2BE5A

Crystal structure of the t. thermophilus rna polymerase holoenzyme in complex with inhibitor tagetitoxin
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
229
structure length
229
Chain Sequence
MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for transcription inhibition by tagetitoxin
pubmed doi rcsb
molecule tags Transferase
molecule keywords DNA-directed RNA polymerase alpha chain
total genus 42
structure length 229
sequence length 229
chains with identical sequence B, K, L
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2005-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01000 RNA_pol_A_bac RNA polymerase Rpb3/RpoA insert domain
A PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain
A PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.12 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 DNA-directed RNA polymerase, insert domain 2be5A02
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 2be5A01
5C4JC 2E2HC 2BE5A 2JA8C 3GTQC 4GZYA 1TWGC 3HOWC 3HOUC 4A3GC 3FKIC 5IYBC 3S16C 3H0GK 2NVQK 2R7ZC 3GTOK 4C3HC 3I4NK 4OIQA 4QJVA 2E2IC 2A68A 5C3EC 2B63C 3S1NC 2WAQD 1XPPA 3S17K 3RZDK 4Y52K 3GTMK 1Y1VC 4G7HA 3HOXK 2JA7C 4A3JK 2NVYC 4MQ9A 3S15C 4BBSC 2YU9K 4KMUA 2R92K 5D4DA 3PO2K 2PPBA 3RZOC 5IYCC 3S1MK 3PO3C 3S2DK 3HOYC 4KN7A 2A69A 3GTPK 4X6AC 1R9TC 1R9TK 1SFOC 4QJVB 2Y0SL 4G7OA 1SMYA 4YFKA 4C2MK 3HOYK 3M3YC 1ZYRA 2O5IA 3CQZK 5M3MK 4A3CK 2R92C 4BY7C 4KN4A 3S15K 4YG2A 4BY1K 3GTMC 1YNJA 3HOVC 4MEXA 4Y52C 3S1NK 4A3EK 3DXJA 2NVXK 4C3HK 2R7ZK 3H0GC 3I4NC 2JA5C 3FKIK 5IYBK 2VUMK 3S16K 3HOUK 4A3GK 5C44C 1TWHK 5C4JK 2E2HK 4C3IC 4A3FC 4A93C 5IP9C 5FLMK 5M5WK 2A6EA 4XSZA 3S1RK 4OINA 1K83K 4A3LC 3GTKC 3GTJK 1TWAC 1I6HC 3S2HC 2R93C 1Y1WK 2JA6K 4Y7NC 3GTGK 4BBRK 5C4XK 4A3MC 2E2JC 3K7AC 4A3KC 3HKZL 4OIRA 4C3JK 5IP7C 3HOZK 2WB1D 1TWFK 3S1QK 3S1QC 3PO2C 5IP7K 5IYDK 3HOZC 5M5XK 1BDFA 4A3MK 4BBRC 4XSXA 1HQMA 2NVTC 2JA6C 4ZH4A 3S2HK 4BXXC 4A3IC 1TWAK 3GTJC 2WAQL 4A3LK 2A6HA 2CW0A 3S1RC 5IP9K 3I4MK 1WCMK 4C3IK 4A3FK 3GTLK 1IW7A 3S14C 2PA8D 4G7ZA 4A3DK 1I3QC 1TWHC 5C44K 4YFXA 2PA8L 2VUMC 1TWCC 4YFNA 2JA5K 3M4OK 1I50C 2NVXC 4LK1A 2PMZD 4A3EC 2Y0SD 1I50K 4LJZA 4OIPA 4XLNA 4BY1C 3M4OC 1TWCK 3HOVK 4A3BK 5M3FK 4BY7K 1I3QK 4A3CC 4LLGA 4A3DC 4AYBL 5M5YK 3CQZC 3S14K 3M3YK 4XLPA 4C2MC 1WCMC 3GTLC 3I4MC 2WB1L 3HKZD 4Q5SA 1SFOK 3H3VL 4X6AK 4QIWD 4A3IK 3GTPC 3WODA 4BXXK 3S2DC 3PO3K 4QIWL 5IYCK 3S1MC 2NVTK 3RZOK 3H3VD 4BBSK 4MEYA 5IYDC 2YU9C 2NVYK 1YNNA 1TWFC 4OIOA 3HOXC 4A3JC 4A3BC 1Y1VK 4C3JC 2JA7K 3K7AK 3RZDC 4A3KK 2E2JK 5C4XC 3GTGC 3S17C 4Q4ZA 5C3EK 5FJ8K 4Y7NK 1Y1WC 2E2IK 2B63K 5TMFA 3GTOC 1I6VA 1I6HK 2R93K 2NVQC 4LK0A 3EQLA 3GTKK 3HOWK 4AYBD 1TWGK 2O5JA 1K83C 4NOIA 2PMZL 2JA8K 3GTQK 5FLMC 4A93K 5TMCA 4JK1A
