4OIPA

Crystal structure of thermus thermophilus transcription initiation complex soaked with ge23077, atp, and cmpcpp
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
231
structure length
231
Chain Sequence
SKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQAAAVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription, transferase/antibiotic
molecule keywords DNA-directed RNA polymerase subunit alpha
publication title GE23077 binds to the RNA polymerase 'i' and 'i+1' sites and prevents the binding of initiating nucleotides.
pubmed rcsb
source organism Thermus thermophilus
total genus 52
structure length 231
sequence length 231
chains with identical sequence B
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2014-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01000 RNA_pol_A_bac RNA polymerase Rpb3/RpoA insert domain
A PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain
A PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.12 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 DNA-directed RNA polymerase, insert domain 4oipA02
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 4oipA01
4A3BC 1YNJA 4AYBL 2E2HK 3GTLC 2VUMC 4LJZA 4OIOA 3HOXC 1K83K 1TWAC 3GTGC 2E2JC 4BY7C 2YU9C 4C3IK 3S14C 1WCMK 1TWFK 5FLMC 3GTKK 4A3KC 2R7ZC 3RZOC 3S2DC 3S2HK 3S1MC 5C44K 4A3JC 2E2IK 4YG2A 4A3CC 2JA6K 1ZYRA 4G7OA 3H0GK 3S1QK 3DXJA 4C3HC 2R92C 1Y1VK 5M5WK 3H3VL 1TWGK 3HOWC 4LK0A 5IP9C 3S1NC 3I4MC 4OIPA 3HOUK 1SMYA 4QJVA 1SFOK 4BY1K 1K83C 1YNNA 4JK1A 4KN4A 3HOVK 4QJVB 2R93K 5C4XK 4G7ZA 5M3FK 4YFNA 1BDFA 3K7AK 2JA5C 2JA7K 3GTMK 4BXXK 5C3EK 3H3VD 4Q5SA 1TWCK 4A3GK 3M3YK 5IYDK 3FKIK 3GTPK 5M5XK 4C2MC 4A3MK 5TMFA 4QIWD 4YFXA 2E2IC 3S16K 3M4OK 3S15K 4YFKA 3RZDC 2PA8D 3S17C 3S1QC 3I4NC 2NVQK 3HOZK 3S1RC 5TMCA 4A3DC 1TWGC 4A3EK 3EQLA 4C3JK 4Y7NK 2NVTK 1I6HK 2NVXC 3HOUC 5C4JC 1SFOC 4BBSC 4BBRK 2PPBA 2Y0SD 3HKZD 4BY1C 4Y52C 4X6AC 3HOVC 2B63K 3GTOK 3PO2K 1I50C 3PO3K 1I3QK 4A3IC 5C4XC 4LLGA 2NVYK 4G7HA 2R93C 2JA7C 2PMZD 2JA8C 4BXXC 4MQ9A 1TWCC 2A68A 4QIWL 3GTJK 2E2HC 5FJ8K 3FKIC 2PA8L 3GTQK 4A3MC 1Y1WK 5IYBK 1TWHK 4ZH4A 4C3IC 4A3FK 4A3LK 1WCMC 4A93K 1TWFC 3GTKC 2A69A 3HOZC 3CQZK 3S2HC 5C44C 1R9TK 4A3BK 4A3EC 2CW0A 2Y0SL 3HKZL 2VUMK 3HOXK 1IW7A 2O5IA 2JA6C 4XLNA 3H0GC 2YU9K 3S14K 2WAQD 1Y1VC 1XPPA 2PMZL 5M5YK 5FLMK 3HOYK 2R7ZK 3RZOK 1I3QC 3WODA 3S1MK 4A3JK 3GTJC 4XLPA 1I6HC 5IYCK 4OIRA 1Y1WC 2R92K 5D4DA 