2A69A

Crystal structure of the t. thermophilus rna polymerase holoenzyme in complex with antibiotic rifapentin
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
229
structure length
229
Chain Sequence
MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase alpha chain
publication title Allosteric modulation of the RNA polymerase catalytic reaction is an essential component of transcription control by rifamycins.
pubmed doi rcsb
molecule tags Transferase
total genus 40
structure length 229
sequence length 229
chains with identical sequence B, K, L
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2005-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01000 RNA_pol_A_bac RNA polymerase Rpb3/RpoA insert domain
A PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain
A PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.12 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 DNA-directed RNA polymerase, insert domain 2a69A02
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 2a69A01
4XLPA 1YNJA 3PO2C 5IP7K 4KMUA 3HOZC 4X6AC 4G7HA 4JK1A 4QIWD 2NVXC 1I6HC 4A3CC 3HOYC 1TWHK 4A3MK 4Q5SA 3RZOK 2PPBA 2JA8C 3H0GC 3S1MC 4BBRK 1I6VA 1TWHC 4A3MC 3HKZD 5C4JC 3GTPC 3S1NC 5IYCK 5C4XK 4A3LK 3S1RK 3GTQK 4BBRC 3PO3K 1Y1WK 3M4OC 3RZDC 1SFOK 2WB1D 3S1RC 4G7OA 3GTQC 4OIOA 3GTOC 4C2MC 2E2IC 4NOIA 3HOXK 1SMYA 1ZYRA 5IYBC 4A3EK 4QIWL 2A69A 1WCMC 1SFOC 2E2HC 1HQMA 2R92C 2PMZD 4A3DC 2O5JA 5TMFA 4BY1K 2NVXK 1I6HK 1R9TC 2A6EA 3S17C 4A3CK 3EQLA 3HOUC 3HKZL 3FKIC 4C3IC 4OINA 2JA8K 3H0GK 3S1MK 4LLGA 4BY1C 3S1NK 5M5WK 5C4JK 3GTPK 1IW7A 2NVYC 2JA7C 5M3FK 4Y7NK 2WB1L 2JA6K 5IP9C 2B63C 3S15K 3M4OK 3RZDK 4OIQA 5C44C 1TWAK 3H3VD 4Y7NC 2PMZL 3GTOK 2NVQC 2JA6C 4C2MK 2E2IK 3S15C 4A3JC 5IYBK 1TWAC 1WCMK 2E2HK 3I4MC 2R92K 2R7ZC 4A3DK 4A3FC 4KN7A 1R9TK 3S17K 3HOUK 4ZH4A 4MEXA 1Y1VK 4C3JC 3FKIK 4C3IK 1I3QC 2VUMK 2O5IA 4OIPA 3DXJA 1TWCK 2WAQD 4YG2A 2NVYK 2E2JK 2JA7K 5C3EC 3S1QK 1Y1VC 2VUMC 3H3VL 4A3KC 3K7AC 5IP9K 2B63K 2R93K 1TWCC 2YU9C 5C44K 1K83K 4LK1A 2E2JC 3S1QC 4C3HK 3HOWC 3S2DC 2NVQK 4A3JK 1BDFA 2R93C 3S14K 3GTKC 4A3GK 1K83C 5D4DA 1YNNA 1XPPA 3I4MK 2NVTK 2R7ZK 4A3FK 2A6HA 4C3HC 3S2HC 4Y52K 4BY7C 5M5YK 3GTJK 3S14C 1TWFK 4A3GC 4Q4ZA 5FLMC 2WAQL 3S16C 4AYBD 4A3BC 2NVTC 1I3QK 4C3JK 4YFKA 2JA5C 3GTGK 4Y52C 5IYDC 3GTJC 1TWFC 3I4NC 5C3EK 3M3YK 4XLNA 2Y0SD 3GTGC 3K7AK 4A3KK 3HOVC 3CQZC 3GTLK 2YU9K 4A93C 3M3YC 