1HQMA

Crystal structure of thermus aquaticus core rna polymerase-includes complete structure with side-chains (except for disordered regions)-further refined from original deposition-contains additional sequence information
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
223
structure length
223
Chain Sequence
LKAPVFTATTQGDHYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLDPRWRTTLILRAEGPKEVRAVDFTPSADVEIMNPDLHIATLEEGGKLYMEVRVDRGVGYVPAERHGIKDRINAIPVDAIFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVAILKEHLNYFANPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords DNA-directed RNA polymerase subunit alpha
publication title Bacterial RNA polymerase subunit omega and eukaryotic RNA polymerase subunit RPB6 are sequence, structural, and functional homologs and promote RNA polymerase assembly.
pubmed doi rcsb
total genus 31
structure length 223
sequence length 223
chains with identical sequence B
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2000-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01000 RNA_pol_A_bac RNA polymerase Rpb3/RpoA insert domain
A PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain
A PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.12 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 DNA-directed RNA polymerase, insert domain 1hqmA02
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 1hqmA01
1ZYRA 3M3YK 3CQZK 3GTQK 4A93K 4A3LK 4ZH4A 4Q4ZA 4QIWL 2YU9K 2PMZD 1YNJA 4XSXA 5C44C 4KN7A 3I4MK 3GTGC 4YFNA 4YFXA 2R93K 2E2JC 3S1QK 4GZYA 4A3EK 3GTKK 3S2HK 4A3MK 3FKIK 4Y7NK 2PMZL 5IP9K 5IYCC 3GTPK 4KN4A 3GTJC 3HOXK 4A3CK 2VUMC 2JA7C 5IP7C 3S1NC 3S16K 1TWHK 5IYDK 2NVQK 4QJVA 3S14C 4OIPA 4LK0A 3HOYC 3S2DC 2JA8K 3GTOC 1TWAK 3HKZD 4BXXC 4C3IK 4OINA 4A3JK 5FLMK 4MEXA 1Y1WK 3EQLA 2R92K 3S1QC 2NVXK 3PO2C 2R7ZK 1TWGK 1TWFC 4C2MK 3S1RC 2E2IC 1HQMA 1Y1VC 4MEYA 1WCMK 2CW0A 4G7HA 4G7ZA 2PA8L 3M3YC 3CQZC 3HKZL 3GTQC 4A93C 4A3LC 1TWCK 2YU9C 2O5IA 2NVTK 2A68A 1I3QK 3H3VL 3I4MC 2E2HK 3PO3K 2R93C 4AYBD 4A3BK 4A3EC 3GTKC 3S2HC 1YNNA 4A3MC 3FKIC 3HOWC 4Y7NC 5IP9C 3GTPC 3HOXC 3S15K 4A3DK 4A3CC 4QJVB 4A3KK 4AYBL 3S16C 1TWHC 5IYDC 3HOZC 5M3FK 1I50K 4MQ9A 2NVQC 3GTLK 3I4NK 3M4OK 4Y52K 3WODA 5TMFA 2JA8C 1TWAC 4JK1A 4C3IC 4LK1A 4A3JC 3K7AK 1SFOK 5FLMC 3S17K 1Y1WC 2R92C 2WB1D 4A3BC 2NVXC 4YG2A 2R7ZC 1TWGC 4C2MC 5M5WK 4X6AK 4XLPA 1K83K 1TWCC 4G7OA 1I6VA 2NVTC 2WB1L 1I3QC 4LJZA 5M5XK 3HOVK 3RZOK 2BE5A 