3EQLA

Crystal structure of the t. thermophilus rna polymerase holoenzyme in complex with antibiotic myxopyronin
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
229
structure length
229
Chain Sequence
MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase subunit alpha
publication title Transcription inactivation through local refolding of the RNA polymerase structure.
pubmed doi rcsb
molecule tags Transferase
total genus 40
structure length 229
sequence length 229
chains with identical sequence B, K, L
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2008-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01000 RNA_pol_A_bac RNA polymerase Rpb3/RpoA insert domain
A PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain
A PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.12 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 DNA-directed RNA polymerase, insert domain 3eqlA02
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3eqlA01
1SFOC 4G7OA 2B63K 4A3GK 2WB1D 4LLGA 3S17C 2E2IC 2O5JA 1I50K 4BY1C 5C44K 3M4OK 4MEYA 4C2MK 2PMZL 3S2HC 3CQZK 2E2HK 4A3JC 2E2JK 3PO2K 3S1MK 3GTGK 5IYBC 2WB1L 3S1QK 4A3FC 4A93C 3HOWK 2R93K 5M3MK 3I4MK 1BDFA 2O5IA 3HOZC 2WAQD 4LK1A 4MQ9A 5TMFA 4OIOA 1TWFC 4A3IK 3GTLK 4A3MK 2NVYK 4Y52K 5M5XK 3M3YC 1TWHK 3GTOC 3GTQC 3S1NK 3HOUK 2CW0A 4A3LC 4YG2A 4Q5SA 2Y0SL 1TWGC 1XPPA 2WAQL 3K7AC 2A68A 2VUMC 4A3KK 2NVTC 2YU9C 4AYBD 2JA7C 5IP7K 3RZDK 4ZH4A 5FLMC 2JA8K 3HOVK 1TWAC 2PPBA 4Y7NC 3GTPK 5C4XK 4QIWD 3S16C 3GTKC 3HOXK 3S14K 4AYBL 5C3EC 2NVQC 4G7HA 4YFKA 4BBSK 1SFOK 5C4JC 2A6HA 4C3IC 3S15C 4Q4ZA 2JA6C 3GTMC 4BXXC 4QJVB 4QIWL 2E2IK 4BY1K 2JA5C 3S2HK 4A3JK 1IW7A 1TWCC 1I6VA 5IYBK 1K83C 1R9TC 2Y0SD 4A3FK 4A3CC 4A93K 2A69A 3HOZK 1SMYA 3HOYC 1HQMA 3S1RK 2A6EA 4BBRC 3GTJK 3GTOK 4C3HC 3GTQK 4LJZA 4YFXA 3H0GC 4NOIA 4A3LK 4MEXA 4OIRA 1WCMC 5M5YK 3K7AK 2VUMK 2NVTK 2YU9K 2JA7K 4A3EC 4OINA 3EQLA 4LK0A 5FLMK 1TWAK 5M5WK 4Y7NK 4A3BC 4KN7A 4JK1A 4QJVA 3GTKK 5IP9C 5FJ8K 3S17K 5C3EK 2NVQK 4KN4A 3FKIC 1TWHC 1Y1VC 5D4DA 3PO3C 1Y1WC 4A3DC 3S1NC 5IYDC 3RZOC 4C3IK 1YNNA 5C4JK 3H3VL 2JA6K 4XSZA 1I6HC 2NVXC 1I3QC 3I4NC 3GTMK 4BXXK 4YFNA 4A3KC 2JA5K 4C3JC 4OIQA 4X6AC 1TWCK 2R7ZC 3S2DC 1K83K 5IYCC 4BY7C 4OIPA 2R92C 4A3CK 5C4XC 1TWFK 2B63C 4A3GC 3M3YK 1I50C 3HOYK 5C44C 3M4OC 4C2MC 3DXJA 3CQZC 2E2HC 2E2JC 3PO2C 3S1MC 1TWGK 4BBRK 3GTGC 4C3HK 3H0GK 5M3FK 2PA8D 3S1QC 1WCMK 