2A69A

Crystal structure of the t. thermophilus rna polymerase holoenzyme in complex with antibiotic rifapentin
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
229
structure length
229
Chain Sequence
MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords DNA-directed RNA polymerase alpha chain
publication title Allosteric modulation of the RNA polymerase catalytic reaction is an essential component of transcription control by rifamycins.
pubmed doi rcsb
total genus 40
structure length 229
sequence length 229
chains with identical sequence B, K, L
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2005-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01000 RNA_pol_A_bac RNA polymerase Rpb3/RpoA insert domain
A PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain
A PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.12 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 DNA-directed RNA polymerase, insert domain 2a69A02
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 2a69A01
4BXXC 2WB1L 4A3JK 3K7AC 2VUMC 5M3MK 4QIWL 3GTLC 2VUMK 3HOZK 3S1MK 4A3DC 4Q5SA 4A3DK 3HOVC 4BBRC 3HOVK 3H3VD 3GTGC 4QJVA 5TMFA 4XLNA 4C3HK 3S2DC 2NVYC 3GTJK 2WAQL 3S15C 3S15K 3PO2C 4YG2A 3GTKC 2A6EA 3S16C 3S16K 4A3LC 4A3LK 4C2MC 4NOIA 3I4NK 2R93K 3S2HC 2JA6C 3FKIC 2JA6K 3FKIK 4MEYA 5IYDC 3S2HK 5IYDK 2NVXC 3GTMK 3EQLA 2NVXK 4Y52C 4A3KK 1I50C 3M4OK 3PO3K 3S14K 4QJVB 2PMZD 3S1RC 2E2JC 5IP7K 2NVTC 2NVTK 2PA8D 3HOXC 3HOXK 5C3EC 5C3EK 4BXXK 4LK0A 4JK1A 4G7HA 3K7AK 4MQ9A 3GTLK 4XSXA 3I4MC 4MEXA 1SMYA 4A3BC 4OIQA 4BBRK 2B63C 3GTGK 1K83C 1K83K 1I3QC 2NVYK 1I3QK 3S2DK 3HKZD 4A3IC 4Y7NC 4A3IK 3PO2K 4KN4A 1I6VA 4KN7A 2A69A 3GTKK 1ZYRA 1HQMA 4C2MK 4C3JC 1Y1VC 5C4JC 1Y1VK 2O5IA 2Y0SL 2A6HA 4OIRA 1WCMC 3RZOC 1WCMK 4C3JK 5FJ8K 5C4JK 4G7ZA 4A3CC 1I6HC 4X6AC 1I6HK 4YFKA 4X6AK 4AYBD 4Y52K 3HOYC 1I50K 1TWFC 1YNJA 1IW7A 4OIPA 4BY1C 2R7ZC 3GTPC 4YFNA 1TWAC 