4G7HA

Crystal structure of thermus thermophilus transcription initiation complex
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
226
structure length
226
Chain Sequence
b'SKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase subunit alpha
publication title Structural basis of transcription initiation.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Transcription, transferase/dna
total genus 48
structure length 226
sequence length 226
chains with identical sequence B, K, L
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2012-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01000 RNA_pol_A_bac RNA polymerase Rpb3/RpoA insert domain
A PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain
A PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.12 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 DNA-directed RNA polymerase, insert domain 4g7hA02
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 4g7hA01
3EQLA 2B63K 1WCMK 4LJZA 4A3JC 5FLMK 3H3VD 2PPBA 1K83K 5IYDC 4OIQA 3GTGK 5D4DA 3FKIC 4BBRC 4QJVB 2A6EA 4GZYA 3H0GC 3S17C 2A68A 2R92C 4QIWL 4A3EC 4A3MC 5M3FK 3GTQC 4XSZA 3HOUK 4C2MC 3S1QC 3GTJK 3HOYK 5IP7C 3HOVK 2R7ZK 5FJ8K 3PO2K 3GTPK 3S1NC 3RZDC 3GTLK 4OIPA 2NVQK 2B63C 1K83C 4AYBD 1I3QK 2R92K 3GTGC 3I4NK 2NVXC 4A93K 3GTQK 4KN4A 2O5IA 2JA7K 4XLPA 5IP7K 3GTOC 4X6AC 4G7HA 2E2IC 2Y0SL 1ZYRA 3HOUC 3S14K 4A3BK 1HQMA 3GTJC 3HOYC 3HOWK 3PO2C 2R7ZC 3HOVC 1TWFK 3GTPC 2NVXK 5M5WK 3GTLC 4JK1A 1IW7A 2NVQC 3WODA 1R9TK 1I3QC 2A69A 4BXXK 3I4NC 4G7OA 2WB1L 4A93C 3GTOK 4X6AK 2JA6C 2YU9K 3GTKK 4OIOA 3S1RC 4LK1A 2E2IK 4A3LK 3PO3K 2JA7C 5IP9K 3S16K 1YNNA 3HOXK 4A3FK 4BBSK 1Y1VK 3HKZD 2E2JK 2PMZD 2PA8D 3S14C 2JA8K 3M4OK 5TMFA 4A3BC 2A6HA 4ZH4A 3HOWC 4BY7C 1TWFC 4Y52K 4BY1K 2JA5C 2JA6K 1R9TC 4C3HK 3S1RK 4BXXC 4Q4ZA 3I4MK 1TWHK 2YU9C 3GTKC 4QJVA 1TWGK 4OIRA 4QIWD 5IYBK 4A3LC 3PO3C 4Q5SA 3HOZK 5IP9C 3S16C 4OINA 3HOXC 4BY7K 3H3VL 4C3IC 4A3FC 1Y1VC 2E2JC 4BBSC 2NVYK 5C4JK 2O5JA 4MEXA 2JA5K 2JA8C 3M3YK 3M4OC 3S2DK 5IYCC 4Y52C 5C4XK 4YFXA 4KN7A 4A3DK 5M5YK 4BY1C 4C3HC 1SFOK 3I4MC 1TWHC 1TWAK 4C3IK 2R93C 3GTMK 3RZOK 3CQZK 1TWGC 4C3JK 5IYBC 3HOZC 5IYCK 2E2HK 5C3EC 1YNJA 4AYBL 1TWCK 2NVYC 5C4JC 4A3GK 2Y0SD 4A3IK 2WAQL 1Y1WC 4Y7NC 3M3YC 3S2DC 1I50K 4MEYA 5C4XC 3S1MK 2VUMC 3DXJA 4A3CC 4A3DC 4YFKA 2BE5A 4XSXA 2NVTK 2R93K 1BDFA 4LLGA 4XLNA 3S2HK 4A3KK 4YFNA 3K7AK 2WB1D 4YG2A 5C44K 1SFOC 1XPPA 3RZOC 1TWAC 5C3EK 5M3MK 1I6HK 3GTMC 3CQZC 3S15K 4C3JC 4Y7NK 1Y1WK 4MQ9A 4A3JK 4NOIA 2E2HC 2VUMK 5IYDK 4A3CK 1TWCC 3FKIK 4BBRK 4A3GC 4A3IC 1I50C 1WCMC 4G7ZA 5FLMC 3H0GK 3S1MC 3S17K 4A3EK 4A3MK 2WAQD 4LK0A 5TMCA 2NVTC 3S2HC 2CW0A 3HKZL 1I6VA 4A3KC 3K7AC 1SMYA 2PA8L 5C44C 2PMZL 4C2MK 1I6HC 5M5XK 3S1QK 4KMUA 3S1NK 3RZDK 3S15C