1HQMA 4XSZA 4A93C 3K7AC 3GTMC 4A3LC 3S1NK 4A3GC 5IYDC 4MEYA 5C3EC 3CQZC 3M3YC 5IP7K 3GTPC 3S16C 3M4OC 4KN7A 2WAQL 3S15C 5M3MK 2NVQC 3HOYC 2JA5K 4GZYA 4OIQA 4C3JC 1I6VA 4Y7NC 4MEXA 3GTLK 2NVTC 2A6HA 4C2MK 2WB1D 5IYCC 1TWAK 3GTGK 2E2JK 4BY7K 4AYBD 4BBRC 2A6EA 3RZDK 3S17K 3GTOC 3I4NK 2B63C 3PO2C 4A3KK 3PO3C 3S1RK 3S2DK 4A3DK 2NVYC 4Q4ZA 4A3CK 3GTQC 2NVXK 5IP7C 4KMUA 5C4JK 4BBSK 4XSXA 2BE5A 4X6AK 5IYBC 4C3HK 4LK1A 1TWHC 2O5JA 4Y52K 4NOIA 4A3FC 1I50K 3HOWK 4OINA 5IP9K 4A3IK 3I4MK 2JA8K 2WB1L 1R9TC
chains in the Genus database with same CATH superfamily
2E2HK 2VUMC 1K83K 4WCES 3GTGC 3GTKA 2E2JC 4BY7C 1AB4A 3A8IA 1O29A 4C3IK 2KWAA 3GTKK 1XZQA 3S2DC 3S1MC 1F93A 1WQHA 4A3JC 4KM9A 3NUHA 1Y1VK 3I4MC 1DCHA 1ISEA 4BY1K 4JK1A 3TFHA 5M3FK 3K7AK 5EGEA 1XZPA 1R9TA 4A3GK 5HL8A 1WQFA 3GTPK 4A3MK 1BS2A 2YU9A 4ILDA 3S15K 4YFKA 3OPFA 3S1RC 4Y7NK 3GTOA 4O2DA 5C4JC 1SFOC 2PPBA 2W7VA 3GTOK 4X6AC 3HOVC 1VLOA 1PJ6A 5C4XC 4LLGA 2JA7C 3GTJK 2JA8C 1I6HK 3FOEA 2E2HC 3FKIC 1PJ7A 4ZH4A 4C3IC 1KQ4A 4A3FK 3GTKC 4KARA 3TTGA 2KQ1A 1TWAA 3GEEA 4A3BK 4RMFA 2O5IA 4XLNA 4J3NA 4C45A 1Y1VC 5M5YK 3PIPS 3N3YA 2R7ZK 3RZOK 1B4BA 1BJTA 1IL2A 2FQOA 3N0BA 4OIRA 3T01A 4IO9S 1DCPA 2ZUFA 4XSZA 3CAGA 3K7AC 4A3GC 4MEYA 1WIHA 5IP7K 3GTPC 3T02A 2V6TA 1VRQC 3GIRA 3S15C 1IE0A 3AD9C 5M3MK 4WFBS 1EQRA 1I6VA 4Y7NC 3H0GA 2WB1D 3GTGK 2E2JK 4BY7K 3S17K 3GTOC 1O27A 1TWGA 3I4NK 3S2DK 5HL7S 1FEUA 1EI6A 2PHCB 4XSXA 3GTMA 4A3FC 3VA7A 4OINA 4A3IK 3I4MK 2CFAA 2WB1L 4A3BC 1YNJA 3CF5S 1EH1A 4LJZA 1TWAC 4A3KC 2R7ZC 3RZOC 1WOPA 4G0VA 1EK8A 3LYWA 2JA6K 2B63A 4GTFA 1I3QA 3DXJA 2NVYA 4C3HC 5M5WK 3H3VL 3GTQA 2P8TA 1SFOK 1IQ0A 3HOVK 4KN4A 4QJVB 5C4XK 4G7ZA 1BDFA 2JA7K 5IYDK 4Q5SA 3FKIK 3A8KA 1BGWA 5TMFA 2XCRB 3AD8C 3S17C 3S1QC 3I4NC 1WSRA 3S0XA 2NVQK 1J6XA 5TMCA 1TWGC 3EQLA 4BLAA 3ERED 3Q3QA 2R92A 2Y0SD 1L0WA 3PO2K 3PO3K 4A3IC 4IOCS 4G7HA 3AQPA 1RU0A 1TWHA 5IYBK 2Y3PA 1TWHK 2JA5A 3L4JA 5HQHA 2P5MA 1R9TK 4A3EC 2CW0A 1WOSA 2Y0SL 3FOFA 4GTCA 2JA6C 3OREA 2ZJQS 2YU9K 3IPJA 5FLMK 3QX3A 1I3QC 2D6FC 2KPUA 4FM9A 1ZBSA 5IOSA 2NVXA 4XLPA 1O26A 1ZVUA 5IYDC 4KMHA 1O2FB 4IOAS 4KN7A 2GAGC 1PJ5A 1WCMA 1TWFA 2RH6A 2NVQC 3HOYC 4GT9A 1USMA 1B4AA 2E2IA 4OIQA 1V5VA 1GE9A 1XZQB 1TWAK 4WFAS 1VJEA 3A8JA 3PO2C 4A3KK 3PO3C 4U67S 1I50A 5IYBC 4C3HK 1TWHC 2R93A 1I50K 4BLBA 1TWCA 4KDDA 4KMAA 2EBBA 1R9TC 1XZPB 4OIOA 5DM6S 3DLLS 4WFNS 2YU9C 1XXBA 3BP3A 5FLMC 3T00A 3S2HK 5C44K 1DD5A 4YG2A 4G7OA 3H0GK 3S1QK 1J98A 