3EQLA

Crystal structure of the t. thermophilus rna polymerase holoenzyme in complex with antibiotic myxopyronin
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
229
structure length
229
Chain Sequence
MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Transcription inactivation through local refolding of the RNA polymerase structure.
pubmed doi rcsb
molecule tags Transferase
molecule keywords DNA-directed RNA polymerase subunit alpha
total genus 40
structure length 229
sequence length 229
chains with identical sequence B, K, L
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2008-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01000 RNA_pol_A_bac RNA polymerase Rpb3/RpoA insert domain
A PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain
A PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.12 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 DNA-directed RNA polymerase, insert domain 3eqlA02
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3eqlA01
2E2IC 2JA6C 5C4XK 2E2JK 4Y7NC 3HOZK 4BBRC 3S1MK 4C3IK 1I50C 4A3IC 4X6AK 4BY1C 3GTJC 2PA8D 1TWHK 3FKIC 1SFOK 1Y1VK 2Y0SL 2R93K 2R7ZK 3S16K 4G7HA 3H3VD 4C2MK 3S16C 3S2HK 4YFXA 1TWGC 1R9TK 4QIWL 4AYBD 2A6EA 3HOWC 3M3YK 2A6HA 3RZDC 5D4DA 3HOWK 3CQZC 4G7OA 3EQLA 1TWCK 3RZDK 3GTQK 1I3QC 2R7ZC 5C3EK 5M3MK 1TWFC 3S1NK 2E2IK 4OIQA 4NOIA 5IP9K 4A3DK 3GTLC 4A3DC 1ZYRA 4Y52C 4YFNA 5IP7C 5IYDC 2O5IA 2WAQL 4X6AC 3GTJK 3S1RC 3S1QK 5TMFA 4JK1A 3HOVC 3I4MC 2B63C 4C3JK 4A3KK 4KN4A 3GTLK 2E2JC 5C4XC 4BXXK 1I6VA 4BBRK 5IYBK 3S2HC 3I4NK 3H0GC 1Y1WK 2VUMC 1HQMA 4LK0A 5M5YK 3S1RK 1YNNA 5M3FK 3HOVK 5C44K 3PO2C 2JA5C 5C4JK 4BBSK 2JA7K 2WAQD 4A3CC 3GTPC 1BDFA 4MEYA 1TWFK 3GTGK 1WCMC 4A3MC 4XLNA 4A3LC 1WCMK 4A3JK 2PMZL 4A3MK 4A3EK 4A3LK 4MQ9A 4A3IK 2JA7C 2E2HC 3HKZL 3HKZD 4A3KC 3S1QC 2NVXK 3GTMC 4XSXA 4ZH4A 3GTPK 3K7AC 2O5JA 5TMCA 2JA6K 2WB1D 5FLMK 5IYDK 1K83K 4C2MC 1Y1WC 4LJZA 1K83C 4A3EC 4BY7K 4BY1K 2JA8K 4KMUA 1TWHC 4A93K 2YU9C 2YU9K 3CQZK 4OIPA 5M5XK 4A3BK 3GTOK 3DXJA 3WODA 4A3GC 2NVTK 2NVQC 3S2DC 2NVTC 1TWAC 3GTQC 2BE5A 3FKIK 2NVXC 3K7AK 4OIOA 4AYBL 3PO3C 3S14C 4QIWD 3S1MC 3M4OC 3GTMK 1YNJA 4YG2A 3HOZC 4Y7NK 3PO3K 3S15K 4C3IC 3H0GK 3M4OK 2A68A 3I4NC 4BY7C 1TWAK 3S17K 2PPBA 2Y0SD 1I6HK 1SMYA 1I6HC 2JA5K 4LLGA 2NVYC 5C44C 5FLMC 4Q5SA 4A3FK 4A3BC 3GTKK 4A3FC 3GTKC 3GTOC 4XSZA 3HOYC 1IW7A 4KN7A 2VUMK 3M3YC 4Y52K 4A3JC 4A93C 3HOXK 