2BE5A

Crystal structure of the t. thermophilus rna polymerase holoenzyme in complex with inhibitor tagetitoxin
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
229
structure length
229
Chain Sequence
MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords DNA-directed RNA polymerase alpha chain
publication title Structural basis for transcription inhibition by tagetitoxin
pubmed doi rcsb
total genus 42
structure length 229
sequence length 229
chains with identical sequence B, K, L
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2005-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01000 RNA_pol_A_bac RNA polymerase Rpb3/RpoA insert domain
A PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain
A PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.12 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 DNA-directed RNA polymerase, insert domain 2be5A02
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 2be5A01
2NVYC 1ZYRA 4OIPA 3S14K 4A3BK 4A3KC 3S1NK 1YNNA 1SMYA 4A93C 3PO2C 4A3CC 4X6AK 4NOIA 2Y0SL 3HOUC 5C4JC 4YG2A 3FKIC 1TWHC 4Y52C 3S16C 5M3MK 4G7OA 2R93K 1I6HK 5IYCC 2JA6K 3S2HK 3S15K 2NVTC 2E2HK 2VUMK 2PPBA 5M5WK 3HOXC 4LK1A 2E2JC 3GTGK 3S17K 4BXXK 3S1RC 4A3JC 1Y1WK 4MEYA 5TMFA 2WAQL 4BY1C 4OIQA 2JA7K 4BY7C 3HOVK 5C4XC 4JK1A 4OINA 3HOZK 4MQ9A 1R9TK 3S14C 4A3BC 1K83K 3GTOC 2CW0A 3S1NC 3GTQK 4C3IK 4X6AC 3S2DK 4C3HK 5FLMC 4C3JK 4QIWL 4LLGA 2NVXK 4QJVB 5IP9K 5FJ8K 3RZOK 3M3YK 4XLNA 2R93C 1I6HC 4BBRK 3S1QK 3HOYK 4YFKA 5IYBK 4OIOA 2JA6C 3S15C 4G7HA 4OIRA 2E2HC 2VUMC 3HKZL 3GTPK 2PMZL 4A3EK 3S1MK 3GTGC 4A3DK 4G7ZA 2Y0SD 3GTLC 3S17C 1Y1WC 4BXXC 2JA5K 2A6EA 4MEXA 4YFNA 3K7AC 2B63K 3HOVC 3H0GK 4Y7NK 3HOZC 3I4MK 1R9TC 2PA8L 3PO3K 1TWFK 2NVQC 4C2MK 1K83C 4A3MK 4A3GK 3GTQC 4GZYA 4C3IC 1TWAK 3CQZK 5M3FK 3M4OK 4C3HC 2A68A 4YFXA 2WAQD 2NVXC 2E2IK 4XSZA 5IP9C 3I4NK 3M3YC 4BBRC 3S1QC 1BDFA 4KN4A 2O5IA 2R7ZK 3HOYC 4BBSK 2A69A 4A3FK 5C4JK 3RZDK 5IYBC 4AYBL 5C4XK 4A3LK 4A3IK 4LJZA 5IP7K 1TWGK 2WB1L 4QJVA 3GTPC 1WCMK 3GTKK 5D4DA 4A3EC 3S2HC 3S1MC 2R92K 3H3VL 4QIWD 3HOWK 2JA8K 4BY7K 2JA5C 3GTJK 4Q5SA 5C44K 1YNJA 2B63C 1IW7A 1SFOK 3H0GC 4KN7A 4Y7NC 3EQLA 5C3EK 2JA7C 3I4MC 1TWCK 3GTMK 1TWFC 3DXJA 3HKZD 4A3MC 1I3QK 5IYDK 4A3GC 3M4OC 3CQZC 1TWAC 1I50K 4LK0A 2YU9K 1Y1VK 5M5XK 2E2IC 2NVYK 3S2DC 3GTOK 3I4NC 4C3JC 3WODA 5TMCA 2R7ZC 5FLMK 4BBSC 4A3KK 4A3FC 3RZDC 2PA8D 3RZOC 4A3LC 4A93K 3PO2K 4A3CK 1HQMA 4A3IC 5IP7C 2NVQK 1TWGC 3HOUK 1WCMC 3GTKC 3HOWC 2R92C 1TWHK 3FKIK 3S16K 4Y52K 1XPPA 2JA8C 2BE5A 3GTJC 5C44C 4XSXA 5IYCK 1I6VA 4Q4ZA 4A3DC 1SFOC 2NVTK 3GTLK 5C3EC 4AYBD 4ZH4A 1TWCC 3GTMC 2YU9C 3K7AK 3HOXK 2E2JK 4KMUA 2WB1D 1I3QC 4A3JK 3S1RK 5IYDC 4XLPA 5M5YK 4BY1K 1I50C 2A6HA 3H3VD 3PO3C 4C2MC 1Y1VC 2O5JA 2PMZD