4BY7K 2E2HC 3PO3C 4C3HK 5C4JK 1I6HK 3GTMK 2B63K 5D4DA 3H0GK 5IYBK 2JA5K 1BDFA 3S15C 4A3DC 4BBRK 4OIOA 4A3KC 4C3JK 4LLGA 4BY1K 3HOUK 3GTLC 3S1MK 3M4OC 3I4NC 2JA6K 1I50C 3S1NK 2NVYK 4A3GK 4Q5SA 4A3IK 3RZDK 4Y52C 4A3FK 4BBSK 1R9TK 1SFOC 3K7AC 5TMCA 3S17C 5C3EK 5C4XK 4NOIA 2A69A 4X6AC 4OIRA 4OIQA 2WAQD 1WCMC 5C44K 5M3MK 1K83C 3GTGK 2E2JK 3HOVC 2A6EA 4XSZA 3RZOC 5FJ8K 3HOWK 4BY7C 5IYCK 2WAQL 3GTJK 4C3HC 5C4JC 1I6HC 2VUMK 2O5JA 3GTMC 2B63C 1Y1VK 5IP7K 3H0GC 5IYBC 2JA5C 2Y0SD 2JA7K 3HOZK 1IW7A 1XPPA 3S14K 2PA8D 4BBRC 3HOYK 3S2DK 4C3JC 4BY1C 3HOUC 3S1MC 4YFKA 3GTOK 4KMUA 2JA6C 2A6HA 4BXXK 2NVYC 4QIWD 3H3VD 4A3GC 4A3IC 3RZDC 5M5YK 4A3FC 3PO2K 4BBSC 1TWFK 3DXJA 2Y0SL 1SMYA 3S1RK 1R9TC 2PPBA 2E2IK 4XLNA 5C3EC 5C4XC
chains in the Genus database with same CATH superfamily
1ZYRA 3CQZK 4C45A 3LAJA 4QIWL 2YU9K 4KASA 1O28A 5IOTA 1ZXOA 4FZBA 1IL2A 4Y7NK 3GTPK 3L4KA 2XCRB 4GTBA 4GTCA 3S16K 4OIPA 3GTOC 4MEXA 3T00A 3EQLA 4WCES 4A3BK 2R7ZK 1TWFC 4C2MK 3S1RC 1DCHA 3CQZA 3G4AA 1Y1VC 2PA8L 1WCMK 2YU9A 2EBBA 3M3YC 1TWCK 3IPJA 4A3LC 1WQFA 4KATA 2A68A 2NVTK 4DDQA 5IOSA 3I4MC 4A3EC 3GTKC 3S2HC 1YX2A 3GTPA 3HOWC 4KARA 4U67S 3S15K 4A3DK 4A3CC 1I50A 5HQHA 3GTLK 5IYDC 3A8KA 2R7ZA 4LK1A 1WOPA 3K7AK 2WB1D 1WCMA 5M5WK 1USMA 4G7OA 3ADAC 1WIHA 3S0XA 2WB1L 4LJZA 3RZOK 2E2HC 3PO3C 3GTMA 4GTLA 4GT9A 2RGRA 1VRQC 2JA5K 4BBRK 4XCHA 4OIOA 4O2DA 3S1MK 1INNA 4KB4A 3I4NC 1EQRA 3BUEA 5DM7S 3RZDK 1XXAA 1SFOC 5C4XK 1VH2A 4OIQA 1XXCA 2WAQD 5C44K 5M3MK 1BGWA 3HOWK 5CHPA 4BY7C 1RU0A 1VJEA 5IYCK 2WAQL 3GTJK 4C3HC 2O5JA 3S1NK 2B63C 3JSTA 3H0GC 3GTOA 1IW7A 1XPPA 3S14K 3GDZA 3HOYK 3HOUC 4BXXK 3PIOS 1J6XA 4A3GC 3H3VD 1Y1VA 3S1QK 1XZPA 1VGXA 2E2IK 2XCOA 4XLNA 5C3EC 5E68A 4A93K 2ZJRS 4WILA 1GE9A 4KN7A 3GEEA 3GTGC 3GTKA 4YFNA 4YFXA 2GAGC 4RMFA 3FOFA 1WSRA 3FKIK 3HOXK 2VUMC 2JA7C 5IP7C 4G0VA 1L0WA 1UV7A 4QJVA 4LK0A 3AQOA 4C3IK 3HKZD 2E2IA 5FLMK 5JVHS 2GAHC 1O2AA 2NVXK 3PO2C 1B4BA 2KQ1A 1F93A 1JOEA 4MEYA 2CW0A 3GIRA 3HKZL 3GTQC 1IBAA 2E2HA 4GFQA 1I3QK 4P5AA 4J3NA 4WJ3M 3FKIA 2R93C 4AYBD 4WF9S 3SZYA 1YNNA 4A3MC 1ZVUA 3A8IA 5IP9C 5JVOA 1WORA 4A3KK 4AYBL 1TWHC 3HOZC 3M4OK 3DLLS 1I50K 2NVQC 1SFOA 1EH1A 4Y52K 3WODA 2JA8C 1TWAC 2NVXA 4A3JC 1Y1WC 2R92C 1TWGC 2P5MA 1I3QA 1O26A 1O2FB 5M5XK 3BP8C 1KQ4A 3AD9C 2KWAA 4PAAA 3L4JA 3GTMK 5IYBK 1VLOA 1BDFA 3LAPA 4LLGA 4BY1K 4IOCS 2NVYK 4A3IK 4A3FK 4BBSK 3Q3QA 3S17C 1DCPA 3NUHA 2A69A 4X6AC 4ILDA 3N0CA 4GTAA 1K83C 1PJ5A 3HOVC 2ZJQS 4XSZA 3T02A 1IE0A 3A8JA 2Y3PA 