1I3QK 3HOXC 2PA8L 3I4MK 3RZOC 5IYCK 2R92K 3HOUK 4QJVA 3S14K 4C3JC 3GTGC 2R93C 4QJVB 2B63K 4LK1A 2CW0A 2WB1L 4C3HC 4XLPA 1I50K 3H3VL 3S17C 5C3EC 4GZYA 2E2HK 2JA8C 1Y1VC 4BXXC 5M5WK 1TWCC 2PMZD 4G7ZA 5IYBC 3S15C 4A3CK 2A69A 4MEXA 4C3HK 1R9TC 1TWGK 5FJ8K 1XPPA 3HOYK 4OIRA 5IP7K 4OINA 5C4JC 4BBSC 2NVQK 3PO2K 3S2DK 4A3GK 2NVYK 2R92C 4YFKA 3HOUC 3S1NC 3RZOK 1SFOC 4Q4ZA 5IP9C 5IYCC
chains in the Genus database with same CATH superfamily
3GTJA 2E2IC 4BBRC 1F9NA 3S1MK 5JVHS 1I50C 4A3IC 4X6AK 1Y1VA 4U67S 2PA8D 2Y0SL 1ZVUA 3H3VD 4C2MK 1VH2A 1R9TK 1IE0A 3N3YA 3HOWC 2ZFZA 4IOAS 2A6HA 1TWCA 5D4DA 3HOWK 4G7OA 3EQLA 1J6WA 5IOSA 4LR2A 5M3MK 3A8KA 1ZYRA 2R7ZA 5CJ9A 3GTJK 4KMAA 5TMFA 3GTLA 2B63C 4KN4A 4BBRK 3S2HC 3I4NK 3AD7C 1Y1WK 1HQMA 3TTGA 5M5YK 1ZBSA 1ZXOA 3N0BA 3HOVK 2JA7A 1BDFA 1PJ5A 1TWFK 3GTGK 4AH6A 2FQOA 1WCMC 2V6TA 4A3LK 3GDZA 4A3EK 1J6XA 1WCMA 4A3IK 3S1QC 3I4MK 1TWAA 3OEPA 4ZH4A 3Q3QA 2JA6K 3L4JA 1IQ0A 4P9SA 1K83K 4C2MC 1ZQ1C 1JQWA 1WQHA 4GTCA 1TWHC 1O26A 1F7VA 4A93K 5HL8A 3GTOK 3DXJA 3WODA 2NVTK 2NVQC 2NVTC 5IORA 1EQRA 1TWFA 2XCRB 1XXCA 2NVXC 3K7AK 4AYBL 3G4CA 3M4OC 3PO3K 1YNJA 4BKWA 4C3IC 4IOCS 2A68A 1TWAK 1EH1A 3BP3A 3L4KA 4GTAA 4LLGA 4Q5SA 4A3FC 2VUMA 4WILA 4KN7A 3M3YC 1WSRA 4A3JC 1UV7A 1EI6A 4KATA 1I3QK 3HOXC 1O29A 2R92K 3HOUK 4QJVA 4G0WA 4C3JC 2V6UA 1VGXA 4KB2A 4P5AA 2GAGC 5M5WK 1Y1VC 4KMDA 4G7ZA 2P8TA 3S15C 5EGEA 1VJEA 2CFAA 2ZJQS 1TWGK 3AH5A 5FJ8K 2E2IA 2L5NA 4OINA 3CAGA 2NVQK 3MMLB 4YFKA 1WIHA 5C3EC 3S14C 5IYCC 1WQFA 4G0VA 2PHCB 3ERED 1JVIA 4GFQA 4C3IK 1SFOK 1XXAA 1XXBA 4G7HA 3S16K 2GAHC 1R9TA 4BLAA 3NUHA 4KC6A 1I3QC 1TWGA 1TWFC 5DM6S 2E2IK 4OIQA 3S1NK 4NOIA 3GTLC 5E68A 4Y52C 4KM8A 3S1RC 4A3KK 5JVGS 4KM9A 1O2AA 2VUMC 4LK0A 5C44K 4GTBA 5CHPA 2JA7K 4A3CC 3GTPC 1RU0A 3LYWA 4A3JK 1WCMK 2L3UA 3QX3A 4MQ9A 1XZPA 1VLOA 2E2HC 3HKZD 3GTMC 2JA6A 2O5JA 4LOWA 3N0CA 5JVOA 2WB1D 1K83A 5IYDK 1J98A 1L0WA 4LJZA 1K83C 4WJ4A 4FZBA 2KPUA 4XCHA 1O28A 4GTFA 4OIPA 4A3BK 3GIRA 1WOSA 1DCPA 3GTQC 2BE5A 3BUEA 3TFHA 1GE9A 4Y7NK 3ADAC 3S15K 3H0GK 3I4NC 3TFIA 3S17K 1SMYA 4WCES 5EGHA 5C44C 4KMHA 2JH3A 2XCQA 3GTOC 1B4AA 1O27A 4PAAA 3S0XA 3BP8C 1I3QA 1JOEA 1XZPB 1USOA 4KASA 4LK1A 2R93A 1ISEA 4GTDA 5L46A 5TJ3A 3AD8C 1I50A 1VRQC 1YX2A 2PMZD 3H0GA 1USMA 3HOYK 5C4JC 4BBSC 3PO2K 2R92C 3HOUC 2RH6A 4Q4ZA 4IO9S 2JA6C 4Y7NC 1SFOA 4BY1C 3GTJC 2ZJPS 3PIPS 3FKIC 1TWHK 3AD9C 2R93K 3S16C 1EFWA 1TWGC 4QIWL 3M3YK 4C45A 3RZDC 3CQZC 