2BE5A

Crystal structure of the t. thermophilus rna polymerase holoenzyme in complex with inhibitor tagetitoxin
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
229
structure length
229
Chain Sequence
MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for transcription inhibition by tagetitoxin
pubmed doi rcsb
molecule tags Transferase
molecule keywords DNA-directed RNA polymerase alpha chain
total genus 42
structure length 229
sequence length 229
chains with identical sequence B, K, L
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2005-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01000 RNA_pol_A_bac RNA polymerase Rpb3/RpoA insert domain
A PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain
A PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.12 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 DNA-directed RNA polymerase, insert domain 2be5A02
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 2be5A01
4QJVA 2O5IA 5TMCA 1TWFK 3S2DC 3S17C 5C4JC 3GTQC 4C2MK 3HOYK 3GTPC 3S1RK 5M5YK 3S1NK 4QIWD 5IP7K 4XSZA 4C3IC 4G7OA 1K83C 4YFNA 1I6VA 4ZH4A 1I3QK 4XLPA 4BXXC 2PA8L 1Y1WC 3GTLC 5TMFA 5C44C 4LLGA 4C3HC 4YFXA 3GTMK 1YNJA 1K83K 5M3MK 2NVYK 4OIOA 3GTJK 3S17K 4Y52K 2E2JC 3S14K 2Y0SL 4BBRC 3S1QC 3M4OK 4C3HK 3RZDK 2WB1D 4KN4A 3S1MC 4A93C 4KMUA 4A3KK 2JA8K 3GTOK 5IP9C 2R93K 1Y1WK 3M3YC 3CQZK 4Q4ZA 3RZDC 2B63C 2JA7C 3DXJA 3GTKK 5C3EK 2NVYC 5FJ8K 4A3DC 3PO2K 2A69A 4YG2A 4A3MC 2BE5A 1TWGK 3S16K 4OIRA 4XLNA 4A3BK 4BY1C 5IYCK 3PO3C 5C4XK 3K7AC 2B63K 3GTGC 4A3FK 1I6HK 5C3EC 2R92C 5M5XK 1SFOC 3GTOC 3HOUK 1TWCK 2A6EA 1HQMA 3K7AK 4G7ZA 4A3FC 4QIWL 3GTGK 5IP7C 2NVXC 4C3IK 1Y1VK 4A3CC 3S16C 1WCMK 4C3JK 5FLMC 3I4NK 1IW7A 1R9TC 2R93C 4JK1A 3HKZL 5C44K 4A3LK 2NVXK 1TWAC 2R92K 3GTMC 2NVQK 4MQ9A 3HOUC 1SFOK 4GZYA 1TWCC 4C3JC 2JA6K 1ZYRA 4OIQA 3WODA 4LJZA 3S1QK 2VUMC 2PA8D 5D4DA 4C2MC 1SMYA 3HOYC 5C4JK 2WAQL 3S2DK 4XSXA 3HOZC 4A3GC 1WCMC 2JA6C 4A3CK 4QJVB 3GTQK 1TWHK 3HOXK 3S2HC 3M3YK 2E2HK 2CW0A 3FKIC 1TWAK 2JA7K 2NVQC 4A3EC 1I3QC 2O5JA 4NOIA 4Q5SA 1TWGC 4A3BC 3S2HK 4Y7NK 2YU9K 3H3VL 5IYCC 1YNNA 1BDFA 1I6HC 5C4XC 2A6HA 2JA5C 2PMZL 4BY1K 4Y52C 2VUMK 3S14C 3RZOC 2E2JK 3HOWK 2PPBA 3GTJC 3I4MK 4X6AK 4A3GK 2NVTC 4Y7NC 2YU9C 3GTKC 2R7ZC 1I50K 1TWFC 3HOWC 3FKIK 5IP9K 4YFKA 4A3EK 4A3KC 2JA8C 1I50C 2E2IC 2R7ZK 3I4NC 5FLMK 1R9TK 3PO2C 4A3DK 3HKZD 3H0GC 4KN7A 3M4OC 3S15C 4A3LC 4A3MK 5IYDC 2JA5K 2WB1L 3I4MC 4X6AC 4AYBD 3RZOK 5IYBC 4A3JC 3H3VD 2E2IK 3EQLA 5M3FK 4MEYA 3HOVK 4OINA 4BBRK 4OIPA 5IYBK 2WAQD 4A3JK 3HOZK 5M5WK 3S1MK 1TWHC 3HOXC 4A93K 4A3IC 4LK0A 4LK1A 2E2HC 4BBSC 1XPPA 3H0GK 5IYDK 1Y1VC 3CQZC 2A68A 3S1NC 3GTPK 4BY7K 3PO3K 4A3IK 3S15K 4BBSK 3HOVC 4MEXA 4AYBL 4BXXK 4G7HA 2PMZD 3GTLK 3S1RC 2Y0SD 4BY7C 2NVTK