chains in the Genus database with same CATH superfamily
2D6FC 1WCMK 3PIPS 4KC6A 1YCLA 2PPBA 4WJ3M 2XCRB 1O2AA 2EBBA 4GZYA 4QIWL 2R92C 4A3EC 3GEHA 3HOUK 3S1QC 4GFQA 2KQ1A 3GSIA 5IP7C 5FJ8K 3RZDC 1J98A 5L46A 1O2FB 4WILA 1Y1WA 1K83C 4WJ4A 3FKIA 3L4KA 3GTQK 4KN4A 1F93A 1C0AA 5JFEA 4GT9A 2JA7K 4XLPA 3GTOC 1TWAA 3BUEA 2E2IC 4A3BK 3GTJC 3TFHA 1O27A 2E2HA 3HOVC 2NVXK 4LQYA 3QX3A 5M5WK 3GTLC 1EH1A 1IW7A 3ERED 4BLAA 4BXXK 4G7OA 3T02A 4A93C 1AB4A 2YU9K 1J6WA 3GTKK 4OIOA 3S1RC 4FZBA 4P5AA 1JOEA 2PA8D 3S14C 3M4OK 3G4AA 3HOWC 1TWFC 2GAHC 2R7ZA 1PJ5A 3LPXA 3GTPA 4WFAS 3T00A 4C3HK 4KMHA 1I3QA 4FM9A 2R92A 1INNA 1TWGK 5JVHS 4OIRA 2JH3A 4BY7K 1EQRA 5C4JK 1VLOA 2JA5K 2KWAA 5IYCC 4Y52C 5C4XK 2GSUA 2ZUEA 1B4AA 5M5YK 2V6TA 4BY1C 3BP8C 1VRQC 4G0UA 1SFOK 4GTBA 3V4GA 4C3IK 2R93C 3PIOS 3GTOA 3IPJA 2L3UA 2E2IA 3DLLS 3GTJA 5C3EC 4KARA 2NVYC 5CHPA 1I50K 4Y7NC 4MEYA 4A3DC 5TJ3A 3S2HK 1XZQA 2P8TA 5M3MK 5IOQA 4C3JC 4MQ9A 3Q3QA 4NOIA 1O2BA 3A8IA 1WCMC 4IOCS 3CAGA 3H0GK 3LAPA 2GSNA 5TMCA 1O29A 3HKZL 4RMFA 3K7AC 5M5XK 2KPUA 1WOPA 4IO9S 4A3JC 5D4DA 1EK8A 3FKIC 4QJVB 1XZQB 2A6EA 4A3MC 4KM8A 3OREA 5M3FK 1X31C 3GTQC 2R93A 1WQGA 3HOYK 3PO2K 2V6UA 4KB2A 2B63C 5EGHA 3MMLB 4M1XA 3GTGC 4AH6A 3I4NK 2NVXC 2ZJQS 2O5IA 1DD5A 3FHZA 2Y0SL 3BP3A 1HQMA 2R7ZC 3GTPC 2NVQC 1WCMA 4BLBA 1I3QC 2A69A 2WB1L 4X6AK 4A3LK 3PO3K 5IP9K 1YNNA 3HOXK 1IS1A 4A3FK 2E2JK 4BBSK 2JA8K 5TMFA 2A6HA 4BY7C 1YX2A 2JA6K 2JA5C 1R9TC 3I4MK 1TWHK 1BJTA 3GTQA 4KMDA 3S16C 2JA7A 3GDZA 4C3IC 1Y1VC 1PJ7A 4MEXA 1B4BA 2B63A 1J6VA 3N0CA 1XXCA 1XXBA 3GTGA 2NVXA 1JVIA 4G0WA 4BKWA 5E68A 5EGEA 1WQFA 1TWAK 3CF5S 3FOFA 2YU9A 3GTKA 1IL2A 5IYBC 3HOZC 2E2HK 1YNJA 1TWCK 3AQOA 2WAQL 3M3YC 3S2DC 5DM7S 3S1MK 4YFKA 3LAJA 4XSXA 1BDFA 4LLGA 3TFJA 4A3KK 4YFNA 4YG2A 2ZJPS 1XPPA 3RZOC 3GTMC 3GIRA 3CQZC 4KAWX 2VUMK 4A3CK 3AD7C 4A3GC 4A3IC 2JA5A 4G7ZA 1R9TA 2P5MA 4A3EK 4DDQA 4LK0A 2NVTC 4WFNS 2CW0A 1G51A 2PA8L 5C44C 4KATA 4GTAA 1I6HC 3S1QK 3L4JA 3TFIA 1Y1VA 4WF9S 3RZDK 3S15C 2PHCB 2L5NA 3EQLA 4LJZA 5FLMK 3H3VD 1HI9A 1K83K 5IYDC 4OIQA 4BBRC 3N0BA 3S17C 2A68A 