1ZYRA 3HKZD 3HOWC 2R93C 4KMUA 3I4MC 3H3VD 4GZYA 4A3EK 3S16K 4A3IC 4Y52C 3GTLC 4A3MC 2NVYC 2PA8L 4XLNA 4G7ZA 4A3BK 3HKZL 3WODA 5TMCA 3S1RC 5IP9K 4XSXA 3HOUC 3S15K 1YNJA 3FKIK 3GTJC 1Y1VK 3PO3K 1Y1WK 4A3DK 2BE5A 4XLPA 3RZOK 5IYDK 1I6HK 5IP7C 3RZDC 1I3QK 2NVXK 3HOVC 3I4NK 2JA8C 4C3JK 1R9TK 3GTPC 4X6AK 2R7ZK 3S2DK 3HOXC 3S14C 5IYCK 4BY7K 2PMZD 2R92K 4BBSC
chains in the Genus database with same CATH superfamily
4WCES 1WIHA 1XZQA 4BY1C 3TFIA 5L46A 4KASA 2PMZL 5IOSA 3L4JA 4A3JC 1WQFA 1G51A 1O28A 2FQOA 4KB4A 1XZPA 1XXBA 1X31C 1TWFC 3GTLK 2E2IA 4Y52K 3GTOC 3GTQC 3CAGA 2CW0A 4A3LC 4Q5SA 1TWGC 3K7AC 2VUMC 4AYBD 5IP7K 4ZH4A 3HOVK 2PPBA 3ADAC 2W7VA 3HOXK 3G4CA 3GTJA 1USMA 4YFKA 1V5VA 4QIWL 2YU9A 2JA5C 1O24A 5JVOA 3OREA 3BP3A 3GTKA 1JOEA 2GSUA 4WFNS 1O2AA 1O29A 4PAAA 1F9NA 1VJEA 2JA6A 1O26A 4C3HC 4MEXA 4OIRA 1TWCA 1DCHA 1K83A 1B4BA 2GAHC 1VGXA 4A3BC 4QJVA 1B4AA 4LQYA 2CFAB 1WOSA 4A3DC 5IYDC 1YNNA 4XSZA 2V6TA 4KARA 4YFNA 4BY7C 2GSOA 4A3CK 4KMHA 3M3YK 1I50C 1Y1WA 4GTAA 3M4OC 5JVGS 1EK8A 2NVXA 3GTGC 1R9TA 1KQ4A 3ERED 5M3FK 1WCMK 2R7ZA 1ZYRA 3LAJA 2KWAA 3PIPS 2L5NA 2R93C 2XCQA 3S16K 2PA8L 2NVYC 3AH5A 3AQOA 1F93A 1ZQ1C 3S1RC 5IP9K 2KPUA 3AQPA 3GTJC 3HXAA 4XLPA 1WSVA 3RZDC 1I3QK 2ZJPS 2JA8C 4KATA 4PABA 1L0WA 3GTLA 5IYCK 2PMZD 1ZXOA 4C45A 2R92K 1SFOC 2B63K 4WFBS 4A3GK 3S17C 3NUHA 3GDZA 3CQZK 4O2DA 3S1MK 5IYBC 1USOA 3SZZA 2JH3A 3LPXA 5M3MK 3I4MK 2O5IA 4WJ4A 5TMFA 4OIOA 4AH6A 4A3MK 1IS1A 1BJTA 1TWHK 4IOCS 3S1NK 3HOUK 3OEPA 4YG2A 2WAQL 3GEEA 4A3KK 2JA7C 1TWAC 2PHCB 4Y7NC 3GTPK 4QIWD 4M1XA 2NVQC 5C4JC 4C3IC 2ZJQS 4Q4ZA 3GTMC 4BXXC 3IPJA 4BY1K 3V4GA 3N0CA 1WOPA 4A3JK 1FEUA 2ZUFA 1R9TC 4GTBA 2Y0SD 1SMYA 4KAWX 4BBRC 3GTOK 3GTQK 4LJZA 4YFXA 1ISEA 3H0GC 4P9SA 2ZJRS 4NOIA 3A8IA 4A3LK 1IL2A 3K7AK 1XZQB 2VUMK 3BP8C 4A3EC 4LK0A 5EGEA 3N0BA 3N3YA 4WF9S 2V6UA 1ZVUA 3LYWA 1WQGA 4KN4A 3FKIC 1Y1VC 1J98A 3PO3C 4LR2A 3RZOC 1WCMA 3H3VL 1XZPB 4WILA 2JA5K 4C3JC 3GEIA 1DCOA 1XXAA 3S2DC 1WQHA 1PJ7A 4BKWA 5HL7S 2Y3PA 5C44C 1PJ6A 4C2MC 3DXJA 2E2HC 1I3QA 2E2JC 3PO2C 4C3HK 2PA8D 4G0UA 3S1QC 3HOWC 4KMUA 1JVIA 2R92A 4G0VA 2CFAA 1VH2A 2B63A 2L3UA 4FM9A 4A3IC 5IOQA 3T01A 4A3BK 3HKZL 5TMCA 4XSXA 3CQZA 3S15K 4GTCA 4U67S 4G0WA 4A3DK 5IYDK 3GSIA 3DLLS 3S14C 4BY7K 1TWHA 1INNA 3QX3A 1JQWA 4KMAA 4BBSC 4ILDA 3SZYA 2E2IC 2O5JA 1I50K 2RH6A 3M4OK 3Q3QA 3S2HC 1VLOA 3GTGK 1EFWA 2WB1L 3GTPA 1J6VA 1O25A 3AD7C 4A3FC 4KM8A 4A93C 2R93K 1BDFA 3HOZC 