1HQMA

Crystal structure of thermus aquaticus core rna polymerase-includes complete structure with side-chains (except for disordered regions)-further refined from original deposition-contains additional sequence information
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
223
structure length
223
Chain Sequence
b'LKAPVFTATTQGDHYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLDPRWRTTLILRAEGPKEVRAVDFTPSADVEIMNPDLHIATLEEGGKLYMEVRVDRGVGYVPAERHGIKDRINAIPVDAIFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVAILKEHLNYFANPE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase subunit alpha
publication title Bacterial RNA polymerase subunit omega and eukaryotic RNA polymerase subunit RPB6 are sequence, structural, and functional homologs and promote RNA polymerase assembly.
pubmed doi rcsb
molecule tags Transferase
total genus 31
structure length 223
sequence length 223
chains with identical sequence B
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2000-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01000 RNA_pol_A_bac RNA polymerase Rpb3/RpoA insert domain
A PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain
A PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.12 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 DNA-directed RNA polymerase, insert domain 1hqmA02
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 1hqmA01
2E2HK 5FLMC 4LK0A 4XLPA 1I6VA 3HOWC 2E2JC 1I50K 4A3EK 3CQZC 3S15K 1SFOK 4A3DK 3RZDC 5M3FK 4BY7K 4Q5SA 4MEXA 2PA8L 4A3IC 3PO2C 1I6HK 3RZOC 5C4XC 4A3KK 4OIRA 5C44K 5IYDK 5IP9C 2JA6K 3I4MK 4C2MC 3S2HK 4Y52C 1YNNA 3K7AC 2VUMC 2NVTK 4A93K 2A6HA 4YFNA 1TWHC 4KMUA 4C3IC 4BXXK 5TMCA 1TWFC 4BBSK 2VUMK 4C3HC 4A3LK 3HOUK 3S1NK 4Y7NC 1TWGK 4MQ9A 1TWAK 5M3MK 3S14K 2E2IK 4JK1A 4C3IK 1R9TK 3WODA 4LJZA 4QJVA 1IW7A 4Q4ZA 4BBRK 2JA7C 2E2HC 4A3CK 5C3EK 4ZH4A 3GTMK 1I50C 4A3EC 3S15C 4KN7A 1SFOC 3GTGK 4XSZA 1ZYRA 1I3QK 3H0GK 2JA7K 4BY7C 2NVXK 2B63K 3HOVK 1I6HC 3GTKK 4A3KC 5C44C 5IYDC 2JA6C 3I4MC 3S1RK 3S2HC 4A93C 2NVTC 2YU9K 2R93K 3GTOK 4A3JC 5FJ8K 3S16K 2R92C 4BXXC 3I4NK 4LLGA 4A3LC 3HOUC 3S1NC 1TWGC 4XLNA 4KN4A 4OIPA 5M5WK 4A3JK 1TWAC 3S14C 2R92K 2E2IC 1R9TC 3DXJA 1BDFA 4BBRC 2R7ZK 4A3CC 5C3EC 2JA8K 1WCMK 3GTMC 3GTGC 2A69A 3S17K 3HKZD 4QIWD 1I3QC 3H0GC 2PPBA 4AYBD 4A3BK 2NVXC 1HQMA 2B63C 2BE5A 3S1MK 4MEYA 3HOVC 4OIOA 3GTKC 3GTJK 3HOYK 3GTPK 4QJVB 3S1RC 1Y1VK 3S2DC 2YU9C 2R93C 1YNJA 3GTOC 3S16C 