2BE5A

Crystal structure of the t. thermophilus rna polymerase holoenzyme in complex with inhibitor tagetitoxin
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
229
structure length
229
Chain Sequence
MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase alpha chain
publication title Structural basis for transcription inhibition by tagetitoxin
pubmed doi rcsb
molecule tags Transferase
total genus 42
structure length 229
sequence length 229
chains with identical sequence B, K, L
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2005-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01000 RNA_pol_A_bac RNA polymerase Rpb3/RpoA insert domain
A PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain
A PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.12 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 DNA-directed RNA polymerase, insert domain 2be5A02
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 2be5A01
2R92C 2A68A 2O5IA 3S2DC 4C3HK 5IYBK 3S1RK 2E2HK 1SMYA 4Y52K 3M4OC 5C4XK 2VUMC 5IP7K 2NVTC 4YFNA 4A3GK 2PA8L 5C44K 4NOIA 4BY1C 3S2HK 4G7ZA 3I4MK 4Q5SA 3CQZK 4BBSK 4A3EC 4A3BK 4XLPA 3H0GK 3S16C 3S1QC 3I4NC 3S2HC 3PO3K 5IYBC 4C3HC 1TWFK 3K7AC 3GTOK 4A3LK 4A3IK 3S1MK 2E2HC 2R92K 4QJVA 4OIQA 4X6AK 5IP7C 5C4XC 5IYCC 4QIWL 2A69A 4OIOA 5C44C 3GTKK 2JA6K 2VUMK 3I4MC 4ZH4A 3CQZC 4BBSC 4BY1K 2WAQD 3HOWK 4A3BC 3HKZD 3H0GC 1YNJA 1SFOK 4A3EK 3I4NK 3GTQK 2YU9K 3PO3C 4A3MK 2NVXK 1TWFC 3S1QK 3GTOC 4LK0A 4XSXA 5IP9C 4A3IC 4QJVB 2PMZD 1I3QK 3K7AK 3H3VD 5FLMK 2Y0SD 4LJZA 3GTKC 2JA6C 2PMZL 5IYCK 4C3IK 4A3JC 5C3EC 4C3JK 3S15K 5FJ8K 2A6EA 3HOWC 4KN4A 4BY7K 2B63K 4GZYA 1WCMK 3EQLA 1SFOC 1IW7A 2CW0A 1HQMA 2YU9C 3GTQC 4A3MC 2NVXC 3HOZK 2BE5A 4G7OA 2WB1D 1I3QC 1I50K 4Y7NK 5M5XK 4A3FK 5FLMC 5IP9K 5IYDK 2O5JA 4G7HA 4C3IC 2E2IK 4C3JC 4XSZA 3S15C 3M3YK 5C4JK 1K83K 4BY7C 2B63C 5C3EK 4A3JK 1WCMC 3S14K 2JA7K 4MQ9A 3HOZC 3DXJA 4A93K 3PO2K 2WAQL 2JA8K 2JA5C 3HKZL 3HOYK 2PPBA 4XLNA 5IYDC 1I50C 1I6VA 4Y7NC 4A3FC 5M5WK 4OINA 4A3KK 3GTJK 4MEXA 4A3DK 2E2IC 3S17K 3GTLK 2NVYK 1R9TK 3M3YC 5C4JC 1K83C 3H3VL 2Y0SL 3S14C 5D4DA 4Q4ZA 2JA7C 4A93C 3PO2C 2JA8C 4LK1A 3HOVC 3HOYC 4A3KC 2NVQK 4C2MK 2JA5K 3GTJC 2R93K 1BDFA 3HOUK 4AYBD 1ZYRA 5TMFA 3S17C 4OIRA 3GTLC 2NVYC 1R9TC 4A3DC 2WB1L 5M3MK 1TWGK 3GTGK 1TWCC 4KMUA 4MEYA 3S1NK 3WODA 4BBRC 1YNNA 1TWAC 3GTPC 3RZOK 3RZDK 2A6HA 2NVQC 1Y1VK 2PA8D 4C2MC 4OIPA 5TMCA 3HOVK 4YG2A 2R93C 3HOUC 4A3CK 3HOXC 2E2JC 3GTMK 1Y1WK 3GTGC 1TWGC 1TWHK 2R7ZC 5M5YK 1I6HK 3S1NC 4BXXK 1TWCK 4Y52C 3S1RC 4BBRK 4LLGA 3RZOC 3RZDC 4QIWD 3FKIK 4KN7A 1Y1VC 1TWAK 3S2DK 3GTPK 4A3GC 4A3CC 3M4OK 3GTMC 5M3FK 2NVTK 1Y1WC 3HOXK 4YFKA 1TWHC 1XPPA 4JK1A 2E2JK 1I6HC 4BXXC 4YFXA 4AYBL 2R7ZK 3S16K 4A3LC 3FKIC 3S1MC 4X6AC
