3EQLA

Crystal structure of the t. thermophilus rna polymerase holoenzyme in complex with antibiotic myxopyronin
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
229
structure length
229
Chain Sequence
MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Transcription inactivation through local refolding of the RNA polymerase structure.
pubmed doi rcsb
molecule tags Transferase
molecule keywords DNA-directed RNA polymerase subunit alpha
total genus 40
structure length 229
sequence length 229
chains with identical sequence B, K, L
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2008-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01000 RNA_pol_A_bac RNA polymerase Rpb3/RpoA insert domain
A PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain
A PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.12 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 DNA-directed RNA polymerase, insert domain 3eqlA02
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 3eqlA01
2VUMK 2NVXK 4MEYA 3FKIC 4G7OA 4G7HA 4C3IC 4XSXA 3H0GC 5FLMC 4C3IK 2BE5A 3S16K 2NVQC 3HOYK 1K83K 3RZDC 3S16C 4BXXC 5FLMK 2E2IK 4X6AK 4XLNA 4LLGA 1K83C 1Y1VC 4YFXA 4X6AC 4BXXK 5M5YK 4OIOA 1I6VA 2NVTK 3GTOK 2YU9K 4XLPA 3S1RC 2WB1D 2NVTC 4A3JC 3GTKC 3S1NC 4C3JC 1I6HC 4A93K 4A3IK 5IYBK 4C2MC 4OINA 4A3JK 1SFOK 4C3JK 4BY1K 2B63K 3GTQK 5IYBC 4A3LK 4BY1C 2B63C 2PMZD 4A3DK 4A3FC 4AYBD 4Y7NC 4A3MK 2WB1L 2E2JC 4A3LC 2JA5K 3I4NK 2JA6C 3S14C 2JA5C 3I4NC 2E2JK 4YFKA 3M4OK 4BBRC 4Q5SA 2PPBA 2R7ZK 2CW0A 4OIRA 5IP9K 3M4OC 2Y0SL 3GTPC 3S2DK 4Q4ZA 2O5IA 4AYBL 4ZH4A 5IP9C 3S1QK 1YNNA 4KMUA 4BBSC 4OIPA 5C4JK 2JA7C 3GTGC 3M3YC 1XPPA 3HOXK 2A69A 1TWGK 4C3HK 4A3CK 3HOZK 4C3HC 1TWGC 4KN4A 5C3EK 4A3KK 1Y1WK 1TWCC 3I4MK 2R92C 1R9TC 4A3GK 5IYDC 4NOIA 2NVYK 1Y1WC 1ZYRA 3RZOK 5IYDK 2NVYC 1TWFK 5C4XK 3HOVK 1I50K 4YFNA 1TWHC 1TWFC 5C4XC 5TMCA 3PO2C 3S15C 1TWHK 5C44K 1TWAC 2E2HK 1YNJA 4MQ9A 4YG2A 3GTJK 5C44C 2VUMC 2WAQD 1WCMC 3GTJC 4GZYA 2PA8D 3HOWC 4QJVB 3S17K 3K7AC 3S2HC 4KN7A 3H0GK 3HOWK 2JA8K 2NVXC 3FKIK 3S2HK 2E2IC 1SMYA 3WODA 2Y0SD 4LK1A 1Y1VK 4G7ZA 3S1MK 3HOYC 2NVQK 4LJZA 2A68A 3RZDK 1IW7A 2R93K 3S1MC 3GTOC 3S1NK 5FJ8K 3GTKK 3H3VD 4BY7K 3DXJA 4QIWL 2YU9C 3S1RK 4BY7C 4A93C 1I6HK 4A3DC 4A3IC 4A3MC 4Y7NK 1SFOC 4C2MK 3GTQC 4A3BK 3H3VL 2A6HA 4A3FK 4A3BC 4Y52C 5D4DA 3HKZL 3S2DC 2JA6K 3GTPK 3S14K 3S1QC 4Y52K 1I3QK 4BBRK 4JK1A 4XSZA 2R7ZC 