1HI9A 1TWGK 4LK0A 1XXAA 4KB2A 5E68A 1EFWA 1Y1WA 4QJVA 3N0CA 5JFEA 3MMLB 3CQZA 4LR2A 4YFNA 4DDQA 3FHZA 3GTMK 3H3VD 4GFQA 1DCOA 3GDZA 3M3YK 2VUMA 1O2BA 4YFXA 4QIWD 2E2IC 3S16K 2L3UA 1YX2A 1X31C 1VGXA 3OEPA 4A3EK 5JVOA 4KC6A 3HOUC 3GEIA 4GTLA 2B63K 5TJ3A 1VH2A 1I50C 4PAAA 1I3QK 3TFIA 2NVYK 2GSUA 4GTEA 2R93C 4WJ3M 4BXXC 4QIWL 1TWCC 2A68A 3GTQK 5FJ8K 2ZJPS 3JSTA 1O2AA 1WORA 5JVGS 3BUEA 3HOZC 3GTLA 3S2HC 5C44C 3G4AA 1IBAA 3HOXK 1IW7A 3H0GC 3S14K 1O24A 2GSNA 1XPPA 3HOYK 4WF9S 2RGRA 3WODA 5IOTA 4PABA 3AQOA 1Y1WC 2R92K 1HQMA 5D4DA 2ZUEA 1JQWA 4A93C 4A3LC 3GTMC 2V6UA 3S1NK 2ZFZA 3CQZC 3M3YC 4KMDA 1K83A 2ZJRS 3L4KA 3S16C 2CFAB 3GSIA 2JA5K 4GZYA 3BP8C 3G4CA 4MEXA 2V6SA 4BKWA 4C2MK 2A6HA 1IS1A 5IYCC 2GAHC 4AYBD 3RZDK 1Y1VA 2B63C 4A3DK 2NVYC 4Q4ZA 3GTQC 4P5BA 2NVXK 3SZZA 5IOQA 4P9SA 4BBSK 2BE5A 4WJ4A 4LK1A 4Y52K 2JH3A 3GTPA 2GSOA 3GEHA 1YCLA 4AYBL 3GTLC 3HOXC 2FQTA 3S14C 1WCMK 3V4GA 1TWFK 1ZXOA 2XCQA 4A3CC 2E2IK 4GTDA 1ZYRA 2R92C 3GTJA 3HOWC 5IP9C 3S1NC 4KATA 4OIPA 3HOUK 1SMYA 1JVIA 4WILA 1K83C 1YNNA 5JVHS 4GTBA 3PIOS 3AD7C 1UV7A 2JA5C 3AH5A 4BXXK 2R93K 5C3EK 1TWCK 1XXCA 5IORA 1INNA 5M5XK 4C2MC 4XCHA 3M4OK 5EGHA 3RZDC 2PA8D 2R7ZA 3HOZK 1WOOA 4A3DC 1F9NA 4KM8A 4C3JK 2NVTK 2NVXC 4G0WA 1J6VA 4BBRK 4BBSC 5DM7S 3HKZD 4BY1C 4Y52C 1G51A 3HXAA 1USOA 2PMZD 4MQ9A 2PA8L 4P5AA 4A3MC 4FZBA 1Y1WK 1JOEA 5CJ9A 4A3LK 1WCMC 4A93K 1TWFC 2A69A 4KASA 3CQZK 3TFJA 1WQGA 3GTGA 3HKZL 2VUMK 1F7UA 2WAQD 2PMZL 2KXYA 1J6WA 5L46A 3S1MK 4AH6A 4A3JK 3GTJC 1I6HC 5IYCK 1WSVA 4KB4A 3SZYA 4GTAA 1ZQ1C 1C0AA 4G0UA 5C3EC 2L5NA 4KAWX 3LPXA 4LOWA 3M4OC 3ADAC 2WAQL 1F7VA 2XCOA 5CHPA 4C3JC 3LAPA 3GTLK 2JA6A 2NVTC 4BBRC 2A6EA 3S1RK 4M1XA 1SFOA 4A3CK 4LQYA 5IP7C 4KMUA 1O28A 5C4JK 4X6AK 2O5JA 2JA7A 4NOIA 3HOWK 3LAJA 5IP9K 2E2HA 3FKIA 1O25A 2JA8K
chains in the Genus database with same CATH topology
4A3BC 1YNJA 4AYBL 2E2HK 3GTLC 2VUMC 4LJZA 4OIOA 3HOXC 1K83K 1TWAC 3GTGC 2E2JC 4BY7C 2YU9C 4C3IK 3S14C 1WCMK 1TWFK 5FLMC 3GTKK 4A3KC 2R7ZC 3RZOC 3S2DC 3S2HK 3S1MC 5C44K 4A3JC 2E2IK 4YG2A 4A3CC 2JA6K 1ZYRA 4G7OA 3H0GK 3S1QK 3DXJA 4C3HC 2R92C 1Y1VK 5M5WK 3H3VL 1TWGK 3HOWC 4LK0A 5IP9C 3S1NC 3I4MC 4OIPA 3HOUK 1SMYA 4QJVA 1SFOK 4BY1K 1K83C 1YNNA 4JK1A 4KN4A 3HOVK 4QJVB 2R93K 5C4XK 4G7ZA 5M3FK 4YFNA 1BDFA 3K7AK 2JA5C 2JA7K 3GTMK 4BXXK 5C3EK 3H3VD 4Q5SA 1TWCK 4A3GK 3M3YK 5IYDK 3FKIK 3GTPK 5M5XK 4C2MC 4A3MK 5TMFA 4QIWD 4YFXA 2E2IC 3S16K 3M4OK 3S15K 4YFKA 3RZDC 2PA8D 3S17C 