chains in the Genus database with same CATH superfamily
2VUMC 1K83A 5C44K 3I4MK 1EFWA 3CQZK 2ZUEA 4A3BK 3H0GK 3S1QC 3AQPA 4KMDA 1O2FB 1L0WA 3GDZA 4X6AK 2E2HC 4IOAS 2ZJRS 5IYCC 2A69A 2VUMK 1C0AA 2V6SA 2XCQA 4GFQA 1INNA 3A8KA 1YNJA 1G51A 4J3NA 2NVXK 3S1QK 4XCHA 4QJVB 4A3IC 3G4CA 3H3VD 3GTKC 2JA6C 5IYCK 4C3IK 3HOWC 1IL2A 3GEHA 2B63K 1USOA 1J6VA 1IW7A 1O27A 3MMLB 3GTQC 4BLAA 4A3MC 4G7OA 3BP8C 1I3QC 1WORA 4Y7NK 3AQOA 4PAAA 1DD5A 5IOTA 4G7HA 1FEUA 1TWCA 3S15C 1K83K 4WCES 1O2AA 1WIHA 1IBAA 3GTPA 2JA8K 2PPBA 1I50C 3ADAC 1XXAA 4IO9S 4MEXA 4A3DK 2E2IC 5C4JC 4P9SA 5IOQA 4A93C 3PO2C 1O26A 4LK1A 4A3KC 2RH6A 2EBBA 2NVQK 3LAPA 1WOPA 2CFAB 4AYBD 3S17C 2NVYC 1R9TC 1TWCC 2Y3PA 3S1NK 5CHPA 2R92A 3GTPC 3RZOK 1O2BA 2PA8D 4YG2A 2R93C 4FZBA 4LR2A 3SZYA 4WF9S 3Q3QA 3GTGC 3IPJA 4KM8A 2YU9A 4BXXK 3PIOS 1TWCK 1F93A 2V6UA 5DM7S 1ZBSA 3FKIK 1Y1VC 4KMAA 3GTPK 2GSUA 3L4KA 2KPUA 1BGWA 1Y1WC 3H0GA 4YFXA 3DLLS 4GTBA 3I4NK 2GAGC 2R92C 2A68A 3S2DC 4KB2A 5IYBK 4P5AA 5JFEA 1YCLA 1DCPA 5C4XK 4YFNA 4KAWX 4G7ZA 2ZJQS 1BJTA 3AD8C 2JA7A 4BBSK 1GE9A 4LOWA 4FM9A 1B4AA 3TFJA 3GTJA 2R92K 3GTLA 4PABA 4QIWL 5C44C 3I4MC 3CQZC 5JVGS 4A3BC 3HKZD 3H0GC 2YU9K 2JA5A 1VH2A 4XSXA 5IP9C 2PMZD 5FLMK 2Y0SD 4LJZA 2PMZL 3OPFA 1WOSA 5C3EC 2A6EA 4KN4A 3NUHA 4BY7K 3L4JA 3HOZK 2NVXC 1XXCA 5IYDK 1KQ4A 5IP9K 1TWHA 4GTFA 5IORA 4C3IC 1JOEA 2B63C 5C3EK 1TWAA 3ERED 2JA7K 3DXJA 1WOOA 3GIRA 2JA5C 1I6VA 4Y7NC 4OINA 1J98A 3BP3A 3GTJK 3OREA 1VGXA 2R7ZA 3GTLK 1K83C 4GT9A 3H3VL 3TFHA 2L3UA 2JA8C 3N3YA 4C2MK 4WFNS 2JA5K 1BDFA 1ZYRA 4A3DC 5M3MK 1XZQA 1V5VA 3CF5S 2GSNA 3A8IA 1TWFA 3GTOA 3FKIA 1TWAC 1BS2A 4AH6A 2NVQC 1O25A 4KATA 1HI9A 5HL8A 4WJ4A 1TWHK 2R7ZC 5M5YK 1I6HK 3S1NC 4C45A 4Y52C 1EQRA 1DCHA 4WFBS 3S1RC 3RZOC 2XCOA 4KN7A 1TWAK 1IE0A 5JVHS 4A3GC 4G0WA 1VRQC 3M4OK 2NVTK 1WCMA 1DCOA 4BXXC 4KMHA 4AYBL 2R7ZK 1EH1A 3S16K 3FKIC 1JQWA 3S1MC 3S2HK 4Y52K 3S1RK 2O5IA 4C3HK 1WQFA 2L5NA 4KASA 5IP7K 4A3GK 2PA8L 4NOIA 1ZVUA 1XZPB 4Q5SA 1YX2A 3N0CA 4A3EC 4XLPA 3QX3A 3I4NC 3PO3K 5IYBC 1TWFK 3GTOK 3VA7A 3S1MK 4GTDA 4QJVA 4OIQA 5C4XC 4IOCS 