4MQ9A 3GTMC 2PA8D 4LJZA 2A68A 4LK0A 5IP7C 5M5XK 3HOWK 3S2DK 3GTLC 3WODA 4GZYA 3GTKK 5TMCA 4A3IK 4XSZA 1TWGK 4AYBL 3S2HK 3RZOC 4BXXK 2BE5A 4BY7K 4XSXA 4A3LC 5IYCC 5C4XC 5FLMK 4A3IC 3S16K 1TWGC 4A3BK 4BBSK 4QJVA 4QJVB 2JA5K 4BXXC 2Y0SL 3PO3C 5IYDK 1Y1WC 4OIRA 4G7ZA 1I50K 3I4NK 5FJ8K 4MEYA 2CW0A 4BBSC 3PO2K 4YFNA 2PA8L 5M3MK 3HOVK 4KN4A 3CQZK 3HOZK 4X6AK 3HOXC 1I50C 4A93K 3HOYK 4A3EC 4YFXA 3GTMK
chains in the Genus database with same CATH superfamily
4XLPA 4RMFA 5IP7K 1IS1A 5JVGS 4O2DA 2NVXC 1TWHK 4QIWD 1O24A 4Q5SA 3S1MC 1BS2A 3HKZD 5C4JC 5IYCK 2RGRA 2CFAA 3SZYA 4IOCS 3AH5A 1TWHA 3GEHA 1SFOK 5CHPA 3GTQC 2XCQA 4QIWL 2A69A 2R92C 1HI9A 1WOOA 4A3DC 2O5JA 1WSRA 4BY1K 2NVXK 2XCOA 3EQLA 3HOUC 3HKZL 1SFOA 4C3IC 1WQGA 3S1MK 1I50A 5C4JK 4GTBA 2JA7C 2B63C 2NVXA 5C44C 1WORA 1TWAK 3H3VD 4Y7NC 2JA6C 1PJ6A 2R92K 2R7ZC 1YCLA 4A3DK 5CJ9A 2ZJQS 1WOSA 4KN7A 4G0VA 3HOUK 1TWAA 1DCHA 4C3IK 1Y1VK 4DDQA 1V5VA 3JSTA 2KXYA 4OIPA 4WJ3M 2R92A 2JA7K 5C3EC 3H3VL 4A3KC 3K7AC 2B63K 3DLLS 3LYWA 1TWCC 2YU9C 2GAHC 5C44K 4LK1A 2ZJRS 3S1QC 1Y1VA 4KM8A 3HOWC 3CF5S 1BDFA 2R93C 5D4DA 1XPPA 3S0XA 2R7ZK 2NVTK 2JA7A 4Y52K 2D6FC 2B63A 3S14C 1TWFK 4Q4ZA 1VRQC 5C3EK 2R7ZA 3GTGC 4A3KK 3K7AK 3CQZC 4PABA 1PJ7A 2YU9K 4A93C 1TWFA 3GTMC 2A68A 3HOWK 2V6TA 4GZYA 3RZOC 4LR2A 2YU9A 4A3LC 2ZFZA 1TWGC 4QJVA 3IPJA 3PO3C 1Y1WC 1XXCA 3G4CA 2CW0A 1DCPA 4KMDA 3CQZK 1JVIA 1F93A 3N0CA 4P5AA 3HOYK 4A93K 4YFXA 3GTMK 3PO2C 3BUEA 3FOFA 4KMUA 1EK8A 4GTDA 1I6HC 4A3MK 4A3CC 3OEPA 1UV7A 1INNA 4KATA 3RZOK 4BBRK 3CQZA 4AH6A 1TWHC 3S1NC 3GTPC 3FHZA 4A3LK 3GTMA 4P9SA 3L4KA 3PIOS 3PO3K 1Y1WK 5E68A 2P8TA 3PIPS 2E2IC 1VH2A 4NOIA 1SFOC 2E2HC 1HQMA 1WQHA 1I6HK 1Y1WA 1R9TC 4A3CK 3GDZA 2W7VA 4BLBA 4BY1C 1BJTA 3S1NK 5M5WK 3GTPK 1IW7A 1USMA 3S15K 1YX2A 1O25A 1WOPA 4GTFA 4LQYA 5IORA 1XZPB 2E2IK 3GTPA 1TWAC 2E2HK 1VLOA 3ADAC 3A8KA 1O2AA 1R9TK 4ZH4A 3A8JA 4C3JC 2V6SA 1O27A 4WILA 2E2IA 2WAQD 2E2JK 2E2HA 1Y1VC 3Q3QA 1B4AA 1R9TA 1K83K 4KARA 4C3HK 3S2DC 4KAWX 3S2HC 5M5YK 3ERED 3GTJK 5FLMC 2WAQL 4C3JK 4A3BC 2NVTC 2JA5C 1XXAA 4Y52C 1TWFC 4KM9A 4KB2A 2Y0SD 3HOVC 3GTJA 3M3YC 4WFBS 4MQ9A 1F7UA 4LJZA 3AD8C 2EBBA 5M5XK 3S2DK 4A3IK 1B4BA 3S2HK 4GTEA 3OREA 5C4XC 3T00A 3GIRA 5FLMK 4A3BK 2ZUFA 5TJ3A 2JA5K 2Y0SL 3G4AA 4G7ZA 3T01A 5FJ8K 3HOVK 4KN4A 3HOZK 4X6AK 4IOAS 3M3YK 4A3EC 3GSIA 3NUHA 1YNJA 2JA5A 4G7HA 4JK1A 3HOYC 3N3YA 2PPBA 2JA8C 4G0WA 1I6VA 3TFHA 4A3MC 5C4XK 3L4JA 1EI6A 3S1RK 5HQHA 1ZBSA 