3EQLA

Crystal structure of the t. thermophilus rna polymerase holoenzyme in complex with antibiotic myxopyronin
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
229
structure length
229
Chain Sequence
b'MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase subunit alpha
publication title Transcription inactivation through local refolding of the RNA polymerase structure.
pubmed doi rcsb
molecule tags Transferase
total genus 40
structure length 229
sequence length 229
chains with identical sequence B, K, L
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2008-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01000 RNA_pol_A_bac RNA polymerase Rpb3/RpoA insert domain
A PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain
A PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.12 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 DNA-directed RNA polymerase, insert domain 3eqlA02
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3eqlA01
3HOYC 1K83K 3PO3K 3HOUC 1I3QK 4A3CK 4LK0A 2CW0A 4QJVB 2B63K 2YU9C 2NVYC 2PA8D 3PO2K 3S15K 3FKIC 1ZYRA 4OIRA 4QIWD 4A3BC 2NVTC 3H0GK 4A3EK 5C4JK 3S1MK 2PA8L 4C3IK 2JA5K 3M4OK 4AYBD 1Y1VC 3GTQC 4QIWL 1TWGC 4A3DK 3GTMK 1I50C 2R92K 4AYBL 2JA6C 2E2HK 3M3YC 5C4XC 4LJZA 4BBRK 2E2IC 3RZDK 4BY1K 4C2MK 4MQ9A 3HOVC 3RZOK 1Y1WC 5C3EC 3HOWK 1TWCC 4KN7A 4OIOA 3CQZK 3I4MC 4A3JC 4YFKA 2E2JC 1I6HC 2WAQD 3GTGK 3GTKC 3S14C 5FLMK 2NVXC 2R7ZC 4Q5SA 3PO3C 4BY7K 2WAQL 3K7AK 3H3VL 1R9TC 5IP9C 5D4DA 2VUMK 1TWAK 3HOXK 3S2DC 1YNNA 3S1MC 3S17K 2R93K 4A3LK 2JA8C 2O5JA 4A3KK 4G7ZA 4A3MK 2O5IA 4A93K 3S14K 1WCMC 3GTMC 4Q4ZA 4XLPA 3S1RC 3HOZC 3GTOC 1TWFC 3S16C 5C44K 5IYDK 1TWHC 4YFXA 4OIPA 4C3HC 5M5YK 3GTLC 5IYBK 4Y7NK 4Y52C 4MEYA 2A6HA 3WODA 4C2MC 5M3FK 4A3FK 3GTPK 4A3GK 3I4NK 3DXJA 3CQZC 2WB1L 3HOUK 1I6VA 4QJVA 3GTJK 3GTGC 2NVYK 3H3VD 4X6AK 2JA7C 3FKIK 4A3IC 1K83C 2PMZL 1I3QC 1XPPA 2NVQK 3S2HK 2B63C 3PO2C 4XSZA 3S15C 2A69A 4LK1A 1Y1VK 3GTQK 5IYCK 4C3JK 4XSXA 5M5WK 3H0GC 4YFNA 4A3EC 4GZYA 1SMYA 5C4JC 2A68A 2R93C 1IW7A 1TWGK 4C3IC 4A3KC 2JA5C 4OIQA 3M4OC 2PPBA 1YNJA 4A93C 5C4XK 5FJ8K 4G7OA 5TMCA 2E2IK 4A3DC 5C44C 1SFOK 2R92C 3HOVK 4BXXK 4KMUA 4KN4A 2E2HC 5C3EK 4LLGA 2NVQC 5IYBC 4BBSC 4BBRC 4Y7NC 4A3FC 3RZDC 2WB1D 4BY1C 4A3GC 4A3JK 3RZOC 2E2JK 3S1NK 4YG2A 3S1QK 1I6HK 3HOWC 4JK1A 3GTKK 2R7ZK 5IP7K 3HOYK 4MEXA 2PMZD 5M3MK 3GTJC 2YU9K 2Y0SL 4X6AC 5IP9K 1R9TK 