3EQLA

Crystal structure of the t. thermophilus rna polymerase holoenzyme in complex with antibiotic myxopyronin
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
229
structure length
229
Chain Sequence
MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase subunit alpha
publication title Transcription inactivation through local refolding of the RNA polymerase structure.
pubmed doi rcsb
molecule tags Transferase
total genus 40
structure length 229
sequence length 229
chains with identical sequence B, K, L
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2008-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01000 RNA_pol_A_bac RNA polymerase Rpb3/RpoA insert domain
A PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain
A PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.12 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 DNA-directed RNA polymerase, insert domain 3eqlA02
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3eqlA01
5C4XC 3S1RK 1TWGC 3S1RC 2WB1L 3PO3C 3M3YC 4AYBL 3GTGC 4A3JK 3GTMC 1R9TK 1SFOK 3GTGK 3S14K 4MEXA 3RZDK 3RZDC 2NVQK 2NVQC 3HOUC 5C4JK 5C4JC 2JA5K 2R7ZK 3S2HK 3S2HC 3HOWK 3HOWC 4C3JK 4C3JC 2NVXC 1TWAC 2R93C 1TWAK 3GTJK 3M3YK 3H0GC 1XPPA 1I6HK 5IYCC 4A3LK 5C44K 2JA7C 4A93K 4A93C 4XSZA 4A3KK 3K7AC 1TWCC 3HKZD 4A3KC 4JK1A 2Y0SL 3DXJA 4Y7NK 4Y7NC 3CQZK 4QIWD 5IYBC 2JA8C 3H3VD 3S1NK 5FLMK 4C2MC 5FLMC 4BY1C 3S1NC 4OIQA 4A3MK 4C3IK 3GTKK 2CW0A 3GTKC 4C3HK 4C3HC 5M5YK 3S17K 2WAQD 3S1MK 2A69A 5IP9C 4QJVA 4A3BK 4YG2A 5IYDC 3HOVK 3I4NK 3I4NC 3GTPK 3GTPC 3I4MK 4OINA 3I4MC 4A3JC 1R9TC 1SFOC 2PPBA 3S14C 2JA5C 2R7ZC 4XSXA 3PO2K 3S17C 4LK1A 1I6HC 3GTJC 4YFXA 4A3GK 4A3LC 5C3EK 5C44C 5C3EC 2NVTC 5IP7K 2NVTK 3RZOK 5FJ8K 4BBSK 1YNNA 1BDFA 3FKIK 3CQZC 5TMCA 2A68A 4QIWL 4OIRA 2E2HK 1K83K 1ZYRA 3H3VL 4OIOA 4A3MC 2PMZD 4C3IC 2PA8L 4A3IK 4A3FK 3GTOK 1I50K 4G7OA 1I50C 2E2IK 3S1MC 2WAQL 4X6AK 1TWHK 4YFKA 1TWHC 4A3BC 4X6AC 4A3EK 4A3EC 3HOVC 1Y1WK 4A3DK 1Y1WC 4A3DC 2YU9K 2R92K 4QJVB 2R92C 4G7HA 3S1QK 4KN4A 3S1QC 4MEYA 3M4OK 1Y1VK 3GTQK 3S2DK 4Q4ZA 3PO2C 5M5XK 4MQ9A 1I3QK 4BY7K 1I3QC 4A3CK 4A3GC 3HOZK 4ZH4A 3HOZC 3GTLK 5IP7C 3EQLA 2VUMK 4BBSC 2VUMC 1TWFK 3HKZL 4OIPA 3S16K 1HQMA 3FKIC 5M3MK 1WCMK 1WCMC 2E2HC 1K83C 1SMYA 2PMZL 4KN7A 5M3FK 4A3IC 4A3FC 5C4XK 2WB1D 4AYBD 2E2IC 3GTOC 4XLPA 4XLNA 5D4DA 4KMUA 3RZOC 4BBRC 4Q5SA 4BBRK 3GTMK 2O5JA 2JA6K 3WODA 2JA6C 3HOUK 