2BE5A

Crystal structure of the t. thermophilus rna polymerase holoenzyme in complex with inhibitor tagetitoxin
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
229
structure length
229
Chain Sequence
MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase alpha chain
publication title Structural basis for transcription inhibition by tagetitoxin
pubmed doi rcsb
molecule tags Transferase
total genus 42
structure length 229
sequence length 229
chains with identical sequence B, K, L
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2005-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01000 RNA_pol_A_bac RNA polymerase Rpb3/RpoA insert domain
A PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain
A PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.12 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 DNA-directed RNA polymerase, insert domain 2be5A02
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 2be5A01
3HOWK 3CQZC 4A93C 4C2MK 1TWGK 4QIWL 4AYBL 4C3HC 1TWCC 3EQLA 5FLMC 1Y1VC 2JA5C 5IP7K 5FJ8K 2PA8D 1SFOK 5C44K 5M3FK 4A3KK 4OIQA 5C4JK 3S1RC 4A3MK 4G7ZA 3I4NC 3FKIK 3S17K 3M4OK 4XSXA 3HOWC 4MEYA 1I50K 4C2MC 3HOUC 1TWGC 4A3GC 4QJVA 3GTKC 3K7AK 4C3JC 5IP7C 1SFOC 3HKZL 1K83C 5IYCK 4Y7NK 2R92K 5C44C 4A3KC 2NVYK 1SMYA 5C4JC 5C3EK 3S14K 4G7HA 4A3MC 3S1NC 5D4DA 1YNNA 3M4OC 4YFKA 4KMUA 3GTJK 4NOIA 3S1QC 2WB1L 1I50C 2PA8L 5C4XK 1R9TK 3RZDK 2R93K 2A69A 4ZH4A 2A68A 4C3IK 3S2DK 2R92C 2O5IA 4Y52C 2JA8K 3HOYK 2NVYC 2R7ZK 2WAQL 2WB1D 3S14C 3M3YC 3S1MC 3RZOK 4YG2A 3GTJC 4A3IC 2Y0SD 1R9TC 4A3JK 4BBSK 4A3EK 2NVXK 2CW0A 3RZDC 4OINA 2R93C 5M5XK 2E2IK 5IYBK 4A3CK 2PPBA 4OIRA 1TWHK 2WAQD 4LJZA 4C3IC 3S2DC 4BY1K 2VUMK 4BY7K 2JA8C 3HOYC 4X6AK 2R7ZC 3H3VD 4JK1A 4BBRK 3RZOC 4BBSC 4A3JC 5M3MK 3S16K 2NVXC 1IW7A 4A3DK 3FKIC 2E2IC 3S17C 4A3FK 4LK0A 5IYBC 2B63K 3DXJA 3GTOK 1TWHC 1TWAK 1Y1WK 3GTGK 4MEXA 5M5WK 2Y0SL 3K7AC 4X6AC 3GTMK 4A3BK 5IYCC 4Y7NC 1ZYRA 4YFNA 4BBRC 1I6HK 3GTPK 3S16C 1TWFK 5C3EC 1I3QK 3H0GK 4KN4A 2JA7K 2BE5A 4OIOA 2B63C 3H3VL 3GTOC 5C4XC 1Y1WC 3HOVK 3GTGC 3WODA 4OIPA 3CQZK 2E2HK 3GTQK 4A93K 3I4MK 4C3HK 4Q4ZA 1TWCK 5FLMK 4LLGA 5TMCA 1Y1VK 5IP9K 2NVQK 3H0GC 4XLNA 1WCMK 5M5YK 3HOZK 3PO2K 4BXXK 3PO3K 3S1RK 4XSZA 4A3EC 1BDFA 2E2JK 3HOVC 4A3CC 4A3LK 3GTQC 4KN7A 2E2HC 4GZYA 3HOUK 4XLPA 3S2HK 3HOXK 4A3GK 5TMFA 2PMZD 3I4MC 3GTKK 4C3JK 5IP9C 4BY1C 2VUMC 4BY7C 1K83K 2NVQC 1WCMC 2A6EA 3HOZC 3PO2C 2YU9K 4G7OA 1XPPA 2JA6K 4BXXC 1HQMA 1I6VA 3PO3C 4A3IK 3S15K 4QIWD 3GTLK 4AYBD 2NVTK 3S1NK 4A3LC 2E2JC 4A3DC 1YNJA 4A3FC 3S1QK 4LK1A 5IYDK 3S2HC 2O5JA 3HOXC 1TWAC 2A6HA 4QJVB 3GTMC 4Q5SA 4Y52K 4MQ9A 2YU9C 4A3BC 2JA5K 2JA6C 1I6HC 3S15C 3GTPC 2PMZL 3M3YK 1TWFC 1I3QC 2NVTC 3GTLC 3S1MK 4YFXA 2JA7C 5IYDC 3I4NK 3HKZD