chains in the Genus database with same CATH superfamily
3AQPA 2BE5A 3GTPA 3TFIA 4A3GC 3I4NK 1Y1VA 2R7ZC 4LQYA 4FM9A 4QJVA 1C0AA 2RGRA 4Y52K 2WAQD 1J6WA 1Y1VC 3CAGA 1G51A 1EQRA 5D4DA 2PPBA 3RZOC 3S1MK 1XZQB 3HOYC 1WOOA 1FEUA 3GTPK 4X6AC 4IO9S 1XZQA 2GAHC 1SFOC 4G7OA 4XCHA 3HOYK 1ZYRA 1PJ7A 2O5IA 3CQZK 3FOEA 1INNA 1R9TA 4YG2A 4IOAS 4Y52C 3FHZA 3OEPA 4A3EK 2R7ZK 3I4NC 1SFOA 5CJ9A 4A3GK 4KM9A 3GSIA 1B4BA 1WQHA 4A3FC 4A93C 1X31C 2A6EA 1ZBSA 5M5WK 3S1RK 4KARA 3CQZA 4Y7NC 1WORA 5C4XK 4P9SA 2WB1D 4KB2A 4DDQA 4XSXA 1HQMA 4P5AA 3TFJA 2V6SA 4KMDA 2JH3A 2FQOA 2A6HA 1F9NA 4WCES 1EK8A 2KPUA 3S1RC 4A3FK 4BLBA 1IW7A 3GEIA 4GTDA 3S0XA 4G0VA 1I3QC 4WFAS 3M4OK 4KMHA 5IOSA 1I50C 4A3EC 4G0UA 2V6TA 4BLAA 5HQHA 1WOSA 3CQZC 2E2IA 4GTLA 1WCMC 3GTLC 2JA6A 1IS1A 1SFOK 3H3VL 4WFNS 4X6AK 2CFAB 3GTPC 4BXXK 3A8IA 3OREA 5TJ3A 3S1MC 2NVTK 3RZOK 3H3VD 3PO2K 2XCQA 1TWAA 5JFEA 1TWFC 1Y1VK 4C3JC 4A3KK 2ZUFA 4Q4ZA 4KATA 3EQLA 4LOWA 1JVIA 3ERED 4GZYA 3GTGA 1TWGC 1WOPA 3HOUC 4BKWA 5IYBC 2NVQK 1IL2A 2A68A 1WSVA 3GIRA 3RZDK 4J3NA 3A8JA 4A3JK 4BBSC 4MQ9A 1O29A 4KMUA 1XXBA 3SZZA 3LYWA 1BGWA 3T01A 1TWFA 1DCPA 1R9TC 2FQTA 4QJVB 5JVGS 3BP8C 4C2MK 3M3YC 1Y1WA 2P8TA 4A3CK 2R92C 3TTGA 3S15K 3N0BA 3BUEA 1YNJA 4U67S 3HOVC 3ADAC 3S1NK 3CF5S 1ISEA 1GE9A 2NVXK 4C3HK 3FKIK 1JOEA 2P5MA 1K83A 4GTFA 1XZPB 4AH6A 5C4JK 4WJ4A 2NVXA 5IP9C 3DLLS 1WSRA 1XXAA 1O28A 4GTCA 1EFWA 3S2HC 2R93C 1BJTA 1Y1WK 2JA6K 3GTGK 4BBRK 2E2JC 3K7AC 3HOZK 5IYDK 4A3MK 4ZH4A 5IORA 2GSUA 1EI6A 3GTJC 1YX2A 2L5NA 1TWHA 2WAQL 2GSOA 1F7UA 4A3LK 3Q3QA 2CW0A 3I4MK 2PA8D 4G7ZA 1HI9A 1TWCC 2PMZD 4OIPA 4BY1C 4BY7K 4KB4A 4AYBL 4A3DC 5M5YK 3SZYA 3S14K 2B63A 2WB1L 4O2DA 4QIWD 2NVYA 4KASA 4A3IK 2E2HA 2JA5A 5EGHA 3BP3A 4MEYA 4PABA 1YNNA 2JA7K 4WF9S 5C3EK 2E2IK 3GTOC 1I6HK 3GTKK 4AYBD 2O5JA 1K83C 3GTQK 1L0WA 4C45A 5FLMC 3N0CA 1RU0A 5TMCA 3PIPS 2E2HC 3NUHA 2JA8C 3G4AA 3MMLB 3HOWC 2JA7A 3S16C 4KM8A 3H0GK 2R92A 3VA7A 4OIQA 2B63C 3S17K 3JSTA 3GTMK 3PIOS 4G7HA 3FKIA 3HOXK 2NVYC 2YU9K 3AQOA 4A3BK 4ILDA 5IYCC 3PO3C 2KQ1A 3S2DK 4KN7A 2A69A 2PHCB 3A8KA 