3GTQK 4G7ZA 2Y0SD 2NVQK 2A68A 3I4NC 3FKIK 4QIWL 4BY1K 3M4OK 3S2DK 4GZYA 4AYBL 2WAQD 3EQLA 2WB1D 4NOIA 5IYBK 1K83K 4YFXA 2R7ZC 3S1QK 2JA8C 1WCMC 4A3MK 4C3JK 3S17C 4BBSC 2PA8D 5M5YK 2Y0SL 5C4JK 3GTLK 1TWCC 4A3FK 3PO3C 4A3BC 3M3YK 3H3VD 3S1MC 4LK1A 2NVYK 3HOYC 3GTJC 4OINA 2WAQL 5IYCK 3GTPC 2WB1L 5D4DA 5TMFA 3HOXK 1TWCK 3HOZK 4YG2A 1Y1VC 3PO3K 2CW0A 5IP7K 2JA5K 4A3GK 3GTQC 1Y1WK 4X6AK 2NVQC 5M5XK 2PMZD 5FLMK 4G7OA 3FKIC 4BY1C 3M4OC 4XSXA 2E2JK 3CQZK 3HOWK 1XPPA 3RZDK 3H3VL 5IYBC 3HKZL 2A6EA 1K83C 4A3IK 3PO2K 3S1QC 5C4XK 3RZOK 4A3MC 1SMYA 4C3JC 5IP9K 4C2MK 4OIQA 4Y52K 5C4JC 3GTLC 3K7AK 2PMZL 4A3FC 3M3YC 4YFKA 2O5JA 4G7HA 1TWHK 2NVYC 5IYCC 1TWFK 3HOZC 4C3HK 3HOXC 4Y7NK 4A3DC 5IP7C 2JA5C 4A3GC 4X6AC 1Y1WC 2O5IA
chains in the Genus database with same CATH superfamily
1C0AA 3S15K 1PJ7A 2L3UA 3RZDC 1RU0A 3PO2C 1I6HK 3RZOC 3SZYA 2VUMC 4C45A 1K83A 2NVTK 4GTEA 1WQHA 4PAAA 1J6WA 4KM8A 1O25A 4A3LK 3HOUK 1KQ4A 4KDDA 4J3NA 3S14K 4JK1A 1R9TK 1FEUA 4Q4ZA 1IW7A 1EI6A 2E2HC 1F9NA 1DCOA 4A3EC 1SFOC 4XSZA 1I3QK 1F7UA 3CAGA 3GTKK 4A3KC 5C44C 5IYDC 2ZUFA 3S1RK 4GTBA 4A93C 5DM7S 5FJ8K 4KM9A 3I4NK 3S1NC 4KN4A 4XLNA 5M5WK 1TWAC 1R9TA 2R92K 2GAHC 4FM9A 3QX3A 2R7ZK 3VA7A 3GTMC 3GTGC 2CFAA 1I3QA 5HL8A 3GTKA 4OIOA 3G4AA 4WFBS 1Y1VK 3N0BA 4FZBA 2JA6A 1JVIA 2R92A 3S0XA 1O29A 1INNA 4KAWX 4YFXA 2R7ZA 4WFAS 4KATA 3LAJA 4KMHA 4BLBA 2E2IA 2PA8D 5C4JK 2ZJRS 3M3YK 3PO3C 4A3BC 2RGRA 2XCRB 2NVYK 3HOYC 1O2AA 4OINA 3HOZK 5TMFA 2ZFZA 3A8JA 1TWCK 4YG2A 3AQOA 2B63A 4A3GK 2D6FC 3TTGA 5M5XK 1WSVA 3FOEA 4KB2A 4G7OA 3FKIC 3M4OC 1B4AA 4XSXA 1VRQC 3RZDK 5IOQA 3HKZL 3PO2K 3RZOK 1G51A 1ZBSA 1SMYA 4C3JC 1PJ5A 3LYWA 3GTLC 4YFKA 4G7HA 2NVYA 5IYCC 3GIRA 4WILA 1TWCA 2KWAA 4KASA 4X6AC 2JA5C 4GFQA 4GT9A 3GTJA 5EGHA 2E2HK 1I6VA 3HOWC 2E2JC 4A3DK 4A3EK 3CQZC 1SFOK 3GTQA 4MEXA 5HL7S 1XZPB 3FOFA 4A3IC 4A3KK 4OIRA 3GEHA 5C44K 5IP9C 5IYDK 4A93K 2A6HA 1TWHC 4KMUA 1TWFC 4C3HC 3S1NK 1TWAK 1O27A 3IPJA 4C3IK 4QJVA 4P5AA 2E2HA 3DLLS 2V6UA 4ZH4A 3GTMK 3GTGK 1SFOA 1Y1WA 1ZYRA 3NUHA 2JA7K 1O26A 4BKWA 1IBAA 5IOSA 3S2HC 3SZZA 4BXXC 1VGXA 4KC6A 4LLGA 4DDQA 1JOEA 1O2BA 1TWGC 4A3JK 1WIHA 1BDFA 4BBRC 2GSOA 3GTMA 2A69A 2W7VA 3GEIA 4PABA 2ZUEA 4QIWD 2JA7A 4AYBD 4A3BK 2NVXC 1HQMA 1B4BA 1O24A 5IOTA 3HOYK 1YCLA 3S2DC 2YU9C 1YNJA 5CJ9A 1XXAA 4WJ4A 3MMLB 4GTFA 4QIWL 3FKIK 3M4OK 5DM6S 4AYBL 2WAQD 3EQLA 3ERED 1XXCA 2JA8C 1WCMC 4C3JK 3S17C 3GTLK 3HXAA 3H3VD 4LK1A 4BBSK 5IYCK 1J6VA 2WAQL 2L5NA 3GTPC 1V5VA 4P5BA 4X6AK 2JA5K 