chains in the Genus database with same CATH superfamily
2RH6A 4KARA 4A93C 1B4AA 1WCMA 4C3HC 1TWCC 2ZJQS 3S1RC 4G7ZA 3GTKA 4C2MC 4KB4A 2YU9A 4QJVA 3GEHA 3SZYA 1X31C 2PHCB 2XCQA 2GAHC 1K83C 5DM7S 2ZFZA 4A3KC 5C3EK 4G7HA 5D4DA 3A8KA 4KMUA 3S1QC 5C4XK 3TTGA 2A69A 4G0WA 4ZH4A 2A68A 4C3IK 3G4AA 2O5IA 3GEEA 4Y52C 1R9TA 2NVYC 2R7ZK 2WB1D 4A3IC 4A3JK 4BBSK 1DCPA 3RZDC 5M5XK 4OIRA 1TWHK 2WAQD 3S2DC 4BY7K 2JA8C 4JK1A 3RZOC 1J98A 1JOEA 2NVXC 4WILA 4A3DK 4GT9A 5IYBC 3GTGK 3A8JA 3VA7A 4KMHA 4MEXA 2Y0SL 4X6AC 3I4NK 1BGWA 4YFNA 1F93A 2B63C 3GTOC 2XCOA 3WODA 4J3NA 3GTQK 4A93K 4C3HK 1XXBA 4GTEA 3OPFA 4WJ3M 1TWCK 4KATA 4FZBA 1PJ6A 1WQFA 3H0GC 4WFBS 4XLNA 1L0WA 3S0XA 3S1RK 1DCOA 1ZVUA 2E2HC 3S2HK 3HOXK 4BY1C 1K83K 2JH3A 2JA6K 3GTGA 1ZXOA 3S1QK 3FOEA 5DM6S 4KMAA 1TWAC 4DDQA 4IO9S 3DLLS 4Y52K 1WOSA 4BKWA 1O2BA 2Y3PA 3S15C 3GTPC 2PMZL 1TWFC 1I3QC 3N0BA 3N3YA 3TFJA 3GTQA 2JA7C 1F7UA 2KWAA 3HKZD 1TWCA 3HOWK 2L3UA 2ZJRS 4G0UA 2ZUFA 5FLMC 2JA5C 5IP7K 1Y1VC 1JQWA 4P5AA 4WF9S 5FJ8K 2PA8D 4WCES 5JVHS 3NUHA 1IE0A 1INNA 1EI6A 3HXAA 2CFAA 5HL7S 3M4OK 3TFHA 4MEYA 4AH6A 3HOUC 1TWGC 1K83A 4KASA 5CJ9A 3FOFA 1SFOC 5C44C 1USMA 5C4JC 3S14K 3Q3QA 4A3MC 3S1NC 4P9SA 1R9TK 2WB1L 1B4BA 1I50C 2R93K 3CF5S 2V6UA 2RGRA 2R92C 3LPXA 2ZJPS 4KC6A 2WAQL 4KM8A 2GSNA 3M3YC 3CAGA 3GTJC 1WIHA 2CW0A 2E2IK 4XCHA 4KMDA 3PIPS 4BY1K 3FHZA 3HOYC 1J6VA 3IPJA 4IOAS 5IOSA 4GTAA 4BBRK 1KQ4A 3S16K 3SZZA 5M3MK 3FKIC 3S17C 1VLOA 3DXJA 1TWAK 1G51A 2XCRB 1BS2A 4Y7NC 1ZYRA 3GTPK 3GSIA 4GFQA 1TWFK 1I3QK 1AB4A 2R93A 2JA7K 2BE5A 4OIOA 3H3VL 1O2FB 1Y1WC 3HOVK 1JVIA 5FLMK 5TMCA 3LYWA 1Y1VK 5IP9K 3QX3A 4WFNS 3HOZK 2E2IA 2E2HA 3T02A 4KDDA 1ZQ1C 4KM9A 3PO3K 4BXXK 1VGXA 4XSZA 4A3EC 1BDFA 3OREA 4KN7A 4GZYA 5IOQA 3HOUK 3ADAC 1ZBSA 3I4MC 4G0VA 1RU0A 2VUMC 2NVQC 1WCMC 1DCHA 2A6EA 3PO2C 4GTFA 1IBAA 2EBBA 1HQMA 1TWAA 3S1NK 3GTLK 2NVTK 1ISEA 4A3LC 2E2JC 2GSOA 2O5JA 2V6TA 2A6HA 3AH5A 3GTPA 1V5VA 1TWFA 1I3QA 2JA7A 2YU9C 4A3BC 1EQRA 1I6HC 3M3YK 5L46A 4YFXA 5IYDC 4M1XA 3JSTA 1DD5A 2JA5A 1Y1VA 3CQZC 4C2MK 4QIWL 3A8IA 4AYBL 1WOOA 5CHPA 3EQLA 