5FLMC 2A6EA 4A3BK 3S2DK 4BY7C 2NVTK 3S2HC 3K7AC 5M5XK 2JA8K 4BBSK 2VUMC 1TWAC 4G7HA 5IYCC 4C3JC 3HOXC 3S17C 1WCMK 4A3CC 4A3LC 2BE5A 3EQLA 1I50K 3S1RK 3HOZK 3GTOK 1TWFK 4A3MC 2JA6K 3S16K 3M3YK 1TWHK 4XLNA 4ZH4A 4C3HK 3GTLK 4Y52K 1SFOC 4BXXC 1Y1WK 3HKZD 5IYDC 5TMFA 1TWCK 3GTPC 1BDFA 4OINA 3HKZL 3S1NC 4NOIA 3S1QC 1HQMA 3I4MK 3I4NC 2JA7K 2Y0SD 2NVXK 5IP7C 4A3IK
chains in the Genus database with same CATH superfamily
3PO3K 3HOUC 4QJVB 2YU9C 1ZYRA 5HL8A 1WQFA 4GT9A 3L4JA 2KQ1A 2GSUA 1USMA 4AYBL 2E2HK 4LJZA 4BY1K 2E2IC 4MQ9A 3RZOK 5C3EC 1TWCC 3CQZK 3BP3A 4BLBA 1WQGA 1GE9A 3I4MC 4A3JC 1IL2A 1O29A 2NVXC 3PO3C 3H3VL 4KMDA 2CFAA 3MMLB 2VUMK 4A3LK 3GTKA 2R7ZA 3SZYA 1WCMC 4XLPA 5C44K 3GTOC 3PIPS 3VA7A 4Y7NK 4Y52C 3GTPK 3WODA 4GTEA 4A3GK 3I4NK 3CQZC 2WB1L 1XZQA 1IQ0A 2JA7C 1TWFA 2JA6A 3LAJA 1BJTA 2B63C 4XSZA 3GTQK 4XSXA 3H0GC 2JA5C 3TTGA 5FJ8K 4A3DC 5C44C 2R92C 4BXXK 2Y3PA 1C0AA 4Y7NC 3RZDC 1WOPA 4A3GC 4KATA 3S1NK 1I6HK 4MEXA 5DM7S 4KARA 2PMZD 3LAPA 1J6WA 3QX3A 1EQRA 4A3BK 3S2DK 2NVTK 3G4CA 3K7AC 2JA8K 3N0CA 1WOSA 1FEUA 4G7HA 3HOXC 1BS2A 3EQLA 1I50K 3HOZK 3GTJA 2GAHC 3LYWA 3GTLK 4BXXC 3V4GA 4WFBS 5IYDC 4KMHA 2R93A 3S1NC 4IO9S 1L0WA 1F93A 1JOEA 4A3IK 1K83K 1I3QK 1XZQB 2CW0A 5DM6S 2L3UA 2NVYC 2PA8D 3PO2K 3S15K 3OEPA 3FKIC 4A3BC 5IORA 2NVTC 4A3EK 3M4OK 3BUEA 4QIWL 1Y1VC 3PIOS 1XXCA 3Q3QA 1TWGC 3GTMK 1I50C 2RH6A 1ZBSA 3A8JA 5C4XC 4BBRK 5JVGS 3HOVC 4XCHA 1VH2A 3HOWK 3CF5S 4O2DA 4KN7A 3IPJA 4LOWA 2E2JC 5FLMK 4Q5SA 4BY7K 2WAQL 2E2IA 2PHCB 1R9TC 1WIHA 1TWAK 3TFHA 1YNNA 4U67S 4GFQA 3SZZA 1O25A 3S17K 4A3KK 1WOOA 1DCOA 4KASA 2O5IA 2EBBA 1IS1A 3GTMC 4Q4ZA 3S16C 1TWHC 4YFXA 1RU0A 4OIPA 4C3HC 2NVQK 4BBSK 5M3FK 4PABA 4A3FK 4MEYA 4IOCS 1X31C 3ERED 1EI6A 1WCMA 3GTOA 1IE0A 2PMZL 2V6UA 1XPPA 4DDQA 1J6VA 3AQOA 1Y1WA 5IYCK 2ZJQS 4KM9A 2D6FC 4A3CK 4A3KC 4OIQA 2PPBA 1F7VA 5HL7S 2JA7A 4G7OA 5TJ3A 2B63A 4KMUA 2E2HC 2JH3A 2NVQC 4BBSC 4A3FC 4BY1C 3H0GA 3RZOC 1WORA 3S1QK 4YG2A 3GIRA 2JA5A 3GTKK 2R7ZK 4ILDA 1F7UA 2XCOA 5IP9K 2R92A 5JVOA 2A6EA 3AD9C 3T02A 4WCES 1O2BA 3AH5A 1O28A 4G0WA 3A8IA 4IOAS 5L46A 2VUMC 5IYCC 4A3CC 4A3LC 4P5BA 1AB4A 3S1RK 4KB4A 1TWFK 2JA6K 3GTGA 1JQWA 2W7VA 4WILA 1WQHA 5TMFA 1VLOA 3GTPC 1BDFA 4OINA 3HKZL 3S1QC 1HQMA 3I4NC 3S14K 1DCPA 4BLAA 4LK0A 3TFIA 1VGXA 1HI9A 1XZPA 5C4JK 5HQHA 3S0XA 4KDDA 4C3IK 4GTCA 4AYBD 1WSRA 3GTQC 3N3YA 5EGHA 2JA6C 2NVYA 3FKIA 3N0BA 3BP8C 1O26A 1Y1VA 1XXBA 1JVIA 4GTBA 1TWGA 1EFWA 