2XCRB 3TTGA 4BBRC 2V6UA 3M4OC 3A8IA 4U67S 4G7OA 4XCHA 3GTOC 4C2MC 1ZYRA 5IYBC 4A3EK 3TFIA 2PMZD 2A6EA 3S17C 2GAGC 2L3UA 4IO9S 4OINA 2JA8K 1IL2A 4WJ4A 4KB4A 3LAJA 5IP9C 3AD9C 3M4OK 4KMAA 1C0AA 1EQRA 1XZPA 3N0BA 2PMZL 3GTOK 2NVQC 4C2MK 3CAGA 3S15C 5IYBK 3I4MC 2FQTA 1O2BA 2Y3PA 3S17K 3GEIA 5JVHS 4KC6A 2VUMK 4PAAA 3V4GA 3GTOA 2P5MA 1XZQB 5DM7S 4YG2A 1FEUA 1WQFA 5IOQA 1X31C 5IP9K 2KPUA 2E2JC 2L5NA 2NVQK 1WIHA 5DM6S 3GTKC 4A3GK 1IQ0A 1K83C 1O29A 3MMLB 3QX3A 3I4MK 2A6HA 4C3HC 2KWAA 4AYBD 4YFKA 3LAPA 2ZUEA 1USOA 3GTJC 3I4NC 4XLNA 3GTLK 1ZQ1C 4LK0A 1DCOA 4FZBA 4KMHA 1XXBA 3GTKK 5TMCA 3SZZA 4AYBL 4BXXK 1IE0A 1EFWA 2BE5A 3GTLA 4XSXA 2FQOA 4A3IC 4BBSK 5HL7S 1RU0A 5JFEA 1I50K 5IOSA 3GTKA 1ISEA 3I4NK 1K83A 4MEYA 3OPFA 3T02A 4YFNA 1J98A 1ZXOA 3HOXC 2JH3A 4WFAS 4WCES 3BP8C 3HOZC 4X6AC 3AQPA 3HXAA 4LOWA 3LPXA 3H0GC 4P5BA 4G0UA 5IOTA 1IBAA 2GSNA 2GSOA 2CFAB 3GTQK 4GTCA 1EH1A 3RZDC 1AB4A 3FOEA 2WB1D 3S1RC 4OIOA 3HOXK 1SMYA 1WCMC 2RH6A 2KQ1A 5TMFA 3GTQA 3FKIC 4GTLA 3H0GK 5JVOA 4LLGA 1F9NA 2PHCB 4GTAA 2NVYC 5M3FK 4Y7NK 2WB1L 4KASA 2JA6K 3RZDK 4OIQA 4GFQA 3H0GA 4A3JC 4WF9S 1WCMK 3GEEA 4A3FC 4ILDA 2JA6A 4WFNS 1GE9A 4BKWA 1O28A 3FKIK 4MEXA 1I3QC 3BP3A 1L0WA 2O5IA 1TWCK 3DXJA 1XZQA 1O2FB 2NVYK 1WCMA 3S1QK 2VUMC 2R93K 3FKIA 4GT9A 4A3JK 1TWCA 3S14K 5HL8A 2NVYA 1YNNA 4KDDA 4A3FK 1WSVA 1J6VA 4BY7C 2R93A 1VGXA 4BLAA 4A3GC 1ZVUA 3S16C 1VJEA 3GTGK 1I3QK 1DD5A 5IYDC 1F7VA 3AD7C 5EGHA 1PJ5A 2PA8D 4J3NA 3GTGA 1JOEA 5IP7C 1I3QA 1J6XA 3GTLC 3WODA 4XSZA 1TWGK 3AQOA 1JQWA 2GSUA 5EGEA 5L46A 1G51A 2VUMA 4BY7K 5IYCC 1BGWA 1KQ4A 3S16K 4QJVB 4BXXC 3TFJA 1O26A 5IYDK 4OIRA 4M1XA 2ZJPS 4C45A 4BBSC 1TWGA 3VA7A 3PO2K 4FM9A 2PA8L 5M3MK 1J6WA 1I50C
chains in the Genus database with same CATH topology
4XLPA 1YNJA 3PO2C 5IP7K 4KMUA 3HOZC 4X6AC 4G7HA 4JK1A 4QIWD 2NVXC 1I6HC 4A3CC 3HOYC 1TWHK 4A3MK 4Q5SA 3RZOK 2PPBA 2JA8C 3H0GC 3S1MC 4BBRK 1I6VA 1TWHC 4A3MC 3HKZD 5C4JC 3GTPC 3S1NC 5IYCK 5C4XK 4A3LK 3S1RK 3GTQK 4BBRC 3PO3K 1Y1WK 3M4OC 3RZDC 1SFOK 2WB1D 3S1RC 4G7OA 3GTQC 4OIOA 3GTOC 4C2MC 2E2IC 4NOIA 3HOXK 1SMYA 1ZYRA 5IYBC 4A3EK 4QIWL 2A69A 1WCMC 1SFOC 2E2HC 1HQMA 2R92C 2PMZD 4A3DC 2O5JA 5TMFA 4BY1K 2NVXK 1I6HK 1R9TC 2A6EA 3S17C 4A3CK 3EQLA 3HOUC 3HKZL 3FKIC 4C3IC 4OINA 2JA8K 3H0GK 3S1MK 4LLGA 4BY1C 3S1NK 5M5WK 5C4JK 3GTPK 1IW7A 2NVYC 2JA7C 5M3FK 4Y7NK 2WB1L 2JA6K 5IP9C 2B63C 3S15K 3M4OK 3RZDK 4OIQA 5C44C 1TWAK 3H3VD 4Y7NC 2PMZL 3GTOK 2NVQC 