4LLGA 3HOXK 3HOXC 2O5IA 2YU9C 1IW7A 4NOIA 2NVXK 2R93K 3H0GK 5IYCK 4BXXK 4BXXC 3M4OC 4LK0A 2JA7K 1Y1VC 3GTQC 3S2DC 3S15K 3S15C 3K7AK 2Y0SD 1TWCK 5M5WK 2BE5A 4BY7C 3HOYK 4GZYA 4A3CC 5IYBK 2JA8K 4G7ZA 3GTLC 1YNJA 4C2MK 4BY1K 4Y52C 4Y52K 2A6HA 1TWFC 2E2JC 2PA8D 2B63C 4LJZA 1TWGK 2E2JK 3S16C 2B63K 3PO3K 5IP9K 1I6VA 2A6EA 5IYDK 2NVYK 2NVYC 4YFNA 5TMFA 3HOYC
chains in the Genus database with same CATH superfamily
4AYBL 3M3YC 1R9TK 1XXCA 3GTOA 3HOUC 3G4AA 1TWAK 2R93C 1TWAC 4J3NA 3GTJK 3S17K 1O29A 3H0GC 1ZVUA 4GFQA 3HKZD 2FQOA 2Y0SL 3LAPA 4P5AA 3TFHA 1F93A 4QIWD 5IYBC 1EK8A 1USOA 4BY1C 2V6SA 4OIQA 2L5NA 4KATA 3GTKK 4GTCA 3GTKC 4KMDA 3S1MK 1WCMA 4RMFA 4YG2A 3I4NK 3I4NC 4ILDA 2ZUFA 2NVYA 4PAAA 2XCQA 3GTGA 3GTMA 2R7ZC 4YFXA 4A3GK 2KWAA 1O2AA 2KPUA 4A3LC 5C44C 5C3EC 5C3EK 1F7UA 4OIRA 2CFAA 1K83K 3H3VL 5JVOA 4KM9A 1VJEA 1PJ5A 5JFEA 3GTOK 2B63A 1F7VA 4AH6A 4A3BC 4WFBS 1V5VA 3GTPA 1SFOA 2P8TA 3S2DK 1YCLA 4G0UA 2V6UA 4BY7K 2Y3PA 4A3CK 1O28A 5EGEA 4BKWA 3HKZL 1XZQA 5IOTA 1WCMK 1WCMC 1WIHA 5C4XK 4A3FC 4AYBD 4XLPA 3RZOK 3RZOC 3GTMK 3QX3A 2O5IA 4NOIA 3G4CA 3OPFA 3M4OC 4LK0A 1Y1VC 2KQ1A 3K7AK 2Y0SD 2JA8K 4G7ZA 1AB4A 1YNJA 1J98A 2B63K 2B63C 3S16C 1BGWA 1WSVA 3FKIA 3L4JA 3HOYK 3HOYC 1TWGC 3PO3C 4A3JK 1SFOK 4P5BA 3CAGA 3S14K 2E2IA 4MEXA 3BP8C 2JA6A 3HOWK 3HOWC 4C3JK 4C3JC 2NVXC 3DLLS 1I6HK 1Y1WA 1O26A 2YU9A 3AH5A 5IYCC 2JA7C 3CF5S 3ERED 3T02A 1O2BA 1TWCC 3MMLB 1WQHA 3H3VD 3S1NK 3GTLA 3S1NC 5EGHA 1TWFA 5M5YK 2A69A 3NUHA 3AQOA 5IYDC 4WCES 1XXAA 4XCHA 1J6XA 1GE9A 4OINA 5HL8A 1R9TC 5DM7S 2PPBA 1RU0A 5CHPA 3S17C 3GTJC 1YX2A 5IP7K 4WJ3M 4BBSK 2ZUEA 4KDDA 1WQGA 3FKIK 5TMCA 2A68A 3PIPS 1FEUA 2V6TA 3LPXA 4OIOA 3AD9C 4KMAA 4BLBA 1C0AA 4KC6A 4BLAA 3FOFA 2E2IK 3S1MC 1O27A 2P5MA 4WILA 1Y1WK 1Y1WC 2YU9K 2R92K 2R92C 3S1QK 1IBAA 2KXYA 4KN4A 4MEYA 3S1QC 3N0BA 1PJ7A 3OREA 1WOOA 2JA5A 4A3GC 3GTLK 1IQ0A 4GTAA 3EQLA 4GTDA 4WF9S 1TWFK 4OIPA 1HQMA 3CQZA 3GDZA 1K83C 2PMZL 4KN7A 5M3FK 3GTOC 1I50A 4KB2A 4KAWX 1EFWA 4LLGA 4LR2A 1TWHA 1DD5A 2D6FC 3Q3QA 3S2DC 3BUEA 2BE5A 4BY7C 4GZYA 4A3CC 1B4AA 1I3QA 4C2MK 5JVGS 2A6HA 4LJZA 4IOAS 5IP9K 1I6VA 2E2HA 2NVYK 2NVYC 5TMFA 5C4XC 4GTFA 4WFNS 3GTGK 3GTGC 3GTMC 3RZDK 3RZDC 3SZZA 2ZJPS 2JA5K 5C4JK 2GSNA 5C4JC 1HI9A 1XPPA 4P9SA 3N3YA 1DCHA 2ZJQS 4XSZA 3K7AC 3GTQA 4G0WA 4KM8A 2ZFZA 4Y7NK 4Y7NC 3CQZK 3T01A 2JA8C 3A8JA 4M1XA 2XCOA 1BS2A 2W7VA 4IOCS 4A3MK 4C3IK 4KMHA 3HXAA 2VUMA 4C3HK 4C3HC 4GTLA 