4OIPA

Crystal structure of thermus thermophilus transcription initiation complex soaked with ge23077, atp, and cmpcpp
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
231
structure length
231
Chain Sequence
SKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQAAAVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase subunit alpha
publication title GE23077 binds to the RNA polymerase 'i' and 'i+1' sites and prevents the binding of initiating nucleotides.
pubmed rcsb
source organism Thermus thermophilus
molecule tags Transcription, transferase/antibiotic
total genus 52
structure length 231
sequence length 231
chains with identical sequence B
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2014-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01000 RNA_pol_A_bac RNA polymerase Rpb3/RpoA insert domain
A PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain
A PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.12 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 DNA-directed RNA polymerase, insert domain 4oipA02
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 4oipA01
3H3VD 5C4XK 2E2JK 3I4MK 3RZOK 3HOXC 3I4NK 4A3BK 1SFOC 3GTLC 5IP9K 2R92C 1K83K 4LK1A 3HOUK 1TWGK 2R93C 4G7HA 4BXXC 5M3FK 3GTGK 4XLNA 1TWFK 4MEYA 3HKZL 3GTOK 3GTJK 5C44C 4A3LK 2WAQL 4C3JK 2PA8D 3FKIK 2JA8K 4GZYA 4C3IC 3S1QC 3GTMK 4MEXA 3HOYC 3S1MK 3S15C 3GTKK 4A3MC 3K7AC 4MQ9A 4BY1K 3S14C 3RZDK 2O5JA 3GTQK 4LLGA 4A3DC 1Y1WK 3GTPK 3S2HC 4XLPA 5D4DA 4QIWD 4OIQA 2B63C 2NVTK 2JA7C 2NVXK 1TWHK 5C3EC 4YFXA 2JA6C 3S2DC 5FJ8K 3S1NC 3H3VL 3CQZK 2R7ZK 2A69A 5TMFA 4A3GC 5C4JC 4C2MK 1TWCC 4X6AC 1TWAK 4BBSC 5M5WK 4OIRA 3HOWK 4G7ZA 4A3IK 3HOXK 2PA8L 2YU9C 3M3YC 2E2IC 4A3JC 3WODA 2NVQC 2NVYK 1SFOK 3GTLK 2R92K 2R93K 3M4OC 4BXXK 1YNJA 4A3KC 2O5IA 4NOIA 5C44K 1I50C 2PMZD 5M5YK 1I3QK 4QIWL 2JA5C 4A3FK 4C3IK 5IP7K 2WB1D 4XSZA 3HOYK 5FLMK 4BBSK 3S16K 4BY7K 3S15K 3K7AK 4Y52C 3S14K 1I6HK 4OIOA 2VUMC 3HOUC 4A3DK 5IYBC 4Y7NC 2E2HC 3S1RC 4A3EK 3S2HK 3GTOC 2B63K 2JA7K 3DXJA 4ZH4A 4G7OA 2JA6K 3S2DK 2Y0SD 5IYDK 3HOZK 3GTMC 2A68A 3PO3C 3S1NK 1ZYRA 5IYCC 5IYDC 3PO2C 1WCMC 3S17C 4YFKA 4A3GK 5C4JK 1XPPA 3HOVC 3GTQC 1TWCK 4X6AK 2BE5A 3EQLA 4C3HC 2A6EA 3H0GC 4KMUA 4A3CC 4A93C 5TMCA 2PMZL 1Y1VC 3M3YK 4OIPA 2E2IK 2WB1L 1I6VA 4BBRC 1R9TC 2NVQK 2E2JC 3I4MC 5C4XC 3RZOC 5M5XK 4Q4ZA 3S1QK 4AYBD 3I4NC 4A3KK 4A3BC 4A3MK 4KN7A 5IP9C 4A3IC 1R9TK 1K83C 