2JA6C 4C2MK 2E2IK 3S15C 4A3JC 5IYBK 1TWAC 1WCMK 2E2HK 3I4MC 2R92K 2R7ZC 4A3DK 4A3FC 4KN7A 1R9TK 3S17K 3HOUK 4ZH4A 4MEXA 1Y1VK 4C3JC 3FKIK 4C3IK 1I3QC 2VUMK 2O5IA 4OIPA 3DXJA 1TWCK 2WAQD 4YG2A 2NVYK 2E2JK 2JA7K 5C3EC 3S1QK 1Y1VC 2VUMC 3H3VL 4A3KC 3K7AC 5IP9K 2B63K 2R93K 1TWCC 2YU9C 5C44K 1K83K 4LK1A 2E2JC 3S1QC 4C3HK 3HOWC 3S2DC 2NVQK 4A3JK 1BDFA 2R93C 3S14K 3GTKC 4A3GK 1K83C 5D4DA 1YNNA 1XPPA 3I4MK 2NVTK 2R7ZK 4A3FK 2A6HA 4C3HC 3S2HC 4Y52K 4BY7C 5M5YK 3GTJK 3S14C 1TWFK 4A3GC 4Q4ZA 5FLMC 2WAQL 3S16C 4AYBD 4A3BC 2NVTC 1I3QK 4C3JK 4YFKA 2JA5C 3GTGK 4Y52C 5IYDC 3GTJC 1TWFC 3I4NC 5C3EK 3M3YK 4XLNA 2Y0SD 3GTGC 3K7AK 4A3KK 3HOVC 3CQZC 3GTLK 2YU9K 4A93C 3M3YC 4MQ9A 3GTMC 2PA8D 4LJZA 2A68A 4LK0A 5IP7C 5M5XK 3HOWK 3S2DK 3GTLC 3WODA 4GZYA 3GTKK 5TMCA 4A3IK 4XSZA 1TWGK 4AYBL 3S2HK 3RZOC 4BXXK 2BE5A 4BY7K 4XSXA 4A3LC 5IYCC 5C4XC 5FLMK 4A3IC 3S16K 1TWGC 4A3BK 4BBSK 4QJVA 4QJVB 2JA5K 4BXXC 2Y0SL 3PO3C 5IYDK 1Y1WC 4OIRA 4G7ZA 1I50K 3I4NK 5FJ8K 4MEYA 2CW0A 4BBSC 3PO2K 4YFNA 2PA8L 5M3MK 3HOVK 4KN4A 3CQZK 3HOZK 4X6AK 3HOXC 1I50C 4A93K 3HOYK 4A3EC 4YFXA 3GTMK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XLP A;  1YNJ A;  3PO2 C;  5IP7 K;  4KMU A;  3HOZ C;  4X6A C;  4G7H A;  4JK1 A;  4QIW D;  2NVX C;  1I6H C;  4A3C C;  3HOY C;  1TWH K;  4A3M K;  4Q5S A;  3RZO K;  2PPB A;  2JA8 C;  3H0G C;  3S1M C;  4BBR K;  1I6V A;  1TWH C;  4A3M C;  3HKZ D;  5C4J C;  3GTP C;  3S1N C;  5IYC K;  5C4X K;  4A3L K;  3S1R K;  3GTQ K;  4BBR C;  3PO3 K;  1Y1W K;  3M4O C;  3RZD C;  1SFO K;  2WB1 D;  3S1R C;  4G7O A;  3GTQ C;  4OIO A;  3GTO C;  4C2M C;  2E2I C;  4NOI A;  3HOX K;  1SMY A;  1ZYR A;  5IYB C;  4A3E K;  4QIW L;  2A69 A;  1WCM C;  1SFO C;  2E2H C;  1HQM A;  2R92 C;  2PMZ D;  4A3D C;  2O5J A;  5TMF A;  4BY1 K;  2NVX K;  1I6H K;  1R9T C;  2A6E A;  3S17 C;  4A3C K;  3EQL A;  3HOU C;  3HKZ L;  3FKI C;  4C3I C;  4OIN A;  2JA8 K;  3H0G K;  3S1M K;  4LLG A;  4BY1 C;  3S1N K;  5M5W K;  5C4J K;  3GTP K;  1IW7 A;  2NVY C;  2JA7 C;  5M3F K;  4Y7N K;  2WB1 L;  2JA6 K;  5IP9 C;  2B63 C;  3S15 K;  3M4O K;  3RZD K;  4OIQ A;  5C44 C;  1TWA K;  3H3V D;  4Y7N C;  2PMZ L;  3GTO K;  2NVQ C;  2JA6 C;  4C2M K;  2E2I K;  3S15 C;  4A3J C;  5IYB K;  1TWA C;  1WCM K;  2E2H K;  3I4M C;  2R92 K;  2R7Z C;  4A3D K;  4A3F C;  4KN7 A;  1R9T K;  3S17 K;  3HOU K;  4ZH4 A;  4MEX A;  1Y1V K;  4C3J C;  3FKI K;  4C3I K;  1I3Q C;  2VUM K;  2O5I A;  4OIP