2VUMA 2JA7A 5C4JC 1I6HC 4AH6A 2D6FC 3HOZK 2RH6A 3QX3A 2CFAA 1ZBSA 3ERED 2NVYA 4C3JC 1WOOA 3GTOK 2JA6C 3N0BA 1ISEA 1WQHA 1EI6A 5EGHA 1TWFK 3S1RK 1R9TC 3GTQA 1Y1VK 5IOQA 2KPUA 3M3YK 3BP3A 4A3LK 4Q4ZA 1YNJA 2R93A 4P5BA 1FEUA 3I4MK 2E2JC 4A3EK 3GTKK 3S2HK 4LQYA 4KN4A 3CAGA 4A3CK 1WSVA 5IYDK 3G4CA 1BJTA 2L5NA 5CJ9A 5JVGS 3S2DC 1Y1WA 2GSOA 1IS1A 1TWGA 1TWFA 1HQMA 5HL7S 3TFHA 3CQZC 4BLBA 2YU9C 2O5IA 3H3VL 1JVIA 2E2HK 3PO3K 3AQPA 1USOA 1EFWA 4Y7NC 1XZQA 3GTPC 1O29A 2JH3A 4QJVB 3S16C 3I4NK 4JK1A 1SFOK 4WFNS 4A3BC 2R7ZC 4C2MC 4KB2A 4G0WA 4IO9S 1TWCC 2NVTC 2ZJPS 1YCLA 3GEHA 3LPXA 4BY7K 1F7VA 4C3HK 3TFJA 2B63K 5D4DA 3H0GK 3S15C 4A3DC 2JA6A 1ZQ1C 3MMLB 3HOUK 3GTLC 1R9TA 4A3GK 3TTGA 4Q5SA 5EGEA 5IORA 2PHCB 4KAWX 3K7AC 5C3EK 4NOIA 1HI9A 4OIRA 3T01A 5L46A 1DCOA 3GTGK 3RZOC 1BS2A 2GSNA 1C0AA 2B63A 3OEPA 5DM6S 3H0GA 2VUMK 2JA7K 5IP7K 2JA5C 2Y0SD 1O24A 2PA8D 4BBRC 1G51A 3S1MC 4YFKA 4KMUA 1V5VA 2A6HA 3RZDC 4IOAS 3PO2K 4WJ4A 2Y0SL 3DXJA 3SZZA 1SMYA 4BLAA 4KMDA 4KMHA 5C4XC 3GTQK 4ZH4A 1O2BA 3FHZA 2PMZD 3GTGA 4XSXA 5C44C 2R93K 4GZYA 4A3MK 5TJ3A 2PMZL 5IP9K 5IYCC 1J6VA 3GTJC 1DD5A 2P8TA 3N3YA 2CFAB 3S1NC 1O27A 3LYWA 1TWHK 3HXAA 1PJ7A 2XCQA 2NVQK 4LOWA 3S14C 3HOYC 2JA8K 1TWAK 4A3JK 4BXXC 4OINA 1Y1WK 2R92K 3S1QC 1X31C 1TWGK 1WOSA 2GSUA 2E2IC 4GTFA 1TWCA 4G7HA 4M1XA 4G7ZA 3PIPS 4A93C 4GTDA 1JQWA 4LR2A 3FKIC 2V6UA 2ZUEA 3GTLA 4WFAS 3HOXC 1TWHA 2ZFZA 3CF5S 1J98A 1O25A 4GTEA 4KDDA 5M3FK 4MQ9A 1TWAA 4PABA 5TMFA 1WQGA 2R92A 4C3IC 3AH5A 1XZPB 1AB4A 5FLMC 3S17K 4KMAA 4P9SA 2NVXC 4YG2A 2W7VA 4X6AK 5JFEA 4XLPA 4BKWA 1B4AA 1K83K 3V4GA 4KM9A 3OPFA 1I6VA 3HOVK 1I3QC 2BE5A 1J6WA 4KM8A 1XZQB 5C4JK 2JA5A 1I6HK 3AD7C 2ZUFA 3FOEA 3TFIA 1IQ0A 4A3KC 5HL8A 4C3JK 3AD8C 2V6SA 3M4OC 2JA6K 1XXBA 1I50C 3OREA 4Y52C 4G0UA 1R9TK 5TMCA 2FQOA 3VA7A 1K83A 2FQTA 1WCMC 4WFBS 2L3UA 2E2JK 2A6EA 1EK8A 2V6TA 3GTJA 5FJ8K 1F7UA 4FM9A 3GTMC 3GSIA 5IYBC 1PJ6A 2KXYA 3GEIA 3S2DK 1F9NA 4BY1C 2NVYC 4QIWD 4A3IC 5M5YK 4A3FC 4BBSC 2PPBA 4KC6A
chains in the Genus database with same CATH topology
1ZYRA 3M3YK 3CQZK 3GTQK 4A93K 4A3LK 4ZH4A 4Q4ZA 4QIWL 2YU9K 2PMZD 1YNJA 4XSXA 5C44C 4KN7A 3I4MK 3GTGC 4YFNA 4YFXA 2R93K 2E2JC 3S1QK 4GZYA 4A3EK 3GTKK 3S2HK 4A3MK 3FKIK 4Y7NK 2PMZL 5IP9K 5IYCC 3GTPK 4KN4A 3GTJC 3HOXK 4A3CK 2VUMC 2JA7C 5IP7C 3S1NC 3S16K 1TWHK 5IYDK 2NVQK 4QJVA 3S14C 4OIPA 4LK0A 3HOYC 3S2DC 2JA8K 3GTOC 1TWAK 3HKZD 4BXXC 4C3IK 4OINA 4A3JK 5FLMK 4MEXA 1Y1WK 3EQLA 2R92K 3S1QC 2NVXK 3PO2C 2R7ZK 1TWGK 1TWFC 