2JA5K 1TWGC 3GTGC 1TWFC 4LJZA 2Y0SL 3GTJC 4A3LC 2NVYC 4BBRK 4C3JC 4YG2A 5C3EK 4Y52K 3FKIC 2JA8C 2VUMK 4XSXA 5IYBK 4Y7NK 1HQMA 2E2HK 3S1RK 3S1MC 3GTKC 4BY1C 3RZDC 1I3QC 4A3FC 4Q5SA 3HKZD 1SMYA 5IP7C 3PO3K 2CW0A 1Y1WC 2WAQD 4OINA 3GTPC 5FLMC 4BY7C 2A6HA 3S16C 2NVTC 1WCMK 5IYCK 2NVXC 5M3MK 1TWHC 4LK0A 1I6HC 3PO2K 3S17K 3HOVK 4A3EC 4C3HK 3CQZC 2YU9K 2R7ZC 1YNNA 4A3JK 4AYBL 3H0GK 4C2MC 4A3CK 4A93K 4QJVB 4QJVA 1BDFA 1TWAC 3HOZC 3M4OK 1Y1VK 4JK1A 2PPBA 3HOWC 1IW7A 1I50K 4YFNA 4KN4A
chains in the Genus database with same CATH superfamily
2RH6A 2GSUA 3HXAA 4BLBA 1VLOA 2R92C 4LK1A 4G7HA 3GTGK 4MEYA 2WAQL 2PA8D 1O29A 4C3IC 4FM9A 4WILA 3GTKK 3GTLA 3K7AC 4MQ9A 1IE0A 2P5MA 3S14C 1JQWA 2XCOA 3GTQK 4A3DC 2R93A 1WORA 3AD9C 1EI6A 4OIQA 4XCHA 4YFXA 1PJ7A 3S1NC 3CQZK 3Q3QA 4A3GC 1WOSA 1WQFA 3V4GA 5M5WK 2JA7A 5TJ3A 4A3IK 4G0WA 1L0WA 3AD7C 2R92K 1TWCA 1RU0A 2O5IA 5M5YK 1F9NA 2JA5C 4C3IK 2WB1D 4XSZA 1VGXA 4KMDA 4BY7K 3K7AK 4Y52C 3S14K 4GFQA 4WFBS 4A3DK 1DCHA 3DXJA 5HL7S 3AQOA 3GEIA 3HOZK 2V6UA 2A68A 4WFNS 3S1NK 5IYDC 3PO2C 4P5AA 4A3GK 3HOVC 2VUMA 1O28A 5IORA 3T02A 4OIPA 3A8IA 3AD8C 3GTQA 3RZOC 3S1QK 5JVGS 4A3BC 4A3MK 1WQGA 3H0GA 4KN7A 1K83C 2JA5K 2PHCB 1TWFC 4LJZA 1Y1VA 3GTJC 1O26A 4Y52K 1V5VA 3FKIC 2JA8C 1HI9A 4U67S 3CF5S 3OEPA 3VA7A 3BP3A 2ZJPS 1I3QC 1J98A 1O27A 3GTPC 2WAQD 1JVIA 5FLMC 5M3MK 3PO2K 5IYDK 2ZJRS 4LK0A 1I6HC 3HOVK 4KM9A 3GTMA 1O24A 2YU9K 2R7ZC 2CFAA 3A8KA 4P9SA 4C2MC 1XZQA 1Y1WA 3HOWC 1I50K 1G51A 1O2AA 4YFNA 4WCES 3TFIA 3RZOK 5CHPA 1O25A 4A3BK 3LPXA 4BLAA 1K83K 3HOUK 1TWAA 5EGEA 1TWFK 1B4AA 1USMA 3GTOK 3GTJK 5C44C 5JFEA 3FKIK 2JA8K 5HQHA 3HOYC 1SFOA 2O5JA 3GTPK 2B63C 1F7UA 3ERED 5C3EC 3GDZA 3H3VL 3BUEA 2R7ZK 4G0VA 4C2MK 1WOPA 3ADAC 4P5BA 3HOWK 2JA6A 1XZPB 3M3YC 4A3JC 3CAGA 3WODA 2NVQC 2NVYK 1EK8A 3M4OC 5C44K 4NOIA 2L3UA 1EQRA 4QIWL 4A3FK 4KMHA 1O2BA 5IP7K 2YU9A 2E2IA 3HOYK 3S16K 4LOWA 4AH6A 3FHZA 5DM7S 1J6XA 2E2HC 2B63K 1I50A 4G7OA 4KATA 3GTMC 3JSTA 1XXAA 3QX3A 1DCPA 2KWAA 3SZZA 2D6FC 3GTOA 2P8TA 4A3CC 1C0AA 4WJ4A 5TMCA 2PMZL 4GTFA 3M3YK 1WCMA 2NVQK 1I6VA 4BBRC 2E2JC 3I4MC 3N0CA 3TFHA 1IQ0A 3I4NC 5IP9C 4J3NA 1TWGC 2Y0SL 1IS1A 4C3JC 4YG2A 1R9TA 1WIHA 2E2HK 3LYWA 2GAHC 3MMLB 5JVHS 4BY1C 5JVOA 3FOFA 1SMYA 3GTGA 3LAJA 2NVYA 2NVXC 1TWHC 4A3EC 1DD5A 3GTKA 4RMFA 4GTCA 4AYBL 4A3CK 4G0UA 3AQPA 2RGRA 2PPBA 3LAPA 1YNJA 4BBRK 4KN4A 2JH3A 3H3VD 5HL8A 2E2JK 3I4MK 3HOXC 3CQZA 3I4NK 3GTLC 5EGHA 5IP9K 4WJ3M 1TWGK 2R93C 