMCA 2JH3A 1J6XA 3GTGC 4GTAA 2NVYA 5JVOA 4A3FC 3H3VD 3FHZA 4KASA 4A3EC 4AH6A 1TWCA 4P9SA 4GTEA 3S1QK 4A3FK 1C0AA 2V6TA 3AD8C 4Q5SA 3PO2K 2GSUA 2CFAB 2ZJRS 4MEYA 2R92A 4G7HA 2NVTC 1SMYA 5FLMC 1AB4A 2ZFZA 1O27A
chains in the Genus database with same CATH topology
3S17C 2WAQD 2E2JC 3HKZD 1R9TC 3S1RC 3HOZK 3S16C 3HOVC 4LK1A 4QJVA 1HQMA 3H0GC 1I3QC 1YNNA 4KN7A 4YFXA 1SFOC 2NVXC 4Y52C 2JA7C 3S1NC 3GTJK 5IYDK 2A6HA 2JA8C 2JA6C 2BE5A 2JA5K 2A6EA 3M3YC 1I50K 1TWHK 1YNJA 4BBRC 2YU9K 3S2HK 4OIRA 1Y1VC 4LK0A 3I4MC 3RZOK 3S16K 2JA8K 5D4DA 3GTGK 4YFNA 4OIOA 3HKZL 4Y7NC 5M5XK 3HOVK 1I3QK 2JA7K 2E2JK 1BDFA 2Y0SL 2A68A 2NVYK 3S1RK 5M5WK 4A3MK 3M4OK 4JK1A 4LLGA 5C4XK 3S17K 3EQLA 4C3IC 3FKIC 3PO2C 3K7AK 1TWGC 4YG2A 3DXJA 2O5IA 5M5YK 4Q4ZA 4A3CK 4A3LC 3RZOC 3GTOK 3I4MK 1I6HK 1TWAC 3HOXC 1TWHC 1TWFC 5C4JC 2R7ZK 3GTPC 4BY7K 3GTQC 4AYBD 2VUMK 4C3JC 4A3IK 3RZDK 3S1MK 4MQ9A 4A3CC 4A3EK 4A3LK 3WODA 3I4NC 1WCMK 5IYBK 3HOYK 2B63C 4BXXK 4GZYA 2PA8L 3HOZC 1R9TK 2R92K 3HOUK 4OINA 5C4XC 5TMFA 4C2MC 3S15C 4X6AK 3HOYC 4BXXC 2NVTK 4XLNA 3CQZC 4G7OA 4XLPA 2PMZD 4A3KC 3GTLK 3HOWK 4C3HC 2R92C 3S14C 1K83C 4BBRK 4Y7NK 1TWCK 4C3JK 4OIQA 5IP7K 4G7ZA 3S1MC 1Y1VK 2WB1L 4XSXA 2PA8D 3PO3C 2NVQC 1Y1WC 3GTKK 2R7ZC 3S2HC 2WB1D 3H0GK 5C4JK 4A3BK 5C44C 4LJZA 3S2DK 2E2IC 4A3IC 4KMUA 3S1NK 5IP7C 3GTMC 2PMZL 4C3HK 3S14K 4BBSK 4A3DC 1TWCC 4A3GK 4C3IK 3GTLC 2R93K 4QJVB 3HOWC 1ZYRA 3HOUC 2WAQL 2PPBA 4BY1C 4YFKA 2NVYC 2A69A 1I6VA 4A3GC 5FLMK 5M3FK 2R93C 3GTMK 3M4OC 5FJ8K 5IP9C 4A3DK 4ZH4A 3S2DC 3I4NK 3H3VL 4A3JC 3RZDC 4A93C 1Y1WK 2Y0SD 3HOXK 1TWFK 1I50C 5C44K 3S1QC 2E2IK 2VUMC 3GTQK 4A3JK 5IYCK 1I6HC 2JA5C 2B63K 1K83K 4X6AC 4C2MK 3S15K 4KN4A 4QIWD 4A3KK 3FKIK 5M3MK 4A3MC 4AYBL 4BY1K 5IYBC 5TMCA 4XSZA 5C3EC 1XPPA 3GTGC 4BBSC 4A3FC 3H3VD 4MEXA 4A3BC 2E2HK 4A93K 5IYCC 4A3EC 2CW0A 3GTKC 4QIWL 2NVQK 1TWAK 2YU9C 3M3YK 3S1QK 4BY7C 3GTPK 5IYDC 2E2HC 4NOIA 3GTJC 4A3FK 3PO3K 3GTOC 4Y52K 3K7AC 3PO2K 4Q5SA 1TWGK 2JA6K 2O5JA 4MEYA 5IP9K 1SFOK 2NVXK 1IW7A 5C3EK 4G7HA 2NVTC 1SMYA 5FLMC 3CQZK 4OIPA 1WCMC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S17 C;  2WAQ D;  2E2J C;  3HKZ D;  1R9T C;  3S1R C;  3HOZ K;  3S16 C;  3HOV