3S1QC 3I4NC 2NVQK 3HOZK 3S1RC 5TMCA 4A3DC 1TWGC 4A3EK 3EQLA 4C3JK 4Y7NK 2NVTK 1I6HK 2NVXC 3HOUC 5C4JC 1SFOC 4BBSC 4BBRK 2PPBA 2Y0SD 3HKZD 4BY1C 4Y52C 4X6AC 3HOVC 2B63K 3GTOK 3PO2K 1I50C 3PO3K 1I3QK 4A3IC 5C4XC 4LLGA 2NVYK 4G7HA 2R93C 2JA7C 2PMZD 2JA8C 4BXXC 4MQ9A 1TWCC 2A68A 4QIWL 3GTJK 2E2HC 5FJ8K 3FKIC 2PA8L 3GTQK 4A3MC 1Y1WK 5IYBK 1TWHK 4ZH4A 4C3IC 4A3FK 4A3LK 1WCMC 4A93K 1TWFC 3GTKC 2A69A 3HOZC 3CQZK 3S2HC 5C44C 1R9TK 4A3BK 4A3EC 2CW0A 2Y0SL 3HKZL 2VUMK 3HOXK 1IW7A 2O5IA 2JA6C 4XLNA 3H0GC 2YU9K 3S14K 2WAQD 1Y1VC 1XPPA 2PMZL 5M5YK 5FLMK 3HOYK 2R7ZK 3RZOK 1I3QC 3WODA 3S1MK 4A3JK 3GTJC 4XLPA 1I6HC 5IYCK 4OIRA 1Y1WC 2R92K 5D4DA 1HQMA 4XSZA 4A93C 3K7AC 3GTMC 4A3LC 3S1NK 4A3GC 5IYDC 4MEYA 5C3EC 3CQZC 3M3YC 5IP7K 3GTPC 3S16C 3M4OC 4KN7A 2WAQL 3S15C 5M3MK 2NVQC 3HOYC 2JA5K 4GZYA 4OIQA 4C3JC 1I6VA 4Y7NC 4MEXA 3GTLK 2NVTC 2A6HA 4C2MK 2WB1D 5IYCC 1TWAK 3GTGK 2E2JK 4BY7K 4AYBD 4BBRC 2A6EA 3RZDK 3S17K 3GTOC 3I4NK 2B63C 3PO2C 4A3KK 3PO3C 3S1RK 3S2DK 4A3DK 2NVYC 4Q4ZA 4A3CK 3GTQC 2NVXK 5IP7C 4KMUA 5C4JK 4BBSK 4XSXA 2BE5A 4X6AK 5IYBC 4C3HK 4LK1A 1TWHC 2O5JA 4Y52K 4NOIA 4A3FC 1I50K 3HOWK 4OINA 5IP9K 4A3IK 3I4MK 2JA8K 2WB1L 1R9TC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A3B C;  1YNJ A;  4AYB L;  2E2H K;  3GTL C;  2VUM C;  4LJZ A;  4OIO A;  3HOX C;  1K83 K;  1TWA C;  3GTG C;  2E2J C;  4BY7 C;  2YU9 C;  4C3I K;  3S14 C;  1WCM K;  1TWF K;  5FLM C;  3GTK K;  4A3K C;  2R7Z C;  3RZO C;  3S2D C;  3S2H K;  3S1M C;  5C44 K;  4A3J C;  2E2I K;  4YG2 A;  4A3C C;  2JA6 K;  1ZYR A;  4G7O A;  3H0G K;  3S1Q K;  3DXJ A;  4C3H C;  2R92 C;  1Y1V K;  5M5W K;  3H3V L;  1TWG K;  3HOW C;  4LK0 A;  5IP9 C;  3S1N C;  3I4M C;  4OIP A;  3HOU K;  1SMY A;  4QJV A;  1SFO K;  4BY1 K;  1K83 C;  1YNN A;  4JK1 A;  4KN4 A;  3HOV K;  4QJV B;  2R93 K;  5C4X K;  4G7Z A;  5M3F K;  4YFN A;  1BDF A;  3K7A K;  2JA5 C;  2JA7 K;  3GTM K;  4BXX K;  5C3E K;  3H3V D;  4Q5S A;  1TWC K;  4A3G K;  3M3Y K;  5IYD K;  3FKI K;  3GTP K;  5M5X K;  4C2M C;  4A3M K;  5TMF A;  4QIW D;  4YFX A;  2E2I C;  3S16 K;  3M4O K;  3S15 K;  4YFK A;  3RZD C;  2PA8 D;  3S17 C;  3S1Q C;  3I4N C;  2NVQ K;  3HOZ K;  3S1R C;  5TMC A;  4A3D C;  1TWG C;  4A3E K;  3EQL A;  4C3J K;  4Y7N K;  2NVT K;  1I6H K;  2NVX C;  3HOU C;  5C4J C;  1SFO C;  4BBS C;  4BBR K;  2PPB A;  2Y0S D;  3HKZ D;  4BY1 C;  4Y52 C;  4X6A C;  3HOV C;  2B63 K;  3GTO K;  3PO2 K;  1I50 C;  3PO3 K;  1I3Q K;  4A3I C;  