3RZDK 4WFAS 2R7ZC 3PIOS 1F93A 3GTQA 5IP9K 4A3DK 3GTPA 4YFNA 2O5IA 5IYDC 1EK8A 2WAQL 4X6AC 3HOVC 1IS1A 4J3NA 4C3JK 5IYBK 4WJ3M 3H0GC 1TWHA 3S1RK 4BLBA 5M3FK 3A8JA 3PO2C 5C4JK 4BBSK 1IL2A 4G0UA 4MEYA 3JSTA 4A3MC 4XLNA 3GEHA 4KARA 3HKZL 1O2FB 2NVXK 4A3KC 3GTPK 4XSXA 3K7AC 5TMCA 5FLMK 4GTEA 1Y1WC 4A3EC 2W7VA 4BY7K 2JA8K 4WFBS 4RMFA 3CQZA 5IOQA 5M5XK 2ZUFA 2V6SA 3T01A 1O24A 2FQTA 3FOEA 1XZQB 2ZJRS 1HI9A 1F7UA 2D6FC 3FKIA 2E2HA 1WOPA 4QIWD 1V5VA 1C0AA 3HOZC 3GSIA 1AB4A 2PPBA 1I6HK 3T02A 1I6HC 1B4BA 2NVYC 3OREA 5FLMC 4FM9A 1J6VA 3GTKK 4A3BC 2NVYA 1IW7A 4Y52K 1PJ7A 2PA8L 3RZOC 3SZYA 5IYCK 3LAPA 3S14K 2B63K 3GTGC 2R93C 2KXYA 4GT9A 3VA7A 2CW0A 4C3HC 4XLPA 1I50K 2GSNA 2Y3PA 4GZYA 5JFEA 2E2HK 2RGRA 2JA8C 4BXXC 2EBBA 1BJTA 1WQGA 5IYBC 1IBAA 4A3CK 2A69A 1R9TC 1INNA 4OIRA 5IP7K 3T00A 5IOTA 3FOFA 2ZUEA 2NVYK 1WOOA 1DCOA 5DM7S 2P5MA 3S1NC 4M1XA 5IP9C 3HXAA 5C4XK 2E2JK 3HOZK 2B63A 2GSOA 4KB4A 1Y1VK 3S2HK 4WFNS 4YFXA 4AYBD 2A6EA 1TWCK 3GTQK 5C3EK 1BS2A 4ILDA 1WORA 4KAWX 4A3DC 1KQ4A 2XCOA 3TFJA 5IP7C 3OPFA 1DCHA 3IPJA 4JK1A 3I4MC 4LQYA 3S1QK 3GTLK 2E2JC 5C4XC 4BXXK 1I6VA 1WSVA 1Y1WA 1YNNA 3LAJA 2JA5C 2WAQD 3GTGA 4A3LC 4A3MK 2PMZL 3AQOA 2NVXA 3SZZA 3CF5S 2JA7C 1O25A 5HQHA 3GEEA 4BY1K 4KMUA 2YU9C 2YU9K 3CQZK 2CFAB 3G4AA 3FHZA 3GTOA 4KDDA 4DDQA 4A3GC 3S2DC 3DLLS 1TWAC 5HL7S 3FKIK 1G51A 3GEIA 4OIOA 3GTMK 3PO3C 3M4OK 3S1MC 4YG2A 3LPXA 4BY7C 4GTLA 2GSUA 1O2BA 2Y0SD 3A8IA 2JA5K 3GTKA 4A3FK 3GTKC 4WF9S 4XSZA 3HOYC 4PABA 2VUMK 2KQ1A 1YCLA 2YU9A 4A93C 3HOXK 1BGWA 2R92A 4QJVB 3V4GA 1X31C 1XZQA 2WB1L 3H3VL 1FEUA 3S17C 3GTMA 1TWCC 1DD5A 4C3HK 4MEXA 4P5BA 4O2DA 1XPPA 2JA5A 1PJ6A 3S2DK 4A3GK 3AQPA 2KWAA 3RZOK 1SFOC 2R7ZK
chains in the Genus database with same CATH topology
2E2IC 2JA6C 5C4XK 2E2JK 4Y7NC 3HOZK 4BBRC 3S1MK 4C3IK 1I50C 4A3IC 4X6AK 4BY1C 3GTJC 2PA8D 1TWHK 3FKIC 1SFOK 1Y1VK 2Y0SL 2R93K 2R7ZK 3S16K 4G7HA 3H3VD 4C2MK 3S16C 3S2HK 4YFXA 1TWGC 1R9TK 4QIWL 4AYBD 2A6EA 3HOWC 3M3YK 2A6HA 3RZDC 5D4DA 3HOWK 3CQZC 4G7OA 3EQLA 1TWCK 3RZDK 3GTQK 1I3QC 2R7ZC 5C3EK 5M3MK 1TWFC 3S1NK 2E2IK 4OIQA 4NOIA 5IP9K 4A3DK 3GTLC 4A3DC 1ZYRA 4Y52C 4YFNA 5IP7C 5IYDC 2O5IA 2WAQL 4X6AC 3GTJK 3S1RC 3S1QK 5TMFA 4JK1A 3HOVC 3I4MC 2B63C 4C3JK 4A3KK 4KN4A 3GTLK 2E2JC 5C4XC 4BXXK 1I6VA 4BBRK 5IYBK 3S2HC 3I4NK 3H0GC 1Y1WK 2VUMC 1HQMA 4LK0A 5M5YK 3S1RK 1YNNA 5M3FK 3HOVK 5C44K 3PO2C 2JA5C 5C4JK 4BBSK 2JA7K 2WAQD 4A3CC 3GTPC 1BDFA 4MEYA 1TWFK 3GTGK 