4C2MK 3S1RC 2E2IC 1HQMA 1Y1VC 4MEYA 1WCMK 2CW0A 4G7HA 4G7ZA 2PA8L 3M3YC 3CQZC 3HKZL 3GTQC 4A93C 4A3LC 1TWCK 2YU9C 2O5IA 2NVTK 2A68A 1I3QK 3H3VL 3I4MC 2E2HK 3PO3K 2R93C 4AYBD 4A3BK 4A3EC 3GTKC 3S2HC 1YNNA 4A3MC 3FKIC 3HOWC 4Y7NC 5IP9C 3GTPC 3HOXC 3S15K 4A3DK 4A3CC 4QJVB 4A3KK 4AYBL 3S16C 1TWHC 5IYDC 3HOZC 5M3FK 1I50K 4MQ9A 2NVQC 3GTLK 3I4NK 3M4OK 4Y52K 3WODA 5TMFA 2JA8C 1TWAC 4JK1A 4C3IC 4LK1A 4A3JC 3K7AK 1SFOK 5FLMC 3S17K 1Y1WC 2R92C 2WB1D 4A3BC 2NVXC 4YG2A 2R7ZC 1TWGC 4C2MC 5M5WK 4X6AK 4XLPA 1K83K 1TWCC 4G7OA 1I6VA 2NVTC 2WB1L 1I3QC 4LJZA 5M5XK 3HOVK 3RZOK 2BE5A 4BY7K 2E2HC 3PO3C 4C3HK 5C4JK 1I6HK 3GTMK 2B63K 5D4DA 3H0GK 5IYBK 2JA5K 1BDFA 3S15C 4A3DC 4BBRK 4OIOA 4A3KC 4C3JK 4LLGA 4BY1K 3HOUK 3GTLC 3S1MK 3M4OC 3I4NC 2JA6K 1I50C 3S1NK 2NVYK 4A3GK 4Q5SA 4A3IK 3RZDK 4Y52C 4A3FK 4BBSK 1R9TK 1SFOC 3K7AC 5TMCA 3S17C 5C3EK 5C4XK 4NOIA 2A69A 4X6AC 4OIRA 4OIQA 2WAQD 1WCMC 5C44K 5M3MK 1K83C 3GTGK 2E2JK 3HOVC 2A6EA 4XSZA 3RZOC 5FJ8K 3HOWK 4BY7C 5IYCK 2WAQL 3GTJK 4C3HC 5C4JC 1I6HC 2VUMK 2O5JA 3GTMC 2B63C 1Y1VK 5IP7K 3H0GC 5IYBC 2JA5C 2Y0SD 2JA7K 3HOZK 1IW7A 1XPPA 3S14K 2PA8D 4BBRC 3HOYK 3S2DK 4C3JC 4BY1C 3HOUC 3S1MC 4YFKA 3GTOK 4KMUA 2JA6C 2A6HA 4BXXK 2NVYC 4QIWD 3H3VD 4A3GC 4A3IC 3RZDC 5M5YK 4A3FC 3PO2K 4BBSC 1TWFK 3DXJA 2Y0SL 1SMYA 3S1RK 1R9TC 2PPBA 2E2IK 4XLNA 5C3EC 5C4XC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZYR A;  3M3Y K;  3CQZ K;  3GTQ K;  4A93 K;  4A3L K;  4ZH4 A;  4Q4Z A;  4QIW L;  2YU9 K;  2PMZ D;  1YNJ A;  4XSX A;  5C44 C;  4KN7 A;  3I4M K;  3GTG C;  4YFN A;  4YFX A;  2R93 K;  2E2J C;  3S1Q K;  4GZY A;  4A3E K;  3GTK K;  3S2H K;  4A3M K;  3FKI K;  4Y7N K;  2PMZ L;  5IP9 K;  5IYC C;  3GTP K;  4KN4 A;  3GTJ C;  3HOX K;  4A3C K;  2VUM C;  2JA7 C;  5IP7 C;  3S1N C;  3S16 K;  1TWH K;  5IYD K;  2NVQ K;  4QJV A;  3S14 C;  4OIP A;  4LK0 A;  3HOY C;  3S2D C;  2JA8 K;  3GTO C;  1TWA K;  3HKZ D;  4BXX C;  4C3I K;  4OIN A;  4A3J K;  5FLM K;  4MEX A;  1Y1W K;  3EQL A;  2R92 K;  3S1Q C;  2NVX K;  3PO2 C;  2R7Z K;  1TWG K;  1TWF C;  4C2M K;  3S1R C;  2E2I C;  1HQM A;  1Y1V C;  4MEY A;  1WCM K;  2CW0 A;  4G7H A;  4G7Z A;  2PA8 L;  3M3Y C;  3CQZ C;  3HKZ L;  3GTQ C;  4A93 C;  4A3L C;  1TWC K;  2YU9 C;  2O5I A;  2NVT K;  2A68 A;  1I3Q K;  3H3V L;  3I4M C;  2E2H K;  3PO3 K;  2R93 C;  4AYB D;  4A3B K;  4A3E C;  3GTK C;  3S2H C;  1YNN A;  4A3M C;  3FKI C;  3HOW C;  4Y7N C;  5IP9 C;  3GTP C;  3HOX C;  3S15 K;  4A3D K;  4A3C C;  4QJV B;  