4OIPA

Crystal structure of thermus thermophilus transcription initiation complex soaked with ge23077, atp, and cmpcpp
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
231
structure length
231
Chain Sequence
SKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQAAAVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase subunit alpha
publication title GE23077 binds to the RNA polymerase 'i' and 'i+1' sites and prevents the binding of initiating nucleotides.
pubmed rcsb
source organism Thermus thermophilus
molecule tags Transcription, transferase/antibiotic
total genus 52
structure length 231
sequence length 231
chains with identical sequence B
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2014-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01000 RNA_pol_A_bac RNA polymerase Rpb3/RpoA insert domain
A PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain
A PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.12 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 DNA-directed RNA polymerase, insert domain 4oipA02
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 4oipA01
3M3YK 3GTOK 4C3HK 3S16K 2JA7K 4A3CK 1TWAK 2WAQD 3GTQC 3HOVC 4A3JK 4A3BC 4A3GC 3M3YC 2R7ZK 4A3LK 4C3HC 3K7AC 4BBRK 2JA6K 2A6EA 1I6VA 2JA7C 3HOWK 1TWAC 5IP7K 1I50K 1HQMA 2R7ZC 2VUMK 4BBRC 3S14K 5IP7C 2VUMC 1ZYRA 3DXJA 1K83C 3WODA 3S14C 1Y1WC 3GTKK 4KN4A 4C3IC 5IYBK 3S1RK 4QIWD 3GTPK 5FLMK 3HOZK 3HKZD 3I4MK 4AYBD 3S2DC 1YNJA 3HOZC 1TWFC 2Y0SD 1YNNA 4XSXA 4QJVB 2A6HA 4A3KC 4A3IC 3RZDC 5C44C 2CW0A 3S1MC 2NVQC 3HOVK 4A3GK 4MQ9A 2A69A 4GZYA 3K7AK 4C2MC 2YU9C 5C4JC 2WB1L 3S15C 1I3QC 3M4OC 3H0GK 1SMYA 3I4NC 4X6AC 4OINA 3S17K 5TMFA 2WAQL 3GTGK 4MEXA 3H0GC 5M5YK 2R92C 4G7HA 2PA8D 1K83K 3S17C 4Y7NC 2E2JC 3GTGC 1Y1WK 4C3IK 4A3FK 4Q5SA 3S2HK 1SFOC 3S1QK 3S2DK 2JA5K 4A3FC 3GTLC 4QJVA 1TWFK 5M5WK 2B63C 2O5IA 3S2HC 3S1QC 4A3DC 4A3KK 4A3IK 4QIWL 5C44K 2JA5C 3RZDK 3HKZL 1R9TK 3S1MK 2NVQK 2PMZD 3S1NK 4NOIA 2NVXK 4AYBL 4C2MK 5IYCC 2YU9K 5C4JK 3S15K 1R9TC 3CQZC 3HOUC 1I3QK 2Y0SL 3S1NC 5IP9K 2NVXC 3HOXK 4A3EK 3I4NK 4LK1A 4A3MK 3M4OK 4X6AK 4LLGA 2NVTK 4A3EC 5IP9C 3HOXC 2R92K 4A3MC 4OIQA 1TWGK 4MEYA 2NVTC 4BXXC 4Y7NK 2E2JK 2JA8K 4Y52K 4BY7C 1Y1VC 1BDFA 1TWGC 1WCMC 1SFOK 3GTQK 4Y52C 2JA8C 5IYDC 4XLPA 5C3EK 5FJ8K 4OIOA 3GTLK 4KMUA 3RZOK 4BY1C 5C4XC 3H3VD 2B63K 4BBSK 1TWCC 2E2HC 4A3DK 4A93C 5C3EC 3EQLA 3HOYK 4YFKA 3RZOC 2E2IK 4BBSC 