4OIPA

Crystal structure of thermus thermophilus transcription initiation complex soaked with ge23077, atp, and cmpcpp
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
231
structure length
231
Chain Sequence
SKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQAAAVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title GE23077 binds to the RNA polymerase 'i' and 'i+1' sites and prevents the binding of initiating nucleotides.
pubmed rcsb
source organism Thermus thermophilus
molecule tags Transcription, transferase/antibiotic
molecule keywords DNA-directed RNA polymerase subunit alpha
total genus 52
structure length 231
sequence length 231
chains with identical sequence B
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2014-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01000 RNA_pol_A_bac RNA polymerase Rpb3/RpoA insert domain
A PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain
A PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.12 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 DNA-directed RNA polymerase, insert domain 4oipA02
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 4oipA01
2A69A 3I4NK 2E2HK 4OIOA 5FJ8K 2WAQD 4MEXA 4AYBL 5C4JK 4JK1A 4Q4ZA 1R9TC 3HOYC 4C3JC 2NVTC 3CQZK 1I6HC 3S2DK 3M3YC 4AYBD 4C2MC 3GTKC 5C4JC 4G7OA 2NVXK 4A3KC 1TWGC 3H0GC 2B63K 2NVQC 4A3BC 1TWAK 4Y52C 4C3JK 3S16C 3H3VL 4ZH4A 4KMUA 4XLPA 5TMFA 5C3EK 2JA7C 4YFNA 2JA8K 3I4NC 3HKZL 2E2HC 3GTJC 3K7AK 4BBSK 2E2JC 1TWFC 2BE5A 2R93C 4C3HC 3HOUC 1TWHC 5IP9C 4YG2A 2JA7K 2JA6K 2JA8C 3WODA 5C44C 2E2IC 4BBSC 1TWFK 3RZOC 1Y1VK 2E2JK 4LK0A 2O5JA 3FKIC 1TWGK 1TWHK 3S1QK 3GTQC 4NOIA 5M5YK 1I3QK 1IW7A 1I6HK 3S16K 4QJVB 4Q5SA 5C4XK 4Y7NK 4BY1K 4A3KK 1SMYA 5TMCA 4YFXA 4A3FC 2WAQL 3RZDK 1SFOK 3GTQK 3S1NK 5IYDK 1I50C 1HQMA 2R7ZK 3HOYK 2WB1D 4A3MC 3RZDC 4C2MK 4XSXA 4C3IC 3GTKK 3S2HK 4C3HK 1BDFA 3PO2K 3I4MK 4YFKA 3S17C 1TWCC 3GTPC 4BXXC 4LK1A 2R92C 3PO3C 4XLNA 4QJVA 4C3IK 2VUMC 5M3FK 4A93C 3GTOC 1K83K 5IP7K 4LLGA 2JA5K 3PO2C 3S17K 2Y0SD 3I4MC 2NVYC 1I50K 3HOXK 3HOVK 3S1NC 3HOUK 1WCMC 4OIQA 5FLMK 2R92K 4A3GC 3M3YK 4A3MK 3S1MC 4BBRC 3GTMK 5D4DA 2B63C 3H0GK 3S1RC 4A3LK 2PA8D 4QIWD 4A3BK 4BY7K 1WCMK 2YU9C 3S14C 5IYBC 3H3VD 3GTGK 3HOZK 2Y0SL 2NVTK 1YNJA 4BY7C 3S1RK 3S1MK 1ZYRA 4A3DK 2NVXC 5IP7C 1YNNA 4A3FK 5M5XK 5IP9K 2NVYK 3HOXC 3HOVC 2PA8L 4QIWL 2A68A 1I6VA 4A3EC 1Y1WC 3HOWC 4X6AK 2CW0A 2VUMK 4A3GK 3GTOK 