C;  4LK1 A;  4QJV A;  1HQM A;  3H0G C;  1I3Q C;  1YNN A;  4KN7 A;  4YFX A;  1SFO C;  2NVX C;  4Y52 C;  2JA7 C;  3S1N C;  3GTJ K;  5IYD K;  2A6H A;  2JA8 C;  2JA6 C;  2BE5 A;  2JA5 K;  2A6E A;  3M3Y C;  1I50 K;  1TWH K;  1YNJ A;  4BBR C;  2YU9 K;  3S2H K;  4OIR A;  1Y1V C;  4LK0 A;  3I4M C;  3RZO K;  3S16 K;  2JA8 K;  5D4D A;  3GTG K;  4YFN A;  4OIO A;  3HKZ L;  4Y7N C;  5M5X K;  3HOV K;  1I3Q K;  2JA7 K;  2E2J K;  1BDF A;  2Y0S L;  2A68 A;  2NVY K;  3S1R K;  5M5W K;  4A3M K;  3M4O K;  4JK1 A;  4LLG A;  5C4X K;  3S17 K;  3EQL A;  4C3I C;  3FKI C;  3PO2 C;  3K7A K;  1TWG C;  4YG2 A;  3DXJ A;  2O5I A;  5M5Y K;  4Q4Z A;  4A3C K;  4A3L C;  3RZO C;  3GTO K;  3I4M K;  1I6H K;  1TWA C;  3HOX C;  1TWH C;  1TWF C;  5C4J C;  2R7Z K;  3GTP C;  4BY7 K;  3GTQ C;  4AYB D;  2VUM K;  4C3J C;  4A3I K;  3RZD K;  3S1M K;  4MQ9 A;  4A3C C;  4A3E K;  4A3L K;  3WOD A;  3I4N C;  1WCM K;  5IYB K;  3HOY K;  2B63 C;  4BXX K;  4GZY A;  2PA8 L;  3HOZ C;  1R9T K;  2R92 K;  3HOU K;  4OIN A;  5C4X C;  5TMF A;  4C2M C;  3S15 C;  4X6A K;  3HOY C;  4BXX C;  2NVT K;  4XLN A;  3CQZ C;  4G7O A;  4XLP A;  2PMZ D;  4A3K C;  3GTL K;  3HOW K;  4C3H C;  2R92 C;  3S14 C;  1K83 C;  4BBR K;  4Y7N K;  1TWC K;  4C3J K;  4OIQ A;  5IP7 K;  4G7Z A;  3S1M C;  1Y1V K;  2WB1 L;  4XSX A;  2PA8 D;  3PO3 C;  2NVQ C;  1Y1W C;  3GTK K;  2R7Z C;  3S2H C;  2WB1 D;  3H0G K;  5C4J K;  4A3B K;  5C44 C;  4LJZ A;  3S2D K;  2E2I C;  4A3I C;  4KMU A;  3S1N K;  5IP7 C;  3GTM C;  2PMZ L;  4C3H K;  3S14 K;  4BBS K;  4A3D C;  1TWC C;  4A3G K;  4C3I K;  3GTL C;  2R93 K;  4QJV B;  3HOW C;  1ZYR A;  3HOU C;  2WAQ L;  2PPB A;  4BY1 C;  4YFK A;  2NVY C;  2A69 A;  1I6V A;  4A3G C;  5FLM K;  5M3F K;  2R93 C;  3GTM K;  3M4O C;  5FJ8 K;  5IP9 C;  4A3D K;  4ZH4 A;  3S2D C;  3I4N K;  3H3V L;  4A3J C;  3RZD C;  4A93 C;  1Y1W K;  2Y0S D;  3HOX K;  1TWF K;  1I50 C;  5C44 K;  3S1Q C;  2E2I K;  2VUM C;  3GTQ K;  4A3J K;  5IYC K;  1I6H C;  2JA5 C;  2B63 K;  1K83 K;  4X6A C;  4C2M K;  3S15 K;  4KN4 A;  4QIW D;  4A3K K;  3FKI K;  5M3M K;  4A3M C;  4AYB L;  4BY1 K;  5IYB C;  5TMC A;  4XSZ A;  5C3E C;  1XPP A;  3GTG C;  4BBS C;  4A3F C;  3H3V