1XZPB 3HOVK 2FQTA 3TTGA 3GTPK 3GTPC 4A3JC 1SFOC 3S14C 4GTEA 3IPJA 3PO2K 4LK1A 1I6HC 2PHCB 2R93A 3H0GA 2NVTK 2NVTC 3FOEA 5FJ8K 1YNNA 2EBBA 4O2DA 2E2HK 1ZYRA 2PMZD 1USMA 5IOQA 4A3IK 1WORA 2XCRB 2WAQL 3GTKA 4X6AK 4YFKA 4X6AC 1B4BA 2GAGC 4C45A 4QJVB 4WJ4A 4KARA 4G0VA 3GTQK 4PABA 3LAJA 3FHZA 4Q4ZA 1IS1A 3OEPA 1IL2A 2R7ZA 5M5XK 3HOZK 3HOZC 5IP7C 3GSIA 2VUMK 4BBSC 2VUMC 4LOWA 3BP3A 3FKIC 5L46A 1O25A 4IO9S 2E2IC 1VH2A 3A8KA 3M3YK 5D4DA 4BBRK 4BBRC 1X31C 2O5JA 2JA6K 2JA6C 3HOUK 3HOXK 3HOXC 2YU9C 2R93K 3H0GK 3S0XA 3T00A 1WOPA 3L4KA 3S15K 3S15C 5M5WK 1INNA 5IYBK 3GTLC 4BY1K 1DCOA 1TWFC 2PA8D 3JSTA 2ZJRS 1XZPA 4GTBA 5JVHS 1J6VA 1DCPA 1EH1A 3ADAC 2GSUA 4YFNA 4DDQA 3S1RK 4FM9A 3S1RC 2WB1L 5HQHA 5E68A 2NVQK 2NVQC 2RH6A 2R7ZK 4GT9A 3S2HK 3S2HC 5CJ9A 1KQ4A 1L0WA 3GEIA 3V4GA 1IE0A 4A3LK 5C44K 4A93K 4A93C 1Y1VA 4A3KK 4A3KC 4JK1A 3DXJA 5IORA 5FLMK 4C2MC 5FLMC 3TFJA 2CW0A 1EQRA 2GAHC 2WAQD 1PJ6A 4KASA 1F9NA 5IP9C 4QJVA 4A3BK 2GSOA 3I4MK 3I4MC 3N0CA 1TWGA 1ISEA 5TJ3A 2JA5C 3A8IA 4XSXA 5DM6S 1WQFA 2NVXA 3TFIA 4KB4A 2JA7A 4WFAS 1BDFA 3CQZC 1UV7A 1TWCA 4QIWL 3AD7C 4A3MC 4C3IC 2PA8L 4A3FK 2RGRA 1I50K 4G7OA 1I50C 1JVIA 1WSRA 1TWHK 1TWHC 1JOEA 4A3EK 4A3EC 3HOVC 2JH3A 3GIRA 4A3DK 4A3DC 4G7HA 3AQPA 1R9TA 3M4OK 1Y1VK 1ZQ1C 3AD8C 3PO2C 4MQ9A 1I3QK 1I3QC 1TWAA 4ZH4A 3GTJA 1J6WA 3S16K 1XXBA 5M3MK 1VGXA 2E2HC 1SMYA 2CFAB 4A3IC 2WB1D 1TWGK 3GEHA 3PO3K 4Q5SA 4KMUA 4XLNA 3GEEA 3WODA 1ZBSA 1O2FB 3VA7A 1IW7A 2NVXK 4FZBA 1JQWA 2R92A 5IYCK 4BXXK 4BXXC 1VRQC 3PIOS 3SZYA 2JA7K 3GTQC 1TWCK 5IOSA 1WOSA 5HL7S 1EI6A 4Y52K 2L3UA 4Y52C 4LQYA 1BJTA 1O24A 2E2JC 2E2JK 4U67S 1G51A 3LYWA 1XZQB 1VLOA 2A6EA 1ZXOA 5IYDK 1K83A
chains in the Genus database with same CATH topology
5C4XC 3S1RK 1TWGC 3S1RC 2WB1L 3PO3C 3M3YC 4AYBL 3GTGC 4A3JK 3GTMC 1R9TK 1SFOK 3GTGK 3S14K 4MEXA 3RZDK 3RZDC 2NVQK 2NVQC 3HOUC 5C4JK 5C4JC 2JA5K 2R7ZK 3S2HK 3S2HC 3HOWK 3HOWC 4C3JK 4C3JC 2NVXC 1TWAC 2R93C 1TWAK 3GTJK 3M3YK 3H0GC 1XPPA 1I6HK 5IYCC 4A3LK 5C44K 2JA7C 4A93K 4A93C 4XSZA 4A3KK 3K7AC 1TWCC 3HKZD 4A3KC 4JK1A 2Y0SL 3DXJA 4Y7NK 4Y7NC 3CQZK 4QIWD 5IYBC 2JA8C 3H3VD 3S1NK 5FLMK 4C2MC 5FLMC 4BY1C 3S1NC 4OIQA 4A3MK 4C3IK 3GTKK 2CW0A 3GTKC 4C3HK 4C3HC 5M5YK 3S17K 2WAQD 3S1MK 2A69A 5IP9C 4QJVA 4A3BK 4YG2A 5IYDC 3HOVK 3I4NK 3I4NC 3GTPK 3GTPC 3I4MK 4OINA 3I4MC 4A3JC 1R9TC 1SFOC 2PPBA 3S14C 2JA5C 2R7ZC 4XSXA 3PO2K 3S17C 4LK1A 1I6HC 3GTJC 4YFXA 4A3GK 4A3LC 5C3EK 5C44C 5C3EC 