3CQZC 1I3QC 2WAQL 2JA7K 3GTGK 2PA8L 3M3YK 2O5JA 3CQZK 3HKZD 2A6EA 1BDFA 4OIQA 3HOZC 4BBSK 4MEXA 5C4JC 3I4MC 3HOXC 2R92K 4A3CC 1HQMA 4LK0A 2R93C 5M3FK 4A3EC 5IYCC 5C3EC 4A3KC 3HOVC 4A3GC 1TWCK 1I50C 2PMZL 5M5XK 1R9TK 4A3EK 3PO3C 5IYCK 4QJVA 3PO2K 3RZOC 5M5WK 5TMFA 3HOUC 3PO3K 5IP7K 3GTMK 2E2HC 3EQLA 1TWAK 4QIWD 3GTLC 3HOUK 5IP7C 3GTMC 5M3MK 3S15K 1WCMK 3GTLK 3S17C 3K7AK 2JA8C
chains in the Genus database with same CATH superfamily
4MEYA 3FKIC 3QX3A 1UV7A 5EGHA 2XCOA 3H0GC 3S16K 3HOYK 2FQTA 3AQOA 5IOSA 5TJ3A 4X6AC 3OREA 1I6VA 4KATA 1O25A 3S1NC 2NVTC 3GTKC 1B4AA 1VGXA 4BY1K 4A3LK 4BY1C 4A3DK 4A3FC 4AYBD 2B63A 3HXAA 4YFKA 2L5NA 4BBRC 2R7ZK 2Y0SL 4C45A 4Q4ZA 4WF9S 5IP9C 4U67S 1YNNA 5C4JK 1TWHA 3LAPA 2A69A 1TWGK 1TWGC 1Y1WK 4WFBS 4A3GK 2R92C 4NOIA 3T00A 3RZOK 1Y1WA 5C4XK 1WCMA 3SZYA 1TWHC 3GEEA 5C4XC 5TMCA 4WFNS 3FOFA 1TWHK 2V6UA 5C44K 4MQ9A 1O2AA 5C44C 4GZYA 3HOWC 4BLAA 2JA8K 2NVXC 4KM8A 3L4KA 1SMYA 5E68A 4LJZA 3FHZA 1WQHA 1IW7A 1JVIA 1VJEA 1I3QA 1GE9A 3H3VD 4PAAA 3JSTA 4QIWL 1O29A 4GTEA 1F93A 4A93C 3GIRA 1I6HK 4A3IC 4GFQA 4C2MK 3GTQC 4KB4A 1RU0A 4AH6A 4Y52C 5D4DA 2ZJQS 2GAHC 3HKZL 2JA6K 1DD5A 4G0UA 2D6FC 2ZUFA 2JA7K 3Q3QA 3HKZD 3GTQA 1WSRA 3SZZA 1BDFA 4BBSK 4MEXA 5DM6S 4PABA 5JVHS 5C3EC 4A3KC 3HOVC 1TWCK 2PMZL 5IYCK 1EH1A 3S0XA 3PO2K 1TWAK 3GTLC 3CQZA 5M3MK 1WCMK 3TFIA 3GTLK 4LOWA 3K7AK 3CF5S 2VUMK 4G7OA 5DM7S 1O2BA 1PJ5A 4C3IC 1B4BA 1VLOA 2BE5A 4C3IK 2NVQC 1K83K 3RZDC 4X6AK 2E2IK 4LLGA 1K83C 1Y1VC 5IOTA 4BXXK 4OIOA 3VA7A 2NVTK 4LR2A 2R7ZA 3S1RC 4C3JC 3GTKA 1SFOK 4A3JK 4C3JK 1Y1VA 2E2JC 1XXCA 3I4NK 3S14C 2JA5C 1O27A 2RH6A 3I4NC 2E2JK 3V4GA 5IP9K 5HL8A 3G4AA 4ZH4A 4IOCS 4GTBA 3GTGC 3M3YC 1XPPA 4A3CK 1I50A 1TWFA 1VH2A 1ZYRA 1WOSA 5IYDK 1DCHA 2ZFZA 1I50K 1FEUA 1USMA 4KMHA 2KPUA 2FQOA 2GSOA 4GTFA 2E2HK 1YNJA 4YG2A 3IPJA 1ZVUA 4O2DA 3S17K 3S2HC 3H0GK 3AD8C 4WFAS 2EBBA 2E2IA 4P5AA 1EFWA 3S2HK 1F9NA 3GTGA 3S1MC 5EGEA 1BGWA 1SFOA 2NVYA 3GTKK 4GTCA 4G0VA 1WOOA 2ZJPS 3S2DC 3GTPK 5JVOA 3S1QC 3GDZA 1WQFA 4XSZA 2R7ZC 1I3QC 1ZQ1C 4OIQA 2KXYA 1G51A 5C4JC 3HOXC 3TFHA 2P5MA 2R93C 1DCPA 4A3EC 3OEPA 5IYCC 4KMAA 2R93K 4A3GC 1R9TK 4A3EK 3RZOC 5M5WK 2R92A 5TMFA 2E2HA 3GTMK 4KB2A 4QIWD 5JFEA 3HOUK 3GTMC 3TFJA 1O24A 3S15K 5IOQA 1WSVA 2GSUA 1WIHA 3BP8C 2JA8C 3N3YA 1USOA 4G7HA 1IS1A 2KQ1A 1DCOA 3FOEA 3GTMA 4FZBA 5L46A 4BXXC 3N0BA 4ILDA 5FLMK 4XLNA 4YFXA 5M5YK 1HI9A 1L0WA 3PIOS 4G0WA 3GTOK 2YU9K 2WB1D 4A3JC 3ADAC 