chains in the Genus database with same CATH superfamily
4GT9A 1ZYRA 4G0UA 3GTJA 4A93C 3PO2C 4A3CC 4X6AK 1DCOA 2L3UA 3HOUC 4YG2A 3FKIC 1PJ5A 1BS2A 1VH2A 4C45A 3LAPA 3BP8C 2VUMK 2PPBA 1J98A 3HOXC 2E2JC 2FQOA 3NUHA 3AD8C 4BXXK 4A3JC 4MEYA 1O25A 2V6TA 3AD7C 4WFAS 1EFWA 5C4XC 4OINA 3HOZK 1O2FB 4X6AC 5FLMC 4C3JK 4LLGA 2NVXK 3LAJA 2CFAB 4QJVB 4XLNA 4BBRK 4IOCS 5IYBK 4OIOA 1TWCA 3FHZA 2VUMC 3GTPK 3S1MK 4G7ZA 2Y0SD 4BXXC 1O26A 4GTDA 4YFNA 3K7AC 3GTOA 2XCOA 5IORA 3HOZC 2PA8L 1TWFK 1PJ6A 1VGXA 1PJ7A 4A3GK 4GZYA 3M4OK 2A68A 2JA6A 2NVXC 3I4NK 4BBRC 4BKWA 4KN4A 2RH6A 4BBSK 4GTAA 3GTLA 5IYBC 4WILA 4FZBA 2GSUA 3GTPC 3GTKK 3A8KA 5D4DA 3S1MC 4AH6A 4QIWD 4GTEA 4Q5SA 1K83A 3TFHA 3EQLA 2GSNA 1TWFC 3GTMK 3HKZD 4A3GC 3M4OC 2YU9K 1Y1VK 2V6SA 3CAGA 2KWAA 2NVYK 3S2DC 3I4NC 1HI9A 4BBSC 1ZQ1C 5IOQA 3GTGA 2W7VA 4G0WA 1WQHA 3GTKC 3H0GA 4KASA 4Y52K 1EQRA 2JA7A 5IYCK 5JFEA 1I6VA 3PIOS 4A3DC 1YCLA 1XXBA 1XZPB 2RGRA 3CQZA 2E2IA 3GTMC 4XLPA 2ZFZA 2A6HA 1EI6A 3PO3C 3LYWA 2YU9C 1Y1VC 2NVYC 3A8IA 1WCMA 4A3BK 2D6FC 3S1NK 1B4BA 4NOIA 4Y52C 5M3MK 4G7OA 1I6HK 5IYCC 4BLAA 3T01A 3GIRA 3S2HK 1B4AA 3S15K 2E2HK 5M5WK 4LK1A 5TMFA 4WJ4A 3AD9C 5IOSA 4JK1A 4GTFA 4KMDA 4A3BC 3S1NC 3GTQK 4DDQA 5IP9K 3M3YK 3S1QK 1I6HC 3MMLB 5DM6S 4G0VA 1ZBSA 3S15C 4G7HA 4OIRA 3AH5A 2E2HC 1I3QA 1WSVA 4A3EK 1WOOA 5JVGS 4MEXA 2GAGC 1J6VA 2NVQC 4C2MK 1J6XA 3GTQC 2WAQD 4P5AA 4KMAA 4KC6A 5IP9C 3M3YC 3S1QC 2A69A 1O28A 4P5BA 5C4JK 4KMHA 4AYBL 4A3FK 3TFJA 1TWGK 2WB1L 4QJVA 2CFAA 3JSTA 3HOWK 4A3EC 1EH1A 2R92K 4KB4A 2JA8K 2GSOA 1YNJA 1J6WA 3V4GA 2NVXA 1TWCK 3QX3A 5EGHA 1L0WA 1I50K 1JOEA 4LK0A 1F9NA 1XZQB 5HL8A 2R93A 3GTOK 3CF5S 1IQ0A 4C3JC 3GTPA 1DCPA 4O2DA 1WIHA 4A3FC 4A3KK 2Y3PA 1TWGC 3FOFA 4KM9A 3HOWC 2R92C 1O2BA 1TWHK 1XPPA 2JA8C 2BE5A 3PIPS 4M1XA 1R9TA 2NVTK 3GTLK 1USMA 4ZH4A 2V6UA 1TWCC 4KMUA 4WJ3M 4RMFA 3S1RK 5M5YK 4BY1K 1I50C 3GEEA 3H3VD 1VJEA 4BY7K 4OIPA 4U67S 2GAHC 3BUEA 1WQFA 3GTKA 5JVHS 3S14K 1O27A 4A3KC 2P8TA 1YNNA 3IPJA 4WF9S 2Y0SL 1TWHC 4WFBS 3GTMA 1DCHA 1X31C 1XXCA 2NVTC 5DM7S 1Y1VA 3N3YA 3GTGK 3S17K 3S1RC 1Y1WK 