D;  4MEX A;  4A3B C;  2E2H K;  4A93 K;  5IYC C;  4A3E C;  2CW0 A;  3GTK C;  4QIW L;  2NVQ K;  1TWA K;  2YU9 C;  3M3Y K;  3S1Q K;  4BY7 C;  3GTP K;  5IYD C;  2E2H C;  4NOI A;  3GTJ C;  4A3F K;  3PO3 K;  3GTO C;  4Y52 K;  3K7A C;  3PO2 K;  4Q5S A;  1TWG K;  2JA6 K;  2O5J A;  4MEY A;  5IP9 K;  1SFO K;  2NVX K;  1IW7 A;  5C3E K;  4G7H A;  2NVT C;  1SMY A;  5FLM C;  3CQZ K;  4OIP A;  1WCM C; 
#chains in the Genus database with same CATH topology
 2WAQ D;  3HKZ D;  3S1R C;  1O29 A;  3GTJ A;  5IYD K;  3S0X A;  4Y52 C;  3A8K A;  2KXY A;  2JA6 C;  1BGW A;  3M3Y C;  3BP8 C;  2JA7 A;  2L5N A;  1DCP A;  2L3U A;  1Y1V C;  1WOO A;  1PJ7 A;  5D4D A;  4WFA S;  1TWH A;  2E2J K;  1BDF A;  2JA5 A;  1TWG A;  3OEP A;  3ORE A;  5EGH A;  4JK1 A;  5IOS A;  3S17 K;  4GTB A;  1O2F B;  1VJE A;  5M5Y K;  4Q4Z A;  3HXA A;  1I6H K;  3HOX C;  2R7Z K;  4BY7 K;  4KM8 A;  2P5M A;  1IBA A;  5DM6 S;  3WOD A;  3GTP A;  3I4N C;  4BXX K;  3LPX A;  3HOZ C;  1R9T K;  1WOR A;  1V5V A;  2NVX A;  4OIN A;  1WQH A;  4BXX C;  1B4B A;  4A3K C;  3S14 C;  4Y7N K;  4XCH A;  4C3J K;  3S1M C;  3FKI A;  4PAB A;  3PO3 C;  4KAT A;  3CF5 S;  5C4J K;  4LJZ A;  3SZZ A;  4A3I C;  4FZB A;  3G4A A;  4DDQ A;  4GTD A;  3S14 K;  1ZQ1 C;  4A3G K;  1VLO A;  4LQY A;  5IOQ A;  3GTL C;  2R93 K;  2GSN A;  1JOE A;  2PPB A;  4RMF A;  4BY1 C;  4P5A A;  4A3G C;  2NVY C;  5HQH A;  1HI9 A;  2PHC B;  2R93 C;  3GTQ A;  1BJT A;  4BKW A;  1WCM A;  1Y1W K;  1IS1 A;  1TWF K;  3S1Q C;  3GTQ K;  2ZJP S;  1VRQ C;  1K83 K;  3N0B A;  4G0U A;  1IL2 A;  2R93 A;  4A3M C;  5IOT A;  1XPP A;  1YX2 A;  2GAH C;  2RH6 A;  4A93 K;  2NVQ K;  1TWA K;  3GTG A;  3M3Y K;  3GTP K;  5TJ3 A;  5IYD C;  1VH2 A;  4Y52 K;  3GTO C;  2JA6 K;  1F7V A;  2ZUE A;  1SFO K;  4U67 S;  1IW7 A;  5C3E K;  4OIP A;  3S17 C;  2V6S A;  2E2J C;  1O2B A;  1HQM A;  3H0G C;  1I3Q C;  1SFO C;  5E68 A;  4FM9 A;  2D6F C;  1L0W A;  2JA5 K;  2A6E A;  2YU9 K;  3S2H K;  1YNJ A;  4BBR C;  3SZY A;  1USO A;  4LK0 A;  3AQO A;  4Y7N C;  4J3N A;  5M5X K;  1I3Q K;  2A68 A;  1EFW A;  1IE0 A;  3M4O K;  4LLG A;  1O25 A;  4GTL A;  3T02 A;  3EQL A;  3FKI C;  1TWG C;  4A3L C;  4KAW X;  3I4M K;  2FQO A;  