3OPFA 3AD9C 2Y0SL 4GTEA 4YFKA 1WQGA 1F7VA 1VJEA 5M3MK 3GEEA 1TWGA 3GTMC 2W7VA 4RMFA 4MEXA 1IQ0A 3H0GC 3S16K 2JA5C 2VUMK 4M1XA 1IBAA 1VLOA 1XXCA 5C44C 1TWHK 1USMA 2E2HK 4C3IC 1IE0A 5FLMK 4OINA 1K83K 4G0WA 3GTKC 5JVHS 1TWAC 4KDDA 3TFHA 1I6HC 2D6FC 3HKZL 4GFQA 5IP7C 3S1QK 3S1QC 5IP7K 5EGEA 5M5XK 1BDFA 3GTQA 5CHPA 1AB4A 4GT9A 2VUMA 4A3IC 1TWAK 3V4GA 2YU9A 4C3IK 3QX3A 3S14C 4WJ3M 5DM7S 4A3DK 1TWHC 5C44K 2VUMC 4YFNA 2JA5K 1DCHA 3IPJA 4LJZA 1TWCK 3LPXA 5M3FK 1XZPA 3GTKA 4LLGA 3I4MC 4PAAA 3GTMA 4Q5SA 3WODA 2KWAA 1V5VA 5IOQA 3S2DC 3PO3K 5IYCK 1WIHA 5IYDC 2NVYK 2YU9C 4A3BC 4OIOA 3HOXC 3H0GA 3K7AK 2E2JK 3GTGC 3S17C 2B63K 1Y1WC 5TMFA 2R93K 1I6VA 2V6UA 4WILA 4LK0A 3HOWK 1PJ5A 4NOIA 2JA8K 1YCLA 1J6XA 5DM6S 5C4JC 3GTQC 3FKIC 1J6VA 1EH1A 4C3HC 3GTOK 2E2IC 5C3EC 3S1NC 1XPPA 2JA7C 3S15C 2R92K 1ZXOA 3GTOA 1PJ6A 1DCOA 1R9TK 3FOFA 1O25A 3AH5A 1VGXA 3N3YA 1I3QA 5HL7S 1SMYA 3T00A 1O27A 3GDZA 3T02A 4WFBS 1F93A 4BY7C 4KN4A 3LAPA 4GTBA 3GTJA 2ZJPS 2GSNA 2CFAA 4BY1K 1O2FB 5L46A 4FZBA 2RH6A 3DXJA 1BS2A 5IYBK 3GEHA 5IOTA 3HOUK 1DD5A 4LR2A 1O24A 1WCMA 3GTLA 4XSZA 4A3LC 3GTJK 1O2BA 4KMAA 4KAWX 4A3MC 1ZVUA 4A3KC 1I50A 4C3JK 4OIRA 1UV7A 1TWFK 3PO2C 4IOCS 3L4KA 3HOZC 4BBRC 2NVTC 2JA6C 1ZQ1C 3S2HK 2KXYA 4BXXC 3L4JA 2GAGC 1B4AA 3HXAA 2L3UA 5IP9K 1WCMK 3LAJA 1KQ4A 3GTLK 1O2AA 4YFXA 3AD8C 2PA8L 2NVXC 4LK1A 2Y0SD 4P5BA 1I50K 4XLNA 3M4OC 5E68A 3HOVK 3AD7C 1I3QK 4A3CC 1USOA 3M3YK 1WQFA 2R93A 4XLPA 4C2MC 5HL8A 1TWCA 3HKZD 1VRQC 2XCOA 1JQWA 2ZJRS 4QIWL 5JVOA 1J98A 4GTAA 2EBBA 2ZUEA 2Y3PA 4BBSK 2R7ZA 2XCRB 4A3JC 4KC6A 3RZDC 5C4XC 4Y7NK 5FJ8K 1O26A 2NVQC 3G4CA 1TWGK 2ZJQS 2PMZL 4A93K 2ZFZA 1VH2A 4JK1A
chains in the Genus database with same CATH topology
5C4JC 2E2HC 2BE5A 2JA8C 3GTQC 4GZYA 1TWGC 3HOWC 3HOUC 4A3GC 3FKIC 5IYBC 3S16C 3H0GK 2NVQK 2R7ZC 3GTOK 4C3HC 3I4NK 4OIQA 4QJVA 2E2IC 2A68A 5C3EC 2B63C 3S1NC 2WAQD 1XPPA 3S17K 3RZDK 4Y52K 3GTMK 1Y1VC 4G7HA 3HOXK 2JA7C 4A3JK 2NVYC 4MQ9A 3S15C 4BBSC 2YU9K 4KMUA 2R92K 5D4DA 3PO2K 2PPBA 3RZOC 5IYCC 3S1MK 3PO3C 3S2DK 3HOYC 4KN7A 2A69A 3GTPK 4X6AC 1R9TC 1R9TK 1SFOC 4QJVB 2Y0SL 4G7OA 1SMYA 4YFKA 4C2MK 3HOYK 3M3YC 1ZYRA 2O5IA 3CQZK 5M3MK 4A3CK 2R92C 4BY7C 4KN4A 3S15K 4YG2A 4BY1K 3GTMC 1YNJA 3HOVC 4MEXA 4Y52C 3S1NK 4A3EK 3DXJA 2NVXK 4C3HK 2R7ZK 3H0GC 3I4NC 2JA5C 3FKIK 5IYBK 2VUMK 3S16K 3HOUK 4A3GK 5C44C 1TWHK 5C4JK 2E2HK 4C3IC 4A3FC 4A93C 5IP9C 5FLMK 5M5WK 2A6EA 4XSZA 3S1RK 4OINA 1K83K 