4A3K K;  4AYB L;  3S16 C;  1TWH C;  5IYD C;  3HOZ C;  5M3F K;  1I50 K;  4MQ9 A;  2NVQ C;  3GTL K;  3I4N K;  3M4O K;  4Y52 K;  3WOD A;  5TMF A;  2JA8 C;  1TWA C;  4JK1 A;  4C3I C;  4LK1 A;  4A3J C;  3K7A K;  1SFO K;  5FLM C;  3S17 K;  1Y1W C;  2R92 C;  2WB1 D;  4A3B C;  2NVX C;  4YG2 A;  2R7Z C;  1TWG C;  4C2M C;  5M5W K;  4X6A K;  4XLP A;  1K83 K;  1TWC C;  4G7O A;  1I6V A;  2NVT C;  2WB1 L;  1I3Q C;  4LJZ A;  5M5X K;  3HOV K;  3RZO K;  2BE5 A;  4BY7 K;  2E2H C;  3PO3 C;  4C3H K;  5C4J K;  1I6H K;  3GTM K;  2B63 K;  5D4D A;  3H0G K;  5IYB K;  2JA5 K;  1BDF A;  3S15 C;  4A3D C;  4BBR K;  4OIO A;  4A3K C;  4C3J K;  4LLG A;  4BY1 K;  3HOU K;  3GTL C;  3S1M K;  3M4O C;  3I4N C;  2JA6 K;  1I50 C;  3S1N K;  2NVY K;  4A3G K;  4Q5S A;  4A3I K;  3RZD K;  4Y52 C;  4A3F K;  4BBS K;  1R9T K;  1SFO C;  3K7A C;  5TMC A;  3S17 C;  5C3E K;  5C4X K;  4NOI A;  2A69 A;  4X6A C;  4OIR A;  4OIQ A;  2WAQ D;  1WCM C;  5C44 K;  5M3M K;  1K83 C;  3GTG K;  2E2J K;  3HOV C;  2A6E A;  4XSZ A;  3RZO C;  5FJ8 K;  3HOW K;  4BY7 C;  5IYC K;  2WAQ L;  3GTJ K;  4C3H C;  5C4J C;  1I6H C;  2VUM K;  2O5J A;  3GTM C;  2B63 C;  1Y1V K;  5IP7 K;  3H0G C;  5IYB C;  2JA5 C;  2Y0S D;  2JA7 K;  3HOZ K;  1IW7 A;  1XPP A;  3S14 K;  2PA8 D;  4BBR C;  3HOY K;  3S2D K;  4C3J C;  4BY1 C;  3HOU C;  3S1M C;  4YFK A;  3GTO K;  4KMU A;  2JA6 C;  2A6H A;  4BXX K;  2NVY C;  4QIW D;  3H3V D;  4A3G C;  4A3I C;  3RZD C;  5M5Y K;  4A3F C;  3PO2 K;  4BBS C;  1TWF K;  3DXJ A;  2Y0S L;  1SMY A;  3S1R K;  1R9T C;  2PPB A;  2E2I K;  4XLN A;  5C3E C;  5C4X C; 
#chains in the Genus database with same CATH topology
 1ZYR A;  3CQZ K;  4C45 A;  3LAJ A;  4QIW L;  2YU9 K;  4KAS A;  1O28 A;  5IOT A;  1ZXO A;  4FZB A;  1IL2 A;  4Y7N K;  3GTP K;  3L4K A;  2XCR B;  4GTB A;  4GTC A;  3S16 K;  4OIP A;  3GTO C;  4MEX A;  3T00 A;  3EQL A;  4WCE S;  4A3B K;  2R7Z K;  1TWF C;  4C2M K;  3S1R C;  1DCH A;  3CQZ A;  3G4A A;  1Y1V C;  2PA8 L;  1WCM K;  2YU9 A;  2EBB A;  3M3Y C;  1TWC K;  3IPJ A;  4A3L C;  1WQF A;  4KAT A;  2A68 A;  2NVT K;  4DDQ A;  5IOS A;  3I4M C;  4A3E C;  3GTK C;  3S2H C;  1YX2 A;  3GTP A;  3HOW C;  4KAR A;  4U67 S;  3S15 K;  4A3D K;  4A3C C;  1I50 A;  5HQH A;  3GTL K;  5IYD C;  3A8K A;  2R7Z A;  4LK1 A;  1WOP A;  3K7A K;  2WB1 D;  1WCM A;  5M5W K;  1USM A;  4G7O A;  3ADA C;  1WIH A;  3S0X A;  2WB1 L;  4LJZ A;  3RZO K;  2E2H C;  3PO3 C;  3GTM A;  4GTL A;  4GT9 A;  2RGR A;  1VRQ C;  2JA5 K;  4BBR K;  