3LYWA

Crystal structure of ybbr family protein dhaf_0833 from desulfitobacterium hafniense dcb-2. northeast structural genomics consortium target id dhr29b
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
86
structure length
86
Chain Sequence
b'RDPTLTLSLIAKNTPANSMIMTKLPSVRVKTEGYNPSINVNELFAYVDLSGSEPGEHDYEVKVEPIPNIKIVEISPRVVTLQLEHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords YbbR family protein
publication title Crystal structure of YbbR family protein Dhaf_0833 from Desulfitobacterium hafniense DCB-2. Northeast Structural Genomics Consortium target id DhR29B
rcsb
source organism Desulfitobacterium hafniense
molecule tags Structural genomics, unknown function
total genus 14
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2010-02-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.30 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 RNA Polymerase Alpha Subunit; Chain A, domain 2 3lywA00
2L3UA 2KQ1A 5HQHA 3LYWA 2L5NA 2KPUA
chains in the Genus database with same CATH superfamily
5IP7C 1IW7A 4X6AC 4AYBD 2B63C 2Y0SD 3H0GC 4IOCS 2WB1D 3GTKC 1BDFA 3RZOC 1YNNA 3I4MC 2A68A 1WCMC 3M3YC 3PO3C 3S1NC 3HOVC 3K7AC 4A3JC 2A69A 5FLMC 2ZJPS 2KQ1A 1TWCC 2NVQC 3S1RC 3H3VD 1I3QC 4KN4A 3HOYC 4WFNS 3GTOC 3HKZD 2WAQD 2L3UA 1R9TC 2ZJQS 2E2JC 4QIWD 3CQZC 1ZYRA 5TMCA 4XLPA 3GTPC 2KPUA 2ZJRS 3PO2C 4OIQA 1TWHC 2KXYA 4Y7NC 4WCES 5C4JC 4A3EC 1FEUA 3FKIC 3I4NC 3HOZC 4A3GC 4XSXA 5IYBC 5D4DA 5DM6S 3DLLS 2A6HA 3GTLC 4IO9S 4A93C 4A3CC 3S1QC 4LK1A 5HL7S 2L5NA 4KMUA 2YU9C 4A3IC 2E2IC 4BY7C 1I50C 1SMYA 4XSZA 3RZDC 4MEYA 3GTGC 4A3KC 1HQMA 4JK1A 1Y1VC 2R92C 4IOAS 2E2HC 2CW0A 5DM7S 4YG2A 2PA8D 4OIRA 4WFBS 2VUMC 2R93C 3S14C 5JVHS 1Y1WC 2JA6C 2JA7C 1I6HC 4G7ZA 3M4OC 5IYCC 3HOUC 4BBRC 1TWFC 4LK0A 4A3LC 1I6VA 4G7HA 2JA8C 1K83C 3S17C 4Y52C 4Q4ZA 3S16C 4BBSC 2NVYC 2NVTC 4C2MC 4NOIA 4KN7A 4MQ9A 2R7ZC 4C3IC 4MEXA 4G7OA 3S2DC 4LJZA 3CF5S 3EQLA 4Q5SA 4ZH4A 3S15C 4C3JC 3S1MC 2O5IA 3PIPS 3GTQC 3HOWC 5IYDC 3GTMC 4A3BC 3S2HC 4OIPA 4YFNA 4XLNA 4WF9S 4YFKA 1YNJA 5C44C 3PIOS 4U67S 4A3DC 4GZYA 4YFXA 3WODA 4A3MC 4BY1C 2BE5A 5C4XC 5TMFA 2O5JA 2JA5C 2A6EA 1SFOC 4QJVA 4C3HC 3HOXC 1TWAC 2PMZD 4WFAS 5HQHA 1TWGC 3LYWA 5JVGS 3DXJA 5IP9C 2NVXC 4OIOA 5C3EC 4LLGA 4OINA 4BXXC 3GTJC 4A3FC 2PPBA