5CJ9A 4BY1C 4OIQA 4J3NA 2JA7K 4BY7C 2EBBA 3HOVK 1C0AA 5CHPA 3S14C 2CW0A 4C3HK 4QIWL 4FM9A 5FJ8K 3RZOK 1SFOA 3AQPA 4YFKA 1WORA 3ERED 3L4JA 3HKZL 3GTGC 1O24A 3S17C 5JVOA 2JA5K 1Y1WC 4KATA 2B63K 4KB2A 3HOVC 4KM8A 4Y7NK 2JH3A 2ZJPS 1TWAK 2ZUEA 3FKIA 4C3HC 3DLLS 4YFXA 4XSZA 5HQHA 3LPXA 3N0CA 4XCHA 1INNA 2E2HA 2ZJRS 2R7ZK 1O29A 1VLOA 4IOAS 2ZUFA 4A3IK 4LJZA 5IP7K 1IS1A 4IO9S 3S2HC 3GEHA 1IL2A 3Q3QA 2JA5C 3T00A 3GTJK 2B63C 3OPFA 3GTQA 5EGEA 4Y7NC 5C3EK 1BGWA 3DXJA 1I3QK 1TWAC 1O2AA 1EK8A 3S0XA 3WODA 5TMCA 2R7ZC 1IBAA 5FLMK 2PA8D 3A8JA 2VUMA 4A3IC 3OEPA 5IP7C 2NVQK 1KQ4A 3G4AA 3S16K 3GTJC 5TJ3A 5C3EC 4LOWA 3K7AK 4PABA 1I3QC 3VA7A 4C2MC 2O5JA 2PMZD 1WOPA 5HL7S 1TWGA 2PHCB 4KDDA 4PAAA 1USOA 2R92A 1SMYA 3HXAA 1XZQA 3L4KA 5C4JC 3S16C 2R93K 1RU0A 1F93A 1DD5A 2JA6K 1I50A 1TWFA 2XCQA 3G4CA 2WAQL 4BLBA 3SZYA 4MQ9A 1R9TK 1TWHA 1VRQC 1JVIA 1K83K 3TFIA 3GTOC 5E68A 4C3IK 3S2DK 1G51A 4P9SA 2KQ1A 1XXAA 2R93C 1AB4A 3HOYK 4LR2A 2JA6C 4KAWX 2PMZL 4A3DK 4WFNS 3GTLC 1V5VA 2YU9A 2A6EA 1BJTA 2NVYA 4KARA 3H0GK 1XZPA 3I4MK 3T02A 1R9TC 3SZZA 3PO3K 1IE0A 1K83C 3ADAC 4A3MK 1ZVUA 2ZJQS 4C3IC 3CQZK 5M3FK 4GFQA 2E2IK 3AQOA 1BDFA 2O5IA 3HOYC 5L46A 4GTCA 3RZDK 4A3LK 1Y1WA 2KXYA 3GDZA 4GTBA 2KPUA 3BP3A 1WCMK 1F7UA 3GEIA 3N0BA 3H3VL 3OREA 5C44K 2P5MA 1ZXOA 1IW7A 1UV7A 3H0GC 1SFOK 4KN7A 4LQYA 2JA7C 3I4MC 2FQTA 5IOTA 4A3MC 4ILDA 5IYDK 1ISEA 3CQZC 4GTLA 5M5XK 2L5NA 2E2IC 2XCRB 3GSIA 1GE9A 3RZDC 4A3LC 3RZOC 1JQWA 4A93K 3PO2K 4A3CK 1HQMA 2JA5A 2B63A 3HOUK 1WCMC 1WQGA 3FKIK 1F7VA 5C44C 4XSXA 1YX2A 4Q4ZA 1SFOC 1TWAA 1WSRA 3TTGA 4AYBD 3HOXK 2E2JK 2WB1D 4A3JK 5IYDC 2R7ZA 3FOEA 4WCES 1FEUA 5C4XK 1WOSA
chains in the Genus database with same CATH topology
2NVYC 1ZYRA 4OIPA 3S14K 4A3BK 4A3KC 3S1NK 1YNNA 1SMYA 4A93C 3PO2C 4A3CC 4X6AK 4NOIA 2Y0SL 3HOUC 5C4JC 4YG2A 3FKIC 1TWHC 4Y52C 3S16C 5M3MK 4G7OA 2R93K 1I6HK 5IYCC 2JA6K 3S2HK 3S15K 2NVTC 2E2HK 2VUMK 2PPBA 5M5WK 3HOXC 4LK1A 2E2JC 3GTGK 3S17K 4BXXK 3S1RC 4A3JC 1Y1WK 4MEYA 5TMFA 2WAQL 4BY1C 4OIQA 2JA7K 4BY7C 3HOVK 5C4XC 4JK1A 4OINA 3HOZK 4MQ9A 1R9TK 3S14C 4A3BC 1K83K 3GTOC 2CW0A 3S1NC 3GTQK 4C3IK 4X6AC 3S2DK 4C3HK 5FLMC 4C3JK 4QIWL 4LLGA 2NVXK 4QJVB 5IP9K 5FJ8K 3RZOK 3M3YK 4XLNA 2R93C 1I6HC 4BBRK 3S1QK 3HOYK 4YFKA 5IYBK 4OIOA 2JA6C 3S15C 4G7HA 4OIRA 2E2HC 2VUMC 3HKZL 3GTPK 2PMZL 4A3EK 3S1MK 3GTGC 4A3DK 4G7ZA 2Y0SD 3GTLC 3S17C 1Y1WC 4BXXC 2JA5K 2A6EA 4MEXA 4YFNA 3K7AC 2B63K 3HOVC 3H0GK 