1I6HC 3S14C 2V6SA 1F9NA 5IOTA 4WFNS 1SFOA 3S2DC 2R93K 5EGEA 2JA8C 1J6XA 4G7ZA 1XXAA 4A3MK 4KC6A 4A93K 3HOZC 2YU9A 1R9TA 4P9SA 3TFJA 5M5YK 5IYBK 3GTLC 2GSOA 3FOEA 4RMFA 3HOUK 5JFEA 1G51A 4X6AK 1ZQ1C 4A3IC 1K83C 1TWHA 1I3QC 1YX2A 3PO2C 3AQPA 3S15C 1DD5A 2A69A 4LK1A 1INNA 4C3JK 1TWCA 1XZPB 4YFNA 4A3EC 2R93C 5IOSA 3M4OC 4J3NA 1YNJA 3GEEA 3DLLS 4A93C 5E68A 2NVXA 4WF9S 2E2IK 2P5MA 4G0VA 2FQTA 2P8TA 5C3EK 1PJ5A 4LLGA 5IYBC 1USOA 4BBRC 1WSVA 4A3JK 4KB2A 3HOWC 4M1XA 3GDZA 5IP7K 3HOYK 1YCLA 3LPXA 5M3MK 4X6AC 5FLMC 2E2HA 4BY7C 5M5XK 2ZFZA 3G4AA 1TWAC 4C3JC 3CQZA 3S17C 1WCMK 2KWAA 3ADAC 2BE5A 5CHPA 3GTOK 3M3YK 4XLNA 1B4BA 1O2AA 4Y52K 1Y1WK 2KXYA 3GEHA 2VUMA 1B4AA 4G0UA 1VRQC 2JA7K 2Y0SD 3HXAA 5IP7C 3HOYC 4WJ4A 2RGRA 2B63K 1IBAA 1O2FB 4OIRA 4QIWD 3H0GK 3S1MK 2PA8L 3GTPA 2JA5K 1VJEA 4A3DK 2R92K 3M3YC 1ISEA 3RZDK 4FZBA 4C2MK 1Y1WC 4OIOA 2GAGC 3GTQA 3OPFA 4YFKA 4PAAA 2WAQD 5JVHS 1O27A 3GTKC 3GTGK 2R7ZC 1PJ7A 4LR2A 3GEIA 4GTDA 2XCQA 3K7AK 5IP9C 3AD7C 5D4DA 3HOXK 3S1MC 4GTLA 4BKWA 3FHZA 2O5JA 1UV7A 3CAGA 3GSIA 3S1RC 2GSNA 1TWFC 5IYDK 3NUHA 4C45A 3JSTA 2A6HA 4C2MC 3DXJA 2V6TA 3AD8C 1I6VA 4QJVA 3GTJK 3GTGC 2NVYK 3H3VD 1I50A 1DCHA 3FKIK 1KQ4A 3GTLA 3S2HK 2CFAB 1V5VA 1Y1VK 1EH1A 5M5WK 4GZYA 1TWGK 1SMYA 5C4JC 2A68A 1IW7A 1J98A 4C3IC 4KM8A 2FQOA 5C4XK 1K83A 5TMCA 1I3QA 3HOVK 1SFOK 2ZUFA 4LQYA 4KN4A 3T00A 4GTAA 2XCRB 2WB1D 2E2JK 2L5NA 1BGWA 4JK1A 3FOFA 1PJ6A 1ZVUA 5IOQA 2ZJRS 3OREA 3GTJC 3GTMA 2YU9K 2Y0SL 1R9TK 4KAWX 4FM9A 3S2HC 3A8KA 1EK8A 4WJ3M 4WFAS 3L4KA 3S16K 4A3MC 1ZXOA 1TWHK 4ZH4A 4C3HK 2ZJPS 1O24A 1SFOC 3HKZD 4AH6A 4P5AA 2KPUA 1TWCK 3T01A 1TWAA 4KMAA 5CJ9A 3I4MK 4GTFA 4NOIA 2ZUEA 2NVXK
chains in the Genus database with same CATH topology
3HOYC 1K83K 3PO3K 3HOUC 1I3QK 4A3CK 4LK0A 2CW0A 4QJVB 2B63K 2YU9C 2NVYC 2PA8D 3PO2K 3S15K 3FKIC 1ZYRA 4OIRA 4QIWD 4A3BC 2NVTC 3H0GK 4A3EK 5C4JK 3S1MK 2PA8L 4C3IK 2JA5K 3M4OK 4AYBD 1Y1VC 3GTQC 4QIWL 1TWGC 4A3DK 3GTMK 1I50C 2R92K 4AYBL 2JA6C 2E2HK 3M3YC 5C4XC 4LJZA 4BBRK 2E2IC 3RZDK 4BY1K 4C2MK 4MQ9A 3HOVC 3RZOK 1Y1WC 5C3EC 3HOWK 1TWCC 4KN7A 4OIOA 3CQZK 3I4MC 4A3JC 4YFKA 2E2JC 1I6HC 2WAQD 3GTGK 3GTKC 3S14C 5FLMK 2NVXC 2R7ZC 4Q5SA 3PO3C 4BY7K 2WAQL 3K7AK 3H3VL 1R9TC 5IP9C 5D4DA 2VUMK 1TWAK 3HOXK 3S2DC 1YNNA 3S1MC 3S17K 2R93K 4A3LK 2JA8C 2O5JA 4A3KK 4G7ZA 4A3MK 2O5IA 4A93K 3S14K 1WCMC 3GTMC 4Q4ZA 4XLPA 3S1RC 3HOZC 3GTOC 1TWFC 3S16C 5C44K 5IYDK 1TWHC 4YFXA 4OIPA 4C3HC 