2PPBA 5IYCK 2NVYK 5D4DA 3HOYC 1TWHC 1IW7A 3CQZK 3HOUK 4ZH4A 4C3JC 2E2IC 5M3FK 2NVYC 3FKIC 2PMZL 3GTOC 4OIPA 4YG2A 3S16C 4A3CC 4XLNA 4OIRA 3PO3K 4BXXK 4A3JC 4XSZA 4A3LC 4BY7K 2JA6C 3GTJK 5M3MK 1Y1VK 1WCMK 3HOWC 3PO3C 1I50C 4YFNA 2A68A 3GTMK 5IYDK 4G7OA 3GTJC 2R93K 1XPPA 4LJZA 4BY1K 5C4XK 4LK0A 4KN7A 1TWCK 3GTMC 2E2HK 2BE5A 3PO2K 4A93K 1I6HK 2R93C 4YFXA 2PA8L 3GTKC 5IYBC 3S1RC 3PO2C 3GTPC 5FLMC 1I6HC 4G7ZA 1TWHK 3I4MC 5M5XK 3H3VL 2O5JA 4C3JK 5TMCA 4JK1A 2WB1D 3FKIK 4A3BK 4Q4ZA
chains in the Genus database with same CATH superfamily
3M3YK 3GTOK 3S16K 1TWAK 2WAQD 1ZBSA 2B63A 5IOTA 3TFHA 3HOWK 4XCHA 1ZYRA 1K83C 4WFAS 3FHZA 4RMFA 1YNNA 2V6TA 2A6HA 1WCMA 3VA7A 3GTMA 5C44C 1WORA 4PAAA 4GZYA 1ZXOA 2WB1L 5C4JC 5TMFA 2WAQL 3GTGK 2GAHC 3H0GC 1DD5A 1K83K 3S17C 4FM9A 3FKIA 1WIHA 4A3FK 1SFOC 1IS1A 3GEIA 1EK8A 2JA5K 3GTLC 2P5MA 2O5IA 1I50A 5C44K 1R9TK 2PMZD 1O2BA 2NVXK 1PJ5A 4ILDA 5C4JK 3PIOS 3HOUC 1O26A 4GTCA 4A3MK 3GTKA 3A8JA 2NVTK 2GSUA 4C45A 1WSRA 4MEYA 4GTAA 4GTEA 1TWGC 1SFOK 2JA8C 4XLPA 2XCOA 5FJ8K 3GTLK 5C4XC 1YCLA 3N0CA 1J6XA 1TWCC 4BLAA 3ERED 4A93C 4YFKA 2E2IK 3HOUK 1Y1WA 3T02A 2PMZL 4OIPA 4YG2A 1AB4A 2PHCB 1TWFA 4WFBS 2JA6C 4IO9S 4YFNA 1VH2A 4LOWA 5C4XK 1O2FB 4LK0A 4KN7A 1TWCK 1I3QA 4A93K 2BE5A 1I6HK 1ISEA 1WSVA 5CHPA 1J6WA 5IYBC 3S1RC 3GTPC 2R92A 5M5XK 3I4MC 3QX3A 2O5JA 3L4KA 1X31C 3LYWA 2FQOA 2RH6A 4KMHA 2JA7K 2R7ZK 3M3YC 2Y3PA 4BBRK 2JA6K 1I6VA 3AD9C 4KASA 1TWAC 4IOAS 1HQMA 4KB2A 2VUMK 3CAGA 5HQHA 3S14K 4G0WA 3PIPS 4KN4A 5IYBK 3TFIA 3S1RK 3GTPK 3AH5A 3I4MK 4PABA 2Y0SD 1O24A 1Y1VA 4QJVB 4A3KC 5EGEA 3RZDC 3N3YA 4MQ9A 1B4BA 5JVOA 2E2HA 1JQWA 4OINA 4MEXA 1TWHA 5JVGS 4LQYA 2E2JC 2NVYA 3GTGC 3GTOA 4IOCS 3S2HK 3SZYA 3OREA 4A3FC 4WCES 4QJVA 3SZZA 4J3NA 4A3KK 3RZDK 1VRQC 5L46A 2JA5C 4KB4A 1F7UA 1R9TC 3CQZC 2Y0SL 2R93A 3JSTA 2NVXC 4LK1A 1RU0A 5EGHA 4LLGA 1F9NA 2L3UA 1BS2A 4A3MC 3N0BA 3LAJA 2NVTC 3L4JA 2E2JK 4Y52K 5CJ9A 4WFNS 4BY7C 1IBAA 1ZQ1C 4BKWA 5C3EK 4OIOA 2KQ1A 4KMUA 3V4GA 4BY1C 3GIRA 4DDQA 3H3VD 4BBSK 2RGRA 1USOA 4KARA 3HOYK 1WQGA 2D6FC 1VGXA 1XXAA 5D4DA 3CQZK 4GTDA 4ZH4A 1K83A 2E2IC 5DM7S 1B4AA 5E68A 4A3CC 4XLNA 2KPUA 2ZJPS 4WF9S 2EBBA 4A3JC 2JA5A 3AQOA 5JFEA 4BY7K 1INNA 3GTJK 2ZUEA 3A8IA 3LPXA 1O29A 3GEEA 2A68A 1WOOA 1VJEA 4P9SA 4BY1K 4LJZA 2ZFZA 3PO2K 2ZUFA 4KM8A 3H0GA 5FLMC 1I6HC 1PJ7A 4WJ3M 3H3VL 5TMCA 3GTQK 1XZPB 1IL2A 4A3BK 1USMA 5IOQA 4C3HK 1SFOA 4A3CK 2KWAA 3HOVC 4A3JK 4A3GC 3GTLA 1XZQA 3K7AC 