1WCMC 4A3MC 4XLNA 4A3LC 1WCMK 4A3JK 2PMZL 4A3MK 4A3EK 4A3LK 4MQ9A 4A3IK 2JA7C 2E2HC 3HKZL 3HKZD 4A3KC 3S1QC 2NVXK 3GTMC 4XSXA 4ZH4A 3GTPK 3K7AC 2O5JA 5TMCA 2JA6K 2WB1D 5FLMK 5IYDK 1K83K 4C2MC 1Y1WC 4LJZA 1K83C 4A3EC 4BY7K 4BY1K 2JA8K 4KMUA 1TWHC 4A93K 2YU9C 2YU9K 3CQZK 4OIPA 5M5XK 4A3BK 3GTOK 3DXJA 3WODA 4A3GC 2NVTK 2NVQC 3S2DC 2NVTC 1TWAC 3GTQC 2BE5A 3FKIK 2NVXC 3K7AK 4OIOA 4AYBL 3PO3C 3S14C 4QIWD 3S1MC 3M4OC 3GTMK 1YNJA 4YG2A 3HOZC 4Y7NK 3PO3K 3S15K 4C3IC 3H0GK 3M4OK 2A68A 3I4NC 4BY7C 1TWAK 3S17K 2PPBA 2Y0SD 1I6HK 1SMYA 1I6HC 2JA5K 4LLGA 2NVYC 5C44C 5FLMC 4Q5SA 4A3FK 4A3BC 3GTKK 4A3FC 3GTKC 3GTOC 4XSZA 3HOYC 1IW7A 4KN7A 2VUMK 3M3YC 4Y52K 4A3JC 4A93C 3HOXK 1I3QK 3HOXC 2PA8L 3I4MK 3RZOC 5IYCK 2R92K 3HOUK 4QJVA 3S14K 4C3JC 3GTGC 2R93C 4QJVB 2B63K 4LK1A 2CW0A 2WB1L 4C3HC 4XLPA 1I50K 3H3VL 3S17C 5C3EC 4GZYA 2E2HK 2JA8C 1Y1VC 4BXXC 5M5WK 1TWCC 2PMZD 4G7ZA 5IYBC 3S15C 4A3CK 2A69A 4MEXA 4C3HK 1R9TC 1TWGK 5FJ8K 1XPPA 3HOYK 4OIRA 5IP7K 4OINA 5C4JC 4BBSC 2NVQK 3PO2K 3S2DK 4A3GK 2NVYK 2R92C 4YFKA 3HOUC 3S1NC 3RZOK 1SFOC 4Q4ZA 5IP9C 5IYCC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E2I C;  2JA6 C;  5C4X K;  2E2J K;  4Y7N C;  3HOZ K;  4BBR C;  3S1M K;  4C3I K;  1I50 C;  4A3I C;  4X6A K;  4BY1 C;  3GTJ C;  2PA8 D;  1TWH K;  3FKI C;  1SFO K;  1Y1V K;  2Y0S L;  2R93 K;  2R7Z K;  3S16 K;  4G7H A;  3H3V D;  4C2M K;  3S16 C;  3S2H K;  4YFX A;  1TWG C;  1R9T K;  4QIW L;  4AYB D;  2A6E A;  3HOW C;  3M3Y K;  2A6H A;  3RZD C;  5D4D A;  3HOW K;  3CQZ C;  4G7O A;  3EQL A;  1TWC K;  3RZD K;  3GTQ K;  1I3Q C;  2R7Z C;  5C3E K;  5M3M K;  1TWF C;  3S1N K;  2E2I K;  4OIQ A;  4NOI A;  5IP9 K;  4A3D K;  3GTL C;  4A3D C;  1ZYR A;  4Y52 C;  4YFN A;  5IP7 C;  5IYD C;  2O5I A;  2WAQ L;  4X6A C;  3GTJ K;  3S1R C;  3S1Q K;  5TMF A;  4JK1 A;  3HOV C;  3I4M C;  2B63 C;  4C3J K;  4A3K K;  4KN4 A;  3GTL K;  2E2J C;  5C4X C;  4BXX K;  1I6V A;  4BBR K;  5IYB K;  3S2H C;  3I4N K;  3H0G C;  1Y1W K;  2VUM C;  1HQM A;  4LK0 A;  5M5Y K;  3S1R K;  1YNN A;  5M3F K;  3HOV K;  5C44 K;  3PO2 C;  2JA5 C;  5C4J K;  4BBS K;  2JA7 K;  2WAQ D;  4A3C C;  3GTP C;  1BDF A;  4MEY A;  1TWF K;  3GTG K;  1WCM C;  4A3M C;  4XLN A;  4A3L C;  1WCM K;  4A3J K;  2PMZ L;  4A3M K;  4A3E K;  4A3L K;  4MQ9 A;  4A3I K;  2JA7 C;  2E2H C;  3HKZ L;  3HKZ D;  4A3K C;  3S1Q C;  2NVX K;  3GTM C;  4XSX A;  4ZH4 A;  3GTP K;  3K7A C;  2O5J A;  5TMC A;  2JA6 