chains in the Genus database with same CATH superfamily
3TFHA 5TMCA 1TWFK 1EK8A 1DCOA 3S17C 3AD8C 3GTPC 4C3IC 4G7OA 3AH5A 4KB4A 5HQHA 4XLPA 1WSVA 5C44C 4LOWA 4G0WA 1WIHA 3AD9C 3RZDK 3AQPA 3LPXA 4KMUA 2JA8K 5IP9C 3HXAA 1TWHA 3CQZK 4Q4ZA 4PABA 2JA7C 3DXJA 3OEPA 5C3EK 2NVYC 2GSOA 2A69A 3TFJA 2BE5A 3FKIA 1X31C 5C4XK 1B4BA 4WFNS 5C3EC 1DCPA 1L0WA 1DD5A 3HOUK 4DDQA 2A6EA 3K7AK 4G7ZA 5EGEA 3GEHA 4J3NA 2RGRA 4C3IK 3GTLA 4GTLA 1WCMK 1R9TC 1IBAA 1O24A 5CJ9A 4GZYA 4KMAA 3CF5S 2W7VA 4LJZA 2PA8D 4C2MC 5C4JK 3OREA 3HOZC 4A3GC 2ZUFA 2JA6C 2R92A 3GTQK 1TWHK 3HOXK 2JA6A 1TWAK 2JA7K 3A8KA 1J98A 4Q5SA 3GTKK 5IYCC 3S15K 2PMZL 4Y52C 4WCES 3S14C 1ZBSA 2E2JK 3I4MK 3GTJC 2NVTC 4O2DA 3GTKC 1RU0A 1YX2A 4BLBA 2ZUEA 1BGWA 4WF9S 3DLLS 3LYWA 2L5NA 4A3KC 2VUMA 1O27A 1O29A 1I50C 5JFEA 1VRQC 3PO2C 4A3DK 2CFAB 3RZOK 1O28A 2WB1L 4AYBD 3IPJA 4BKWA 1JVIA 2FQOA 4BBRK 2NVXA 2WAQD 1KQ4A 3AD7C 1TWHC 3HOXC 4A3IC 4LK1A 4BBSC 3H0GK 2P5MA 1O25A 3LAJA 1EQRA 1JOEA 3L4KA 3CQZC 3GTPK 1V5VA 4BY7K 3TTGA 3T02A 1WQHA 1WOOA 3GTLK 3NUHA 1IE0A 2Y0SD 4BY7C 2NVTK 4QJVA 4IOAS 3Q3QA 3S2DC 3PIOS 2JH3A 2ZJPS 5M5YK 3N0CA 1YCLA 4BXXC 1INNA 3S0XA 1XXBA 3GTMK 4KASA 4KARA 4BBRC 2Y3PA 1C0AA 4C3HK 4GTAA 2V6TA 2NVYA 4GTBA 3M3YC 1ZXOA 4KC6A 1UV7A 5FJ8K 1G51A 4A3MC 5IYCK 3PO3C 3K7AC 3SZYA 1WCMA 5M5XK 5DM7S 3GTOC 4KATA 1EI6A 4A3FC 3GTGK 2NVXC 4ILDA 1Y1VK 4WFAS 3A8JA 3S16C 4KM9A 2YU9A 2NVXK 1TWAC 2R92K 3GTMC 3GTQA 4MQ9A 3BUEA 1PJ5A 5IOSA 1TWCC 3H0GA 1WOPA 1ZYRA 4OIQA 2JA6K 2V6SA 4FZBA 3S1QK 5D4DA 4A3CK 3OPFA 4QJVB 1IL2A 3M3YK 3FKIC 2D6FC 2NVQC 4A3EC 2O5JA 3BP8C 4BY1K 3PIPS 3PO3K 1GE9A 3HOWK 2VUMK 3RZOC 4X6AK 3GDZA 1I50K 3HOWC 5JVGS 5JVOA 5IP9K 1J6XA 3N0BA 1O2FB 4BLAA 4KN7A 3M4OC 4A3LC 5CHPA 5IYBC 1XXCA 3GTPA 5M3FK 4MEYA 5HL7S 3GEIA 2P8TA 1DCHA 4G0UA 2XCOA 5IYBK 2JA5A 4AH6A 5E68A 4P5BA 4A93K 5IYDK 4P9SA 2A68A 2XCRB 1XZQB 3A8IA 4P5AA 2KPUA 4KM8A 3HOYK 3GTQC 4WILA 3GTMA 1WOSA 4WFBS 4GTEA 1K83C 2KXYA 1I6VA 4ZH4A 1I3QK 1ZQ1C 2PA8L 2V6UA 4U67S 5TMFA 4LLGA 4C3HC 1K83K 5M3MK 2NVYK 4GTFA 4OIOA 3GTJK 1SFOA 3S17K 4Y52K 3S1QC 2ZJRS 