1O25A 3G4CA 2V6SA 4XSZA 4C2MC 3GTJK 3HOVK 3S1NC 3GTLK 1XZPA 3OPFA 2XCOA 5IOTA 5HL8A 4AYBD 4A93K 1O26A 4KDDA 1RU0A 2CFAA 3H0GA 1PJ6A 4X6AC 1DCPA 3GTMA 3CQZA 4G7HA 2Y3PA 3S14K 3HOUC 3HOWK 4IOAS 1TWFK 3AD9C 4JK1A 1ZQ1C 3WODA 2JA6C 4U67S 2JA7C 2ZJRS 1J6XA 5DM6S 5IOSA 2PMZD 4A3BC 4P5BA 1USMA 4Y52K 1UV7A 4BY1K 4XCHA 2CFAB 4GTEA 4BXXC 2GSOA 1DCHA 1VGXA 2YU9C 3GTKC 4QIWD 1XXAA 3ADAC 2W7VA 1ZBSA 3A8KA 3AQPA 3N3YA 2NVYK 2O5JA 3M4OC 4YFXA 4A3DK 4C3HC 1DCOA 1TWGC 4C3JK 5HL7S 5C4JC 1WOSA 1WIHA 5C4XC 3TTGA 2VUMC 4A3CC 1USOA 2BE5A 1VH2A 4GTDA 3SZYA 2JA6A 3S0XA 1ISEA 2FQTA 3K7AK 3VA7A 1SFOC 1TWHA 1Y1WK 4A3JK 4PAAA 3HXAA 1ZVUA 3FKIK 1I50C 1F9NA 5FLMC 4ILDA 4WFBS 4A3MK 2WAQD 3S2HC 4C45A 1I6VA 3NUHA 1ZXOA 4Q4ZA 4KMUA 2B63K 1WSVA 3GTGK 1EI6A 5IORA 1TWCA 1IBAA 3H0GC 3OEPA 4LR2A 1IE0A 3AH5A 5JVOA 1L0WA 1TWGA 3AD8C 1FEUA 2KXYA 2R7ZK 1WQHA 3GTPK 4OIPA 2NVQK 1I3QK 2R92K 1BS2A 2VUMA 3GEIA 2RGRA 4G0VA 3T01A 5CJ9A 4LOWA 4P9SA 1SFOA 5IP7K 1ZYRA 3HOYC 3PO2C 1BGWA 1I50A 1R9TK 1WSRA 1K83A 3I4NC 3GTOK 1KQ4A 2E2IK 4LK1A 3GEEA 1O24A 3S16K 1Y1VK 3HKZD 4KM9A 4KMAA 4ZH4A 2XCQA 3GTLA 4PABA 3S1RK 3LYWA 1O28A 1IQ0A 4QJVA 4J3NA 1WOOA 5IYBK 4A3LC 3PO3C 4Q5SA 3HOZK 5IP9C 4OINA 3HOXC 3H3VL 4A3FC 4BBSC 2E2JC 1F7VA 2JA8C 4WCES 3M3YK 3S2DK 1EFWA 5HQHA 4KN7A 1TWFA 2ZFZA 1GE9A 2FQOA 3I4MC 1TWHC 4GTCA 4O2DA 3RZOK 3GTMK 1XZPB 3CQZK 1V5VA 3JSTA 4KASA 1WORA 5IYCK 4AYBL 4A3GK 2Y0SD 4A3IK 1Y1WC 4GTFA 3SZZA 3DXJA 2R93K 2NVTK 2GAGC 4XLNA 2ZUFA 2WB1D 4GTLA 5C44K 1I6HK 1TWAC 3A8JA 5C3EK 1F7UA 2RH6A 3S15K 4Y7NK 2E2HC 5IYDK 1VJEA 1TWCC 1JQWA 2NVYA 4BBRK 5JVGS 3S1MC 3S17K 4A3KC 1SMYA 2PMZL 4C2MK 3FOEA 4KB4A 3S1NK
chains in the Genus database with same CATH topology
3EQLA 2B63K 1WCMK 4LJZA 4A3JC 5FLMK 3H3VD 2PPBA 1K83K 5IYDC 4OIQA 3GTGK 5D4DA 3FKIC 4BBRC 4QJVB 2A6EA 4GZYA 3H0GC 3S17C 2A68A 2R92C 4QIWL 4A3EC 4A3MC 5M3FK 3GTQC 4XSZA 3HOUK 4C2MC 3S1QC 3GTJK 3HOYK 5IP7C 3HOVK 2R7ZK 5FJ8K 3PO2K 3GTPK 3S1NC 3RZDC 3GTLK 4OIPA 2NVQK 2B63C 1K83C 4AYBD 1I3QK 2R92K 3GTGC 3I4NK 2NVXC 4A93K 3GTQK 4KN4A 2O5IA 2JA7K 4XLPA 5IP7K 3GTOC 4X6AC 4G7HA 2E2IC 2Y0SL 1ZYRA 3HOUC 3S14K 4A3BK 1HQMA 3GTJC 3HOYC 3HOWK 3PO2C 2R7ZC 3HOVC 1TWFK 3GTPC 2NVXK 5M5WK 3GTLC 4JK1A 1IW7A 2NVQC 3WODA 1R9TK 1I3QC 2A69A 4BXXK 3I4NC 4G7OA 2WB1L 4A93C 3GTOK 4X6AK 2JA6C 2YU9K 3GTKK 4OIOA 3S1RC 4LK1A 2E2IK 4A3LK 3PO3K 2JA7C 5IP9K 3S16K 1YNNA 3HOXK 4A3FK 4BBSK 1Y1VK 3HKZD 2E2JK 2PMZD 2PA8D 