K;  2WB1 D;  5FLM K;  5IYD K;  1K83 K;  4C2M C;  1Y1W C;  4LJZ A;  1K83 C;  4A3E C;  4BY7 K;  4BY1 K;  2JA8 K;  4KMU A;  1TWH C;  4A93 K;  2YU9 C;  2YU9 K;  3CQZ K;  4OIP A;  5M5X K;  4A3B K;  3GTO K;  3DXJ A;  3WOD A;  4A3G C;  2NVT K;  2NVQ C;  3S2D C;  2NVT C;  1TWA C;  3GTQ C;  2BE5 A;  3FKI K;  2NVX C;  3K7A K;  4OIO A;  4AYB L;  3PO3 C;  3S14 C;  4QIW D;  3S1M C;  3M4O C;  3GTM K;  1YNJ A;  4YG2 A;  3HOZ C;  4Y7N K;  3PO3 K;  3S15 K;  4C3I C;  3H0G K;  3M4O K;  2A68 A;  3I4N C;  4BY7 C;  1TWA K;  3S17 K;  2PPB A;  2Y0S D;  1I6H K;  1SMY A;  1I6H C;  2JA5 K;  4LLG A;  2NVY C;  5C44 C;  5FLM C;  4Q5S A;  4A3F K;  4A3B C;  3GTK K;  4A3F C;  3GTK C;  3GTO C;  4XSZ A;  3HOY C;  1IW7 A;  4KN7 A;  2VUM K;  3M3Y C;  4Y52 K;  4A3J C;  4A93 C;  3HOX K;  1I3Q K;  3HOX C;  2PA8 L;  3I4M K;  3RZO C;  5IYC K;  2R92 K;  3HOU K;  4QJV A;  3S14 K;  4C3J C;  3GTG C;  2R93 C;  4QJV B;  2B63 K;  4LK1 A;  2CW0 A;  2WB1 L;  4C3H C;  4XLP A;  1I50 K;  3H3V L;  3S17 C;  5C3E C;  4GZY A;  2E2H K;  2JA8 C;  1Y1V C;  4BXX C;  5M5W K;  1TWC C;  2PMZ D;  4G7Z A;  5IYB C;  3S15 C;  4A3C K;  2A69 A;  4MEX A;  4C3H K;  1R9T C;  1TWG K;  5FJ8 K;  1XPP A;  3HOY K;  4OIR A;  5IP7 K;  4OIN A;  5C4J C;  4BBS C;  2NVQ K;  3PO2 K;  3S2D K;  4A3G K;  2NVY K;  2R92 C;  4YFK A;  3HOU C;  3S1N C;  3RZO K;  1SFO C;  4Q4Z A;  5IP9 C;  5IYC C; 
#chains in the Genus database with same CATH topology
 3GTJ A;  2E2I C;  4BBR C;  1F9N A;  3S1M K;  5JVH S;  1I50 C;  4A3I C;  4X6A K;  1Y1V A;  4U67 S;  2PA8 D;  2Y0S L;  1ZVU A;  3H3V D;  4C2M K;  1VH2 A;  1R9T K;  1IE0 A;  3N3Y A;  3HOW C;  2ZFZ A;  4IOA S;  2A6H A;  1TWC A;  5D4D A;  3HOW K;  4G7O A;  3EQL A;  1J6W A;  5IOS A;  4LR2 A;  5M3M K;  3A8K A;  1ZYR A;  2R7Z A;  5CJ9 A;  3GTJ K;  4KMA A;  5TMF A;  3GTL A;  2B63 C;  4KN4 A;  4BBR K;  3S2H C;  3I4N K;  3AD7 C;  1Y1W K;  1HQM A;  3TTG A;  5M5Y K;  1ZBS A;  1ZXO A;  3N0B A;  3HOV K;  2JA7 A;  1BDF A;  1PJ5 A;  1TWF K;  3GTG K;  4AH6 A;  2FQO A;  1WCM C;  2V6T A;  4A3L K;  3GDZ A;  4A3E K;  1J6X A;  1WCM A;  4A3I K;  3S1Q C;  3I4M K;  1TWA A;  3OEP A;  4ZH4 A;  3Q3Q A;  2JA6 K;  3L4J A;  1IQ0 A;  4P9S A;  1K83 K;  4C2M C;  1ZQ1 C;  1JQW A;  1WQH A;  4GTC A;  1TWH C;  1O26 A;  1F7V A;  4A93 K;  5HL8 A;  3GTO K;  3DXJ A;  3WOD A;  2NVT K;  2NVQ C;  2NVT C;  5IOR A;  1EQR A;  1TWF A;  2XCR B;  1XXC A;  2NVX C;  3K7A K;  4AYB L;  