3LYWA

Crystal structure of ybbr family protein dhaf_0833 from desulfitobacterium hafniense dcb-2. northeast structural genomics consortium target id dhr29b
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
86
structure length
86
Chain Sequence
RDPTLTLSLIAKNTPANSMIMTKLPSVRVKTEGYNPSINVNELFAYVDLSGSEPGEHDYEVKVEPIPNIKIVEISPRVVTLQLEHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of YbbR family protein Dhaf_0833 from Desulfitobacterium hafniense DCB-2. Northeast Structural Genomics Consortium target id DhR29B
rcsb
source organism Desulfitobacterium hafniense
molecule tags Structural genomics, unknown function
molecule keywords YbbR family protein
total genus 14
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2010-02-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.30 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 RNA Polymerase Alpha Subunit; Chain A, domain 2 3lywA00
2KQ1A 5HQHA 2KPUA 2L5NA 3LYWA 2L3UA
chains in the Genus database with same CATH superfamily
3S1QC 4WFNS 1TWHC 4BBSC 2O5JA 1YNNA 2WB1D 5JVGS 2KXYA 1SFOC 2JA7C 4QJVA 4Y7NC 1Y1VC 2E2IC 3EQLA 3H0GC 2L5NA 2YU9C 2CW0A 2L3UA 3M3YC 3S2HC 4YG2A 2JA6C 4G7HA 1FEUA 4XSZA 4YFXA 1BDFA 3HKZD 4G7ZA 3FKIC 4Q4ZA 4LLGA 3PO2C 5IYDC 4ZH4A 1Y1WC 1I6VA 4WCES 4BXXC 1TWFC 1TWGC 4KN7A 3S15C 3S16C 2A69A 4A93C 4A3LC 4BBRC 5C3EC 2R92C 3GTJC 2WAQD 4OIOA 2NVTC 3GTLC 3S17C 5IYBC 4G7OA 4KN4A 5TMFA 4X6AC 4OINA 5HQHA 3HOUC 4A3FC 2PPBA 4WF9S 3HOYC 3PO3C 4JK1A 4LK1A 4QIWD 3DLLS 2VUMC 3GTMC 3S1RC 1SMYA 4AYBD 4YFKA 4LK0A 4XLPA 4BY1C 5IP7C 3M4OC 4IOAS 2R93C 5DM6S 4GZYA 4YFNA 3GTPC 4LJZA 5IYCC 3I4NC 5HL7S 5C4XC 2A6EA 4MEYA 2ZJPS 4A3DC 4A3JC 4Y52C 2PA8D 4IOCS 3S1MC 3K7AC 2Y0SD 2A68A 2E2HC 2KPUA 2B63C 1IW7A 3LYWA 3GTQC 3HOWC 1I3QC 2BE5A 3WODA 3H3VD 3HOVC 1TWAC 4A3BC 3HOXC 2NVXC 3GTKC 4A3CC 3PIPS 2A6HA 4C3IC 4U67S 2E2JC 3DXJA 3RZOC 5DM7S 4A3IC 4XLNA 1TWCC 4BY7C 4Q5SA 1ZYRA 2NVYC 4IO9S 4MEXA 2O5IA 5D4DA 5C44C 2NVQC 2ZJRS 1R9TC 4OIRA 3S14C 3CQZC 3PIOS 3GTGC 4WFBS 2ZJQS 4C3HC 4OIPA 3GTOC 3I4MC 1I6HC 4A3EC 3S2DC 5C4JC 4MQ9A 2PMZD 4OIQA 4C3JC 2KQ1A 4A3KC 1HQMA 3S1NC 4NOIA 5FLMC 5IP9C 4A3MC 2JA8C 5JVHS 3CF5S 4KMUA 3RZDC 2JA5C 1WCMC 2R7ZC 4WFAS 1I50C 4A3GC 1K83C 4XSXA 1YNJA 4C2MC 5TMCA 3HOZC