2NVTC 5IP7K 2NVTK 3RZOK 5FJ8K 4BBSK 1YNNA 1BDFA 3FKIK 3CQZC 5TMCA 2A68A 4QIWL 4OIRA 2E2HK 1K83K 1ZYRA 3H3VL 4OIOA 4A3MC 2PMZD 4C3IC 2PA8L 4A3IK 4A3FK 3GTOK 1I50K 4G7OA 1I50C 2E2IK 3S1MC 2WAQL 4X6AK 1TWHK 4YFKA 1TWHC 4A3BC 4X6AC 4A3EK 4A3EC 3HOVC 1Y1WK 4A3DK 1Y1WC 4A3DC 2YU9K 2R92K 4QJVB 2R92C 4G7HA 3S1QK 4KN4A 3S1QC 4MEYA 3M4OK 1Y1VK 3GTQK 3S2DK 4Q4ZA 3PO2C 5M5XK 4MQ9A 1I3QK 4BY7K 1I3QC 4A3CK 4A3GC 3HOZK 4ZH4A 3HOZC 3GTLK 5IP7C 3EQLA 2VUMK 4BBSC 2VUMC 1TWFK 3HKZL 4OIPA 3S16K 1HQMA 3FKIC 5M3MK 1WCMK 1WCMC 2E2HC 1K83C 1SMYA 2PMZL 4KN7A 5M3FK 4A3IC 4A3FC 5C4XK 2WB1D 4AYBD 2E2IC 3GTOC 4XLPA 4XLNA 5D4DA 4KMUA 3RZOC 4BBRC 4Q5SA 4BBRK 3GTMK 2O5JA 2JA6K 3WODA 2JA6C 3HOUK 4LLGA 3HOXK 3HOXC 2O5IA 2YU9C 1IW7A 4NOIA 2NVXK 2R93K 3H0GK 5IYCK 4BXXK 4BXXC 3M4OC 4LK0A 2JA7K 1Y1VC 3GTQC 3S2DC 3S15K 3S15C 3K7AK 2Y0SD 1TWCK 5M5WK 2BE5A 4BY7C 3HOYK 4GZYA 4A3CC 5IYBK 2JA8K 4G7ZA 3GTLC 1YNJA 4C2MK 4BY1K 4Y52C 4Y52K 2A6HA 1TWFC 2E2JC 2PA8D 2B63C 4LJZA 1TWGK 2E2JK 3S16C 2B63K 3PO3K 5IP9K 1I6VA 2A6EA 5IYDK 2NVYK 2NVYC 4YFNA 5TMFA 3HOYC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C4X C;  3S1R K;  1TWG C;  3S1R C;  2WB1 L;  3PO3 C;  3M3Y C;  4AYB L;  3GTG C;  4A3J K;  3GTM C;  1R9T K;  1SFO K;  3GTG K;  3S14 K;  4MEX A;  3RZD K;  3RZD C;  2NVQ K;  2NVQ C;  3HOU C;  5C4J K;  5C4J C;  2JA5 K;  2R7Z K;  3S2H K;  3S2H C;  3HOW K;  3HOW C;  4C3J K;  4C3J C;  2NVX C;  1TWA C;  2R93 C;  1TWA K;  3GTJ K;  3M3Y K;  3H0G C;  1XPP A;  1I6H K;  5IYC C;  4A3L K;  5C44 K;  2JA7 C;  4A93 K;  4A93 C;  4XSZ A;  4A3K K;  3K7A C;  1TWC C;  3HKZ D;  4A3K C;  4JK1 A;  2Y0S L;  3DXJ A;  4Y7N K;  4Y7N C;  3CQZ K;  4QIW D;  5IYB C;  2JA8 C;  3H3V D;  3S1N K;  5FLM K;  4C2M C;  5FLM C;  4BY1 C;  3S1N C;  4OIQ A;  4A3M K;  4C3I K;  3GTK K;  2CW0 A;  3GTK C;  4C3H K;  4C3H C;  5M5Y K;  3S17 K;  2WAQ D;  3S1M K;  2A69 A;  5IP9 C;  4QJV A;  4A3B K;  4YG2 A;  5IYD C;  3HOV K;  3I4N K;  3I4N C;  3GTP K;  3GTP C;  3I4M K;  4OIN A;  3I4M C;  4A3J C;  1R9T C;  1SFO C;  2PPB A;  3S14 C;  2JA5 C;  2R7Z C;  4XSX A;  3PO2 K;  3S17 C;  4LK1 A;  1I6H C;  3GTJ C;  4YFX A;  4A3G K;  4A3L C;  5C3E K;  5C44 C;  5C3E C;  2NVT C;  5IP7 K;  2NVT K;  3RZO K;  5FJ8 K;  4BBS K;  1YNN A;  1BDF A;  3FKI K;  3CQZ C;  5TMC A;  2A68 A;  4QIW L;  4OIR A;  2E2H K;  1K83 K;  1ZYR A;  3H3V L;  4OIO A;  4A3M C;  2PMZ D;  4C3I C;  2PA8 L;  4A3I K;  4A3F K;  