4BY1K 1TWAK 3S1RK 4LLGA 4LJZA 3CQZC 5IP9C 2PA8L 4QIWD 2E2JK 2O5JA 5FLMC 5FLMK 3WODA 5C44C 5C44K 5M5YK 2E2IC 3GTOC 3HOWC 2E2IK 5IYCC 2JA8C 5IYCK 2JA8K 3HOWK 3M3YC 3H3VL 4XLPA 2WAQD 3I4MK 3RZDC 3M3YK 3RZDK 4A3BK 3S1NC 3GTPK 2B63K 4LK1A 2BE5A 3DXJA 3S1QC 4A3MC 3HKZL 4A3MK 2JA7C 4KMUA 2A68A 4ZH4A 4Y7NK 2PPBA 4GZYA 1TWCC 1YNNA 4Q4ZA 1TWCK 1BDFA 1SFOC 4C3IC 4A3FC 3GTQC 4C3IK 5M3FK 1SFOK 3GTQK 3H0GC 3RZOK 4OIOA 4A3EC 3H0GK 3HOUC 4A3CK 1R9TC 1R9TK 5IYBC 1TWGC 1TWGK 3HOYK 2PMZL 1TWFK 4A3JC 2R7ZK 2WB1D 3S1MC 4BY7C 3HOZC 4BY7K 3CQZK 5IP9K 2NVQC 2NVQK 4C3HC 5TMCA 3GTJC 3GTOK 4G7OA 3S17C 3S17K 1XPPA 5D4DA 3S1NK 2E2HC 2E2HK 2CW0A 2JA5C 5C4XC 3I4NC 5C4XK 2JA5K 2R93C 3S1QK 4BBSC 2JA7K 4BBSK 2Y0SD 3GTMC 5M5WK 2R92C 4A3KC 4A3GC 2R92K 4A3GK 4OINA 3M4OC 4A3FK 3PO3C 3S14C 5M5XK 1Y1WC 1TWHC 1Y1WK 1TWHK 2YU9C 4A3EK 2YU9K 5IP7C 4AYBL 3HOUK 4A93C 4YFXA 4A93K 4XSZA 5IYBK
chains in the Genus database with same CATH superfamily
3GTLC 3S1MK 1DCHA 3IPJA 3HOVC 1J6XA 3HOVK 3GTGC 3CAGA 1XXCA 4GTAA 4A3LC 1HI9A 4A3LK 4NOIA 3I4NK 1TWCA 4MEYA 1WOOA 2NVXC 2NVXK 4G0VA 4FM9A 1XZQB 1I50C 1XZPA 2E2JC 5C3EC 5C3EK 4BXXK 4G7HA 2JH3A 5E68A 4MEXA 1SMYA 5HL7S 1WSVA 2P8TA 1IE0A 3LAJA 2NVYK 4A3IC 3AQPA 4A3IK 3PO2K 1VH2A 1HQMA 4G0WA 2O5IA 3A8JA 4OIRA 3OPFA 4KDDA 1IBAA 5DM6S 1I6HC 4PABA 1I6HK 1J98A 1TWHA 4Y52K 2RGRA 1ZQ1C 1WQGA 4GTCA 3S1RK 4LJZA 3CQZC 2EBBA 2PA8L 1O2AA 3GTLA 4AH6A 1EK8A 5C44C 5C44K 1G51A 3GTOC 5M5YK 1O26A 3GTGA 5IYCC 2JA8C 5IYCK 2JA8K 3H3VL 4A3BK 3G4CA 2BE5A 4A3MC 1EH1A 4A3MK 1V5VA 2PPBA 4GZYA 4BLAA 4ILDA 1YNNA 1WCMA 3AD9C 1BDFA 2NVXA 3BUEA 3H0GC 3H0GK 3Q3QA 1I50A 4A3CK 3T00A 5TJ3A 5CJ9A 5IYBC 1ZXOA 2Y3PA 3SZZA 2V6TA 3HOZC 4LQYA 5IP9K 1O25A 4GTDA 1L0WA 3GTJC 1WSRA 1XPPA 2CW0A 2V6UA 3QX3A 3GTMC 2ZUEA 4A3GC 4A3GK 1R9TA 3HOUK 4YFXA 1YX2A 3CQZA 1PJ5A 4A3JK 3K7AC 4GTLA 1WORA 4BBRC 3GTOA 3H3VD 1IL2A 4C3HK 1O27A 4WFAS 1PJ7A 2XCOA 3TFIA 2D6FC 3GTKC 2A6EA 4IOAS 2ZUFA 4A3KK 3H0GA 