4XCH A;  4OIO A;  4O2D A;  3S1M K;  1INN A;  4KB4 A;  3I4N C;  1EQR A;  3BUE A;  5DM7 S;  3RZD K;  1XXA A;  1SFO C;  5C4X K;  1VH2 A;  4OIQ A;  1XXC A;  2WAQ D;  5C44 K;  5M3M K;  1BGW A;  3HOW K;  5CHP A;  4BY7 C;  1RU0 A;  1VJE A;  5IYC K;  2WAQ L;  3GTJ K;  4C3H C;  2O5J A;  3S1N K;  2B63 C;  3JST A;  3H0G C;  3GTO A;  1IW7 A;  1XPP A;  3S14 K;  3GDZ A;  3HOY K;  3HOU C;  4BXX K;  3PIO S;  1J6X A;  4A3G C;  3H3V D;  1Y1V A;  3S1Q K;  1XZP A;  1VGX A;  2E2I K;  2XCO A;  4XLN A;  5C3E C;  5E68 A;  4A93 K;  2ZJR S;  4WIL A;  1GE9 A;  4KN7 A;  3GEE A;  3GTG C;  3GTK A;  4YFN A;  4YFX A;  2GAG C;  4RMF A;  3FOF A;  1WSR A;  3FKI K;  3HOX K;  2VUM C;  2JA7 C;  5IP7 C;  4G0V A;  1L0W A;  1UV7 A;  4QJV A;  4LK0 A;  3AQO A;  4C3I K;  3HKZ D;  2E2I A;  5FLM K;  5JVH S;  2GAH C;  1O2A A;  2NVX K;  3PO2 C;  1B4B A;  2KQ1 A;  1F93 A;  1JOE A;  4MEY A;  2CW0 A;  3GIR A;  3HKZ L;  3GTQ C;  1IBA A;  2E2H A;  4GFQ A;  1I3Q K;  4P5A A;  4J3N A;  4WJ3 M;  3FKI A;  2R93 C;  4AYB D;  4WF9 S;  3SZY A;  1YNN A;  4A3M C;  1ZVU A;  3A8I A;  5IP9 C;  5JVO A;  1WOR A;  4A3K K;  4AYB L;  1TWH C;  3HOZ C;  3M4O K;  3DLL S;  1I50 K;  2NVQ C;  1SFO A;  1EH1 A;  4Y52 K;  3WOD A;  2JA8 C;  1TWA C;  2NVX A;  4A3J C;  1Y1W C;  2R92 C;  1TWG C;  2P5M A;  1I3Q A;  1O26 A;  1O2F B;  5M5X K;  3BP8 C;  1KQ4 A;  3AD9 C;  2KWA A;  4PAA A;  3L4J A;  3GTM K;  5IYB K;  1VLO A;  1BDF A;  3LAP A;  4LLG A;  4BY1 K;  4IOC S;  2NVY K;  4A3I K;  4A3F K;  4BBS K;  3Q3Q A;  3S17 C;  1DCP A;  3NUH A;  2A69 A;  4X6A C;  4ILD A;  3N0C A;  4GTA A;  1K83 C;  1PJ5 A;  3HOV C;  2ZJQ S;  4XSZ A;  3T02 A;  1IE0 A;  3A8J A;  2Y3P A;  2VUM A;  2JA7 A;  5C4J C;  1I6H C;  4AH6 A;  2D6F C;  3HOZ K;  2RH6 A;  3QX3 A;  2CFA A;  1ZBS A;  3ERE D;  2NVY A;  4C3J C;  1WOO A;  3GTO K;  2JA6 C;  3N0B A;  1ISE A;  1WQH A;  1EI6 A;  5EGH A;  1TWF K;  3S1R K;  1R9T C;  3GTQ A;  1Y1V K;  5IOQ A;  2KPU A;  3M3Y K;  3BP3 A;  4A3L K;  4Q4Z A;  1YNJ A;  2R93 A;  4P5B A;  1FEU A;  3I4M K;  2E2J C;  4A3E K;  3GTK K;  3S2H K;  4LQY A;  4KN4 A;  3CAG A;  4A3C K;  1WSV A;  5IYD K;  3G4C A;  1BJT A;  2L5N A;  5CJ9 A;  5JVG S;  3S2D C;  1Y1W A;  2GSO A;  1IS1 A;  1TWG A;  1TWF A;  1HQM A;  5HL7 S;  3TFH A;  3CQZ C;  4BLB A;  2YU9 C;  2O5I A;  3H3V L;  1JVI A;  2E2H K;  3PO3 K;  3AQP A;  1USO A;  1EFW A;  4Y7N C;  1XZQ A;  3GTP C;  1O29 A;  2JH3 A;  4QJV B;  3S16 C;  3I4N K;  4JK1 A;  1SFO K;  4WFN S;  4A3B C;  2R7Z