4M1XA 4KN4A 4A93C 4A3KK 1BJTA 1Y1WK 1TWGK 5IORA 3S16K 4OIRA 4A3BK 4BY1C 1I6HK 3GTGC 4A3FK 3QX3A 2ZJQS 2GAGC 1HQMA 5IP7C 2KQ1A 4KB2A 3I4NK 2R7ZA 2R93A 4A3LK 2XCQA 3SZZA 3GTJA 2NVQK 1SFOK 3AQOA 1J6VA 1WORA 2WAQL 3S2DK 1WCMC 1IS1A 2EBBA 1TWGC 4A3BC 4Y7NK 1BDFA 1I6HC 2A6HA 3M4OK 4KMHA 2PPBA 4C45A 1XZPA 4XCHA 4PAAA 4Y7NC 2CFAA 1F9NA 2R7ZC 2GAHC 4YFKA 3LAPA 2JA8C 2E2IC 2R7ZK 3I4NC 2R93K 3H0GC 1O2BA 1TWCA 2JA5K 4FM9A 4A3MK 1EFWA 3I4MC 2KWAA 4A3JC 3H3VD 2E2IK 3GTKA 5L46A 1PJ7A 3JSTA 4OIPA 4A3JK 1O2AA 1TWGA 1XXAA 3S1MK 3GIRA 4LK0A 2E2HC 3GTOA 3GEEA 1JQWA 3HOVC 1F7UA 4MEXA 4BXXK 2E2HA 2FQTA 3S1RC 2B63A 2O5IA 4GTCA 1VLOA 5C4JC 4C2MK 3S1NK 3S1RK 1K83A 1VJEA 4QIWD 4GT9A 4XSZA 5IP7K 4YFNA 3TFIA 2RH6A 2GSNA 1Y1WC 3GTLC 1PJ6A 2E2IA 4YFXA 1YNJA 5TJ3A 1Y1WA 1IQ0A 2E2JC 3L4JA 3S14K 5DM6S 2Y0SL 2WB1D 3T00A 3S1MC 1XZPB 3CAGA 3GTOK 1XZQA 3RZDC 2B63C 2ZFZA 4A3DC 3PO2K 4YG2A 3ADAC 4XLNA 3T01A 1USOA 3BP3A 2B63K 1ZVUA 2R92C 3CQZA 3N3YA 1SFOC 1HI9A 1TWCK 1J6WA 5EGHA 4QIWL 5HL8A 4A3CC 4C3JK 5FLMC 1TWFA 1IW7A 2R93C 3GSIA 1AB4A 4JK1A 3HKZL 4KMDA 5C44K 1R9TA 4IO9S 3FHZA 3HOUC 4KDDA 4C3JC 1ISEA 3FOEA 1I50A 4LR2A 3WODA 1USMA 2VUMC 3HOYC 1SMYA 2L3UA 1BS2A 1F93A 1O26A 3MMLB 4XSXA 3GTGA 3S2HC 2E2HK 2CW0A 5IOQA 3V4GA 1Y1VA 1I3QC 4NOIA 3G4AA 2PHCB 2YU9K 3S2HK 3H3VL 5C4XC 1YNNA 1VGXA 2JA5C 2GSUA 4KAWX 1B4AA 4G0VA 1TWAA 4A3GK 2YU9C 1TWFC 5IOTA 3FKIK 4A3EK 1WQGA 4WJ3M 5FLMK 1R9TK 3HKZD 3G4CA 3S15C 3VA7A 5IYDC 4X6AC 4IOCS 4RMFA 3EQLA 3HOVK 4GTDA 1F7VA 4OINA 4GFQA 4LQYA 3HOZK 1FEUA 5M5WK 3FOFA 1WSRA 1XPPA 1I3QA 1Y1VC 3S1NC 4WJ4A 3ERED 1WQFA 1VH2A 1EH1A 4A3IK 4BBSK 4AYBL 4G7HA 2PMZD 5JVHS 2JA7A
chains in the Genus database with same CATH topology
4QJVA 2O5IA 5TMCA 1TWFK 3S2DC 3S17C 5C4JC 3GTQC 4C2MK 3HOYK 3GTPC 3S1RK 5M5YK 3S1NK 4QIWD 5IP7K 4XSZA 4C3IC 4G7OA 1K83C 4YFNA 1I6VA 4ZH4A 1I3QK 4XLPA 4BXXC 2PA8L 1Y1WC 3GTLC 5TMFA 5C44C 4LLGA 4C3HC 4YFXA 3GTMK 1YNJA 1K83K 5M3MK 2NVYK 4OIOA 3GTJK 3S17K 4Y52K 2E2JC 3S14K 2Y0SL 4BBRC 3S1QC 3M4OK 4C3HK 3RZDK 2WB1D 4KN4A 3S1MC 4A93C 4KMUA 4A3KK 2JA8K 3GTOK 5IP9C 2R93K 1Y1WK 3M3YC 3CQZK 4Q4ZA 3RZDC 2B63C 2JA7C 3DXJA 3GTKK 5C3EK 2NVYC 5FJ8K 4A3DC 3PO2K 2A69A 4YG2A 4A3MC 2BE5A 1TWGK 3S16K 4OIRA 4XLNA 4A3BK 4BY1C 5IYCK 3PO3C 5C4XK 3K7AC 2B63K 3GTGC 4A3FK 1I6HK 5C3EC 2R92C 5M5XK 1SFOC 3GTOC 3HOUK 1TWCK 2A6EA 1HQMA 3K7AK 4G7ZA 4A3FC 4QIWL 3GTGK 5IP7C 2NVXC 4C3IK 1Y1VK 4A3CC 3S16C 1WCMK 