1VGXA 3M4OK 3PO3K 3S14K 3OREA 4IO9S 4C45A 1JQWA 1ZBSA 5IP7K 1XXAA 1IQ0A 1WOSA 2CFAB 4JK1A 4MQ9A 3GTLK 1RU0A 3L4JA 3GTJA 4OIQA 2B63C 3GEHA 3GTGK 3N0CA 1ISEA 2CFAA 3N3YA 1I6VA 1XZPB 3GDZA 1EQRA 3GTMA 2A6HA 1WCMC 3RZOC 1WCMK 3GSIA 1DD5A 4GTBA 1I50K 1TWFC 3GTPC 3GTPK 4YFNA 4LLGA 2E2JK 2KWAA 1JOEA 3NUHA 2O5JA 1F7UA 5FLMC 5FLMK 4GTEA 3LAPA 4KMAA 5JFEA 3M3YC 3M3YK 3AD7C 3S1NC 3S1QC 3HKZL 3GTKA 2JA7C 4O2DA 4WF9S 1SFOC 2L3UA 4C3IC 3GTQC 4C3IK 5M3FK 1SFOK 4KC6A 3GTQK 4KM8A 3HXAA 1R9TC 1R9TK 1TWGC 1TWGK 1GE9A 4U67S 4J3NA 1UV7A 3GEEA 4BY7C 1VJEA 4BY7K 1DCOA 3CQZK 3GEIA 3CF5S 4WJ4A 3GTOK 2B63A 4G7OA 3G4AA 3FHZA 2E2HC 2E2HK 2JA5C 4IOCS 5C4XC 5C4XK 2JA5K 4LOWA 2R93C 2GAGC 5M5WK 2R92C 1USMA 3N0BA 2R92K 4OINA 1KQ4A 1Y1WC 1BJTA 1Y1WK 4AYBL 1TWFA 3GTPA 4XSZA 3TFHA 5IYBK 2WB1L 5M3MK 3HOZK 4WFBS 4KAWX 5EGHA 4QJVA 5TMFA 3S2DC 3GTJK 3S15C 3S15K 2FQOA 4YG2A 1EI6A 4KMDA 2JA7A 5JVGS 5HQHA 4C2MC 5JVHS 5HL8A 5IOQA 3S2HC 3S2HK 1IS1A 3GTMK 1SFOA 3GTQA 4KB2A 1TWGA 4GTFA 3L4KA 2NVTC 2NVTK 2PA8D 2XCQA 4LK0A 1XXBA 3K7AK 4M1XA 4WJ3M 3I4MC 4BBRK 2XCRB 2E2HA 2GAHC 2JA5A 4Y7NC 2R93A 4KN4A 3GTKK 4KN7A 2A69A 2JA6A 4GFQA 1Y1VC 2Y0SL 1Y1VK 5FJ8K 2R92A 3ERED 4G7ZA 4X6AC 4WCES 1Y1WA 4X6AK 4AYBD 2P5MA 3HOYC 4P5BA 1YNJA 1IW7A 2R7ZC 1TWAC 1TWAK 3A8IA 4PAAA 4KARA 3WODA 2E2IC 3HOWC 2E2IK 1BGWA 1O2BA 3HOWK 3MMLB 2B63K 4KB4A 2V6SA 5DM7S 4A3FC 4KMHA 3AQOA 1F7VA 4OIOA 4A3EC 3RZOK 1USOA 3V4GA 3BP8C 2PMZL 5CHPA 1TWFK 5IOSA 3S1MC 4P5AA 4BLBA 1YCLA 5TMCA 4LR2A 2FQTA 1BS2A 1VRQC 1B4BA 4P9SA 2ZJQS 3S1NK 3I4NC 3S1QK 2ZJRS 3BP3A 4BBSC 2JA7K 4BBSK 2Y0SD 1Y1VA 1INNA 3JSTA 4BKWA 2ZFZA 3FOFA 4A93C 4A93K 3OEPA 2R7ZA 1TWAA 4BXXC 3ADAC 2L5NA 2VUMC 4QIWL 2VUMK 4A3DC 4Q5SA 1XZQA 4A3DK 2E2IA 3AH5A 4XLNA 2NVYC 3GIRA 2WAQL 3PO2C 3S16C 1WQHA 3S16K 5JVOA 1ZVUA 4WILA 1C0AA 4KASA 4DDQA 2R93K 2JA6C 3FKIC 2JA6K 3FKIK 5IYDC 5IYDK 3EQLA 4Y52C 3PIPS 2YU9A 4QJVB 2PMZD 3TFJA 3S1RC 3HOXC 3HOXK 1F93A 4XSXA 1O2FB 3PIOS 