1O2FB 3GSIA 1F7VA 5IYBK 4C2MC 4OINA 1WORA 4KC6A 1IL2A 2CFAB 5IYBC 2Y3PA 2XCRB 2PMZD 3T01A 4Y7NC 4A3MK 2JA5K 1J6VA 3M4OK 3A8IA 2PPBA 1YCLA 3GTPA 4OIRA 4GTLA 3M4OC 4P9SA 4AYBL 4WILA 4KMUA 4OIPA 2JA7C 2V6TA 4GT9A 3HOZK 3LPXA 4KN4A 5C3EK 4A3KK 3I4MK 2VUMA 5IYDC 2NVYK 2PHCB 3GEIA 4LQYA 4GTDA 2JA5A 2NVYC 3HOVK 4YFNA 2W7VA 1TWGA 3PO2C 1IE0A 1TWAA 4P5BA 3A8JA 1ISEA 2ZJRS 2YU9A 2VUMC 3MMLB 2WAQD 1WCMC 3GTJC 3FKIK 2E2IC 4KMDA 3WODA 3S1MK 3HOYC 2JA7A 2XCQA 3S1NK 3OPFA 4BY7K 3BUEA 3AD7C 4BY7C 4RMFA 4A3DC 1IQ0A 4A3BK 3H3VL 5HL7S 4A3FK 4A3BC 3LYWA 1ZBSA 1I3QK 4BBRK 2L3UA 3TTGA 2WAQL 1XZQA 2PA8L 5HQHA 2O5JA 3AQPA 2KWAA 3N0CA 4IOAS 1J6WA 3FKIA 2R92K 1EQRA 1HQMA 4LK0A 2R93A 5M5XK 1I50C 3PO3C 3HOUC 3PO3K 5IP7K 2E2HC 1VRQC 5IP7C 1XXAA 2NVXA 1ZXOA 1PJ6A 2NVXK 4GTAA 1F7UA 3PIPS 3GTLA 2GAGC 4XSXA 1XZPB 4IO9S 5FLMC 1BJTA 2ZUEA 3S16C 1TWCA 2V6SA 1JQWA 4XLPA 3GTJA 1I6HC 4A93K 5IORA 4A3IK 2B63K 3GTQK 4WJ3M 2B63C 1XZQB 2P8TA 2WB1L 4A3LC 4KAWX 1C0AA 2JA6C 4KDDA 3A8KA 4Q5SA 1KQ4A 3H0GA 2CW0A 1XZPA 3GTPC 3S2DK 2O5IA 3DLLS 2JH3A 3S1QK 3L4JA 4BBSC 1X31C 3G4CA 2RGRA 3HOXK 1XXBA 4C3HK 4C3HC 1TWCC 1R9TC 4KARA 1Y1WC 1J6XA 4BKWA 1TWFK 3LAJA 4KM9A 3GEHA 1TWFC 3AD9C 3S15C 3CAGA 1TWAC 1EK8A 3GTJK 1R9TA 2PA8D 4WCES 4QJVB 1PJ7A 3K7AC 1IBAA 4KN7A 3HOWK 2GSNA 1EI6A 1K83A 1V5VA 4DDQA 2Y0SD 4LK1A 1Y1VK 4G7ZA 2NVQK 2A68A 5CHPA 3RZDK 3GTOC 4BLBA 5FJ8K 1WQGA 4KASA 3DXJA 2YU9C 3S1RK 4A3MC 4Y7NK 1SFOC 1J98A 1AB4A 2A6HA 4XCHA 3NUHA 3S14K 4Y52K 4JK1A 3CQZC 3GTGK 3M3YK 3CQZK 1YX2A 2A6EA 3HOZC 1BS2A 3I4MC 4FM9A 4A3CC 5M3FK 3BP3A 3AH5A 1INNA 3T02A 3GTOA 4WJ4A 2JA6A 1JOEA 5JVGS 5CJ9A 4QJVA 4M1XA 3EQLA 1WOPA 3ERED 2CFAA 3S17C 1O28A 1O26A 4J3NA
chains in the Genus database with same CATH topology
2VUMK 2NVXK 4MEYA 3FKIC 4G7OA 4G7HA 4C3IC 4XSXA 3H0GC 5FLMC 4C3IK 2BE5A 3S16K 2NVQC 3HOYK 1K83K 3RZDC 3S16C 4BXXC 5FLMK 2E2IK 4X6AK 4XLNA 4LLGA 1K83C 1Y1VC 4YFXA 4X6AC 4BXXK 5M5YK 4OIOA 1I6VA 2NVTK 3GTOK 2YU9K 4XLPA 3S1RC 2WB1D 2NVTC 4A3JC 3GTKC 3S1NC 4C3JC 1I6HC 4A93K 4A3IK 5IYBK 4C2MC 4OINA 4A3JK 1SFOK 4C3JK 4BY1K 2B63K 3GTQK 5IYBC 4A3LK 4BY1C 2B63C 2PMZD 4A3DK 4A3FC 4AYBD 4Y7NC 4A3MK 2WB1L 2E2JC 4A3LC 2JA5K 3I4NK 2JA6C 3S14C 2JA5C 3I4NC 2E2JK 4YFKA 3M4OK 4BBRC 4Q5SA 2PPBA 2R7ZK 2CW0A 4OIRA 5IP9K 3M4OC 2Y0SL 3GTPC 3S2DK 4Q4ZA 2O5IA 4AYBL 4ZH4A 5IP9C 3S1QK 1YNNA 4KMUA 4BBSC 4OIPA 5C4JK 2JA7C 3GTGC 3M3YC 1XPPA 3HOXK 2A69A 1TWGK 4C3HK 4A3CK 3HOZK 4C3HC 