3GIRA 2WAQD 4FZBA 2NVYK 5M5XK 3M3YC 2P8TA 1F7VA 4DDQA 5HQHA 1XPPA 2NVTC 2YU9C 3S0XA 3RZDK 5E68A 5FLMC 2JA8K 4J3NA 3FOFA 2KXYA 4KC6A 5C4XK 3S16C 3GTKC 1WORA 5C3EC 3GTOA 3GTQA 4RMFA 1SFOK 1AB4A 2JA6C 4KDDA 2VUMA 1WOOA 1J6WA 5IOTA 1IW7A 1TWCC 1XXCA 1K83C 5IORA 5IYBK 2GSNA 1PJ5A 4GTFA 4IOAS 3HOYC 2A6EA 5EGHA 5DM7S 4WJ3M 2JA5A 5M5YK 2JA7K 3EQLA 1TWAK 4Y7NK 4JK1A 5FJ8K 3L4KA 2NVQK 1TWHC 1Y1WC 3S1NC 5C4JK 4C3IK 3GTMK 1I6HC 4BXXK 3CF5S 2NVXC 3I4NC 4A3KC 5CHPA 4OIQA 4X6AC 2R7ZC 4OIPA 1O2FB 1TWFK 3MMLB 3G4AA 4BBRK 1TWGK 1EI6A 3H0GK 3HKZD 4GTDA 3PIOS 4GZYA 4A3EK 2ZFZA 4WFAS 4Y52C 3GTLC 1I50A 2RGRA 4XLNA 4G7ZA 3WODA 3FKIK 1Y1VK 3GTGA 3PO3K 3RZOK 5IP7C 3HOVC 2R93A 2EBBA 1DD5A 4C3JK 1O27A 4BLAA 3S2DK 3HOXC 1BS2A 2NVYA 3AD8C 1ZBSA 3OPFA 1IQ0A 4G7OA 2XCRB 2WB1D 4LLGA 4GTLA 3T00A 2ZUEA 5C44K 4MEYA 4C2MK 1VRQC 4P5BA 2E2HK 3BUEA 2E2JK 3PO2K 2V6SA 1YX2A 3S1QK 1HI9A 3HOWK 3TTGA 1SFOA 4LK1A 4MQ9A 4A3IK 1F7UA 1WSRA 1EH1A 3TFHA 2Y0SL 3GEHA 2XCOA 2A68A 1BGWA 3JSTA 4KB2A 3T02A 3S14K 3A8JA 4AYBL 3FHZA 4G7HA 4BBSK 4LOWA 1EQRA 2A6HA 3S15C 4QJVB 2E2IK 5HL8A 3S2HK 4P5AA 2JA7A 1I6VA 2P5MA 3LAPA 1TWAA 4GT9A 4A3FK 4A3CC 4A93K 2A69A 5TJ3A 3HOZK 3S1RK 1HQMA 1YCLA 3GTMA 1DCPA 3GTJK 3VA7A 1WCMC 2NVTK 2YU9K 3A8KA 1J6XA 4OINA 5CJ9A 1TWFA 2GAGC 5FLMK 1C0AA 1IBAA 2FQTA 4GFQA 5M5WK 1IE0A 4KN7A 3GTKK 5IP9C 3S17K 5C3EK 1TWGA 1GE9A 4KM9A 5D4DA 3H0GA 2JA6K 1O2BA 1I3QC 4GTEA 4KMDA 2D6FC 1TWCK 1K83K 5IYCC 4BLBA 2R92C 5C4XC 2B63C 4A3GC 3FKIA 1Y1VA 4XCHA 3HOYK 2KQ1A 3CQZC 3S1MC 1RU0A 3FOEA 5JVHS 3I4MC 3H3VD 4IO9S 4A3MC 3HOUC 2E2HA 1UV7A 1YNJA 3AD9C 1Y1WK 2BE5A 1I6HK 2NVXK 3I4NK 1R9TK 5DM6S 3GTPC 4X6AK 2R7ZK 3TFJA 5JFEA
chains in the Genus database with same CATH topology
1SFOC 4G7OA 2B63K 4A3GK 2WB1D 4LLGA 3S17C 2E2IC 2O5JA 1I50K 4BY1C 5C44K 3M4OK 4MEYA 4C2MK 2PMZL 3S2HC 3CQZK 2E2HK 4A3JC 2E2JK 3PO2K 3S1MK 3GTGK 5IYBC 2WB1L 3S1QK 4A3FC 4A93C 3HOWK 2R93K 5M3MK 3I4MK 1BDFA 2O5IA 3HOZC 2WAQD 4LK1A 4MQ9A 5TMFA 4OIOA 1TWFC 4A3IK 3GTLK 4A3MK 2NVYK 4Y52K 5M5XK 3M3YC 1TWHK 3GTOC 3GTQC 3S1NK 3HOUK 2CW0A 4A3LC 4YG2A 4Q5SA 2Y0SL 1TWGC 1XPPA 2WAQL 3K7AC 2A68A 2VUMC 4A3KK 2NVTC 2YU9C 4AYBD 2JA7C 5IP7K 3RZDK 4ZH4A 5FLMC 2JA8K 3HOVK 1TWAC 2PPBA 4Y7NC 3GTPK 5C4XK 4QIWD 3S16C 3GTKC 3HOXK 3S14K 4AYBL 5C3EC 2NVQC 4G7HA 4YFKA 4BBSK 1SFOK 5C4JC 2A6HA 4C3IC 3S15C 4Q4ZA 2JA6C 3GTMC 4BXXC 4QJVB 4QIWL 2E2IK 4BY1K 2JA5C 3S2HK 4A3JK 1IW7A 1TWCC 1I6VA 5IYBK 1K83C 