3G4C A;  3M4O C;  3PO3 K;  1YNJ A;  4BKW A;  4C3I C;  4IOC S;  2A68 A;  1TWA K;  1EH1 A;  3BP3 A;  3L4K A;  4GTA A;  4LLG A;  4Q5S A;  4A3F C;  2VUM A;  4WIL A;  4KN7 A;  3M3Y C;  1WSR A;  4A3J C;  1UV7 A;  1EI6 A;  4KAT A;  1I3Q K;  3HOX C;  1O29 A;  2R92 K;  3HOU K;  4QJV A;  4G0W A;  4C3J C;  2V6U A;  1VGX A;  4KB2 A;  4P5A A;  2GAG C;  5M5W K;  1Y1V C;  4KMD A;  4G7Z A;  2P8T A;  3S15 C;  5EGE A;  1VJE A;  2CFA A;  2ZJQ S;  1TWG K;  3AH5 A;  5FJ8 K;  2E2I A;  2L5N A;  4OIN A;  3CAG A;  2NVQ K;  3MML B;  4YFK A;  1WIH A;  5C3E C;  3S14 C;  5IYC C;  1WQF A;  4G0V A;  2PHC B;  3ERE D;  1JVI A;  4GFQ A;  4C3I K;  1SFO K;  1XXA A;  1XXB A;  4G7H A;  3S16 K;  2GAH C;  1R9T A;  4BLA A;  3NUH A;  4KC6 A;  1I3Q C;  1TWG A;  1TWF C;  5DM6 S;  2E2I K;  4OIQ A;  3S1N K;  4NOI A;  3GTL C;  5E68 A;  4Y52 C;  4KM8 A;  3S1R C;  4A3K K;  5JVG S;  4KM9 A;  1O2A A;  2VUM C;  4LK0 A;  5C44 K;  4GTB A;  5CHP A;  2JA7 K;  4A3C C;  3GTP C;  1RU0 A;  3LYW A;  4A3J K;  1WCM K;  2L3U A;  3QX3 A;  4MQ9 A;  1XZP A;  1VLO A;  2E2H C;  3HKZ D;  3GTM C;  2JA6 A;  2O5J A;  4LOW A;  3N0C A;  5JVO A;  2WB1 D;  1K83 A;  5IYD K;  1J98 A;  1L0W A;  4LJZ A;  1K83 C;  4WJ4 A;  4FZB A;  2KPU A;  4XCH A;  1O28 A;  4GTF A;  4OIP A;  4A3B K;  3GIR A;  1WOS A;  1DCP A;  3GTQ C;  2BE5 A;  3BUE A;  3TFH A;  1GE9 A;  4Y7N K;  3ADA C;  3S15 K;  3H0G K;  3I4N C;  3TFI A;  3S17 K;  1SMY A;  4WCE S;  5EGH A;  5C44 C;  4KMH A;  2JH3 A;  2XCQ A;  3GTO C;  1B4A A;  1O27 A;  4PAA A;  3S0X A;  3BP8 C;  1I3Q A;  1JOE A;  1XZP B;  1USO A;  4KAS A;  4LK1 A;  2R93 A;  1ISE A;  4GTD A;  5L46 A;  5TJ3 A;  3AD8 C;  1I50 A;  1VRQ C;  1YX2 A;  2PMZ D;  3H0G A;  1USM A;  3HOY K;  5C4J C;  4BBS C;  3PO2 K;  2R92 C;  3HOU C;  2RH6 A;  4Q4Z A;  4IO9 S;  2JA6 C;  4Y7N C;  1SFO A;  4BY1 C;  3GTJ C;  2ZJP S;  3PIP S;  3FKI C;  1TWH K;  3AD9 C;  2R93 K;  3S16 C;  1EFW A;  1TWG C;  4QIW L;  3M3Y K;  4C45 A;  3RZD C;  3CQZ C;  3RZD K;  4WFA S;  2R7Z C;  3PIO S;  1F93 A;  3GTQ A;  5IP9 K;  4A3D K;  3GTP A;  4YFN A;  2O5I A;  5IYD C;  1EK8 A;  2WAQ L;  4X6A C;  3HOV C;  1IS1 A;  4J3N A;  4C3J K;  5IYB K;  4WJ3 M;  3H0G C;  1TWH A;  3S1R K;  4BLB A;  5M3F K;  3A8J A;  3PO2 C;  5C4J K;  4BBS K;  1IL2 A;  4G0U A;  4MEY A;  3JST A;  4A3M C;  4XLN A;  3GEH A;  4KAR A;  3HKZ L;  1O2F B;  2NVX K;  4A3K C;  3GTP K;  4XSX A;  3K7A C;  5TMC A;  5FLM K;  4GTE A;  1Y1W