A;  3DXJ A;  1TWC K;  2WAQ D;  4YG2 A;  2NVY K;  2E2J K;  2JA7 K;  5C3E C;  3S1Q K;  1Y1V C;  2VUM C;  3H3V L;  4A3K C;  3K7A C;  5IP9 K;  2B63 K;  2R93 K;  1TWC C;  2YU9 C;  5C44 K;  1K83 K;  4LK1 A;  2E2J C;  3S1Q C;  4C3H K;  3HOW C;  3S2D C;  2NVQ K;  4A3J K;  1BDF A;  2R93 C;  3S14 K;  3GTK C;  4A3G K;  1K83 C;  5D4D A;  1YNN A;  1XPP A;  3I4M K;  2NVT K;  2R7Z K;  4A3F K;  2A6H A;  4C3H C;  3S2H C;  4Y52 K;  4BY7 C;  5M5Y K;  3GTJ K;  3S14 C;  1TWF K;  4A3G C;  4Q4Z A;  5FLM C;  2WAQ L;  3S16 C;  4AYB D;  4A3B C;  2NVT C;  1I3Q K;  4C3J K;  4YFK A;  2JA5 C;  3GTG K;  4Y52 C;  5IYD C;  3GTJ C;  1TWF C;  3I4N C;  5C3E K;  3M3Y K;  4XLN A;  2Y0S D;  3GTG C;  3K7A K;  4A3K K;  3HOV C;  3CQZ C;  3GTL K;  2YU9 K;  4A93 C;  3M3Y C;  4MQ9 A;  3GTM C;  2PA8 D;  4LJZ A;  2A68 A;  4LK0 A;  5IP7 C;  5M5X K;  3HOW K;  3S2D K;  3GTL C;  3WOD A;  4GZY A;  3GTK K;  5TMC A;  4A3I K;  4XSZ A;  1TWG K;  4AYB L;  3S2H K;  3RZO C;  4BXX K;  2BE5 A;  4BY7 K;  4XSX A;  4A3L C;  5IYC C;  5C4X C;  5FLM K;  4A3I C;  3S16 K;  1TWG C;  4A3B K;  4BBS K;  4QJV A;  4QJV B;  2JA5 K;  4BXX C;  2Y0S L;  3PO3 C;  5IYD K;  1Y1W C;  4OIR A;  4G7Z A;  1I50 K;  3I4N K;  5FJ8 K;  4MEY A;  2CW0 A;  4BBS C;  3PO2 K;  4YFN A;  2PA8 L;  5M3M K;  3HOV K;  4KN4 A;  3CQZ K;  3HOZ K;  4X6A K;  3HOX C;  1I50 C;  4A93 K;  3HOY K;  4A3E C;  4YFX A;  3GTM K; 
#chains in the Genus database with same CATH topology
 4XLP A;  4RMF A;  5IP7 K;  1IS1 A;  5JVG S;  4O2D A;  2NVX C;  1TWH K;  4QIW D;  1O24 A;  4Q5S A;  3S1M C;  1BS2 A;  3HKZ D;  5C4J C;  5IYC K;  2RGR A;  2CFA A;  3SZY A;  4IOC S;  3AH5 A;  1TWH A;  3GEH A;  1SFO K;  5CHP A;  3GTQ C;  2XCQ A;  4QIW L;  2A69 A;  2R92 C;  1HI9 A;  1WOO A;  4A3D C;  2O5J A;  1WSR A;  4BY1 K;  2NVX K;  2XCO A;  3EQL A;  3HOU C;  3HKZ L;  1SFO A;  4C3I C;  1WQG A;  3S1M K;  1I50 A;  5C4J K;  4GTB A;  2JA7 C;  2B63 C;  2NVX A;  5C44 C;  1WOR A;  1TWA K;  3H3V D;  4Y7N C;  2JA6 C;  1PJ6 A;  2R92 K;  2R7Z C;  1YCL A;  4A3D K;  5CJ9 A;  2ZJQ S;  1WOS A;  4KN7 A;  4G0V A;  3HOU K;  1TWA A;  1DCH A;  4C3I K;  1Y1V K;  4DDQ A;  1V5V A;  3JST A;  2KXY A;  4OIP A;  4WJ3 M;  2R92 A;  2JA7 K;  5C3E C;  3H3V L;  4A3K C;  3K7A C;  2B63 K;  3DLL S;  3LYW A;  1TWC C;  2YU9 C;  2GAH C;  5C44 K;  4LK1 A;  2ZJR S;  3S1Q C;  1Y1V A;  4KM8 A;  3HOW C;  3CF5 S;  1BDF A;  2R93 C;  5D4D A;  1XPP A;  3S0X A;  2R7Z K;  