3S14C 2JA8K 3M4OK 5TMFA 4A3BC 2A6HA 4ZH4A 3HOWC 4BY7C 1TWFC 4Y52K 4BY1K 2JA5C 2JA6K 1R9TC 4C3HK 3S1RK 4BXXC 4Q4ZA 3I4MK 1TWHK 2YU9C 3GTKC 4QJVA 1TWGK 4OIRA 4QIWD 5IYBK 4A3LC 3PO3C 4Q5SA 3HOZK 5IP9C 3S16C 4OINA 3HOXC 4BY7K 3H3VL 4C3IC 4A3FC 1Y1VC 2E2JC 4BBSC 2NVYK 5C4JK 2O5JA 4MEXA 2JA5K 2JA8C 3M3YK 3M4OC 3S2DK 5IYCC 4Y52C 5C4XK 4YFXA 4KN7A 4A3DK 5M5YK 4BY1C 4C3HC 1SFOK 3I4MC 1TWHC 1TWAK 4C3IK 2R93C 3GTMK 3RZOK 3CQZK 1TWGC 4C3JK 5IYBC 3HOZC 5IYCK 2E2HK 5C3EC 1YNJA 4AYBL 1TWCK 2NVYC 5C4JC 4A3GK 2Y0SD 4A3IK 2WAQL 1Y1WC 4Y7NC 3M3YC 3S2DC 1I50K 4MEYA 5C4XC 3S1MK 2VUMC 3DXJA 4A3CC 4A3DC 4YFKA 2BE5A 4XSXA 2NVTK 2R93K 1BDFA 4LLGA 4XLNA 3S2HK 4A3KK 4YFNA 3K7AK 2WB1D 4YG2A 5C44K 1SFOC 1XPPA 3RZOC 1TWAC 5C3EK 5M3MK 1I6HK 3GTMC 3CQZC 3S15K 4C3JC 4Y7NK 1Y1WK 4MQ9A 4A3JK 4NOIA 2E2HC 2VUMK 5IYDK 4A3CK 1TWCC 3FKIK 4BBRK 4A3GC 4A3IC 1I50C 1WCMC 4G7ZA 5FLMC 3H0GK 3S1MC 3S17K 4A3EK 4A3MK 2WAQD 4LK0A 5TMCA 2NVTC 3S2HC 2CW0A 3HKZL 1I6VA 4A3KC 3K7AC 1SMYA 2PA8L 5C44C 2PMZL 4C2MK 1I6HC 5M5XK 3S1QK 4KMUA 3S1NK 3RZDK 3S15C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EQL A;  2B63 K;  1WCM K;  4LJZ A;  4A3J C;  5FLM K;  3H3V D;  2PPB A;  1K83 K;  5IYD C;  4OIQ A;  3GTG K;  5D4D A;  3FKI C;  4BBR C;  4QJV B;  2A6E A;  4GZY A;  3H0G C;  3S17 C;  2A68 A;  2R92 C;  4QIW L;  4A3E C;  4A3M C;  5M3F K;  3GTQ C;  4XSZ A;  3HOU K;  4C2M C;  3S1Q C;  3GTJ K;  3HOY K;  5IP7 C;  3HOV K;  2R7Z K;  5FJ8 K;  3PO2 K;  3GTP K;  3S1N C;  3RZD C;  3GTL K;  4OIP A;  2NVQ K;  2B63 C;  1K83 C;  4AYB D;  1I3Q K;  2R92 K;  3GTG C;  3I4N K;  2NVX C;  4A93 K;  3GTQ K;  4KN4 A;  2O5I A;  2JA7 K;  4XLP A;  5IP7 K;  3GTO C;  4X6A C;  4G7H A;  2E2I C;  2Y0S L;  1ZYR A;  3HOU C;  3S14 K;  4A3B K;  1HQM A;  3GTJ C;  3HOY C;  3HOW K;  3PO2 C;  2R7Z C;  3HOV C;  1TWF K;  3GTP C;  2NVX K;  5M5W K;  3GTL C;  4JK1 A;  1IW7 A;  2NVQ C;  3WOD A;  1R9T K;  1I3Q C;  2A69 A;  4BXX K;  3I4N C;  4G7O A;  2WB1 L;  4A93 C;  3GTO K;  4X6A K;  2JA6 C;  2YU9 K;  3GTK K;  4OIO A;  3S1R C;  4LK1 A;  2E2I K;  4A3L K;  3PO3 K;  2JA7 C;  5IP9 K;  3S16 K;  1YNN A;  3HOX K;  4A3F K;  4BBS K;  1Y1V K;  3HKZ D;  2E2J K;  2PMZ D;  2PA8 D;  3S14 C;  2JA8 K;  3M4O K;  5TMF A;  4A3B C;  2A6H A;  4ZH4 A;  3HOW C;  4BY7 C;  1TWF C;  4Y52 K;  4BY1 K;  2JA5 C;  2JA6 K;  1R9T C;  4C3H K;  3S1R K;  4BXX C;  4Q4Z A;  3I4M K;  1TWH K;  2YU9 C;  3GTK C;  4QJV A;  1TWG