2GAGC 4GTCA 4A3KK 3I4NC 3FKIK 3S17K 1SFOA 4A3GC 3GTLA 4Y7NK 2NVYK 4WJ4A 1SMYA 1YNNA 4A3IK 2FQOA 3RZDK 2FQTA 3S2DK 1EK8A 2JA8K 3RZOK 4YG2A 2W7VA 2Y0SD 1VJEA 4A3EK 2NVXK 1J6XA 3TFIA 5IYBK 2PPBA 2KQ1A 4BLAA 4PABA 4C3IC 5EGEA 1WSVA 2VUMK 4X6AK 2R7ZC 3AQOA 1XZPB 3FKIA 1C0AA 4BBSC 4A3JC 1EH1A 3BP8C 2P5MA 2B63K 3GTOK 1TWHC 2ZUEA 1O26A 2NVYA 4FM9A 3K7AC 4A3BK 5IYCC 1YX2A 1I6HK 3H0GK 3GTGC 3CQZK 4OIPA 2E2HK 3LAPA 4Q4ZA 4U67S 1O29A 2P8TA 1O28A 2NVXA 3PIOS 4IOCS 4A3CC 3GTQC 1XZQB 2VUMA 3GIRA 4A3GK 2PMZD 1XXAA 4G7OA 1XPPA 2B63A 3GTOA 3S15K 5HL8A 4A3FC 3MMLB 3S2HC 3HOXC 2D6FC 3H0GA 4QJVB 3GTMC 5JFEA 4MQ9A 1F7VA 2JA5K 2JA6C 1VRQC 1YCLA 4KAWX 5IORA 3CQZA 4WFAS 4BLBA 5M3FK 4LR2A 1TWGK 3GEIA 1SFOK 5C44K 1WSRA 3GDZA 4OIQA 5C4JK 4A3MK 3LAJA 4XSXA 3HOWC 2KXYA 1I50K 4GTDA 4RMFA 3GTKC 3K7AK 4C3JC 5JVOA 2GSUA 5IP7C 5EGHA 5IYCK 3HKZL 2R92K 5E68A 3GTJK 3M4OC 4YFKA 4NOIA 3T01A 2PA8L 4GTLA 1WQGA 1WOPA 1WQHA 2V6SA 5HQHA 1O2AA 3L4KA 3HOYK 3V4GA 1WORA 3L4JA 3S14C 3S1MC 1R9TC 1TWGA 4A3CK 4OINA 2R93C 2L5NA 3AD9C 2R7ZA 1IQ0A 1USOA 1UV7A 4LJZA 1IL2A 2KPUA 1PJ7A 1F9NA 3H3VD 1TWHA 1IS1A 1I50A 1IW7A 4LOWA 4A3FK 2E2IC 1J6WA 4LK0A 1VH2A 1Y1WK 3BUEA 2R92A 4P5BA 5M5WK 4KB2A 3BP3A 3GTMK 3GTJA 4BBRC 1BJTA 3S16C 5C3EC 4KN4A 1PJ5A 4O2DA 1EFWA 5C4XC 3AD8C 4C45A 1FEUA 3I4MK 1XZPA 4LLGA 2NVQK 1WCMK 4GTBA 3N0CA 4LQYA 5M5YK 3PO2K 5TJ3A 3OEPA 4A3LK 2E2JK 1O27A 3HOVC 3AD7C 1O25A 4XLPA 5TMFA 3GTKK 4C3JK 5IP9C 4BY7C 4PAAA 3HOZC 2YU9K 3G4CA 4BXXC 1I6VA 3PO3C 1HI9A 4QIWD 4AYBD 1XXCA 1Y1WA 4A3DC 1YNJA 5IYDK 4LK1A 2CFAB 3GTMA 1O24A 2JA6A 5JVGS 3T00A 4Q5SA 3ERED 3S1MK 3GTLC 2NVTC 3AQPA 1GE9A 1XZQA 5IOTA 4ILDA
chains in the Genus database with same CATH topology
3HOWK 3CQZC 4A93C 4C2MK 1TWGK 4QIWL 4AYBL 4C3HC 1TWCC 3EQLA 5FLMC 1Y1VC 2JA5C 5IP7K 5FJ8K 2PA8D 1SFOK 5C44K 5M3FK 4A3KK 4OIQA 5C4JK 3S1RC 4A3MK 4G7ZA 3I4NC 3FKIK 3S17K 3M4OK 4XSXA 3HOWC 4MEYA 1I50K 4C2MC 3HOUC 1TWGC 4A3GC 4QJVA 3GTKC 3K7AK 4C3JC 5IP7C 1SFOC 3HKZL 1K83C 5IYCK 4Y7NK 2R92K 5C44C 4A3KC 2NVYK 1SMYA 5C4JC 5C3EK 3S14K 4G7HA 4A3MC 3S1NC 5D4DA 1YNNA 3M4OC 4YFKA 4KMUA 3GTJK 4NOIA 3S1QC 2WB1L 1I50C 2PA8L 5C4XK 1R9TK 3RZDK 2R93K 2A69A 4ZH4A 2A68A 4C3IK 3S2DK 2R92C 2O5IA 4Y52C 2JA8K 3HOYK 2NVYC 2R7ZK 2WAQL 2WB1D 3S14C 3M3YC 3S1MC 3RZOK 4YG2A 3GTJC 4A3IC 2Y0SD 1R9TC 4A3JK 4BBSK 4A3EK 2NVXK 2CW0A 3RZDC 4OINA 2R93C 5M5XK 2E2IK 5IYBK 4A3CK 2PPBA 4OIRA 1TWHK 2WAQD 4LJZA 4C3IC 3S2DC 