3LYWA

Crystal structure of ybbr family protein dhaf_0833 from desulfitobacterium hafniense dcb-2. northeast structural genomics consortium target id dhr29b
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
86
structure length
86
Chain Sequence
RDPTLTLSLIAKNTPANSMIMTKLPSVRVKTEGYNPSINVNELFAYVDLSGSEPGEHDYEVKVEPIPNIKIVEISPRVVTLQLEHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords YbbR family protein
publication title Crystal structure of YbbR family protein Dhaf_0833 from Desulfitobacterium hafniense DCB-2. Northeast Structural Genomics Consortium target id DhR29B
rcsb
source organism Desulfitobacterium hafniense
molecule tags Structural genomics, unknown function
total genus 14
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2010-02-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.30 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 RNA Polymerase Alpha Subunit; Chain A, domain 2 3lywA00
3LYWA 2L5NA 2KPUA 5HQHA 2KQ1A 2L3UA
chains in the Genus database with same CATH superfamily
4OIQA 4Y52C 3LYWA 2O5JA 3GTGC 3RZOC 1ZYRA 4A3CC 4U67S 1R9TC 4C3JC 4XSZA 4LK0A 2L5NA 4A3LC 4KMUA 2E2JC 4QJVA 3HOXC 3GTKC 4A3BC 4BBRC 2JA6C 3HKZD 4MEYA 4A3IC 3S1NC 4WCES 4A3GC 5DM7S 4LLGA 4YFXA 4YFKA 2KXYA 4IOCS 2A6EA 4AYBD 2WB1D 4Y7NC 4Q4ZA 3HOWC 4KN7A 3WODA 4A3MC 1I6VA 4A93C 1WCMC 3S1MC 5FLMC 4BBSC 3M3YC 4X6AC 2NVYC 4ZH4A 2JA5C 2E2IC 2A69A 2B63C 3S15C 1I3QC 3S17C 3HOYC 3I4MC 2ZJQS 3HOVC 2Y0SD 5IP9C 5HQHA 3S2HC 4A3EC 2A68A 5D4DA 2PMZD 1YNNA 3GTJC 3GTPC 5JVGS 4XLPA 4MEXA 3GTLC 4WFNS 4OIOA 5IYCC 1TWFC 4Q5SA 3S1RC 2E2HC 2R92C 1FEUA 2PPBA 3S2DC 3CQZC 3H0GC 2NVQC 3I4NC 1TWCC 2NVTC 4GZYA 1TWAC 1SFOC 3S14C 2YU9C 4QIWD 3M4OC 3RZDC 3S1QC 3K7AC 5HL7S 5TMFA 3H3VD 4WF9S 2ZJPS 5C4JC 5TMCA 4XSXA 3HOZC 4OIRA 3CF5S 5DM6S 3PIOS 2PA8D 2O5IA 4KN4A 2KPUA 5IYBC 4IO9S 4G7OA 5C4XC 2JA8C 1YNJA 4IOAS 2R7ZC 4G7ZA 4A3KC 2JA7C 5IYDC 3PO2C 3EQLA 1I6HC 3DXJA 3GTQC 4XLNA 2BE5A 5IP7C 2VUMC 1TWHC 1I50C 3PIPS 2KQ1A 2L3UA 4C3IC 4A3DC 4BXXC 3HOUC 1TWGC 3S16C 1Y1WC 4BY7C 1HQMA 4YG2A 2R93C 1SMYA 4LK1A 4BY1C 3GTMC 4YFNA 5C44C 4OIPA 5C3EC 2NVXC 1K83C 4LJZA 1Y1VC 4NOIA 3FKIC 4OINA 2WAQD 1IW7A 4JK1A 1BDFA 5JVHS 4A3FC 4C3HC 4A3JC 3PO3C 4C2MC 4G7HA 2CW0A 4WFAS 2A6HA 4MQ9A 3DLLS 2ZJRS 4WFBS 3GTOC