C;  4A3E C;  2W7V A;  4BY7 K;  2JA8 K;  4WFB S;  4RMF A;  3CQZ A;  5IOQ A;  5M5X K;  2ZUF A;  2V6S A;  3T01 A;  1O24 A;  2FQT A;  3FOE A;  1XZQ B;  2ZJR S;  1HI9 A;  1F7U A;  2D6F C;  3FKI A;  2E2H A;  1WOP A;  4QIW D;  1V5V A;  1C0A A;  3HOZ C;  3GSI A;  1AB4 A;  2PPB A;  1I6H K;  3T02 A;  1I6H C;  1B4B A;  2NVY C;  3ORE A;  5FLM C;  4FM9 A;  1J6V A;  3GTK K;  4A3B C;  2NVY A;  1IW7 A;  4Y52 K;  1PJ7 A;  2PA8 L;  3RZO C;  3SZY A;  5IYC K;  3LAP A;  3S14 K;  2B63 K;  3GTG C;  2R93 C;  2KXY A;  4GT9 A;  3VA7 A;  2CW0 A;  4C3H C;  4XLP A;  1I50 K;  2GSN A;  2Y3P A;  4GZY A;  5JFE A;  2E2H K;  2RGR A;  2JA8 C;  4BXX C;  2EBB A;  1BJT A;  1WQG A;  5IYB C;  1IBA A;  4A3C K;  2A69 A;  1R9T C;  1INN A;  4OIR A;  5IP7 K;  3T00 A;  5IOT A;  3FOF A;  2ZUE A;  2NVY K;  1WOO A;  1DCO A;  5DM7 S;  2P5M A;  3S1N C;  4M1X A;  5IP9 C;  3HXA A;  5C4X K;  2E2J K;  3HOZ K;  2B63 A;  2GSO A;  4KB4 A;  1Y1V K;  3S2H K;  4WFN S;  4YFX A;  4AYB D;  2A6E A;  1TWC K;  3GTQ K;  5C3E K;  1BS2 A;  4ILD A;  1WOR A;  4KAW X;  4A3D C;  1KQ4 A;  2XCO A;  3TFJ A;  5IP7 C;  3OPF A;  1DCH A;  3IPJ A;  4JK1 A;  3I4M C;  4LQY A;  3S1Q K;  3GTL K;  2E2J C;  5C4X C;  4BXX K;  1I6V A;  1WSV A;  1Y1W A;  1YNN A;  3LAJ A;  2JA5 C;  2WAQ D;  3GTG A;  4A3L C;  4A3M K;  2PMZ L;  3AQO A;  2NVX A;  3SZZ A;  3CF5 S;  2JA7 C;  1O25 A;  5HQH A;  3GEE A;  4BY1 K;  4KMU A;  2YU9 C;  2YU9 K;  3CQZ K;  2CFA B;  3G4A A;  3FHZ A;  3GTO A;  4KDD A;  4DDQ A;  4A3G C;  3S2D C;  3DLL S;  1TWA C;  5HL7 S;  3FKI K;  1G51 A;  3GEI A;  4OIO A;  3GTM K;  3PO3 C;  3M4O K;  3S1M C;  4YG2 A;  3LPX A;  4BY7 C;  4GTL A;  2GSU A;  1O2B A;  2Y0S D;  3A8I A;  2JA5 K;  3GTK A;  4A3F K;  3GTK C;  4WF9 S;  4XSZ A;  3HOY C;  4PAB A;  2VUM K;  2KQ1 A;  1YCL A;  2YU9 A;  4A93 C;  3HOX K;  1BGW A;  2R92 A;  4QJV B;  3V4G A;  1X31 C;  1XZQ A;  2WB1 L;  3H3V L;  1FEU A;  3S17 C;  3GTM A;  1TWC C;  1DD5 A;  4C3H K;  4MEX A;  4P5B A;  4O2D A;  1XPP A;  2JA5 A;  1PJ6 A;  3S2D K;  4A3G K;  3AQP A;  2KWA A;  3RZO K;  1SFO C;  2R7Z K; 
#chains in the Genus database with same CATH homology