1TWH C;  5C4J C;  1XXA A;  1IQ0 A;  2VUM K;  4C3J C;  4A3I K;  3RZD K;  3S1M K;  4MQ9 A;  4A3E K;  4A3L K;  1DCO A;  1WCM K;  5IYB K;  2PA8 L;  3L4K A;  3GTM A;  2NVT K;  3GTL K;  4XLN A;  2PMZ D;  4C3H C;  1K83 C;  2FQT A;  1TWC K;  4G7Z A;  1Y1W C;  2E2H A;  2V6U A;  3QX3 A;  4C3H K;  4GT9 A;  1TWC C;  1F9N A;  4C3I K;  3GDZ A;  1G51 A;  1WOS A;  4QJV B;  2ZUF A;  2WAQ L;  2KWA A;  3AD9 C;  4WFN S;  3LAJ A;  4YFK A;  2A69 A;  1I6V A;  5FLM K;  3LYW A;  3G4C A;  4LR2 A;  4A93 C;  4IOC S;  5C44 K;  2E2I K;  3GEI A;  1B4A A;  1I6H C;  4X6A C;  1EK8 A;  4C2M K;  3S15 K;  3ADA C;  3V4G A;  3GEE A;  1Y1V A;  4AYB L;  1XZQ B;  5CHP A;  1GE9 A;  4XSZ A;  5JVH S;  5C3E C;  1FEU A;  1J98 A;  2KPU A;  1ZBS A;  5HL7 S;  4A3B C;  3AQP A;  1R9T A;  3GTK C;  4QIW L;  2YU9 C;  4BY7 C;  1WQG A;  3N0C A;  3PO3 K;  1TWG K;  3JST A;  2NVX K;  3CAG A;  2P8T A;  3CQZ K;  3GTO A;  3VA7 A;  1J6W A;  1R9T C;  3HOZ K;  1I50 A;  3S16 C;  3OPF A;  4LK1 A;  1XZQ A;  4WJ3 M;  4ILD A;  1YNN A;  4YFX A;  2NVX C;  2JA7 C;  4G0V A;  3GTJ K;  3S1N C;  2A6H A;  2JA8 C;  4IOA S;  1I50 K;  1TWH K;  2XCR B;  3I4M C;  3S16 K;  2JA8 K;  1UV7 A;  2XCO A;  1ZVU A;  1PJ5 A;  2JA7 K;  1WOP A;  2Y0S L;  4WCE S;  5M5W K;  4KC6 A;  3K7A K;  4GTC A;  3BUE A;  3TFJ A;  1F93 A;  4A3C K;  3RZO C;  4GFQ A;  1EI6 A;  4KDD A;  1TWF C;  1WQF A;  3GTQ C;  4A3C C;  3TFI A;  4BLA A;  2B63 C;  3T01 A;  5C4X C;  5TMF A;  1O2A A;  5L46 A;  1BS2 A;  4OIQ A;  5IP7 K;  2WB1 L;  1Y1V K;  2B63 K;  2NVQ C;  2GSO A;  3N3Y A;  2WB1 D;  3H0G K;  2RGR A;  1K83 A;  5C44 C;  2E2I C;  4KMU A;  5IP7 C;  1JQW A;  3GTM C;  4A3D C;  4KB2 A;  3TFH A;  3HOW C;  3HOU C;  3GTL A;  5JVG S;  4P5B A;  3GTM K;  3M4O C;  5FJ8 K;  1WIH A;  4A3D K;  1WSR A;  4ZH4 A;  3S2D C;  3H3V L;  1XZP B;  4WF9 S;  3HOX K;  1F7U A;  2R7Z A;  2JA5 C;  4KN4 A;  4KMD A;  4G0W A;  2GAG C;  4A3K K;  4C45 A;  5IYB C;  3AD7 C;  3Q3Q A;  1JVI A;  2EBB A;  3A8J A;  4BBS C;  5JFE A;  4GTF A;  2E2H K;  4MEX A;  5IYC C;  2CW0 A;  1O24 A;  1KQ4 A;  4WJ4 A;  2CFA A;  3MML B;  2E2H C;  4NOI A;  3GTJ C;  4WIL A;  3K7A C;  4O2D A;  2O5J A;  5IP9 K;  2VUM A;  5DM7 S;  1O26 