4Y7NK 3HOZC 3I4MK 1R9TC 2PA8L 3PO3K 1TWFK 2NVQC 4C2MK 1K83C 4A3MK 4A3GK 3GTQC 4GZYA 4C3IC 1TWAK 3CQZK 5M3FK 3M4OK 4C3HC 2A68A 4YFXA 2WAQD 2NVXC 2E2IK 4XSZA 5IP9C 3I4NK 3M3YC 4BBRC 3S1QC 1BDFA 4KN4A 2O5IA 2R7ZK 3HOYC 4BBSK 2A69A 4A3FK 5C4JK 3RZDK 5IYBC 4AYBL 5C4XK 4A3LK 4A3IK 4LJZA 5IP7K 1TWGK 2WB1L 4QJVA 3GTPC 1WCMK 3GTKK 5D4DA 4A3EC 3S2HC 3S1MC 2R92K 3H3VL 4QIWD 3HOWK 2JA8K 4BY7K 2JA5C 3GTJK 4Q5SA 5C44K 1YNJA 2B63C 1IW7A 1SFOK 3H0GC 4KN7A 4Y7NC 3EQLA 5C3EK 2JA7C 3I4MC 1TWCK 3GTMK 1TWFC 3DXJA 3HKZD 4A3MC 1I3QK 5IYDK 4A3GC 3M4OC 3CQZC 1TWAC 1I50K 4LK0A 2YU9K 1Y1VK 5M5XK 2E2IC 2NVYK 3S2DC 3GTOK 3I4NC 4C3JC 3WODA 5TMCA 2R7ZC 5FLMK 4BBSC 4A3KK 4A3FC 3RZDC 2PA8D 3RZOC 4A3LC 4A93K 3PO2K 4A3CK 1HQMA 4A3IC 5IP7C 2NVQK 1TWGC 3HOUK 1WCMC 3GTKC 3HOWC 2R92C 1TWHK 3FKIK 3S16K 4Y52K 1XPPA 2JA8C 2BE5A 3GTJC 5C44C 4XSXA 5IYCK 1I6VA 4Q4ZA 4A3DC 1SFOC 2NVTK 3GTLK 5C3EC 4AYBD 4ZH4A 1TWCC 3GTMC 2YU9C 3K7AK 3HOXK 2E2JK 4KMUA 2WB1D 1I3QC 4A3JK 3S1RK 5IYDC 4XLPA 5M5YK 4BY1K 1I50C 2A6HA 3H3VD 3PO3C 4C2MC 1Y1VC 2O5JA 2PMZD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NVY C;  1ZYR A;  4OIP A;  3S14 K;  4A3B K;  4A3K C;  3S1N K;  1YNN A;  1SMY A;  4A93 C;  3PO2 C;  4A3C C;  4X6A K;  4NOI A;  2Y0S L;  3HOU C;  5C4J C;  4YG2 A;  3FKI C;  1TWH C;  4Y52 C;  3S16 C;  5M3M K;  4G7O A;  2R93 K;  1I6H K;  5IYC C;  2JA6 K;  3S2H K;  3S15 K;  2NVT C;  2E2H K;  2VUM K;  2PPB A;  5M5W K;  3HOX C;  4LK1 A;  2E2J C;  3GTG K;  3S17 K;  4BXX K;  3S1R C;  4A3J C;  1Y1W K;  4MEY A;  5TMF A;  2WAQ L;  4BY1 C;  4OIQ A;  2JA7 K;  4BY7 C;  3HOV K;  5C4X C;  4JK1 A;  4OIN A;  3HOZ K;  4MQ9 A;  1R9T K;  3S14 C;  4A3B C;  1K83 K;  3GTO C;  2CW0 A;  3S1N C;  3GTQ K;  4C3I K;  4X6A C;  3S2D K;  4C3H K;  5FLM C;  4C3J K;  4QIW L;  4LLG A;  2NVX K;  4QJV B;  5IP9 K;  5FJ8 K;  3RZO K;  3M3Y K;  4XLN A;  2R93 C;  1I6H C;  4BBR K;  3S1Q K;  3HOY K;  4YFK A;  5IYB K;  4OIO A;  2JA6 C;  3S15 C;  4G7H A;  4OIR A;  2E2H C;  2VUM C;  3HKZ L;  3GTP K;  2PMZ L;  4A3E K;  3S1M K;  3GTG C;  4A3D K;  4G7Z A;  2Y0S D;  3GTL C;  3S17 C;  1Y1W C;  4BXX C;  2JA5 K;  2A6E A;  4MEX A;  4YFN A;  3K7A C;  2B63 K;  3HOV C;  3H0G K;  4Y7N K;  3HOZ C;  3I4M K;  1R9T C;  2PA8 L;  3PO3 K;  1TWF K;  2NVQ C;  4C2M K;  1K83 C;  4A3M K;  4A3G K;  3GTQ C;  4GZY A;  4C3I C;  1TWA K;  3CQZ K;  5M3F K;  3M4O K;  4C3H C;  2A68 A;  4YFX A;  2WAQ D;  2NVX C;  