2CFAB 3HOWK 2E2JK 1VH2A 3CQZK 1F93A 3CF5S 4IOAS 3H3VL 5JVGS 5IYBC 1K83C 4A3IK 1DCPA 5IP9K 4OIQA 3GTLA 1TWHK 1TWFK 4C3HK 3T00A 5IP7C 4LQYA 2O5IA 4LK0A 1Y1VA 5TJ3A 3OPFA 5M3FK 1EQRA 1EH1A 4AH6A 4Q5SA 2PA8L 1XZQA 4WFNS 3S2HK 4Y52C 1YNNA 1O2FB 2V6TA 1DCHA 3BP8C 4YFNA 4BXXK 1IE0A 1TWFA 5EGEA 2VUMK 1WQGA 1TWGK 4MQ9A 4LJZA 4BBRK 1J6XA 1XXBA 1I50C 4WJ3M 4KN7A 1X31C 1USOA 4BY7C 1F7VA 2NVXK 3G4CA 4GTCA 1PJ6A 4P9SA 2JA6C 3I4MC 2YU9K 3AQPA 2R92C 3PIOS 2VUMA 4KMAA 3LPXA 3Q3QA 1YX2A 1TWGA 3A8KA 3OREA 3GSIA 2E2IC 4GTDA 4A3CC 5C3EC 2JA8K 1WCMK 3S17K 3TFJA 3H0GC 3OEPA 1GE9A 2PPBA 2B63C 3TFHA 4MEYA 3HOVC 3GTPK 2XCQA 4QJVB 3AD7C 2YU9A 2R93C 2RH6A 3GTOC 3S16C 2Y0SD 4BLAA 2A68A 1BJTA 1USMA 5E68A 4NOIA 3AD8C 5IYBK 1K83K 1WCMA 1TWAA 5IORA 1BS2A 3TFIA 2Y0SL 1TWCC 1WSRA 2GSUA 3L4JA 3S1MC 3GTGA 3JSTA 3GTJC 1IQ0A 3GTPA 5D4DA 4O2DA 3PO3K 5IP7K 3FHZA 4G0WA 3GTQC 2NVQC 4BY1C 1VJEA 2KQ1A 3GEEA 2P8TA 3S1QC 4A3MC 4Y52K 4LOWA 2ZJQS 4A3FC 4G0VA 2O5JA 3LAPA 4U67S 4G0UA 3HOXC 3A8IA 4A3DC 1Y1WC 4LR2A 4WCES 5FLMC 4XLPA 2P5MA 1ISEA 1I50K 2GSNA 4BY7K 3FKIA 5L46A 5C4XC 2JA6K 3I4MK 4C2MC 1WOSA 3K7AC 1J98A 4IO9S 4C3IC 5TMCA 4Y7NC 5CHPA 1WQFA 5M3MK 4M1XA 2E2IK 3AH5A 3WODA 2JA7C 4XCHA 4A3CK 4RMFA 5C3EK 1I50A 3S15C 2JA5A 3T02A 3H0GK 2KXYA 2B63K 3CQZA 3HOVK 1I6HC 1AB4A 3BUEA 2NVTC 2R93K 4KARA 3GTOK 4A3JC 3S16K 1WOPA 4KMDA 3N3YA 4A3LC 1IS1A 3HOUC 5HQHA 4OIPA 3S14C 1TWHA 1R9TC 2FQTA 1XZQB 2V6SA 3DXJA 3V4GA 1EFWA 1VLOA 5JFEA 3HKZD 1O28A 1ZXOA 3H0GA 3L4KA 1I3QC 2EBBA 1WOOA 1DD5A 2BE5A 3S1MK 3GTKC 3GTJK 3S1RC 4ILDA 2R93A 3GTOA 3GTQK 4G7ZA 2FQOA 2NVQK 1BGWA 3I4NC 4BY1K 3S2DK 4GZYA 3N0CA 4WF9S 2WB1D 2KPUA 3ADAC 1ZVUA 2R7ZC 3S1QK 2JH3A 4A3MK 4BBSC 4GTAA 5M5YK 2Y3PA 1EK8A 4A3FK 3PIPS 2ZJPS 2WB1L 3HOXK 4IOCS 1XZPA 2NVXA 1Y1VC 2CW0A 3T01A 1Y1WK 5JVHS 2PMZD 5FLMK 1ZQ1C 3BP3A 1XPPA 3GDZA 2A6EA 1WORA 4GTLA 5C4XK 2XCOA 2GAGC 1IL2A 1JQWA 4C2MK 5C4JC 1UV7A 3K7AK 3AD9C 2PMZL 3M3YC 2NVYC 1L0WA 3HOZC 4Y7NK 2PHCB 1HI9A 5JVOA 4A3GC 4KB4A
chains in the Genus database with same CATH topology
2E2HK 5FLMC 4LK0A 4XLPA 1I6VA 3HOWC 2E2JC 1I50K 4A3EK 3CQZC 3S15K 1SFOK 4A3DK 3RZDC 5M3FK 4BY7K 4Q5SA 4MEXA 2PA8L 4A3IC 3PO2C 1I6HK 3RZOC 5C4XC 4A3KK 4OIRA 5C44K 5IYDK 5IP9C 2JA6K 3I4MK 4C2MC 3S2HK 4Y52C 1YNNA 3K7AC 2VUMC 2NVTK 4A93K 2A6HA 4YFNA 1TWHC 4KMUA 4C3IC 4BXXK 5TMCA 1TWFC 4BBSK 2VUMK 4C3HC 4A3LK 3HOUK 3S1NK 4Y7NC 1TWGK 4MQ9A 1TWAK 5M3MK 3S14K 2E2IK 4JK1A 4C3IK 1R9TK 3WODA 4LJZA 4QJVA 1IW7A 4Q4ZA 4BBRK 2JA7C 