4A3LC 3GTKC 3GTJK 1TWAC 1I6HC 3S2HC 2R93C 1Y1WK 2JA6K 4Y7NC 3GTGK 4BBRK 5C4XK 4A3MC 2E2JC 3K7AC 4A3KC 3HKZL 4OIRA 4C3JK 5IP7C 3HOZK 2WB1D 1TWFK 3S1QK 3S1QC 3PO2C 5IP7K 5IYDK 3HOZC 5M5XK 1BDFA 4A3MK 4BBRC 4XSXA 1HQMA 2NVTC 2JA6C 4ZH4A 3S2HK 4BXXC 4A3IC 1TWAK 3GTJC 2WAQL 4A3LK 2A6HA 2CW0A 3S1RC 5IP9K 3I4MK 1WCMK 4C3IK 4A3FK 3GTLK 1IW7A 3S14C 2PA8D 4G7ZA 4A3DK 1I3QC 1TWHC 5C44K 4YFXA 2PA8L 2VUMC 1TWCC 4YFNA 2JA5K 3M4OK 1I50C 2NVXC 4LK1A 2PMZD 4A3EC 2Y0SD 1I50K 4LJZA 4OIPA 4XLNA 4BY1C 3M4OC 1TWCK 3HOVK 4A3BK 5M3FK 4BY7K 1I3QK 4A3CC 4LLGA 4A3DC 4AYBL 5M5YK 3CQZC 3S14K 3M3YK 4XLPA 4C2MC 1WCMC 3GTLC 3I4MC 2WB1L 3HKZD 4Q5SA 1SFOK 3H3VL 4X6AK 4QIWD 4A3IK 3GTPC 3WODA 4BXXK 3S2DC 3PO3K 4QIWL 5IYCK 3S1MC 2NVTK 3RZOK 3H3VD 4BBSK 4MEYA 5IYDC 2YU9C 2NVYK 1YNNA 1TWFC 4OIOA 3HOXC 4A3JC 4A3BC 1Y1VK 4C3JC 2JA7K 3K7AK 3RZDC 4A3KK 2E2JK 5C4XC 3GTGC 3S17C 4Q4ZA 5C3EK 5FJ8K 4Y7NK 1Y1WC 2E2IK 2B63K 5TMFA 3GTOC 1I6VA 1I6HK 2R93K 2NVQC 4LK0A 3EQLA 3GTKK 3HOWK 4AYBD 1TWGK 2O5JA 1K83C 4NOIA 2PMZL 2JA8K 3GTQK 5FLMC 4A93K 5TMCA 4JK1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C4J C;  2E2H C;  2BE5 A;  2JA8 C;  3GTQ C;  4GZY A;  1TWG C;  3HOW C;  3HOU C;  4A3G C;  3FKI C;  5IYB C;  3S16 C;  3H0G K;  2NVQ K;  2R7Z C;  3GTO K;  4C3H C;  3I4N K;  4OIQ A;  4QJV A;  2E2I C;  2A68 A;  5C3E C;  2B63 C;  3S1N C;  2WAQ D;  1XPP A;  3S17 K;  3RZD K;  4Y52 K;  3GTM K;  1Y1V C;  4G7H A;  3HOX K;  2JA7 C;  4A3J K;  2NVY C;  4MQ9 A;  3S15 C;  4BBS C;  2YU9 K;  4KMU A;  2R92 K;  5D4D A;  3PO2 K;  2PPB A;  3RZO C;  5IYC C;  3S1M K;  3PO3 C;  3S2D K;  3HOY C;  4KN7 A;  2A69 A;  3GTP K;  4X6A C;  1R9T C;  1R9T K;  1SFO C;  4QJV B;  2Y0S L;  4G7O A;  1SMY A;  4YFK A;  4C2M K;  3HOY K;  3M3Y C;  1ZYR A;  2O5I A;  3CQZ K;  5M3M K;  4A3C K;  2R92 C;  4BY7 C;  4KN4 A;  3S15 K;  4YG2 A;  4BY1 K;  3GTM C;  1YNJ A;  3HOV C;  4MEX A;  4Y52 C;  3S1N K;  4A3E K;  3DXJ A;  2NVX K;  4C3H K;  2R7Z K;  3H0G C;  3I4N C;  2JA5 C;  3FKI K;  5IYB K;  2VUM K;  3S16 K;  3HOU K;  4A3G K;  5C44 C;  1TWH K;  5C4J K;  2E2H K;  4C3I C;  4A3F C;  4A93 C;  5IP9 C;  5FLM K;  5M5W K;  2A6E A;  4XSZ A;  3S1R K;  4OIN A;  1K83 K;  4A3L C;  3GTK C;  3GTJ K;  1TWA C;  1I6H C;  3S2H C;  2R93 C;  1Y1W K;  2JA6 K;  4Y7N C;  3GTG K;  4BBR K;  5C4X K;  4A3M C;  2E2J C;  3K7A C;  4A3K C;  3HKZ L;  4OIR A;  4C3J K;  5IP7 C;  3HOZ K;  2WB1 D;  1TWF K;  3S1Q K;  