4BXXC 2Y3PA 1PJ5A 3N3YA 4XLNA 4C3JK 2GSOA 4MEXA 3GEHA 3S15C 4IOAS 1WOOA 4KB2A 1FEUA 4BY1K 2R92A 4LLGA 3L4KA 5DM6S 3S2HC 5D4DA 1BS2A 4QIWD 4ILDA 2JA7C 1XXBA 1TWHK 2NVXK 4BKWA 5FJ8K 2A69A 5TMFA 5C4JC 5IOSA 3G4AA 1TWCC 2GAGC 4BBSC 4PAAA 1WQHA 4G7ZA 1XZPA 3HOXK 3GTLK 2R93K 4BXXK 4LQYA 2XCRB 2PMZD 1I3QK 3SZYA 5CJ9A 5FLMK 4WFAS 3S15K 2V6SA 4DDQA 1I6HK 2VUMC 3S1RC 3S2HK 4GTAA 1USOA 1VH2A 2JA7K 5IOQA 4ZH4A 2JA5A 2Y0SD 4KMAA 4M1XA 5IYCC 5C4JK 3GTQC 1TWCK 1YX2A 4C3HC 4FZBA 3NUHA 1F93A 3H0GC 4GTBA 1Y1VC 5C4XC 3GSIA 4AYBD 1J6WA 2ZJQS 4A3IC 1X31C 1PJ6A 4GT9A 4A3LC 5C3EK 4LR2A 2VUMK 4XSXA 4GTDA 3S1RK 3S1MC 3RZDC 1JOEA 1K83A 2CW0A 1TWFA 1Y1WC 4OINA 4BY7C 5IYCK 3GTJA 2NVTC 4KC6A 3FKIA 4C3HK 4A3JK 3H0GK 1I3QA 4QJVB 1BDFA 1TWAC 3HOZC 3M4OK 3GTPA 1Y1VK 2V6TA 2ZUFA 5C4XK 3AH5A 1F7VA 2R7ZA 3DLLS 1SFOC 2L5NA 1ZBSA 1ZXOA 3GEEA 5M3FK 3HKZL 4A3LK 2W7VA 4PABA 4GZYA 3A8JA 3S1QC 3GTMK 3S1MK 4A3MC 3RZDK 1WSRA 4KASA 3GIRA 1BJTA 2KPUA 3OREA 1Y1WK 4KARA 4XLPA 3S0XA 1WSVA 3TTGA 2NVTK 2JA6C 3S2DC 3N0BA 1KQ4A 3PIOS 2ZUEA 4X6AC 1TWAK 4IOCS 2B63A 4OIRA 4WF9S 4KM8A 1IL2A 2PA8L 2YU9C 2E2IC 3G4CA 1YCLA 1SFOK 1AB4A 2FQTA 4GTLA 4KB4A 4A3KC 3FOEA 1I50C 1VJEA 4KAWX 5IOTA 1VRQC 1EFWA 2ZFZA 4OIOA 3HOUC 3T00A 1INNA 5IYBC 4Y7NC 5L46A 4A3EK 3GTOC 3IPJA 2JA6K 3S2DK 2GSNA 2EBBA 3PO3C 3OPFA 1EH1A 1ZYRA 1WCMC 3S17C 1IBAA 4YFKA 1XPPA 4X6AK 2BE5A 3EQLA 2E2HA 2A6EA 1ZVUA 4KMUA 4A93C 4O2DA 1XXCA 2E2IK 2WB1L 1R9TC 5M5XK 3L4JA 4Q4ZA 1DCOA 4A3KK 3PIPS 1J6VA 1O2FB 2XCQA 4GTEA 3GTGC 2NVYC 1ZQ1C 4IO9S 5IYBK 4Y7NK 1HQMA 1UV7A 3GTKC 3TFJA 4Q5SA 4A3FC 3HKZD 1TWGA 5IP7C 3PO3K 1BGWA 2FQOA 4BBSK 2A6HA 3S16C 1WCMK 3S17K 2KQ1A 3CQZC 2CFAB 1YNNA 3T01A 4C45A 4A93K 5E68A 4QJVA 1XZQB 4KDDA 1B4BA 1GE9A 1ISEA 4JK1A 3BP8C 2NVXA 2KXYA 1TWHA 1IW7A 1R9TK
chains in the Genus database with same CATH topology
3H3VD 5C4XK 2E2JK 3I4MK 3RZOK 3HOXC 3I4NK 4A3BK 1SFOC 3GTLC 5IP9K 2R92C 1K83K 4LK1A 3HOUK 1TWGK 2R93C 4G7HA 4BXXC 5M3FK 3GTGK 4XLNA 1TWFK 4MEYA 3HKZL 3GTOK 3GTJK 5C44C 4A3LK 2WAQL 4C3JK 2PA8D 3FKIK 2JA8K 4GZYA 4C3IC 3S1QC 3GTMK 4MEXA 3HOYC 3S1MK 3S15C 3GTKK 4A3MC 3K7AC 4MQ9A 4BY1K 3S14C 3RZDK 2O5JA 3GTQK 4LLGA 4A3DC 1Y1WK 3GTPK 3S2HC 4XLPA 5D4DA 4QIWD 4OIQA 2B63C 2NVTK 2JA7C 2NVXK 1TWHK 5C3EC 4YFXA 2JA6C 3S2DC 5FJ8K 3S1NC 3H3VL 3CQZK 2R7ZK 2A69A 5TMFA 4A3GC 5C4JC 4C2MK 1TWCC 4X6AC 1TWAK 4BBSC 5M5WK 4OIRA 3HOWK 4G7ZA 4A3IK 3HOXK 2PA8L 2YU9C 3M3YC 2E2IC 4A3JC 3WODA 2NVQC 2NVYK 