5IORA 2JA7C 5IP7K 1VLOA 2R7ZC 1O27A 4BBRC 1KQ4A 3NUHA 3BUEA 2GSNA 2VUMC 3DXJA 3S14C 3HOZK 5FLMK 3HKZD 1EI6A 3G4CA 4AYBD 4AH6A 3S2DC 3FOEA 1YNJA 1XZPA 4XSXA 1TWGA 3MMLB 2CW0A 3HOVK 4A3GK 2A69A 3K7AK 4C2MC 1TWCA 2YU9C 3S15C 3M4OC 4M1XA 1WQHA 3I4NC 3OPFA 4GTLA 4KC6A 1XXBA 5M5YK 2PA8D 1HI9A 2JA7A 3S1QK 3S2DK 2R7ZA 2L5NA 2JA6A 5M5WK 2B63C 3S2HC 4A3DC 2VUMA 3HKZL 3S1NK 1ZVUA 4AYBL 1YX2A 4C2MK 5IYCC 2YU9K 3S15K 4A3EK 5IP9K 3HOXK 3M4OK 3I4NK 3GTPA 1O25A 3BP8C 4BXXC 1EH1A 2KXYA 1WCMC 1O2AA 4Y52C 3GDZA 3RZOK 2B63K 1TWAA 3BP3A 1IQ0A 4A3DK 5C3EC 1BGWA 4G0UA 4G0VA 4BBSC 2PPBA 2FQTA 2NVYK 5IYCK 3HOYC 1IW7A 4C3JC 1L0WA 3FKIC 3AD8C 3S0XA 4OIRA 1J98A 3PO3K 3HXAA 4BXXK 4GTFA 4XSZA 4A3LC 2P8TA 4KMAA 5M3MK 1JVIA 1WCMK 1I50C 3GTMK 5JVHS 3GTJC 2R93K 5HL8A 4YFXA 3GTKC 3PO2C 4WJ4A 4G7ZA 2V6UA 4LR2A 4C3JK 3GTGA 1DCOA 2JH3A 3FKIK 3FOFA 4GT9A 4FZBA 3GTQC 4A3BC 4A3LK 1IE0A 1G51A 4C3HC 2A6EA 1I50K 1XZQB 5IP7C 3CQZA 1R9TA 1EFWA 2NVXA 3A8KA 3GEHA 2V6SA 3WODA 1F7VA 1Y1WC 3GTKK 4C3IC 3G4AA 3TFJA 4QIWD 3HOZC 1TWFC 1DCHA 1DCPA 1UV7A 3GTJA 2GAGC 4KM9A 4A3IC 3S1MC 4KMDA 2NVQC 2XCQA 4P5AA 2CFAB 5TJ3A 1I3QC 3H0GK 3IPJA 1SMYA 4X6AC 3S17K 1PJ6A 5HL7S 3LAPA 2R92C 4G7HA 3GSIA 3DLLS 2E2IA 4Y7NC 3GTQA 4KATA 4P5BA 1Y1WK 4C3IK 4Q5SA 3TTGA 3T01A 1TWFK 3CF5S 3S1QC 3OEPA 4A3IK 4QIWL 1J6VA 3S1MK 2NVQK 4NOIA 2GSOA 1WQFA 2CFAA 1I3QK 3S1NC 4X6AK 3T00A 2ZJQS 4A3EC 5IP9C 3HOXC 5DM6S 4KAWX 1C0AA 2R92K 4BLBA 4OIQA 1TWGK 4GFQA 5IOSA 4Y7NK 2JA8K 1Y1VC 1BDFA 3Q3QA 5IYDC 2XCRB 1FEUA 2E2HC 3EQLA 1EQRA 3RZOC 1O28A 1F93A 1TWHC 4U67S 5M3FK 2NVYC 3GTOC 3S16C 1V5VA 4GTBA 1Y1VK 2ZJRS 3HOWC 3PO3C 5IYDK 4G7OA 4O2DA 1WOSA 1XPPA 2YU9A 1XXCA 3AQPA 1GE9A 3AD7C 1JOEA 2E2HK 3GTMC 3ADAC 2R93C 2PA8L 2W7VA 1WOPA 1TWHK 4KDDA 1BJTA 4WILA 4JK1A 2WB1D 4Q4ZA
chains in the Genus database with same CATH topology
3M3YK 3GTOK 4C3HK 3S16K 2JA7K 4A3CK 1TWAK 2WAQD 3GTQC 3HOVC 4A3JK 4A3BC 4A3GC 3M3YC 2R7ZK 4A3LK 4C3HC 3K7AC 4BBRK 2JA6K 2A6EA 1I6VA 2JA7C 3HOWK 1TWAC 5IP7K 1I50K 1HQMA 2R7ZC 2VUMK 4BBRC 3S14K 5IP7C 2VUMC 1ZYRA 3DXJA 1K83C 3WODA 3S14C 1Y1WC 3GTKK 4KN4A 4C3IC 5IYBK 3S1RK 4QIWD 3GTPK 5FLMK 3HOZK 3HKZD 3I4MK 4AYBD 3S2DC 1YNJA 3HOZC 1TWFC 2Y0SD 1YNNA 4XSXA 4QJVB 2A6HA 4A3KC 4A3IC 3RZDC 5C44C 2CW0A 3S1MC 2NVQC 3HOVK 4A3GK 4MQ9A 2A69A 4GZYA 3K7AK 4C2MC 2YU9C 5C4JC 2WB1L 3S15C 1I3QC 3M4OC 3H0GK 1SMYA 3I4NC 4X6AC 4OINA 3S17K 5TMFA 2WAQL 3GTGK 4MEXA 3H0GC 5M5YK 2R92C 4G7HA 2PA8D 1K83K 