3EQLA

Crystal structure of the t. thermophilus rna polymerase holoenzyme in complex with antibiotic myxopyronin
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
229
structure length
229
Chain Sequence
MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords DNA-directed RNA polymerase subunit alpha
publication title Transcription inactivation through local refolding of the RNA polymerase structure.
pubmed doi rcsb
total genus 40
structure length 229
sequence length 229
chains with identical sequence B, K, L
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2008-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01000 RNA_pol_A_bac RNA polymerase Rpb3/RpoA insert domain
A PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain
A PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.12 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 DNA-directed RNA polymerase, insert domain 3eqlA02
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3eqlA01
4OIRA 2NVQK 3GTPC 3PO2K 4G7HA 1IW7A 4C3IK 4JK1A 2A69A 3RZDK 1YNNA 4BY1C 3S17C 4A3CC 4A3IK 4OIQA 1Y1VC 3RZOK 5C4XK 4BXXC 4LLGA 2JA8C 2WB1L 3HOZC 4QJVA 1TWGK 5FJ8K 3S2DC 1TWFK 5TMFA 5IP7K 4X6AK 5C3EK 3HOUK 2JA7C 3H3VD 5IP9C 5C4JC 2NVYK 3HOVK 4KN7A 2NVXC 3GTGK 1K83C 4A3JC 2O5IA 2NVTK 2PA8L 4C3HK 4Y7NK 3S15C 1I6VA 4QIWL 2R92K 2WAQD 3GTMK 2JA5C 1SMYA 3S1MK 3M4OK 2PPBA 2PMZD 3GTJC 3GTQC 5M5XK 4KMUA 3S17K 4A3CK 4A3GK 1WCMC 4A3EC 4C2MK 1Y1VK 5FLMK 2Y0SD 2VUMC 4MEXA 2A6EA 1SFOK 5C44C 3PO3C 2JA8K 3HOZK 4LK0A 3HOWC 2E2HK 2R93C 4XSZA 2CW0A 5IYCC 2JA7K 5IP9K 3I4NK 2YU9K 3S1QC 4YG2A 4Q4ZA 2R7ZC 3H0GK 2NVXK 4BBSK 3M3YC 4NOIA 2E2IC 3GTKC 1K83K 1TWCK 4A3JK 3S1RK 3HOYK 1YNJA 2A6HA 5IYBK 5M3FK 4BBRC 3S15K 1I6HC 1I3QK 4A3LK 3S1NC 4A3MC 4A3KK 3GTLK 3HKZL 4AYBL 4Q5SA 3FKIC 1ZYRA 4Y52C 3GTQK 3K7AK 3GTJK 4A3FC 3GTPK 2WB1D 2NVQC 4A3EK 3PO2C 2B63C 4BY1K 4C3IC 3I4MC 3RZDC 3S14C 4KN4A 5C44K 3PO3K 5D4DA 3S16C 4A3IC 1TWHC 2R93K 4BXXK 5IYCK 5C4XC 2PA8D 4A93C 3S2DK 2E2JC 4QIWD 4XLNA 2R7ZK 4G7ZA 3M3YK 4C3JC 1TWFC 5IP7C 3HOXC 2O5JA 2JA6C 4X6AC 3HOUC 5C4JK 3GTKK 3S2HC 4BBRK 4A3DC 3EQLA 5IYDC 1I50C 4G7OA 3S1NK 4A3MK 2BE5A 3CQZC 4YFNA 2NVTC 4YFKA 4Y52K 1HQMA 3GTOC 4XLPA 5TMCA 4MEYA 2A68A 4A3BC 2JA5K 3H3VL 1TWAC 3GTMC 4MQ9A 1XPPA 5M5WK 2B63K 3M4OC 3S1MC 1R9TC 4BY7C 3I4MK 3S14K 4OIOA 4OIPA 1Y1WC 3RZOC 1WCMK 3S16K 2VUMK 4A3GC 1TWHK 4C2MC 5FLMC 2WAQL 1SFOC 4A93K 