K;  4OIR A;  4QIW D;  5IYB K;  4A3L C;  3PO3 C;  4Q5S A;  3HOZ K;  5IP9 C;  3S16 C;  4OIN A;  3HOX C;  4BY7 K;  3H3V L;  4C3I C;  4A3F C;  1Y1V C;  2E2J C;  4BBS C;  2NVY K;  5C4J K;  2O5J A;  4MEX A;  2JA5 K;  2JA8 C;  3M3Y K;  3M4O C;  3S2D K;  5IYC C;  4Y52 C;  5C4X K;  4YFX A;  4KN7 A;  4A3D K;  5M5Y K;  4BY1 C;  4C3H C;  1SFO K;  3I4M C;  1TWH C;  1TWA K;  4C3I K;  2R93 C;  3GTM K;  3RZO K;  3CQZ K;  1TWG C;  4C3J K;  5IYB C;  3HOZ C;  5IYC K;  2E2H K;  5C3E C;  1YNJ A;  4AYB L;  1TWC K;  2NVY C;  5C4J C;  4A3G K;  2Y0S D;  4A3I K;  2WAQ L;  1Y1W C;  4Y7N C;  3M3Y C;  3S2D C;  1I50 K;  4MEY A;  5C4X C;  3S1M K;  2VUM C;  3DXJ A;  4A3C C;  4A3D C;  4YFK A;  2BE5 A;  4XSX A;  2NVT K;  2R93 K;  1BDF A;  4LLG A;  4XLN A;  3S2H K;  4A3K K;  4YFN A;  3K7A K;  2WB1 D;  4YG2 A;  5C44 K;  1SFO C;  1XPP A;  3RZO C;  1TWA C;  5C3E K;  5M3M K;  1I6H K;  3GTM C;  3CQZ C;  3S15 K;  4C3J C;  4Y7N K;  1Y1W K;  4MQ9 A;  4A3J K;  4NOI A;  2E2H C;  2VUM K;  5IYD K;  4A3C K;  1TWC C;  3FKI K;  4BBR K;  4A3G C;  4A3I C;  1I50 C;  1WCM C;  4G7Z A;  5FLM C;  3H0G K;  3S1M C;  3S17 K;  4A3E K;  4A3M K;  2WAQ D;  4LK0 A;  5TMC A;  2NVT C;  3S2H C;  2CW0 A;  3HKZ L;  1I6V A;  4A3K C;  3K7A C;  1SMY A;  2PA8 L;  5C44 C;  2PMZ L;  4C2M K;  1I6H C;  5M5X K;  3S1Q K;  4KMU A;  3S1N K;  3RZD K;  3S15 C; 
#chains in the Genus database with same CATH topology
 2D6F C;  1WCM K;  3PIP S;  4KC6 A;  1YCL A;  2PPB A;  4WJ3 M;  2XCR B;  1O2A A;  2EBB A;  4GZY A;  4QIW L;  2R92 C;  4A3E C;  3GEH A;  3HOU K;  3S1Q C;  4GFQ A;  2KQ1 A;  3GSI A;  5IP7 C;  5FJ8 K;  3RZD C;  1J98 A;  5L46 A;  1O2F B;  4WIL A;  1Y1W A;  1K83 C;  4WJ4 A;  3FKI A;  3L4K A;  3GTQ K;  4KN4 A;  1F93 A;  1C0A A;  5JFE A;  4GT9 A;  2JA7 K;  4XLP A;  3GTO C;  1TWA A;  3BUE A;  2E2I C;  4A3B K;  3GTJ C;  3TFH A;  1O27 A;  2E2H A;  3HOV C;  2NVX K;  4LQY A;  3QX3 A;  5M5W K;  3GTL C;  1EH1 A;  1IW7 A;  3ERE D;  4BLA A;  4BXX K;  4G7O A;  3T02 A;  4A93 C;  1AB4 A;  2YU9 K;  1J6W A;  3GTK K;  4OIO A;  3S1R C;  4FZB A;  4P5A A;  1JOE A;  2PA8 D;  3S14 C;  3M4O K;  3G4A A;  3HOW C;  1TWF C;  2GAH C;  2R7Z A;  1PJ5 A;  3LPX A;  3GTP A;  4WFA S;  3T00 A;  4C3H K;  4KMH A;  1I3Q A;  4FM9 A;  2R92 A;  1INN A;  1TWG K;  5JVH S;  4OIR A;  2JH3 A;  4BY7 K;  1EQR A;  5C4J K;  1VLO A;  2JA5 K;  2KWA A;  5IYC C;  4Y52 C;  5C4X K;  2GSU A;  2ZUE A;  1B4A A;  