1F7UA 4OIOA 1EK8A 1IQ0A 4ZH4A 3GEIA 4BBSC 2WAQD 1AB4A 1SFOK 4LQYA 4A3EK 3PIPS 4LK0A 2GSOA 1PJ7A 1TWGA 3FHZA 1B4BA 4C3JK 1VLOA 1WSVA 1WCMK 3EQLA 4RMFA 2CW0A 1HQMA 2YU9C 1F9NA 3LYWA 3JSTA 2BE5A 3GTMA 2WB1D 4A3FK 5FLMC 3V4GA 2O5JA 5HQHA 2P8TA 3M3YK 1IS1A 4BY7C 4GTAA 1F7VA 3S14K 1J6XA 1X31C 3HOZC 3HKZL 3HOYK 1WQHA 4XLNA 5IYDC 3LPXA 4BLBA 5CJ9A 2W7VA 2ZUFA 2CFAA 2GAHC 2Y0SL 5EGEA 2PHCB 5D4DA 2JA7C 3OEPA 3N0BA 2KWAA 2FQTA 2E2HA 3HOVC 4O2DA 1VJEA 3GTJC 2ZFZA 3HOUK 3T02A 3GTLC 1TWGK 4BBRC 1ISEA 1XXBA 1WQGA 3RZDK 4DDQA 4C2MC 5TMCA 3GSIA 2XCRB 1ZQ1C 3HOVK 3GTKA 2JA6A 4A3CK 2E2JC 3GTMK 2KXYA 3T01A 4G0VA 3GTQA 3BUEA 4KM9A 3FOEA 2FQOA 4BBRK 4LLGA 1I3QA 1UV7A 4ILDA 5M3FK 4KC6A 2JH3A 1TWHC 2E2JK 4JK1A 1I6HC 5L46A 1PJ5A 4G0UA 1I50A 4A3LC 2E2HK 1SMYA 2E2IA 3M4OC 2NVTC 4GTLA 4BY1C 5HL7S 5EGHA 1SFOA 3S16C 4WILA 3S2HC 4C3HC 3K7AC 4A3LK 4A3IK 5E68A 2NVYA 5IP7C 1R9TA 1O28A 3GTKK 2JA6K 4KDDA 4BY1K 4U67S 3HOWK 2ZJPS 4BKWA 1JVIA 3AD7C 3GTQK 3PO3C 3AD9C 5IOSA 1TWFC 4A3MK 2R93A 3CAGA 3GTOC 1PJ6A 1RU0A 1I3QK 3K7AK 5TJ3A 3GTGA 4A3JC 1O24A 3S15K 5FJ8K 4GZYA 1SFOC 1Y1VA 3LAJA 1I50K 1Y1WA 3S0XA 5M5XK 3AH5A 2E2IK 4C3JC 4XSZA 4KB4A 5C4JK 3FOFA 4A3JK 1WCMC 4MQ9A 3TFIA 4A93K 3PO2K 2WAQL 4A3KK 2D6FC 5M5WK 4A3FC 2V6TA 3S17K 2NVYK 1R9TK 3M3YC 2KQ1A 3S14C 4Q4ZA 3T00A 3HOYC 4GTCA 2R93K 5JVOA 4WFAS 3TTGA 3CQZA 1EI6A 5TMFA 4OIRA 2P5MA 2WB1L 3GTGK 1USMA 4KMUA 4MEYA 3WODA 3GEEA 1YNNA 2A6HA 1Y1VK 4OIPA 2VUMA 3HOUC 2RGRA 3HOXC 1XZQB 1Y1WK 4WJ3M 1TWGC 4GTEA 4KARA 2NVXA 5DM6S 3A8JA 3RZDC 4QIWD 3G4AA 4P5BA 3S2DK 4A3CC 1J6WA 3GTMC 3SZZA 2B63A 3HOXK 4YFKA 1XPPA 4M1XA 1O29A 1ZXOA 1XZPA 1WSRA 3HXAA 4X6AC
chains in the Genus database with same CATH topology
2R92C 2A68A 2O5IA 3S2DC 4C3HK 5IYBK 3S1RK 2E2HK 1SMYA 4Y52K 3M4OC 5C4XK 2VUMC 5IP7K 2NVTC 4YFNA 4A3GK 2PA8L 5C44K 4NOIA 4BY1C 3S2HK 4G7ZA 3I4MK 4Q5SA 3CQZK 4BBSK 4A3EC 4A3BK 4XLPA 3H0GK 3S16C 3S1QC 3I4NC 3S2HC 3PO3K 5IYBC 4C3HC 1TWFK 3K7AC 3GTOK 4A3LK 4A3IK 3S1MK 2E2HC 2R92K 4QJVA 4OIQA 4X6AK 5IP7C 5C4XC 5IYCC 4QIWL 2A69A 4OIOA 5C44C 3GTKK 2JA6K 2VUMK 3I4MC 4ZH4A 3CQZC 4BBSC 4BY1K 2WAQD 3HOWK 4A3BC 3HKZD 3H0GC 1YNJA 1SFOK 4A3EK 3I4NK 3GTQK 2YU9K 3PO3C 4A3MK 2NVXK 1TWFC 3S1QK 3GTOC 4LK0A 4XSXA 5IP9C 4A3IC 4QJVB 2PMZD 1I3QK 3K7AK 3H3VD 5FLMK 2Y0SD 4LJZA 3GTKC 2JA6C 2PMZL 5IYCK 4C3IK 4A3JC 5C3EC 4C3JK 3S15K 5FJ8K 2A6EA 3HOWC 4KN4A 4BY7K 2B63K 4GZYA 1WCMK 3EQLA 1SFOC 1IW7A 2CW0A 1HQMA 