3HOWK 2E2JK 4ZH4A 4LK1A 2PMZL 2E2HC 4C3JK 4QJVB 3HOXK 4GZYA 2JA6K 3HKZD 4AYBD 3S1QK 3S2HK 3I4NC 1TWGC 4A3DK 1BDFA 2YU9C 5IYDK 1I50K 2Y0SL 2E2IK 3H0GC 4BBSC 5C3EC 3CQZK 2NVYC 4YFXA 1TWCC 3HOYC 3S1RC 1I6HK 4XSXA 5IYBC 3HOVC 3GTGC 3GTOK 4OINA 1I3QC 4A3LC 4A3BK 4A3KC 4C3HC 4Y7NC 3GTLC 1TWAK 3FKIK 5M3MK 4A3FK 4LJZA 2R92C 5M5YK 1R9TK 4BY7K 3WODA 3K7AC 3DXJA 1Y1WK
chains in the Genus database with same CATH superfamily
4OIRA 4G7HA 1IW7A 4C3IK 4JK1A 2CFAB 1YNNA 2PHCB 3SZYA 2W7VA 3TFHA 1Y1VC 1Y1VA 4AH6A 4QJVA 5FJ8K 3S2DC 3TFJA 5IOQA 1O2BA 3T00A 2NVXC 2RGRA 2NVTK 2PA8L 2NVXA 1I6VA 1XXBA 4QIWL 2WAQD 5E68A 1L0WA 3V4GA 4BKWA 1VJEA 4A3GK 1Y1VK 5FLMK 2Y0SD 2VUMC 4MEXA 4KAWX 2KPUA 1ZQ1C 2VUMA 1EQRA 1FEUA 3I4NK 2NVXK 4BBSK 4FZBA 4GTDA 3BP3A 1WQGA 4NOIA 1TWCK 2L3UA 2GSOA 4A3KK 4AYBL 1ISEA 1ZVUA 2FQOA 3K7AK 5L46A 4U67S 3GTPK 3PO2C 4BY1K 3S14C 2JH3A 4P9SA 5D4DA 3N0CA 5HL8A 3N0BA 1TWHC 1WOSA 3OEPA 2PA8D 4A93C 1TWHA 2E2JC 4QIWD 4G7ZA 5IP7C 3BP8C 2O5JA 3S2HC 5JVGS 1I50C 4G7OA 1J6XA 1I50A 1VLOA 4YFKA 1KQ4A 1XXAA 3GEHA 1HQMA 3AH5A 4XLPA 5TMCA 1EI6A 4A3BC 4KMHA 2JA5K 3GTMC 4WFAS 5M5WK 4WCES 3S1MC 1HI9A 3S14K 1EH1A 4ILDA 4DDQA 3GTMA 4OIOA 1Y1WC 4KM8A 1DCPA 1Y1WA 1TWHK 4FM9A 4A93K 3HOWK 2V6UA 2E2JK 1RU0A 4QJVB 1XZQA 4GZYA 4AYBD 4LQYA 3LAPA 3N3YA 4KB4A 3S2HK 1TWGC 3S1QK 1I50K 2E2IK 1TWGA 1DCOA 5IYBC 3HOVC 3NUHA 1GE9A 4A3BK 1B4BA 4C3HC 3FKIK 4GTCA 3AQPA 4LJZA 5M5YK 4A3FK 1B4AA 3WODA 1Y1WK 3TFIA 3RZDK 4KDDA 2FQTA 4OIQA 1IQ0A 3AD8C 2XCRB 5C4XK 5JVHS 4LLGA 2JA8C 2WB1L 2XCOA 3HOZC 3AQOA 1TWGK 1TWFK 4X6AK 3HOUK 2KXYA 1UV7A 3HOVK 2EBBA 4C3HK 1WOOA 1O27A 3BUEA 3VA7A 1SMYA 1USMA 1WORA 1O25A 1BJTA 3GTQC 3GTJC 1O2AA 3GTQA 3GTJA 3A8JA 2JA8K 3HOZK 1X31C 2P8TA 2CW0A 1IS1A 4XCHA 4YG2A 3HOYK 3S1RK 1XXCA 5M3FK 4BBRC 1WQHA 3GEEA 5JFEA 3S1NC 4A3MC 3CAGA 4A3LK 1JQWA 4P5BA 4KMDA 4Y52C 3GTQK 3GTJK 4O2DA 5HQHA 3FOEA 2WB1D 2NVQC 4KASA 4GTEA 4A3IC 4WILA 1WOPA 3S2DK 1XZQB 4XLNA 3HOXC 5IOSA 4BBRK 5IYDC 3S1NK 4A3MK 4YFNA 1BS2A 4Y52K 3S0XA 3GTOC 3H3VL 1TWAC 3GTOA 1XPPA 3M4OC 4BY7C 1TWAA 4IOAS 4WFBS 5IOTA 2VUMK 4C2MC 1SFOC 4WJ3M 1SFOA 4LK1A 2E2HC 3HOXK 3AD7C 2E2HA 1PJ6A 2YU9C 5IYDK 4IO9S 3H0GC 5C3EC 1USOA 3A8KA 1WIHA 4KM9A 2YU9A 3H0GA 1O26A 4G0VA 3GTGC 3GTOK 1I3QC 4WF9S 5M3MK 1TWAK 4Y7NC 3GTLC 5EGHA 4KC6A 1I3QA 3GTGA 4BY7K 3L4JA 3GTLA 3OREA 3PO2K 3T01A 2A69A 5DM6S 4GTBA 4KB2A 3T02A 4PAAA 4WJ4A 4BXXC 1XZPA 5CHPA 1IL2A 5IP7K 5TMFA 5C3EK 3FOFA 