3M4OK 5M5WK 3FKIK 3S2HC 2WB1L 2R93K 4X6AC 3EQLA 4GZYA 4XSZA 3HOWK 4A3CC 4A3JK 2JA6C 3HOZC 5IYCC 3GTGC 4OIPA 5IYBK 4A3IK 3M4OC 4A3DC 1Y1WK 1TWAC 3S15C 2NVQK 4G7ZA 4Y52K 5IYDC 2YU9K 2R7ZC 3S14K 1R9TK 3HKZD 1I3QC 5C3EC 3GTLC 5FLMC 2PMZL 4A3IC 4MQ9A 4Y7NC 4BY1C 4LJZA 3S2DC 5C4XC 3GTMC 4BBRK 3S15K 4BXXK 4A3LC 4G7HA 1SFOC 2PMZD 5M3MK 3GTLK 2PPBA 3DXJA 3CQZC 2A6HA 4A3JC 3PO3K 1XPPA 5IYCK 1Y1VC 5C44K 2E2IK 3RZOK 1K83C 2JA5C 4A93K 3K7AC 3GTJK 4MEYA 2A6EA 4KN7A 3S1QC 4OIRA 4A3CK 4OINA 1TWCK 4KN4A 2O5IA 4A3EK 3GTPK
chains in the Genus database with same CATH superfamily
2A69A 4OIOA 4MEXA 4GT9A 2E2IA 1XZQB 3HOYC 4C3JC 1I6HC 1PJ7A 3S2DK 4AYBD 3GTKC 3OREA 5C4JC 4G7OA 1PJ6A 3FOEA 4A3KC 1XZPB 2NVXK 1ZVUA 4GTCA 1WQHA 1TWAK 4A3BC 4Y52C 1O2FB 3OEPA 5TMFA 4BLAA 1J6XA 4XCHA 2BE5A 3QX3A 2R93A 4WFAS 4PABA 5IP9C 4IOCS 5HL7S 2JA8C 1DCOA 3WODA 1J98A 4BBSC 1DD5A 1TWFK 1TWGK 3GTQC 1X31C 1I3QK 1USOA 3GSIA 3S16K 5C4XK 1EK8A 4A3FC 2KXYA 1DCHA 2V6SA 3GTQK 4WJ3M 1I50A 5JVGS 3GEEA 4XSXA 4LQYA 3PO2K 3S17C 1TWCC 3GTPC 4LK1A 4ILDA 3GTOC 2XCQA 3HOXK 3GTPA 1WCMC 5FLMK 3GTKA 4A3GC 4IO9S 2B63C 3H0GK 1TWHA 4P9SA 1EH1A 1C0AA 2ZUFA 1V5VA 3S1MK 1DCPA 1I3QA 4A3DK 2GSUA 2NVXC 1YNNA 4LOWA 4KM8A 3HOVC 1PJ5A 1Y1WC 3HOWC 1WSRA 1INNA 5M5WK 3S2HC 5HL8A 3EQLA 4XSZA 3GEHA 3A8JA 5IYCC 3Q3QA 4A3DC 4G7ZA 5IYDC 1VH2A 3SZYA 1WQGA 2W7VA 1R9TK 1O2BA 3GTLC 5FLMC 4Y7NC 4BY1C 4KM9A 4A3LC 1SFOC 3CQZC 2A6HA 4A3JC 3BUEA 5IYCK 5C44K 2E2IK 3RZOK 2JA5C 2ZJQS 3K7AC 3GTJK 1K83A 2A6EA 1F9NA 4KARA 2ZUEA 4A3CK 1TWCK 3CQZA 4A3EK 4KMDA 4BXXK 3I4NK 2JA5A 3CF5S 1WSVA 2NVTC 4DDQA 1TWGC 4KMHA 3OPFA 3BP8C 4XLPA 2JA8K 4YFNA 3I4NC 3HKZL 2E2HC 3GTJC 3K7AK 4BBSK 2E2JC 2R93C 1Y1VA 4KB4A 1YX2A 4IOAS 4FM9A 5C44C 2E2IC 2Y3PA 4KB2A 2E2JK 2O5JA 4LR2A 3JSTA 3S1QK 4NOIA 1IL2A 1JVIA 1I6HK 4Y7NK 4BY1K 4A3KK 1WOSA 5CJ9A 3S1NK 5IYDK 1I50C 4WFBS 2R7ZK 3HOYK 1XZPA 2P5MA 3GTKK 3S2HK 1BDFA 3I4MK 4BXXC 1WIHA 3G4AA 2R92C 2D6FC 4C3IK 4A93C 5HQHA 2JA5K 3TFIA 2YU9A 3HOUK 3M3YK 4A3MK 3S1MC 3GTMK 4A3LK 3S1RC 4BY7K 2PA8D 4A3BK 2RGRA 3PIOS 1WCMK 2YU9C 5IYBC 3IPJA 3HOZK 4BY7C 4O2DA 3S1RK 4KC6A 1B4BA 5M5XK 4KAWX 2PA8L 1R9TA 2CW0A 1IE0A 3TFJA 2GAHC 5TJ3A 3M4OK 3FKIK 3VA7A 3BP3A 2R93K 4X6AC 4GZYA 3HOWK 2JA6C 4U67S 2NVYA 4A3IK 1B4AA 3N0BA 4P5BA 2XCRB 2GAGC 1TWAA 3S14K 2R7ZC 1I3QC 3LYWA 5C3EC 3SZZA 1EI6A 5C4XC 4LJZA 4BBRK 2GSOA 5M3MK 2PPBA 3PO3K 1J6WA 3V4GA 1WORA 1K83C 3S1QC 1AB4A 1VLOA 4OIRA 4OINA 1FEUA 4KASA 3GTPK 1YCLA 