2YU9C 3GTQC 4A3MC 2NVXC 3HOZK 2BE5A 4G7OA 2WB1D 1I3QC 1I50K 4Y7NK 5M5XK 4A3FK 5FLMC 5IP9K 5IYDK 2O5JA 4G7HA 4C3IC 2E2IK 4C3JC 4XSZA 3S15C 3M3YK 5C4JK 1K83K 4BY7C 2B63C 5C3EK 4A3JK 1WCMC 3S14K 2JA7K 4MQ9A 3HOZC 3DXJA 4A93K 3PO2K 2WAQL 2JA8K 2JA5C 3HKZL 3HOYK 2PPBA 4XLNA 5IYDC 1I50C 1I6VA 4Y7NC 4A3FC 5M5WK 4OINA 4A3KK 3GTJK 4MEXA 4A3DK 2E2IC 3S17K 3GTLK 2NVYK 1R9TK 3M3YC 5C4JC 1K83C 3H3VL 2Y0SL 3S14C 5D4DA 4Q4ZA 2JA7C 4A93C 3PO2C 2JA8C 4LK1A 3HOVC 3HOYC 4A3KC 2NVQK 4C2MK 2JA5K 3GTJC 2R93K 1BDFA 3HOUK 4AYBD 1ZYRA 5TMFA 3S17C 4OIRA 3GTLC 2NVYC 1R9TC 4A3DC 2WB1L 5M3MK 1TWGK 3GTGK 1TWCC 4KMUA 4MEYA 3S1NK 3WODA 4BBRC 1YNNA 1TWAC 3GTPC 3RZOK 3RZDK 2A6HA 2NVQC 1Y1VK 2PA8D 4C2MC 4OIPA 5TMCA 3HOVK 4YG2A 2R93C 3HOUC 4A3CK 3HOXC 2E2JC 3GTMK 1Y1WK 3GTGC 1TWGC 1TWHK 2R7ZC 5M5YK 1I6HK 3S1NC 4BXXK 1TWCK 4Y52C 3S1RC 4BBRK 4LLGA 3RZOC 3RZDC 4QIWD 3FKIK 4KN7A 1Y1VC 1TWAK 3S2DK 3GTPK 4A3GC 4A3CC 3M4OK 3GTMC 5M3FK 2NVTK 1Y1WC 3HOXK 4YFKA 1TWHC 1XPPA 4JK1A 2E2JK 1I6HC 4BXXC 4YFXA 4AYBL 2R7ZK 3S16K 4A3LC 3FKIC 3S1MC 4X6AC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R92 C;  2A68 A;  2O5I A;  3S2D C;  4C3H K;  5IYB K;  3S1R K;  2E2H K;  1SMY A;  4Y52 K;  3M4O C;  5C4X K;  2VUM C;  5IP7 K;  2NVT C;  4YFN A;  4A3G K;  2PA8 L;  5C44 K;  4NOI A;  4BY1 C;  3S2H K;  4G7Z A;  3I4M K;  4Q5S A;  3CQZ K;  4BBS K;  4A3E C;  4A3B K;  4XLP A;  3H0G K;  3S16 C;  3S1Q C;  3I4N C;  3S2H C;  3PO3 K;  5IYB C;  4C3H C;  1TWF K;  3K7A C;  3GTO K;  4A3L K;  4A3I K;  3S1M K;  2E2H C;  2R92 K;  4QJV A;  4OIQ A;  4X6A K;  5IP7 C;  5C4X C;  5IYC C;  4QIW L;  2A69 A;  4OIO A;  5C44 C;  3GTK K;  2JA6 K;  2VUM K;  3I4M C;  4ZH4 A;  3CQZ C;  4BBS C;  4BY1 K;  2WAQ D;  3HOW K;  4A3B C;  3HKZ D;  3H0G C;  1YNJ A;  1SFO K;  4A3E K;  3I4N K;  3GTQ K;  2YU9 K;  3PO3 C;  4A3M K;  2NVX K;  1TWF C;  3S1Q K;  3GTO C;  4LK0 A;  4XSX A;  5IP9 C;  4A3I C;  4QJV B;  2PMZ D;  1I3Q K;  3K7A K;  3H3V D;  5FLM K;  2Y0S D;  4LJZ A;  3GTK C;  2JA6 C;  2PMZ L;  5IYC K;  4C3I K;  4A3J C;  5C3E C;  4C3J K;  3S15 K;  5FJ8 K;  2A6E A;  3HOW C;  4KN4 A;  4BY7 K;  2B63 K;  4GZY A;  1WCM K;  3EQL A;  1SFO C;  1IW7 A;  2CW0 A;  1HQM A;  2YU9 C;  3GTQ C;  4A3M C;  2NVX C;  3HOZ K;  2BE5 A;  4G7O A;  2WB1 D;  1I3Q C;  1I50 K;  4Y7N K;  5M5X K;  4A3F K;  5FLM C;  5IP9 K;  5IYD K;  2O5J A;  4G7H A;  4C3I C;  2E2I K;  4C3J C;  4XSZ A;  3S15 C;  3M3Y K;  5C4J