3S1Q C;  3PO2 C;  5IP7 K;  5IYD K;  3HOZ C;  5M5X K;  1BDF A;  4A3M K;  4BBR C;  4XSX A;  1HQM A;  2NVT C;  2JA6 C;  4ZH4 A;  3S2H K;  4BXX C;  4A3I C;  1TWA K;  3GTJ C;  2WAQ L;  4A3L K;  2A6H A;  2CW0 A;  3S1R C;  5IP9 K;  3I4M K;  1WCM K;  4C3I K;  4A3F K;  3GTL K;  1IW7 A;  3S14 C;  2PA8 D;  4G7Z A;  4A3D K;  1I3Q C;  1TWH C;  5C44 K;  4YFX A;  2PA8 L;  2VUM C;  1TWC C;  4YFN A;  2JA5 K;  3M4O K;  1I50 C;  2NVX C;  4LK1 A;  2PMZ D;  4A3E C;  2Y0S D;  1I50 K;  4LJZ A;  4OIP A;  4XLN A;  4BY1 C;  3M4O C;  1TWC K;  3HOV K;  4A3B K;  5M3F K;  4BY7 K;  1I3Q K;  4A3C C;  4LLG A;  4A3D C;  4AYB L;  5M5Y K;  3CQZ C;  3S14 K;  3M3Y K;  4XLP A;  4C2M C;  1WCM C;  3GTL C;  3I4M C;  2WB1 L;  3HKZ D;  4Q5S A;  1SFO K;  3H3V L;  4X6A K;  4QIW D;  4A3I K;  3GTP C;  3WOD A;  4BXX K;  3S2D C;  3PO3 K;  4QIW L;  5IYC K;  3S1M C;  2NVT K;  3RZO K;  3H3V D;  4BBS K;  4MEY A;  5IYD C;  2YU9 C;  2NVY K;  1YNN A;  1TWF C;  4OIO A;  3HOX C;  4A3J C;  4A3B C;  1Y1V K;  4C3J C;  2JA7 K;  3K7A K;  3RZD C;  4A3K K;  2E2J K;  5C4X C;  3GTG C;  3S17 C;  4Q4Z A;  5C3E K;  5FJ8 K;  4Y7N K;  1Y1W C;  2E2I K;  2B63 K;  5TMF A;  3GTO C;  1I6V A;  1I6H K;  2R93 K;  2NVQ C;  4LK0 A;  3EQL A;  3GTK K;  3HOW K;  4AYB D;  1TWG K;  2O5J A;  1K83 C;  4NOI A;  2PMZ L;  2JA8 K;  3GTQ K;  5FLM C;  4A93 K;  5TMC A;  4JK1 A; 
#chains in the Genus database with same CATH topology
 3AQP A;  2BE5 A;  3GTP A;  3TFI A;  4A3G C;  3I4N K;  1Y1V A;  2R7Z C;  4LQY A;  4FM9 A;  4QJV A;  1C0A A;  2RGR A;  4Y52 K;  2WAQ D;  1J6W A;  1Y1V C;  3CAG A;  1G51 A;  1EQR A;  5D4D A;  2PPB A;  3RZO C;  3S1M K;  1XZQ B;  3HOY C;  1WOO A;  1FEU A;  3GTP K;  4X6A C;  4IO9 S;  1XZQ A;  2GAH C;  1SFO C;  4G7O A;  4XCH A;  3HOY K;  1ZYR A;  1PJ7 A;  2O5I A;  3CQZ K;  3FOE A;  1INN A;  1R9T A;  4YG2 A;  4IOA S;  4Y52 C;  3FHZ A;  3OEP A;  4A3E K;  2R7Z K;  3I4N C;  1SFO A;  5CJ9 A;  4A3G K;  4KM9 A;  3GSI A;  1B4B A;  1WQH A;  4A3F C;  4A93 C;  1X31 C;  2A6E A;  1ZBS A;  5M5W K;  3S1R K;  4KAR A;  3CQZ A;  4Y7N C;  1WOR A;  5C4X K;  4P9S A;  2WB1 D;  4KB2 A;  4DDQ A;  4XSX A;  1HQM A;  4P5A A;  3TFJ A;  2V6S A;  4KMD A;  2JH3 A;  2FQO A;  2A6H A;  1F9N A;  4WCE S;  1EK8 A;  2KPU A;  3S1R C;  4A3F K;  4BLB A;  1IW7 A;  3GEI A;  4GTD A;  3S0X A;  4G0V A;  1I3Q C;  4WFA S;  3M4O K;  4KMH A;  5IOS A;  1I50 C;  4A3E C;  4G0U A;  2V6T A;  4BLA A;  5HQH