1R9TC 2Y0SD 4A3FK 4A3CC 4A93K 2A69A 3HOZK 1SMYA 3HOYC 1HQMA 3S1RK 2A6EA 4BBRC 3GTJK 3GTOK 4C3HC 3GTQK 4LJZA 4YFXA 3H0GC 4NOIA 4A3LK 4MEXA 4OIRA 1WCMC 5M5YK 3K7AK 2VUMK 2NVTK 2YU9K 2JA7K 4A3EC 4OINA 3EQLA 4LK0A 5FLMK 1TWAK 5M5WK 4Y7NK 4A3BC 4KN7A 4JK1A 4QJVA 3GTKK 5IP9C 5FJ8K 3S17K 5C3EK 2NVQK 4KN4A 3FKIC 1TWHC 1Y1VC 5D4DA 3PO3C 1Y1WC 4A3DC 3S1NC 5IYDC 3RZOC 4C3IK 1YNNA 5C4JK 3H3VL 2JA6K 4XSZA 1I6HC 2NVXC 1I3QC 3I4NC 3GTMK 4BXXK 4YFNA 4A3KC 2JA5K 4C3JC 4OIQA 4X6AC 1TWCK 2R7ZC 3S2DC 1K83K 5IYCC 4BY7C 4OIPA 2R92C 4A3CK 5C4XC 1TWFK 2B63C 4A3GC 3M3YK 1I50C 3HOYK 5C44C 3M4OC 4C2MC 3DXJA 3CQZC 2E2HC 2E2JC 3PO2C 3S1MC 1TWGK 4BBRK 3GTGC 4C3HK 3H0GK 5M3FK 2PA8D 3S1QC 1WCMK 1ZYRA 3HKZD 3HOWC 2R93C 4KMUA 3I4MC 3H3VD 4GZYA 4A3EK 3S16K 4A3IC 4Y52C 3GTLC 4A3MC 2NVYC 2PA8L 4XLNA 4G7ZA 4A3BK 3HKZL 3WODA 5TMCA 3S1RC 5IP9K 4XSXA 3HOUC 3S15K 1YNJA 3FKIK 3GTJC 1Y1VK 3PO3K 1Y1WK 4A3DK 2BE5A 4XLPA 3RZOK 5IYDK 1I6HK 5IP7C 3RZDC 1I3QK 2NVXK 3HOVC 3I4NK 2JA8C 4C3JK 1R9TK 3GTPC 4X6AK 2R7ZK 3S2DK 3HOXC 3S14C 5IYCK 4BY7K 2PMZD 2R92K 4BBSC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SFO C;  4G7O A;  2B63 K;  4A3G K;  2WB1 D;  4LLG A;  3S17 C;  2E2I C;  2O5J A;  1I50 K;  4BY1 C;  5C44 K;  3M4O K;  4MEY A;  4C2M K;  2PMZ L;  3S2H C;  3CQZ K;  2E2H K;  4A3J C;  2E2J K;  3PO2 K;  3S1M K;  3GTG K;  5IYB C;  2WB1 L;  3S1Q K;  4A3F C;  4A93 C;  3HOW K;  2R93 K;  5M3M K;  3I4M K;  1BDF A;  2O5I A;  3HOZ C;  2WAQ D;  4LK1 A;  4MQ9 A;  5TMF A;  4OIO A;  1TWF C;  4A3I K;  3GTL K;  4A3M K;  2NVY K;  4Y52 K;  5M5X K;  3M3Y C;  1TWH K;  3GTO C;  3GTQ C;  3S1N K;  3HOU K;  2CW0 A;  4A3L C;  4YG2 A;  4Q5S A;  2Y0S L;  1TWG C;  1XPP A;  2WAQ L;  3K7A C;  2A68 A;  2VUM C;  4A3K K;  2NVT C;  2YU9 C;  4AYB D;  2JA7 C;  5IP7 K;  3RZD K;  4ZH4 A;  5FLM C;  2JA8 K;  3HOV K;  1TWA C;  2PPB A;  4Y7N C;  3GTP K;  5C4X K;  4QIW D;  3S16 C;  3GTK C;  3HOX K;  3S14 K;  4AYB L;  5C3E C;  2NVQ C;  4G7H A;  4YFK A;  4BBS K;  1SFO K;  5C4J C;  2A6H A;  4C3I C;  3S15 C;  4Q4Z A;  2JA6 C;  3GTM C;  4BXX C;  4QJV B;  4QIW L;  2E2I K;  4BY1 K;  2JA5 C;  3S2H K;  4A3J K;  1IW7 A;  1TWC C;  1I6V A;  5IYB K;  1K83 C;  1R9T C;  2Y0S D;  4A3F K;  4A3C C;  4A93 K;  2A69 A;  3HOZ K;  1SMY A;  3HOY C;  1HQM A;  3S1R K;  2A6E A;  4BBR C;  3GTJ K;  3GTO K;  4C3H C;  3GTQ K;  4LJZ A;  4YFX A;  3H0G C;  4NOI A;  4A3L K;  4MEX A;  4OIR A;  1WCM C;  