K;  1K83 K;  4BY7 C;  2B63 C;  5C3E K;  4A3J K;  1WCM C;  3S14 K;  2JA7 K;  4MQ9 A;  3HOZ C;  3DXJ A;  4A93 K;  3PO2 K;  2WAQ L;  2JA8 K;  2JA5 C;  3HKZ L;  3HOY K;  2PPB A;  4XLN A;  5IYD C;  1I50 C;  1I6V A;  4Y7N C;  4A3F C;  5M5W K;  4OIN A;  4A3K K;  3GTJ K;  4MEX A;  4A3D K;  2E2I C;  3S17 K;  3GTL K;  2NVY K;  1R9T K;  3M3Y C;  5C4J C;  1K83 C;  3H3V L;  2Y0S L;  3S14 C;  5D4D A;  4Q4Z A;  2JA7 C;  4A93 C;  3PO2 C;  2JA8 C;  4LK1 A;  3HOV C;  3HOY C;  4A3K C;  2NVQ K;  4C2M K;  2JA5 K;  3GTJ C;  2R93 K;  1BDF A;  3HOU K;  4AYB D;  1ZYR A;  5TMF A;  3S17 C;  4OIR A;  3GTL C;  2NVY C;  1R9T C;  4A3D C;  2WB1 L;  5M3M K;  1TWG K;  3GTG K;  1TWC C;  4KMU A;  4MEY A;  3S1N K;  3WOD A;  4BBR C;  1YNN A;  1TWA C;  3GTP C;  3RZO K;  3RZD K;  2A6H A;  2NVQ C;  1Y1V K;  2PA8 D;  4C2M C;  4OIP A;  5TMC A;  3HOV K;  4YG2 A;  2R93 C;  3HOU C;  4A3C K;  3HOX C;  2E2J C;  3GTM K;  1Y1W K;  3GTG C;  1TWG C;  1TWH K;  2R7Z C;  5M5Y K;  1I6H K;  3S1N C;  4BXX K;  1TWC K;  4Y52 C;  3S1R C;  4BBR K;  4LLG A;  3RZO C;  3RZD C;  4QIW D;  3FKI K;  4KN7 A;  1Y1V C;  1TWA K;  3S2D K;  3GTP K;  4A3G C;  4A3C C;  3M4O K;  3GTM C;  5M3F K;  2NVT K;  1Y1W C;  3HOX K;  4YFK A;  1TWH C;  1XPP A;  4JK1 A;  2E2J K;  1I6H C;  4BXX C;  4YFX A;  4AYB L;  2R7Z K;  3S16 K;  4A3L C;  3FKI C;  3S1M C;  4X6A C; 
#chains in the Genus database with same CATH topology
 2VUM C;  1K83 A;  5C44 K;  3I4M K;  1EFW A;  3CQZ K;  2ZUE A;  4A3B K;  3H0G K;  3S1Q C;  3AQP A;  4KMD A;  1O2F B;  1L0W A;  3GDZ A;  4X6A K;  2E2H C;  4IOA S;  2ZJR S;  5IYC C;  2A69 A;  2VUM K;  1C0A A;  2V6S A;  2XCQ A;  4GFQ A;  1INN A;  3A8K A;  1YNJ A;  1G51 A;  4J3N A;  2NVX K;  3S1Q K;  4XCH A;  4QJV B;  4A3I C;  3G4C A;  3H3V D;  3GTK C;  2JA6 C;  5IYC K;  4C3I K;  3HOW C;  1IL2 A;  3GEH A;  2B63 K;  1USO A;  1J6V A;  1IW7 A;  1O27 A;  3MML B;  3GTQ C;  4BLA A;  4A3M C;  4G7O A;  3BP8 C;  1I3Q C;  1WOR A;  4Y7N K;  3AQO A;  4PAA A;  1DD5 A;  5IOT A;  4G7H A;  1FEU A;  1TWC A;  3S15 C;  1K83 K;  4WCE S;  1O2A A;  1WIH A;  1IBA A;  3GTP A;  2JA8 K;  2PPB A;  1I50 C;  3ADA C;  1XXA A;  4IO9 S;  4MEX A;  4A3D K;  2E2I C;  5C4J C;  4P9S A;  5IOQ A;  4A93 C;  3PO2 C;  1O26 A;  4LK1 A;  4A3K C;  2RH6 A;  2EBB A;  2NVQ K;  3LAP A;  1WOP A;  2CFA B;  4AYB D;  3S17 C;  2NVY C;  1R9T C;  1TWC C;  2Y3P A;  3S1N K;  5CHP A;  2R92 A;  3GTP C;  3RZO K;  