1TWGC 4KN4A 5C3EK 4A3KK 1Y1WK 1TWCC 3I4MK 2R92C 1R9TC 4A3GK 5IYDC 4NOIA 2NVYK 1Y1WC 1ZYRA 3RZOK 5IYDK 2NVYC 1TWFK 5C4XK 3HOVK 1I50K 4YFNA 1TWHC 1TWFC 5C4XC 5TMCA 3PO2C 3S15C 1TWHK 5C44K 1TWAC 2E2HK 1YNJA 4MQ9A 4YG2A 3GTJK 5C44C 2VUMC 2WAQD 1WCMC 3GTJC 4GZYA 2PA8D 3HOWC 4QJVB 3S17K 3K7AC 3S2HC 4KN7A 3H0GK 3HOWK 2JA8K 2NVXC 3FKIK 3S2HK 2E2IC 1SMYA 3WODA 2Y0SD 4LK1A 1Y1VK 4G7ZA 3S1MK 3HOYC 2NVQK 4LJZA 2A68A 3RZDK 1IW7A 2R93K 3S1MC 3GTOC 3S1NK 5FJ8K 3GTKK 3H3VD 4BY7K 3DXJA 4QIWL 2YU9C 3S1RK 4BY7C 4A93C 1I6HK 4A3DC 4A3IC 4A3MC 4Y7NK 1SFOC 4C2MK 3GTQC 4A3BK 3H3VL 2A6HA 4A3FK 4A3BC 4Y52C 5D4DA 3HKZL 3S2DC 2JA6K 3GTPK 3S14K 3S1QC 4Y52K 1I3QK 4BBRK 4JK1A 4XSZA 2R7ZC 3CQZC 1I3QC 2WAQL 2JA7K 3GTGK 2PA8L 3M3YK 2O5JA 3CQZK 3HKZD 2A6EA 1BDFA 4OIQA 3HOZC 4BBSK 4MEXA 5C4JC 3I4MC 3HOXC 2R92K 4A3CC 1HQMA 4LK0A 2R93C 5M3FK 4A3EC 5IYCC 5C3EC 4A3KC 3HOVC 4A3GC 1TWCK 1I50C 2PMZL 5M5XK 1R9TK 4A3EK 3PO3C 5IYCK 4QJVA 3PO2K 3RZOC 5M5WK 5TMFA 3HOUC 3PO3K 5IP7K 3GTMK 2E2HC 3EQLA 1TWAK 4QIWD 3GTLC 3HOUK 5IP7C 3GTMC 5M3MK 3S15K 1WCMK 3GTLK 3S17C 3K7AK 2JA8C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VUM K;  2NVX K;  4MEY A;  3FKI C;  4G7O A;  4G7H A;  4C3I C;  4XSX A;  3H0G C;  5FLM C;  4C3I K;  2BE5 A;  3S16 K;  2NVQ C;  3HOY K;  1K83 K;  3RZD C;  3S16 C;  4BXX C;  5FLM K;  2E2I K;  4X6A K;  4XLN A;  4LLG A;  1K83 C;  1Y1V C;  4YFX A;  4X6A C;  4BXX K;  5M5Y K;  4OIO A;  1I6V A;  2NVT K;  3GTO K;  2YU9 K;  4XLP A;  3S1R C;  2WB1 D;  2NVT C;  4A3J C;  3GTK C;  3S1N C;  4C3J C;  1I6H C;  4A93 K;  4A3I K;  5IYB K;  4C2M C;  4OIN A;  4A3J K;  1SFO K;  4C3J K;  4BY1 K;  2B63 K;  3GTQ K;  5IYB C;  4A3L K;  4BY1 C;  2B63 C;  2PMZ D;  4A3D K;  4A3F C;  4AYB D;  4Y7N C;  4A3M K;  2WB1 L;  2E2J C;  4A3L C;  2JA5 K;  3I4N K;  2JA6 C;  3S14 C;  2JA5 C;  3I4N C;  2E2J K;  4YFK A;  3M4O K;  4BBR C;  4Q5S A;  2PPB A;  2R7Z K;  2CW0 A;  4OIR A;  5IP9 K;  3M4O C;  2Y0S L;  3GTP C;  3S2D K;  4Q4Z A;  2O5I A;  4AYB L;  4ZH4 A;  5IP9 C;  3S1Q K;  1YNN A;  4KMU A;  4BBS C;  4OIP A;  5C4J K;  2JA7 C;  3GTG C;  3M3Y C;  1XPP A;  3HOX K;  2A69 A;  1TWG K;  4C3H K;  4A3C K;  3HOZ K;  4C3H C;  1TWG C;  4KN4 A;  5C3E K;  4A3K K;  1Y1W K;  1TWC C;  3I4M K;  2R92 C;  1R9T C;  4A3G K;  5IYD C;  4NOI A;  2NVY K;  1Y1W C;  1ZYR A;  3RZO K;  5IYD K;  2NVY C;  1TWF K;  5C4X K;  3HOV K;  1I50 K;  4YFN A;  1TWH C;  1TWF C;  5C4X C;  5TMC