3S17C 4Y7NC 2E2JC 3GTGC 1Y1WK 4C3IK 4A3FK 4Q5SA 3S2HK 1SFOC 3S1QK 3S2DK 2JA5K 4A3FC 3GTLC 4QJVA 1TWFK 5M5WK 2B63C 2O5IA 3S2HC 3S1QC 4A3DC 4A3KK 4A3IK 4QIWL 5C44K 2JA5C 3RZDK 3HKZL 1R9TK 3S1MK 2NVQK 2PMZD 3S1NK 4NOIA 2NVXK 4AYBL 4C2MK 5IYCC 2YU9K 5C4JK 3S15K 1R9TC 3CQZC 3HOUC 1I3QK 2Y0SL 3S1NC 5IP9K 2NVXC 3HOXK 4A3EK 3I4NK 4LK1A 4A3MK 3M4OK 4X6AK 4LLGA 2NVTK 4A3EC 5IP9C 3HOXC 2R92K 4A3MC 4OIQA 1TWGK 4MEYA 2NVTC 4BXXC 4Y7NK 2E2JK 2JA8K 4Y52K 4BY7C 1Y1VC 1BDFA 1TWGC 1WCMC 1SFOK 3GTQK 4Y52C 2JA8C 5IYDC 4XLPA 5C3EK 5FJ8K 4OIOA 3GTLK 4KMUA 3RZOK 4BY1C 5C4XC 3H3VD 2B63K 4BBSK 1TWCC 2E2HC 4A3DK 4A93C 5C3EC 3EQLA 3HOYK 4YFKA 3RZOC 2E2IK 4BBSC 2PPBA 5IYCK 2NVYK 5D4DA 3HOYC 1TWHC 1IW7A 3CQZK 3HOUK 4ZH4A 4C3JC 2E2IC 5M3FK 2NVYC 3FKIC 2PMZL 3GTOC 4OIPA 4YG2A 3S16C 4A3CC 4XLNA 4OIRA 3PO3K 4BXXK 4A3JC 4XSZA 4A3LC 4BY7K 2JA6C 3GTJK 5M3MK 1Y1VK 1WCMK 3HOWC 3PO3C 1I50C 4YFNA 2A68A 3GTMK 5IYDK 4G7OA 3GTJC 2R93K 1XPPA 4LJZA 4BY1K 5C4XK 4LK0A 4KN7A 1TWCK 3GTMC 2E2HK 2BE5A 3PO2K 4A93K 1I6HK 2R93C 4YFXA 2PA8L 3GTKC 5IYBC 3S1RC 3PO2C 3GTPC 5FLMC 1I6HC 4G7ZA 1TWHK 3I4MC 5M5XK 3H3VL 2O5JA 4C3JK 5TMCA 4JK1A 2WB1D 3FKIK 4A3BK 4Q4ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M3Y K;  3GTO K;  4C3H K;  3S16 K;  2JA7 K;  4A3C K;  1TWA K;  2WAQ D;  3GTQ C;  3HOV C;  4A3J K;  4A3B C;  4A3G C;  3M3Y C;  2R7Z K;  4A3L K;  4C3H C;  3K7A C;  4BBR K;  2JA6 K;  2A6E A;  1I6V A;  2JA7 C;  3HOW K;  1TWA C;  5IP7 K;  1I50 K;  1HQM A;  2R7Z C;  2VUM K;  4BBR C;  3S14 K;  5IP7 C;  2VUM C;  1ZYR A;  3DXJ A;  1K83 C;  3WOD A;  3S14 C;  1Y1W C;  3GTK K;  4KN4 A;  4C3I C;  5IYB K;  3S1R K;  4QIW D;  3GTP K;  5FLM K;  3HOZ K;  3HKZ D;  3I4M K;  4AYB D;  3S2D C;  1YNJ A;  3HOZ C;  1TWF C;  2Y0S D;  1YNN A;  4XSX A;  4QJV B;  2A6H A;  4A3K C;  4A3I C;  3RZD C;  5C44 C;  2CW0 A;  3S1M C;  2NVQ C;  3HOV K;  4A3G K;  4MQ9 A;  2A69 A;  4GZY A;  3K7A K;  4C2M C;  2YU9 C;  5C4J C;  2WB1 L;  3S15 C;  1I3Q C;  3M4O C;  3H0G K;  1SMY A;  3I4N C;  4X6A C;  4OIN A;  3S17 K;  5TMF A;  2WAQ L;  3GTG K;  4MEX A;  3H0G C;  5M5Y K;  2R92 C;  4G7H A;  2PA8 D;  1K83 K;  3S17 C;  4Y7N C;  2E2J C;  3GTG C;  1Y1W K;  4C3I K;  4A3F K;  4Q5S A;  3S2H K;  1SFO C;  3S1Q K;  3S2D K;  2JA5 K;  4A3F C;  3GTL C;  4QJV A;  1TWF K;  5M5W K;  2B63 C;  2O5I A;  3S2H C;  3S1Q C;  4A3D C;  4A3K K;  4A3I K;  4QIW L;  5C44 K;  2JA5 C;  3RZD K;  3HKZ L;  1R9T K;  3S1M K;  2NVQ K;  