1SFOK 3GTLK 2R92K 2R93K 3M4OC 4BXXK 1YNJA 4A3KC 2O5IA 4NOIA 5C44K 1I50C 2PMZD 5M5YK 1I3QK 4QIWL 2JA5C 4A3FK 4C3IK 5IP7K 2WB1D 4XSZA 3HOYK 5FLMK 4BBSK 3S16K 4BY7K 3S15K 3K7AK 4Y52C 3S14K 1I6HK 4OIOA 2VUMC 3HOUC 4A3DK 5IYBC 4Y7NC 2E2HC 3S1RC 4A3EK 3S2HK 3GTOC 2B63K 2JA7K 3DXJA 4ZH4A 4G7OA 2JA6K 3S2DK 2Y0SD 5IYDK 3HOZK 3GTMC 2A68A 3PO3C 3S1NK 1ZYRA 5IYCC 5IYDC 3PO2C 1WCMC 3S17C 4YFKA 4A3GK 5C4JK 1XPPA 3HOVC 3GTQC 1TWCK 4X6AK 2BE5A 3EQLA 4C3HC 2A6EA 3H0GC 4KMUA 4A3CC 4A93C 5TMCA 2PMZL 1Y1VC 3M3YK 4OIPA 2E2IK 2WB1L 1I6VA 4BBRC 1R9TC 2NVQK 2E2JC 3I4MC 5C4XC 3RZOC 5M5XK 4Q4ZA 3S1QK 4AYBD 3I4NC 4A3KK 4A3BC 4A3MK 4KN7A 5IP9C 4A3IC 1R9TK 1K83C 2JA5K 1TWGC 3GTGC 1TWFC 4LJZA 2Y0SL 3GTJC 4A3LC 2NVYC 4BBRK 4C3JC 4YG2A 5C3EK 4Y52K 3FKIC 2JA8C 2VUMK 4XSXA 5IYBK 4Y7NK 1HQMA 2E2HK 3S1RK 3S1MC 3GTKC 4BY1C 3RZDC 1I3QC 4A3FC 4Q5SA 3HKZD 1SMYA 5IP7C 3PO3K 2CW0A 1Y1WC 2WAQD 4OINA 3GTPC 5FLMC 4BY7C 2A6HA 3S16C 2NVTC 1WCMK 5IYCK 2NVXC 5M3MK 1TWHC 4LK0A 1I6HC 3PO2K 3S17K 3HOVK 4A3EC 4C3HK 3CQZC 2YU9K 2R7ZC 1YNNA 4A3JK 4AYBL 3H0GK 4C2MC 4A3CK 4A93K 4QJVB 4QJVA 1BDFA 1TWAC 3HOZC 3M4OK 1Y1VK 4JK1A 2PPBA 3HOWC 1IW7A 1I50K 4YFNA 4KN4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H3V D;  5C4X K;  2E2J K;  3I4M K;  3RZO K;  3HOX C;  3I4N K;  4A3B K;  1SFO C;  3GTL C;  5IP9 K;  2R92 C;  1K83 K;  4LK1 A;  3HOU K;  1TWG K;  2R93 C;  4G7H A;  4BXX C;  5M3F K;  3GTG K;  4XLN A;  1TWF K;  4MEY A;  3HKZ L;  3GTO K;  3GTJ K;  5C44 C;  4A3L K;  2WAQ L;  4C3J K;  2PA8 D;  3FKI K;  2JA8 K;  4GZY A;  4C3I C;  3S1Q C;  3GTM K;  4MEX A;  3HOY C;  3S1M K;  3S15 C;  3GTK K;  4A3M C;  3K7A C;  4MQ9 A;  4BY1 K;  3S14 C;  3RZD K;  2O5J A;  3GTQ K;  4LLG A;  4A3D C;  1Y1W K;  3GTP K;  3S2H C;  4XLP A;  5D4D A;  4QIW D;  4OIQ A;  2B63 C;  2NVT K;  2JA7 C;  2NVX K;  1TWH K;  5C3E C;  4YFX A;  2JA6 C;  3S2D C;  5FJ8 K;  3S1N C;  3H3V L;  3CQZ K;  2R7Z K;  2A69 A;  5TMF A;  4A3G C;  5C4J C;  4C2M K;  1TWC C;  4X6A C;  1TWA K;  4BBS C;  5M5W K;  4OIR A;  3HOW K;  4G7Z A;  4A3I K;  3HOX K;  2PA8 L;  2YU9 C;  3M3Y C;  2E2I C;  4A3J C;  3WOD A;  2NVQ C;  2NVY K;  1SFO K;  3GTL K;  2R92 K;  2R93 K;  3M4O C;  4BXX K;  1YNJ A;  4A3K C;  2O5I A;  4NOI A;  5C44 K;  1I50 C;  2PMZ D;  5M5Y K;  1I3Q K;  4QIW L;  2JA5 C;  4A3F K;  4C3I K;  5IP7 K;  2WB1 D;  4XSZ A;  3HOY K;  5FLM K;  4BBS K;  3S16 K;  4BY7 K;  3S15 K;  3K7A K;  4Y52 C;  3S14 K;  1I6H K;  4OIO A;  