5M5Y K;  3K7A K;  2VUM K;  2NVT K;  2YU9 K;  2JA7 K;  4A3E C;  4OIN A;  3EQL A;  4LK0 A;  5FLM K;  1TWA K;  5M5W K;  4Y7N K;  4A3B C;  4KN7 A;  4JK1 A;  4QJV A;  3GTK K;  5IP9 C;  5FJ8 K;  3S17 K;  5C3E K;  2NVQ K;  4KN4 A;  3FKI C;  1TWH C;  1Y1V C;  5D4D A;  3PO3 C;  1Y1W C;  4A3D C;  3S1N C;  5IYD C;  3RZO C;  4C3I K;  1YNN A;  5C4J K;  3H3V L;  2JA6 K;  4XSZ A;  1I6H C;  2NVX C;  1I3Q C;  3I4N C;  3GTM K;  4BXX K;  4YFN A;  4A3K C;  2JA5 K;  4C3J C;  4OIQ A;  4X6A C;  1TWC K;  2R7Z C;  3S2D C;  1K83 K;  5IYC C;  4BY7 C;  4OIP A;  2R92 C;  4A3C K;  5C4X C;  1TWF K;  2B63 C;  4A3G C;  3M3Y K;  1I50 C;  3HOY K;  5C44 C;  3M4O C;  4C2M C;  3DXJ A;  3CQZ C;  2E2H C;  2E2J C;  3PO2 C;  3S1M C;  1TWG K;  4BBR K;  3GTG C;  4C3H K;  3H0G K;  5M3F K;  2PA8 D;  3S1Q C;  1WCM K;  1ZYR A;  3HKZ D;  3HOW C;  2R93 C;  4KMU A;  3I4M C;  3H3V D;  4GZY A;  4A3E K;  3S16 K;  4A3I C;  4Y52 C;  3GTL C;  4A3M C;  2NVY C;  2PA8 L;  4XLN A;  4G7Z A;  4A3B K;  3HKZ L;  3WOD A;  5TMC A;  3S1R C;  5IP9 K;  4XSX A;  3HOU C;  3S15 K;  1YNJ A;  3FKI K;  3GTJ C;  1Y1V K;  3PO3 K;  1Y1W K;  4A3D K;  2BE5 A;  4XLP A;  3RZO K;  5IYD K;  1I6H K;  5IP7 C;  3RZD C;  1I3Q K;  2NVX K;  3HOV C;  3I4N K;  2JA8 C;  4C3J K;  1R9T K;  3GTP C;  4X6A K;  2R7Z K;  3S2D K;  3HOX C;  3S14 C;  5IYC K;  4BY7 K;  2PMZ D;  2R92 K;  4BBS C; 
#chains in the Genus database with same CATH topology
 4WCE S;  1WIH A;  1XZQ A;  4BY1 C;  3TFI A;  5L46 A;  4KAS A;  2PMZ L;  5IOS A;  3L4J A;  4A3J C;  1WQF A;  1G51 A;  1O28 A;  2FQO A;  4KB4 A;  1XZP A;  1XXB A;  1X31 C;  1TWF C;  3GTL K;  2E2I A;  4Y52 K;  3GTO C;  3GTQ C;  3CAG A;  2CW0 A;  4A3L C;  4Q5S A;  1TWG C;  3K7A C;  2VUM C;  4AYB D;  5IP7 K;  4ZH4 A;  3HOV K;  2PPB A;  3ADA C;  2W7V A;  3HOX K;  3G4C A;  3GTJ A;  1USM A;  4YFK A;  1V5V A;  4QIW L;  2YU9 A;  2JA5 C;  1O24 A;  5JVO A;  3ORE A;  3BP3 A;  3GTK A;  1JOE A;  2GSU A;  4WFN S;  1O2A A;  1O29 A;  4PAA A;  1F9N A;  1VJE A;  2JA6 A;  1O26 A;  4C3H C;  4MEX A;  4OIR A;  1TWC A;  1DCH A;  1K83 A;  1B4B A;  2GAH C;  1VGX A;  4A3B C;  4QJV A;  1B4A A;  4LQY A;  2CFA B;  1WOS A;  4A3D C;  5IYD C;  1YNN A;  4XSZ A;  2V6T A;  4KAR A;  4YFN A;  4BY7 C;  2GSO A;  4A3C K;  4KMH A;  3M3Y K;  1I50 C;  1Y1W A;  4GTA A;  3M4O C;  5JVG S;  1EK8 A;  2NVX A;  3GTG C;  1R9T A;  1KQ4 A;  3ERE D;  5M3F K;  1WCM K;  2R7Z A;  1ZYR A;  3LAJ A;  