4C3JK 5FLMC 3I4NK 1IW7A 1R9TC 2R93C 4JK1A 3HKZL 5C44K 4A3LK 2NVXK 1TWAC 2R92K 3GTMC 2NVQK 4MQ9A 3HOUC 1SFOK 4GZYA 1TWCC 4C3JC 2JA6K 1ZYRA 4OIQA 3WODA 4LJZA 3S1QK 2VUMC 2PA8D 5D4DA 4C2MC 1SMYA 3HOYC 5C4JK 2WAQL 3S2DK 4XSXA 3HOZC 4A3GC 1WCMC 2JA6C 4A3CK 4QJVB 3GTQK 1TWHK 3HOXK 3S2HC 3M3YK 2E2HK 2CW0A 3FKIC 1TWAK 2JA7K 2NVQC 4A3EC 1I3QC 2O5JA 4NOIA 4Q5SA 1TWGC 4A3BC 3S2HK 4Y7NK 2YU9K 3H3VL 5IYCC 1YNNA 1BDFA 1I6HC 5C4XC 2A6HA 2JA5C 2PMZL 4BY1K 4Y52C 2VUMK 3S14C 3RZOC 2E2JK 3HOWK 2PPBA 3GTJC 3I4MK 4X6AK 4A3GK 2NVTC 4Y7NC 2YU9C 3GTKC 2R7ZC 1I50K 1TWFC 3HOWC 3FKIK 5IP9K 4YFKA 4A3EK 4A3KC 2JA8C 1I50C 2E2IC 2R7ZK 3I4NC 5FLMK 1R9TK 3PO2C 4A3DK 3HKZD 3H0GC 4KN7A 3M4OC 3S15C 4A3LC 4A3MK 5IYDC 2JA5K 2WB1L 3I4MC 4X6AC 4AYBD 3RZOK 5IYBC 4A3JC 3H3VD 2E2IK 3EQLA 5M3FK 4MEYA 3HOVK 4OINA 4BBRK 4OIPA 5IYBK 2WAQD 4A3JK 3HOZK 5M5WK 3S1MK 1TWHC 3HOXC 4A93K 4A3IC 4LK0A 4LK1A 2E2HC 4BBSC 1XPPA 3H0GK 5IYDK 1Y1VC 3CQZC 2A68A 3S1NC 3GTPK 4BY7K 3PO3K 4A3IK 3S15K 4BBSK 3HOVC 4MEXA 4AYBL 4BXXK 4G7HA 2PMZD 3GTLK 3S1RC 2Y0SD 4BY7C 2NVTK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QJV A;  2O5I A;  5TMC A;  1TWF K;  3S2D C;  3S17 C;  5C4J C;  3GTQ C;  4C2M K;  3HOY K;  3GTP C;  3S1R K;  5M5Y K;  3S1N K;  4QIW D;  5IP7 K;  4XSZ A;  4C3I C;  4G7O A;  1K83 C;  4YFN A;  1I6V A;  4ZH4 A;  1I3Q K;  4XLP A;  4BXX C;  2PA8 L;  1Y1W C;  3GTL C;  5TMF A;  5C44 C;  4LLG A;  4C3H C;  4YFX A;  3GTM K;  1YNJ A;  1K83 K;  5M3M K;  2NVY K;  4OIO A;  3GTJ K;  3S17 K;  4Y52 K;  2E2J C;  3S14 K;  2Y0S L;  4BBR C;  3S1Q C;  3M4O K;  4C3H K;  3RZD K;  2WB1 D;  4KN4 A;  3S1M C;  4A93 C;  4KMU A;  4A3K K;  2JA8 K;  3GTO K;  5IP9 C;  2R93 K;  1Y1W K;  3M3Y C;  3CQZ K;  4Q4Z A;  3RZD C;  2B63 C;  2JA7 C;  3DXJ A;  3GTK K;  5C3E K;  2NVY C;  5FJ8 K;  4A3D C;  3PO2 K;  2A69 A;  4YG2 A;  4A3M C;  2BE5 A;  1TWG K;  3S16 K;  4OIR A;  4XLN A;  4A3B K;  4BY1 C;  5IYC K;  3PO3 C;  5C4X K;  3K7A C;  2B63 K;  3GTG C;  4A3F K;  1I6H K;  5C3E C;  2R92 C;  5M5X K;  1SFO C;  3GTO C;  3HOU K;  1TWC K;  2A6E A;  1HQM A;  3K7A K;  4G7Z A;  4A3F C;  4QIW L;  3GTG K;  5IP7 C;  2NVX C;  4C3I K;  1Y1V K;  4A3C C;  3S16 C;  1WCM K;  4C3J K;  5FLM C;  3I4N K;  1IW7 A;  1R9T C;  2R93 C;  4JK1 A;  3HKZ L;  5C44 K;  4A3L K;  2NVX K;  1TWA C;  2R92 K;  3GTM C;  2NVQ K;  4MQ9 A;  3HOU C;  1SFO K;  4GZY A;  1TWC C;  4C3J C;  2JA6 K;  1ZYR A;  4OIQ A;  3WOD A;  