4BY1K 2VUMK 4BY7K 2JA8C 3HOYC 4X6AK 2R7ZC 3H3VD 4JK1A 4BBRK 3RZOC 4BBSC 4A3JC 5M3MK 3S16K 2NVXC 1IW7A 4A3DK 3FKIC 2E2IC 3S17C 4A3FK 4LK0A 5IYBC 2B63K 3DXJA 3GTOK 1TWHC 1TWAK 1Y1WK 3GTGK 4MEXA 5M5WK 2Y0SL 3K7AC 4X6AC 3GTMK 4A3BK 5IYCC 4Y7NC 1ZYRA 4YFNA 4BBRC 1I6HK 3GTPK 3S16C 1TWFK 5C3EC 1I3QK 3H0GK 4KN4A 2JA7K 2BE5A 4OIOA 2B63C 3H3VL 3GTOC 5C4XC 1Y1WC 3HOVK 3GTGC 3WODA 4OIPA 3CQZK 2E2HK 3GTQK 4A93K 3I4MK 4C3HK 4Q4ZA 1TWCK 5FLMK 4LLGA 5TMCA 1Y1VK 5IP9K 2NVQK 3H0GC 4XLNA 1WCMK 5M5YK 3HOZK 3PO2K 4BXXK 3PO3K 3S1RK 4XSZA 4A3EC 1BDFA 2E2JK 3HOVC 4A3CC 4A3LK 3GTQC 4KN7A 2E2HC 4GZYA 3HOUK 4XLPA 3S2HK 3HOXK 4A3GK 5TMFA 2PMZD 3I4MC 3GTKK 4C3JK 5IP9C 4BY1C 2VUMC 4BY7C 1K83K 2NVQC 1WCMC 2A6EA 3HOZC 3PO2C 2YU9K 4G7OA 1XPPA 2JA6K 4BXXC 1HQMA 1I6VA 3PO3C 4A3IK 3S15K 4QIWD 3GTLK 4AYBD 2NVTK 3S1NK 4A3LC 2E2JC 4A3DC 1YNJA 4A3FC 3S1QK 4LK1A 5IYDK 3S2HC 2O5JA 3HOXC 1TWAC 2A6HA 4QJVB 3GTMC 4Q5SA 4Y52K 4MQ9A 2YU9C 4A3BC 2JA5K 2JA6C 1I6HC 3S15C 3GTPC 2PMZL 3M3YK 1TWFC 1I3QC 2NVTC 3GTLC 3S1MK 4YFXA 2JA7C 5IYDC 3I4NK 3HKZD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HOW K;  3CQZ C;  4A93 C;  4C2M K;  1TWG K;  4QIW L;  4AYB L;  4C3H C;  1TWC C;  3EQL A;  5FLM C;  1Y1V C;  2JA5 C;  5IP7 K;  5FJ8 K;  2PA8 D;  1SFO K;  5C44 K;  5M3F K;  4A3K K;  4OIQ A;  5C4J K;  3S1R C;  4A3M K;  4G7Z A;  3I4N C;  3FKI K;  3S17 K;  3M4O K;  4XSX A;  3HOW C;  4MEY A;  1I50 K;  4C2M C;  3HOU C;  1TWG C;  4A3G C;  4QJV A;  3GTK C;  3K7A K;  4C3J C;  5IP7 C;  1SFO C;  3HKZ L;  1K83 C;  5IYC K;  4Y7N K;  2R92 K;  5C44 C;  4A3K C;  2NVY K;  1SMY A;  5C4J C;  5C3E K;  3S14 K;  4G7H A;  4A3M C;  3S1N C;  5D4D A;  1YNN A;  3M4O C;  4YFK A;  4KMU A;  3GTJ K;  4NOI A;  3S1Q C;  2WB1 L;  1I50 C;  2PA8 L;  5C4X K;  1R9T K;  3RZD K;  2R93 K;  2A69 A;  4ZH4 A;  2A68 A;  4C3I K;  3S2D K;  2R92 C;  2O5I A;  4Y52 C;  2JA8 K;  3HOY K;  2NVY C;  2R7Z K;  2WAQ L;  2WB1 D;  3S14 C;  3M3Y C;  3S1M C;  3RZO K;  4YG2 A;  3GTJ C;  4A3I C;  2Y0S D;  1R9T C;  4A3J K;  4BBS K;  4A3E K;  2NVX K;  2CW0 A;  3RZD C;  4OIN A;  2R93 C;  5M5X K;  2E2I K;  5IYB K;  4A3C K;  2PPB A;  4OIR A;  1TWH K;  2WAQ D;  4LJZ A;  4C3I C;  3S2D C;  4BY1 K;  2VUM K;  4BY7 K;  2JA8 C;  3HOY C;  4X6A K;  2R7Z C;  3H3V D;  4JK1 A;  4BBR K;  3RZO C;  4BBS C;  4A3J C;  5M3M K;  3S16 K;  2NVX C;  1IW7 A;  4A3D K;  3FKI C;  2E2I C;  3S17 C;  4A3F K;  4LK0 A;  5IYB C;  2B63 