5M5Y K;  2V6T A;  4BY1 C;  3BP8 C;  1VRQ C;  4G0U A;  1SFO K;  4GTB A;  3V4G A;  4C3I K;  2R93 C;  3PIO S;  3GTO A;  3IPJ A;  2L3U A;  2E2I A;  3DLL S;  3GTJ A;  5C3E C;  4KAR A;  2NVY C;  5CHP A;  1I50 K;  4Y7N C;  4MEY A;  4A3D C;  5TJ3 A;  3S2H K;  1XZQ A;  2P8T A;  5M3M K;  5IOQ A;  4C3J C;  4MQ9 A;  3Q3Q A;  4NOI A;  1O2B A;  3A8I A;  1WCM C;  4IOC S;  3CAG A;  3H0G K;  3LAP A;  2GSN A;  5TMC A;  1O29 A;  3HKZ L;  4RMF A;  3K7A C;  5M5X K;  2KPU A;  1WOP A;  4IO9 S;  4A3J C;  5D4D A;  1EK8 A;  3FKI C;  4QJV B;  1XZQ B;  2A6E A;  4A3M C;  4KM8 A;  3ORE A;  5M3F K;  1X31 C;  3GTQ C;  2R93 A;  1WQG A;  3HOY K;  3PO2 K;  2V6U A;  4KB2 A;  2B63 C;  5EGH A;  3MML B;  4M1X A;  3GTG C;  4AH6 A;  3I4N K;  2NVX C;  2ZJQ S;  2O5I A;  1DD5 A;  3FHZ A;  2Y0S L;  3BP3 A;  1HQM A;  2R7Z C;  3GTP C;  2NVQ C;  1WCM A;  4BLB A;  1I3Q C;  2A69 A;  2WB1 L;  4X6A K;  4A3L K;  3PO3 K;  5IP9 K;  1YNN A;  3HOX K;  1IS1 A;  4A3F K;  2E2J K;  4BBS K;  2JA8 K;  5TMF A;  2A6H A;  4BY7 C;  1YX2 A;  2JA6 K;  2JA5 C;  1R9T C;  3I4M K;  1TWH K;  1BJT A;  3GTQ A;  4KMD A;  3S16 C;  2JA7 A;  3GDZ A;  4C3I C;  1Y1V C;  1PJ7 A;  4MEX A;  1B4B A;  2B63 A;  1J6V A;  3N0C A;  1XXC A;  1XXB A;  3GTG A;  2NVX A;  1JVI A;  4G0W A;  4BKW A;  5E68 A;  5EGE A;  1WQF A;  1TWA K;  3CF5 S;  3FOF A;  2YU9 A;  3GTK A;  1IL2 A;  5IYB C;  3HOZ C;  2E2H K;  1YNJ A;  1TWC K;  3AQO A;  2WAQ L;  3M3Y C;  3S2D C;  5DM7 S;  3S1M K;  4YFK A;  3LAJ A;  4XSX A;  1BDF A;  4LLG A;  3TFJ A;  4A3K K;  4YFN A;  4YG2 A;  2ZJP S;  1XPP A;  3RZO C;  3GTM C;  3GIR A;  3CQZ C;  4KAW X;  2VUM K;  4A3C K;  3AD7 C;  4A3G C;  4A3I C;  2JA5 A;  4G7Z A;  1R9T A;  2P5M A;  4A3E K;  4DDQ A;  4LK0 A;  2NVT C;  4WFN S;  2CW0 A;  1G51 A;  2PA8 L;  5C44 C;  4KAT A;  4GTA A;  1I6H C;  3S1Q K;  3L4J A;  3TFI A;  1Y1V A;  4WF9 S;  3RZD K;  3S15 C;  2PHC B;  2L5N A;  3EQL A;  4LJZ A;  5FLM K;  3H3V D;  1HI9 A;  1K83 K;  5IYD C;  4OIQ A;  4BBR C;  3N0B A;  3S17 C;  2A68 A;  1O25 A;  3G4C A;  2V6S A;  4XSZ A;  4C2M C;  3GTJ K;  3HOV K;  3S1N C;  3GTL K;  1XZP A;  3OPF A;  2XCO A;  5IOT A;  5HL8 A;  4AYB D;  4A93 K;  1O26 A;  4KDD A;  1RU0 A;  2CFA A;  3H0G A;  1PJ6 A;  4X6A C;  1DCP A;  3GTM A;  3CQZ A;  4G7H A;  2Y3P A;  3S14 K;  3HOU C;  3HOW K;  4IOA S;  1TWF K;  3AD9 C;  4JK1 A;  1ZQ1 C;  3WOD A;  2JA6 C;  4U67 S;  2JA7 C;  2ZJR S;  1J6X A;  5DM6 S;  5IOS