chains in the Genus database with same CATH topology
2L3UA 2KQ1A 2KXYA 5HQHA 3LYWA 2L5NA 2KPUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L3U A;  2KQ1 A;  5HQH A;  3LYW A;  2L5N A;  2KPU A; 
#chains in the Genus database with same CATH topology
 5IP7 C;  1IW7 A;  4X6A C;  4AYB D;  2B63 C;  2Y0S D;  3H0G C;  4IOC S;  2WB1 D;  3GTK C;  1BDF A;  3RZO C;  1YNN A;  3I4M C;  2A68 A;  1WCM C;  3M3Y C;  3PO3 C;  3S1N C;  3HOV C;  3K7A C;  4A3J C;  2A69 A;  5FLM C;  2ZJP S;  2KQ1 A;  1TWC C;  2NVQ C;  3S1R C;  3H3V D;  1I3Q C;  4KN4 A;  3HOY C;  4WFN S;  3GTO C;  3HKZ D;  2WAQ D;  2L3U A;  1R9T C;  2ZJQ S;  2E2J C;  4QIW D;  3CQZ C;  1ZYR A;  5TMC A;  4XLP A;  3GTP C;  2KPU A;  2ZJR S;  3PO2 C;  4OIQ A;  1TWH C;  2KXY A;  4Y7N C;  4WCE S;  5C4J C;  4A3E C;  1FEU A;  3FKI C;  3I4N C;  3HOZ C;  4A3G C;  4XSX A;  5IYB C;  5D4D A;  5DM6 S;  3DLL S;  2A6H A;  3GTL C;  4IO9 S;  4A93 C;  4A3C C;  3S1Q C;  4LK1 A;  5HL7 S;  2L5N A;  4KMU A;  2YU9 C;  4A3I C;  2E2I C;  4BY7 C;  1I50 C;  1SMY A;  4XSZ A;  3RZD C;  4MEY A;  3GTG C;  4A3K C;  1HQM A;  4JK1 A;  1Y1V C;  2R92 C;  4IOA S;  2E2H C;  2CW0 A;  5DM7 S;  4YG2 A;  2PA8 D;  4OIR A;  4WFB S;  2VUM C;  2R93 C;  3S14 C;  5JVH S;  1Y1W C;  2JA6 C;  2JA7 C;  1I6H C;  4G7Z A;  3M4O C;  5IYC C;  3HOU C;  4BBR C;  1TWF C;  4LK0 A;  4A3L C;  1I6V A;  4G7H A;  2JA8 C;  1K83 C;  3S17 C;  4Y52 C;  4Q4Z A;  3S16 C;  4BBS C;  2NVY C;  2NVT C;  4C2M C;  4NOI A;  4KN7 A;  4MQ9 A;  2R7Z C;  4C3I C;  4MEX A;  4G7O A;  3S2D C;  4LJZ A;  3CF5 S;  3EQL A;  4Q5S A;  4ZH4 A;  3S15 C;  4C3J C;  3S1M C;  2O5I A;  3PIP S;  3GTQ C;  3HOW C;  5IYD C;  3GTM C;  4A3B C;  3S2H C;  4OIP A;  4YFN A;  4XLN A;  4WF9 S;  4YFK A;  1YNJ A;  5C44 C;  3PIO S;  4U67 S;  4A3D C;  4GZY A;  4YFX A;  3WOD A;  4A3M C;  4BY1 C;  2BE5 A;  5C4X C;  5TMF A;  2O5J A;  2JA5 C;  2A6E A;  1SFO C;  4QJV A;  4C3H C;  3HOX C;  1TWA C;  2PMZ D;  4WFA S;  5HQH A;  1TWG C;  3LYW A;  5JVG S;  3DXJ A;  5IP9 C;  2NVX C;  4OIO A;  5C3E C;  4LLG A;  4OIN A;  4BXX C;  3GTJ C;  4A3F C;  2PPB A; 
#chains in the Genus database with same CATH homology
 2L3U A;  2KQ1 A;  2KXY A;  5HQH A;  3LYW A;  2L5N A;  2KPU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...