K;  3DXJ A;  3GTO K;  1TWH C;  1TWA K;  1Y1W K;  3GTG K;  4MEX A;  5M5W K;  2Y0S L;  3K7A C;  4X6A C;  3GTM K;  4A3B K;  5IYC C;  4Y7N C;  1ZYR A;  4YFN A;  4BBR C;  1I6H K;  3GTP K;  3S16 C;  1TWF K;  5C3E C;  1I3Q K;  3H0G K;  4KN4 A;  2JA7 K;  2BE5 A;  4OIO A;  2B63 C;  3H3V L;  3GTO C;  5C4X C;  1Y1W C;  3HOV K;  3GTG C;  3WOD A;  4OIP A;  3CQZ K;  2E2H K;  3GTQ K;  4A93 K;  3I4M K;  4C3H K;  4Q4Z A;  1TWC K;  5FLM K;  4LLG A;  5TMC A;  1Y1V K;  5IP9 K;  2NVQ K;  3H0G C;  4XLN A;  1WCM K;  5M5Y K;  3HOZ K;  3PO2 K;  4BXX K;  3PO3 K;  3S1R K;  4XSZ A;  4A3E C;  1BDF A;  2E2J K;  3HOV C;  4A3C C;  4A3L K;  3GTQ C;  4KN7 A;  2E2H C;  4GZY A;  3HOU K;  4XLP A;  3S2H K;  3HOX K;  4A3G K;  5TMF A;  2PMZ D;  3I4M C;  3GTK K;  4C3J K;  5IP9 C;  4BY1 C;  2VUM C;  4BY7 C;  1K83 K;  2NVQ C;  1WCM C;  2A6E A;  3HOZ C;  3PO2 C;  2YU9 K;  4G7O A;  1XPP A;  2JA6 K;  4BXX C;  1HQM A;  1I6V A;  3PO3 C;  4A3I K;  3S15 K;  4QIW D;  3GTL K;  4AYB D;  2NVT K;  3S1N K;  4A3L C;  2E2J C;  4A3D C;  1YNJ A;  4A3F C;  3S1Q K;  4LK1 A;  5IYD K;  3S2H C;  2O5J A;  3HOX C;  1TWA C;  2A6H A;  4QJV B;  3GTM C;  4Q5S A;  4Y52 K;  4MQ9 A;  2YU9 C;  4A3B C;  2JA5 K;  2JA6 C;  1I6H C;  3S15 C;  3GTP C;  2PMZ L;  3M3Y K;  1TWF C;  1I3Q C;  2NVT C;  3GTL C;  3S1M K;  4YFX A;  2JA7 C;  5IYD C;  3I4N K;  3HKZ D; 
#chains in the Genus database with same CATH topology
 2RH6 A;  4KAR A;  4A93 C;  1B4A A;  1WCM A;  4C3H C;  1TWC C;  2ZJQ S;  3S1R C;  4G7Z A;  3GTK A;  4C2M C;  4KB4 A;  2YU9 A;  4QJV A;  3GEH A;  3SZY A;  1X31 C;  2PHC B;  2XCQ A;  2GAH C;  1K83 C;  5DM7 S;  2ZFZ A;  4A3K C;  5C3E K;  4G7H A;  5D4D A;  3A8K A;  4KMU A;  3S1Q C;  5C4X K;  3TTG A;  2A69 A;  4G0W A;  4ZH4 A;  2A68 A;  4C3I K;  3G4A A;  2O5I A;  3GEE A;  4Y52 C;  1R9T A;  2NVY C;  2R7Z K;  2WB1 D;  4A3I C;  4A3J K;  4BBS K;  1DCP A;  3RZD C;  5M5X K;  4OIR A;  1TWH K;  2WAQ D;  3S2D C;  4BY7 K;  2JA8 C;  4JK1 A;  3RZO C;  1J98 A;  1JOE A;  2NVX C;  4WIL A;  4A3D K;  4GT9 A;  5IYB C;  3GTG K;  3A8J A;  3VA7 A;  4KMH A;  4MEX A;  2Y0S L;  4X6A C;  3I4N K;  1BGW A;  4YFN A;  1F93 A;  2B63 C;  3GTO C;  2XCO A;  3WOD A;  4J3N A;  3GTQ K;  4A93 K;  4C3H K;  1XXB A;  4GTE A;  3OPF A;  4WJ3 M;  1TWC K;  4KAT A;  4FZB A;  1PJ6 A;  1WQF A;  3H0G C;  4WFB S;  4XLN A;  1L0W A;  3S0X A;  3S1R K;  1DCO A;  1ZVU A;  2E2H C;  3S2H K;  3HOX K;  4BY1 C;  