4LJZ A;  3S1Q K;  2VUM C;  2PA8 D;  5D4D A;  4C2M C;  1SMY A;  3HOY C;  5C4J K;  2WAQ L;  3S2D K;  4XSX A;  3HOZ C;  4A3G C;  1WCM C;  2JA6 C;  4A3C K;  4QJV B;  3GTQ K;  1TWH K;  3HOX K;  3S2H C;  3M3Y K;  2E2H K;  2CW0 A;  3FKI C;  1TWA K;  2JA7 K;  2NVQ C;  4A3E C;  1I3Q C;  2O5J A;  4NOI A;  4Q5S A;  1TWG C;  4A3B C;  3S2H K;  4Y7N K;  2YU9 K;  3H3V L;  5IYC C;  1YNN A;  1BDF A;  1I6H C;  5C4X C;  2A6H A;  2JA5 C;  2PMZ L;  4BY1 K;  4Y52 C;  2VUM K;  3S14 C;  3RZO C;  2E2J K;  3HOW K;  2PPB A;  3GTJ C;  3I4M K;  4X6A K;  4A3G K;  2NVT C;  4Y7N C;  2YU9 C;  3GTK C;  2R7Z C;  1I50 K;  1TWF C;  3HOW C;  3FKI K;  5IP9 K;  4YFK A;  4A3E K;  4A3K C;  2JA8 C;  1I50 C;  2E2I C;  2R7Z K;  3I4N C;  5FLM K;  1R9T K;  3PO2 C;  4A3D K;  3HKZ D;  3H0G C;  4KN7 A;  3M4O C;  3S15 C;  4A3L C;  4A3M K;  5IYD C;  2JA5 K;  2WB1 L;  3I4M C;  4X6A C;  4AYB D;  3RZO K;  5IYB C;  4A3J C;  3H3V D;  2E2I K;  3EQL A;  5M3F K;  4MEY A;  3HOV K;  4OIN A;  4BBR K;  4OIP A;  5IYB K;  2WAQ D;  4A3J K;  3HOZ K;  5M5W K;  3S1M K;  1TWH C;  3HOX C;  4A93 K;  4A3I C;  4LK0 A;  4LK1 A;  2E2H C;  4BBS C;  1XPP A;  3H0G K;  5IYD K;  1Y1V C;  3CQZ C;  2A68 A;  3S1N C;  3GTP K;  4BY7 K;  3PO3 K;  4A3I K;  3S15 K;  4BBS K;  3HOV C;  4MEX A;  4AYB L;  4BXX K;  4G7H A;  2PMZ D;  3GTL K;  3S1R C;  2Y0S D;  4BY7 C;  2NVT K; 
#chains in the Genus database with same CATH topology
 3TFH A;  5TMC A;  1TWF K;  1EK8 A;  1DCO A;  3S17 C;  3AD8 C;  3GTP C;  4C3I C;  4G7O A;  3AH5 A;  4KB4 A;  5HQH A;  4XLP A;  1WSV A;  5C44 C;  4LOW A;  4G0W A;  1WIH A;  3AD9 C;  3RZD K;  3AQP A;  3LPX A;  4KMU A;  2JA8 K;  5IP9 C;  3HXA A;  1TWH A;  3CQZ K;  4Q4Z A;  4PAB A;  2JA7 C;  3DXJ A;  3OEP A;  5C3E K;  2NVY C;  2GSO A;  2A69 A;  3TFJ A;  2BE5 A;  3FKI A;  1X31 C;  5C4X K;  1B4B A;  4WFN S;  5C3E C;  1DCP A;  1L0W A;  1DD5 A;  3HOU K;  4DDQ A;  2A6E A;  3K7A K;  4G7Z A;  5EGE A;  3GEH A;  4J3N A;  2RGR A;  4C3I K;  3GTL A;  4GTL A;  1WCM K;  1R9T C;  1IBA A;  1O24 A;  5CJ9 A;  4GZY A;  4KMA A;  3CF5 S;  2W7V A;  4LJZ A;  2PA8 D;  4C2M C;  5C4J K;  3ORE A;  3HOZ C;  4A3G C;  2ZUF A;  2JA6 C;  2R92 A;  3GTQ K;  1TWH K;  3HOX K;  2JA6 A;  1TWA K;  2JA7 K;  3A8K A;  1J98 A;  4Q5S A;  3GTK K;  5IYC C;  3S15 K;  2PMZ L;  4Y52 C;  4WCE S;  3S14 C;  1ZBS A;  2E2J K;  3I4M K;  3GTJ C;  2NVT C;  4O2D A;  3GTK C;  1RU0 A;  1YX2 A;  4BLB A;  2ZUE