2JA7C 3H3VD 5IP9C 5C4JC 1O29A 1C0AA 2JA7A 4KN7A 3GTGK 2ZUFA 1K83C 4A3JC 2O5IA 1V5VA 1YCLA 4GTFA 4Y7NK 1JOEA 1K83A 1IBAA 4G0WA 3GTMK 3S1MK 2ZUEA 2GAHC 1EFWA 1WCMC 4A3EC 4C45A 2A6EA 1WCMA 4WFNS 2R93C 1EK8A 2JA7K 5IP9K 2R93A 4Q4ZA 3LYWA 2R7ZC 2KQ1A 1K83K 4A3JK 3GTKC 2R7ZA 1VH2A 4KATA 5IYBK 1I6HC 3GTKA 3HKZL 4Q5SA 5JVOA 4BLAA 1F7VA 4A3EK 4C3IC 3I4MC 1DD5A 1YX2A 2Y3PA 3TTGA 1BGWA 2R93K 1PJ7A 3ERED 1F9NA 2R7ZK 3GTKK 3G4CA 5CJ9A 5EGEA 2NVTC 4BLBA 2GAGC 2A68A 4MQ9A 3I4MK 1VRQC 4RMFA 3RZOC 1AB4A 4A3GC 5FLMC 4KMAA 1DCHA 1XZPB 2PMZL 3G4AA 2D6FC 1JVIA 3HKZD 3I4NC 1BDFA 1F7UA 4BBSC 3MMLB 2NVYC 4YFXA 1TWCC 3OPFA 3IPJA 2NVYA 1TWCA 4OINA 4GFQA 2KWAA 4A3KC 4LOWA 2R92C 3K7AC 3RZOK 3HXAA 2NVQK 2R92A 3GTPC 5HL7S 4J3NA 4BY1C 3ADAC 3GTPA 3S17C 1VGXA 1WQFA 4A3CC 4A3IK 1J6VA 1O24A 3CF5S 3SZZA 1J6WA 3LPXA 2NVYK 1J98A 3GIRA 1O2FB 2ZFZA 3S15C 1PJ5A 2R92K 3FHZA 4P5AA 2JA5C 3M4OK 5DM7S 2PPBA 2PMZD 5M5XK 2JA5A 3GEIA 4KMUA 3S17K 3GSIA 3LAJA 4A3CK 2CFAA 2ZJPS 4C2MK 1SFOK 5C44C 3PO3C 2ZJRS 4LK0A 3HOWC 2E2HK 4XSZA 5IYCC 4PABA 2YU9K 3S1QC 2V6TA 1F93A 3H0GK 3M3YC 2E2IC 2GSNA 1YNJA 2A6HA 3S15K 2E2IA 4LR2A 1I3QK 5IORA 4KARA 3GTLK 3FKIC 1ZYRA 4A3FC 1ZBSA 3L4KA 3FKIA 4GT9A 2B63C 3RZDC 1INNA 4KN4A 2B63A 5C44K 3DLLS 3PO3K 3S16C 2GSUA 3Q3QA 4BXXK 5IYCK 5C4XC 4IOCS 4GTLA 2XCQA 4C3JC 1TWFC 4X6AC 5C4JK 3M3YK 2JA6C 3HOUC 1TWFA 4A3DC 3EQLA 2P5MA 2JA6A 1WSRA 2BE5A 3A8IA 3CQZC 3PIPS 3GDZA 1O28A 3CQZA 3AD9C 4MEYA 1WSVA 1ZXOA 2B63K 1R9TC 4OIPA 4G0UA 1WCMK 1R9TA 3S16K 2ZJQS 2WAQL 3PIOS 3JSTA 4ZH4A 1IE0A 4C3JK 2L5NA 2JA6K 4A3DK 2Y0SL 3CQZK 4GTAA 3HOYC 3S1RC 1I6HK 1G51A 4XSXA 2RH6A 3QX3A 4A3LC 2V6SA 4M1XA 5TJ3A 1R9TK 3DXJA
chains in the Genus database with same CATH topology
4OIRA 2NVQK 3GTPC 3PO2K 4G7HA 1IW7A 4C3IK 4JK1A 2A69A 3RZDK 1YNNA 4BY1C 3S17C 4A3CC 4A3IK 4OIQA 1Y1VC 3RZOK 5C4XK 4BXXC 4LLGA 2JA8C 2WB1L 3HOZC 4QJVA 1TWGK 5FJ8K 3S2DC 1TWFK 5TMFA 5IP7K 4X6AK 5C3EK 3HOUK 2JA7C 3H3VD 5IP9C 5C4JC 2NVYK 3HOVK 4KN7A 2NVXC 3GTGK 1K83C 4A3JC 2O5IA 2NVTK 2PA8L 4C3HK 4Y7NK 3S15C 1I6VA 4QIWL 2R92K 2WAQD 3GTMK 2JA5C 1SMYA 3S1MK 3M4OK 2PPBA 2PMZD 3GTJC 3GTQC 5M5XK 4KMUA 3S17K 4A3CK 4A3GK 1WCMC 4A3EC 4C2MK 1Y1VK 5FLMK 2Y0SD 2VUMC 4MEXA 2A6EA 1SFOK 5C44C 3PO3C 2JA8K 3HOZK 4LK0A 3HOWC 2E2HK 2R93C 4XSZA 2CW0A 5IYCC 2JA7K 5IP9K 3I4NK 2YU9K 3S1QC 4YG2A 4Q4ZA 2R7ZC 3H0GK 2NVXK 4BBSK 3M3YC 4NOIA 2E2IC 3GTKC 1K83K 1TWCK 4A3JK 3S1RK 3HOYK 1YNJA 2A6HA 