2E2I K;  4XSZ A;  5IP9 C;  3I4N K;  3M3Y C;  4BBR C;  3S1Q C;  1BDF A;  4KN4 A;  2O5I A;  2R7Z K;  3HOY C;  4BBS K;  2A69 A;  4A3F K;  5C4J K;  3RZD K;  5IYB C;  4AYB L;  5C4X K;  4A3L K;  4A3I K;  4LJZ A;  5IP7 K;  1TWG K;  2WB1 L;  4QJV A;  3GTP C;  1WCM K;  3GTK K;  5D4D A;  4A3E C;  3S2H C;  3S1M C;  2R92 K;  3H3V L;  4QIW D;  3HOW K;  2JA8 K;  4BY7 K;  2JA5 C;  3GTJ K;  4Q5S A;  5C44 K;  1YNJ A;  2B63 C;  1IW7 A;  1SFO K;  3H0G C;  4KN7 A;  4Y7N C;  3EQL A;  5C3E K;  2JA7 C;  3I4M C;  1TWC K;  3GTM K;  1TWF C;  3DXJ A;  3HKZ D;  4A3M C;  1I3Q K;  5IYD K;  4A3G C;  3M4O C;  3CQZ C;  1TWA C;  1I50 K;  4LK0 A;  2YU9 K;  1Y1V K;  5M5X K;  2E2I C;  2NVY K;  3S2D C;  3GTO K;  3I4N C;  4C3J C;  3WOD A;  5TMC A;  2R7Z C;  5FLM K;  4BBS C;  4A3K K;  4A3F C;  3RZD C;  2PA8 D;  3RZO C;  4A3L C;  4A93 K;  3PO2 K;  4A3C K;  1HQM A;  4A3I C;  5IP7 C;  2NVQ K;  1TWG C;  3HOU K;  1WCM C;  3GTK C;  3HOW C;  2R92 C;  1TWH K;  3FKI K;  3S16 K;  4Y52 K;  1XPP A;  2JA8 C;  2BE5 A;  3GTJ C;  5C44 C;  4XSX A;  5IYC K;  1I6V A;  4Q4Z A;  4A3D C;  1SFO C;  2NVT K;  3GTL K;  5C3E C;  4AYB D;  4ZH4 A;  1TWC C;  3GTM C;  2YU9 C;  3K7A K;  3HOX K;  2E2J K;  4KMU A;  2WB1 D;  1I3Q C;  4A3J K;  3S1R K;  5IYD C;  4XLP A;  5M5Y K;  4BY1 K;  1I50 C;  2A6H A;  3H3V D;  3PO3 C;  4C2M C;  1Y1V C;  2O5J A;  2PMZ D; 
#chains in the Genus database with same CATH topology
 4GT9 A;  1ZYR A;  4G0U A;  3GTJ A;  4A93 C;  3PO2 C;  4A3C C;  4X6A K;  1DCO A;  2L3U A;  3HOU C;  4YG2 A;  3FKI C;  1PJ5 A;  1BS2 A;  1VH2 A;  4C45 A;  3LAP A;  3BP8 C;  2VUM K;  2PPB A;  1J98 A;  3HOX C;  2E2J C;  2FQO A;  3NUH A;  3AD8 C;  4BXX K;  4A3J C;  4MEY A;  1O25 A;  2V6T A;  3AD7 C;  4WFA S;  1EFW A;  5C4X C;  4OIN A;  3HOZ K;  1O2F B;  4X6A C;  5FLM C;  4C3J K;  4LLG A;  2NVX K;  3LAJ A;  2CFA B;  4QJV B;  4XLN A;  4BBR K;  4IOC S;  5IYB K;  4OIO A;  1TWC A;  3FHZ A;  2VUM C;  3GTP K;  3S1M K;  4G7Z A;  2Y0S D;  4BXX C;  1O26 A;  4GTD A;  4YFN A;  3K7A C;  3GTO A;  2XCO A;  5IOR A;  3HOZ C;  2PA8 L;  1TWF K;  1PJ6 A;  1VGX A;  1PJ7 A;  4A3G K;  4GZY A;  3M4O K;  2A68 A;  2JA6 A;  2NVX C;  3I4N K;  4BBR C;  4BKW A;  4KN4 A;  2RH6 A;  4BBS K;  4GTA A;  3GTL A;  5IYB C;  4WIL A;  4FZB A;  2GSU A;  3GTP C;  3GTK K;  3A8K A;  5D4D A;  3S1M C;  4AH6 A;  4QIW D;  4GTE A;  4Q5S A;  1K83 A;  3TFH A;  3EQL A;  2GSN A;  1TWF C;  3GTM K;  3HKZ D;  