2PMZ D;  3S1N K;  4NOI A;  2NVX K;  4AYB L;  4C2M K;  5IYC C;  2YU9 K;  5C4J K;  3S15 K;  1R9T C;  3CQZ C;  3HOU C;  1I3Q K;  2Y0S L;  3S1N C;  5IP9 K;  2NVX C;  3HOX K;  4A3E K;  3I4N K;  4LK1 A;  4A3M K;  3M4O K;  4X6A K;  4LLG A;  2NVT K;  4A3E C;  5IP9 C;  3HOX C;  2R92 K;  4A3M C;  4OIQ A;  1TWG K;  4MEY A;  2NVT C;  4BXX C;  4Y7N K;  2E2J K;  2JA8 K;  4Y52 K;  4BY7 C;  1Y1V C;  1BDF A;  1TWG C;  1WCM C;  1SFO K;  3GTQ K;  4Y52 C;  2JA8 C;  5IYD C;  4XLP A;  5C3E K;  5FJ8 K;  4OIO A;  3GTL K;  4KMU A;  3RZO K;  4BY1 C;  5C4X C;  3H3V D;  2B63 K;  4BBS K;  1TWC C;  2E2H C;  4A3D K;  4A93 C;  5C3E C;  3EQL A;  3HOY K;  4YFK A;  3RZO C;  2E2I K;  4BBS C;  2PPB A;  5IYC K;  2NVY K;  5D4D A;  3HOY C;  1TWH C;  1IW7 A;  3CQZ K;  3HOU K;  4ZH4 A;  4C3J C;  2E2I C;  5M3F K;  2NVY C;  3FKI C;  2PMZ L;  3GTO C;  4OIP A;  4YG2 A;  3S16 C;  4A3C C;  4XLN A;  4OIR A;  3PO3 K;  4BXX K;  4A3J C;  4XSZ A;  4A3L C;  4BY7 K;  2JA6 C;  3GTJ K;  5M3M K;  1Y1V K;  1WCM K;  3HOW C;  3PO3 C;  1I50 C;  4YFN A;  2A68 A;  3GTM K;  5IYD K;  4G7O A;  3GTJ C;  2R93 K;  1XPP A;  4LJZ A;  4BY1 K;  5C4X K;  4LK0 A;  4KN7 A;  1TWC K;  3GTM C;  2E2H K;  2BE5 A;  3PO2 K;  4A93 K;  1I6H K;  2R93 C;  4YFX A;  2PA8 L;  3GTK C;  5IYB C;  3S1R C;  3PO2 C;  3GTP C;  5FLM C;  1I6H C;  4G7Z A;  1TWH K;  3I4M C;  5M5X K;  3H3V L;  2O5J A;  4C3J K;  5TMC A;  4JK1 A;  2WB1 D;  3FKI K;  4A3B K;  4Q4Z A; 
#chains in the Genus database with same CATH topology
 3M3Y K;  3GTO K;  3S16 K;  1TWA K;  2WAQ D;  1ZBS A;  2B63 A;  5IOT A;  3TFH A;  3HOW K;  4XCH A;  1ZYR A;  1K83 C;  4WFA S;  3FHZ A;  4RMF A;  1YNN A;  2V6T A;  2A6H A;  1WCM A;  3VA7 A;  3GTM A;  5C44 C;  1WOR A;  4PAA A;  4GZY A;  1ZXO A;  2WB1 L;  5C4J C;  5TMF A;  2WAQ L;  3GTG K;  2GAH C;  3H0G C;  1DD5 A;  1K83 K;  3S17 C;  4FM9 A;  3FKI A;  1WIH A;  4A3F K;  1SFO C;  1IS1 A;  3GEI A;  1EK8 A;  2JA5 K;  3GTL C;  2P5M A;  2O5I A;  1I50 A;  5C44 K;  1R9T K;  2PMZ D;  1O2B A;  2NVX K;  1PJ5 A;  4ILD A;  5C4J K;  3PIO S;  3HOU C;  1O26 A;  4GTC A;  4A3M K;  3GTK A;  3A8J A;  2NVT K;  2GSU A;  4C45 A;  1WSR A;  4MEY A;  4GTA A;  4GTE A;  1TWG C;  1SFO K;  2JA8 C;  4XLP A;  2XCO A;  5FJ8 K;  3GTL K;  5C4X C;  1YCL A;  3N0C A;  1J6X A;  1TWC C;  4BLA A;  3ERE D;  4A93 C;  4YFK A;  2E2I K;  3HOU K;  1Y1W A;  3T02 A;  2PMZ L;  4OIP A;  4YG2 A;  1AB4 A;  2PHC B;  1TWF A;  4WFB S;  2JA6 C;  