2VUM C;  3HOU C;  4A3D K;  5IYB C;  4Y7N C;  2E2H C;  3S1R C;  4A3E K;  3S2H K;  3GTO C;  2B63 K;  2JA7 K;  3DXJ A;  4ZH4 A;  4G7O A;  2JA6 K;  3S2D K;  2Y0S D;  5IYD K;  3HOZ K;  3GTM C;  2A68 A;  3PO3 C;  3S1N K;  1ZYR A;  5IYC C;  5IYD C;  3PO2 C;  1WCM C;  3S17 C;  4YFK A;  4A3G K;  5C4J K;  1XPP A;  3HOV C;  3GTQ C;  1TWC K;  4X6A K;  2BE5 A;  3EQL A;  4C3H C;  2A6E A;  3H0G C;  4KMU A;  4A3C C;  4A93 C;  5TMC A;  2PMZ L;  1Y1V C;  3M3Y K;  4OIP A;  2E2I K;  2WB1 L;  1I6V A;  4BBR C;  1R9T C;  2NVQ K;  2E2J C;  3I4M C;  5C4X C;  3RZO C;  5M5X K;  4Q4Z A;  3S1Q K;  4AYB D;  3I4N C;  4A3K K;  4A3B C;  4A3M K;  4KN7 A;  5IP9 C;  4A3I C;  1R9T K;  1K83 C;  2JA5 K;  1TWG C;  3GTG C;  1TWF C;  4LJZ A;  2Y0S L;  3GTJ C;  4A3L C;  2NVY C;  4BBR K;  4C3J C;  4YG2 A;  5C3E K;  4Y52 K;  3FKI C;  2JA8 C;  2VUM K;  4XSX A;  5IYB K;  4Y7N K;  1HQM A;  2E2H K;  3S1R K;  3S1M C;  3GTK C;  4BY1 C;  3RZD C;  1I3Q C;  4A3F C;  4Q5S A;  3HKZ D;  1SMY A;  5IP7 C;  3PO3 K;  2CW0 A;  1Y1W C;  2WAQ D;  4OIN A;  3GTP C;  5FLM C;  4BY7 C;  2A6H A;  3S16 C;  2NVT C;  1WCM K;  5IYC K;  2NVX C;  5M3M K;  1TWH C;  4LK0 A;  1I6H C;  3PO2 K;  3S17 K;  3HOV K;  4A3E C;  4C3H K;  3CQZ C;  2YU9 K;  2R7Z C;  1YNN A;  4A3J K;  4AYB L;  3H0G K;  4C2M C;  4A3C K;  4A93 K;  4QJV B;  4QJV A;  1BDF A;  1TWA C;  3HOZ C;  3M4O K;  1Y1V K;  4JK1 A;  2PPB A;  3HOW C;  1IW7 A;  1I50 K;  4YFN A;  4KN4 A; 
#chains in the Genus database with same CATH topology
 2RH6 A;  2GSU A;  3HXA A;  4BLB A;  1VLO A;  2R92 C;  4LK1 A;  4G7H A;  3GTG K;  4MEY A;  2WAQ L;  2PA8 D;  1O29 A;  4C3I C;  4FM9 A;  4WIL A;  3GTK K;  3GTL A;  3K7A C;  4MQ9 A;  1IE0 A;  2P5M A;  3S14 C;  1JQW A;  2XCO A;  3GTQ K;  4A3D C;  2R93 A;  1WOR A;  3AD9 C;  1EI6 A;  4OIQ A;  4XCH A;  4YFX A;  1PJ7 A;  3S1N C;  3CQZ K;  3Q3Q A;  4A3G C;  1WOS A;  1WQF A;  3V4G A;  5M5W K;  2JA7 A;  5TJ3 A;  4A3I K;  4G0W A;  1L0W A;  3AD7 C;  2R92 K;  1TWC A;  1RU0 A;  2O5I A;  5M5Y K;  1F9N A;  2JA5 C;  4C3I K;  2WB1 D;  4XSZ A;  1VGX A;  4KMD A;  4BY7 K;  3K7A K;  4Y52 C;  3S14 K;  4GFQ A;  4WFB S;  4A3D K;  1DCH A;  3DXJ A;  5HL7 S;  3AQO A;  3GEI A;  3HOZ K;  2V6U A;  2A68 A;  4WFN S;  3S1N K;  5IYD C;  3PO2 C;  4P5A A;  4A3G K;  3HOV C;  2VUM A;  1O28 A;  5IOR A;  3T02 A;  4OIP A;  3A8I A;  3AD8 C;  3GTQ A;  3RZO C;  3S1Q K;  5JVG S;  4A3B C;  4A3M K;  1WQG A;  3H0G A;  4KN7 A;  1K83 C;  2JA5 K;  2PHC B;  1TWF C;  4LJZ A;  1Y1V A;  3GTJ C;  1O26 A;  4Y52 K;  1V5V A;  3FKI C;  2JA8 C;  1HI9 A;  4U67 S;  3CF5 S;  3OEP A;  3VA7 A;  3BP3 A;  2ZJP S;  1I3Q C;  1J98 A;  1O27 A;  3GTP C;  2WAQ D;  1JVI A;  5FLM C;  5M3M K;  3PO2 K;  5IYD K;  2ZJR S;  4LK0 A;  1I6H C;  3HOV K;  4KM9 A;  3GTM A;  1O24 A;  2YU9 K;  2R7Z C;  2CFA A;  3A8K A;  4P9S A;  4C2M C;  1XZQ A;  1Y1W A;  3HOW C;  1I50 K;  1G51 A;  1O2A A;  4YFN A;  4WCE S;  3TFI A;  3RZO K;  5CHP A;  1O25 A;  4A3B K;  3LPX A;  4BLA A;  1K83 K;  3HOU K;  1TWA A;  5EGE A;  1TWF K;  1B4A A;  1USM A;  3GTO K;  3GTJ K;  5C44 C;  5JFE A;  3FKI K;  2JA8 K;  5HQH A;  3HOY C;  1SFO A;  2O5J A;  3GTP K;  2B63 C;  1F7U A;  3ERE D;  5C3E C;  3GDZ A;  3H3V L;  3BUE A;  2R7Z K;  4G0V A;  4C2M K;  1WOP A;  3ADA C;  4P5B A;  3HOW K;  2JA6 A;  1XZP B;  3M3Y C;  4A3J C;  3CAG A;  3WOD A;  2NVQ C;  2NVY K;  1EK8 A;  3M4O C;  5C44 K;  4NOI A;  2L3U A;  1EQR A;  4QIW L;  4A3F K;  4KMH A;  1O2B A;  5IP7 K;  2YU9 A;  2E2I A;  3HOY K;  3S16 K;  4LOW A;  4AH6 A;  3FHZ A;  5DM7 S;  1J6X A;  2E2H C;  2B63 K;  1I50 A;  4G7O A;  4KAT A;  3GTM C;  3JST A;  1XXA A;  3QX3 A;  1DCP A;  2KWA A;  3SZZ A;  2D6F C;  3GTO A;  2P8T A;  4A3C C;  1C0A A;  4WJ4 A;  5TMC A;  2PMZ L;  4GTF A;  3M3Y K;  1WCM A;  2NVQ K;  1I6V A;  4BBR C;  2E2J C;  3I4M C;  3N0C A;  3TFH A;  1IQ0 A;  3I4N C;  5IP9 C;  4J3N A;  1TWG C;  2Y0S L;  1IS1 A;  4C3J C;  4YG2 A;  1R9T A;  1WIH A;  2E2H K;  3LYW A;  2GAH C;  3MML B;  5JVH S;  4BY1 C;  5JVO A;  3FOF A;  1SMY A;  3GTG A;  3LAJ A;  2NVY A;  2NVX C;  1TWH C;  4A3E C;  1DD5 A;  3GTK A;  4RMF A;  4GTC A;  4AYB L;  4A3C K;  4G0U A;  3AQP A;  2RGR A;  2PPB A;  3LAP A;  1YNJ A;  4BBR K;  4KN4 A;  2JH3 A;  3H3V D;  5HL8 A;  2E2J K;  3I4M K;  3HOX C;  3CQZ A;  3I4N K;  3GTL C;  5EGH A;  5IP9 K;  4WJ3 M;  1TWG K;  2R93 C;  4BXX C;  2Y3P A;  1PJ5 A;  3N3Y A;  4XLN A;  4C3J K;  2GSO A;  4MEX A;  3GEH A;  3S15 C;  4IOA S;  1WOO A;  4KB2 A;  1FEU A;  4BY1 K;  2R92 A;  4LLG A;  3L4K A;  5DM6 S;  3S2H C;  5D4D A;  1BS2 A;  4QIW D;  4ILD A;  2JA7 C;  1XXB A;  1TWH K;  2NVX K;  4BKW A;  5FJ8 K;  2A69 A;  5TMF A;  5C4J C;  5IOS A;  3G4A A;  1TWC C;  2GAG C;  4BBS C;  4PAA A;  1WQH A;  4G7Z A;  1XZP A;  3HOX K;  3GTL K;  2R93 K;  4BXX K;  4LQY A;  2XCR B;  2PMZ D;  1I3Q K;  3SZY A;  5CJ9 A;  5FLM K;  4WFA S;  3S15 K;  2V6S A;  4DDQ A;  1I6H K;  2VUM C;  3S1R C;  