1K83 K;  2JH3 A;  2JA6 K;  3GTG A;  1ZXO A;  3S1Q K;  3FOE A;  5DM6 S;  4KMA A;  1TWA C;  4DDQ A;  4IO9 S;  3DLL S;  4Y52 K;  1WOS A;  4BKW A;  1O2B A;  2Y3P A;  3S15 C;  3GTP C;  2PMZ L;  1TWF C;  1I3Q C;  3N0B A;  3N3Y A;  3TFJ A;  3GTQ A;  2JA7 C;  1F7U A;  2KWA A;  3HKZ D;  1TWC A;  3HOW K;  2L3U A;  2ZJR S;  4G0U A;  2ZUF A;  5FLM C;  2JA5 C;  5IP7 K;  1Y1V C;  1JQW A;  4P5A A;  4WF9 S;  5FJ8 K;  2PA8 D;  4WCE S;  5JVH S;  3NUH A;  1IE0 A;  1INN A;  1EI6 A;  3HXA A;  2CFA A;  5HL7 S;  3M4O K;  3TFH A;  4MEY A;  4AH6 A;  3HOU C;  1TWG C;  1K83 A;  4KAS A;  5CJ9 A;  3FOF A;  1SFO C;  5C44 C;  1USM A;  5C4J C;  3S14 K;  3Q3Q A;  4A3M C;  3S1N C;  4P9S A;  1R9T K;  2WB1 L;  1B4B A;  1I50 C;  2R93 K;  3CF5 S;  2V6U A;  2RGR A;  2R92 C;  3LPX A;  2ZJP S;  4KC6 A;  2WAQ L;  4KM8 A;  2GSN A;  3M3Y C;  3CAG A;  3GTJ C;  1WIH A;  2CW0 A;  2E2I K;  4XCH A;  4KMD A;  3PIP S;  4BY1 K;  3FHZ A;  3HOY C;  1J6V A;  3IPJ A;  4IOA S;  5IOS A;  4GTA A;  4BBR K;  1KQ4 A;  3S16 K;  3SZZ A;  5M3M K;  3FKI C;  3S17 C;  1VLO A;  3DXJ A;  1TWA K;  1G51 A;  2XCR B;  1BS2 A;  4Y7N C;  1ZYR A;  3GTP K;  3GSI A;  4GFQ A;  1TWF K;  1I3Q K;  1AB4 A;  2R93 A;  2JA7 K;  2BE5 A;  4OIO A;  3H3V L;  1O2F B;  1Y1W C;  3HOV K;  1JVI A;  5FLM K;  5TMC A;  3LYW A;  1Y1V K;  5IP9 K;  3QX3 A;  4WFN S;  3HOZ K;  2E2I A;  2E2H A;  3T02 A;  4KDD A;  1ZQ1 C;  4KM9 A;  3PO3 K;  4BXX K;  1VGX A;  4XSZ A;  4A3E C;  1BDF A;  3ORE A;  4KN7 A;  4GZY A;  5IOQ A;  3HOU K;  3ADA C;  1ZBS A;  3I4M C;  4G0V A;  1RU0 A;  2VUM C;  2NVQ C;  1WCM C;  1DCH A;  2A6E A;  3PO2 C;  4GTF A;  1IBA A;  2EBB A;  1HQM A;  1TWA A;  3S1N K;  3GTL K;  2NVT K;  1ISE A;  4A3L C;  2E2J C;  2GSO A;  2O5J A;  2V6T A;  2A6H A;  3AH5 A;  3GTP A;  1V5V A;  1TWF A;  1I3Q A;  2JA7 A;  2YU9 C;  4A3B C;  1EQR A;  1I6H C;  3M3Y K;  5L46 A;  4YFX A;  5IYD C;  4M1X A;  3JST A;  1DD5 A;  2JA5 A;  1Y1V A;  3CQZ C;  4C2M K;  4QIW L;  3A8I A;  4AYB L;  1WOO A;  5CHP A;  3EQL A;  2GAG C;  4GTC A;  4A3K K;  3I4N C;  3FKI K;  3S17 K;  1SFO A;  4A3G C;  3GTL A;  4Y7N K;  2NVY K;  4WJ4 A;  1SMY A;  1YNN A;  4A3I K;  2FQO A;  3RZD K;  2FQT A;  3S2D K;  1EK8 A;  2JA8 K;  3RZO K;  4YG2 A;  2W7V A;  2Y0S D;  1VJE A;  4A3E K;  2NVX K;  1J6X A;  3TFI A;  5IYB K;  2PPB A;  2KQ1 A;  4BLA A;  4PAB A;  4C3I C;  5EGE A;  1WSV A;  2VUM K;  4X6A K;  2R7Z C;  3AQO A;  1XZP B;  3FKI