5M5YK 3GTLC 5IYBK 4Y7NK 4Y52C 4MEYA 2A6HA 3WODA 4C2MC 5M3FK 4A3FK 3GTPK 4A3GK 3I4NK 3DXJA 3CQZC 2WB1L 3HOUK 1I6VA 4QJVA 3GTJK 3GTGC 2NVYK 3H3VD 4X6AK 2JA7C 3FKIK 4A3IC 1K83C 2PMZL 1I3QC 1XPPA 2NVQK 3S2HK 2B63C 3PO2C 4XSZA 3S15C 2A69A 4LK1A 1Y1VK 3GTQK 5IYCK 4C3JK 4XSXA 5M5WK 3H0GC 4YFNA 4A3EC 4GZYA 1SMYA 5C4JC 2A68A 2R93C 1IW7A 1TWGK 4C3IC 4A3KC 2JA5C 4OIQA 3M4OC 2PPBA 1YNJA 4A93C 5C4XK 5FJ8K 4G7OA 5TMCA 2E2IK 4A3DC 5C44C 1SFOK 2R92C 3HOVK 4BXXK 4KMUA 4KN4A 2E2HC 5C3EK 4LLGA 2NVQC 5IYBC 4BBSC 4BBRC 4Y7NC 4A3FC 3RZDC 2WB1D 4BY1C 4A3GC 4A3JK 3RZOC 2E2JK 3S1NK 4YG2A 3S1QK 1I6HK 3HOWC 4JK1A 3GTKK 2R7ZK 5IP7K 3HOYK 4MEXA 2PMZD 5M3MK 3GTJC 2YU9K 2Y0SL 4X6AC 5IP9K 1R9TK 5FLMC 2A6EA 4A3BK 3S2DK 4BY7C 2NVTK 3S2HC 3K7AC 5M5XK 2JA8K 4BBSK 2VUMC 1TWAC 4G7HA 5IYCC 4C3JC 3HOXC 3S17C 1WCMK 4A3CC 4A3LC 2BE5A 3EQLA 1I50K 3S1RK 3HOZK 3GTOK 1TWFK 4A3MC 2JA6K 3S16K 3M3YK 1TWHK 4XLNA 4ZH4A 4C3HK 3GTLK 4Y52K 1SFOC 4BXXC 1Y1WK 3HKZD 5IYDC 5TMFA 1TWCK 3GTPC 1BDFA 4OINA 3HKZL 3S1NC 4NOIA 3S1QC 1HQMA 3I4MK 3I4NC 2JA7K 2Y0SD 2NVXK 5IP7C 4A3IK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HOY C;  1K83 K;  3PO3 K;  3HOU C;  1I3Q K;  4A3C K;  4LK0 A;  2CW0 A;  4QJV B;  2B63 K;  2YU9 C;  2NVY C;  2PA8 D;  3PO2 K;  3S15 K;  3FKI C;  1ZYR A;  4OIR A;  4QIW D;  4A3B C;  2NVT C;  3H0G K;  4A3E K;  5C4J K;  3S1M K;  2PA8 L;  4C3I K;  2JA5 K;  3M4O K;  4AYB D;  1Y1V C;  3GTQ C;  4QIW L;  1TWG C;  4A3D K;  3GTM K;  1I50 C;  2R92 K;  4AYB L;  2JA6 C;  2E2H K;  3M3Y C;  5C4X C;  4LJZ A;  4BBR K;  2E2I C;  3RZD K;  4BY1 K;  4C2M K;  4MQ9 A;  3HOV C;  3RZO K;  1Y1W C;  5C3E C;  3HOW K;  1TWC C;  4KN7 A;  4OIO A;  3CQZ K;  3I4M C;  4A3J C;  4YFK A;  2E2J C;  1I6H C;  2WAQ D;  3GTG K;  3GTK C;  3S14 C;  5FLM K;  2NVX C;  2R7Z C;  4Q5S A;  3PO3 C;  4BY7 K;  2WAQ L;  3K7A K;  3H3V L;  1R9T C;  5IP9 C;  5D4D A;  2VUM K;  1TWA K;  3HOX K;  3S2D C;  1YNN A;  3S1M C;  3S17 K;  2R93 K;  4A3L K;  2JA8 C;  2O5J A;  4A3K K;  4G7Z A;  4A3M K;  2O5I A;  4A93 K;  3S14 K;  1WCM C;  3GTM C;  4Q4Z A;  4XLP A;  3S1R C;  3HOZ C;  3GTO C;  1TWF C;  3S16 C;  5C44 K;  5IYD K;  1TWH C;  4YFX A;  4OIP A;  4C3H C;  5M5Y K;  3GTL C;  5IYB K;  4Y7N K;  4Y52 C;  4MEY A;  2A6H A;  3WOD A;  4C2M C;  5M3F K;  4A3F K;  3GTP K;  4A3G K;  3I4N K;  3DXJ A;  3CQZ C;  2WB1 L;  3HOU K;  1I6V A;  4QJV A;  3GTJ K;  3GTG C;  2NVY K;  3H3V D;  4X6A K;  2JA7 C;  