5IYBK 5M3FK 4BBRC 3S15K 1I6HC 1I3QK 4A3LK 3S1NC 4A3MC 4A3KK 3GTLK 3HKZL 4AYBL 4Q5SA 3FKIC 1ZYRA 4Y52C 3GTQK 3K7AK 3GTJK 4A3FC 3GTPK 2WB1D 2NVQC 4A3EK 3PO2C 2B63C 4BY1K 4C3IC 3I4MC 3RZDC 3S14C 4KN4A 5C44K 3PO3K 5D4DA 3S16C 4A3IC 1TWHC 2R93K 4BXXK 5IYCK 5C4XC 2PA8D 4A93C 3S2DK 2E2JC 4QIWD 4XLNA 2R7ZK 4G7ZA 3M3YK 4C3JC 1TWFC 5IP7C 3HOXC 2O5JA 2JA6C 4X6AC 3HOUC 5C4JK 3GTKK 3S2HC 4BBRK 4A3DC 3EQLA 5IYDC 1I50C 4G7OA 3S1NK 4A3MK 2BE5A 3CQZC 4YFNA 2NVTC 4YFKA 4Y52K 1HQMA 3GTOC 4XLPA 5TMCA 4MEYA 2A68A 4A3BC 2JA5K 3H3VL 1TWAC 3GTMC 4MQ9A 1XPPA 5M5WK 2B63K 3M4OC 3S1MC 1R9TC 4BY7C 3I4MK 3S14K 4OIOA 4OIPA 1Y1WC 3RZOC 1WCMK 3S16K 2VUMK 4A3GC 1TWHK 4C2MC 5FLMC 2WAQL 1SFOC 4A93K 3HOWK 2E2JK 4ZH4A 4LK1A 2PMZL 2E2HC 4C3JK 4QJVB 3HOXK 4GZYA 2JA6K 3HKZD 4AYBD 3S1QK 3S2HK 3I4NC 1TWGC 4A3DK 1BDFA 2YU9C 5IYDK 1I50K 2Y0SL 2E2IK 3H0GC 4BBSC 5C3EC 3CQZK 2NVYC 4YFXA 1TWCC 3HOYC 3S1RC 1I6HK 4XSXA 5IYBC 3HOVC 3GTGC 3GTOK 4OINA 1I3QC 4A3LC 4A3BK 4A3KC 4C3HC 4Y7NC 3GTLC 1TWAK 3FKIK 5M3MK 4A3FK 4LJZA 2R92C 5M5YK 1R9TK 4BY7K 3WODA 3K7AC 3DXJA 1Y1WK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OIR A;  2NVQ K;  3GTP C;  3PO2 K;  4G7H A;  1IW7 A;  4C3I K;  4JK1 A;  2A69 A;  3RZD K;  1YNN A;  4BY1 C;  3S17 C;  4A3C C;  4A3I K;  4OIQ A;  1Y1V C;  3RZO K;  5C4X K;  4BXX C;  4LLG A;  2JA8 C;  2WB1 L;  3HOZ C;  4QJV A;  1TWG K;  5FJ8 K;  3S2D C;  1TWF K;  5TMF A;  5IP7 K;  4X6A K;  5C3E K;  3HOU K;  2JA7 C;  3H3V D;  5IP9 C;  5C4J C;  2NVY K;  3HOV K;  4KN7 A;  2NVX C;  3GTG K;  1K83 C;  4A3J C;  2O5I A;  2NVT K;  2PA8 L;  4C3H K;  4Y7N K;  3S15 C;  1I6V A;  4QIW L;  2R92 K;  2WAQ D;  3GTM K;  2JA5 C;  1SMY A;  3S1M K;  3M4O K;  2PPB A;  2PMZ D;  3GTJ C;  3GTQ C;  5M5X K;  4KMU A;  3S17 K;  4A3C K;  4A3G K;  1WCM C;  4A3E C;  4C2M K;  1Y1V K;  5FLM K;  2Y0S D;  2VUM C;  4MEX A;  2A6E A;  1SFO K;  5C44 C;  3PO3 C;  2JA8 K;  3HOZ K;  4LK0 A;  3HOW C;  2E2H K;  2R93 C;  4XSZ A;  2CW0 A;  5IYC C;  2JA7 K;  5IP9 K;  3I4N K;  2YU9 K;  3S1Q C;  4YG2 A;  4Q4Z A;  2R7Z C;  3H0G K;  2NVX K;  4BBS K;  3M3Y C;  4NOI A;  2E2I C;  3GTK C;  1K83 K;  1TWC K;  4A3J K;  3S1R K;  3HOY K;  1YNJ A;  2A6H A;  5IYB K;  5M3F K;  4BBR C;  3S15 K;  1I6H C;  1I3Q K;  4A3L K;  3S1N C;  4A3M C;  4A3K K;  3GTL K;  3HKZ L;  4AYB L;  4Q5S A;  3FKI C;  1ZYR A;  4Y52 C;  3GTQ K;  3K7A K;  3GTJ K;  4A3F C;  3GTP K;  2WB1 D;  2NVQ C;  4A3E K;  3PO2 C;  