2E2HC 4A3CK 5C3EK 4ZH4A 3GTMK 1I50C 4A3EC 3S15C 4KN7A 1SFOC 3GTGK 4XSZA 1ZYRA 1I3QK 3H0GK 2JA7K 4BY7C 2NVXK 2B63K 3HOVK 1I6HC 3GTKK 4A3KC 5C44C 5IYDC 2JA6C 3I4MC 3S1RK 3S2HC 4A93C 2NVTC 2YU9K 2R93K 3GTOK 4A3JC 5FJ8K 3S16K 2R92C 4BXXC 3I4NK 4LLGA 4A3LC 3HOUC 3S1NC 1TWGC 4XLNA 4KN4A 4OIPA 5M5WK 4A3JK 1TWAC 3S14C 2R92K 2E2IC 1R9TC 3DXJA 1BDFA 4BBRC 2R7ZK 4A3CC 5C3EC 2JA8K 1WCMK 3GTMC 3GTGC 2A69A 3S17K 3HKZD 4QIWD 1I3QC 3H0GC 2PPBA 4AYBD 4A3BK 2NVXC 1HQMA 2B63C 2BE5A 3S1MK 4MEYA 3HOVC 4OIOA 3GTKC 3GTJK 3HOYK 3GTPK 4QJVB 3S1RC 1Y1VK 3S2DC 2YU9C 2R93C 1YNJA 3GTOC 3S16C 3GTQK 4G7ZA 2Y0SD 2NVQK 2A68A 3I4NC 3FKIK 4QIWL 4BY1K 3M4OK 3S2DK 4GZYA 4AYBL 2WAQD 3EQLA 2WB1D 4NOIA 5IYBK 1K83K 4YFXA 2R7ZC 3S1QK 2JA8C 1WCMC 4A3MK 4C3JK 3S17C 4BBSC 2PA8D 5M5YK 2Y0SL 5C4JK 3GTLK 1TWCC 4A3FK 3PO3C 4A3BC 3M3YK 3H3VD 3S1MC 4LK1A 2NVYK 3HOYC 3GTJC 4OINA 2WAQL 5IYCK 3GTPC 2WB1L 5D4DA 5TMFA 3HOXK 1TWCK 3HOZK 4YG2A 1Y1VC 3PO3K 2CW0A 5IP7K 2JA5K 4A3GK 3GTQC 1Y1WK 4X6AK 2NVQC 5M5XK 2PMZD 5FLMK 4G7OA 3FKIC 4BY1C 3M4OC 4XSXA 2E2JK 3CQZK 3HOWK 1XPPA 3RZDK 3H3VL 5IYBC 3HKZL 2A6EA 1K83C 4A3IK 3PO2K 3S1QC 5C4XK 3RZOK 4A3MC 1SMYA 4C3JC 5IP9K 4C2MK 4OIQA 4Y52K 5C4JC 3GTLC 3K7AK 2PMZL 4A3FC 3M3YC 4YFKA 2O5JA 4G7HA 1TWHK 2NVYC 5IYCC 1TWFK 3HOZC 4C3HK 3HOXC 4Y7NK 4A3DC 5IP7C 2JA5C 4A3GC 4X6AC 1Y1WC 2O5IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E2H K;  5FLM C;  4LK0 A;  4XLP A;  1I6V A;  3HOW C;  2E2J C;  1I50 K;  4A3E K;  3CQZ C;  3S15 K;  1SFO K;  4A3D K;  3RZD C;  5M3F K;  4BY7 K;  4Q5S A;  4MEX A;  2PA8 L;  4A3I C;  3PO2 C;  1I6H K;  3RZO C;  5C4X C;  4A3K K;  4OIR A;  5C44 K;  5IYD K;  5IP9 C;  2JA6 K;  3I4M K;  4C2M C;  3S2H K;  4Y52 C;  1YNN A;  3K7A C;  2VUM C;  2NVT K;  4A93 K;  2A6H A;  4YFN A;  1TWH C;  4KMU A;  4C3I C;  4BXX K;  5TMC A;  1TWF C;  4BBS K;  2VUM K;  4C3H C;  4A3L K;  3HOU K;  3S1N K;  4Y7N C;  1TWG K;  4MQ9 A;  1TWA K;  5M3M K;  3S14 K;  2E2I K;  4JK1 A;  4C3I K;  1R9T K;  3WOD A;  4LJZ A;  4QJV A;  1IW7 A;  4Q4Z A;  4BBR K;  2JA7 C;  2E2H C;  4A3C K;  5C3E K;  4ZH4 A;  3GTM K;  1I50 C;  4A3E C;  3S15 C;  4KN7 A;  1SFO C;  3GTG K;  4XSZ A;  1ZYR A;  1I3Q K;  3H0G K;  2JA7 K;  4BY7 C;  2NVX K;  2B63 K;  3HOV K;  1I6H C;  3GTK K;  4A3K C;  5C44 C;  5IYD C;  2JA6 C;  3I4M C;  3S1R K;  3S2H C;  4A93 C;  2NVT C;  2YU9 K;  2R93 K;  3GTO K;  4A3J C;  5FJ8 K;  3S16 K;  2R92 C;  4BXX C;  3I4N K;  4LLG A;  4A3L C;  3HOU C;  3S1N C;  1TWG C;  