3S2H K;  4GTA A;  1USO A;  1VH2 A;  2JA7 K;  5IOQ A;  4ZH4 A;  2JA5 A;  2Y0S D;  4KMA A;  4M1X A;  5IYC C;  5C4J K;  3GTQ C;  1TWC K;  1YX2 A;  4C3H C;  4FZB A;  3NUH A;  1F93 A;  3H0G C;  4GTB A;  1Y1V C;  5C4X C;  3GSI A;  4AYB D;  1J6W A;  2ZJQ S;  4A3I C;  1X31 C;  1PJ6 A;  4GT9 A;  4A3L C;  5C3E K;  4LR2 A;  2VUM K;  4XSX A;  4GTD A;  3S1R K;  3S1M C;  3RZD C;  1JOE A;  1K83 A;  2CW0 A;  1TWF A;  1Y1W C;  4OIN A;  4BY7 C;  5IYC K;  3GTJ A;  2NVT C;  4KC6 A;  3FKI A;  4C3H K;  4A3J K;  3H0G K;  1I3Q A;  4QJV B;  1BDF A;  1TWA C;  3HOZ C;  3M4O K;  3GTP A;  1Y1V K;  2V6T A;  2ZUF A;  5C4X K;  3AH5 A;  1F7V A;  2R7Z A;  3DLL S;  1SFO C;  2L5N A;  1ZBS A;  1ZXO A;  3GEE A;  5M3F K;  3HKZ L;  4A3L K;  2W7V A;  4PAB A;  4GZY A;  3A8J A;  3S1Q C;  3GTM K;  3S1M K;  4A3M C;  3RZD K;  1WSR A;  4KAS A;  3GIR A;  1BJT A;  2KPU A;  3ORE A;  1Y1W K;  4KAR A;  4XLP A;  3S0X A;  1WSV A;  3TTG A;  2NVT K;  2JA6 C;  3S2D C;  3N0B A;  1KQ4 A;  3PIO S;  2ZUE A;  4X6A C;  1TWA K;  4IOC S;  2B63 A;  4OIR A;  4WF9 S;  4KM8 A;  1IL2 A;  2PA8 L;  2YU9 C;  2E2I C;  3G4C A;  1YCL A;  1SFO K;  1AB4 A;  2FQT A;  4GTL A;  4KB4 A;  4A3K C;  3FOE A;  1I50 C;  1VJE A;  4KAW X;  5IOT A;  1VRQ C;  1EFW A;  2ZFZ A;  4OIO A;  3HOU C;  3T00 A;  1INN A;  5IYB C;  4Y7N C;  5L46 A;  4A3E K;  3GTO C;  3IPJ A;  2JA6 K;  3S2D K;  2GSN A;  2EBB A;  3PO3 C;  3OPF A;  1EH1 A;  1ZYR A;  1WCM C;  3S17 C;  1IBA A;  4YFK A;  1XPP A;  4X6A K;  2BE5 A;  3EQL A;  2E2H A;  2A6E A;  1ZVU A;  4KMU A;  4A93 C;  4O2D A;  1XXC A;  2E2I K;  2WB1 L;  1R9T C;  5M5X K;  3L4J A;  4Q4Z A;  1DCO A;  4A3K K;  3PIP S;  1J6V A;  1O2F B;  2XCQ A;  4GTE A;  3GTG C;  2NVY C;  1ZQ1 C;  4IO9 S;  5IYB K;  4Y7N K;  1HQM A;  1UV7 A;  3GTK C;  3TFJ A;  4Q5S A;  4A3F C;  3HKZ D;  1TWG A;  5IP7 C;  3PO3 K;  1BGW A;  2FQO A;  4BBS K;  2A6H A;  3S16 C;  1WCM K;  3S17 K;  2KQ1 A;  3CQZ C;  2CFA B;  1YNN A;  3T01 A;  4C45 A;  4A93 K;  5E68 A;  4QJV A;  1XZQ B;  4KDD A;  1B4B A;  1GE9 A;  1ISE A;  4JK1 A;  3BP8 C;  2NVX A;  2KXY A;  1TWH A;  1IW7 A;  1R9T K; 
#chains in the Genus database with same CATH homology