5C4X C;  4LLG A;  2NVY K;  4G7H A;  2R93 C;  2JA7 C;  2PMZ D;  2JA8 C;  4BXX C;  4MQ9 A;  1TWC C;  2A68 A;  4QIW L;  3GTJ K;  2E2H C;  5FJ8 K;  3FKI C;  2PA8 L;  3GTQ K;  4A3M C;  1Y1W K;  5IYB K;  1TWH K;  4ZH4 A;  4C3I C;  4A3F K;  4A3L K;  1WCM C;  4A93 K;  1TWF C;  3GTK C;  2A69 A;  3HOZ C;  3CQZ K;  3S2H C;  5C44 C;  1R9T K;  4A3B K;  4A3E C;  2CW0 A;  2Y0S L;  3HKZ L;  2VUM K;  3HOX K;  1IW7 A;  2O5I A;  2JA6 C;  4XLN A;  3H0G C;  2YU9 K;  3S14 K;  2WAQ D;  1Y1V C;  1XPP A;  2PMZ L;  5M5Y K;  5FLM K;  3HOY K;  2R7Z K;  3RZO K;  1I3Q C;  3WOD A;  3S1M K;  4A3J K;  3GTJ C;  4XLP A;  1I6H C;  5IYC K;  4OIR A;  1Y1W C;  2R92 K;  5D4D A;  1HQM A;  4XSZ A;  4A93 C;  3K7A C;  3GTM C;  4A3L C;  3S1N K;  4A3G C;  5IYD C;  4MEY A;  5C3E C;  3CQZ C;  3M3Y C;  5IP7 K;  3GTP C;  3S16 C;  3M4O C;  4KN7 A;  2WAQ L;  3S15 C;  5M3M K;  2NVQ C;  3HOY C;  2JA5 K;  4GZY A;  4OIQ A;  4C3J C;  1I6V A;  4Y7N C;  4MEX A;  3GTL K;  2NVT C;  2A6H A;  4C2M K;  2WB1 D;  5IYC C;  1TWA K;  3GTG K;  2E2J K;  4BY7 K;  4AYB D;  4BBR C;  2A6E A;  3RZD K;  3S17 K;  3GTO C;  3I4N K;  2B63 C;  3PO2 C;  4A3K K;  3PO3 C;  3S1R K;  3S2D K;  4A3D K;  2NVY C;  4Q4Z A;  4A3C K;  3GTQ C;  2NVX K;  5IP7 C;  4KMU A;  5C4J K;  4BBS K;  4XSX A;  2BE5 A;  4X6A K;  5IYB C;  4C3H K;  4LK1 A;  1TWH C;  2O5J A;  4Y52 K;  4NOI A;  4A3F C;  1I50 K;  3HOW K;  4OIN A;  5IP9 K;  4A3I K;  3I4M K;  2JA8 K;  2WB1 L;  1R9T C; 
#chains in the Genus database with same CATH topology
 2E2H K;  2VUM C;  1K83 K;  4WCE S;  3GTG C;  3GTK A;  2E2J C;  4BY7 C;  1AB4 A;  3A8I A;  1O29 A;  4C3I K;  2KWA A;  3GTK K;  1XZQ A;  3S2D C;  3S1M C;  1F93 A;  1WQH A;  4A3J C;  4KM9 A;  3NUH A;  1Y1V K;  3I4M C;  1DCH A;  1ISE A;  4BY1 K;  4JK1 A;  3TFH A;  5M3F K;  3K7A K;  5EGE A;  1XZP A;  1R9T A;  4A3G K;  5HL8 A;  1WQF A;  3GTP K;  4A3M K;  1BS2 A;  2YU9 A;  4ILD A;  3S15 K;  4YFK A;  3OPF A;  3S1R C;  4Y7N K;  3GTO A;  4O2D A;  5C4J C;  1SFO C;  2PPB A;  2W7V A;  3GTO K;  4X6A C;  3HOV C;  1VLO A;  1PJ6 A;  5C4X C;  4LLG A;  2JA7 C;  3GTJ K;  2JA8 C;  1I6H K;  3FOE A;  2E2H C;  3FKI C;  1PJ7 A;  4ZH4 A;  4C3I C;  1KQ4 A;  4A3F K;  3GTK C;  4KAR A;  3TTG A;  2KQ1 A;  1TWA A;  3GEE A;  4A3B K;  4RMF A;  2O5I A;  4XLN A;  4J3N A;  4C45 A;  1Y1V C;  5M5Y K;  3PIP S;  3N3Y A;  2R7Z K;  3RZO K;  1B4B A;  1BJT A;  1IL2 A;  2FQO A;  3N0B A;  4OIR A;  3T01 A;  4IO9 S;  1DCP A;  