 2E2I C;  2JA6 C;  5C4X K;  2E2J K;  4Y7N C;  3HOZ K;  4BBR C;  3S1M K;  4C3I K;  1I50 C;  4A3I C;  4X6A K;  4BY1 C;  3GTJ C;  2PA8 D;  1TWH K;  3FKI C;  1SFO K;  1Y1V K;  2Y0S L;  2R93 K;  2R7Z K;  3S16 K;  4G7H A;  3H3V D;  4C2M K;  3S16 C;  3S2H K;  4YFX A;  1TWG C;  1R9T K;  4QIW L;  4AYB D;  2A6E A;  3HOW C;  3M3Y K;  2A6H A;  3RZD C;  5D4D A;  3HOW K;  3CQZ C;  4G7O A;  3EQL A;  1TWC K;  3RZD K;  3GTQ K;  1I3Q C;  2R7Z C;  5C3E K;  5M3M K;  1TWF C;  3S1N K;  2E2I K;  4OIQ A;  4NOI A;  5IP9 K;  4A3D K;  3GTL C;  4A3D C;  1ZYR A;  4Y52 C;  4YFN A;  5IP7 C;  5IYD C;  2O5I A;  2WAQ L;  4X6A C;  3GTJ K;  3S1R C;  3S1Q K;  5TMF A;  4JK1 A;  3HOV C;  3I4M C;  2B63 C;  4C3J K;  4A3K K;  4KN4 A;  3GTL K;  2E2J C;  5C4X C;  4BXX K;  1I6V A;  4BBR K;  5IYB K;  3S2H C;  3I4N K;  3H0G C;  1Y1W K;  2VUM C;  1HQM A;  4LK0 A;  5M5Y K;  3S1R K;  1YNN A;  5M3F K;  3HOV K;  5C44 K;  3PO2 C;  2JA5 C;  5C4J K;  4BBS K;  2JA7 K;  2WAQ D;  4A3C C;  3GTP C;  1BDF A;  4MEY A;  1TWF K;  3GTG K;  1WCM C;  4A3M C;  4XLN A;  4A3L C;  1WCM K;  4A3J K;  2PMZ L;  4A3M K;  4A3E K;  4A3L K;  4MQ9 A;  4A3I K;  2JA7 C;  2E2H C;  3HKZ L;  3HKZ D;  4A3K C;  3S1Q C;  2NVX K;  3GTM C;  4XSX A;  4ZH4 A;  3GTP K;  3K7A C;  2O5J A;  5TMC A;  2JA6 K;  2WB1 D;  5FLM K;  5IYD K;  1K83 K;  4C2M C;  1Y1W C;  4LJZ A;  1K83 C;  4A3E C;  4BY7 K;  4BY1 K;  2JA8 K;  4KMU A;  1TWH C;  4A93 K;  2YU9 C;  2YU9 K;  3CQZ K;  4OIP A;  5M5X K;  4A3B K;  3GTO K;  3DXJ A;  3WOD A;  4A3G C;  2NVT K;  2NVQ C;  3S2D C;  2NVT C;  1TWA C;  3GTQ C;  2BE5 A;  3FKI K;  2NVX C;  3K7A K;  4OIO A;  4AYB L;  3PO3 C;  3S14 C;  4QIW D;  3S1M C;  3M4O C;  3GTM K;  1YNJ A;  4YG2 A;  3HOZ C;  4Y7N K;  3PO3 K;  3S15 K;  4C3I C;  3H0G K;  3M4O K;  2A68 A;  3I4N C;  4BY7 C;  1TWA K;  3S17 K;  2PPB A;  2Y0S D;  1I6H K;  1SMY A;  1I6H C;  2JA5 K;  4LLG A;  2NVY C;  5C44 C;  5FLM C;  4Q5S A;  4A3F K;  4A3B C;  3GTK K;  4A3F C;  3GTK C;  3GTO C;  4XSZ A;  3HOY C;  1IW7 A;  4KN7 A;  2VUM K;  3M3Y C;  4Y52 K;  4A3J C;  4A93 C;  3HOX K;  1I3Q K;  3HOX C;  2PA8 L;  3I4M K;  3RZO C;  5IYC K;  2R92 K;  3HOU K;  4QJV A;  3S14 K;  4C3J C;  3GTG C;  2R93 C;  4QJV B;  2B63 K;  4LK1 A;  2CW0 A;  2WB1 L;  4C3H C;  4XLP A;  1I50 K;  3H3V L;  3S17 C;  5C3E C;  4GZY A;  2E2H K;  2JA8 C;  1Y1V C;  4BXX C;  5M5W K;  1TWC C;  2PMZ D;  4G7Z A;  5IYB C;  3S15 C;  4A3C K;  2A69 A;  4MEX A;  4C3H K;  1R9T C;  1TWG K;  5FJ8 K;  1XPP A;  3HOY K;  4OIR A;  5IP7 K;  4OIN A;  5C4J C;  4BBS C;  2NVQ K;  3PO2 K;  3S2D K;  4A3G K;  2NVY K;  2R92 C;  4YFK A;  3HOU C;  3S1N C;  3RZO K;  1SFO C;  4Q4Z A;  5IP9 C;  5IYC C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...