2NVT K;  2JA7 A;  4Y52 K;  2D6F C;  2B63 A;  3S14 C;  1TWF K;  4Q4Z A;  1VRQ C;  5C3E K;  2R7Z A;  3GTG C;  4A3K K;  3K7A K;  3CQZ C;  4PAB A;  1PJ7 A;  2YU9 K;  4A93 C;  1TWF A;  3GTM C;  2A68 A;  3HOW K;  2V6T A;  4GZY A;  3RZO C;  4LR2 A;  2YU9 A;  4A3L C;  2ZFZ A;  1TWG C;  4QJV A;  3IPJ A;  3PO3 C;  1Y1W C;  1XXC A;  3G4C A;  2CW0 A;  1DCP A;  4KMD A;  3CQZ K;  1JVI A;  1F93 A;  3N0C A;  4P5A A;  3HOY K;  4A93 K;  4YFX A;  3GTM K;  3PO2 C;  3BUE A;  3FOF A;  4KMU A;  1EK8 A;  4GTD A;  1I6H C;  4A3M K;  4A3C C;  3OEP A;  1UV7 A;  1INN A;  4KAT A;  3RZO K;  4BBR K;  3CQZ A;  4AH6 A;  1TWH C;  3S1N C;  3GTP C;  3FHZ A;  4A3L K;  3GTM A;  4P9S A;  3L4K A;  3PIO S;  3PO3 K;  1Y1W K;  5E68 A;  2P8T A;  3PIP S;  2E2I C;  1VH2 A;  4NOI A;  1SFO C;  2E2H C;  1HQM A;  1WQH A;  1I6H K;  1Y1W A;  1R9T C;  4A3C K;  3GDZ A;  2W7V A;  4BLB A;  4BY1 C;  1BJT A;  3S1N K;  5M5W K;  3GTP K;  1IW7 A;  1USM A;  3S15 K;  1YX2 A;  1O25 A;  1WOP A;  4GTF A;  4LQY A;  5IOR A;  1XZP B;  2E2I K;  3GTP A;  1TWA C;  2E2H K;  1VLO A;  3ADA C;  3A8K A;  1O2A A;  1R9T K;  4ZH4 A;  3A8J A;  4C3J C;  2V6S A;  1O27 A;  4WIL A;  2E2I A;  2WAQ D;  2E2J K;  2E2H A;  1Y1V C;  3Q3Q A;  1B4A A;  1R9T A;  1K83 K;  4KAR A;  4C3H K;  3S2D C;  4KAW X;  3S2H C;  5M5Y K;  3ERE D;  3GTJ K;  5FLM C;  2WAQ L;  4C3J K;  4A3B C;  2NVT C;  2JA5 C;  1XXA A;  4Y52 C;  1TWF C;  4KM9 A;  4KB2 A;  2Y0S D;  3HOV C;  3GTJ A;  3M3Y C;  4WFB S;  4MQ9 A;  1F7U A;  4LJZ A;  3AD8 C;  2EBB A;  5M5X K;  3S2D K;  4A3I K;  1B4B A;  3S2H K;  4GTE A;  3ORE A;  5C4X C;  3T00 A;  3GIR A;  5FLM K;  4A3B K;  2ZUF A;  5TJ3 A;  2JA5 K;  2Y0S L;  3G4A A;  4G7Z A;  3T01 A;  5FJ8 K;  3HOV K;  4KN4 A;  3HOZ K;  4X6A K;  4IOA S;  3M3Y K;  4A3E C;  3GSI A;  3NUH A;  1YNJ A;  2JA5 A;  4G7H A;  4JK1 A;  3HOY C;  3N3Y A;  2PPB A;  2JA8 C;  4G0W A;  1I6V A;  3TFH A;  4A3M C;  5C4X K;  3L4J A;  1EI6 A;  3S1R K;  5HQH A;  1ZBS A;  2XCR B;  3TTG A;  4BBR C;  2V6U A;  3M4O C;  3A8I A;  4U67 S;  4G7O A;  4XCH A;  3GTO C;  4C2M C;  1ZYR A;  5IYB C;  4A3E K;  3TFI A;  2PMZ D;  2A6E A;  3S17 C;  2GAG C;  2L3U A;  4IO9 S;  4OIN A;  2JA8 K;  1IL2 A;  4WJ4 A;  4KB4 A;  3LAJ A;  5IP9 C;  3AD9 C;  3M4O K;  4KMA A;  1C0A A;  1EQR A;  1XZP A;  3N0B A;  2PMZ L;  3GTO K;  2NVQ C;  4C2M K;  3CAG A;  3S15 C;  5IYB K;  3I4M C;  2FQT A;  1O2B A;  2Y3P A;  3S17 K;  3GEI A;  5JVH S;  4KC6 