1O2B A;  2PA8 D;  4YG2 A;  2R93 C;  4FZB A;  4LR2 A;  3SZY A;  4WF9 S;  3Q3Q A;  3GTG C;  3IPJ A;  4KM8 A;  2YU9 A;  4BXX K;  3PIO S;  1TWC K;  1F93 A;  2V6U A;  5DM7 S;  1ZBS A;  3FKI K;  1Y1V C;  4KMA A;  3GTP K;  2GSU A;  3L4K A;  2KPU A;  1BGW A;  1Y1W C;  3H0G A;  4YFX A;  3DLL S;  4GTB A;  3I4N K;  2GAG C;  2R92 C;  2A68 A;  3S2D C;  4KB2 A;  5IYB K;  4P5A A;  5JFE A;  1YCL A;  1DCP A;  5C4X K;  4YFN A;  4KAW X;  4G7Z A;  2ZJQ S;  1BJT A;  3AD8 C;  2JA7 A;  4BBS K;  1GE9 A;  4LOW A;  4FM9 A;  1B4A A;  3TFJ A;  3GTJ A;  2R92 K;  3GTL A;  4PAB A;  4QIW L;  5C44 C;  3I4M C;  3CQZ C;  5JVG S;  4A3B C;  3HKZ D;  3H0G C;  2YU9 K;  2JA5 A;  1VH2 A;  4XSX A;  5IP9 C;  2PMZ D;  5FLM K;  2Y0S D;  4LJZ A;  2PMZ L;  3OPF A;  1WOS A;  5C3E C;  2A6E A;  4KN4 A;  3NUH A;  4BY7 K;  3L4J A;  3HOZ K;  2NVX C;  1XXC A;  5IYD K;  1KQ4 A;  5IP9 K;  1TWH A;  4GTF A;  5IOR A;  4C3I C;  1JOE A;  2B63 C;  5C3E K;  1TWA A;  3ERE D;  2JA7 K;  3DXJ A;  1WOO A;  3GIR A;  2JA5 C;  1I6V A;  4Y7N C;  4OIN A;  1J98 A;  3BP3 A;  3GTJ K;  3ORE A;  1VGX A;  2R7Z A;  3GTL K;  1K83 C;  4GT9 A;  3H3V L;  3TFH A;  2L3U A;  2JA8 C;  3N3Y A;  4C2M K;  4WFN S;  2JA5 K;  1BDF A;  1ZYR A;  4A3D C;  5M3M K;  1XZQ A;  1V5V A;  3CF5 S;  2GSN A;  3A8I A;  1TWF A;  3GTO A;  3FKI A;  1TWA C;  1BS2 A;  4AH6 A;  2NVQ C;  1O25 A;  4KAT A;  1HI9 A;  5HL8 A;  4WJ4 A;  1TWH K;  2R7Z C;  5M5Y K;  1I6H K;  3S1N C;  4C45 A;  4Y52 C;  1EQR A;  1DCH A;  4WFB S;  3S1R C;  3RZO C;  2XCO A;  4KN7 A;  1TWA K;  1IE0 A;  5JVH S;  4A3G C;  4G0W A;  1VRQ C;  3M4O K;  2NVT K;  1WCM A;  1DCO A;  4BXX C;  4KMH A;  4AYB L;  2R7Z K;  1EH1 A;  3S16 K;  3FKI C;  1JQW A;  3S1M C;  3S2H K;  4Y52 K;  3S1R K;  2O5I A;  4C3H K;  1WQF A;  2L5N A;  4KAS A;  5IP7 K;  4A3G K;  2PA8 L;  4NOI A;  1ZVU A;  1XZP B;  4Q5S A;  1YX2 A;  3N0C A;  4A3E C;  4XLP A;  3QX3 A;  3I4N C;  3PO3 K;  5IYB C;  1TWF K;  3GTO K;  3VA7 A;  3S1M K;  4GTD A;  4QJV A;  4OIQ A;  5C4X C;  4IOC S;  1F7U A;  4OIO A;  1EK8 A;  1IQ0 A;  4ZH4 A;  3GEI A;  4BBS C;  2WAQ D;  1AB4 A;  1SFO K;  4LQY A;  4A3E K;  3PIP S;  4LK0 A;  2GSO A;  1PJ7 A;  1TWG A;  3FHZ A;  1B4B A;  4C3J K;  1VLO A;  1WSV A;  1WCM K;  3EQL A;  4RMF A;  2CW0 A;  1HQM A;  2YU9 C;  1F9N A;  3LYW A;  3JST A;  2BE5 A;  3GTM A;  2WB1 D;  4A3F K;  5FLM C;  3V4G A;  2O5J A;  5HQH A;  2P8T A;  3M3Y K;  1IS1 A;  4BY7 C;  4GTA