A;  1WOS A;  3CQZ C;  2E2I A;  4GTL A;  1WCM C;  3GTL C;  2JA6 A;  1IS1 A;  1SFO K;  3H3V L;  4WFN S;  4X6A K;  2CFA B;  3GTP C;  4BXX K;  3A8I A;  3ORE A;  5TJ3 A;  3S1M C;  2NVT K;  3RZO K;  3H3V D;  3PO2 K;  2XCQ A;  1TWA A;  5JFE A;  1TWF C;  1Y1V K;  4C3J C;  4A3K K;  2ZUF A;  4Q4Z A;  4KAT A;  3EQL A;  4LOW A;  1JVI A;  3ERE D;  4GZY A;  3GTG A;  1TWG C;  1WOP A;  3HOU C;  4BKW A;  5IYB C;  2NVQ K;  1IL2 A;  2A68 A;  1WSV A;  3GIR A;  3RZD K;  4J3N A;  3A8J A;  4A3J K;  4BBS C;  4MQ9 A;  1O29 A;  4KMU A;  1XXB A;  3SZZ A;  3LYW A;  1BGW A;  3T01 A;  1TWF A;  1DCP A;  1R9T C;  2FQT A;  4QJV B;  5JVG S;  3BP8 C;  4C2M K;  3M3Y C;  1Y1W A;  2P8T A;  4A3C K;  2R92 C;  3TTG A;  3S15 K;  3N0B A;  3BUE A;  1YNJ A;  4U67 S;  3HOV C;  3ADA C;  3S1N K;  3CF5 S;  1ISE A;  1GE9 A;  2NVX K;  4C3H K;  3FKI K;  1JOE A;  2P5M A;  1K83 A;  4GTF A;  1XZP B;  4AH6 A;  5C4J K;  4WJ4 A;  2NVX A;  5IP9 C;  3DLL S;  1WSR A;  1XXA A;  1O28 A;  4GTC A;  1EFW A;  3S2H C;  2R93 C;  1BJT A;  1Y1W K;  2JA6 K;  3GTG K;  4BBR K;  2E2J C;  3K7A C;  3HOZ K;  5IYD K;  4A3M K;  4ZH4 A;  5IOR A;  2GSU A;  1EI6 A;  3GTJ C;  1YX2 A;  2L5N A;  1TWH A;  2WAQ L;  2GSO A;  1F7U A;  4A3L K;  3Q3Q A;  2CW0 A;  3I4M K;  2PA8 D;  4G7Z A;  1HI9 A;  1TWC C;  2PMZ D;  4OIP A;  4BY1 C;  4BY7 K;  4KB4 A;  4AYB L;  4A3D C;  5M5Y K;  3SZY A;  3S14 K;  2B63 A;  2WB1 L;  4O2D A;  4QIW D;  2NVY A;  4KAS A;  4A3I K;  2E2H A;  2JA5 A;  5EGH A;  3BP3 A;  4MEY A;  4PAB A;  1YNN A;  2JA7 K;  4WF9 S;  5C3E K;  2E2I K;  3GTO C;  1I6H K;  3GTK K;  4AYB D;  2O5J A;  1K83 C;  3GTQ K;  1L0W A;  4C45 A;  5FLM C;  3N0C A;  1RU0 A;  5TMC A;  3PIP S;  2E2H C;  3NUH A;  2JA8 C;  3G4A A;  3MML B;  3HOW C;  2JA7 A;  3S16 C;  4KM8 A;  3H0G K;  2R92 A;  3VA7 A;  4OIQ A;  2B63 C;  3S17 K;  3JST A;  3GTM K;  3PIO S;  4G7H A;  3FKI A;  3HOX K;  2NVY C;  2YU9 K;  3AQO A;  4A3B K;  4ILD A;  5IYC C;  3PO3 C;  2KQ1 A;  3S2D K;  4KN7 A;  2A69 A;  2PHC B;  3A8K A;  3OPF A;  3AD9 C;  2Y0S L;  4GTE A;  4YFK A;  1WQG A;  1F7V A;  1VJE A;  5M3M K;  3GEE A;  1TWG A;  3GTM C;  2W7V A;  4RMF A;  4MEX A;  1IQ0 A;  3H0G C;  3S16 K;  2JA5 C;  2VUM K;  4M1X A;  1IBA A;  1VLO A;  1XXC A;  5C44 C;  1TWH K;  1USM A;  2E2H K;  4C3I C;  1IE0 A;  5FLM K;  4OIN A;  1K83 K;  4G0W A;  3GTK C;  5JVH S;  1TWA C;  4KDD A;  3TFH A;  1I6H C;  2D6F C;  3HKZ L;  4GFQ A;  5IP7 C;  3S1Q