A;  3PO2 C;  3S15 C;  1TWH K;  5C44 K;  1TWA C;  2E2H K;  1YNJ A;  4MQ9 A;  4YG2 A;  3GTJ K;  5C44 C;  2VUM C;  2WAQ D;  1WCM C;  3GTJ C;  4GZY A;  2PA8 D;  3HOW C;  4QJV B;  3S17 K;  3K7A C;  3S2H C;  4KN7 A;  3H0G K;  3HOW K;  2JA8 K;  2NVX C;  3FKI K;  3S2H K;  2E2I C;  1SMY A;  3WOD A;  2Y0S D;  4LK1 A;  1Y1V K;  4G7Z A;  3S1M K;  3HOY C;  2NVQ K;  4LJZ A;  2A68 A;  3RZD K;  1IW7 A;  2R93 K;  3S1M C;  3GTO C;  3S1N K;  5FJ8 K;  3GTK K;  3H3V D;  4BY7 K;  3DXJ A;  4QIW L;  2YU9 C;  3S1R K;  4BY7 C;  4A93 C;  1I6H K;  4A3D C;  4A3I C;  4A3M C;  4Y7N K;  1SFO C;  4C2M K;  3GTQ C;  4A3B K;  3H3V L;  2A6H A;  4A3F K;  4A3B C;  4Y52 C;  5D4D A;  3HKZ L;  3S2D C;  2JA6 K;  3GTP K;  3S14 K;  3S1Q C;  4Y52 K;  1I3Q K;  4BBR K;  4JK1 A;  4XSZ A;  2R7Z C;  3CQZ C;  1I3Q C;  2WAQ L;  2JA7 K;  3GTG K;  2PA8 L;  3M3Y K;  2O5J A;  3CQZ K;  3HKZ D;  2A6E A;  1BDF A;  4OIQ A;  3HOZ C;  4BBS K;  4MEX A;  5C4J C;  3I4M C;  3HOX C;  2R92 K;  4A3C C;  1HQM A;  4LK0 A;  2R93 C;  5M3F K;  4A3E C;  5IYC C;  5C3E C;  4A3K C;  3HOV C;  4A3G C;  1TWC K;  1I50 C;  2PMZ L;  5M5X K;  1R9T K;  4A3E K;  3PO3 C;  5IYC K;  4QJV A;  3PO2 K;  3RZO C;  5M5W K;  5TMF A;  3HOU C;  3PO3 K;  5IP7 K;  3GTM K;  2E2H C;  3EQL A;  1TWA K;  4QIW D;  3GTL C;  3HOU K;  5IP7 C;  3GTM C;  5M3M K;  3S15 K;  1WCM K;  3GTL K;  3S17 C;  3K7A K;  2JA8 C; 
#chains in the Genus database with same CATH topology
 4MEY A;  3FKI C;  3QX3 A;  1UV7 A;  5EGH A;  2XCO A;  3H0G C;  3S16 K;  3HOY K;  2FQT A;  3AQO A;  5IOS A;  5TJ3 A;  4X6A C;  3ORE A;  1I6V A;  4KAT A;  1O25 A;  3S1N C;  2NVT C;  3GTK C;  1B4A A;  1VGX A;  4BY1 K;  4A3L K;  4BY1 C;  4A3D K;  4A3F C;  4AYB D;  2B63 A;  3HXA A;  4YFK A;  2L5N A;  4BBR C;  2R7Z K;  2Y0S L;  4C45 A;  4Q4Z A;  4WF9 S;  5IP9 C;  4U67 S;  1YNN A;  5C4J K;  1TWH A;  3LAP A;  2A69 A;  1TWG K;  1TWG C;  1Y1W K;  4WFB S;  4A3G K;  2R92 C;  4NOI A;  3T00 A;  3RZO K;  1Y1W A;  5C4X K;  1WCM A;  3SZY A;  1TWH C;  3GEE A;  5C4X C;  5TMC A;  4WFN S;  3FOF A;  1TWH K;  2V6U A;  5C44 K;  4MQ9 A;  1O2A A;  5C44 C;  4GZY A;  3HOW C;  4BLA A;  2JA8 K;  2NVX C;  4KM8 A;  3L4K A;  1SMY A;  5E68 A;  4LJZ A;  3FHZ A;  1WQH A;  1IW7 A;  1JVI A;  1VJE A;  1I3Q A;  1GE9 A;  3H3V D;  4PAA A;  3JST A;  4QIW L;  1O29 A;  4GTE A;  1F93 A;  4A93 C;  3GIR A;  1I6H K;  4A3I C;  4GFQ A;  4C2M K;  3GTQ C;  4KB4 A;  1RU0 A;  4AH6 A;  