A;  4IO9 S;  3LAP A;  1WCM C;  1VGX A;  4PAA A;  5EGE A;  2YU9 A;  3HOV C;  1ISE A;  4QJV A;  4KN7 A;  1DD5 A;  5IOR A;  2BE5 A;  1YCL A;  1I3Q A;  2Y3P A;  4OIR A;  3RZO K;  3HOV K;  1TWA A;  4YFN A;  4OIO A;  3HKZ L;  4WFB S;  3GTG K;  2NVY K;  3FOF A;  1J6V A;  3S1R K;  4KAR A;  4A3M K;  1XXB A;  2KQ1 A;  5C4X K;  1DCH A;  3GEH A;  4C3I C;  2ZJQ S;  3PO2 C;  1XXC A;  4YG2 A;  4KMA A;  3DXJ A;  3GIR A;  2O5I A;  1RU0 A;  5HL8 A;  3CQZ A;  3GTO K;  1PJ6 A;  1TWA C;  1USM A;  3PIP S;  3GTP C;  3GSI A;  4AYB D;  4A3B K;  2JA6 A;  3AH5 A;  1X31 C;  3HOY K;  4GZY A;  4M1X A;  4KMH A;  2R92 K;  3HOU K;  1SFO A;  3PIO S;  4C2M C;  3S15 C;  4X6A K;  3HOY C;  4LOW A;  3CQZ C;  4G7O A;  4XLP A;  1TWF A;  3HOW K;  3A8I A;  2R92 C;  1Y1W A;  4BBR K;  1EQR A;  4XSX A;  2PA8 D;  3NUH A;  3GTK K;  4KB4 A;  2R7Z C;  3S2H C;  3L4J A;  3S2D K;  3S1N K;  2PMZ L;  3IPJ A;  3GTK A;  4BBS K;  1O28 A;  3BP3 A;  2XCQ A;  5CJ9 A;  1ZYR A;  1WSV A;  4KM9 A;  3H0G A;  5M3F K;  3ERE D;  5IP9 C;  2E2I A;  1XZP A;  3I4N K;  1INN A;  1EH1 A;  4A3J C;  3RZD C;  3TTG A;  2Y0S D;  1I50 C;  2VUM C;  4A3J K;  5IYC K;  4BLB A;  1ZXO A;  2W7V A;  3FOE A;  4QIW D;  3T00 A;  3FKI K;  5M3M K;  2B63 A;  4BY1 K;  3DLL S;  5TMC A;  2JH3 A;  1J6X A;  3GTG C;  4GTA A;  2NVY A;  5JVO A;  4A3F C;  3H3V D;  3FHZ A;  4KAS A;  4A3E C;  4AH6 A;  1TWC A;  4P9S A;  4GTE A;  3S1Q K;  4A3F K;  1C0A A;  2V6T A;  3AD8 C;  4Q5S A;  3PO2 K;  2GSU A;  2CFA B;  2ZJR S;  4MEY A;  2R92 A;  4G7H A;  2NVT C;  1SMY A;  5FLM C;  1AB4 A;  2ZFZ A;  1O27 A; 
#chains in the Genus database with same CATH homology
 3S17 C;  2WAQ D;  2E2J C;  3HKZ D;  1R9T C;  3S1R C;  3HOZ K;  3S16 C;  3HOV C;  4LK1 A;  4QJV A;  1HQM A;  3H0G C;  1I3Q C;  1YNN A;  4KN7 A;  4YFX A;  1SFO C;  2NVX C;  4Y52 C;  2JA7 C;  3S1N C;  3GTJ K;  5IYD K;  2A6H A;  2JA8 C;  2JA6 C;  2BE5 A;  2JA5 K;  2A6E A;  3M3Y C;  1I50 K;  1TWH K;  1YNJ A;  4BBR C;  2YU9 K;  3S2H K;  4OIR A;  1Y1V C;  4LK0 A;  3I4M C;  3RZO K;  3S16 K;  2JA8 K;  5D4D A;  3GTG K;  4YFN A;  4OIO A;  3HKZ L;  4Y7N C;  5M5X K;  3HOV K;  1I3Q K;  2JA7 K;  2E2J K;  1BDF A;  2Y0S L;  2A68 