2B63 C;  4BY1 K;  4C3I C;  3I4M C;  3RZD C;  3S14 C;  4KN4 A;  5C44 K;  3PO3 K;  5D4D A;  3S16 C;  4A3I C;  1TWH C;  2R93 K;  4BXX K;  5IYC K;  5C4X C;  2PA8 D;  4A93 C;  3S2D K;  2E2J C;  4QIW D;  4XLN A;  2R7Z K;  4G7Z A;  3M3Y K;  4C3J C;  1TWF C;  5IP7 C;  3HOX C;  2O5J A;  2JA6 C;  4X6A C;  3HOU C;  5C4J K;  3GTK K;  3S2H C;  4BBR K;  4A3D C;  3EQL A;  5IYD C;  1I50 C;  4G7O A;  3S1N K;  4A3M K;  2BE5 A;  3CQZ C;  4YFN A;  2NVT C;  4YFK A;  4Y52 K;  1HQM A;  3GTO C;  4XLP A;  5TMC A;  4MEY A;  2A68 A;  4A3B C;  2JA5 K;  3H3V L;  1TWA C;  3GTM C;  4MQ9 A;  1XPP A;  5M5W K;  2B63 K;  3M4O C;  3S1M C;  1R9T C;  4BY7 C;  3I4M K;  3S14 K;  4OIO A;  4OIP A;  1Y1W C;  3RZO C;  1WCM K;  3S16 K;  2VUM K;  4A3G C;  1TWH K;  4C2M C;  5FLM C;  2WAQ L;  1SFO C;  4A93 K;  3HOW K;  2E2J K;  4ZH4 A;  4LK1 A;  2PMZ L;  2E2H C;  4C3J K;  4QJV B;  3HOX K;  4GZY A;  2JA6 K;  3HKZ D;  4AYB D;  3S1Q K;  3S2H K;  3I4N C;  1TWG C;  4A3D K;  1BDF A;  2YU9 C;  5IYD K;  1I50 K;  2Y0S L;  2E2I K;  3H0G C;  4BBS C;  5C3E C;  3CQZ K;  2NVY C;  4YFX A;  1TWC C;  3HOY C;  3S1R C;  1I6H K;  4XSX A;  5IYB C;  3HOV C;  3GTG C;  3GTO K;  4OIN A;  1I3Q C;  4A3L C;  4A3B K;  4A3K C;  4C3H C;  4Y7N C;  3GTL C;  1TWA K;  3FKI K;  5M3M K;  4A3F K;  4LJZ A;  2R92 C;  5M5Y K;  1R9T K;  4BY7 K;  3WOD A;  3K7A C;  3DXJ A;  1Y1W K; 
#chains in the Genus database with same CATH topology
 4OIR A;  4G7H A;  1IW7 A;  4C3I K;  4JK1 A;  2CFA B;  1YNN A;  2PHC B;  3SZY A;  2W7V A;  3TFH A;  1Y1V C;  1Y1V A;  4AH6 A;  4QJV A;  5FJ8 K;  3S2D C;  3TFJ A;  5IOQ A;  1O2B A;  3T00 A;  2NVX C;  2RGR A;  2NVT K;  2PA8 L;  2NVX A;  1I6V A;  1XXB A;  4QIW L;  2WAQ D;  5E68 A;  1L0W A;  3V4G A;  4BKW A;  1VJE A;  4A3G K;  1Y1V K;  5FLM K;  2Y0S D;  2VUM C;  4MEX A;  4KAW X;  2KPU A;  1ZQ1 C;  2VUM A;  1EQR A;  1FEU A;  3I4N K;  2NVX K;  4BBS K;  4FZB A;  4GTD A;  3BP3 A;  1WQG A;  4NOI A;  1TWC K;  2L3U A;  2GSO A;  4A3K K;  4AYB L;  1ISE A;  1ZVU A;  2FQO A;  3K7A K;  5L46 A;  4U67 S;  3GTP K;  3PO2 C;  4BY1 K;  3S14 C;  2JH3 A;  4P9S A;  5D4D A;  3N0C A;  5HL8 A;  3N0B A;  1TWH C;  1WOS A;  3OEP A;  2PA8 D;  4A93 C;  1TWH A;  2E2J C;  4QIW D;  4G7Z A;  5IP7 C;  3BP8 C;  2O5J A;  3S2H C;  5JVG S;  1I50 C;  4G7O A;  1J6X A;  1I50 A;  1VLO A;  4YFK A;  1KQ4 A;  1XXA A;  3GEH A;  1HQM A;  3AH5 A;  4XLP A;  5TMC A;  1EI6 A;  4A3B C;  4KMH A;  