2KWA A;  3PIP S;  2L5N A;  2R93 C;  2XCQ A;  3S16 K;  2PA8 L;  2NVY C;  3AH5 A;  3AQO A;  1F93 A;  1ZQ1 C;  3S1R C;  5IP9 K;  2KPU A;  3AQP A;  3GTJ C;  3HXA A;  4XLP A;  1WSV A;  3RZD C;  1I3Q K;  2ZJP S;  2JA8 C;  4KAT A;  4PAB A;  1L0W A;  3GTL A;  5IYC K;  2PMZ D;  1ZXO A;  4C45 A;  2R92 K;  1SFO C;  2B63 K;  4WFB S;  4A3G K;  3S17 C;  3NUH A;  3GDZ A;  3CQZ K;  4O2D A;  3S1M K;  5IYB C;  1USO A;  3SZZ A;  2JH3 A;  3LPX A;  5M3M K;  3I4M K;  2O5I A;  4WJ4 A;  5TMF A;  4OIO A;  4AH6 A;  4A3M K;  1IS1 A;  1BJT A;  1TWH K;  4IOC S;  3S1N K;  3HOU K;  3OEP A;  4YG2 A;  2WAQ L;  3GEE A;  4A3K K;  2JA7 C;  1TWA C;  2PHC B;  4Y7N C;  3GTP K;  4QIW D;  4M1X A;  2NVQ C;  5C4J C;  4C3I C;  2ZJQ S;  4Q4Z A;  3GTM C;  4BXX C;  3IPJ A;  4BY1 K;  3V4G A;  3N0C A;  1WOP A;  4A3J K;  1FEU A;  2ZUF A;  1R9T C;  4GTB A;  2Y0S D;  1SMY A;  4KAW X;  4BBR C;  3GTO K;  3GTQ K;  4LJZ A;  4YFX A;  1ISE A;  3H0G C;  4P9S A;  2ZJR S;  4NOI A;  3A8I A;  4A3L K;  1IL2 A;  3K7A K;  1XZQ B;  2VUM K;  3BP8 C;  4A3E C;  4LK0 A;  5EGE A;  3N0B A;  3N3Y A;  4WF9 S;  2V6U A;  1ZVU A;  3LYW A;  1WQG A;  4KN4 A;  3FKI C;  1Y1V C;  1J98 A;  3PO3 C;  4LR2 A;  3RZO C;  1WCM A;  3H3V L;  1XZP B;  4WIL A;  2JA5 K;  4C3J C;  3GEI A;  1DCO A;  1XXA A;  3S2D C;  1WQH A;  1PJ7 A;  4BKW A;  5HL7 S;  2Y3P A;  5C44 C;  1PJ6 A;  4C2M C;  3DXJ A;  2E2H C;  1I3Q A;  2E2J C;  3PO2 C;  4C3H K;  2PA8 D;  4G0U A;  3S1Q C;  3HOW C;  4KMU A;  1JVI A;  2R92 A;  4G0V A;  2CFA A;  1VH2 A;  2B63 A;  2L3U A;  4FM9 A;  4A3I C;  5IOQ A;  3T01 A;  4A3B K;  3HKZ L;  5TMC A;  4XSX A;  3CQZ A;  3S15 K;  4GTC A;  4U67 S;  4G0W A;  4A3D K;  5IYD K;  3GSI A;  3DLL S;  3S14 C;  4BY7 K;  1TWH A;  1INN A;  3QX3 A;  1JQW A;  4KMA A;  4BBS C;  4ILD A;  3SZY A;  2E2I C;  2O5J A;  1I50 K;  2RH6 A;  3M4O K;  3Q3Q A;  3S2H C;  1VLO A;  3GTG K;  1EFW A;  2WB1 L;  3GTP A;  1J6V A;  1O25 A;  3AD7 C;  4A3F C;  4KM8 A;  4A93 C;  2R93 K;  1BDF A;  3HOZ C;  3GIR A;  2WAQ D;  4FZB A;  2NVY K;  5M5X K;  3M3Y C;  2P8T A;  1F7V A;  4DDQ A;  5HQH A;  1XPP A;  2NVT C;  2YU9 C;  3S0X A;  3RZD K;  5E68 A;  5FLM C;  2JA8 K;  4J3N A;  3FOF A;  2KXY A;  4KC6 A;  5C4X K;  3S16 C;  3GTK C;  1WOR A;  5C3E C;  3GTO A;  3GTQ A;  4RMF A;  1SFO K;  1AB4 A;  2JA6 C;  4KDD A;  2VUM A;  1WOO A;  1J6W A;  5IOT A;  1IW7 A;  1TWC C;  1XXC A;  1K83 C;  5IOR A;  5IYB K;  2GSN A;  1PJ5 A;  