3GTO K;  1I50 K;  4G7O A;  1I50 C;  2E2I K;  3S1M C;  2WAQ L;  4X6A K;  1TWH K;  4YFK A;  1TWH C;  4A3B C;  4X6A C;  4A3E K;  4A3E C;  3HOV C;  1Y1W K;  4A3D K;  1Y1W C;  4A3D C;  2YU9 K;  2R92 K;  4QJV B;  2R92 C;  4G7H A;  3S1Q K;  4KN4 A;  3S1Q C;  4MEY A;  3M4O K;  1Y1V K;  3GTQ K;  3S2D K;  4Q4Z A;  3PO2 C;  5M5X K;  4MQ9 A;  1I3Q K;  4BY7 K;  1I3Q C;  4A3C K;  4A3G C;  3HOZ K;  4ZH4 A;  3HOZ C;  3GTL K;  5IP7 C;  3EQL A;  2VUM K;  4BBS C;  2VUM C;  1TWF K;  3HKZ L;  4OIP A;  3S16 K;  1HQM A;  3FKI C;  5M3M K;  1WCM K;  1WCM C;  2E2H C;  1K83 C;  1SMY A;  2PMZ L;  4KN7 A;  5M3F K;  4A3I C;  4A3F C;  5C4X K;  2WB1 D;  4AYB D;  2E2I C;  3GTO C;  4XLP A;  4XLN A;  5D4D A;  4KMU A;  3RZO C;  4BBR C;  4Q5S A;  4BBR K;  3GTM K;  2O5J A;  2JA6 K;  3WOD A;  2JA6 C;  3HOU K;  4LLG A;  3HOX K;  3HOX C;  2O5I A;  2YU9 C;  1IW7 A;  4NOI A;  2NVX K;  2R93 K;  3H0G K;  5IYC K;  4BXX K;  4BXX C;  3M4O C;  4LK0 A;  2JA7 K;  1Y1V C;  3GTQ C;  3S2D C;  3S15 K;  3S15 C;  3K7A K;  2Y0S D;  1TWC K;  5M5W K;  2BE5 A;  4BY7 C;  3HOY K;  4GZY A;  4A3C C;  5IYB K;  2JA8 K;  4G7Z A;  3GTL C;  1YNJ A;  4C2M K;  4BY1 K;  4Y52 C;  4Y52 K;  2A6H A;  1TWF C;  2E2J C;  2PA8 D;  2B63 C;  4LJZ A;  1TWG K;  2E2J K;  3S16 C;  2B63 K;  3PO3 K;  5IP9 K;  1I6V A;  2A6E A;  5IYD K;  2NVY K;  2NVY C;  4YFN A;  5TMF A;  3HOY C; 
#chains in the Genus database with same CATH topology
 4AYB L;  3M3Y C;  1R9T K;  1XXC A;  3GTO A;  3HOU C;  3G4A A;  1TWA K;  2R93 C;  1TWA C;  4J3N A;  3GTJ K;  3S17 K;  1O29 A;  3H0G C;  1ZVU A;  4GFQ A;  3HKZ D;  2FQO A;  2Y0S L;  3LAP A;  4P5A A;  3TFH A;  1F93 A;  4QIW D;  5IYB C;  1EK8 A;  1USO A;  4BY1 C;  2V6S A;  4OIQ A;  2L5N A;  4KAT A;  3GTK K;  4GTC A;  3GTK C;  4KMD A;  3S1M K;  1WCM A;  4RMF A;  4YG2 A;  3I4N K;  3I4N C;  4ILD A;  2ZUF A;  2NVY A;  4PAA A;  2XCQ A;  3GTG A;  3GTM A;  2R7Z C;  4YFX A;  4A3G K;  2KWA A;  1O2A A;  2KPU A;  4A3L C;  5C44 C;  5C3E C;  5C3E K;  1F7U A;  4OIR A;  2CFA A;  1K83 K;  3H3V L;  5JVO A;  4KM9 A;  1VJE A;  1PJ5 A;  5JFE A;  3GTO K;  2B63 A;  1F7V A;  4AH6 A;  4A3B C;  4WFB S;  1V5V A;  3GTP A;  1SFO A;  2P8T A;  3S2D K;  1YCL A;  4G0U A;  2V6U A;  4BY7 K;  2Y3P A;  4A3C K;  1O28 A;  5EGE A;  4BKW A;  3HKZ L;  1XZQ A;  5IOT A;  1WCM K;  1WCM C;  1WIH A;  5C4X K;  4A3F C;  4AYB D;  4XLP A;  3RZO K;  3RZO C;  3GTM K;  3QX3 A;  2O5I A;  4NOI A;  