1BS2A 2E2HK 5FJ8K 3AD7C 3S0XA 2WAQD 4AYBL 5C4JK 3LAPA 4JK1A 3AQOA 1KQ4A 4KMAA 1UV7A 3S16C 3H3VL 4ZH4A 5C3EK 4G0UA 5CHPA 1TWFC 4KDDA 4C3HC 4PAAA 1J6VA 2JA7K 2JA6K 5JFEA 1F7UA 3CAGA 1JOEA 3RZOC 3FKIC 1VJEA 1TWHK 5M5YK 2JH3A 3H0GA 5IOQA 1IW7A 1O2AA 4QJVB 4Q5SA 3AQPA 1SMYA 5TMCA 4WCES 3RZDK 4GTAA 1SFOK 4P5AA 1EFWA 1BJTA 1HQMA 2NVXA 1O24A 2WB1D 4A3MC 1G51A 3RZDC 4C2MK 4C3IC 5JVHS 4C3HK 3DLLS 2R92A 2B63A 3ADAC 4XLNA 4QJVA 5DM7S 3GEIA 3AH5A 3N3YA 5IP7K 2XCOA 2RH6A 3PO2C 2Y0SD 3I4MC 1I50K 3HOVK 3PIPS 3S1NC 4OIQA 2R92K 5D4DA 3GTOA 3GTGK 2Y0SL 2NVTK 1YNJA 1SFOA 2GSNA 4WFNS 4WILA 2VUMA 2NVYK 1F7VA 3HOXC 1ZXOA 2A68A 4A3EC 1EQRA 2CFAA 2ZFZA 3GTGA 4A3GK 2VUMK 3GTOK 3LPXA 1ZBSA 2P8TA 2JA6A 2FQTA 4GTEA 5E68A 4A3JK 3GTGC 4OIPA 1XXCA 5EGEA 1TWAC 3TFHA 3FOFA 2PMZL 4A3IC 3A8IA 1VRQC 1O28A 4RMFA 1ISEA 4G7HA 3AD8C 4GTFA 2PMZD 2E2HA 1XPPA 1Y1VC 1XXAA 1Y1WA 3GTLA 1USMA 5IORA 4KN7A 2FQOA 4KN4A 1Y1WK 3A8KA 1O25A 1WOPA 1F93A 2R7ZA 4Q4ZA 1R9TC 3G4CA 3GTJA 3GTQA 3CQZK 4KATA 2JA7A 3M3YC 4C2MC 1O26A 3H0GC 2B63K 4BLBA 2NVQC 4C3JK 4KMUA 2JA7C 5DM6S 4BKWA 2EBBA 2ZJPS 1TWHC 3HOUC 4YG2A 1WQFA 1BGWA 3L4KA 1WOOA 2V6TA 1Y1VK 3ERED 4LK0A 3MMLB 4WJ4A 3T00A 2L5NA 1O27A 4GTDA 1IS1A 3TTGA 1WCMA 5EGHA 1IQ0A 4C45A 4YFXA 2WAQL 1XZQA 3T02A 2L3UA 4G0WA 3GTMA 4YFKA 3LAJA 1TWCA 3PO3C 1HI9A 5M3FK 2VUMC 3GIRA 1K83K 4LLGA 3S17K 3NUHA 2NVYC 5IOTA 1TWFA 4BBRC 4WF9S 4QIWD 3L4JA 2KPUA 2KWAA 1L0WA 3S14C 4FZBA 3H3VD 3FKIA 1ZYRA 5IP7C 4A3FK 5IP9K 3HXAA 4M1XA 1IBAA 2KQ1A 4QIWL 1I6VA 3FHZA 4X6AK 2WB1L 1TWGA 5IOSA 3T01A 4A3CC 1O29A 3HOZC 5IYBK 3M4OC 3AD9C 2V6UA 4GTBA 2PHCB 3S15C 2NVQK 4Y52K 2YU9K 5JVOA 4GTLA 3HKZD 5L46A 4MQ9A 3S2DC 4G0VA 3S15K 3GTMC 1ZQ1C 1RU0A 2ZJRS 3GDZA 4J3NA 2CFAB 3GTLK 3DXJA 3N0CA 4A93K 2O5IA 4MEYA 4GFQA 1XXBA 1GE9A 1JQWA 4AH6A 1VGXA
chains in the Genus database with same CATH topology
2A69A 3I4NK 2E2HK 4OIOA 5FJ8K 2WAQD 4MEXA 4AYBL 5C4JK 4JK1A 4Q4ZA 1R9TC 3HOYC 4C3JC 2NVTC 3CQZK 1I6HC 3S2DK 3M3YC 4AYBD 4C2MC 3GTKC 5C4JC 4G7OA 2NVXK 4A3KC 1TWGC 3H0GC 2B63K 2NVQC 4A3BC 1TWAK 4Y52C 4C3JK 3S16C 3H3VL 4ZH4A 4KMUA 4XLPA 5TMFA 5C3EK 2JA7C 4YFNA 2JA8K 3I4NC 3HKZL 2E2HC 3GTJC 3K7AK 4BBSK 2E2JC 1TWFC 2BE5A 2R93C 4C3HC 3HOUC 1TWHC 5IP9C 4YG2A 2JA7K 2JA6K 2JA8C 3WODA 5C44C 2E2IC 4BBSC 1TWFK 3RZOC 1Y1VK 2E2JK 4LK0A 2O5JA 3FKIC 1TWGK 1TWHK 3S1QK 3GTQC 4NOIA 5M5YK 1I3QK 1IW7A 1I6HK 3S16K 4QJVB 4Q5SA 5C4XK 4Y7NK 4BY1K 4A3KK 1SMYA 5TMCA 4YFXA 4A3FC 2WAQL 3RZDK 