A;  1BGW A;  4WF9 S;  3DLL S;  3LYW A;  2L5N A;  4A3K C;  2VUM A;  1O27 A;  1O29 A;  1I50 C;  5JFE A;  1VRQ C;  3PO2 C;  4A3D K;  2CFA B;  3RZO K;  1O28 A;  2WB1 L;  4AYB D;  3IPJ A;  4BKW A;  1JVI A;  2FQO A;  4BBR K;  2NVX A;  2WAQ D;  1KQ4 A;  3AD7 C;  1TWH C;  3HOX C;  4A3I C;  4LK1 A;  4BBS C;  3H0G K;  2P5M A;  1O25 A;  3LAJ A;  1EQR A;  1JOE A;  3L4K A;  3CQZ C;  3GTP K;  1V5V A;  4BY7 K;  3TTG A;  3T02 A;  1WQH A;  1WOO A;  3GTL K;  3NUH A;  1IE0 A;  2Y0S D;  4BY7 C;  2NVT K;  4QJV A;  4IOA S;  3Q3Q A;  3S2D C;  3PIO S;  2JH3 A;  2ZJP S;  5M5Y K;  3N0C A;  1YCL A;  4BXX C;  1INN A;  3S0X A;  1XXB A;  3GTM K;  4KAS A;  4KAR A;  4BBR C;  2Y3P A;  1C0A A;  4C3H K;  4GTA A;  2V6T A;  2NVY A;  4GTB A;  3M3Y C;  1ZXO A;  4KC6 A;  1UV7 A;  5FJ8 K;  1G51 A;  4A3M C;  5IYC K;  3PO3 C;  3K7A C;  3SZY A;  1WCM A;  5M5X K;  5DM7 S;  3GTO C;  4KAT A;  1EI6 A;  4A3F C;  3GTG K;  2NVX C;  4ILD A;  1Y1V K;  4WFA S;  3A8J A;  3S16 C;  4KM9 A;  2YU9 A;  2NVX K;  1TWA C;  2R92 K;  3GTM C;  3GTQ A;  4MQ9 A;  3BUE A;  1PJ5 A;  5IOS A;  1TWC C;  3H0G A;  1WOP A;  1ZYR A;  4OIQ A;  2JA6 K;  2V6S A;  4FZB A;  3S1Q K;  5D4D A;  4A3C K;  3OPF A;  4QJV B;  1IL2 A;  3M3Y K;  3FKI C;  2D6F C;  2NVQ C;  4A3E C;  2O5J A;  3BP8 C;  4BY1 K;  3PIP S;  3PO3 K;  1GE9 A;  3HOW K;  2VUM K;  3RZO C;  4X6A K;  3GDZ A;  1I50 K;  3HOW C;  5JVG S;  5JVO A;  5IP9 K;  1J6X A;  3N0B A;  1O2F B;  4BLA A;  4KN7 A;  3M4O C;  4A3L C;  5CHP A;  5IYB C;  1XXC A;  3GTP A;  5M3F K;  4MEY A;  5HL7 S;  3GEI A;  2P8T A;  1DCH A;  4G0U A;  2XCO A;  5IYB K;  2JA5 A;  4AH6 A;  5E68 A;  4P5B A;  4A93 K;  5IYD K;  4P9S A;  2A68 A;  2XCR B;  1XZQ B;  3A8I A;  4P5A A;  2KPU A;  4KM8 A;  3HOY K;  3GTQ C;  4WIL A;  3GTM A;  1WOS A;  4WFB S;  4GTE A;  1K83 C;  2KXY A;  1I6V A;  4ZH4 A;  1I3Q K;  1ZQ1 C;  2PA8 L;  2V6U A;  4U67 S;  5TMF A;  4LLG A;  4C3H C;  1K83 K;  5M3M K;  2NVY K;  4GTF A;  4OIO A;  3GTJ K;  1SFO A;  3S17 K;  4Y52 K;  3S1Q C;  2ZJR S;  4M1X A;  4KN4 A;  4A93 C;  4A3K K;  1BJT A;  1Y1W K;  1TWG K;  5IOR A;  3S16 K;  4OIR A;  4A3B K;  4BY1 C;  1I6H K;  3GTG C;  4A3F K;  3QX3 A;  2ZJQ S;  2GAG C;  1HQM A;  5IP7 C;  2KQ1 A;  4KB2 A;  3I4N K;  2R7Z A;  2R93 A;  4A3L K;  2XCQ A;  3SZZ A;  3GTJ A;  2NVQ K;  1SFO K;  3AQO A;  1J6V A;  1WOR A;  2WAQ L;  3S2D K;  1WCM C;  1IS1 A;  2EBB A;  1TWG C;  4A3B C;  4Y7N K;  1BDF A;  1I6H