K;  3S1Q C;  5IP7 K;  5EGE A;  5M5X K;  1BDF A;  3GTQ A;  5CHP A;  1AB4 A;  4GT9 A;  2VUM A;  4A3I C;  1TWA K;  3V4G A;  2YU9 A;  4C3I K;  3QX3 A;  3S14 C;  4WJ3 M;  5DM7 S;  4A3D K;  1TWH C;  5C44 K;  2VUM C;  4YFN A;  2JA5 K;  1DCH A;  3IPJ A;  4LJZ A;  1TWC K;  3LPX A;  5M3F K;  1XZP A;  3GTK A;  4LLG A;  3I4M C;  4PAA A;  3GTM A;  4Q5S A;  3WOD A;  2KWA A;  1V5V A;  5IOQ A;  3S2D C;  3PO3 K;  5IYC K;  1WIH A;  5IYD C;  2NVY K;  2YU9 C;  4A3B C;  4OIO A;  3HOX C;  3H0G A;  3K7A K;  2E2J K;  3GTG C;  3S17 C;  2B63 K;  1Y1W C;  5TMF A;  2R93 K;  1I6V A;  2V6U A;  4WIL A;  4LK0 A;  3HOW K;  1PJ5 A;  4NOI A;  2JA8 K;  1YCL A;  1J6X A;  5DM6 S;  5C4J C;  3GTQ C;  3FKI C;  1J6V A;  1EH1 A;  4C3H C;  3GTO K;  2E2I C;  5C3E C;  3S1N C;  1XPP A;  2JA7 C;  3S15 C;  2R92 K;  1ZXO A;  3GTO A;  1PJ6 A;  1DCO A;  1R9T K;  3FOF A;  1O25 A;  3AH5 A;  1VGX A;  3N3Y A;  1I3Q A;  5HL7 S;  1SMY A;  3T00 A;  1O27 A;  3GDZ A;  3T02 A;  4WFB S;  1F93 A;  4BY7 C;  4KN4 A;  3LAP A;  4GTB A;  3GTJ A;  2ZJP S;  2GSN A;  2CFA A;  4BY1 K;  1O2F B;  5L46 A;  4FZB A;  2RH6 A;  3DXJ A;  1BS2 A;  5IYB K;  3GEH A;  5IOT A;  3HOU K;  1DD5 A;  4LR2 A;  1O24 A;  1WCM A;  3GTL A;  4XSZ A;  4A3L C;  3GTJ K;  1O2B A;  4KMA A;  4KAW X;  4A3M C;  1ZVU A;  4A3K C;  1I50 A;  4C3J K;  4OIR A;  1UV7 A;  1TWF K;  3PO2 C;  4IOC S;  3L4K A;  3HOZ C;  4BBR C;  2NVT C;  2JA6 C;  1ZQ1 C;  3S2H K;  2KXY A;  4BXX C;  3L4J A;  2GAG C;  1B4A A;  3HXA A;  2L3U A;  5IP9 K;  1WCM K;  3LAJ A;  1KQ4 A;  3GTL K;  1O2A A;  4YFX A;  3AD8 C;  2PA8 L;  2NVX C;  4LK1 A;  2Y0S D;  4P5B A;  1I50 K;  4XLN A;  3M4O C;  5E68 A;  3HOV K;  3AD7 C;  1I3Q K;  4A3C C;  1USO A;  3M3Y K;  1WQF A;  2R93 A;  4XLP A;  4C2M C;  5HL8 A;  1TWC A;  3HKZ D;  1VRQ C;  2XCO A;  1JQW A;  2ZJR S;  4QIW L;  5JVO A;  1J98 A;  4GTA A;  2EBB A;  2ZUE A;  2Y3P A;  4BBS K;  2R7Z A;  2XCR B;  4A3J C;  4KC6 A;  3RZD C;  5C4X C;  4Y7N K;  5FJ8 K;  1O26 A;  2NVQ C;  3G4C A;  1TWG K;  2ZJQ S;  2PMZ L;  4A93 K;  2ZFZ A;  1VH2 A;  4JK1 A; 
#chains in the Genus database with same CATH homology