A;  2PMZ D;  4A3B C;  4P5B A;  1USM A;  4Y52 K;  1UV7 A;  4BY1 K;  4XCH A;  2CFA B;  4GTE A;  4BXX C;  2GSO A;  1DCH A;  1VGX A;  2YU9 C;  3GTK C;  4QIW D;  1XXA A;  3ADA C;  2W7V A;  1ZBS A;  3A8K A;  3AQP A;  3N3Y A;  2NVY K;  2O5J A;  3M4O C;  4YFX A;  4A3D K;  4C3H C;  1DCO A;  1TWG C;  4C3J K;  5HL7 S;  5C4J C;  1WOS A;  1WIH A;  5C4X C;  3TTG A;  2VUM C;  4A3C C;  1USO A;  2BE5 A;  1VH2 A;  4GTD A;  3SZY A;  2JA6 A;  3S0X A;  1ISE A;  2FQT A;  3K7A K;  3VA7 A;  1SFO C;  1TWH A;  1Y1W K;  4A3J K;  4PAA A;  3HXA A;  1ZVU A;  3FKI K;  1I50 C;  1F9N A;  5FLM C;  4ILD A;  4WFB S;  4A3M K;  2WAQ D;  3S2H C;  4C45 A;  1I6V A;  3NUH A;  1ZXO A;  4Q4Z A;  4KMU A;  2B63 K;  1WSV A;  3GTG K;  1EI6 A;  5IOR A;  1TWC A;  1IBA A;  3H0G C;  3OEP A;  4LR2 A;  1IE0 A;  3AH5 A;  5JVO A;  1L0W A;  1TWG A;  3AD8 C;  1FEU A;  2KXY A;  2R7Z K;  1WQH A;  3GTP K;  4OIP A;  2NVQ K;  1I3Q K;  2R92 K;  1BS2 A;  2VUM A;  3GEI A;  2RGR A;  4G0V A;  3T01 A;  5CJ9 A;  4LOW A;  4P9S A;  1SFO A;  5IP7 K;  1ZYR A;  3HOY C;  3PO2 C;  1BGW A;  1I50 A;  1R9T K;  1WSR A;  1K83 A;  3I4N C;  3GTO K;  1KQ4 A;  2E2I K;  4LK1 A;  3GEE A;  1O24 A;  3S16 K;  1Y1V K;  3HKZ D;  4KM9 A;  4KMA A;  4ZH4 A;  2XCQ A;  3GTL A;  4PAB A;  3S1R K;  3LYW A;  1O28 A;  1IQ0 A;  4QJV A;  4J3N A;  1WOO A;  5IYB K;  4A3L C;  3PO3 C;  4Q5S A;  3HOZ K;  5IP9 C;  4OIN A;  3HOX C;  3H3V L;  4A3F C;  4BBS C;  2E2J C;  1F7V A;  2JA8 C;  4WCE S;  3M3Y K;  3S2D K;  1EFW A;  5HQH A;  4KN7 A;  1TWF A;  2ZFZ A;  1GE9 A;  2FQO A;  3I4M C;  1TWH C;  4GTC A;  4O2D A;  3RZO K;  3GTM K;  1XZP B;  3CQZ K;  1V5V A;  3JST A;  4KAS A;  1WOR A;  5IYC K;  4AYB L;  4A3G K;  2Y0S D;  4A3I K;  1Y1W C;  4GTF A;  3SZZ A;  3DXJ A;  2R93 K;  2NVT K;  2GAG C;  4XLN A;  2ZUF A;  2WB1 D;  4GTL A;  5C44 K;  1I6H K;  1TWA C;  3A8J A;  5C3E K;  1F7U A;  2RH6 A;  3S15 K;  4Y7N K;  2E2H C;  5IYD K;  1VJE A;  1TWC C;  1JQW A;  2NVY A;  4BBR K;  5JVG S;  3S1M C;  3S17 K;  4A3K C;  1SMY A;  2PMZ L;  4C2M K;  3FOE A;  4KB4 A;  3S1N K; 
#chains in the Genus database with same CATH homology