C;  2A6H A;  3M4O K;  4KMH A;  2PPB A;  4C45 A;  1XZP A;  4XCH A;  4PAA A;  4Y7N C;  2CFA A;  1F9N A;  2R7Z C;  2GAH C;  4YFK A;  3LAP A;  2JA8 C;  2E2I C;  2R7Z K;  3I4N C;  2R93 K;  3H0G C;  1O2B A;  1TWC A;  2JA5 K;  4FM9 A;  4A3M K;  1EFW A;  3I4M C;  2KWA A;  4A3J C;  3H3V D;  2E2I K;  3GTK A;  5L46 A;  1PJ7 A;  3JST A;  4OIP A;  4A3J K;  1O2A A;  1TWG A;  1XXA A;  3S1M K;  3GIR A;  4LK0 A;  2E2H C;  3GTO A;  3GEE A;  1JQW A;  3HOV C;  1F7U A;  4MEX A;  4BXX K;  2E2H A;  2FQT A;  3S1R C;  2B63 A;  2O5I A;  4GTC A;  1VLO A;  5C4J C;  4C2M K;  3S1N K;  3S1R K;  1K83 A;  1VJE A;  4QIW D;  4GT9 A;  4XSZ A;  5IP7 K;  4YFN A;  3TFI A;  2RH6 A;  2GSN A;  1Y1W C;  3GTL C;  1PJ6 A;  2E2I A;  4YFX A;  1YNJ A;  5TJ3 A;  1Y1W A;  1IQ0 A;  2E2J C;  3L4J A;  3S14 K;  5DM6 S;  2Y0S L;  2WB1 D;  3T00 A;  3S1M C;  1XZP B;  3CAG A;  3GTO K;  1XZQ A;  3RZD C;  2B63 C;  2ZFZ A;  4A3D C;  3PO2 K;  4YG2 A;  3ADA C;  4XLN A;  3T01 A;  1USO A;  3BP3 A;  2B63 K;  1ZVU A;  2R92 C;  3CQZ A;  3N3Y A;  1SFO C;  1HI9 A;  1TWC K;  1J6W A;  5EGH A;  4QIW L;  5HL8 A;  4A3C C;  4C3J K;  5FLM C;  1TWF A;  1IW7 A;  2R93 C;  3GSI A;  1AB4 A;  4JK1 A;  3HKZ L;  4KMD A;  5C44 K;  1R9T A;  4IO9 S;  3FHZ A;  3HOU C;  4KDD A;  4C3J C;  1ISE A;  3FOE A;  1I50 A;  4LR2 A;  3WOD A;  1USM A;  2VUM C;  3HOY C;  1SMY A;  2L3U A;  1BS2 A;  1F93 A;  1O26 A;  3MML B;  4XSX A;  3GTG A;  3S2H C;  2E2H K;  2CW0 A;  5IOQ A;  3V4G A;  1Y1V A;  1I3Q C;  4NOI A;  3G4A A;  2PHC B;  2YU9 K;  3S2H K;  3H3V L;  5C4X C;  1YNN A;  1VGX A;  2JA5 C;  2GSU A;  4KAW X;  1B4A A;  4G0V A;  1TWA A;  4A3G K;  2YU9 C;  1TWF C;  5IOT A;  3FKI K;  4A3E K;  1WQG A;  4WJ3 M;  5FLM K;  1R9T K;  3HKZ D;  3G4C A;  3S15 C;  3VA7 A;  5IYD C;  4X6A C;  4IOC S;  4RMF A;  3EQL A;  3HOV K;  4GTD A;  1F7V A;  4OIN A;  4GFQ A;  4LQY A;  3HOZ K;  1FEU A;  5M5W K;  3FOF A;  1WSR A;  1XPP A;  1I3Q A;  1Y1V C;  3S1N C;  4WJ4 A;  3ERE D;  1WQF A;  1VH2 A;  1EH1 A;  4A3I K;  4BBS K;  4AYB L;  4G7H A;  2PMZ D;  5JVH S;  2JA7 A; 
#chains in the Genus database with same CATH homology