A;  1F7V A;  3S14 K;  1J6X A;  1X31 C;  3HOZ C;  3HKZ L;  3HOY K;  1WQH A;  4XLN A;  5IYD C;  3LPX A;  4BLB A;  5CJ9 A;  2W7V A;  2ZUF A;  2CFA A;  2GAH C;  2Y0S L;  5EGE A;  2PHC B;  5D4D A;  2JA7 C;  3OEP A;  3N0B A;  2KWA A;  2FQT A;  2E2H A;  3HOV C;  4O2D A;  1VJE A;  3GTJ C;  2ZFZ A;  3HOU K;  3T02 A;  3GTL C;  1TWG K;  4BBR C;  1ISE A;  1XXB A;  1WQG A;  3RZD K;  4DDQ A;  4C2M C;  5TMC A;  3GSI A;  2XCR B;  1ZQ1 C;  3HOV K;  3GTK A;  2JA6 A;  4A3C K;  2E2J C;  3GTM K;  2KXY A;  3T01 A;  4G0V A;  3GTQ A;  3BUE A;  4KM9 A;  3FOE A;  2FQO A;  4BBR K;  4LLG A;  1I3Q A;  1UV7 A;  4ILD A;  5M3F K;  4KC6 A;  2JH3 A;  1TWH C;  2E2J K;  4JK1 A;  1I6H C;  5L46 A;  1PJ5 A;  4G0U A;  1I50 A;  4A3L C;  2E2H K;  1SMY A;  2E2I A;  3M4O C;  2NVT C;  4GTL A;  4BY1 C;  5HL7 S;  5EGH A;  1SFO A;  3S16 C;  4WIL A;  3S2H C;  4C3H C;  3K7A C;  4A3L K;  4A3I K;  5E68 A;  2NVY A;  5IP7 C;  1R9T A;  1O28 A;  3GTK K;  2JA6 K;  4KDD A;  4BY1 K;  4U67 S;  3HOW K;  2ZJP S;  4BKW A;  1JVI A;  3AD7 C;  3GTQ K;  3PO3 C;  3AD9 C;  5IOS A;  1TWF C;  4A3M K;  2R93 A;  3CAG A;  3GTO C;  1PJ6 A;  1RU0 A;  1I3Q K;  3K7A K;  5TJ3 A;  3GTG A;  4A3J C;  1O24 A;  3S15 K;  5FJ8 K;  4GZY A;  1SFO C;  1Y1V A;  3LAJ A;  1I50 K;  1Y1W A;  3S0X A;  5M5X K;  3AH5 A;  2E2I K;  4C3J C;  4XSZ A;  4KB4 A;  5C4J K;  3FOF A;  4A3J K;  1WCM C;  4MQ9 A;  3TFI A;  4A93 K;  3PO2 K;  2WAQ L;  4A3K K;  2D6F C;  5M5W K;  4A3F C;  2V6T A;  3S17 K;  2NVY K;  1R9T K;  3M3Y C;  2KQ1 A;  3S14 C;  4Q4Z A;  3T00 A;  3HOY C;  4GTC A;  2R93 K;  5JVO A;  4WFA S;  3TTG A;  3CQZ A;  1EI6 A;  5TMF A;  4OIR A;  2P5M A;  2WB1 L;  3GTG K;  1USM A;  4KMU A;  4MEY A;  3WOD A;  3GEE A;  1YNN A;  2A6H A;  1Y1V K;  4OIP A;  2VUM A;  3HOU C;  2RGR A;  3HOX C;  1XZQ B;  1Y1W K;  4WJ3 M;  1TWG C;  4GTE A;  4KAR A;  2NVX A;  5DM6 S;  3A8J A;  3RZD C;  4QIW D;  3G4A A;  4P5B A;  3S2D K;  4A3C C;  1J6W A;  3GTM C;  3SZZ A;  2B63 A;  3HOX K;  4YFK A;  1XPP A;  4M1X A;  1O29 A;  1ZXO A;  1XZP A;  1WSR A;  3HXA A;  4X6A C; 
#chains in the Genus database with same CATH homology
