3LYWA

Crystal structure of ybbr family protein dhaf_0833 from desulfitobacterium hafniense dcb-2. northeast structural genomics consortium target id dhr29b
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
86
structure length
86
Chain Sequence
RDPTLTLSLIAKNTPANSMIMTKLPSVRVKTEGYNPSINVNELFAYVDLSGSEPGEHDYEVKVEPIPNIKIVEISPRVVTLQLEHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords YbbR family protein
publication title Crystal structure of YbbR family protein Dhaf_0833 from Desulfitobacterium hafniense DCB-2. Northeast Structural Genomics Consortium target id DhR29B
rcsb
source organism Desulfitobacterium hafniense
total genus 14
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2010-02-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.30 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 RNA Polymerase Alpha Subunit; Chain A, domain 2 3lywA00
2KPUA 5HQHA 2L3UA 3LYWA 2KQ1A 2L5NA
chains in the Genus database with same CATH superfamily
2KPUA 2NVYC 4KMUA 4IO9S 3S2DC 4A3JC 2YU9C 5DM7S 4Y52C 1Y1WC 2E2HC 4WCES 4BY7C 4A3CC 2O5JA 3RZDC 2PMZD 4BY1C 2PA8D 4LLGA 4OIPA 4U67S 3CF5S 2NVQC 4MEXA 1Y1VC 2PPBA 4XLPA 3HOZC 4OIOA 4QIWD 4WFNS 4A3IC 2O5IA 4A93C 4LJZA 5D4DA 3HOUC 3GTPC 4YFXA 5C44C 2JA6C 3PIPS 4LK1A 2CW0A 4G7HA 4MEYA 5TMFA 3S1MC 2R93C 3HOWC 4X6AC 3S15C 1TWHC 4Q5SA 1TWGC 4BBSC 1I3QC 2JA5C 2NVXC 4XSZA 5FLMC 2ZJRS 4OINA 3RZOC 3PO2C 1FEUA 5JVGS 3LYWA 3GTQC 2E2JC 2A6EA 4IOAS 3S1NC 2WB1D 4G7OA 4A3FC 4WF9S 3S16C 4YFKA 1ZYRA 2BE5A 4LK0A 5IYCC 5IYDC 3I4MC 3I4NC 1R9TC 2VUMC 4C3IC 5DM6S 4BXXC 2Y0SD 4NOIA 4ZH4A 2NVTC 3CQZC 1IW7A 4Y7NC 2KQ1A 5C3EC 3HOVC 2A68A 1SMYA 5HQHA 5IYBC 4C2MC 3S1QC 2A69A 1K83C 3PIOS 3GTJC 1YNNA 4BBRC 2ZJPS 4KN7A 3S17C 5C4JC 2KXYA 4JK1A 4KN4A 2JA8C 2JA7C 3WODA 4XSXA 2L3UA 4A3MC 5IP7C 3GTLC 3DXJA 1TWFC 2WAQD 1SFOC 4OIQA 3HOYC 1I6HC 3GTMC 1TWCC 4MQ9A 1WCMC 4WFBS 2E2IC 2R92C 3H3VD 4OIRA 3M3YC 2ZJQS 2A6HA 3PO3C 3S2HC 2R7ZC 1HQMA 4XLNA 2B63C 4GZYA 5HL7S 3DLLS 2L5NA 3M4OC 3HOXC 1YNJA 4AYBD 4IOCS 4A3EC 3GTOC 4Q4ZA 4C3HC 3K7AC 3H0GC 5IP9C 4YG2A 3S14C 1BDFA 4A3BC 3GTGC 4A3DC 3S1RC 3FKIC 4A3KC 4C3JC 5JVHS 4QJVA 4A3GC 5C4XC 4YFNA 1TWAC 3EQLA 5TMCA 3GTKC 1I50C 4A3LC 4G7ZA 3HKZD 4WFAS 1I6VA