3FKI K;  4A3I C;  1K83 C;  2PMZ L;  1I3Q C;  1XPP A;  2NVQ K;  3S2H K;  2B63 C;  3PO2 C;  4XSZ A;  3S15 C;  2A69 A;  4LK1 A;  1Y1V K;  3GTQ K;  5IYC K;  4C3J K;  4XSX A;  5M5W K;  3H0G C;  4YFN A;  4A3E C;  4GZY A;  1SMY A;  5C4J C;  2A68 A;  2R93 C;  1IW7 A;  1TWG K;  4C3I C;  4A3K C;  2JA5 C;  4OIQ A;  3M4O C;  2PPB A;  1YNJ A;  4A93 C;  5C4X K;  5FJ8 K;  4G7O A;  5TMC A;  2E2I K;  4A3D C;  5C44 C;  1SFO K;  2R92 C;  3HOV K;  4BXX K;  4KMU A;  4KN4 A;  2E2H C;  5C3E K;  4LLG A;  2NVQ C;  5IYB C;  4BBS C;  4BBR C;  4Y7N C;  4A3F C;  3RZD C;  2WB1 D;  4BY1 C;  4A3G C;  4A3J K;  3RZO C;  2E2J K;  3S1N K;  4YG2 A;  3S1Q K;  1I6H K;  3HOW C;  4JK1 A;  3GTK K;  2R7Z K;  5IP7 K;  3HOY K;  4MEX A;  2PMZ D;  5M3M K;  3GTJ C;  2YU9 K;  2Y0S L;  4X6A C;  5IP9 K;  1R9T K;  5FLM C;  2A6E A;  4A3B K;  3S2D K;  4BY7 C;  2NVT K;  3S2H C;  3K7A C;  5M5X K;  2JA8 K;  4BBS K;  2VUM C;  1TWA C;  4G7H A;  5IYC C;  4C3J C;  3HOX C;  3S17 C;  1WCM K;  4A3C C;  4A3L C;  2BE5 A;  3EQL A;  1I50 K;  3S1R K;  3HOZ K;  3GTO K;  1TWF K;  4A3M C;  2JA6 K;  3S16 K;  3M3Y K;  1TWH K;  4XLN A;  4ZH4 A;  4C3H K;  3GTL K;  4Y52 K;  1SFO C;  4BXX C;  1Y1W K;  3HKZ D;  5IYD C;  5TMF A;  1TWC K;  3GTP C;  1BDF A;  4OIN A;  3HKZ L;  3S1N C;  4NOI A;  3S1Q C;  1HQM A;  3I4M K;  3I4N C;  2JA7 K;  2Y0S D;  2NVX K;  5IP7 C;  4A3I K; 
#chains in the Genus database with same CATH topology
 3PO3 K;  3HOU C;  4QJV B;  2YU9 C;  1ZYR A;  5HL8 A;  1WQF A;  4GT9 A;  3L4J A;  2KQ1 A;  2GSU A;  1USM A;  4AYB L;  2E2H K;  4LJZ A;  4BY1 K;  2E2I C;  4MQ9 A;  3RZO K;  5C3E C;  1TWC C;  3CQZ K;  3BP3 A;  4BLB A;  1WQG A;  1GE9 A;  3I4M C;  4A3J C;  1IL2 A;  1O29 A;  2NVX C;  3PO3 C;  3H3V L;  4KMD A;  2CFA A;  3MML B;  2VUM K;  4A3L K;  3GTK A;  2R7Z A;  3SZY A;  1WCM C;  4XLP A;  5C44 K;  3GTO C;  3PIP S;  3VA7 A;  4Y7N K;  4Y52 C;  3GTP K;  3WOD A;  4GTE A;  4A3G K;  3I4N K;  3CQZ C;  2WB1 L;  1XZQ A;  1IQ0 A;  2JA7 C;  1TWF A;  2JA6 A;  3LAJ A;  1BJT A;  2B63 C;  4XSZ A;  3GTQ K;  4XSX A;  3H0G C;  2JA5 C;  3TTG A;  5FJ8 K;  4A3D C;  5C44 C;  2R92 C;  4BXX K;  2Y3P A;  1C0A A;  4Y7N C;  3RZD C;  1WOP A;  4A3G C;  4KAT A;  3S1N K;  1I6H K;  4MEX A;  5DM7 S;  4KAR A;  2PMZ D;  3LAP A;  1J6W A;  3QX3 A;  1EQR A;  4A3B K;  3S2D K;  2NVT K;  3G4C A;  3K7A C;  2JA8 K;  3N0C A;  1WOS A;  1FEU A;  4G7H A;  3HOX C;  1BS2 A;  3EQL A;  1I50 K;  