A;  1C0A A;  4BBS C;  4A3J C;  1EH1 A;  3BP8 C;  2P5M A;  2B63 K;  3GTO K;  1TWH C;  2ZUE A;  1O26 A;  2NVY A;  4FM9 A;  3K7A C;  4A3B K;  5IYC C;  1YX2 A;  1I6H K;  3H0G K;  3GTG C;  3CQZ K;  4OIP A;  2E2H K;  3LAP A;  4Q4Z A;  4U67 S;  1O29 A;  2P8T A;  1O28 A;  2NVX A;  3PIO S;  4IOC S;  4A3C C;  3GTQ C;  1XZQ B;  2VUM A;  3GIR A;  4A3G K;  2PMZ D;  1XXA A;  4G7O A;  1XPP A;  2B63 A;  3GTO A;  3S15 K;  5HL8 A;  4A3F C;  3MML B;  3S2H C;  3HOX C;  2D6F C;  3H0G A;  4QJV B;  3GTM C;  5JFE A;  4MQ9 A;  1F7V A;  2JA5 K;  2JA6 C;  1VRQ C;  1YCL A;  4KAW X;  5IOR A;  3CQZ A;  4WFA S;  4BLB A;  5M3F K;  4LR2 A;  1TWG K;  3GEI A;  1SFO K;  5C44 K;  1WSR A;  3GDZ A;  4OIQ A;  5C4J K;  4A3M K;  3LAJ A;  4XSX A;  3HOW C;  2KXY A;  1I50 K;  4GTD A;  4RMF A;  3GTK C;  3K7A K;  4C3J C;  5JVO A;  2GSU A;  5IP7 C;  5EGH A;  5IYC K;  3HKZ L;  2R92 K;  5E68 A;  3GTJ K;  3M4O C;  4YFK A;  4NOI A;  3T01 A;  2PA8 L;  4GTL A;  1WQG A;  1WOP A;  1WQH A;  2V6S A;  5HQH A;  1O2A A;  3L4K A;  3HOY K;  3V4G A;  1WOR A;  3L4J A;  3S14 C;  3S1M C;  1R9T C;  1TWG A;  4A3C K;  4OIN A;  2R93 C;  2L5N A;  3AD9 C;  2R7Z A;  1IQ0 A;  1USO A;  1UV7 A;  4LJZ A;  1IL2 A;  2KPU A;  1PJ7 A;  1F9N A;  3H3V D;  1TWH A;  1IS1 A;  1I50 A;  1IW7 A;  4LOW A;  4A3F K;  2E2I C;  1J6W A;  4LK0 A;  1VH2 A;  1Y1W K;  3BUE A;  2R92 A;  4P5B A;  5M5W K;  4KB2 A;  3BP3 A;  3GTM K;  3GTJ A;  4BBR C;  1BJT A;  3S16 C;  5C3E C;  4KN4 A;  1PJ5 A;  4O2D A;  1EFW A;  5C4X C;  3AD8 C;  4C45 A;  1FEU A;  3I4M K;  1XZP A;  4LLG A;  2NVQ K;  1WCM K;  4GTB A;  3N0C A;  4LQY A;  5M5Y K;  3PO2 K;  5TJ3 A;  3OEP A;  4A3L K;  2E2J K;  1O27 A;  3HOV C;  3AD7 C;  1O25 A;  4XLP A;  5TMF A;  3GTK K;  4C3J K;  5IP9 C;  4BY7 C;  4PAA A;  3HOZ C;  2YU9 K;  3G4C A;  4BXX C;  1I6V A;  3PO3 C;  1HI9 A;  4QIW D;  4AYB D;  1XXC A;  1Y1W A;  4A3D C;  1YNJ A;  5IYD K;  4LK1 A;  2CFA B;  3GTM A;  1O24 A;  2JA6 A;  5JVG S;  3T00 A;  4Q5S A;  3ERE D;  3S1M K;  3GTL C;  2NVT C;  3AQP A;  1GE9 A;  1XZQ A;  5IOT A;  4ILD A; 
#chains in the Genus database with same CATH homology