1SFOK 3GTQK 3S1NK 5IYDK 1I50C 1HQMA 2R7ZK 3HOYK 2WB1D 4A3MC 3RZDC 4C2MK 4XSXA 4C3IC 3GTKK 3S2HK 4C3HK 1BDFA 3PO2K 3I4MK 4YFKA 3S17C 1TWCC 3GTPC 4BXXC 4LK1A 2R92C 3PO3C 4XLNA 4QJVA 4C3IK 2VUMC 5M3FK 4A93C 3GTOC 1K83K 5IP7K 4LLGA 2JA5K 3PO2C 3S17K 2Y0SD 3I4MC 2NVYC 1I50K 3HOXK 3HOVK 3S1NC 3HOUK 1WCMC 4OIQA 5FLMK 2R92K 4A3GC 3M3YK 4A3MK 3S1MC 4BBRC 3GTMK 5D4DA 2B63C 3H0GK 3S1RC 4A3LK 2PA8D 4QIWD 4A3BK 4BY7K 1WCMK 2YU9C 3S14C 5IYBC 3H3VD 3GTGK 3HOZK 2Y0SL 2NVTK 1YNJA 4BY7C 3S1RK 3S1MK 1ZYRA 4A3DK 2NVXC 5IP7C 1YNNA 4A3FK 5M5XK 5IP9K 2NVYK 3HOXC 3HOVC 2PA8L 4QIWL 2A68A 1I6VA 4A3EC 1Y1WC 3HOWC 4X6AK 2CW0A 2VUMK 4A3GK 3GTOK 3M4OK 5M5WK 3FKIK 3S2HC 2WB1L 2R93K 4X6AC 3EQLA 4GZYA 4XSZA 3HOWK 4A3CC 4A3JK 2JA6C 3HOZC 5IYCC 3GTGC 4OIPA 5IYBK 4A3IK 3M4OC 4A3DC 1Y1WK 1TWAC 3S15C 2NVQK 4G7ZA 4Y52K 5IYDC 2YU9K 2R7ZC 3S14K 1R9TK 3HKZD 1I3QC 5C3EC 3GTLC 5FLMC 2PMZL 4A3IC 4MQ9A 4Y7NC 4BY1C 4LJZA 3S2DC 5C4XC 3GTMC 4BBRK 3S15K 4BXXK 4A3LC 4G7HA 1SFOC 2PMZD 5M3MK 3GTLK 2PPBA 3DXJA 3CQZC 2A6HA 4A3JC 3PO3K 1XPPA 5IYCK 1Y1VC 5C44K 2E2IK 3RZOK 1K83C 2JA5C 4A93K 3K7AC 3GTJK 4MEYA 2A6EA 4KN7A 3S1QC 4OIRA 4A3CK 4OINA 1TWCK 4KN4A 2O5IA 4A3EK 3GTPK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A69 A;  3I4N K;  2E2H K;  4OIO A;  5FJ8 K;  2WAQ D;  4MEX A;  4AYB L;  5C4J K;  4JK1 A;  4Q4Z A;  1R9T C;  3HOY C;  4C3J C;  2NVT C;  3CQZ K;  1I6H C;  3S2D K;  3M3Y C;  4AYB D;  4C2M C;  3GTK C;  5C4J C;  4G7O A;  2NVX K;  4A3K C;  1TWG C;  3H0G C;  2B63 K;  2NVQ C;  4A3B C;  1TWA K;  4Y52 C;  4C3J K;  3S16 C;  3H3V L;  4ZH4 A;  4KMU A;  4XLP A;  5TMF A;  5C3E K;  2JA7 C;  4YFN A;  2JA8 K;  3I4N C;  3HKZ L;  2E2H C;  3GTJ C;  3K7A K;  4BBS K;  2E2J C;  1TWF C;  2BE5 A;  2R93 C;  4C3H C;  3HOU C;  1TWH C;  5IP9 C;  4YG2 A;  2JA7 K;  2JA6 K;  2JA8 C;  3WOD A;  5C44 C;  2E2I C;  4BBS C;  1TWF K;  3RZO C;  1Y1V K;  2E2J K;  4LK0 A;  2O5J A;  3FKI C;  1TWG K;  1TWH K;  3S1Q K;  3GTQ C;  4NOI A;  5M5Y K;  1I3Q K;  1IW7 A;  1I6H K;  3S16 K;  4QJV B;  4Q5S A;  5C4X K;  4Y7N K;  4BY1 K;  4A3K K;  1SMY A;  5TMC A;  4YFX A;  4A3F C;  2WAQ L;  3RZD K;  1SFO K;  3GTQ K;  3S1N K;  5IYD K;  1I50 C;  1HQM A;  2R7Z K;  3HOY K;  2WB1 D;  4A3M C;  3RZD C;  4C2M K;  4XSX A;  4C3I C;  3GTK K;  3S2H K;  4C3H K;  1BDF A;  3PO2 K;  3I4M K;  4YFK A;  3S17 C;  1TWC C;  3GTP C;  4BXX C;  4LK1 A;  2R92 C;  3PO3 C;  4XLN A;  4QJV A;  4C3I K;  2VUM C;  5M3F K;  4A93 