 4QJV A;  2O5I A;  5TMC A;  1TWF K;  3S2D C;  3S17 C;  5C4J C;  3GTQ C;  4C2M K;  3HOY K;  3GTP C;  3S1R K;  5M5Y K;  3S1N K;  4QIW D;  5IP7 K;  4XSZ A;  4C3I C;  4G7O A;  1K83 C;  4YFN A;  1I6V A;  4ZH4 A;  1I3Q K;  4XLP A;  4BXX C;  2PA8 L;  1Y1W C;  3GTL C;  5TMF A;  5C44 C;  4LLG A;  4C3H C;  4YFX A;  3GTM K;  1YNJ A;  1K83 K;  5M3M K;  2NVY K;  4OIO A;  3GTJ K;  3S17 K;  4Y52 K;  2E2J C;  3S14 K;  2Y0S L;  4BBR C;  3S1Q C;  3M4O K;  4C3H K;  3RZD K;  2WB1 D;  4KN4 A;  3S1M C;  4A93 C;  4KMU A;  4A3K K;  2JA8 K;  3GTO K;  5IP9 C;  2R93 K;  1Y1W K;  3M3Y C;  3CQZ K;  4Q4Z A;  3RZD C;  2B63 C;  2JA7 C;  3DXJ A;  3GTK K;  5C3E K;  2NVY C;  5FJ8 K;  4A3D C;  3PO2 K;  2A69 A;  4YG2 A;  4A3M C;  2BE5 A;  1TWG K;  3S16 K;  4OIR A;  4XLN A;  4A3B K;  4BY1 C;  5IYC K;  3PO3 C;  5C4X K;  3K7A C;  2B63 K;  3GTG C;  4A3F K;  1I6H K;  5C3E C;  2R92 C;  5M5X K;  1SFO C;  3GTO C;  3HOU K;  1TWC K;  2A6E A;  1HQM A;  3K7A K;  4G7Z A;  4A3F C;  4QIW L;  3GTG K;  5IP7 C;  2NVX C;  4C3I K;  1Y1V K;  4A3C C;  3S16 C;  1WCM K;  4C3J K;  5FLM C;  3I4N K;  1IW7 A;  1R9T C;  2R93 C;  4JK1 A;  3HKZ L;  5C44 K;  4A3L K;  2NVX K;  1TWA C;  2R92 K;  3GTM C;  2NVQ K;  4MQ9 A;  3HOU C;  1SFO K;  4GZY A;  1TWC C;  4C3J C;  2JA6 K;  1ZYR A;  4OIQ A;  3WOD A;  4LJZ A;  3S1Q K;  2VUM C;  2PA8 D;  5D4D A;  4C2M C;  1SMY A;  3HOY C;  5C4J K;  2WAQ L;  3S2D K;  4XSX A;  3HOZ C;  4A3G C;  1WCM C;  2JA6 C;  4A3C K;  4QJV B;  3GTQ K;  1TWH K;  3HOX K;  3S2H C;  3M3Y K;  2E2H K;  2CW0 A;  3FKI C;  1TWA K;  2JA7 K;  2NVQ C;  4A3E C;  1I3Q C;  2O5J A;  4NOI A;  4Q5S A;  1TWG C;  4A3B C;  3S2H K;  4Y7N K;  2YU9 K;  3H3V L;  5IYC C;  1YNN A;  1BDF A;  1I6H C;  5C4X C;  2A6H A;  2JA5 C;  2PMZ L;  4BY1 K;  4Y52 C;  2VUM K;  3S14 C;  3RZO C;  2E2J K;  3HOW K;  2PPB A;  3GTJ C;  3I4M K;  4X6A K;  4A3G K;  2NVT C;  4Y7N C;  2YU9 C;  3GTK C;  2R7Z C;  1I50 K;  1TWF C;  3HOW C;  3FKI K;  5IP9 K;  4YFK A;  4A3E K;  4A3K C;  2JA8 C;  1I50 C;  2E2I C;  2R7Z K;  3I4N C;  5FLM K;  1R9T K;  3PO2 C;  4A3D K;  3HKZ D;  3H0G C;  4KN7 A;  3M4O C;  3S15 C;  4A3L C;  4A3M K;  5IYD C;  2JA5 K;  2WB1 L;  3I4M C;  4X6A C;  4AYB D;  3RZO K;  5IYB C;  4A3J C;  3H3V D;  2E2I K;  3EQL A;  5M3F K;  4MEY A;  3HOV K;  4OIN A;  4BBR K;  4OIP A;  5IYB K;  2WAQ D;  4A3J K;  3HOZ K;  5M5W K;  3S1M K;  1TWH C;  3HOX C;  4A93 K;  4A3I C;  4LK0 A;  4LK1 A;  2E2H C;  4BBS C;  1XPP A;  3H0G K;  5IYD K;  1Y1V C;  3CQZ C;  2A68 A;  3S1N C;  3GTP K;  4BY7 K;  3PO3 K;  4A3I K;  3S15 K;  4BBS K;  3HOV C;  4MEX A;  4AYB L;  4BXX K;  4G7H A;  2PMZ D;  3GTL K;  3S1R C;  2Y0S D;  4BY7 C;  2NVT K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...