chains in the Genus database with same CATH topology
2KPUA 5HQHA 2KXYA 2L3UA 3LYWA 2KQ1A 2L5NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KPU A;  5HQH A;  2L3U A;  3LYW A;  2KQ1 A;  2L5N A; 
#chains in the Genus database with same CATH topology
 2KPU A;  2NVY C;  4KMU A;  4IO9 S;  3S2D C;  4A3J C;  2YU9 C;  5DM7 S;  4Y52 C;  1Y1W C;  2E2H C;  4WCE S;  4BY7 C;  4A3C C;  2O5J A;  3RZD C;  2PMZ D;  4BY1 C;  2PA8 D;  4LLG A;  4OIP A;  4U67 S;  3CF5 S;  2NVQ C;  4MEX A;  1Y1V C;  2PPB A;  4XLP A;  3HOZ C;  4OIO A;  4QIW D;  4WFN S;  4A3I C;  2O5I A;  4A93 C;  4LJZ A;  5D4D A;  3HOU C;  3GTP C;  4YFX A;  5C44 C;  2JA6 C;  3PIP S;  4LK1 A;  2CW0 A;  4G7H A;  4MEY A;  5TMF A;  3S1M C;  2R93 C;  3HOW C;  4X6A C;  3S15 C;  1TWH C;  4Q5S A;  1TWG C;  4BBS C;  1I3Q C;  2JA5 C;  2NVX C;  4XSZ A;  5FLM C;  2ZJR S;  4OIN A;  3RZO C;  3PO2 C;  1FEU A;  5JVG S;  3LYW A;  3GTQ C;  2E2J C;  2A6E A;  4IOA S;  3S1N C;  2WB1 D;  4G7O A;  4A3F C;  4WF9 S;  3S16 C;  4YFK A;  1ZYR A;  2BE5 A;  4LK0 A;  5IYC C;  5IYD C;  3I4M C;  3I4N C;  1R9T C;  2VUM C;  4C3I C;  5DM6 S;  4BXX C;  2Y0S D;  4NOI A;  4ZH4 A;  2NVT C;  3CQZ C;  1IW7 A;  4Y7N C;  2KQ1 A;  5C3E C;  3HOV C;  2A68 A;  1SMY A;  5HQH A;  5IYB C;  4C2M C;  3S1Q C;  2A69 A;  1K83 C;  3PIO S;  3GTJ C;  1YNN A;  4BBR C;  2ZJP S;  4KN7 A;  3S17 C;  5C4J C;  2KXY A;  4JK1 A;  4KN4 A;  2JA8 C;  2JA7 C;  3WOD A;  4XSX A;  2L3U A;  4A3M C;  5IP7 C;  3GTL C;  3DXJ A;  1TWF C;  2WAQ D;  1SFO C;  4OIQ A;  3HOY C;  1I6H C;  3GTM C;  1TWC C;  4MQ9 A;  1WCM C;  4WFB S;  2E2I C;  2R92 C;  3H3V D;  4OIR A;  3M3Y C;  2ZJQ S;  2A6H A;  3PO3 C;  3S2H C;  2R7Z C;  1HQM A;  4XLN A;  2B63 C;  4GZY A;  5HL7 S;  3DLL S;  2L5N A;  3M4O C;  3HOX C;  1YNJ A;  4AYB D;  4IOC S;  4A3E C;  3GTO C;  4Q4Z A;  4C3H C;  3K7A C;  3H0G C;  5IP9 C;  4YG2 A;  3S14 C;  1BDF A;  4A3B C;  3GTG C;  4A3D C;  3S1R C;  3FKI C;  4A3K C;  4C3J C;  5JVH S;  4QJV A;  4A3G C;  5C4X C;  4YFN A;  1TWA C;  3EQL A;  5TMC A;  3GTK C;  1I50 C;  4A3L C;  4G7Z A;  3HKZ D;  4WFA S;  1I6V A; 
#chains in the Genus database with same CATH homology
 2KPU A;  5HQH A;  2KXY A;  2L3U A;  3LYW A;  2KQ1 A;  2L5N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...