3HOZ K;  3GTJ A;  2GAH C;  3LYW A;  3GTL K;  4BXX C;  3V4G A;  4WFB S;  5IYD C;  4KMH A;  2R93 A;  3S1N C;  4IO9 S;  1L0W A;  1F93 A;  1JOE A;  4A3I K;  1K83 K;  1I3Q K;  1XZQ B;  2CW0 A;  5DM6 S;  2L3U A;  2NVY C;  2PA8 D;  3PO2 K;  3S15 K;  3OEP A;  3FKI C;  4A3B C;  5IOR A;  2NVT C;  4A3E K;  3M4O K;  3BUE A;  4QIW L;  1Y1V C;  3PIO S;  1XXC A;  3Q3Q A;  1TWG C;  3GTM K;  1I50 C;  2RH6 A;  1ZBS A;  3A8J A;  5C4X C;  4BBR K;  5JVG S;  3HOV C;  4XCH A;  1VH2 A;  3HOW K;  3CF5 S;  4O2D A;  4KN7 A;  3IPJ A;  4LOW A;  2E2J C;  5FLM K;  4Q5S A;  4BY7 K;  2WAQ L;  2E2I A;  2PHC B;  1R9T C;  1WIH A;  1TWA K;  3TFH A;  1YNN A;  4U67 S;  4GFQ A;  3SZZ A;  1O25 A;  3S17 K;  4A3K K;  1WOO A;  1DCO A;  4KAS A;  2O5I A;  2EBB A;  1IS1 A;  3GTM C;  4Q4Z A;  3S16 C;  1TWH C;  4YFX A;  1RU0 A;  4OIP A;  4C3H C;  2NVQ K;  4BBS K;  5M3F K;  4PAB A;  4A3F K;  4MEY A;  4IOC S;  1X31 C;  3ERE D;  1EI6 A;  1WCM A;  3GTO A;  1IE0 A;  2PMZ L;  2V6U A;  1XPP A;  4DDQ A;  1J6V A;  3AQO A;  1Y1W A;  5IYC K;  2ZJQ S;  4KM9 A;  2D6F C;  4A3C K;  4A3K C;  4OIQ A;  2PPB A;  1F7V A;  5HL7 S;  2JA7 A;  4G7O A;  5TJ3 A;  2B63 A;  4KMU A;  2E2H C;  2JH3 A;  2NVQ C;  4BBS C;  4A3F C;  4BY1 C;  3H0G A;  3RZO C;  1WOR A;  3S1Q K;  4YG2 A;  3GIR A;  2JA5 A;  3GTK K;  2R7Z K;  4ILD A;  1F7U A;  2XCO A;  5IP9 K;  2R92 A;  5JVO A;  2A6E A;  3AD9 C;  3T02 A;  4WCE S;  1O2B A;  3AH5 A;  1O28 A;  4G0W A;  3A8I A;  4IOA S;  5L46 A;  2VUM C;  5IYC C;  4A3C C;  4A3L C;  4P5B A;  1AB4 A;  3S1R K;  4KB4 A;  1TWF K;  2JA6 K;  3GTG A;  1JQW A;  2W7V A;  4WIL A;  1WQH A;  5TMF A;  1VLO A;  3GTP C;  1BDF A;  4OIN A;  3HKZ L;  3S1Q C;  1HQM A;  3I4N C;  3S14 K;  1DCP A;  4BLA A;  4LK0 A;  3TFI A;  1VGX A;  1HI9 A;  1XZP A;  5C4J K;  5HQH A;  3S0X A;  4KDD A;  4C3I K;  4GTC A;  4AYB D;  1WSR A;  3GTQ C;  3N3Y A;  5EGH A;  2JA6 C;  2NVY A;  3FKI A;  3N0B A;  3BP8 C;  1O26 A;  1Y1V A;  1XXB A;  1JVI A;  4GTB A;  1TWG A;  1EFW A;  1I6H C;  3S14 C;  2V6S A;  1F9N A;  5IOT A;  4WFN S;  1SFO A;  3S2D C;  2R93 K;  5EGE A;  2JA8 C;  1J6X A;  4G7Z A;  1XXA A;  4A3M K;  4KC6 A;  4A93 K;  3HOZ C;  2YU9 A;  1R9T A;  4P9S A;  3TFJ A;  5M5Y K;  5IYB K;  3GTL C;  2GSO A;  3FOE A;  4RMF A;  3HOU K;  5JFE A;  1G51 A;  4X6A K;  1ZQ1 C;  4A3I C;  1K83 C;  1TWH A;  1I3Q C;  1YX2 A;  3PO2 C;  3AQP A;  3S15 C;  1DD5 A;  2A69 A;  4LK1 A;  1INN A;  4C3J K;  