4IO9 S;  4YFN A;  1VH2 A;  4LOW A;  5C4X K;  1O2F B;  4LK0 A;  4KN7 A;  1TWC K;  1I3Q A;  4A93 K;  2BE5 A;  1I6H K;  1ISE A;  1WSV A;  5CHP A;  1J6W A;  5IYB C;  3S1R C;  3GTP C;  2R92 A;  5M5X K;  3I4M C;  3QX3 A;  2O5J A;  3L4K A;  1X31 C;  3LYW A;  2FQO A;  2RH6 A;  4KMH A;  2JA7 K;  2R7Z K;  3M3Y C;  2Y3P A;  4BBR K;  2JA6 K;  1I6V A;  3AD9 C;  4KAS A;  1TWA C;  4IOA S;  1HQM A;  4KB2 A;  2VUM K;  3CAG A;  5HQH A;  3S14 K;  4G0W A;  3PIP S;  4KN4 A;  5IYB K;  3TFI A;  3S1R K;  3GTP K;  3AH5 A;  3I4M K;  4PAB A;  2Y0S D;  1O24 A;  1Y1V A;  4QJV B;  4A3K C;  5EGE A;  3RZD C;  3N3Y A;  4MQ9 A;  1B4B A;  5JVO A;  2E2H A;  1JQW A;  4OIN A;  4MEX A;  1TWH A;  5JVG S;  4LQY A;  2E2J C;  2NVY A;  3GTG C;  3GTO A;  4IOC S;  3S2H K;  3SZY A;  3ORE A;  4A3F C;  4WCE S;  4QJV A;  3SZZ A;  4J3N A;  4A3K K;  3RZD K;  1VRQ C;  5L46 A;  2JA5 C;  4KB4 A;  1F7U A;  1R9T C;  3CQZ C;  2Y0S L;  2R93 A;  3JST A;  2NVX C;  4LK1 A;  1RU0 A;  5EGH A;  4LLG A;  1F9N A;  2L3U A;  1BS2 A;  4A3M C;  3N0B A;  3LAJ A;  2NVT C;  3L4J A;  2E2J K;  4Y52 K;  5CJ9 A;  4WFN S;  4BY7 C;  1IBA A;  1ZQ1 C;  4BKW A;  5C3E K;  4OIO A;  2KQ1 A;  4KMU A;  3V4G A;  4BY1 C;  3GIR A;  4DDQ A;  3H3V D;  4BBS K;  2RGR A;  1USO A;  4KAR A;  3HOY K;  1WQG A;  2D6F C;  1VGX A;  1XXA A;  5D4D A;  3CQZ K;  4GTD A;  4ZH4 A;  1K83 A;  2E2I C;  5DM7 S;  1B4A A;  5E68 A;  4A3C C;  4XLN A;  2KPU A;  2ZJP S;  4WF9 S;  2EBB A;  4A3J C;  2JA5 A;  3AQO A;  5JFE A;  4BY7 K;  1INN A;  3GTJ K;  2ZUE A;  3A8I A;  3LPX A;  1O29 A;  3GEE A;  2A68 A;  1WOO A;  1VJE A;  4P9S A;  4BY1 K;  4LJZ A;  2ZFZ A;  3PO2 K;  2ZUF A;  4KM8 A;  3H0G A;  5FLM C;  1I6H C;  1PJ7 A;  4WJ3 M;  3H3V L;  5TMC A;  3GTQ K;  1XZP B;  1IL2 A;  4A3B K;  1USM A;  5IOQ A;  4C3H K;  1SFO A;  4A3C K;  2KWA A;  3HOV C;  4A3J K;  4A3G C;  3GTL A;  1XZQ A;  3K7A C;  5IOR A;  2JA7 C;  5IP7 K;  1VLO A;  2R7Z C;  1O27 A;  4BBR C;  1KQ4 A;  3NUH A;  3BUE A;  2GSN A;  2VUM C;  3DXJ A;  3S14 C;  3HOZ K;  5FLM K;  3HKZ D;  1EI6 A;  3G4C A;  4AYB D;  4AH6 A;  3S2D C;  3FOE A;  1YNJ A;  1XZP A;  4XSX A;  1TWG A;  3MML B;  2CW0 A;  3HOV K;  4A3G K;  2A69 A;  3K7A K;  4C2M C;  1TWC A;  2YU9 C;  3S15 C;  3M4O C;  4M1X A;  1WQH A;  3I4N C;  3OPF A;  4GTL A;  4KC6 A;  1XXB A;  5M5Y K;  2PA8 D;  1HI9 A;  2JA7 A;  3S1Q K;  3S2D K;  2R7Z A;  2L5N A;  2JA6 A;  5M5W K;  2B63 C;  3S2H C;  4A3D C;  2VUM A;  3HKZ L;  