4Y52 C;  5D4D A;  2ZJQ S;  2GAH C;  3HKZ L;  2JA6 K;  1DD5 A;  4G0U A;  2D6F C;  2ZUF A;  2JA7 K;  3Q3Q A;  3HKZ D;  3GTQ A;  1WSR A;  3SZZ A;  1BDF A;  4BBS K;  4MEX A;  5DM6 S;  4PAB A;  5JVH S;  5C3E C;  4A3K C;  3HOV C;  1TWC K;  2PMZ L;  5IYC K;  1EH1 A;  3S0X A;  3PO2 K;  1TWA K;  3GTL C;  3CQZ A;  5M3M K;  1WCM K;  3TFI A;  3GTL K;  4LOW A;  3K7A K;  3CF5 S;  2VUM K;  4G7O A;  5DM7 S;  1O2B A;  1PJ5 A;  4C3I C;  1B4B A;  1VLO A;  2BE5 A;  4C3I K;  2NVQ C;  1K83 K;  3RZD C;  4X6A K;  2E2I K;  4LLG A;  1K83 C;  1Y1V C;  5IOT A;  4BXX K;  4OIO A;  3VA7 A;  2NVT K;  4LR2 A;  2R7Z A;  3S1R C;  4C3J C;  3GTK A;  1SFO K;  4A3J K;  4C3J K;  1Y1V A;  2E2J C;  1XXC A;  3I4N K;  3S14 C;  2JA5 C;  1O27 A;  2RH6 A;  3I4N C;  2E2J K;  3V4G A;  5IP9 K;  5HL8 A;  3G4A A;  4ZH4 A;  4IOC S;  4GTB A;  3GTG C;  3M3Y C;  1XPP A;  4A3C K;  1I50 A;  1TWF A;  1VH2 A;  1ZYR A;  1WOS A;  5IYD K;  1DCH A;  2ZFZ A;  1I50 K;  1FEU A;  1USM A;  4KMH A;  2KPU A;  2FQO A;  2GSO A;  4GTF A;  2E2H K;  1YNJ A;  4YG2 A;  3IPJ A;  1ZVU A;  4O2D A;  3S17 K;  3S2H C;  3H0G K;  3AD8 C;  4WFA S;  2EBB A;  2E2I A;  4P5A A;  1EFW A;  3S2H K;  1F9N A;  3GTG A;  3S1M C;  5EGE A;  1BGW A;  1SFO A;  2NVY A;  3GTK K;  4GTC A;  4G0V A;  1WOO A;  2ZJP S;  3S2D C;  3GTP K;  5JVO A;  3S1Q C;  3GDZ A;  1WQF A;  4XSZ A;  2R7Z C;  1I3Q C;  1ZQ1 C;  4OIQ A;  2KXY A;  1G51 A;  5C4J C;  3HOX C;  3TFH A;  2P5M A;  2R93 C;  1DCP A;  4A3E C;  3OEP A;  5IYC C;  4KMA A;  2R93 K;  4A3G C;  1R9T K;  4A3E K;  3RZO C;  5M5W K;  2R92 A;  5TMF A;  2E2H A;  3GTM K;  4KB2 A;  4QIW D;  5JFE A;  3HOU K;  3GTM C;  3TFJ A;  1O24 A;  3S15 K;  5IOQ A;  1WSV A;  2GSU A;  1WIH A;  3BP8 C;  2JA8 C;  3N3Y A;  1USO A;  4G7H A;  1IS1 A;  2KQ1 A;  1DCO A;  3FOE A;  3GTM A;  4FZB A;  5L46 A;  4BXX C;  3N0B A;  4ILD A;  5FLM K;  4XLN A;  4YFX A;  5M5Y K;  1HI9 A;  1L0W A;  3PIO S;  4G0W A;  3GTO K;  2YU9 K;  2WB1 D;  4A3J C;  3ADA C;  1O2F B;  3GSI A;  1F7V A;  5IYB K;  4C2M C;  4OIN A;  1WOR A;  4KC6 A;  1IL2 A;  2CFA B;  5IYB C;  2Y3P A;  2XCR B;  2PMZ D;  3T01 A;  4Y7N C;  4A3M K;  2JA5 K;  1J6V A;  3M4O K;  3A8I A;  2PPB A;  1YCL A;  3GTP A;  4OIR A;  4GTL A;  3M4O C;  4P9S A;  4AYB L;  4WIL A;  4KMU A;  4OIP A;  2JA7 C;  2V6T A;  4GT9 A;  3HOZ K;  3LPX A;  4KN4 A;  5C3E K;  4A3K K;  3I4M K;  2VUM A;  5IYD C;  2NVY K;  2PHC B;  3GEI A;  4LQY A;  4GTD A;  