2JA5 K;  3GTM C;  4WFA S;  5M5W K;  4WCE S;  3S1M C;  1HI9 A;  3S14 K;  1EH1 A;  4ILD A;  4DDQ A;  3GTM A;  4OIO A;  1Y1W C;  4KM8 A;  1DCP A;  1Y1W A;  1TWH K;  4FM9 A;  4A93 K;  3HOW K;  2V6U A;  2E2J K;  1RU0 A;  4QJV B;  1XZQ A;  4GZY A;  4AYB D;  4LQY A;  3LAP A;  3N3Y A;  4KB4 A;  3S2H K;  1TWG C;  3S1Q K;  1I50 K;  2E2I K;  1TWG A;  1DCO A;  5IYB C;  3HOV C;  3NUH A;  1GE9 A;  4A3B K;  1B4B A;  4C3H C;  3FKI K;  4GTC A;  3AQP A;  4LJZ A;  5M5Y K;  4A3F K;  1B4A A;  3WOD A;  1Y1W K;  3TFI A;  3RZD K;  4KDD A;  2FQT A;  4OIQ A;  1IQ0 A;  3AD8 C;  2XCR B;  5C4X K;  5JVH S;  4LLG A;  2JA8 C;  2WB1 L;  2XCO A;  3HOZ C;  3AQO A;  1TWG K;  1TWF K;  4X6A K;  3HOU K;  2KXY A;  1UV7 A;  3HOV K;  2EBB A;  4C3H K;  1WOO A;  1O27 A;  3BUE A;  3VA7 A;  1SMY A;  1USM A;  1WOR A;  1O25 A;  1BJT A;  3GTQ C;  3GTJ C;  1O2A A;  3GTQ A;  3GTJ A;  3A8J A;  2JA8 K;  3HOZ K;  1X31 C;  2P8T A;  2CW0 A;  1IS1 A;  4XCH A;  4YG2 A;  3HOY K;  3S1R K;  1XXC A;  5M3F K;  4BBR C;  1WQH A;  3GEE A;  5JFE A;  3S1N C;  4A3M C;  3CAG A;  4A3L K;  1JQW A;  4P5B A;  4KMD A;  4Y52 C;  3GTQ K;  3GTJ K;  4O2D A;  5HQH A;  3FOE A;  2WB1 D;  2NVQ C;  4KAS A;  4GTE A;  4A3I C;  4WIL A;  1WOP A;  3S2D K;  1XZQ B;  4XLN A;  3HOX C;  5IOS A;  4BBR K;  5IYD C;  3S1N K;  4A3M K;  4YFN A;  1BS2 A;  4Y52 K;  3S0X A;  3GTO C;  3H3V L;  1TWA C;  3GTO A;  1XPP A;  3M4O C;  4BY7 C;  1TWA A;  4IOA S;  4WFB S;  5IOT A;  2VUM K;  4C2M C;  1SFO C;  4WJ3 M;  1SFO A;  4LK1 A;  2E2H C;  3HOX K;  3AD7 C;  2E2H A;  1PJ6 A;  2YU9 C;  5IYD K;  4IO9 S;  3H0G C;  5C3E C;  1USO A;  3A8K A;  1WIH A;  4KM9 A;  2YU9 A;  3H0G A;  1O26 A;  4G0V A;  3GTG C;  3GTO K;  1I3Q C;  4WF9 S;  5M3M K;  1TWA K;  4Y7N C;  3GTL C;  5EGH A;  4KC6 A;  1I3Q A;  3GTG A;  4BY7 K;  3L4J A;  3GTL A;  3ORE A;  3PO2 K;  3T01 A;  2A69 A;  5DM6 S;  4GTB A;  4KB2 A;  3T02 A;  4PAA A;  4WJ4 A;  4BXX C;  1XZP A;  5CHP A;  1IL2 A;  5IP7 K;  5TMF A;  5C3E K;  3FOF A;  2JA7 C;  3H3V D;  5IP9 C;  5C4J C;  1O29 A;  1C0A A;  2JA7 A;  4KN7 A;  3GTG K;  2ZUF A;  1K83 C;  4A3J C;  2O5I A;  1V5V A;  1YCL A;  4GTF A;  4Y7N K;  1JOE A;  1K83 A;  1IBA A;  4G0W A;  3GTM K;  3S1M K;  2ZUE A;  2GAH C;  1EFW A;  1WCM C;  4A3E C;  4C45 A;  2A6E A;  1WCM A;  4WFN S;  2R93 C;  1EK8 A;  2JA7 K;  5IP9 K;  2R93 A;  4Q4Z A;  3LYW A;  2R7Z C;  2KQ1 A;  1K83 K;  4A3J K;  3GTK C;  2R7Z A;  1VH2 A;  