A;  2VUM K;  4PAA A;  3V4G A;  3GTO A;  2P5M A;  1XZQ B;  5DM7 S;  4YG2 A;  1FEU A;  1WQF A;  5IOQ A;  1X31 C;  5IP9 K;  2KPU A;  2E2J C;  2L5N A;  2NVQ K;  1WIH A;  5DM6 S;  3GTK C;  4A3G K;  1IQ0 A;  1K83 C;  1O29 A;  3MML B;  3QX3 A;  3I4M K;  2A6H A;  4C3H C;  2KWA A;  4AYB D;  4YFK A;  3LAP A;  2ZUE A;  1USO A;  3GTJ C;  3I4N C;  4XLN A;  3GTL K;  1ZQ1 C;  4LK0 A;  1DCO A;  4FZB A;  4KMH A;  1XXB A;  3GTK K;  5TMC A;  3SZZ A;  4AYB L;  4BXX K;  1IE0 A;  1EFW A;  2BE5 A;  3GTL A;  4XSX A;  2FQO A;  4A3I C;  4BBS K;  5HL7 S;  1RU0 A;  5JFE A;  1I50 K;  5IOS A;  3GTK A;  1ISE A;  3I4N K;  1K83 A;  4MEY A;  3OPF A;  3T02 A;  4YFN A;  1J98 A;  1ZXO A;  3HOX C;  2JH3 A;  4WFA S;  4WCE S;  3BP8 C;  3HOZ C;  4X6A C;  3AQP A;  3HXA A;  4LOW A;  3LPX A;  3H0G C;  4P5B A;  4G0U A;  5IOT A;  1IBA A;  2GSN A;  2GSO A;  2CFA B;  3GTQ K;  4GTC A;  1EH1 A;  3RZD C;  1AB4 A;  3FOE A;  2WB1 D;  3S1R C;  4OIO A;  3HOX K;  1SMY A;  1WCM C;  2RH6 A;  2KQ1 A;  5TMF A;  3GTQ A;  3FKI C;  4GTL A;  3H0G K;  5JVO A;  4LLG A;  1F9N A;  2PHC B;  4GTA A;  2NVY C;  5M3F K;  4Y7N K;  2WB1 L;  4KAS A;  2JA6 K;  3RZD K;  4OIQ A;  4GFQ A;  3H0G A;  4A3J C;  4WF9 S;  1WCM K;  3GEE A;  4A3F C;  4ILD A;  2JA6 A;  4WFN S;  1GE9 A;  4BKW A;  1O28 A;  3FKI K;  4MEX A;  1I3Q C;  3BP3 A;  1L0W A;  2O5I A;  1TWC K;  3DXJ A;  1XZQ A;  1O2F B;  2NVY K;  1WCM A;  3S1Q K;  2VUM C;  2R93 K;  3FKI A;  4GT9 A;  4A3J K;  1TWC A;  3S14 K;  5HL8 A;  2NVY A;  1YNN A;  4KDD A;  4A3F K;  1WSV A;  1J6V A;  4BY7 C;  2R93 A;  1VGX A;  4BLA A;  4A3G C;  1ZVU A;  3S16 C;  1VJE A;  3GTG K;  1I3Q K;  1DD5 A;  5IYD C;  1F7V A;  3AD7 C;  5EGH A;  1PJ5 A;  2PA8 D;  4J3N A;  3GTG A;  1JOE A;  5IP7 C;  1I3Q A;  1J6X A;  3GTL C;  3WOD A;  4XSZ A;  1TWG K;  3AQO A;  1JQW A;  2GSU A;  5EGE A;  5L46 A;  1G51 A;  2VUM A;  4BY7 K;  5IYC C;  1BGW A;  1KQ4 A;  3S16 K;  4QJV B;  4BXX C;  3TFJ A;  1O26 A;  5IYD K;  4OIR A;  4M1X A;  2ZJP S;  4C45 A;  4BBS C;  1TWG A;  3VA7 A;  3PO2 K;  4FM9 A;  2PA8 L;  5M3M K;  1J6W A;  1I50 C; 
#chains in the Genus database with same CATH homology