4XLN A;  4KN4 A;  4OIP A;  5M5W K;  4A3J K;  1TWA C;  3S14 C;  2R92 K;  2E2I C;  1R9T C;  3DXJ A;  1BDF A;  4BBR C;  2R7Z K;  4A3C C;  5C3E C;  2JA8 K;  1WCM K;  3GTM C;  3GTG C;  2A69 A;  3S17 K;  3HKZ D;  4QIW D;  1I3Q C;  3H0G C;  2PPB A;  4AYB D;  4A3B K;  2NVX C;  1HQM A;  2B63 C;  2BE5 A;  3S1M K;  4MEY A;  3HOV C;  4OIO A;  3GTK C;  3GTJ K;  3HOY K;  3GTP K;  4QJV B;  3S1R C;  1Y1V K;  3S2D C;  2YU9 C;  2R93 C;  1YNJ A;  3GTO C;  3S16 C;  3GTQ K;  4G7Z A;  2Y0S D;  2NVQ K;  2A68 A;  3I4N C;  3FKI K;  4QIW L;  4BY1 K;  3M4O K;  3S2D K;  4GZY A;  4AYB L;  2WAQ D;  3EQL A;  2WB1 D;  4NOI A;  5IYB K;  1K83 K;  4YFX A;  2R7Z C;  3S1Q K;  2JA8 C;  1WCM C;  4A3M K;  4C3J K;  3S17 C;  4BBS C;  2PA8 D;  5M5Y K;  2Y0S L;  5C4J K;  3GTL K;  1TWC C;  4A3F K;  3PO3 C;  4A3B C;  3M3Y K;  3H3V D;  3S1M C;  4LK1 A;  2NVY K;  3HOY C;  3GTJ C;  4OIN A;  2WAQ L;  5IYC K;  3GTP C;  2WB1 L;  5D4D A;  5TMF A;  3HOX K;  1TWC K;  3HOZ K;  4YG2 A;  1Y1V C;  3PO3 K;  2CW0 A;  5IP7 K;  2JA5 K;  4A3G K;  3GTQ C;  1Y1W K;  4X6A K;  2NVQ C;  5M5X K;  2PMZ D;  5FLM K;  4G7O A;  3FKI C;  4BY1 C;  3M4O C;  4XSX A;  2E2J K;  3CQZ K;  3HOW K;  1XPP A;  3RZD K;  3H3V L;  5IYB C;  3HKZ L;  2A6E A;  1K83 C;  4A3I K;  3PO2 K;  3S1Q C;  5C4X K;  3RZO K;  4A3M C;  1SMY A;  4C3J C;  5IP9 K;  4C2M K;  4OIQ A;  4Y52 K;  5C4J C;  3GTL C;  3K7A K;  2PMZ L;  4A3F C;  3M3Y C;  4YFK A;  2O5J A;  4G7H A;  1TWH K;  2NVY C;  5IYC C;  1TWF K;  3HOZ C;  4C3H K;  3HOX C;  4Y7N K;  4A3D C;  5IP7 C;  2JA5 C;  4A3G C;  4X6A C;  1Y1W C;  2O5I A; 
#chains in the Genus database with same CATH topology
 1C0A A;  3S15 K;  1PJ7 A;  2L3U A;  3RZD C;  1RU0 A;  3PO2 C;  1I6H K;  3RZO C;  3SZY A;  2VUM C;  4C45 A;  1K83 A;  2NVT K;  4GTE A;  1WQH A;  4PAA A;  1J6W A;  4KM8 A;  1O25 A;  4A3L K;  3HOU K;  1KQ4 A;  4KDD A;  4J3N A;  3S14 K;  4JK1 A;  1R9T K;  1FEU A;  4Q4Z A;  1IW7 A;  1EI6 A;  2E2H C;  1F9N A;  1DCO A;  4A3E C;  1SFO C;  4XSZ A;  1I3Q K;  1F7U A;  3CAG A;  3GTK K;  4A3K C;  5C44 C;  5IYD C;  2ZUF A;  3S1R K;  4GTB A;  4A93 C;  5DM7 S;  5FJ8 K;  4KM9 A;  3I4N K;  3S1N C;  4KN4 A;  4XLN A;  5M5W K;  1TWA C;  1R9T A;  2R92 K;  2GAH C;  4FM9 A;  3QX3 A;  2R7Z K;  3VA7 A;  3GTM C;  3GTG C;  2CFA A;  1I3Q A;  5HL8 A;  3GTK A;  4OIO A;  3G4A A;  4WFB S;  1Y1V K;  3N0B A;  4FZB A;  2JA6 A;  1JVI A;  2R92 A;  3S0X A;  1O29 A;  1INN A;  4KAW X;  4YFX A;  2R7Z A;  4WFA S;  4KAT A;  3LAJ A;  4KMH A;  4BLB A;  2E2I A;  2PA8 D;  5C4J K;  2ZJR S;  3M3Y K;  3PO3 C;  4A3B C;  2RGR A;  2XCR B;  2NVY K;  3HOY C;  1O2A A;  4OIN A;  3HOZ K;  5TMF A;  2ZFZ A;  3A8J A;  1TWC K;  4YG2 A;  3AQO A;  2B63 A;  4A3G K;  2D6F C;  3TTG A;  5M5X K;  1WSV A;  3FOE A;  4KB2 A;  4G7O A;  3FKI C;  3M4O C;  1B4A A;  4XSX A;  1VRQ C;  3RZD K;  5IOQ A;  3HKZ L;  3PO2 K;  3RZO K;  1G51 A;  1ZBS A;  1SMY A;  4C3J C;  1PJ5 A;  3LYW A;  3GTL C;  4YFK A;  4G7H A;  2NVY A;  5IYC C;  3GIR A;  4WIL A;  1TWC A;  2KWA A;  4KAS A;  4X6A C;  2JA5 C;  4GFQ A;  4GT9 A;  3GTJ A;  5EGH A;  2E2H K;  1I6V A;  3HOW C;  2E2J C;  4A3D K;  4A3E K;  3CQZ C;  1SFO K;  3GTQ A;  4MEX A;  5HL7 S;  1XZP B;  3FOF A;  4A3I C;  4A3K K;  4OIR A;  3GEH A;  5C44 K;  5IP9 C;  5IYD K;  4A93 K;  2A6H A;  1TWH C;  4KMU A;  1TWF C;  4C3H C;  3S1N K;  1TWA K;  1O27 A;  3IPJ A;  4C3I K;  4QJV A;  4P5A A;  2E2H A;  3DLL S;  2V6U A;  4ZH4 A;  3GTM K;  3GTG K;  1SFO A;  1Y1W A;  1ZYR A;  3NUH A;  2JA7 K;  1O26 A;  4BKW A;  1IBA A;  5IOS A;  3S2H C;  3SZZ A;  4BXX C;  1VGX A;  4KC6 A;  4LLG A;  4DDQ A;  1JOE A;  1O2B A;  1TWG C;  4A3J K;  1WIH A;  1BDF A;  4BBR C;  2GSO A;  3GTM A;  2A69 A;  2W7V A;  3GEI A;  4PAB A;  2ZUE A;  4QIW D;  2JA7 A;  4AYB D;  4A3B K;  2NVX C;  1HQM A;  1B4B A;  1O24 A;  5IOT A;  3HOY K;  1YCL A;  3S2D C;  2YU9 C;  1YNJ A;  5CJ9 A;  1XXA A;  4WJ4 A;  3MML B;  4GTF A;  4QIW L;  3FKI K;  3M4O K;  5DM6 S;  4AYB L;  2WAQ D;  3EQL A;  3ERE D;  1XXC A;  2JA8 C;  1WCM C;  4C3J K;  3S17 C;  3GTL K;  3HXA A;  3H3V D;  4LK1 A;  4BBS K;  5IYC K;  1J6V A;  2WAQ L;  2L5N A;  3GTP C;  1V5V A;  4P5B A;  4X6A K;  2JA5 K;  2CFA B;  3HOW K;  2E2J K;  1VH2 A;  3CQZ K;  1F93 A;  3CF5 S;  4IOA S;  3H3V L;  5JVG S;  5IYB C;  1K83 C;  4A3I K;  1DCP A;  5IP9 K;  4OIQ A;  3GTL A;  1TWH K;  1TWF K;  4C3H K;  3T00 A;  5IP7 C;  4LQY A;  2O5I A;  4LK0 A;  1Y1V A;  5TJ3 A;  3OPF A;  5M3F K;  1EQR A;  1EH1 A;  4AH6 A;  4Q5S A;  2PA8 L;  1XZQ A;  4WFN S;  3S2H K;  4Y52 C;  1YNN A;  1O2F B;  2V6T A;  1DCH A;  3BP8 C;  4YFN A;  4BXX K;  1IE0 A;  1TWF A;  5EGE A;  2VUM K;  1WQG A;  1TWG K;  4MQ9 A;  4LJZ A;  4BBR K;  1J6X A;  1XXB A;  1I50 C;  4WJ3 M;  4KN7 A;  1X31 C;  1USO A;  4BY7 C;  1F7V A;  2NVX K;  3G4C A;  4GTC A;  1PJ6 A;  4P9S A;  2JA6 C;  3I4M C;  2YU9 K;  3AQP A;  2R92 C;  3PIO S;  2VUM A;  4KMA A;  3LPX A;  3Q3Q A;  1YX2 A;  1TWG A;  3A8K A;  3ORE A;  3GSI A;  2E2I C;  4GTD A;  4A3C