2JA5 A;  2NVY C;  3HOV K;  4YFN A;  2W7V A;  1TWG A;  3PO2 C;  1IE0 A;  1TWA A;  4P5B A;  3A8J A;  1ISE A;  2ZJR S;  2YU9 A;  2VUM C;  3MML B;  2WAQ D;  1WCM C;  3GTJ C;  3FKI K;  2E2I C;  4KMD A;  3WOD A;  3S1M K;  3HOY C;  2JA7 A;  2XCQ A;  3S1N K;  3OPF A;  4BY7 K;  3BUE A;  3AD7 C;  4BY7 C;  4RMF A;  4A3D C;  1IQ0 A;  4A3B K;  3H3V L;  5HL7 S;  4A3F K;  4A3B C;  3LYW A;  1ZBS A;  1I3Q K;  4BBR K;  2L3U A;  3TTG A;  2WAQ L;  1XZQ A;  2PA8 L;  5HQH A;  2O5J A;  3AQP A;  2KWA A;  3N0C A;  4IOA S;  1J6W A;  3FKI A;  2R92 K;  1EQR A;  1HQM A;  4LK0 A;  2R93 A;  5M5X K;  1I50 C;  3PO3 C;  3HOU C;  3PO3 K;  5IP7 K;  2E2H C;  1VRQ C;  5IP7 C;  1XXA A;  2NVX A;  1ZXO A;  1PJ6 A;  2NVX K;  4GTA A;  1F7U A;  3PIP S;  3GTL A;  2GAG C;  4XSX A;  1XZP B;  4IO9 S;  5FLM C;  1BJT A;  2ZUE A;  3S16 C;  1TWC A;  2V6S A;  1JQW A;  4XLP A;  3GTJ A;  1I6H C;  4A93 K;  5IOR A;  4A3I K;  2B63 K;  3GTQ K;  4WJ3 M;  2B63 C;  1XZQ B;  2P8T A;  2WB1 L;  4A3L C;  4KAW X;  1C0A A;  2JA6 C;  4KDD A;  3A8K A;  4Q5S A;  1KQ4 A;  3H0G A;  2CW0 A;  1XZP A;  3GTP C;  3S2D K;  2O5I A;  3DLL S;  2JH3 A;  3S1Q K;  3L4J A;  4BBS C;  1X31 C;  3G4C A;  2RGR A;  3HOX K;  1XXB A;  4C3H K;  4C3H C;  1TWC C;  1R9T C;  4KAR A;  1Y1W C;  1J6X A;  4BKW A;  1TWF K;  3LAJ A;  4KM9 A;  3GEH A;  1TWF C;  3AD9 C;  3S15 C;  3CAG A;  1TWA C;  1EK8 A;  3GTJ K;  1R9T A;  2PA8 D;  4WCE S;  4QJV B;  1PJ7 A;  3K7A C;  1IBA A;  4KN7 A;  3HOW K;  2GSN A;  1EI6 A;  1K83 A;  1V5V A;  4DDQ A;  2Y0S D;  4LK1 A;  1Y1V K;  4G7Z A;  2NVQ K;  2A68 A;  5CHP A;  3RZD K;  3GTO C;  4BLB A;  5FJ8 K;  1WQG A;  4KAS A;  3DXJ A;  2YU9 C;  3S1R K;  4A3M C;  4Y7N K;  1SFO C;  1J98 A;  1AB4 A;  2A6H A;  4XCH A;  3NUH A;  3S14 K;  4Y52 K;  4JK1 A;  3CQZ C;  3GTG K;  3M3Y K;  3CQZ K;  1YX2 A;  2A6E A;  3HOZ C;  1BS2 A;  3I4M C;  4FM9 A;  4A3C C;  5M3F K;  3BP3 A;  3AH5 A;  1INN A;  3T02 A;  3GTO A;  4WJ4 A;  2JA6 A;  1JOE A;  5JVG S;  5CJ9 A;  4QJV A;  4M1X A;  3EQL A;  1WOP A;  3ERE D;  2CFA A;  3S17 C;  1O28 A;  1O26 A;  4J3N A; 
#chains in the Genus database with same CATH homology