3G4C A;  3OPF A;  3M4O C;  4LK0 A;  1Y1V C;  2KQ1 A;  3K7A K;  2Y0S D;  2JA8 K;  4G7Z A;  1AB4 A;  1YNJ A;  1J98 A;  2B63 K;  2B63 C;  3S16 C;  1BGW A;  1WSV A;  3FKI A;  3L4J A;  3HOY K;  3HOY C;  1TWG C;  3PO3 C;  4A3J K;  1SFO K;  4P5B A;  3CAG A;  3S14 K;  2E2I A;  4MEX A;  3BP8 C;  2JA6 A;  3HOW K;  3HOW C;  4C3J K;  4C3J C;  2NVX C;  3DLL S;  1I6H K;  1Y1W A;  1O26 A;  2YU9 A;  3AH5 A;  5IYC C;  2JA7 C;  3CF5 S;  3ERE D;  3T02 A;  1O2B A;  1TWC C;  3MML B;  1WQH A;  3H3V D;  3S1N K;  3GTL A;  3S1N C;  5EGH A;  1TWF A;  5M5Y K;  2A69 A;  3NUH A;  3AQO A;  5IYD C;  4WCE S;  1XXA A;  4XCH A;  1J6X A;  1GE9 A;  4OIN A;  5HL8 A;  1R9T C;  5DM7 S;  2PPB A;  1RU0 A;  5CHP A;  3S17 C;  3GTJ C;  1YX2 A;  5IP7 K;  4WJ3 M;  4BBS K;  2ZUE A;  4KDD A;  1WQG A;  3FKI K;  5TMC A;  2A68 A;  3PIP S;  1FEU A;  2V6T A;  3LPX A;  4OIO A;  3AD9 C;  4KMA A;  4BLB A;  1C0A A;  4KC6 A;  4BLA A;  3FOF A;  2E2I K;  3S1M C;  1O27 A;  2P5M A;  4WIL A;  1Y1W K;  1Y1W C;  2YU9 K;  2R92 K;  2R92 C;  3S1Q K;  1IBA A;  2KXY A;  4KN4 A;  4MEY A;  3S1Q C;  3N0B A;  1PJ7 A;  3ORE A;  1WOO A;  2JA5 A;  4A3G C;  3GTL K;  1IQ0 A;  4GTA A;  3EQL A;  4GTD A;  4WF9 S;  1TWF K;  4OIP A;  1HQM A;  3CQZ A;  3GDZ A;  1K83 C;  2PMZ L;  4KN7 A;  5M3F K;  3GTO C;  1I50 A;  4KB2 A;  4KAW X;  1EFW A;  4LLG A;  4LR2 A;  1TWH A;  1DD5 A;  2D6F C;  3Q3Q A;  3S2D C;  3BUE A;  2BE5 A;  4BY7 C;  4GZY A;  4A3C C;  1B4A A;  1I3Q A;  4C2M K;  5JVG S;  2A6H A;  4LJZ A;  4IOA S;  5IP9 K;  1I6V A;  2E2H A;  2NVY K;  2NVY C;  5TMF A;  5C4X C;  4GTF A;  4WFN S;  3GTG K;  3GTG C;  3GTM C;  3RZD K;  3RZD C;  3SZZ A;  2ZJP S;  2JA5 K;  5C4J K;  2GSN A;  5C4J C;  1HI9 A;  1XPP A;  4P9S A;  3N3Y A;  1DCH A;  2ZJQ S;  4XSZ A;  3K7A C;  3GTQ A;  4G0W A;  4KM8 A;  2ZFZ A;  4Y7N K;  4Y7N C;  3CQZ K;  3T01 A;  2JA8 C;  3A8J A;  4M1X A;  2XCO A;  1BS2 A;  2W7V A;  4IOC S;  4A3M K;  4C3I K;  4KMH A;  3HXA A;  2VUM A;  4C3H K;  4C3H C;  4GTL A;  1XZP B;  3HOV K;  2FQT A;  3TTG A;  3GTP K;  3GTP C;  4A3J C;  1SFO C;  3S14 C;  4GTE A;  3IPJ A;  3PO2 K;  4LK1 A;  1I6H C;  2PHC B;  2R93 A;  3H0G A;  2NVT K;  2NVT C;  3FOE A;  5FJ8 K;  1YNN A;  2EBB A;  4O2D A;  2E2H K;  1ZYR A;  2PMZ D;  1USM A;  5IOQ A;  4A3I K;  1WOR A;  2XCR B;  2WAQ L;  3GTK A;  4X6A K;  4YFK A;  4X6A C;  1B4B A;  2GAG C;  4C45 A;  4QJV B;  4WJ4 A;  4KAR A;  4G0V A;  3GTQ K;  4PAB A;  