2ZUF A;  4XSZ A;  3CAG A;  3K7A C;  4A3G C;  4MEY A;  1WIH A;  5IP7 K;  3GTP C;  3T02 A;  2V6T A;  1VRQ C;  3GIR A;  3S15 C;  1IE0 A;  3AD9 C;  5M3M K;  4WFB S;  1EQR A;  1I6V A;  4Y7N C;  3H0G A;  2WB1 D;  3GTG K;  2E2J K;  4BY7 K;  3S17 K;  3GTO C;  1O27 A;  1TWG A;  3I4N K;  3S2D K;  5HL7 S;  1FEU A;  1EI6 A;  2PHC B;  4XSX A;  3GTM A;  4A3F C;  3VA7 A;  4OIN A;  4A3I K;  3I4M K;  2CFA A;  2WB1 L;  4A3B C;  1YNJ A;  3CF5 S;  1EH1 A;  4LJZ A;  1TWA C;  4A3K C;  2R7Z C;  3RZO C;  1WOP A;  4G0V A;  1EK8 A;  3LYW A;  2JA6 K;  2B63 A;  4GTF A;  1I3Q A;  3DXJ A;  2NVY A;  4C3H C;  5M5W K;  3H3V L;  3GTQ A;  2P8T A;  1SFO K;  1IQ0 A;  3HOV K;  4KN4 A;  4QJV B;  5C4X K;  4G7Z A;  1BDF A;  2JA7 K;  5IYD K;  4Q5S A;  3FKI K;  3A8K A;  1BGW A;  5TMF A;  2XCR B;  3AD8 C;  3S17 C;  3S1Q C;  3I4N C;  1WSR A;  3S0X A;  2NVQ K;  1J6X A;  5TMC A;  1TWG C;  3EQL A;  4BLA A;  3ERE D;  3Q3Q A;  2R92 A;  2Y0S D;  1L0W A;  3PO2 K;  3PO3 K;  4A3I C;  4IOC S;  4G7H A;  3AQP A;  1RU0 A;  1TWH A;  5IYB K;  2Y3P A;  1TWH K;  2JA5 A;  3L4J A;  5HQH A;  2P5M A;  1R9T K;  4A3E C;  2CW0 A;  1WOS A;  2Y0S L;  3FOF A;  4GTC A;  2JA6 C;  3ORE A;  2ZJQ S;  2YU9 K;  3IPJ A;  5FLM K;  3QX3 A;  1I3Q C;  2D6F C;  2KPU A;  4FM9 A;  1ZBS A;  5IOS A;  2NVX A;  4XLP A;  1O26 A;  1ZVU A;  5IYD C;  4KMH A;  1O2F B;  4IOA S;  4KN7 A;  2GAG C;  1PJ5 A;  1WCM A;  1TWF A;  2RH6 A;  2NVQ C;  3HOY C;  4GT9 A;  1USM A;  1B4A A;  2E2I A;  4OIQ A;  1V5V A;  1GE9 A;  1XZQ B;  1TWA K;  4WFA S;  1VJE A;  3A8J A;  3PO2 C;  4A3K K;  3PO3 C;  4U67 S;  1I50 A;  5IYB C;  4C3H K;  1TWH C;  2R93 A;  1I50 K;  4BLB A;  1TWC A;  4KDD A;  4KMA A;  2EBB A;  1R9T C;  1XZP B;  4OIO A;  5DM6 S;  3DLL S;  4WFN S;  2YU9 C;  1XXB A;  3BP3 A;  5FLM C;  3T00 A;  3S2H K;  5C44 K;  1DD5 A;  4YG2 A;  4G7O A;  3H0G K;  3S1Q K;  1J98 A;  1HI9 A;  1TWG K;  4LK0 A;  1XXA A;  4KB2 A;  5E68 A;  1EFW A;  1Y1W A;  4QJV A;  3N0C A;  5JFE A;  3MML B;  3CQZ A;  4LR2 A;  4YFN A;  4DDQ A;  3FHZ A;  3GTM K;  3H3V D;  4GFQ A;  1DCO A;  3GDZ A;  3M3Y K;  2VUM A;  1O2B A;  4YFX A;  4QIW D;  2E2I C;  3S16 K;  2L3U A;  1YX2 A;  1X31 C;  1VGX A;  3OEP A;  4A3E K;  5JVO A;  4KC6 A;  3HOU C;  3GEI A;  4GTL A;  2B63 K;  5TJ3 A;  1VH2 A;  1I50 C;  4PAA A;  1I3Q K;  3TFI A;  2NVY K;  2GSU A;  4GTE A;  2R93 C;  4WJ3 M;  4BXX C;  4QIW L;  1TWC C;  2A68 A;  3GTQ K;  5FJ8 K;  2ZJP S;  3JST A;  1O2A A;  1WOR