1TWC A;  1XZP B;  4YFN A;  4A3E C;  2R93 C;  5IOS A;  3M4O C;  4J3N A;  1YNJ A;  3GEE A;  3DLL S;  4A93 C;  5E68 A;  2NVX A;  4WF9 S;  2E2I K;  2P5M A;  4G0V A;  2FQT A;  2P8T A;  5C3E K;  1PJ5 A;  4LLG A;  5IYB C;  1USO A;  4BBR C;  1WSV A;  4A3J K;  4KB2 A;  3HOW C;  4M1X A;  3GDZ A;  5IP7 K;  3HOY K;  1YCL A;  3LPX A;  5M3M K;  4X6A C;  5FLM C;  2E2H A;  4BY7 C;  5M5X K;  2ZFZ A;  3G4A A;  1TWA C;  4C3J C;  3CQZ A;  3S17 C;  1WCM K;  2KWA A;  3ADA C;  2BE5 A;  5CHP A;  3GTO K;  3M3Y K;  4XLN A;  1B4B A;  1O2A A;  4Y52 K;  1Y1W K;  2KXY A;  3GEH A;  2VUM A;  1B4A A;  4G0U A;  1VRQ C;  2JA7 K;  2Y0S D;  3HXA A;  5IP7 C;  3HOY C;  4WJ4 A;  2RGR A;  2B63 K;  1IBA A;  1O2F B;  4OIR A;  4QIW D;  3H0G K;  3S1M K;  2PA8 L;  3GTP A;  2JA5 K;  1VJE A;  4A3D K;  2R92 K;  3M3Y C;  1ISE A;  3RZD K;  4FZB A;  4C2M K;  1Y1W C;  4OIO A;  2GAG C;  3GTQ A;  3OPF A;  4YFK A;  4PAA A;  2WAQ D;  5JVH S;  1O27 A;  3GTK C;  3GTG K;  2R7Z C;  1PJ7 A;  4LR2 A;  3GEI A;  4GTD A;  2XCQ A;  3K7A K;  5IP9 C;  3AD7 C;  5D4D A;  3HOX K;  3S1M C;  4GTL A;  4BKW A;  3FHZ A;  2O5J A;  1UV7 A;  3CAG A;  3GSI A;  3S1R C;  2GSN A;  1TWF C;  5IYD K;  3NUH A;  4C45 A;  3JST A;  2A6H A;  4C2M C;  3DXJ A;  2V6T A;  3AD8 C;  1I6V A;  4QJV A;  3GTJ K;  3GTG C;  2NVY K;  3H3V D;  1I50 A;  1DCH A;  3FKI K;  1KQ4 A;  3GTL A;  3S2H K;  2CFA B;  1V5V A;  1Y1V K;  1EH1 A;  5M5W K;  4GZY A;  1TWG K;  1SMY A;  5C4J C;  2A68 A;  1IW7 A;  1J98 A;  4C3I C;  4KM8 A;  2FQO A;  5C4X K;  1K83 A;  5TMC A;  1I3Q A;  3HOV K;  1SFO K;  2ZUF A;  4LQY A;  4KN4 A;  3T00 A;  4GTA A;  2XCR B;  2WB1 D;  2E2J K;  2L5N A;  1BGW A;  4JK1 A;  3FOF A;  1PJ6 A;  1ZVU A;  5IOQ A;  2ZJR S;  3ORE A;  3GTJ C;  3GTM A;  2YU9 K;  2Y0S L;  1R9T K;  4KAW X;  4FM9 A;  3S2H C;  3A8K A;  1EK8 A;  4WJ3 M;  4WFA S;  3L4K A;  3S16 K;  4A3M C;  1ZXO A;  1TWH K;  4ZH4 A;  4C3H K;  2ZJP S;  1O24 A;  1SFO C;  3HKZ D;  4AH6 A;  4P5A A;  2KPU A;  1TWC K;  3T01 A;  1TWA A;  4KMA A;  5CJ9 A;  3I4M K;  4GTF A;  4NOI A;  2ZUE A;  2NVX K; 
#chains in the Genus database with same CATH homology