C;  4C2M C;  4KB2 A;  4G0W A;  4IO9 S;  1TWC C;  2NVT C;  2ZJP S;  1YCL A;  3GEH A;  3LPX A;  4BY7 K;  1F7V A;  4C3H K;  3TFJ A;  2B63 K;  5D4D A;  3H0G K;  3S15 C;  4A3D C;  2JA6 A;  1ZQ1 C;  3MML B;  3HOU K;  3GTL C;  1R9T A;  4A3G K;  3TTG A;  4Q5S A;  5EGE A;  5IOR A;  2PHC B;  4KAW X;  3K7A C;  5C3E K;  4NOI A;  1HI9 A;  4OIR A;  3T01 A;  5L46 A;  1DCO A;  3GTG K;  3RZO C;  1BS2 A;  2GSN A;  1C0A A;  2B63 A;  3OEP A;  5DM6 S;  3H0G A;  2VUM K;  2JA7 K;  5IP7 K;  2JA5 C;  2Y0S D;  1O24 A;  2PA8 D;  4BBR C;  1G51 A;  3S1M C;  4YFK A;  4KMU A;  1V5V A;  2A6H A;  3RZD C;  4IOA S;  3PO2 K;  4WJ4 A;  2Y0S L;  3DXJ A;  3SZZ A;  1SMY A;  4BLA A;  4KMD A;  4KMH A;  5C4X C;  3GTQ K;  4ZH4 A;  1O2B A;  3FHZ A;  2PMZ D;  3GTG A;  4XSX A;  5C44 C;  2R93 K;  4GZY A;  4A3M K;  5TJ3 A;  2PMZ L;  5IP9 K;  5IYC C;  1J6V A;  3GTJ C;  1DD5 A;  2P8T A;  3N3Y A;  2CFA B;  3S1N C;  1O27 A;  3LYW A;  1TWH K;  3HXA A;  1PJ7 A;  2XCQ A;  2NVQ K;  4LOW A;  3S14 C;  3HOY C;  2JA8 K;  1TWA K;  4A3J K;  4BXX C;  4OIN A;  1Y1W K;  2R92 K;  3S1Q C;  1X31 C;  1TWG K;  1WOS A;  2GSU A;  2E2I C;  4GTF A;  1TWC A;  4G7H A;  4M1X A;  4G7Z A;  3PIP S;  4A93 C;  4GTD A;  1JQW A;  4LR2 A;  3FKI C;  2V6U A;  2ZUE A;  3GTL A;  4WFA S;  3HOX C;  1TWH A;  2ZFZ A;  3CF5 S;  1J98 A;  1O25 A;  4GTE A;  4KDD A;  5M3F K;  4MQ9 A;  1TWA A;  4PAB A;  5TMF A;  1WQG A;  2R92 A;  4C3I C;  3AH5 A;  1XZP B;  1AB4 A;  5FLM C;  3S17 K;  4KMA A;  4P9S A;  2NVX C;  4YG2 A;  2W7V A;  4X6A K;  5JFE A;  4XLP A;  4BKW A;  1B4A A;  1K83 K;  3V4G A;  4KM9 A;  3OPF A;  1I6V A;  3HOV K;  1I3Q C;  2BE5 A;  1J6W A;  4KM8 A;  1XZQ B;  5C4J K;  2JA5 A;  1I6H K;  3AD7 C;  2ZUF A;  3FOE A;  3TFI A;  1IQ0 A;  4A3K C;  5HL8 A;  4C3J K;  3AD8 C;  2V6S A;  3M4O C;  2JA6 K;  1XXB A;  1I50 C;  3ORE A;  4Y52 C;  4G0U A;  1R9T K;  5TMC A;  2FQO A;  3VA7 A;  1K83 A;  2FQT A;  1WCM C;  4WFB S;  2L3U A;  2E2J K;  2A6E A;  1EK8 A;  2V6T A;  3GTJ A;  5FJ8 K;  1F7U A;  4FM9 A;  3GTM C;  3GSI A;  5IYB C;  1PJ6 A;  2KXY A;  3GEI A;  3S2D K;  1F9N A;  4BY1 C;  2NVY C;  4QIW D;  4A3I C;  5M5Y K;  4A3F C;  4BBS C;  2PPB A;  4KC6 A; 
#chains in the Genus database with same CATH homology