 3H3V D;  5C4X K;  2E2J K;  3I4M K;  3RZO K;  3HOX C;  3I4N K;  4A3B K;  1SFO C;  3GTL C;  5IP9 K;  2R92 C;  1K83 K;  4LK1 A;  3HOU K;  1TWG K;  2R93 C;  4G7H A;  4BXX C;  5M3F K;  3GTG K;  4XLN A;  1TWF K;  4MEY A;  3HKZ L;  3GTO K;  3GTJ K;  5C44 C;  4A3L K;  2WAQ L;  4C3J K;  2PA8 D;  3FKI K;  2JA8 K;  4GZY A;  4C3I C;  3S1Q C;  3GTM K;  4MEX A;  3HOY C;  3S1M K;  3S15 C;  3GTK K;  4A3M C;  3K7A C;  4MQ9 A;  4BY1 K;  3S14 C;  3RZD K;  2O5J A;  3GTQ K;  4LLG A;  4A3D C;  1Y1W K;  3GTP K;  3S2H C;  4XLP A;  5D4D A;  4QIW D;  4OIQ A;  2B63 C;  2NVT K;  2JA7 C;  2NVX K;  1TWH K;  5C3E C;  4YFX A;  2JA6 C;  3S2D C;  5FJ8 K;  3S1N C;  3H3V L;  3CQZ K;  2R7Z K;  2A69 A;  5TMF A;  4A3G C;  5C4J C;  4C2M K;  1TWC C;  4X6A C;  1TWA K;  4BBS C;  5M5W K;  4OIR A;  3HOW K;  4G7Z A;  4A3I K;  3HOX K;  2PA8 L;  2YU9 C;  3M3Y C;  2E2I C;  4A3J C;  3WOD A;  2NVQ C;  2NVY K;  1SFO K;  3GTL K;  2R92 K;  2R93 K;  3M4O C;  4BXX K;  1YNJ A;  4A3K C;  2O5I A;  4NOI A;  5C44 K;  1I50 C;  2PMZ D;  5M5Y K;  1I3Q K;  4QIW L;  2JA5 C;  4A3F K;  4C3I K;  5IP7 K;  2WB1 D;  4XSZ A;  3HOY K;  5FLM K;  4BBS K;  3S16 K;  4BY7 K;  3S15 K;  3K7A K;  4Y52 C;  3S14 K;  1I6H K;  4OIO A;  2VUM C;  3HOU C;  4A3D K;  5IYB C;  4Y7N C;  2E2H C;  3S1R C;  4A3E K;  3S2H K;  3GTO C;  2B63 K;  2JA7 K;  3DXJ A;  4ZH4 A;  4G7O A;  2JA6 K;  3S2D K;  2Y0S D;  5IYD K;  3HOZ K;  3GTM C;  2A68 A;  3PO3 C;  3S1N K;  1ZYR A;  5IYC C;  5IYD C;  3PO2 C;  1WCM C;  3S17 C;  4YFK A;  4A3G K;  5C4J K;  1XPP A;  3HOV C;  3GTQ C;  1TWC K;  4X6A K;  2BE5 A;  3EQL A;  4C3H C;  2A6E A;  3H0G C;  4KMU A;  4A3C C;  4A93 C;  5TMC A;  2PMZ L;  1Y1V C;  3M3Y K;  4OIP A;  2E2I K;  2WB1 L;  1I6V A;  4BBR C;  1R9T C;  2NVQ K;  2E2J C;  3I4M C;  5C4X C;  3RZO C;  5M5X K;  4Q4Z A;  3S1Q K;  4AYB D;  3I4N C;  4A3K K;  4A3B C;  4A3M K;  4KN7 A;  5IP9 C;  4A3I C;  1R9T K;  1K83 C;  2JA5 K;  1TWG C;  3GTG C;  1TWF C;  4LJZ A;  2Y0S L;  3GTJ C;  4A3L C;  2NVY C;  4BBR K;  4C3J C;  4YG2 A;  5C3E K;  4Y52 K;  3FKI C;  2JA8 C;  2VUM K;  4XSX A;  5IYB K;  4Y7N K;  1HQM A;  2E2H K;  3S1R K;  3S1M C;  3GTK C;  4BY1 C;  3RZD C;  1I3Q C;  4A3F C;  4Q5S A;  3HKZ D;  1SMY A;  5IP7 C;  3PO3 K;  2CW0 A;  1Y1W C;  2WAQ D;  4OIN A;  3GTP C;  5FLM C;  4BY7 C;  2A6H A;  3S16 C;  2NVT C;  1WCM K;  5IYC K;  2NVX C;  5M3M K;  1TWH C;  4LK0 A;  1I6H C;  3PO2 K;  3S17 K;  3HOV K;  4A3E C;  4C3H K;  3CQZ C;  2YU9 K;  2R7Z C;  1YNN A;  4A3J K;  4AYB L;  3H0G K;  4C2M C;  4A3C K;  4A93 K;  4QJV B;  4QJV A;  1BDF A;  1TWA C;  3HOZ C;  3M4O K;  1Y1V K;  4JK1 A;  2PPB A;  3HOW C;  1IW7 A;  1I50 K;  4YFN A;  4KN4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...