C;  3GTO C;  1K83 K;  5IP7 K;  4LLG A;  2JA5 K;  3PO2 C;  3S17 K;  2Y0S D;  3I4M C;  2NVY C;  1I50 K;  3HOX K;  3HOV K;  3S1N C;  3HOU K;  1WCM C;  4OIQ A;  5FLM K;  2R92 K;  4A3G C;  3M3Y K;  4A3M K;  3S1M C;  4BBR C;  3GTM K;  5D4D A;  2B63 C;  3H0G K;  3S1R C;  4A3L K;  2PA8 D;  4QIW D;  4A3B K;  4BY7 K;  1WCM K;  2YU9 C;  3S14 C;  5IYB C;  3H3V D;  3GTG K;  3HOZ K;  2Y0S L;  2NVT K;  1YNJ A;  4BY7 C;  3S1R K;  3S1M K;  1ZYR A;  4A3D K;  2NVX C;  5IP7 C;  1YNN A;  4A3F K;  5M5X K;  5IP9 K;  2NVY K;  3HOX C;  3HOV C;  2PA8 L;  4QIW L;  2A68 A;  1I6V A;  4A3E C;  1Y1W C;  3HOW C;  4X6A K;  2CW0 A;  2VUM K;  4A3G K;  3GTO K;  3M4O K;  5M5W K;  3FKI K;  3S2H C;  2WB1 L;  2R93 K;  4X6A C;  3EQL A;  4GZY A;  4XSZ A;  3HOW K;  4A3C C;  4A3J K;  2JA6 C;  3HOZ C;  5IYC C;  3GTG C;  4OIP A;  5IYB K;  4A3I K;  3M4O C;  4A3D C;  1Y1W K;  1TWA C;  3S15 C;  2NVQ K;  4G7Z A;  4Y52 K;  5IYD C;  2YU9 K;  2R7Z C;  3S14 K;  1R9T K;  3HKZ D;  1I3Q C;  5C3E C;  3GTL C;  5FLM C;  2PMZ L;  4A3I C;  4MQ9 A;  4Y7N C;  4BY1 C;  4LJZ A;  3S2D C;  5C4X C;  3GTM C;  4BBR K;  3S15 K;  4BXX K;  4A3L C;  4G7H A;  1SFO C;  2PMZ D;  5M3M K;  3GTL K;  2PPB A;  3DXJ A;  3CQZ C;  2A6H A;  4A3J C;  3PO3 K;  1XPP A;  5IYC K;  1Y1V C;  5C44 K;  2E2I K;  3RZO K;  1K83 C;  2JA5 C;  4A93 K;  3K7A C;  3GTJ K;  4MEY A;  2A6E A;  4KN7 A;  3S1Q C;  4OIR A;  4A3C K;  4OIN A;  1TWC K;  4KN4 A;  2O5I A;  4A3E K;  3GTP K; 
#chains in the Genus database with same CATH topology
 2A69 A;  4OIO A;  4MEX A;  4GT9 A;  2E2I A;  1XZQ B;  3HOY C;  4C3J C;  1I6H C;  1PJ7 A;  3S2D K;  4AYB D;  3GTK C;  3ORE A;  5C4J C;  4G7O A;  1PJ6 A;  3FOE A;  4A3K C;  1XZP B;  2NVX K;  1ZVU A;  4GTC A;  1WQH A;  1TWA K;  4A3B C;  4Y52 C;  1O2F B;  3OEP A;  5TMF A;  4BLA A;  1J6X A;  4XCH A;  2BE5 A;  3QX3 A;  2R93 A;  4WFA S;  4PAB A;  5IP9 C;  4IOC S;  5HL7 S;  2JA8 C;  1DCO A;  3WOD A;  1J98 A;  4BBS C;  1DD5 A;  1TWF K;  1TWG K;  3GTQ C;  1X31 C;  1I3Q K;  1USO A;  3GSI A;  3S16 K;  5C4X K;  1EK8 A;  4A3F C;  2KXY A;  1DCH A;  2V6S A;  3GTQ K;  4WJ3 M;  1I50 A;  5JVG S;  3GEE A;  4XSX A;  4LQY A;  3PO2 K;  3S17 C;  1TWC C;  3GTP C;  4LK1 A;  4ILD A;  3GTO C;  2XCQ A;  3HOX K;  3GTP A;  1WCM C;  5FLM K;  3GTK A;  4A3G C;  4IO9 S;  2B63 C;  3H0G K;  1TWH A;  4P9S A;  1EH1 A;  1C0A A;  2ZUF A;  1V5V A;  3S1M K;  1DCP A;  1I3Q A;  4A3D K;  2GSU A;  2NVX C;  1YNN A;  4LOW