 3HOY C;  1K83 K;  3PO3 K;  3HOU C;  1I3Q K;  4A3C K;  4LK0 A;  2CW0 A;  4QJV B;  2B63 K;  2YU9 C;  2NVY C;  2PA8 D;  3PO2 K;  3S15 K;  3FKI C;  1ZYR A;  4OIR A;  4QIW D;  4A3B C;  2NVT C;  3H0G K;  4A3E K;  5C4J K;  3S1M K;  2PA8 L;  4C3I K;  2JA5 K;  3M4O K;  4AYB D;  1Y1V C;  3GTQ C;  4QIW L;  1TWG C;  4A3D K;  3GTM K;  1I50 C;  2R92 K;  4AYB L;  2JA6 C;  2E2H K;  3M3Y C;  5C4X C;  4LJZ A;  4BBR K;  2E2I C;  3RZD K;  4BY1 K;  4C2M K;  4MQ9 A;  3HOV C;  3RZO K;  1Y1W C;  5C3E C;  3HOW K;  1TWC C;  4KN7 A;  4OIO A;  3CQZ K;  3I4M C;  4A3J C;  4YFK A;  2E2J C;  1I6H C;  2WAQ D;  3GTG K;  3GTK C;  3S14 C;  5FLM K;  2NVX C;  2R7Z C;  4Q5S A;  3PO3 C;  4BY7 K;  2WAQ L;  3K7A K;  3H3V L;  1R9T C;  5IP9 C;  5D4D A;  2VUM K;  1TWA K;  3HOX K;  3S2D C;  1YNN A;  3S1M C;  3S17 K;  2R93 K;  4A3L K;  2JA8 C;  2O5J A;  4A3K K;  4G7Z A;  4A3M K;  2O5I A;  4A93 K;  3S14 K;  1WCM C;  3GTM C;  4Q4Z A;  4XLP A;  3S1R C;  3HOZ C;  3GTO C;  1TWF C;  3S16 C;  5C44 K;  5IYD K;  1TWH C;  4YFX A;  4OIP A;  4C3H C;  5M5Y K;  3GTL C;  5IYB K;  4Y7N K;  4Y52 C;  4MEY A;  2A6H A;  3WOD A;  4C2M C;  5M3F K;  4A3F K;  3GTP K;  4A3G K;  3I4N K;  3DXJ A;  3CQZ C;  2WB1 L;  3HOU K;  1I6V A;  4QJV A;  3GTJ K;  3GTG C;  2NVY K;  3H3V D;  4X6A K;  2JA7 C;  3FKI K;  4A3I C;  1K83 C;  2PMZ L;  1I3Q C;  1XPP A;  2NVQ K;  3S2H K;  2B63 C;  3PO2 C;  4XSZ A;  3S15 C;  2A69 A;  4LK1 A;  1Y1V K;  3GTQ K;  5IYC K;  4C3J K;  4XSX A;  5M5W K;  3H0G C;  4YFN A;  4A3E C;  4GZY A;  1SMY A;  5C4J C;  2A68 A;  2R93 C;  1IW7 A;  1TWG K;  4C3I C;  4A3K C;  2JA5 C;  4OIQ A;  3M4O C;  2PPB A;  1YNJ A;  4A93 C;  5C4X K;  5FJ8 K;  4G7O A;  5TMC A;  2E2I K;  4A3D C;  5C44 C;  1SFO K;  2R92 C;  3HOV K;  4BXX K;  4KMU A;  4KN4 A;  2E2H C;  5C3E K;  4LLG A;  2NVQ C;  5IYB C;  4BBS C;  4BBR C;  4Y7N C;  4A3F C;  3RZD C;  2WB1 D;  4BY1 C;  4A3G C;  4A3J K;  3RZO C;  2E2J K;  3S1N K;  4YG2 A;  3S1Q K;  1I6H K;  3HOW C;  4JK1 A;  3GTK K;  2R7Z K;  5IP7 K;  3HOY K;  4MEX A;  2PMZ D;  5M3M K;  3GTJ C;  2YU9 K;  2Y0S L;  4X6A C;  5IP9 K;  1R9T K;  5FLM C;  2A6E A;  4A3B K;  3S2D K;  4BY7 C;  2NVT K;  3S2H C;  3K7A C;  5M5X K;  2JA8 K;  4BBS K;  2VUM C;  1TWA C;  4G7H A;  5IYC C;  4C3J C;  3HOX C;  3S17 C;  1WCM K;  4A3C C;  4A3L C;  2BE5 A;  3EQL A;  1I50 K;  3S1R K;  3HOZ K;  3GTO K;  1TWF K;  4A3M C;  2JA6 K;  3S16 K;  3M3Y K;  1TWH K;  4XLN A;  4ZH4 A;  4C3H K;  3GTL K;  4Y52 K;  1SFO C;  4BXX C;  1Y1W K;  3HKZ D;  5IYD C;  5TMF A;  1TWC K;  3GTP C;  1BDF A;  4OIN A;  3HKZ L;  3S1N C;  4NOI A;  3S1Q C;  1HQM A;  3I4M K;  3I4N C;  2JA7 K;  2Y0S D;  2NVX K;  5IP7 C;  4A3I K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...