3S1N K;  1ZVU A;  4AYB L;  1YX2 A;  4C2M K;  5IYC C;  2YU9 K;  3S15 K;  4A3E K;  5IP9 K;  3HOX K;  3M4O K;  3I4N K;  3GTP A;  1O25 A;  3BP8 C;  4BXX C;  1EH1 A;  2KXY A;  1WCM C;  1O2A A;  4Y52 C;  3GDZ A;  3RZO K;  2B63 K;  1TWA A;  3BP3 A;  1IQ0 A;  4A3D K;  5C3E C;  1BGW A;  4G0U A;  4G0V A;  4BBS C;  2PPB A;  2FQT A;  2NVY K;  5IYC K;  3HOY C;  1IW7 A;  4C3J C;  1L0W A;  3FKI C;  3AD8 C;  3S0X A;  4OIR A;  1J98 A;  3PO3 K;  3HXA A;  4BXX K;  4GTF A;  4XSZ A;  4A3L C;  2P8T A;  4KMA A;  5M3M K;  1JVI A;  1WCM K;  1I50 C;  3GTM K;  5JVH S;  3GTJ C;  2R93 K;  5HL8 A;  4YFX A;  3GTK C;  3PO2 C;  4WJ4 A;  4G7Z A;  2V6U A;  4LR2 A;  4C3J K;  3GTG A;  1DCO A;  2JH3 A;  3FKI K;  3FOF A;  4GT9 A;  4FZB A;  3GTQ C;  4A3B C;  4A3L K;  1IE0 A;  1G51 A;  4C3H C;  2A6E A;  1I50 K;  1XZQ B;  5IP7 C;  3CQZ A;  1R9T A;  1EFW A;  2NVX A;  3A8K A;  3GEH A;  2V6S A;  3WOD A;  1F7V A;  1Y1W C;  3GTK K;  4C3I C;  3G4A A;  3TFJ A;  4QIW D;  3HOZ C;  1TWF C;  1DCH A;  1DCP A;  1UV7 A;  3GTJ A;  2GAG C;  4KM9 A;  4A3I C;  3S1M C;  4KMD A;  2NVQ C;  2XCQ A;  4P5A A;  2CFA B;  5TJ3 A;  1I3Q C;  3H0G K;  3IPJ A;  1SMY A;  4X6A C;  3S17 K;  1PJ6 A;  5HL7 S;  3LAP A;  2R92 C;  4G7H A;  3GSI A;  3DLL S;  2E2I A;  4Y7N C;  3GTQ A;  4KAT A;  4P5B A;  1Y1W K;  4C3I K;  4Q5S A;  3TTG A;  3T01 A;  1TWF K;  3CF5 S;  3S1Q C;  3OEP A;  4A3I K;  4QIW L;  1J6V A;  3S1M K;  2NVQ K;  4NOI A;  2GSO A;  1WQF A;  2CFA A;  1I3Q K;  3S1N C;  4X6A K;  3T00 A;  2ZJQ S;  4A3E C;  5IP9 C;  3HOX C;  5DM6 S;  4KAW X;  1C0A A;  2R92 K;  4BLB A;  4OIQ A;  1TWG K;  4GFQ A;  5IOS A;  4Y7N K;  2JA8 K;  1Y1V C;  1BDF A;  3Q3Q A;  5IYD C;  2XCR B;  1FEU A;  2E2H C;  3EQL A;  1EQR A;  3RZO C;  1O28 A;  1F93 A;  1TWH C;  4U67 S;  5M3F K;  2NVY C;  3GTO C;  3S16 C;  1V5V A;  4GTB A;  1Y1V K;  2ZJR S;  3HOW C;  3PO3 C;  5IYD K;  4G7O A;  4O2D A;  1WOS A;  1XPP A;  2YU9 A;  1XXC A;  3AQP A;  1GE9 A;  3AD7 C;  1JOE A;  2E2H K;  3GTM C;  3ADA C;  2R93 C;  2PA8 L;  2W7V A;  1WOP A;  1TWH K;  4KDD A;  1BJT A;  4WIL A;  4JK1 A;  2WB1 D;  4Q4Z A; 
#chains in the Genus database with same CATH homology