chains in the Genus database with same CATH topology
3LYWA 2KXYA 2L5NA 2KPUA 5HQHA 2KQ1A 2L3UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LYW A;  2L5N A;  2KPU A;  5HQH A;  2KQ1 A;  2L3U A; 
#chains in the Genus database with same CATH topology
 4OIQ A;  4Y52 C;  3LYW A;  2O5J A;  3GTG C;  3RZO C;  1ZYR A;  4A3C C;  4U67 S;  1R9T C;  4C3J C;  4XSZ A;  4LK0 A;  2L5N A;  4A3L C;  4KMU A;  2E2J C;  4QJV A;  3HOX C;  3GTK C;  4A3B C;  4BBR C;  2JA6 C;  3HKZ D;  4MEY A;  4A3I C;  3S1N C;  4WCE S;  4A3G C;  5DM7 S;  4LLG A;  4YFX A;  4YFK A;  2KXY A;  4IOC S;  2A6E A;  4AYB D;  2WB1 D;  4Y7N C;  4Q4Z A;  3HOW C;  4KN7 A;  3WOD A;  4A3M C;  1I6V A;  4A93 C;  1WCM C;  3S1M C;  5FLM C;  4BBS C;  3M3Y C;  4X6A C;  2NVY C;  4ZH4 A;  2JA5 C;  2E2I C;  2A69 A;  2B63 C;  3S15 C;  1I3Q C;  3S17 C;  3HOY C;  3I4M C;  2ZJQ S;  3HOV C;  2Y0S D;  5IP9 C;  5HQH A;  3S2H C;  4A3E C;  2A68 A;  5D4D A;  2PMZ D;  1YNN A;  3GTJ C;  3GTP C;  5JVG S;  4XLP A;  4MEX A;  3GTL C;  4WFN S;  4OIO A;  5IYC C;  1TWF C;  4Q5S A;  3S1R C;  2E2H C;  2R92 C;  1FEU A;  2PPB A;  3S2D C;  3CQZ C;  3H0G C;  2NVQ C;  3I4N C;  1TWC C;  2NVT C;  4GZY A;  1TWA C;  1SFO C;  3S14 C;  2YU9 C;  4QIW D;  3M4O C;  3RZD C;  3S1Q C;  3K7A C;  5HL7 S;  5TMF A;  3H3V D;  4WF9 S;  2ZJP S;  5C4J C;  5TMC A;  4XSX A;  3HOZ C;  4OIR A;  3CF5 S;  5DM6 S;  3PIO S;  2PA8 D;  2O5I A;  4KN4 A;  2KPU A;  5IYB C;  4IO9 S;  4G7O A;  5C4X C;  2JA8 C;  1YNJ A;  4IOA S;  2R7Z C;  4G7Z A;  4A3K C;  2JA7 C;  5IYD C;  3PO2 C;  3EQL A;  1I6H C;  3DXJ A;  3GTQ C;  4XLN A;  2BE5 A;  5IP7 C;  2VUM C;  1TWH C;  1I50 C;  3PIP S;  2KQ1 A;  2L3U A;  4C3I C;  4A3D C;  4BXX C;  3HOU C;  1TWG C;  3S16 C;  1Y1W C;  4BY7 C;  1HQM A;  4YG2 A;  2R93 C;  1SMY A;  4LK1 A;  4BY1 C;  3GTM C;  4YFN A;  5C44 C;  4OIP A;  5C3E C;  2NVX C;  1K83 C;  4LJZ A;  1Y1V C;  4NOI A;  3FKI C;  4OIN A;  2WAQ D;  1IW7 A;  4JK1 A;  1BDF A;  5JVH S;  4A3F C;  4C3H C;  4A3J C;  3PO3 C;  4C2M C;  4G7H A;  2CW0 A;  4WFA S;  2A6H A;  4MQ9 A;  3DLL S;  2ZJR S;  4WFB S;  3GTO C; 
#chains in the Genus database with same CATH homology
 3LYW A;  2KXY A;  2L5N A;  2KPU A;  5HQH A;  2KQ1 A;  2L3U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...