 3EQL A;  2B63 K;  1WCM K;  4LJZ A;  4A3J C;  5FLM K;  3H3V D;  2PPB A;  1K83 K;  5IYD C;  4OIQ A;  3GTG K;  5D4D A;  3FKI C;  4BBR C;  4QJV B;  2A6E A;  4GZY A;  3H0G C;  3S17 C;  2A68 A;  2R92 C;  4QIW L;  4A3E C;  4A3M C;  5M3F K;  3GTQ C;  4XSZ A;  3HOU K;  4C2M C;  3S1Q C;  3GTJ K;  3HOY K;  5IP7 C;  3HOV K;  2R7Z K;  5FJ8 K;  3PO2 K;  3GTP K;  3S1N C;  3RZD C;  3GTL K;  4OIP A;  2NVQ K;  2B63 C;  1K83 C;  4AYB D;  1I3Q K;  2R92 K;  3GTG C;  3I4N K;  2NVX C;  4A93 K;  3GTQ K;  4KN4 A;  2O5I A;  2JA7 K;  4XLP A;  5IP7 K;  3GTO C;  4X6A C;  4G7H A;  2E2I C;  2Y0S L;  1ZYR A;  3HOU C;  3S14 K;  4A3B K;  1HQM A;  3GTJ C;  3HOY C;  3HOW K;  3PO2 C;  2R7Z C;  3HOV C;  1TWF K;  3GTP C;  2NVX K;  5M5W K;  3GTL C;  4JK1 A;  1IW7 A;  2NVQ C;  3WOD A;  1R9T K;  1I3Q C;  2A69 A;  4BXX K;  3I4N C;  4G7O A;  2WB1 L;  4A93 C;  3GTO K;  4X6A K;  2JA6 C;  2YU9 K;  3GTK K;  4OIO A;  3S1R C;  4LK1 A;  2E2I K;  4A3L K;  3PO3 K;  2JA7 C;  5IP9 K;  3S16 K;  1YNN A;  3HOX K;  4A3F K;  4BBS K;  1Y1V K;  3HKZ D;  2E2J K;  2PMZ D;  2PA8 D;  3S14 C;  2JA8 K;  3M4O K;  5TMF A;  4A3B C;  2A6H A;  4ZH4 A;  3HOW C;  4BY7 C;  1TWF C;  4Y52 K;  4BY1 K;  2JA5 C;  2JA6 K;  1R9T C;  4C3H K;  3S1R K;  4BXX C;  4Q4Z A;  3I4M K;  1TWH K;  2YU9 C;  3GTK C;  4QJV A;  1TWG K;  4OIR A;  4QIW D;  5IYB K;  4A3L C;  3PO3 C;  4Q5S A;  3HOZ K;  5IP9 C;  3S16 C;  4OIN A;  3HOX C;  4BY7 K;  3H3V L;  4C3I C;  4A3F C;  1Y1V C;  2E2J C;  4BBS C;  2NVY K;  5C4J K;  2O5J A;  4MEX A;  2JA5 K;  2JA8 C;  3M3Y K;  3M4O C;  3S2D K;  5IYC C;  4Y52 C;  5C4X K;  4YFX A;  4KN7 A;  4A3D K;  5M5Y K;  4BY1 C;  4C3H C;  1SFO K;  3I4M C;  1TWH C;  1TWA K;  4C3I K;  2R93 C;  3GTM K;  3RZO K;  3CQZ K;  1TWG C;  4C3J K;  5IYB C;  3HOZ C;  5IYC K;  2E2H K;  5C3E C;  1YNJ A;  4AYB L;  1TWC K;  2NVY C;  5C4J C;  4A3G K;  2Y0S D;  4A3I K;  2WAQ L;  1Y1W C;  4Y7N C;  3M3Y C;  3S2D C;  1I50 K;  4MEY A;  5C4X C;  3S1M K;  2VUM C;  3DXJ A;  4A3C C;  4A3D C;  4YFK A;  2BE5 A;  4XSX A;  2NVT K;  2R93 K;  1BDF A;  4LLG A;  4XLN A;  3S2H K;  4A3K K;  4YFN A;  3K7A K;  2WB1 D;  4YG2 A;  5C44 K;  1SFO C;  1XPP A;  3RZO C;  1TWA C;  5C3E K;  5M3M K;  1I6H K;  3GTM C;  3CQZ C;  3S15 K;  4C3J C;  4Y7N K;  1Y1W K;  4MQ9 A;  4A3J K;  4NOI A;  2E2H C;  2VUM K;  5IYD K;  4A3C K;  1TWC C;  3FKI K;  4BBR K;  4A3G C;  4A3I C;  1I50 C;  1WCM C;  4G7Z A;  5FLM C;  3H0G K;  3S1M C;  3S17 K;  4A3E K;  4A3M K;  2WAQ D;  4LK0 A;  5TMC A;  2NVT C;  3S2H C;  2CW0 A;  3HKZ L;  1I6V A;  4A3K C;  3K7A C;  1SMY A;  2PA8 L;  5C44 C;  2PMZ L;  4C2M K;  1I6H C;  5M5X K;  3S1Q K;  4KMU A;  3S1N K;  3RZD K;  3S15 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...