 2VUM K;  2NVX K;  4MEY A;  3FKI C;  4G7O A;  4G7H A;  4C3I C;  4XSX A;  3H0G C;  5FLM C;  4C3I K;  2BE5 A;  3S16 K;  2NVQ C;  3HOY K;  1K83 K;  3RZD C;  3S16 C;  4BXX C;  5FLM K;  2E2I K;  4X6A K;  4XLN A;  4LLG A;  1K83 C;  1Y1V C;  4YFX A;  4X6A C;  4BXX K;  5M5Y K;  4OIO A;  1I6V A;  2NVT K;  3GTO K;  2YU9 K;  4XLP A;  3S1R C;  2WB1 D;  2NVT C;  4A3J C;  3GTK C;  3S1N C;  4C3J C;  1I6H C;  4A93 K;  4A3I K;  5IYB K;  4C2M C;  4OIN A;  4A3J K;  1SFO K;  4C3J K;  4BY1 K;  2B63 K;  3GTQ K;  5IYB C;  4A3L K;  4BY1 C;  2B63 C;  2PMZ D;  4A3D K;  4A3F C;  4AYB D;  4Y7N C;  4A3M K;  2WB1 L;  2E2J C;  4A3L C;  2JA5 K;  3I4N K;  2JA6 C;  3S14 C;  2JA5 C;  3I4N C;  2E2J K;  4YFK A;  3M4O K;  4BBR C;  4Q5S A;  2PPB A;  2R7Z K;  2CW0 A;  4OIR A;  5IP9 K;  3M4O C;  2Y0S L;  3GTP C;  3S2D K;  4Q4Z A;  2O5I A;  4AYB L;  4ZH4 A;  5IP9 C;  3S1Q K;  1YNN A;  4KMU A;  4BBS C;  4OIP A;  5C4J K;  2JA7 C;  3GTG C;  3M3Y C;  1XPP A;  3HOX K;  2A69 A;  1TWG K;  4C3H K;  4A3C K;  3HOZ K;  4C3H C;  1TWG C;  4KN4 A;  5C3E K;  4A3K K;  1Y1W K;  1TWC C;  3I4M K;  2R92 C;  1R9T C;  4A3G K;  5IYD C;  4NOI A;  2NVY K;  1Y1W C;  1ZYR A;  3RZO K;  5IYD K;  2NVY C;  1TWF K;  5C4X K;  3HOV K;  1I50 K;  4YFN A;  1TWH C;  1TWF C;  5C4X C;  5TMC A;  3PO2 C;  3S15 C;  1TWH K;  5C44 K;  1TWA C;  2E2H K;  1YNJ A;  4MQ9 A;  4YG2 A;  3GTJ K;  5C44 C;  2VUM C;  2WAQ D;  1WCM C;  3GTJ C;  4GZY A;  2PA8 D;  3HOW C;  4QJV B;  3S17 K;  3K7A C;  3S2H C;  4KN7 A;  3H0G K;  3HOW K;  2JA8 K;  2NVX C;  3FKI K;  3S2H K;  2E2I C;  1SMY A;  3WOD A;  2Y0S D;  4LK1 A;  1Y1V K;  4G7Z A;  3S1M K;  3HOY C;  2NVQ K;  4LJZ A;  2A68 A;  3RZD K;  1IW7 A;  2R93 K;  3S1M C;  3GTO C;  3S1N K;  5FJ8 K;  3GTK K;  3H3V D;  4BY7 K;  3DXJ A;  4QIW L;  2YU9 C;  3S1R K;  4BY7 C;  4A93 C;  1I6H K;  4A3D C;  4A3I C;  4A3M C;  4Y7N K;  1SFO C;  4C2M K;  3GTQ C;  4A3B K;  3H3V L;  2A6H A;  4A3F K;  4A3B C;  4Y52 C;  5D4D A;  3HKZ L;  3S2D C;  2JA6 K;  3GTP K;  3S14 K;  3S1Q C;  4Y52 K;  1I3Q K;  4BBR K;  4JK1 A;  4XSZ A;  2R7Z C;  3CQZ C;  1I3Q C;  2WAQ L;  2JA7 K;  3GTG K;  2PA8 L;  3M3Y K;  2O5J A;  3CQZ K;  3HKZ D;  2A6E A;  1BDF A;  4OIQ A;  3HOZ C;  4BBS K;  4MEX A;  5C4J C;  3I4M C;  3HOX C;  2R92 K;  4A3C C;  1HQM A;  4LK0 A;  2R93 C;  5M3F K;  4A3E C;  5IYC C;  5C3E C;  4A3K C;  3HOV C;  4A3G C;  1TWC K;  1I50 C;  2PMZ L;  5M5X K;  1R9T K;  4A3E K;  3PO3 C;  5IYC K;  4QJV A;  3PO2 K;  3RZO C;  5M5W K;  5TMF A;  3HOU C;  3PO3 K;  5IP7 K;  3GTM K;  2E2H C;  3EQL A;  1TWA K;  4QIW D;  3GTL C;  3HOU K;  5IP7 C;  3GTM C;  5M3M K;  3S15 K;  1WCM K;  3GTL K;  3S17 C;  3K7A K;  2JA8 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...