4KAT A;  5IYB K;  1I6H C;  3GTK A;  3HKZ L;  4Q5S A;  5JVO A;  4BLA A;  1F7V A;  4A3E K;  4C3I C;  3I4M C;  1DD5 A;  1YX2 A;  2Y3P A;  3TTG A;  1BGW A;  2R93 K;  1PJ7 A;  3ERE D;  1F9N A;  2R7Z K;  3GTK K;  3G4C A;  5CJ9 A;  5EGE A;  2NVT C;  4BLB A;  2GAG C;  2A68 A;  4MQ9 A;  3I4M K;  1VRQ C;  4RMF A;  3RZO C;  1AB4 A;  4A3G C;  5FLM C;  4KMA A;  1DCH A;  1XZP B;  2PMZ L;  3G4A A;  2D6F C;  1JVI A;  3HKZ D;  3I4N C;  1BDF A;  1F7U A;  4BBS C;  3MML B;  2NVY C;  4YFX A;  1TWC C;  3OPF A;  3IPJ A;  2NVY A;  1TWC A;  4OIN A;  4GFQ A;  2KWA A;  4A3K C;  4LOW A;  2R92 C;  3K7A C;  3RZO K;  3HXA A;  2NVQ K;  2R92 A;  3GTP C;  5HL7 S;  4J3N A;  4BY1 C;  3ADA C;  3GTP A;  3S17 C;  1VGX A;  1WQF A;  4A3C C;  4A3I K;  1J6V A;  1O24 A;  3CF5 S;  3SZZ A;  1J6W A;  3LPX A;  2NVY K;  1J98 A;  3GIR A;  1O2F B;  2ZFZ A;  3S15 C;  1PJ5 A;  2R92 K;  3FHZ A;  4P5A A;  2JA5 C;  3M4O K;  5DM7 S;  2PPB A;  2PMZ D;  5M5X K;  2JA5 A;  3GEI A;  4KMU A;  3S17 K;  3GSI A;  3LAJ A;  4A3C K;  2CFA A;  2ZJP S;  4C2M K;  1SFO K;  5C44 C;  3PO3 C;  2ZJR S;  4LK0 A;  3HOW C;  2E2H K;  4XSZ A;  5IYC C;  4PAB A;  2YU9 K;  3S1Q C;  2V6T A;  1F93 A;  3H0G K;  3M3Y C;  2E2I C;  2GSN A;  1YNJ A;  2A6H A;  3S15 K;  2E2I A;  4LR2 A;  1I3Q K;  5IOR A;  4KAR A;  3GTL K;  3FKI C;  1ZYR A;  4A3F C;  1ZBS A;  3L4K A;  3FKI A;  4GT9 A;  2B63 C;  3RZD C;  1INN A;  4KN4 A;  2B63 A;  5C44 K;  3DLL S;  3PO3 K;  3S16 C;  2GSU A;  3Q3Q A;  4BXX K;  5IYC K;  5C4X C;  4IOC S;  4GTL A;  2XCQ A;  4C3J C;  1TWF C;  4X6A C;  5C4J K;  3M3Y K;  2JA6 C;  3HOU C;  1TWF A;  4A3D C;  3EQL A;  2P5M A;  2JA6 A;  1WSR A;  2BE5 A;  3A8I A;  3CQZ C;  3PIP S;  3GDZ A;  1O28 A;  3CQZ A;  3AD9 C;  4MEY A;  1WSV A;  1ZXO A;  2B63 K;  1R9T C;  4OIP A;  4G0U A;  1WCM K;  1R9T A;  3S16 K;  2ZJQ S;  2WAQ L;  3PIO S;  3JST A;  4ZH4 A;  1IE0 A;  4C3J K;  2L5N A;  2JA6 K;  4A3D K;  2Y0S L;  3CQZ K;  4GTA A;  3HOY C;  3S1R C;  1I6H K;  1G51 A;  4XSX A;  2RH6 A;  3QX3 A;  4A3L C;  2V6S A;  4M1X A;  5TJ3 A;  1R9T K;  3DXJ A; 
#chains in the Genus database with same CATH homology