4GTF A;  4IOA S;  3HOY C;  2A6E A;  5EGH A;  5DM7 S;  4WJ3 M;  2JA5 A;  5M5Y K;  2JA7 K;  3EQL A;  1TWA K;  4Y7N K;  4JK1 A;  5FJ8 K;  3L4K A;  2NVQ K;  1TWH C;  1Y1W C;  3S1N C;  5C4J K;  4C3I K;  3GTM K;  1I6H C;  4BXX K;  3CF5 S;  2NVX C;  3I4N C;  4A3K C;  5CHP A;  4OIQ A;  4X6A C;  2R7Z C;  4OIP A;  1O2F B;  1TWF K;  3MML B;  3G4A A;  4BBR K;  1TWG K;  1EI6 A;  3H0G K;  3HKZ D;  4GTD A;  3PIO S;  4GZY A;  4A3E K;  2ZFZ A;  4WFA S;  4Y52 C;  3GTL C;  1I50 A;  2RGR A;  4XLN A;  4G7Z A;  3WOD A;  3FKI K;  1Y1V K;  3GTG A;  3PO3 K;  3RZO K;  5IP7 C;  3HOV C;  2R93 A;  2EBB A;  1DD5 A;  4C3J K;  1O27 A;  4BLA A;  3S2D K;  3HOX C;  1BS2 A;  2NVY A;  3AD8 C;  1ZBS A;  3OPF A;  1IQ0 A;  4G7O A;  2XCR B;  2WB1 D;  4LLG A;  4GTL A;  3T00 A;  2ZUE A;  5C44 K;  4MEY A;  4C2M K;  1VRQ C;  4P5B A;  2E2H K;  3BUE A;  2E2J K;  3PO2 K;  2V6S A;  1YX2 A;  3S1Q K;  1HI9 A;  3HOW K;  3TTG A;  1SFO A;  4LK1 A;  4MQ9 A;  4A3I K;  1F7U A;  1WSR A;  1EH1 A;  3TFH A;  2Y0S L;  3GEH A;  2XCO A;  2A68 A;  1BGW A;  3JST A;  4KB2 A;  3T02 A;  3S14 K;  3A8J A;  4AYB L;  3FHZ A;  4G7H A;  4BBS K;  4LOW A;  1EQR A;  2A6H A;  3S15 C;  4QJV B;  2E2I K;  5HL8 A;  3S2H K;  4P5A A;  2JA7 A;  1I6V A;  2P5M A;  3LAP A;  1TWA A;  4GT9 A;  4A3F K;  4A3C C;  4A93 K;  2A69 A;  5TJ3 A;  3HOZ K;  3S1R K;  1HQM A;  1YCL A;  3GTM A;  1DCP A;  3GTJ K;  3VA7 A;  1WCM C;  2NVT K;  2YU9 K;  3A8K A;  1J6X A;  4OIN A;  5CJ9 A;  1TWF A;  2GAG C;  5FLM K;  1C0A A;  1IBA A;  2FQT A;  4GFQ A;  5M5W K;  1IE0 A;  4KN7 A;  3GTK K;  5IP9 C;  3S17 K;  5C3E K;  1TWG A;  1GE9 A;  4KM9 A;  5D4D A;  3H0G A;  2JA6 K;  1O2B A;  1I3Q C;  4GTE A;  4KMD A;  2D6F C;  1TWC K;  1K83 K;  5IYC C;  4BLB A;  2R92 C;  5C4X C;  2B63 C;  4A3G C;  3FKI A;  1Y1V A;  4XCH A;  3HOY K;  2KQ1 A;  3CQZ C;  3S1M C;  1RU0 A;  3FOE A;  5JVH S;  3I4M C;  3H3V D;  4IO9 S;  4A3M C;  3HOU C;  2E2H A;  1UV7 A;  1YNJ A;  3AD9 C;  1Y1W K;  2BE5 A;  1I6H K;  2NVX K;  3I4N K;  1R9T K;  5DM6 S;  3GTP C;  4X6A K;  2R7Z K;  3TFJ A;  5JFE A; 
#chains in the Genus database with same CATH homology