4A3G C;  3M4O C;  2YU9 K;  1Y1V K;  2V6S A;  3CAG A;  2KWA A;  2NVY K;  3S2D C;  3I4N C;  1HI9 A;  4BBS C;  1ZQ1 C;  5IOQ A;  3GTG A;  2W7V A;  4G0W A;  1WQH A;  3GTK C;  3H0G A;  4KAS A;  4Y52 K;  1EQR A;  2JA7 A;  5IYC K;  5JFE A;  1I6V A;  3PIO S;  4A3D C;  1YCL A;  1XXB A;  1XZP B;  2RGR A;  3CQZ A;  2E2I A;  3GTM C;  4XLP A;  2ZFZ A;  2A6H A;  1EI6 A;  3PO3 C;  3LYW A;  2YU9 C;  1Y1V C;  2NVY C;  3A8I A;  1WCM A;  4A3B K;  2D6F C;  3S1N K;  1B4B A;  4NOI A;  4Y52 C;  5M3M K;  4G7O A;  1I6H K;  5IYC C;  4BLA A;  3T01 A;  3GIR A;  3S2H K;  1B4A A;  3S15 K;  2E2H K;  5M5W K;  4LK1 A;  5TMF A;  4WJ4 A;  3AD9 C;  5IOS A;  4JK1 A;  4GTF A;  4KMD A;  4A3B C;  3S1N C;  3GTQ K;  4DDQ A;  5IP9 K;  3M3Y K;  3S1Q K;  1I6H C;  3MML B;  5DM6 S;  4G0V A;  1ZBS A;  3S15 C;  4G7H A;  4OIR A;  3AH5 A;  2E2H C;  1I3Q A;  1WSV A;  4A3E K;  1WOO A;  5JVG S;  4MEX A;  2GAG C;  1J6V A;  2NVQ C;  4C2M K;  1J6X A;  3GTQ C;  2WAQ D;  4P5A A;  4KMA A;  4KC6 A;  5IP9 C;  3M3Y C;  3S1Q C;  2A69 A;  1O28 A;  4P5B A;  5C4J K;  4KMH A;  4AYB L;  4A3F K;  3TFJ A;  1TWG K;  2WB1 L;  4QJV A;  2CFA A;  3JST A;  3HOW K;  4A3E C;  1EH1 A;  2R92 K;  4KB4 A;  2JA8 K;  2GSO A;  1YNJ A;  1J6W A;  3V4G A;  2NVX A;  1TWC K;  3QX3 A;  5EGH A;  1L0W A;  1I50 K;  1JOE A;  4LK0 A;  1F9N A;  1XZQ B;  5HL8 A;  2R93 A;  3GTO K;  3CF5 S;  1IQ0 A;  4C3J C;  3GTP A;  1DCP A;  4O2D A;  1WIH A;  4A3F C;  4A3K K;  2Y3P A;  1TWG C;  3FOF A;  4KM9 A;  3HOW C;  2R92 C;  1O2B A;  1TWH K;  1XPP A;  2JA8 C;  2BE5 A;  3PIP S;  4M1X A;  1R9T A;  2NVT K;  3GTL K;  1USM A;  4ZH4 A;  2V6U A;  1TWC C;  4KMU A;  4WJ3 M;  4RMF A;  3S1R K;  5M5Y K;  4BY1 K;  1I50 C;  3GEE A;  3H3V D;  1VJE A;  4BY7 K;  4OIP A;  4U67 S;  2GAH C;  3BUE A;  1WQF A;  3GTK A;  5JVH S;  3S14 K;  1O27 A;  4A3K C;  2P8T A;  1YNN A;  3IPJ A;  4WF9 S;  2Y0S L;  1TWH C;  4WFB S;  3GTM A;  1DCH A;  1X31 C;  1XXC A;  2NVT C;  5DM7 S;  1Y1V A;  3N3Y A;  3GTG K;  3S17 K;  3S1R C;  1Y1W K;  5CJ9 A;  4BY1 C;  4OIQ A;  4J3N A;  2JA7 K;  4BY7 C;  2EBB A;  3HOV K;  1C0A A;  5CHP A;  3S14 C;  2CW0 A;  4C3H K;  4QIW L;  4FM9 A;  5FJ8 K;  3RZO K;  1SFO A;  3AQP A;  4YFK A;  1WOR A;  3ERE D;  3L4J A;  3HKZ L;  3GTG C;  1O24 A;  3S17 C;  5JVO A;  2JA5 K;  1Y1W C;  4KAT A;  2B63 K;  4KB2 A;  3HOV C;  4KM8 A;  4Y7N K;  2JH3 A;  2ZJP S;  1TWA K;  2ZUE A;  3FKI A;  4C3H C;  3DLL S;  4YFX