3LAJ A;  3FHZ A;  4Q4Z A;  1IS1 A;  3OEP A;  1IL2 A;  2R7Z A;  5M5X K;  3HOZ K;  3HOZ C;  5IP7 C;  3GSI A;  2VUM K;  4BBS C;  2VUM C;  4LOW A;  3BP3 A;  3FKI C;  5L46 A;  1O25 A;  4IO9 S;  2E2I C;  1VH2 A;  3A8K A;  3M3Y K;  5D4D A;  4BBR K;  4BBR C;  1X31 C;  2O5J A;  2JA6 K;  2JA6 C;  3HOU K;  3HOX K;  3HOX C;  2YU9 C;  2R93 K;  3H0G K;  3S0X A;  3T00 A;  1WOP A;  3L4K A;  3S15 K;  3S15 C;  5M5W K;  1INN A;  5IYB K;  3GTL C;  4BY1 K;  1DCO A;  1TWF C;  2PA8 D;  3JST A;  2ZJR S;  1XZP A;  4GTB A;  5JVH S;  1J6V A;  1DCP A;  1EH1 A;  3ADA C;  2GSU A;  4YFN A;  4DDQ A;  3S1R K;  4FM9 A;  3S1R C;  2WB1 L;  5HQH A;  5E68 A;  2NVQ K;  2NVQ C;  2RH6 A;  2R7Z K;  4GT9 A;  3S2H K;  3S2H C;  5CJ9 A;  1KQ4 A;  1L0W A;  3GEI A;  3V4G A;  1IE0 A;  4A3L K;  5C44 K;  4A93 K;  4A93 C;  1Y1V A;  4A3K K;  4A3K C;  4JK1 A;  3DXJ A;  5IOR A;  5FLM K;  4C2M C;  5FLM C;  3TFJ A;  2CW0 A;  1EQR A;  2GAH C;  2WAQ D;  1PJ6 A;  4KAS A;  1F9N A;  5IP9 C;  4QJV A;  4A3B K;  2GSO A;  3I4M K;  3I4M C;  3N0C A;  1TWG A;  1ISE A;  5TJ3 A;  2JA5 C;  3A8I A;  4XSX A;  5DM6 S;  1WQF A;  2NVX A;  3TFI A;  4KB4 A;  2JA7 A;  4WFA S;  1BDF A;  3CQZ C;  1UV7 A;  1TWC A;  4QIW L;  3AD7 C;  4A3M C;  4C3I C;  2PA8 L;  4A3F K;  2RGR A;  1I50 K;  4G7O A;  1I50 C;  1JVI A;  1WSR A;  1TWH K;  1TWH C;  1JOE A;  4A3E K;  4A3E C;  3HOV C;  2JH3 A;  3GIR A;  4A3D K;  4A3D C;  4G7H A;  3AQP A;  1R9T A;  3M4O K;  1Y1V K;  1ZQ1 C;  3AD8 C;  3PO2 C;  4MQ9 A;  1I3Q K;  1I3Q C;  1TWA A;  4ZH4 A;  3GTJ A;  1J6W A;  3S16 K;  1XXB A;  5M3M K;  1VGX A;  2E2H C;  1SMY A;  2CFA B;  4A3I C;  2WB1 D;  1TWG K;  3GEH A;  3PO3 K;  4Q5S A;  4KMU A;  4XLN A;  3GEE A;  3WOD A;  1ZBS A;  1O2F B;  3VA7 A;  1IW7 A;  2NVX K;  4FZB A;  1JQW A;  2R92 A;  5IYC K;  4BXX K;  4BXX C;  1VRQ C;  3PIO S;  3SZY A;  2JA7 K;  3GTQ C;  1TWC K;  5IOS A;  1WOS A;  5HL7 S;  1EI6 A;  4Y52 K;  2L3U A;  4Y52 C;  4LQY A;  1BJT A;  1O24 A;  2E2J C;  2E2J K;  4U67 S;  1G51 A;  3LYW A;  1XZQ B;  1VLO A;  2A6E A;  1ZXO A;  5IYD K;  1K83 A; 
#chains in the Genus database with same CATH homology