C;  5C3E C;  2JA8 K;  1WCM K;  3S17 K;  3TFJ A;  3H0G C;  3OEP A;  1GE9 A;  2PPB A;  2B63 C;  3TFH A;  4MEY A;  3HOV C;  3GTP K;  2XCQ A;  4QJV B;  3AD7 C;  2YU9 A;  2R93 C;  2RH6 A;  3GTO C;  3S16 C;  2Y0S D;  4BLA A;  2A68 A;  1BJT A;  1USM A;  5E68 A;  4NOI A;  3AD8 C;  5IYB K;  1K83 K;  1WCM A;  1TWA A;  5IOR A;  1BS2 A;  3TFI A;  2Y0S L;  1TWC C;  1WSR A;  2GSU A;  3L4J A;  3S1M C;  3GTG A;  3JST A;  3GTJ C;  1IQ0 A;  3GTP A;  5D4D A;  4O2D A;  3PO3 K;  5IP7 K;  3FHZ A;  4G0W A;  3GTQ C;  2NVQ C;  4BY1 C;  1VJE A;  2KQ1 A;  3GEE A;  2P8T A;  3S1Q C;  4A3M C;  4Y52 K;  4LOW A;  2ZJQ S;  4A3F C;  4G0V A;  2O5J A;  3LAP A;  4U67 S;  4G0U A;  3HOX C;  3A8I A;  4A3D C;  1Y1W C;  4LR2 A;  4WCE S;  5FLM C;  4XLP A;  2P5M A;  1ISE A;  1I50 K;  2GSN A;  4BY7 K;  3FKI A;  5L46 A;  5C4X C;  2JA6 K;  3I4M K;  4C2M C;  1WOS A;  3K7A C;  1J98 A;  4IO9 S;  4C3I C;  5TMC A;  4Y7N C;  5CHP A;  1WQF A;  5M3M K;  4M1X A;  2E2I K;  3AH5 A;  3WOD A;  2JA7 C;  4XCH A;  4A3C K;  4RMF A;  5C3E K;  1I50 A;  3S15 C;  2JA5 A;  3T02 A;  3H0G K;  2KXY A;  2B63 K;  3CQZ A;  3HOV K;  1I6H C;  1AB4 A;  3BUE A;  2NVT C;  2R93 K;  4KAR A;  3GTO K;  4A3J C;  3S16 K;  1WOP A;  4KMD A;  3N3Y A;  4A3L C;  1IS1 A;  3HOU C;  5HQH A;  4OIP A;  3S14 C;  1TWH A;  1R9T C;  2FQT A;  1XZQ B;  2V6S A;  3DXJ A;  3V4G A;  1EFW A;  1VLO A;  5JFE A;  3HKZ D;  1O28 A;  1ZXO A;  3H0G A;  3L4K A;  1I3Q C;  2EBB A;  1WOO A;  1DD5 A;  2BE5 A;  3S1M K;  3GTK C;  3GTJ K;  3S1R C;  4ILD A;  2R93 A;  3GTO A;  3GTQ K;  4G7Z A;  2FQO A;  2NVQ K;  1BGW A;  3I4N C;  4BY1 K;  3S2D K;  4GZY A;  3N0C A;  4WF9 S;  2WB1 D;  2KPU A;  3ADA C;  1ZVU A;  2R7Z C;  3S1Q K;  2JH3 A;  4A3M K;  4BBS C;  4GTA A;  5M5Y K;  2Y3P A;  1EK8 A;  4A3F K;  3PIP S;  2ZJP S;  2WB1 L;  3HOX K;  4IOC S;  1XZP A;  2NVX A;  1Y1V C;  2CW0 A;  3T01 A;  1Y1W K;  5JVH S;  2PMZ D;  5FLM K;  1ZQ1 C;  3BP3 A;  1XPP A;  3GDZ A;  2A6E A;  1WOR A;  4GTL A;  5C4X K;  2XCO A;  2GAG C;  1IL2 A;  1JQW A;  4C2M K;  5C4J C;  1UV7 A;  3K7A K;  3AD9 C;  2PMZ L;  3M3Y C;  2NVY C;  1L0W A;  3HOZ C;  4Y7N K;  2PHC B;  1HI9 A;  5JVO A;  4A3G C;  4KB4 A; 
#chains in the Genus database with same CATH homology