 5C4J C;  2E2H C;  2BE5 A;  2JA8 C;  3GTQ C;  4GZY A;  1TWG C;  3HOW C;  3HOU C;  4A3G C;  3FKI C;  5IYB C;  3S16 C;  3H0G K;  2NVQ K;  2R7Z C;  3GTO K;  4C3H C;  3I4N K;  4OIQ A;  4QJV A;  2E2I C;  2A68 A;  5C3E C;  2B63 C;  3S1N C;  2WAQ D;  1XPP A;  3S17 K;  3RZD K;  4Y52 K;  3GTM K;  1Y1V C;  4G7H A;  3HOX K;  2JA7 C;  4A3J K;  2NVY C;  4MQ9 A;  3S15 C;  4BBS C;  2YU9 K;  4KMU A;  2R92 K;  5D4D A;  3PO2 K;  2PPB A;  3RZO C;  5IYC C;  3S1M K;  3PO3 C;  3S2D K;  3HOY C;  4KN7 A;  2A69 A;  3GTP K;  4X6A C;  1R9T C;  1R9T K;  1SFO C;  4QJV B;  2Y0S L;  4G7O A;  1SMY A;  4YFK A;  4C2M K;  3HOY K;  3M3Y C;  1ZYR A;  2O5I A;  3CQZ K;  5M3M K;  4A3C K;  2R92 C;  4BY7 C;  4KN4 A;  3S15 K;  4YG2 A;  4BY1 K;  3GTM C;  1YNJ A;  3HOV C;  4MEX A;  4Y52 C;  3S1N K;  4A3E K;  3DXJ A;  2NVX K;  4C3H K;  2R7Z K;  3H0G C;  3I4N C;  2JA5 C;  3FKI K;  5IYB K;  2VUM K;  3S16 K;  3HOU K;  4A3G K;  5C44 C;  1TWH K;  5C4J K;  2E2H K;  4C3I C;  4A3F C;  4A93 C;  5IP9 C;  5FLM K;  5M5W K;  2A6E A;  4XSZ A;  3S1R K;  4OIN A;  1K83 K;  4A3L C;  3GTK C;  3GTJ K;  1TWA C;  1I6H C;  3S2H C;  2R93 C;  1Y1W K;  2JA6 K;  4Y7N C;  3GTG K;  4BBR K;  5C4X K;  4A3M C;  2E2J C;  3K7A C;  4A3K C;  3HKZ L;  4OIR A;  4C3J K;  5IP7 C;  3HOZ K;  2WB1 D;  1TWF K;  3S1Q K;  3S1Q C;  3PO2 C;  5IP7 K;  5IYD K;  3HOZ C;  5M5X K;  1BDF A;  4A3M K;  4BBR C;  4XSX A;  1HQM A;  2NVT C;  2JA6 C;  4ZH4 A;  3S2H K;  4BXX C;  4A3I C;  1TWA K;  3GTJ C;  2WAQ L;  4A3L K;  2A6H A;  2CW0 A;  3S1R C;  5IP9 K;  3I4M K;  1WCM K;  4C3I K;  4A3F K;  3GTL K;  1IW7 A;  3S14 C;  2PA8 D;  4G7Z A;  4A3D K;  1I3Q C;  1TWH C;  5C44 K;  4YFX A;  2PA8 L;  2VUM C;  1TWC C;  4YFN A;  2JA5 K;  3M4O K;  1I50 C;  2NVX C;  4LK1 A;  2PMZ D;  4A3E C;  2Y0S D;  1I50 K;  4LJZ A;  4OIP A;  4XLN A;  4BY1 C;  3M4O C;  1TWC K;  3HOV K;  4A3B K;  5M3F K;  4BY7 K;  1I3Q K;  4A3C C;  4LLG A;  4A3D C;  4AYB L;  5M5Y K;  3CQZ C;  3S14 K;  3M3Y K;  4XLP A;  4C2M C;  1WCM C;  3GTL C;  3I4M C;  2WB1 L;  3HKZ D;  4Q5S A;  1SFO K;  3H3V L;  4X6A K;  4QIW D;  4A3I K;  3GTP C;  3WOD A;  4BXX K;  3S2D C;  3PO3 K;  4QIW L;  5IYC K;  3S1M C;  2NVT K;  3RZO K;  3H3V D;  4BBS K;  4MEY A;  5IYD C;  2YU9 C;  2NVY K;  1YNN A;  1TWF C;  4OIO A;  3HOX C;  4A3J C;  4A3B C;  1Y1V K;  4C3J C;  2JA7 K;  3K7A K;  3RZD C;  4A3K K;  2E2J K;  5C4X C;  3GTG C;  3S17 C;  4Q4Z A;  5C3E K;  5FJ8 K;  4Y7N K;  1Y1W C;  2E2I K;  2B63 K;  5TMF A;  3GTO C;  1I6V A;  1I6H K;  2R93 K;  2NVQ C;  4LK0 A;  3EQL A;  3GTK K;  3HOW K;  4AYB D;  1TWG K;  2O5J A;  1K83 C;  4NOI A;  2PMZ L;  2JA8 K;  3GTQ K;  5FLM C;  4A93 K;  5TMC A;  4JK1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...