A;  5JVG S;  3BUE A;  3HOZ C;  3GTL A;  3S2H C;  5C44 C;  3G4A A;  1IBA A;  3HOX K;  1IW7 A;  3H0G C;  3S14 K;  1O24 A;  2GSN A;  1XPP A;  3HOY K;  4WF9 S;  2RGR A;  3WOD A;  5IOT A;  4PAB A;  3AQO A;  1Y1W C;  2R92 K;  1HQM A;  5D4D A;  2ZUE A;  1JQW A;  4A93 C;  4A3L C;  3GTM C;  2V6U A;  3S1N K;  2ZFZ A;  3CQZ C;  3M3Y C;  4KMD A;  1K83 A;  2ZJR S;  3L4K A;  3S16 C;  2CFA B;  3GSI A;  2JA5 K;  4GZY A;  3BP8 C;  3G4C A;  4MEX A;  2V6S A;  4BKW A;  4C2M K;  2A6H A;  1IS1 A;  5IYC C;  2GAH C;  4AYB D;  3RZD K;  1Y1V A;  2B63 C;  4A3D K;  2NVY C;  4Q4Z A;  3GTQ C;  4P5B A;  2NVX K;  3SZZ A;  5IOQ A;  4P9S A;  4BBS K;  2BE5 A;  4WJ4 A;  4LK1 A;  4Y52 K;  2JH3 A;  3GTP A;  2GSO A;  3GEH A;  1YCL A;  4AYB L;  3GTL C;  3HOX C;  2FQT A;  3S14 C;  1WCM K;  3V4G A;  1TWF K;  1ZXO A;  2XCQ A;  4A3C C;  2E2I K;  4GTD A;  1ZYR A;  2R92 C;  3GTJ A;  3HOW C;  5IP9 C;  3S1N C;  4KAT A;  4OIP A;  3HOU K;  1SMY A;  1JVI A;  4WIL A;  1K83 C;  1YNN A;  5JVH S;  4GTB A;  3PIO S;  3AD7 C;  1UV7 A;  2JA5 C;  3AH5 A;  4BXX K;  2R93 K;  5C3E K;  1TWC K;  1XXC A;  5IOR A;  1INN A;  5M5X K;  4C2M C;  4XCH A;  3M4O K;  5EGH A;  3RZD C;  2PA8 D;  2R7Z A;  3HOZ K;  1WOO A;  4A3D C;  1F9N A;  4KM8 A;  4C3J K;  2NVT K;  2NVX C;  4G0W A;  1J6V A;  4BBR K;  4BBS C;  5DM7 S;  3HKZ D;  4BY1 C;  4Y52 C;  1G51 A;  3HXA A;  1USO A;  2PMZ D;  4MQ9 A;  2PA8 L;  4P5A A;  4A3M C;  4FZB A;  1Y1W K;  1JOE A;  5CJ9 A;  4A3L K;  1WCM C;  4A93 K;  1TWF C;  2A69 A;  4KAS A;  3CQZ K;  3TFJ A;  1WQG A;  3GTG A;  3HKZ L;  2VUM K;  1F7U A;  2WAQ D;  2PMZ L;  2KXY A;  1J6W A;  5L46 A;  3S1M K;  4AH6 A;  4A3J K;  3GTJ C;  1I6H C;  5IYC K;  1WSV A;  4KB4 A;  3SZY A;  4GTA A;  1ZQ1 C;  1C0A A;  4G0U A;  5C3E C;  2L5N A;  4KAW X;  3LPX A;  4LOW A;  3M4O C;  3ADA C;  2WAQ L;  1F7V A;  2XCO A;  5CHP A;  4C3J C;  3LAP A;  3GTL K;  2JA6 A;  2NVT C;  4BBR C;  2A6E A;  3S1R K;  4M1X A;  1SFO A;  4A3C K;  4LQY A;  5IP7 C;  4KMU A;  1O28 A;  5C4J K;  4X6A K;  2O5J A;  2JA7 A;  4NOI A;  3HOW K;  3LAJ A;  5IP9 K;  2E2H A;  3FKI A;  1O25 A;  2JA8 K; 
#chains in the Genus database with same CATH homology