 2E2H K;  5FLM C;  4LK0 A;  4XLP A;  1I6V A;  3HOW C;  2E2J C;  1I50 K;  4A3E K;  3CQZ C;  3S15 K;  1SFO K;  4A3D K;  3RZD C;  5M3F K;  4BY7 K;  4Q5S A;  4MEX A;  2PA8 L;  4A3I C;  3PO2 C;  1I6H K;  3RZO C;  5C4X C;  4A3K K;  4OIR A;  5C44 K;  5IYD K;  5IP9 C;  2JA6 K;  3I4M K;  4C2M C;  3S2H K;  4Y52 C;  1YNN A;  3K7A C;  2VUM C;  2NVT K;  4A93 K;  2A6H A;  4YFN A;  1TWH C;  4KMU A;  4C3I C;  4BXX K;  5TMC A;  1TWF C;  4BBS K;  2VUM K;  4C3H C;  4A3L K;  3HOU K;  3S1N K;  4Y7N C;  1TWG K;  4MQ9 A;  1TWA K;  5M3M K;  3S14 K;  2E2I K;  4JK1 A;  4C3I K;  1R9T K;  3WOD A;  4LJZ A;  4QJV A;  1IW7 A;  4Q4Z A;  4BBR K;  2JA7 C;  2E2H C;  4A3C K;  5C3E K;  4ZH4 A;  3GTM K;  1I50 C;  4A3E C;  3S15 C;  4KN7 A;  1SFO C;  3GTG K;  4XSZ A;  1ZYR A;  1I3Q K;  3H0G K;  2JA7 K;  4BY7 C;  2NVX K;  2B63 K;  3HOV K;  1I6H C;  3GTK K;  4A3K C;  5C44 C;  5IYD C;  2JA6 C;  3I4M C;  3S1R K;  3S2H C;  4A93 C;  2NVT C;  2YU9 K;  2R93 K;  3GTO K;  4A3J C;  5FJ8 K;  3S16 K;  2R92 C;  4BXX C;  3I4N K;  4LLG A;  4A3L C;  3HOU C;  3S1N C;  1TWG C;  4XLN A;  4KN4 A;  4OIP A;  5M5W K;  4A3J K;  1TWA C;  3S14 C;  2R92 K;  2E2I C;  1R9T C;  3DXJ A;  1BDF A;  4BBR C;  2R7Z K;  4A3C C;  5C3E C;  2JA8 K;  1WCM K;  3GTM C;  3GTG C;  2A69 A;  3S17 K;  3HKZ D;  4QIW D;  1I3Q C;  3H0G C;  2PPB A;  4AYB D;  4A3B K;  2NVX C;  1HQM A;  2B63 C;  2BE5 A;  3S1M K;  4MEY A;  3HOV C;  4OIO A;  3GTK C;  3GTJ K;  3HOY K;  3GTP K;  4QJV B;  3S1R C;  1Y1V K;  3S2D C;  2YU9 C;  2R93 C;  1YNJ A;  3GTO C;  3S16 C;  3GTQ K;  4G7Z A;  2Y0S D;  2NVQ K;  2A68 A;  3I4N C;  3FKI K;  4QIW L;  4BY1 K;  3M4O K;  3S2D K;  4GZY A;  4AYB L;  2WAQ D;  3EQL A;  2WB1 D;  4NOI A;  5IYB K;  1K83 K;  4YFX A;  2R7Z C;  3S1Q K;  2JA8 C;  1WCM C;  4A3M K;  4C3J K;  3S17 C;  4BBS C;  2PA8 D;  5M5Y K;  2Y0S L;  5C4J K;  3GTL K;  1TWC C;  4A3F K;  3PO3 C;  4A3B C;  3M3Y K;  3H3V D;  3S1M C;  4LK1 A;  2NVY K;  3HOY C;  3GTJ C;  4OIN A;  2WAQ L;  5IYC K;  3GTP C;  2WB1 L;  5D4D A;  5TMF A;  3HOX K;  1TWC K;  3HOZ K;  4YG2 A;  1Y1V C;  3PO3 K;  2CW0 A;  5IP7 K;  2JA5 K;  4A3G K;  3GTQ C;  1Y1W K;  4X6A K;  2NVQ C;  5M5X K;  2PMZ D;  5FLM K;  4G7O A;  3FKI C;  4BY1 C;  3M4O C;  4XSX A;  2E2J K;  3CQZ K;  3HOW K;  1XPP A;  3RZD K;  3H3V L;  5IYB C;  3HKZ L;  2A6E A;  1K83 C;  4A3I K;  3PO2 K;  3S1Q C;  5C4X K;  3RZO K;  4A3M C;  1SMY A;  4C3J C;  5IP9 K;  4C2M K;  4OIQ A;  4Y52 K;  5C4J C;  3GTL C;  3K7A K;  2PMZ L;  4A3F C;  3M3Y C;  4YFK A;  2O5J A;  4G7H A;  1TWH K;  2NVY C;  5IYC C;  1TWF K;  3HOZ C;  4C3H K;  3HOX C;  4Y7N K;  4A3D C;  5IP7 C;  2JA5 C;  4A3G C;  4X6A C;  1Y1W C;  2O5I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...