 1ZYR A;  3M3Y K;  3CQZ K;  3GTQ K;  4A93 K;  4A3L K;  4ZH4 A;  4Q4Z A;  4QIW L;  2YU9 K;  2PMZ D;  1YNJ A;  4XSX A;  5C44 C;  4KN7 A;  3I4M K;  3GTG C;  4YFN A;  4YFX A;  2R93 K;  2E2J C;  3S1Q K;  4GZY A;  4A3E K;  3GTK K;  3S2H K;  4A3M K;  3FKI K;  4Y7N K;  2PMZ L;  5IP9 K;  5IYC C;  3GTP K;  4KN4 A;  3GTJ C;  3HOX K;  4A3C K;  2VUM C;  2JA7 C;  5IP7 C;  3S1N C;  3S16 K;  1TWH K;  5IYD K;  2NVQ K;  4QJV A;  3S14 C;  4OIP A;  4LK0 A;  3HOY C;  3S2D C;  2JA8 K;  3GTO C;  1TWA K;  3HKZ D;  4BXX C;  4C3I K;  4OIN A;  4A3J K;  5FLM K;  4MEX A;  1Y1W K;  3EQL A;  2R92 K;  3S1Q C;  2NVX K;  3PO2 C;  2R7Z K;  1TWG K;  1TWF C;  4C2M K;  3S1R C;  2E2I C;  1HQM A;  1Y1V C;  4MEY A;  1WCM K;  2CW0 A;  4G7H A;  4G7Z A;  2PA8 L;  3M3Y C;  3CQZ C;  3HKZ L;  3GTQ C;  4A93 C;  4A3L C;  1TWC K;  2YU9 C;  2O5I A;  2NVT K;  2A68 A;  1I3Q K;  3H3V L;  3I4M C;  2E2H K;  3PO3 K;  2R93 C;  4AYB D;  4A3B K;  4A3E C;  3GTK C;  3S2H C;  1YNN A;  4A3M C;  3FKI C;  3HOW C;  4Y7N C;  5IP9 C;  3GTP C;  3HOX C;  3S15 K;  4A3D K;  4A3C C;  4QJV B;  4A3K K;  4AYB L;  3S16 C;  1TWH C;  5IYD C;  3HOZ C;  5M3F K;  1I50 K;  4MQ9 A;  2NVQ C;  3GTL K;  3I4N K;  3M4O K;  4Y52 K;  3WOD A;  5TMF A;  2JA8 C;  1TWA C;  4JK1 A;  4C3I C;  4LK1 A;  4A3J C;  3K7A K;  1SFO K;  5FLM C;  3S17 K;  1Y1W C;  2R92 C;  2WB1 D;  4A3B C;  2NVX C;  4YG2 A;  2R7Z C;  1TWG C;  4C2M C;  5M5W K;  4X6A K;  4XLP A;  1K83 K;  1TWC C;  4G7O A;  1I6V A;  2NVT C;  2WB1 L;  1I3Q C;  4LJZ A;  5M5X K;  3HOV K;  3RZO K;  2BE5 A;  4BY7 K;  2E2H C;  3PO3 C;  4C3H K;  5C4J K;  1I6H K;  3GTM K;  2B63 K;  5D4D A;  3H0G K;  5IYB K;  2JA5 K;  1BDF A;  3S15 C;  4A3D C;  4BBR K;  4OIO A;  4A3K C;  4C3J K;  4LLG A;  4BY1 K;  3HOU K;  3GTL C;  3S1M K;  3M4O C;  3I4N C;  2JA6 K;  1I50 C;  3S1N K;  2NVY K;  4A3G K;  4Q5S A;  4A3I K;  3RZD K;  4Y52 C;  4A3F K;  4BBS K;  1R9T K;  1SFO C;  3K7A C;  5TMC A;  3S17 C;  5C3E K;  5C4X K;  4NOI A;  2A69 A;  4X6A C;  4OIR A;  4OIQ A;  2WAQ D;  1WCM C;  5C44 K;  5M3M K;  1K83 C;  3GTG K;  2E2J K;  3HOV C;  2A6E A;  4XSZ A;  3RZO C;  5FJ8 K;  3HOW K;  4BY7 C;  5IYC K;  2WAQ L;  3GTJ K;  4C3H C;  5C4J C;  1I6H C;  2VUM K;  2O5J A;  3GTM C;  2B63 C;  1Y1V K;  5IP7 K;  3H0G C;  5IYB C;  2JA5 C;  2Y0S D;  2JA7 K;  3HOZ K;  1IW7 A;  1XPP A;  3S14 K;  2PA8 D;  4BBR C;  3HOY K;  3S2D K;  4C3J C;  4BY1 C;  3HOU C;  3S1M C;  4YFK A;  3GTO K;  4KMU A;  2JA6 C;  2A6H A;  4BXX K;  2NVY C;  4QIW D;  3H3V D;  4A3G C;  4A3I C;  3RZD C;  5M5Y K;  4A3F C;  3PO2 K;  4BBS C;  1TWF K;  3DXJ A;  2Y0S L;  1SMY A;  3S1R K;  1R9T C;  2PPB A;  2E2I K;  4XLN A;  5C3E C;  5C4X C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...