A;  4KM8 A;  3HOV C;  1PJ5 A;  1Y1W C;  3HOW C;  1WSR A;  1INN A;  5M5W K;  3S2H C;  5HL8 A;  3EQL A;  4XSZ A;  3GEH A;  3A8J A;  5IYC C;  3Q3Q A;  4A3D C;  4G7Z A;  5IYD C;  1VH2 A;  3SZY A;  1WQG A;  2W7V A;  1R9T K;  1O2B A;  3GTL C;  5FLM C;  4Y7N C;  4BY1 C;  4KM9 A;  4A3L C;  1SFO C;  3CQZ C;  2A6H A;  4A3J C;  3BUE A;  5IYC K;  5C44 K;  2E2I K;  3RZO K;  2JA5 C;  2ZJQ S;  3K7A C;  3GTJ K;  1K83 A;  2A6E A;  1F9N A;  4KAR A;  2ZUE A;  4A3C K;  1TWC K;  3CQZ A;  4A3E K;  4KMD A;  4BXX K;  3I4N K;  2JA5 A;  3CF5 S;  1WSV A;  2NVT C;  4DDQ A;  1TWG C;  4KMH A;  3OPF A;  3BP8 C;  4XLP A;  2JA8 K;  4YFN A;  3I4N C;  3HKZ L;  2E2H C;  3GTJ C;  3K7A K;  4BBS K;  2E2J C;  2R93 C;  1Y1V A;  4KB4 A;  1YX2 A;  4IOA S;  4FM9 A;  5C44 C;  2E2I C;  2Y3P A;  4KB2 A;  2E2J K;  2O5J A;  4LR2 A;  3JST A;  3S1Q K;  4NOI A;  1IL2 A;  1JVI A;  1I6H K;  4Y7N K;  4BY1 K;  4A3K K;  1WOS A;  5CJ9 A;  3S1N K;  5IYD K;  1I50 C;  4WFB S;  2R7Z K;  3HOY K;  1XZP A;  2P5M A;  3GTK K;  3S2H K;  1BDF A;  3I4M K;  4BXX C;  1WIH A;  3G4A A;  2R92 C;  2D6F C;  4C3I K;  4A93 C;  5HQH A;  2JA5 K;  3TFI A;  2YU9 A;  3HOU K;  3M3Y K;  4A3M K;  3S1M C;  3GTM K;  4A3L K;  3S1R C;  4BY7 K;  2PA8 D;  4A3B K;  2RGR A;  3PIO S;  1WCM K;  2YU9 C;  5IYB C;  3IPJ A;  3HOZ K;  4BY7 C;  4O2D A;  3S1R K;  4KC6 A;  1B4B A;  5M5X K;  4KAW X;  2PA8 L;  1R9T A;  2CW0 A;  1IE0 A;  3TFJ A;  2GAH C;  5TJ3 A;  3M4O K;  3FKI K;  3VA7 A;  3BP3 A;  2R93 K;  4X6A C;  4GZY A;  3HOW K;  2JA6 C;  4U67 S;  2NVY A;  4A3I K;  1B4A A;  3N0B A;  4P5B A;  2XCR B;  2GAG C;  1TWA A;  3S14 K;  2R7Z C;  1I3Q C;  3LYW A;  5C3E C;  3SZZ A;  1EI6 A;  5C4X C;  4LJZ A;  4BBR K;  2GSO A;  5M3M K;  2PPB A;  3PO3 K;  1J6W A;  3V4G A;  1WOR A;  1K83 C;  3S1Q C;  1AB4 A;  1VLO A;  4OIR A;  4OIN A;  1FEU A;  4KAS A;  3GTP K;  1YCL A;  1BS2 A;  2E2H K;  5FJ8 K;  3AD7 C;  3S0X A;  2WAQ D;  4AYB L;  5C4J K;  3LAP A;  4JK1 A;  3AQO A;  1KQ4 A;  4KMA A;  1UV7 A;  3S16 C;  3H3V L;  4ZH4 A;  5C3E K;  4G0U A;  5CHP A;  1TWF C;  4KDD A;  4C3H C;  4PAA A;  1J6V A;  2JA7 K;  2JA6 K;  5JFE A;  1F7U A;  3CAG A;  1JOE A;  3RZO C;  3FKI C;  1VJE A;  1TWH K;  5M5Y K;  2JH3 A;  3H0G A;  5IOQ A;  1IW7 A;  1O2A A;  4QJV B;  4Q5S A;  3AQP A;  1SMY A;  5TMC A;  4WCE S;  3RZD K;  4GTA A;  1SFO K;  4P5A A;  1EFW A;  1BJT A;  1HQM A;  2NVX A;  1O24 A;  2WB1 D;  4A3M C;  1G51 A;  3RZD C;  4C2M K;  4C3I C;  