 3HOW K;  3CQZ C;  4A93 C;  4C2M K;  1TWG K;  4QIW L;  4AYB L;  4C3H C;  1TWC C;  3EQL A;  5FLM C;  1Y1V C;  2JA5 C;  5IP7 K;  5FJ8 K;  2PA8 D;  1SFO K;  5C44 K;  5M3F K;  4A3K K;  4OIQ A;  5C4J K;  3S1R C;  4A3M K;  4G7Z A;  3I4N C;  3FKI K;  3S17 K;  3M4O K;  4XSX A;  3HOW C;  4MEY A;  1I50 K;  4C2M C;  3HOU C;  1TWG C;  4A3G C;  4QJV A;  3GTK C;  3K7A K;  4C3J C;  5IP7 C;  1SFO C;  3HKZ L;  1K83 C;  5IYC K;  4Y7N K;  2R92 K;  5C44 C;  4A3K C;  2NVY K;  1SMY A;  5C4J C;  5C3E K;  3S14 K;  4G7H A;  4A3M C;  3S1N C;  5D4D A;  1YNN A;  3M4O C;  4YFK A;  4KMU A;  3GTJ K;  4NOI A;  3S1Q C;  2WB1 L;  1I50 C;  2PA8 L;  5C4X K;  1R9T K;  3RZD K;  2R93 K;  2A69 A;  4ZH4 A;  2A68 A;  4C3I K;  3S2D K;  2R92 C;  2O5I A;  4Y52 C;  2JA8 K;  3HOY K;  2NVY C;  2R7Z K;  2WAQ L;  2WB1 D;  3S14 C;  3M3Y C;  3S1M C;  3RZO K;  4YG2 A;  3GTJ C;  4A3I C;  2Y0S D;  1R9T C;  4A3J K;  4BBS K;  4A3E K;  2NVX K;  2CW0 A;  3RZD C;  4OIN A;  2R93 C;  5M5X K;  2E2I K;  5IYB K;  4A3C K;  2PPB A;  4OIR A;  1TWH K;  2WAQ D;  4LJZ A;  4C3I C;  3S2D C;  4BY1 K;  2VUM K;  4BY7 K;  2JA8 C;  3HOY C;  4X6A K;  2R7Z C;  3H3V D;  4JK1 A;  4BBR K;  3RZO C;  4BBS C;  4A3J C;  5M3M K;  3S16 K;  2NVX C;  1IW7 A;  4A3D K;  3FKI C;  2E2I C;  3S17 C;  4A3F K;  4LK0 A;  5IYB C;  2B63 K;  3DXJ A;  3GTO K;  1TWH C;  1TWA K;  1Y1W K;  3GTG K;  4MEX A;  5M5W K;  2Y0S L;  3K7A C;  4X6A C;  3GTM K;  4A3B K;  5IYC C;  4Y7N C;  1ZYR A;  4YFN A;  4BBR C;  1I6H K;  3GTP K;  3S16 C;  1TWF K;  5C3E C;  1I3Q K;  3H0G K;  4KN4 A;  2JA7 K;  2BE5 A;  4OIO A;  2B63 C;  3H3V L;  3GTO C;  5C4X C;  1Y1W C;  3HOV K;  3GTG C;  3WOD A;  4OIP A;  3CQZ K;  2E2H K;  3GTQ K;  4A93 K;  3I4M K;  4C3H K;  4Q4Z A;  1TWC K;  5FLM K;  4LLG A;  5TMC A;  1Y1V K;  5IP9 K;  2NVQ K;  3H0G C;  4XLN A;  1WCM K;  5M5Y K;  3HOZ K;  3PO2 K;  4BXX K;  3PO3 K;  3S1R K;  4XSZ A;  4A3E C;  1BDF A;  2E2J K;  3HOV C;  4A3C C;  4A3L K;  3GTQ C;  4KN7 A;  2E2H C;  4GZY A;  3HOU K;  4XLP A;  3S2H K;  3HOX K;  4A3G K;  5TMF A;  2PMZ D;  3I4M C;  3GTK K;  4C3J K;  5IP9 C;  4BY1 C;  2VUM C;  4BY7 C;  1K83 K;  2NVQ C;  1WCM C;  2A6E A;  3HOZ C;  3PO2 C;  2YU9 K;  4G7O A;  1XPP A;  2JA6 K;  4BXX C;  1HQM A;  1I6V A;  3PO3 C;  4A3I K;  3S15 K;  4QIW D;  3GTL K;  4AYB D;  2NVT K;  3S1N K;  4A3L C;  2E2J C;  4A3D C;  1YNJ A;  4A3F C;  3S1Q K;  4LK1 A;  5IYD K;  3S2H C;  2O5J A;  3HOX C;  1TWA C;  2A6H A;  4QJV B;  3GTM C;  4Q5S A;  4Y52 K;  4MQ9 A;  2YU9 C;  4A3B C;  2JA5 K;  2JA6 C;  1I6H C;  3S15 C;  3GTP C;  2PMZ L;  3M3Y K;  1TWF C;  1I3Q C;  2NVT C;  3GTL C;  3S1M K;  4YFX A;  2JA7 C;  5IYD C;  3I4N K;  3HKZ D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...