A;  2NVY K;  3S1R K;  5M5W K;  4A3M K;  3M4O K;  4JK1 A;  4LLG A;  5C4X K;  3S17 K;  3EQL A;  4C3I C;  3FKI C;  3PO2 C;  3K7A K;  1TWG C;  4YG2 A;  3DXJ A;  2O5I A;  5M5Y K;  4Q4Z A;  4A3C K;  4A3L C;  3RZO C;  3GTO K;  3I4M K;  1I6H K;  1TWA C;  3HOX C;  1TWH C;  1TWF C;  5C4J C;  2R7Z K;  3GTP C;  4BY7 K;  3GTQ C;  4AYB D;  2VUM K;  4C3J C;  4A3I K;  3RZD K;  3S1M K;  4MQ9 A;  4A3C C;  4A3E K;  4A3L K;  3WOD A;  3I4N C;  1WCM K;  5IYB K;  3HOY K;  2B63 C;  4BXX K;  4GZY A;  2PA8 L;  3HOZ C;  1R9T K;  2R92 K;  3HOU K;  4OIN A;  5C4X C;  5TMF A;  4C2M C;  3S15 C;  4X6A K;  3HOY C;  4BXX C;  2NVT K;  4XLN A;  3CQZ C;  4G7O A;  4XLP A;  2PMZ D;  4A3K C;  3GTL K;  3HOW K;  4C3H C;  2R92 C;  3S14 C;  1K83 C;  4BBR K;  4Y7N K;  1TWC K;  4C3J K;  4OIQ A;  5IP7 K;  4G7Z A;  3S1M C;  1Y1V K;  2WB1 L;  4XSX A;  2PA8 D;  3PO3 C;  2NVQ C;  1Y1W C;  3GTK K;  2R7Z C;  3S2H C;  2WB1 D;  3H0G K;  5C4J K;  4A3B K;  5C44 C;  4LJZ A;  3S2D K;  2E2I C;  4A3I C;  4KMU A;  3S1N K;  5IP7 C;  3GTM C;  2PMZ L;  4C3H K;  3S14 K;  4BBS K;  4A3D C;  1TWC C;  4A3G K;  4C3I K;  3GTL C;  2R93 K;  4QJV B;  3HOW C;  1ZYR A;  3HOU C;  2WAQ L;  2PPB A;  4BY1 C;  4YFK A;  2NVY C;  2A69 A;  1I6V A;  4A3G C;  5FLM K;  5M3F K;  2R93 C;  3GTM K;  3M4O C;  5FJ8 K;  5IP9 C;  4A3D K;  4ZH4 A;  3S2D C;  3I4N K;  3H3V L;  4A3J C;  3RZD C;  4A93 C;  1Y1W K;  2Y0S D;  3HOX K;  1TWF K;  1I50 C;  5C44 K;  3S1Q C;  2E2I K;  2VUM C;  3GTQ K;  4A3J K;  5IYC K;  1I6H C;  2JA5 C;  2B63 K;  1K83 K;  4X6A C;  4C2M K;  3S15 K;  4KN4 A;  4QIW D;  4A3K K;  3FKI K;  5M3M K;  4A3M C;  4AYB L;  4BY1 K;  5IYB C;  5TMC A;  4XSZ A;  5C3E C;  1XPP A;  3GTG C;  4BBS C;  4A3F C;  3H3V D;  4MEX A;  4A3B C;  2E2H K;  4A93 K;  5IYC C;  4A3E C;  2CW0 A;  3GTK C;  4QIW L;  2NVQ K;  1TWA K;  2YU9 C;  3M3Y K;  3S1Q K;  4BY7 C;  3GTP K;  5IYD C;  2E2H C;  4NOI A;  3GTJ C;  4A3F K;  3PO3 K;  3GTO C;  4Y52 K;  3K7A C;  3PO2 K;  4Q5S A;  1TWG K;  2JA6 K;  2O5J A;  4MEY A;  5IP9 K;  1SFO K;  2NVX K;  1IW7 A;  5C3E K;  4G7H A;  2NVT C;  1SMY A;  5FLM C;  3CQZ K;  4OIP A;  1WCM C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...