5JVH S;  4C3H K;  3DLL S;  2R92 A;  2B63 A;  3ADA C;  4XLN A;  4QJV A;  5DM7 S;  3GEI A;  3AH5 A;  3N3Y A;  5IP7 K;  2XCO A;  2RH6 A;  3PO2 C;  2Y0S D;  3I4M C;  1I50 K;  3HOV K;  3PIP S;  3S1N C;  4OIQ A;  2R92 K;  5D4D A;  3GTO A;  3GTG K;  2Y0S L;  2NVT K;  1YNJ A;  1SFO A;  2GSN A;  4WFN S;  4WIL A;  2VUM A;  2NVY K;  1F7V A;  3HOX C;  1ZXO A;  2A68 A;  4A3E C;  1EQR A;  2CFA A;  2ZFZ A;  3GTG A;  4A3G K;  2VUM K;  3GTO K;  3LPX A;  1ZBS A;  2P8T A;  2JA6 A;  2FQT A;  4GTE A;  5E68 A;  4A3J K;  3GTG C;  4OIP A;  1XXC A;  5EGE A;  1TWA C;  3TFH A;  3FOF A;  2PMZ L;  4A3I C;  3A8I A;  1VRQ C;  1O28 A;  4RMF A;  1ISE A;  4G7H A;  3AD8 C;  4GTF A;  2PMZ D;  2E2H A;  1XPP A;  1Y1V C;  1XXA A;  1Y1W A;  3GTL A;  1USM A;  5IOR A;  4KN7 A;  2FQO A;  4KN4 A;  1Y1W K;  3A8K A;  1O25 A;  1WOP A;  1F93 A;  2R7Z A;  4Q4Z A;  1R9T C;  3G4C A;  3GTJ A;  3GTQ A;  3CQZ K;  4KAT A;  2JA7 A;  3M3Y C;  4C2M C;  1O26 A;  3H0G C;  2B63 K;  4BLB A;  2NVQ C;  4C3J K;  4KMU A;  2JA7 C;  5DM6 S;  4BKW A;  2EBB A;  2ZJP S;  1TWH C;  3HOU C;  4YG2 A;  1WQF A;  1BGW A;  3L4K A;  1WOO A;  2V6T A;  1Y1V K;  3ERE D;  4LK0 A;  3MML B;  4WJ4 A;  3T00 A;  2L5N A;  1O27 A;  4GTD A;  1IS1 A;  3TTG A;  1WCM A;  5EGH A;  1IQ0 A;  4C45 A;  4YFX A;  2WAQ L;  1XZQ A;  3T02 A;  2L3U A;  4G0W A;  3GTM A;  4YFK A;  3LAJ A;  1TWC A;  3PO3 C;  1HI9 A;  5M3F K;  2VUM C;  3GIR A;  1K83 K;  4LLG A;  3S17 K;  3NUH A;  2NVY C;  5IOT A;  1TWF A;  4BBR C;  4WF9 S;  4QIW D;  3L4J A;  2KPU A;  2KWA A;  1L0W A;  3S14 C;  4FZB A;  3H3V D;  3FKI A;  1ZYR A;  5IP7 C;  4A3F K;  5IP9 K;  3HXA A;  4M1X A;  1IBA A;  2KQ1 A;  4QIW L;  1I6V A;  3FHZ A;  4X6A K;  2WB1 L;  1TWG A;  5IOS A;  3T01 A;  4A3C C;  1O29 A;  3HOZ C;  5IYB K;  3M4O C;  3AD9 C;  2V6U A;  4GTB A;  2PHC B;  3S15 C;  2NVQ K;  4Y52 K;  2YU9 K;  5JVO A;  4GTL A;  3HKZ D;  5L46 A;  4MQ9 A;  3S2D C;  4G0V A;  3S15 K;  3GTM C;  1ZQ1 C;  1RU0 A;  2ZJR S;  3GDZ A;  4J3N A;  2CFA B;  3GTL K;  3DXJ A;  3N0C A;  4A93 K;  2O5I A;  4MEY A;  4GFQ A;  1XXB A;  1GE9 A;  1JQW A;  4AH6 A;  1VGX A; 
#chains in the Genus database with same CATH homology