1O28A 4A3BC 2GSOA 1K83C 1K83K 1I3QC 3S2DK 1I3QK 3HKZD 2KPUA 2W7VA 1EFWA 1WQFA 1ZYRA 4C2MK 4C3JC 5C4JC 4C3JK 5C4JK 1B4AA 4A3CC 1JVIA 4YFKA 3FOEA 4OIPA 4BY1C 1DCPA 4BY1K 5IP9C 4QIWD 2VUMA 4G0UA 1WOPA 3AD8C 4KATA 3I4MK 3T01A 4XLPA 2WAQD 2NVYA 3RZDC 3RZDK 4RMFA 3LPXA 4LK1A 1J6VA 3SZYA 3DXJA 4XCHA 5EGEA 2KXYA 1VLOA 4KMUA 4WFNS 2A68A 4ZH4A 1F9NA 4Y7NK 3T02A 3FKIA 1TWCC 3LYWA 4Q4ZA 1TWCK 5IOTA 3HOUC 3VA7A 2ZJPS 1AB4A 3HOYK 4A3JC 4GT9A 2R7ZK 2WB1D 2GSUA 4FZBA 2NVQC 2GSNA 2NVQK 5L46A 4C3HC 3S0XA 3TTGA 3DLLS 1FEUA 3S17C 1X31C 1K83A 3S17K 1I3QA 5D4DA 2PHCB 1O24A 3A8KA 5IORA 1WIHA 1O29A 2KQ1A 4A3KC 2RH6A 3M4OC 4A3FK 3PO3C 3S14C 5M5XK 1TWHC 1TWHK 1J6WA 2YU9C 4A3EK 2YU9K 5IP7C 4KM9A 1PJ6A
chains in the Genus database with same CATH topology
4BXXC 2WB1L 4A3JK 3K7AC 2VUMC 5M3MK 4QIWL 3GTLC 2VUMK 3HOZK 3S1MK 4A3DC 4Q5SA 4A3DK 3HOVC 4BBRC 3HOVK 3H3VD 3GTGC 4QJVA 5TMFA 4XLNA 4C3HK 3S2DC 2NVYC 3GTJK 2WAQL 3S15C 3S15K 3PO2C 4YG2A 3GTKC 2A6EA 3S16C 3S16K 4A3LC 4A3LK 4C2MC 4NOIA 3I4NK 2R93K 3S2HC 2JA6C 3FKIC 2JA6K 3FKIK 4MEYA 5IYDC 3S2HK 5IYDK 2NVXC 3GTMK 3EQLA 2NVXK 4Y52C 4A3KK 1I50C 3M4OK 3PO3K 3S14K 4QJVB 2PMZD 3S1RC 2E2JC 5IP7K 2NVTC 2NVTK 2PA8D 3HOXC 3HOXK 5C3EC 5C3EK 4BXXK 4LK0A 4JK1A 4G7HA 3K7AK 4MQ9A 3GTLK 4XSXA 3I4MC 4MEXA 1SMYA 4A3BC 4OIQA 4BBRK 2B63C 3GTGK 1K83C 1K83K 1I3QC 2NVYK 1I3QK 3S2DK 3HKZD 4A3IC 4Y7NC 4A3IK 3PO2K 4KN4A 1I6VA 4KN7A 2A69A 3GTKK 1ZYRA 1HQMA 4C2MK 4C3JC 1Y1VC 5C4JC 1Y1VK 2O5IA 2Y0SL 2A6HA 4OIRA 1WCMC 3RZOC 1WCMK 4C3JK 5FJ8K 5C4JK 4G7ZA 4A3CC 1I6HC 4X6AC 1I6HK 4YFKA 4X6AK 4AYBD 4Y52K 3HOYC 1I50K 1TWFC 1YNJA 1IW7A 4OIPA 4BY1C 2R7ZC 3GTPC 4YFNA 1TWAC 4BY1K 1TWAK 3S1RK 4LLGA 4LJZA 3CQZC 5IP9C 2PA8L 4QIWD 2E2JK 2O5JA 5FLMC 5FLMK 3WODA 5C44C 5C44K 5M5YK 2E2IC 3GTOC 3HOWC 2E2IK 5IYCC 2JA8C 5IYCK 2JA8K 3HOWK 3M3YC 3H3VL 4XLPA 2WAQD 3I4MK 3RZDC 3M3YK 3RZDK 4A3BK 3S1NC 3GTPK 2B63K 4LK1A 2BE5A 3DXJA 3S1QC 4A3MC 3HKZL 4A3MK 2JA7C 4KMUA 