 2R92 C;  2A68 A;  2O5I A;  3S2D C;  4C3H K;  5IYB K;  3S1R K;  2E2H K;  1SMY A;  4Y52 K;  3M4O C;  5C4X K;  2VUM C;  5IP7 K;  2NVT C;  4YFN A;  4A3G K;  2PA8 L;  5C44 K;  4NOI A;  4BY1 C;  3S2H K;  4G7Z A;  3I4M K;  4Q5S A;  3CQZ K;  4BBS K;  4A3E C;  4A3B K;  4XLP A;  3H0G K;  3S16 C;  3S1Q C;  3I4N C;  3S2H C;  3PO3 K;  5IYB C;  4C3H C;  1TWF K;  3K7A C;  3GTO K;  4A3L K;  4A3I K;  3S1M K;  2E2H C;  2R92 K;  4QJV A;  4OIQ A;  4X6A K;  5IP7 C;  5C4X C;  5IYC C;  4QIW L;  2A69 A;  4OIO A;  5C44 C;  3GTK K;  2JA6 K;  2VUM K;  3I4M C;  4ZH4 A;  3CQZ C;  4BBS C;  4BY1 K;  2WAQ D;  3HOW K;  4A3B C;  3HKZ D;  3H0G C;  1YNJ A;  1SFO K;  4A3E K;  3I4N K;  3GTQ K;  2YU9 K;  3PO3 C;  4A3M K;  2NVX K;  1TWF C;  3S1Q K;  3GTO C;  4LK0 A;  4XSX A;  5IP9 C;  4A3I C;  4QJV B;  2PMZ D;  1I3Q K;  3K7A K;  3H3V D;  5FLM K;  2Y0S D;  4LJZ A;  3GTK C;  2JA6 C;  2PMZ L;  5IYC K;  4C3I K;  4A3J C;  5C3E C;  4C3J K;  3S15 K;  5FJ8 K;  2A6E A;  3HOW C;  4KN4 A;  4BY7 K;  2B63 K;  4GZY A;  1WCM K;  3EQL A;  1SFO C;  1IW7 A;  2CW0 A;  1HQM A;  2YU9 C;  3GTQ C;  4A3M C;  2NVX C;  3HOZ K;  2BE5 A;  4G7O A;  2WB1 D;  1I3Q C;  1I50 K;  4Y7N K;  5M5X K;  4A3F K;  5FLM C;  5IP9 K;  5IYD K;  2O5J A;  4G7H A;  4C3I C;  2E2I K;  4C3J C;  4XSZ A;  3S15 C;  3M3Y K;  5C4J K;  1K83 K;  4BY7 C;  2B63 C;  5C3E K;  4A3J K;  1WCM C;  3S14 K;  2JA7 K;  4MQ9 A;  3HOZ C;  3DXJ A;  4A93 K;  3PO2 K;  2WAQ L;  2JA8 K;  2JA5 C;  3HKZ L;  3HOY K;  2PPB A;  4XLN A;  5IYD C;  1I50 C;  1I6V A;  4Y7N C;  4A3F C;  5M5W K;  4OIN A;  4A3K K;  3GTJ K;  4MEX A;  4A3D K;  2E2I C;  3S17 K;  3GTL K;  2NVY K;  1R9T K;  3M3Y C;  5C4J C;  1K83 C;  3H3V L;  2Y0S L;  3S14 C;  5D4D A;  4Q4Z A;  2JA7 C;  4A93 C;  3PO2 C;  2JA8 C;  4LK1 A;  3HOV C;  3HOY C;  4A3K C;  2NVQ K;  4C2M K;  2JA5 K;  3GTJ C;  2R93 K;  1BDF A;  3HOU K;  4AYB D;  1ZYR A;  5TMF A;  3S17 C;  4OIR A;  3GTL C;  2NVY C;  1R9T C;  4A3D C;  2WB1 L;  5M3M K;  1TWG K;  3GTG K;  1TWC C;  4KMU A;  4MEY A;  3S1N K;  3WOD A;  4BBR C;  1YNN A;  1TWA C;  3GTP C;  3RZO K;  3RZD K;  2A6H A;  2NVQ C;  1Y1V K;  2PA8 D;  4C2M C;  4OIP A;  5TMC A;  3HOV K;  4YG2 A;  2R93 C;  3HOU C;  4A3C K;  3HOX C;  2E2J C;  3GTM K;  1Y1W K;  3GTG C;  1TWG C;  1TWH K;  2R7Z C;  5M5Y K;  1I6H K;  3S1N C;  4BXX K;  1TWC K;  4Y52 C;  3S1R C;  4BBR K;  4LLG A;  3RZO C;  3RZD C;  4QIW D;  3FKI K;  4KN7 A;  1Y1V C;  1TWA K;  3S2D K;  3GTP K;  4A3G C;  4A3C C;  3M4O K;  3GTM C;  5M3F K;  2NVT K;  1Y1W C;  3HOX K;  4YFK A;  1TWH C;  1XPP A;  4JK1 A;  2E2J K;  1I6H C;  4BXX C;  4YFX A;  4AYB L;  2R7Z K;  3S16 K;  4A3L C;  3FKI C;  3S1M C;  4X6A C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...