 5C4X C;  3S1R K;  1TWG C;  3S1R C;  2WB1 L;  3PO3 C;  3M3Y C;  4AYB L;  3GTG C;  4A3J K;  3GTM C;  1R9T K;  1SFO K;  3GTG K;  3S14 K;  4MEX A;  3RZD K;  3RZD C;  2NVQ K;  2NVQ C;  3HOU C;  5C4J K;  5C4J C;  2JA5 K;  2R7Z K;  3S2H K;  3S2H C;  3HOW K;  3HOW C;  4C3J K;  4C3J C;  2NVX C;  1TWA C;  2R93 C;  1TWA K;  3GTJ K;  3M3Y K;  3H0G C;  1XPP A;  1I6H K;  5IYC C;  4A3L K;  5C44 K;  2JA7 C;  4A93 K;  4A93 C;  4XSZ A;  4A3K K;  3K7A C;  1TWC C;  3HKZ D;  4A3K C;  4JK1 A;  2Y0S L;  3DXJ A;  4Y7N K;  4Y7N C;  3CQZ K;  4QIW D;  5IYB C;  2JA8 C;  3H3V D;  3S1N K;  5FLM K;  4C2M C;  5FLM C;  4BY1 C;  3S1N C;  4OIQ A;  4A3M K;  4C3I K;  3GTK K;  2CW0 A;  3GTK C;  4C3H K;  4C3H C;  5M5Y K;  3S17 K;  2WAQ D;  3S1M K;  2A69 A;  5IP9 C;  4QJV A;  4A3B K;  4YG2 A;  5IYD C;  3HOV K;  3I4N K;  3I4N C;  3GTP K;  3GTP C;  3I4M K;  4OIN A;  3I4M C;  4A3J C;  1R9T C;  1SFO C;  2PPB A;  3S14 C;  2JA5 C;  2R7Z C;  4XSX A;  3PO2 K;  3S17 C;  4LK1 A;  1I6H C;  3GTJ C;  4YFX A;  4A3G K;  4A3L C;  5C3E K;  5C44 C;  5C3E C;  2NVT C;  5IP7 K;  2NVT K;  3RZO K;  5FJ8 K;  4BBS K;  1YNN A;  1BDF A;  3FKI K;  3CQZ C;  5TMC A;  2A68 A;  4QIW L;  4OIR A;  2E2H K;  1K83 K;  1ZYR A;  3H3V L;  4OIO A;  4A3M C;  2PMZ D;  4C3I C;  2PA8 L;  4A3I K;  4A3F K;  3GTO K;  1I50 K;  4G7O A;  1I50 C;  2E2I K;  3S1M C;  2WAQ L;  4X6A K;  1TWH K;  4YFK A;  1TWH C;  4A3B C;  4X6A C;  4A3E K;  4A3E C;  3HOV C;  1Y1W K;  4A3D K;  1Y1W C;  4A3D C;  2YU9 K;  2R92 K;  4QJV B;  2R92 C;  4G7H A;  3S1Q K;  4KN4 A;  3S1Q C;  4MEY A;  3M4O K;  1Y1V K;  3GTQ K;  3S2D K;  4Q4Z A;  3PO2 C;  5M5X K;  4MQ9 A;  1I3Q K;  4BY7 K;  1I3Q C;  4A3C K;  4A3G C;  3HOZ K;  4ZH4 A;  3HOZ C;  3GTL K;  5IP7 C;  3EQL A;  2VUM K;  4BBS C;  2VUM C;  1TWF K;  3HKZ L;  4OIP A;  3S16 K;  1HQM A;  3FKI C;  5M3M K;  1WCM K;  1WCM C;  2E2H C;  1K83 C;  1SMY A;  2PMZ L;  4KN7 A;  5M3F K;  4A3I C;  4A3F C;  5C4X K;  2WB1 D;  4AYB D;  2E2I C;  3GTO C;  4XLP A;  4XLN A;  5D4D A;  4KMU A;  3RZO C;  4BBR C;  4Q5S A;  4BBR K;  3GTM K;  2O5J A;  2JA6 K;  3WOD A;  2JA6 C;  3HOU K;  4LLG A;  3HOX K;  3HOX C;  2O5I A;  2YU9 C;  1IW7 A;  4NOI A;  2NVX K;  2R93 K;  3H0G K;  5IYC K;  4BXX K;  4BXX C;  3M4O C;  4LK0 A;  2JA7 K;  1Y1V C;  3GTQ C;  3S2D C;  3S15 K;  3S15 C;  3K7A K;  2Y0S D;  1TWC K;  5M5W K;  2BE5 A;  4BY7 C;  3HOY K;  4GZY A;  4A3C C;  5IYB K;  2JA8 K;  4G7Z A;  3GTL C;  1YNJ A;  4C2M K;  4BY1 K;  4Y52 C;  4Y52 K;  2A6H A;  1TWF C;  2E2J C;  2PA8 D;  2B63 C;  4LJZ A;  1TWG K;  2E2J K;  3S16 C;  2B63 K;  3PO3 K;  5IP9 K;  1I6V A;  2A6E A;  5IYD K;  2NVY K;  2NVY C;  4YFN A;  5TMF A;  3HOY C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...