2A68A 4ZH4A 4Y7NK 2PPBA 4GZYA 1TWCC 1YNNA 4Q4ZA 1TWCK 1BDFA 1SFOC 4C3IC 4A3FC 3GTQC 4C3IK 5M3FK 1SFOK 3GTQK 3H0GC 3RZOK 4OIOA 4A3EC 3H0GK 3HOUC 4A3CK 1R9TC 1R9TK 5IYBC 1TWGC 1TWGK 3HOYK 2PMZL 1TWFK 4A3JC 2R7ZK 2WB1D 3S1MC 4BY7C 3HOZC 4BY7K 3CQZK 5IP9K 2NVQC 2NVQK 4C3HC 5TMCA 3GTJC 3GTOK 4G7OA 3S17C 3S17K 1XPPA 5D4DA 3S1NK 2E2HC 2E2HK 2CW0A 2JA5C 5C4XC 3I4NC 5C4XK 2JA5K 2R93C 3S1QK 4BBSC 2JA7K 4BBSK 2Y0SD 3GTMC 5M5WK 2R92C 4A3KC 4A3GC 2R92K 4A3GK 4OINA 3M4OC 4A3FK 3PO3C 3S14C 5M5XK 1Y1WC 1TWHC 1Y1WK 1TWHK 2YU9C 4A3EK 2YU9K 5IP7C 4AYBL 3HOUK 4A93C 4YFXA 4A93K 4XSZA 5IYBK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BXX C;  2WB1 L;  4A3J K;  3K7A C;  2VUM C;  5M3M K;  4QIW L;  3GTL C;  2VUM K;  3HOZ K;  3S1M K;  4A3D C;  4Q5S A;  4A3D K;  3HOV C;  4BBR C;  3HOV K;  3H3V D;  3GTG C;  4QJV A;  5TMF A;  4XLN A;  4C3H K;  3S2D C;  2NVY C;  3GTJ K;  2WAQ L;  3S15 C;  3S15 K;  3PO2 C;  4YG2 A;  3GTK C;  2A6E A;  3S16 C;  3S16 K;  4A3L C;  4A3L K;  4C2M C;  4NOI A;  3I4N K;  2R93 K;  3S2H C;  2JA6 C;  3FKI C;  2JA6 K;  3FKI K;  4MEY A;  5IYD C;  3S2H K;  5IYD K;  2NVX C;  3GTM K;  3EQL A;  2NVX K;  4Y52 C;  4A3K K;  1I50 C;  3M4O K;  3PO3 K;  3S14 K;  4QJV B;  2PMZ D;  3S1R C;  2E2J C;  5IP7 K;  2NVT C;  2NVT K;  2PA8 D;  3HOX C;  3HOX K;  5C3E C;  5C3E K;  4BXX K;  4LK0 A;  4JK1 A;  4G7H A;  3K7A K;  4MQ9 A;  3GTL K;  4XSX A;  3I4M C;  4MEX A;  1SMY A;  4A3B C;  4OIQ A;  4BBR K;  2B63 C;  3GTG K;  1K83 C;  1K83 K;  1I3Q C;  2NVY K;  1I3Q K;  3S2D K;  3HKZ D;  4A3I C;  4Y7N C;  4A3I K;  3PO2 K;  4KN4 A;  1I6V A;  4KN7 A;  2A69 A;  3GTK K;  1ZYR A;  1HQM A;  4C2M K;  4C3J C;  1Y1V C;  5C4J C;  1Y1V K;  2O5I A;  2Y0S L;  2A6H A;  4OIR A;  1WCM C;  3RZO C;  1WCM K;  4C3J K;  5FJ8 K;  5C4J K;  4G7Z A;  4A3C C;  1I6H C;  4X6A C;  1I6H K;  4YFK A;  4X6A K;  4AYB D;  4Y52 K;  3HOY C;  1I50 K;  1TWF C;  1YNJ A;  1IW7 A;  4OIP A;  4BY1 C;  2R7Z C;  