A;  4XSZ A;  5HQH A;  3LPX A;  3N0C A;  4XCH A;  1INN A;  2E2H A;  2ZJR S;  2R7Z K;  1O29 A;  1VLO A;  4IOA S;  2ZUF A;  4A3I K;  4LJZ A;  5IP7 K;  1IS1 A;  4IO9 S;  3S2H C;  3GEH A;  1IL2 A;  3Q3Q A;  2JA5 C;  3T00 A;  3GTJ K;  2B63 C;  3OPF A;  3GTQ A;  5EGE A;  4Y7N C;  5C3E K;  1BGW A;  3DXJ A;  1I3Q K;  1TWA C;  1O2A A;  1EK8 A;  3S0X A;  3WOD A;  5TMC A;  2R7Z C;  1IBA A;  5FLM K;  2PA8 D;  3A8J A;  2VUM A;  4A3I C;  3OEP A;  5IP7 C;  2NVQ K;  1KQ4 A;  3G4A A;  3S16 K;  3GTJ C;  5TJ3 A;  5C3E C;  4LOW A;  3K7A K;  4PAB A;  1I3Q C;  3VA7 A;  4C2M C;  2O5J A;  2PMZ D;  1WOP A;  5HL7 S;  1TWG A;  2PHC B;  4KDD A;  4PAA A;  1USO A;  2R92 A;  1SMY A;  3HXA A;  1XZQ A;  3L4K A;  5C4J C;  3S16 C;  2R93 K;  1RU0 A;  1F93 A;  1DD5 A;  2JA6 K;  1I50 A;  1TWF A;  2XCQ A;  3G4C A;  2WAQ L;  4BLB A;  3SZY A;  4MQ9 A;  1R9T K;  1TWH A;  1VRQ C;  1JVI A;  1K83 K;  3TFI A;  3GTO C;  5E68 A;  4C3I K;  3S2D K;  1G51 A;  4P9S A;  2KQ1 A;  1XXA A;  2R93 C;  1AB4 A;  3HOY K;  4LR2 A;  2JA6 C;  4KAW X;  2PMZ L;  4A3D K;  4WFN S;  3GTL C;  1V5V A;  2YU9 A;  2A6E A;  1BJT A;  2NVY A;  4KAR A;  3H0G K;  1XZP A;  3I4M K;  3T02 A;  1R9T C;  3SZZ A;  3PO3 K;  1IE0 A;  1K83 C;  3ADA C;  4A3M K;  1ZVU A;  2ZJQ S;  4C3I C;  3CQZ K;  5M3F K;  4GFQ A;  2E2I K;  3AQO A;  1BDF A;  2O5I A;  3HOY C;  5L46 A;  4GTC A;  3RZD K;  4A3L K;  1Y1W A;  2KXY A;  3GDZ A;  4GTB A;  2KPU A;  3BP3 A;  1WCM K;  1F7U A;  3GEI A;  3N0B A;  3H3V L;  3ORE A;  5C44 K;  2P5M A;  1ZXO A;  1IW7 A;  1UV7 A;  3H0G C;  1SFO K;  4KN7 A;  4LQY A;  2JA7 C;  3I4M C;  2FQT A;  5IOT A;  4A3M C;  4ILD A;  5IYD K;  1ISE A;  3CQZ C;  4GTL A;  5M5X K;  2L5N A;  2E2I C;  2XCR B;  3GSI A;  1GE9 A;  3RZD C;  4A3L C;  3RZO C;  1JQW A;  4A93 K;  3PO2 K;  4A3C K;  1HQM A;  2JA5 A;  2B63 A;  3HOU K;  1WCM C;  1WQG A;  3FKI K;  1F7V A;  5C44 C;  4XSX A;  1YX2 A;  4Q4Z A;  1SFO C;  1TWA A;  1WSR A;  3TTG A;  4AYB D;  3HOX K;  2E2J K;  2WB1 D;  4A3J K;  5IYD C;  2R7Z A;  3FOE A;  4WCE S;  1FEU A;  5C4X K;  1WOS A; 
#chains in the Genus database with same CATH homology