 2A69 A;  3I4N K;  2E2H K;  4OIO A;  5FJ8 K;  2WAQ D;  4MEX A;  4AYB L;  5C4J K;  4JK1 A;  4Q4Z A;  1R9T C;  3HOY C;  4C3J C;  2NVT C;  3CQZ K;  1I6H C;  3S2D K;  3M3Y C;  4AYB D;  4C2M C;  3GTK C;  5C4J C;  4G7O A;  2NVX K;  4A3K C;  1TWG C;  3H0G C;  2B63 K;  2NVQ C;  4A3B C;  1TWA K;  4Y52 C;  4C3J K;  3S16 C;  3H3V L;  4ZH4 A;  4KMU A;  4XLP A;  5TMF A;  5C3E K;  2JA7 C;  4YFN A;  2JA8 K;  3I4N C;  3HKZ L;  2E2H C;  3GTJ C;  3K7A K;  4BBS K;  2E2J C;  1TWF C;  2BE5 A;  2R93 C;  4C3H C;  3HOU C;  1TWH C;  5IP9 C;  4YG2 A;  2JA7 K;  2JA6 K;  2JA8 C;  3WOD A;  5C44 C;  2E2I C;  4BBS C;  1TWF K;  3RZO C;  1Y1V K;  2E2J K;  4LK0 A;  2O5J A;  3FKI C;  1TWG K;  1TWH K;  3S1Q K;  3GTQ C;  4NOI A;  5M5Y K;  1I3Q K;  1IW7 A;  1I6H K;  3S16 K;  4QJV B;  4Q5S A;  5C4X K;  4Y7N K;  4BY1 K;  4A3K K;  1SMY A;  5TMC A;  4YFX A;  4A3F C;  2WAQ L;  3RZD K;  1SFO K;  3GTQ K;  3S1N K;  5IYD K;  1I50 C;  1HQM A;  2R7Z K;  3HOY K;  2WB1 D;  4A3M C;  3RZD C;  4C2M K;  4XSX A;  4C3I C;  3GTK K;  3S2H K;  4C3H K;  1BDF A;  3PO2 K;  3I4M K;  4YFK A;  3S17 C;  1TWC C;  3GTP C;  4BXX C;  4LK1 A;  2R92 C;  3PO3 C;  4XLN A;  4QJV A;  4C3I K;  2VUM C;  5M3F K;  4A93 C;  3GTO C;  1K83 K;  5IP7 K;  4LLG A;  2JA5 K;  3PO2 C;  3S17 K;  2Y0S D;  3I4M C;  2NVY C;  1I50 K;  3HOX K;  3HOV K;  3S1N C;  3HOU K;  1WCM C;  4OIQ A;  5FLM K;  2R92 K;  4A3G C;  3M3Y K;  4A3M K;  3S1M C;  4BBR C;  3GTM K;  5D4D A;  2B63 C;  3H0G K;  3S1R C;  4A3L K;  2PA8 D;  4QIW D;  4A3B K;  4BY7 K;  1WCM K;  2YU9 C;  3S14 C;  5IYB C;  3H3V D;  3GTG K;  3HOZ K;  2Y0S L;  2NVT K;  1YNJ A;  4BY7 C;  3S1R K;  3S1M K;  1ZYR A;  4A3D K;  2NVX C;  5IP7 C;  1YNN A;  4A3F K;  5M5X K;  5IP9 K;  2NVY K;  3HOX C;  3HOV C;  2PA8 L;  4QIW L;  2A68 A;  1I6V A;  4A3E C;  1Y1W C;  3HOW C;  4X6A K;  2CW0 A;  2VUM K;  4A3G K;  3GTO K;  3M4O K;  5M5W K;  3FKI K;  3S2H C;  2WB1 L;  2R93 K;  4X6A C;  3EQL A;  4GZY A;  4XSZ A;  3HOW K;  4A3C C;  4A3J K;  2JA6 C;  3HOZ C;  5IYC C;  3GTG C;  4OIP A;  5IYB K;  4A3I K;  3M4O C;  4A3D C;  1Y1W K;  1TWA C;  3S15 C;  2NVQ K;  4G7Z A;  4Y52 K;  5IYD C;  2YU9 K;  2R7Z C;  3S14 K;  1R9T K;  3HKZ D;  1I3Q C;  5C3E C;  3GTL C;  5FLM C;  2PMZ L;  4A3I C;  4MQ9 A;  4Y7N C;  4BY1 C;  4LJZ A;  3S2D C;  5C4X C;  3GTM C;  4BBR K;  3S15 K;  4BXX K;  4A3L C;  4G7H A;  1SFO C;  2PMZ D;  5M3M K;  3GTL K;  2PPB A;  3DXJ A;  3CQZ C;  2A6H A;  4A3J C;  3PO3 K;  1XPP A;  5IYC K;  1Y1V C;  5C44 K;  2E2I K;  3RZO K;  1K83 C;  2JA5 C;  4A93 K;  3K7A C;  3GTJ K;  4MEY A;  2A6E A;  4KN7 A;  3S1Q C;  4OIR A;  4A3C K;  4OIN A;  1TWC K;  4KN4 A;  2O5I A;  4A3E K;  3GTP K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...