 4A3B C;  1YNJ A;  4AYB L;  2E2H K;  3GTL C;  2VUM C;  4LJZ A;  4OIO A;  3HOX C;  1K83 K;  1TWA C;  3GTG C;  2E2J C;  4BY7 C;  2YU9 C;  4C3I K;  3S14 C;  1WCM K;  1TWF K;  5FLM C;  3GTK K;  4A3K C;  2R7Z C;  3RZO C;  3S2D C;  3S2H K;  3S1M C;  5C44 K;  4A3J C;  2E2I K;  4YG2 A;  4A3C C;  2JA6 K;  1ZYR A;  4G7O A;  3H0G K;  3S1Q K;  3DXJ A;  4C3H C;  2R92 C;  1Y1V K;  5M5W K;  3H3V L;  1TWG K;  3HOW C;  4LK0 A;  5IP9 C;  3S1N C;  3I4M C;  4OIP A;  3HOU K;  1SMY A;  4QJV A;  1SFO K;  4BY1 K;  1K83 C;  1YNN A;  4JK1 A;  4KN4 A;  3HOV K;  4QJV B;  2R93 K;  5C4X K;  4G7Z A;  5M3F K;  4YFN A;  1BDF A;  3K7A K;  2JA5 C;  2JA7 K;  3GTM K;  4BXX K;  5C3E K;  3H3V D;  4Q5S A;  1TWC K;  4A3G K;  3M3Y K;  5IYD K;  3FKI K;  3GTP K;  5M5X K;  4C2M C;  4A3M K;  5TMF A;  4QIW D;  4YFX A;  2E2I C;  3S16 K;  3M4O K;  3S15 K;  4YFK A;  3RZD C;  2PA8 D;  3S17 C;  3S1Q C;  3I4N C;  2NVQ K;  3HOZ K;  3S1R C;  5TMC A;  4A3D C;  1TWG C;  4A3E K;  3EQL A;  4C3J K;  4Y7N K;  2NVT K;  1I6H K;  2NVX C;  3HOU C;  5C4J C;  1SFO C;  4BBS C;  4BBR K;  2PPB A;  2Y0S D;  3HKZ D;  4BY1 C;  4Y52 C;  4X6A C;  3HOV C;  2B63 K;  3GTO K;  3PO2 K;  1I50 C;  3PO3 K;  1I3Q K;  4A3I C;  5C4X C;  4LLG A;  2NVY K;  4G7H A;  2R93 C;  2JA7 C;  2PMZ D;  2JA8 C;  4BXX C;  4MQ9 A;  1TWC C;  2A68 A;  4QIW L;  3GTJ K;  2E2H C;  5FJ8 K;  3FKI C;  2PA8 L;  3GTQ K;  4A3M C;  1Y1W K;  5IYB K;  1TWH K;  4ZH4 A;  4C3I C;  4A3F K;  4A3L K;  1WCM C;  4A93 K;  1TWF C;  3GTK C;  2A69 A;  3HOZ C;  3CQZ K;  3S2H C;  5C44 C;  1R9T K;  4A3B K;  4A3E C;  2CW0 A;  2Y0S L;  3HKZ L;  2VUM K;  3HOX K;  1IW7 A;  2O5I A;  2JA6 C;  4XLN A;  3H0G C;  2YU9 K;  3S14 K;  2WAQ D;  1Y1V C;  1XPP A;  2PMZ L;  5M5Y K;  5FLM K;  3HOY K;  2R7Z K;  3RZO K;  1I3Q C;  3WOD A;  3S1M K;  4A3J K;  3GTJ C;  4XLP A;  1I6H C;  5IYC K;  4OIR A;  1Y1W C;  2R92 K;  5D4D A;  1HQM A;  4XSZ A;  4A93 C;  3K7A C;  3GTM C;  4A3L C;  3S1N K;  4A3G C;  5IYD C;  4MEY A;  5C3E C;  3CQZ C;  3M3Y C;  5IP7 K;  3GTP C;  3S16 C;  3M4O C;  4KN7 A;  2WAQ L;  3S15 C;  5M3M K;  2NVQ C;  3HOY C;  2JA5 K;  4GZY A;  4OIQ A;  4C3J C;  1I6V A;  4Y7N C;  4MEX A;  3GTL K;  2NVT C;  2A6H A;  4C2M K;  2WB1 D;  5IYC C;  1TWA K;  3GTG K;  2E2J K;  4BY7 K;  4AYB D;  4BBR C;  2A6E A;  3RZD K;  3S17 K;  3GTO C;  3I4N K;  2B63 C;  3PO2 C;  4A3K K;  3PO3 C;  3S1R K;  3S2D K;  4A3D K;  2NVY C;  4Q4Z A;  4A3C K;  3GTQ C;  2NVX K;  5IP7 C;  4KMU A;  5C4J K;  4BBS K;  4XSX A;  2BE5 A;  4X6A K;  5IYB C;  4C3H K;  4LK1 A;  1TWH C;  2O5J A;  4Y52 K;  4NOI A;  4A3F C;  1I50 K;  3HOW K;  4OIN A;  5IP9 K;  4A3I K;  3I4M K;  2JA8 K;  2WB1 L;  1R9T C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...