chains in the Genus database with same CATH topology
2KQ1A 5HQHA 2KPUA 2L5NA 3LYWA 2L3UA 2KXYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KQ1 A;  5HQH A;  2KPU A;  2L5N A;  3LYW A;  2L3U A; 
#chains in the Genus database with same CATH topology
 3S1Q C;  4WFN S;  1TWH C;  4BBS C;  2O5J A;  1YNN A;  2WB1 D;  5JVG S;  2KXY A;  1SFO C;  2JA7 C;  4QJV A;  4Y7N C;  1Y1V C;  2E2I C;  3EQL A;  3H0G C;  2L5N A;  2YU9 C;  2CW0 A;  2L3U A;  3M3Y C;  3S2H C;  4YG2 A;  2JA6 C;  4G7H A;  1FEU A;  4XSZ A;  4YFX A;  1BDF A;  3HKZ D;  4G7Z A;  3FKI C;  4Q4Z A;  4LLG A;  3PO2 C;  5IYD C;  4ZH4 A;  1Y1W C;  1I6V A;  4WCE S;  4BXX C;  1TWF C;  1TWG C;  4KN7 A;  3S15 C;  3S16 C;  2A69 A;  4A93 C;  4A3L C;  4BBR C;  5C3E C;  2R92 C;  3GTJ C;  2WAQ D;  4OIO A;  2NVT C;  3GTL C;  3S17 C;  5IYB C;  4G7O A;  4KN4 A;  5TMF A;  4X6A C;  4OIN A;  5HQH A;  3HOU C;  4A3F C;  2PPB A;  4WF9 S;  3HOY C;  3PO3 C;  4JK1 A;  4LK1 A;  4QIW D;  3DLL S;  2VUM C;  3GTM C;  3S1R C;  1SMY A;  4AYB D;  4YFK A;  4LK0 A;  4XLP A;  4BY1 C;  5IP7 C;  3M4O C;  4IOA S;  2R93 C;  5DM6 S;  4GZY A;  4YFN A;  3GTP C;  4LJZ A;  5IYC C;  3I4N C;  5HL7 S;  5C4X C;  2A6E A;  4MEY A;  2ZJP S;  4A3D C;  4A3J C;  4Y52 C;  2PA8 D;  4IOC S;  3S1M C;  3K7A C;  2Y0S D;  2A68 A;  2E2H C;  2KPU A;  2B63 C;  1IW7 A;  3LYW A;  3GTQ C;  3HOW C;  1I3Q C;  2BE5 A;  3WOD A;  3H3V D;  3HOV C;  1TWA C;  4A3B C;  3HOX C;  2NVX C;  3GTK C;  4A3C C;  3PIP S;  2A6H A;  4C3I C;  4U67 S;  2E2J C;  3DXJ A;  3RZO C;  5DM7 S;  4A3I C;  4XLN A;  1TWC C;  4BY7 C;  4Q5S A;  1ZYR A;  2NVY C;  4IO9 S;  4MEX A;  2O5I A;  5D4D A;  5C44 C;  2NVQ C;  2ZJR S;  1R9T C;  4OIR A;  3S14 C;  3CQZ C;  3PIO S;  3GTG C;  4WFB S;  2ZJQ S;  4C3H C;  4OIP A;  3GTO C;  3I4M C;  1I6H C;  4A3E C;  3S2D C;  5C4J C;  4MQ9 A;  2PMZ D;  4OIQ A;  4C3J C;  2KQ1 A;  4A3K C;  1HQM A;  3S1N C;  4NOI A;  5FLM C;  5IP9 C;  4A3M C;  2JA8 C;  5JVH S;  3CF5 S;  4KMU A;  3RZD C;  2JA5 C;  1WCM C;  2R7Z C;  4WFA S;  1I50 C;  4A3G C;  1K83 C;  4XSX A;  1YNJ A;  4C2M C;  5TMC A;  3HOZ C; 
#chains in the Genus database with same CATH homology
 2KQ1 A;  5HQH A;  2KPU A;  2L5N A;  3LYW A;  2L3U A;  2KXY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...