 4XLP A;  1YNJ A;  3PO2 C;  5IP7 K;  4KMU A;  3HOZ C;  4X6A C;  4G7H A;  4JK1 A;  4QIW D;  2NVX C;  1I6H C;  4A3C C;  3HOY C;  1TWH K;  4A3M K;  4Q5S A;  3RZO K;  2PPB A;  2JA8 C;  3H0G C;  3S1M C;  4BBR K;  1I6V A;  1TWH C;  4A3M C;  3HKZ D;  5C4J C;  3GTP C;  3S1N C;  5IYC K;  5C4X K;  4A3L K;  3S1R K;  3GTQ K;  4BBR C;  3PO3 K;  1Y1W K;  3M4O C;  3RZD C;  1SFO K;  2WB1 D;  3S1R C;  4G7O A;  3GTQ C;  4OIO A;  3GTO C;  4C2M C;  2E2I C;  4NOI A;  3HOX K;  1SMY A;  1ZYR A;  5IYB C;  4A3E K;  4QIW L;  2A69 A;  1WCM C;  1SFO C;  2E2H C;  1HQM A;  2R92 C;  2PMZ D;  4A3D C;  2O5J A;  5TMF A;  4BY1 K;  2NVX K;  1I6H K;  1R9T C;  2A6E A;  3S17 C;  4A3C K;  3EQL A;  3HOU C;  3HKZ L;  3FKI C;  4C3I C;  4OIN A;  2JA8 K;  3H0G K;  3S1M K;  4LLG A;  4BY1 C;  3S1N K;  5M5W K;  5C4J K;  3GTP K;  1IW7 A;  2NVY C;  2JA7 C;  5M3F K;  4Y7N K;  2WB1 L;  2JA6 K;  5IP9 C;  2B63 C;  3S15 K;  3M4O K;  3RZD K;  4OIQ A;  5C44 C;  1TWA K;  3H3V D;  4Y7N C;  2PMZ L;  3GTO K;  2NVQ C;  2JA6 C;  4C2M K;  2E2I K;  3S15 C;  4A3J C;  5IYB K;  1TWA C;  1WCM K;  2E2H K;  3I4M C;  2R92 K;  2R7Z C;  4A3D K;  4A3F C;  4KN7 A;  1R9T K;  3S17 K;  3HOU K;  4ZH4 A;  4MEX A;  1Y1V K;  4C3J C;  3FKI K;  4C3I K;  1I3Q C;  2VUM K;  2O5I A;  4OIP A;  3DXJ A;  1TWC K;  2WAQ D;  4YG2 A;  2NVY K;  2E2J K;  2JA7 K;  5C3E C;  3S1Q K;  1Y1V C;  2VUM C;  3H3V L;  4A3K C;  3K7A C;  5IP9 K;  2B63 K;  2R93 K;  1TWC C;  2YU9 C;  5C44 K;  1K83 K;  4LK1 A;  2E2J C;  3S1Q C;  4C3H K;  3HOW C;  3S2D C;  2NVQ K;  4A3J K;  1BDF A;  2R93 C;  3S14 K;  3GTK C;  4A3G K;  1K83 C;  5D4D A;  1YNN A;  1XPP A;  3I4M K;  2NVT K;  2R7Z K;  4A3F K;  2A6H A;  4C3H C;  3S2H C;  4Y52 K;  4BY7 C;  5M5Y K;  3GTJ K;  3S14 C;  1TWF K;  4A3G C;  4Q4Z A;  5FLM C;  2WAQ L;  3S16 C;  4AYB D;  4A3B C;  2NVT C;  1I3Q K;  4C3J K;  4YFK A;  2JA5 C;  3GTG K;  4Y52 C;  5IYD C;  3GTJ C;  1TWF C;  3I4N C;  5C3E K;  3M3Y K;  4XLN A;  2Y0S D;  3GTG C;  3K7A K;  4A3K K;  3HOV C;  3CQZ C;  3GTL K;  2YU9 K;  4A93 C;  3M3Y C;  4MQ9 A;  3GTM C;  2PA8 D;  4LJZ A;  2A68 A;  4LK0 A;  5IP7 C;  5M5X K;  3HOW K;  3S2D K;  3GTL C;  3WOD A;  4GZY A;  3GTK K;  5TMC A;  4A3I K;  4XSZ A;  1TWG K;  4AYB L;  3S2H K;  3RZO C;  4BXX K;  2BE5 A;  4BY7 K;  4XSX A;  4A3L C;  5IYC C;  5C4X C;  5FLM K;  4A3I C;  3S16 K;  1TWG C;  4A3B K;  4BBS K;  4QJV A;  4QJV B;  2JA5 K;  4BXX C;  2Y0S L;  3PO3 C;  5IYD K;  1Y1W C;  4OIR A;  4G7Z A;  1I50 K;  3I4N K;  5FJ8 K;  4MEY A;  2CW0 A;  4BBS C;  3PO2 K;  4YFN A;  2PA8 L;  5M3M K;  3HOV K;  4KN4 A;  3CQZ K;  3HOZ K;  4X6A K;  3HOX C;  1I50 C;  4A93 K;  3HOY K;  4A3E C;  4YFX A;  3GTM K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...