 1SFO C;  4G7O A;  2B63 K;  4A3G K;  2WB1 D;  4LLG A;  3S17 C;  2E2I C;  2O5J A;  1I50 K;  4BY1 C;  5C44 K;  3M4O K;  4MEY A;  4C2M K;  2PMZ L;  3S2H C;  3CQZ K;  2E2H K;  4A3J C;  2E2J K;  3PO2 K;  3S1M K;  3GTG K;  5IYB C;  2WB1 L;  3S1Q K;  4A3F C;  4A93 C;  3HOW K;  2R93 K;  5M3M K;  3I4M K;  1BDF A;  2O5I A;  3HOZ C;  2WAQ D;  4LK1 A;  4MQ9 A;  5TMF A;  4OIO A;  1TWF C;  4A3I K;  3GTL K;  4A3M K;  2NVY K;  4Y52 K;  5M5X K;  3M3Y C;  1TWH K;  3GTO C;  3GTQ C;  3S1N K;  3HOU K;  2CW0 A;  4A3L C;  4YG2 A;  4Q5S A;  2Y0S L;  1TWG C;  1XPP A;  2WAQ L;  3K7A C;  2A68 A;  2VUM C;  4A3K K;  2NVT C;  2YU9 C;  4AYB D;  2JA7 C;  5IP7 K;  3RZD K;  4ZH4 A;  5FLM C;  2JA8 K;  3HOV K;  1TWA C;  2PPB A;  4Y7N C;  3GTP K;  5C4X K;  4QIW D;  3S16 C;  3GTK C;  3HOX K;  3S14 K;  4AYB L;  5C3E C;  2NVQ C;  4G7H A;  4YFK A;  4BBS K;  1SFO K;  5C4J C;  2A6H A;  4C3I C;  3S15 C;  4Q4Z A;  2JA6 C;  3GTM C;  4BXX C;  4QJV B;  4QIW L;  2E2I K;  4BY1 K;  2JA5 C;  3S2H K;  4A3J K;  1IW7 A;  1TWC C;  1I6V A;  5IYB K;  1K83 C;  1R9T C;  2Y0S D;  4A3F K;  4A3C C;  4A93 K;  2A69 A;  3HOZ K;  1SMY A;  3HOY C;  1HQM A;  3S1R K;  2A6E A;  4BBR C;  3GTJ K;  3GTO K;  4C3H C;  3GTQ K;  4LJZ A;  4YFX A;  3H0G C;  4NOI A;  4A3L K;  4MEX A;  4OIR A;  1WCM C;  5M5Y K;  3K7A K;  2VUM K;  2NVT K;  2YU9 K;  2JA7 K;  4A3E C;  4OIN A;  3EQL A;  4LK0 A;  5FLM K;  1TWA K;  5M5W K;  4Y7N K;  4A3B C;  4KN7 A;  4JK1 A;  4QJV A;  3GTK K;  5IP9 C;  5FJ8 K;  3S17 K;  5C3E K;  2NVQ K;  4KN4 A;  3FKI C;  1TWH C;  1Y1V C;  5D4D A;  3PO3 C;  1Y1W C;  4A3D C;  3S1N C;  5IYD C;  3RZO C;  4C3I K;  1YNN A;  5C4J K;  3H3V L;  2JA6 K;  4XSZ A;  1I6H C;  2NVX C;  1I3Q C;  3I4N C;  3GTM K;  4BXX K;  4YFN A;  4A3K C;  2JA5 K;  4C3J C;  4OIQ A;  4X6A C;  1TWC K;  2R7Z C;  3S2D C;  1K83 K;  5IYC C;  4BY7 C;  4OIP A;  2R92 C;  4A3C K;  5C4X C;  1TWF K;  2B63 C;  4A3G C;  3M3Y K;  1I50 C;  3HOY K;  5C44 C;  3M4O C;  4C2M C;  3DXJ A;  3CQZ C;  2E2H C;  2E2J C;  3PO2 C;  3S1M C;  1TWG K;  4BBR K;  3GTG C;  4C3H K;  3H0G K;  5M3F K;  2PA8 D;  3S1Q C;  1WCM K;  1ZYR A;  3HKZ D;  3HOW C;  2R93 C;  4KMU A;  3I4M C;  3H3V D;  4GZY A;  4A3E K;  3S16 K;  4A3I C;  4Y52 C;  3GTL C;  4A3M C;  2NVY C;  2PA8 L;  4XLN A;  4G7Z A;  4A3B K;  3HKZ L;  3WOD A;  5TMC A;  3S1R C;  5IP9 K;  4XSX A;  3HOU C;  3S15 K;  1YNJ A;  3FKI K;  3GTJ C;  1Y1V K;  3PO3 K;  1Y1W K;  4A3D K;  2BE5 A;  4XLP A;  3RZO K;  5IYD K;  1I6H K;  5IP7 C;  3RZD C;  1I3Q K;  2NVX K;  3HOV C;  3I4N K;  2JA8 C;  4C3J K;  1R9T K;  3GTP C;  4X6A K;  2R7Z K;  3S2D K;  3HOX C;  3S14 C;  5IYC K;  4BY7 K;  2PMZ D;  2R92 K;  4BBS C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...