 2NVY C;  1ZYR A;  4OIP A;  3S14 K;  4A3B K;  4A3K C;  3S1N K;  1YNN A;  1SMY A;  4A93 C;  3PO2 C;  4A3C C;  4X6A K;  4NOI A;  2Y0S L;  3HOU C;  5C4J C;  4YG2 A;  3FKI C;  1TWH C;  4Y52 C;  3S16 C;  5M3M K;  4G7O A;  2R93 K;  1I6H K;  5IYC C;  2JA6 K;  3S2H K;  3S15 K;  2NVT C;  2E2H K;  2VUM K;  2PPB A;  5M5W K;  3HOX C;  4LK1 A;  2E2J C;  3GTG K;  3S17 K;  4BXX K;  3S1R C;  4A3J C;  1Y1W K;  4MEY A;  5TMF A;  2WAQ L;  4BY1 C;  4OIQ A;  2JA7 K;  4BY7 C;  3HOV K;  5C4X C;  4JK1 A;  4OIN A;  3HOZ K;  4MQ9 A;  1R9T K;  3S14 C;  4A3B C;  1K83 K;  3GTO C;  2CW0 A;  3S1N C;  3GTQ K;  4C3I K;  4X6A C;  3S2D K;  4C3H K;  5FLM C;  4C3J K;  4QIW L;  4LLG A;  2NVX K;  4QJV B;  5IP9 K;  5FJ8 K;  3RZO K;  3M3Y K;  4XLN A;  2R93 C;  1I6H C;  4BBR K;  3S1Q K;  3HOY K;  4YFK A;  5IYB K;  4OIO A;  2JA6 C;  3S15 C;  4G7H A;  4OIR A;  2E2H C;  2VUM C;  3HKZ L;  3GTP K;  2PMZ L;  4A3E K;  3S1M K;  3GTG C;  4A3D K;  4G7Z A;  2Y0S D;  3GTL C;  3S17 C;  1Y1W C;  4BXX C;  2JA5 K;  2A6E A;  4MEX A;  4YFN A;  3K7A C;  2B63 K;  3HOV C;  3H0G K;  4Y7N K;  3HOZ C;  3I4M K;  1R9T C;  2PA8 L;  3PO3 K;  1TWF K;  2NVQ C;  4C2M K;  1K83 C;  4A3M K;  4A3G K;  3GTQ C;  4GZY A;  4C3I C;  1TWA K;  3CQZ K;  5M3F K;  3M4O K;  4C3H C;  2A68 A;  4YFX A;  2WAQ D;  2NVX C;  2E2I K;  4XSZ A;  5IP9 C;  3I4N K;  3M3Y C;  4BBR C;  3S1Q C;  1BDF A;  4KN4 A;  2O5I A;  2R7Z K;  3HOY C;  4BBS K;  2A69 A;  4A3F K;  5C4J K;  3RZD K;  5IYB C;  4AYB L;  5C4X K;  4A3L K;  4A3I K;  4LJZ A;  5IP7 K;  1TWG K;  2WB1 L;  4QJV A;  3GTP C;  1WCM K;  3GTK K;  5D4D A;  4A3E C;  3S2H C;  3S1M C;  2R92 K;  3H3V L;  4QIW D;  3HOW K;  2JA8 K;  4BY7 K;  2JA5 C;  3GTJ K;  4Q5S A;  5C44 K;  1YNJ A;  2B63 C;  1IW7 A;  1SFO K;  3H0G C;  4KN7 A;  4Y7N C;  3EQL A;  5C3E K;  2JA7 C;  3I4M C;  1TWC K;  3GTM K;  1TWF C;  3DXJ A;  3HKZ D;  4A3M C;  1I3Q K;  5IYD K;  4A3G C;  3M4O C;  3CQZ C;  1TWA C;  1I50 K;  4LK0 A;  2YU9 K;  1Y1V K;  5M5X K;  2E2I C;  2NVY K;  3S2D C;  3GTO K;  3I4N C;  4C3J C;  3WOD A;  5TMC A;  2R7Z C;  5FLM K;  4BBS C;  4A3K K;  4A3F C;  3RZD C;  2PA8 D;  3RZO C;  4A3L C;  4A93 K;  3PO2 K;  4A3C K;  1HQM A;  4A3I C;  5IP7 C;  2NVQ K;  1TWG C;  3HOU K;  1WCM C;  3GTK C;  3HOW C;  2R92 C;  1TWH K;  3FKI K;  3S16 K;  4Y52 K;  1XPP A;  2JA8 C;  2BE5 A;  3GTJ C;  5C44 C;  4XSX A;  5IYC K;  1I6V A;  4Q4Z A;  4A3D C;  1SFO C;  2NVT K;  3GTL K;  5C3E C;  4AYB D;  4ZH4 A;  1TWC C;  3GTM C;  2YU9 C;  3K7A K;  3HOX K;  2E2J K;  4KMU A;  2WB1 D;  1I3Q C;  4A3J K;  3S1R K;  5IYD C;  4XLP A;  5M5Y K;  4BY1 K;  1I50 C;  2A6H A;  3H3V D;  3PO3 C;  4C2M C;  1Y1V C;  2O5J A;  2PMZ D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...