 4OIR A;  2NVQ K;  3GTP C;  3PO2 K;  4G7H A;  1IW7 A;  4C3I K;  4JK1 A;  2A69 A;  3RZD K;  1YNN A;  4BY1 C;  3S17 C;  4A3C C;  4A3I K;  4OIQ A;  1Y1V C;  3RZO K;  5C4X K;  4BXX C;  4LLG A;  2JA8 C;  2WB1 L;  3HOZ C;  4QJV A;  1TWG K;  5FJ8 K;  3S2D C;  1TWF K;  5TMF A;  5IP7 K;  4X6A K;  5C3E K;  3HOU K;  2JA7 C;  3H3V D;  5IP9 C;  5C4J C;  2NVY K;  3HOV K;  4KN7 A;  2NVX C;  3GTG K;  1K83 C;  4A3J C;  2O5I A;  2NVT K;  2PA8 L;  4C3H K;  4Y7N K;  3S15 C;  1I6V A;  4QIW L;  2R92 K;  2WAQ D;  3GTM K;  2JA5 C;  1SMY A;  3S1M K;  3M4O K;  2PPB A;  2PMZ D;  3GTJ C;  3GTQ C;  5M5X K;  4KMU A;  3S17 K;  4A3C K;  4A3G K;  1WCM C;  4A3E C;  4C2M K;  1Y1V K;  5FLM K;  2Y0S D;  2VUM C;  4MEX A;  2A6E A;  1SFO K;  5C44 C;  3PO3 C;  2JA8 K;  3HOZ K;  4LK0 A;  3HOW C;  2E2H K;  2R93 C;  4XSZ A;  2CW0 A;  5IYC C;  2JA7 K;  5IP9 K;  3I4N K;  2YU9 K;  3S1Q C;  4YG2 A;  4Q4Z A;  2R7Z C;  3H0G K;  2NVX K;  4BBS K;  3M3Y C;  4NOI A;  2E2I C;  3GTK C;  1K83 K;  1TWC K;  4A3J K;  3S1R K;  3HOY K;  1YNJ A;  2A6H A;  5IYB K;  5M3F K;  4BBR C;  3S15 K;  1I6H C;  1I3Q K;  4A3L K;  3S1N C;  4A3M C;  4A3K K;  3GTL K;  3HKZ L;  4AYB L;  4Q5S A;  3FKI C;  1ZYR A;  4Y52 C;  3GTQ K;  3K7A K;  3GTJ K;  4A3F C;  3GTP K;  2WB1 D;  2NVQ C;  4A3E K;  3PO2 C;  2B63 C;  4BY1 K;  4C3I C;  3I4M C;  3RZD C;  3S14 C;  4KN4 A;  5C44 K;  3PO3 K;  5D4D A;  3S16 C;  4A3I C;  1TWH C;  2R93 K;  4BXX K;  5IYC K;  5C4X C;  2PA8 D;  4A93 C;  3S2D K;  2E2J C;  4QIW D;  4XLN A;  2R7Z K;  4G7Z A;  3M3Y K;  4C3J C;  1TWF C;  5IP7 C;  3HOX C;  2O5J A;  2JA6 C;  4X6A C;  3HOU C;  5C4J K;  3GTK K;  3S2H C;  4BBR K;  4A3D C;  3EQL A;  5IYD C;  1I50 C;  4G7O A;  3S1N K;  4A3M K;  2BE5 A;  3CQZ C;  4YFN A;  2NVT C;  4YFK A;  4Y52 K;  1HQM A;  3GTO C;  4XLP A;  5TMC A;  4MEY A;  2A68 A;  4A3B C;  2JA5 K;  3H3V L;  1TWA C;  3GTM C;  4MQ9 A;  1XPP A;  5M5W K;  2B63 K;  3M4O C;  3S1M C;  1R9T C;  4BY7 C;  3I4M K;  3S14 K;  4OIO A;  4OIP A;  1Y1W C;  3RZO C;  1WCM K;  3S16 K;  2VUM K;  4A3G C;  1TWH K;  4C2M C;  5FLM C;  2WAQ L;  1SFO C;  4A93 K;  3HOW K;  2E2J K;  4ZH4 A;  4LK1 A;  2PMZ L;  2E2H C;  4C3J K;  4QJV B;  3HOX K;  4GZY A;  2JA6 K;  3HKZ D;  4AYB D;  3S1Q K;  3S2H K;  3I4N C;  1TWG C;  4A3D K;  1BDF A;  2YU9 C;  5IYD K;  1I50 K;  2Y0S L;  2E2I K;  3H0G C;  4BBS C;  5C3E C;  3CQZ K;  2NVY C;  4YFX A;  1TWC C;  3HOY C;  3S1R C;  1I6H K;  4XSX A;  5IYB C;  3HOV C;  3GTG C;  3GTO K;  4OIN A;  1I3Q C;  4A3L C;  4A3B K;  4A3K C;  4C3H C;  4Y7N C;  3GTL C;  1TWA K;  3FKI K;  5M3M K;  4A3F K;  4LJZ A;  2R92 C;  5M5Y K;  1R9T K;  4BY7 K;  3WOD A;  3K7A C;  3DXJ A;  1Y1W K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...