 3M3Y K;  3GTO K;  4C3H K;  3S16 K;  2JA7 K;  4A3C K;  1TWA K;  2WAQ D;  3GTQ C;  3HOV C;  4A3J K;  4A3B C;  4A3G C;  3M3Y C;  2R7Z K;  4A3L K;  4C3H C;  3K7A C;  4BBR K;  2JA6 K;  2A6E A;  1I6V A;  2JA7 C;  3HOW K;  1TWA C;  5IP7 K;  1I50 K;  1HQM A;  2R7Z C;  2VUM K;  4BBR C;  3S14 K;  5IP7 C;  2VUM C;  1ZYR A;  3DXJ A;  1K83 C;  3WOD A;  3S14 C;  1Y1W C;  3GTK K;  4KN4 A;  4C3I C;  5IYB K;  3S1R K;  4QIW D;  3GTP K;  5FLM K;  3HOZ K;  3HKZ D;  3I4M K;  4AYB D;  3S2D C;  1YNJ A;  3HOZ C;  1TWF C;  2Y0S D;  1YNN A;  4XSX A;  4QJV B;  2A6H A;  4A3K C;  4A3I C;  3RZD C;  5C44 C;  2CW0 A;  3S1M C;  2NVQ C;  3HOV K;  4A3G K;  4MQ9 A;  2A69 A;  4GZY A;  3K7A K;  4C2M C;  2YU9 C;  5C4J C;  2WB1 L;  3S15 C;  1I3Q C;  3M4O C;  3H0G K;  1SMY A;  3I4N C;  4X6A C;  4OIN A;  3S17 K;  5TMF A;  2WAQ L;  3GTG K;  4MEX A;  3H0G C;  5M5Y K;  2R92 C;  4G7H A;  2PA8 D;  1K83 K;  3S17 C;  4Y7N C;  2E2J C;  3GTG C;  1Y1W K;  4C3I K;  4A3F K;  4Q5S A;  3S2H K;  1SFO C;  3S1Q K;  3S2D K;  2JA5 K;  4A3F C;  3GTL C;  4QJV A;  1TWF K;  5M5W K;  2B63 C;  2O5I A;  3S2H C;  3S1Q C;  4A3D C;  4A3K K;  4A3I K;  4QIW L;  5C44 K;  2JA5 C;  3RZD K;  3HKZ L;  1R9T K;  3S1M K;  2NVQ K;  2PMZ D;  3S1N K;  4NOI A;  2NVX K;  4AYB L;  4C2M K;  5IYC C;  2YU9 K;  5C4J K;  3S15 K;  1R9T C;  3CQZ C;  3HOU C;  1I3Q K;  2Y0S L;  3S1N C;  5IP9 K;  2NVX C;  3HOX K;  4A3E K;  3I4N K;  4LK1 A;  4A3M K;  3M4O K;  4X6A K;  4LLG A;  2NVT K;  4A3E C;  5IP9 C;  3HOX C;  2R92 K;  4A3M C;  4OIQ A;  1TWG K;  4MEY A;  2NVT C;  4BXX C;  4Y7N K;  2E2J K;  2JA8 K;  4Y52 K;  4BY7 C;  1Y1V C;  1BDF A;  1TWG C;  1WCM C;  1SFO K;  3GTQ K;  4Y52 C;  2JA8 C;  5IYD C;  4XLP A;  5C3E K;  5FJ8 K;  4OIO A;  3GTL K;  4KMU A;  3RZO K;  4BY1 C;  5C4X C;  3H3V D;  2B63 K;  4BBS K;  1TWC C;  2E2H C;  4A3D K;  4A93 C;  5C3E C;  3EQL A;  3HOY K;  4YFK A;  3RZO C;  2E2I K;  4BBS C;  2PPB A;  5IYC K;  2NVY K;  5D4D A;  3HOY C;  1TWH C;  1IW7 A;  3CQZ K;  3HOU K;  4ZH4 A;  4C3J C;  2E2I C;  5M3F K;  2NVY C;  3FKI C;  2PMZ L;  3GTO C;  4OIP A;  4YG2 A;  3S16 C;  4A3C C;  4XLN A;  4OIR A;  3PO3 K;  4BXX K;  4A3J C;  4XSZ A;  4A3L C;  4BY7 K;  2JA6 C;  3GTJ K;  5M3M K;  1Y1V K;  1WCM K;  3HOW C;  3PO3 C;  1I50 C;  4YFN A;  2A68 A;  3GTM K;  5IYD K;  4G7O A;  3GTJ C;  2R93 K;  1XPP A;  4LJZ A;  4BY1 K;  5C4X K;  4LK0 A;  4KN7 A;  1TWC K;  3GTM C;  2E2H K;  2BE5 A;  3PO2 K;  4A93 K;  1I6H K;  2R93 C;  4YFX A;  2PA8 L;  3GTK C;  5IYB C;  3S1R C;  3PO2 C;  3GTP C;  5FLM C;  1I6H C;  4G7Z A;  1TWH K;  3I4M C;  5M5X K;  3H3V L;  2O5J A;  4C3J K;  5TMC A;  4JK1 A;  2WB1 D;  3FKI K;  4A3B K;  4Q4Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...