3GTP C;  4YFN A;  1TWA C;  4BY1 K;  1TWA K;  3S1R K;  4LLG A;  4LJZ A;  3CQZ C;  5IP9 C;  2PA8 L;  4QIW D;  2E2J K;  2O5J A;  5FLM C;  5FLM K;  3WOD A;  5C44 C;  5C44 K;  5M5Y K;  2E2I C;  3GTO C;  3HOW C;  2E2I K;  5IYC C;  2JA8 C;  5IYC K;  2JA8 K;  3HOW K;  3M3Y C;  3H3V L;  4XLP A;  2WAQ D;  3I4M K;  3RZD C;  3M3Y K;  3RZD K;  4A3B K;  3S1N C;  3GTP K;  2B63 K;  4LK1 A;  2BE5 A;  3DXJ A;  3S1Q C;  4A3M C;  3HKZ L;  4A3M K;  2JA7 C;  4KMU A;  2A68 A;  4ZH4 A;  4Y7N K;  2PPB A;  4GZY A;  1TWC C;  1YNN A;  4Q4Z A;  1TWC K;  1BDF A;  1SFO C;  4C3I C;  4A3F C;  3GTQ C;  4C3I K;  5M3F K;  1SFO K;  3GTQ K;  3H0G C;  3RZO K;  4OIO A;  4A3E C;  3H0G K;  3HOU C;  4A3C K;  1R9T C;  1R9T K;  5IYB C;  1TWG C;  1TWG K;  3HOY K;  2PMZ L;  1TWF K;  4A3J C;  2R7Z K;  2WB1 D;  3S1M C;  4BY7 C;  3HOZ C;  4BY7 K;  3CQZ K;  5IP9 K;  2NVQ C;  2NVQ K;  4C3H C;  5TMC A;  3GTJ C;  3GTO K;  4G7O A;  3S17 C;  3S17 K;  1XPP A;  5D4D A;  3S1N K;  2E2H C;  2E2H K;  2CW0 A;  2JA5 C;  5C4X C;  3I4N C;  5C4X K;  2JA5 K;  2R93 C;  3S1Q K;  4BBS C;  2JA7 K;  4BBS K;  2Y0S D;  3GTM C;  5M5W K;  2R92 C;  4A3K C;  4A3G C;  2R92 K;  4A3G K;  4OIN A;  3M4O C;  4A3F K;  3PO3 C;  3S14 C;  5M5X K;  1Y1W C;  1TWH C;  1Y1W K;  1TWH K;  2YU9 C;  4A3E K;  2YU9 K;  5IP7 C;  4AYB L;  3HOU K;  4A93 C;  4YFX A;  4A93 K;  4XSZ A;  5IYB K; 
#chains in the Genus database with same CATH topology
 3GTL C;  3S1M K;  1DCH A;  3IPJ A;  3HOV C;  1J6X A;  3HOV K;  3GTG C;  3CAG A;  1XXC A;  4GTA A;  4A3L C;  1HI9 A;  4A3L K;  4NOI A;  3I4N K;  1TWC A;  4MEY A;  1WOO A;  2NVX C;  2NVX K;  4G0V A;  4FM9 A;  1XZQ B;  1I50 C;  1XZP A;  2E2J C;  5C3E C;  5C3E K;  4BXX K;  4G7H A;  2JH3 A;  5E68 A;  4MEX A;  1SMY A;  5HL7 S;  1WSV A;  2P8T A;  1IE0 A;  3LAJ A;  2NVY K;  4A3I C;  3AQP A;  4A3I K;  3PO2 K;  1VH2 A;  1HQM A;  4G0W A;  2O5I A;  3A8J A;  4OIR A;  3OPF A;  4KDD A;  1IBA A;  5DM6 S;  1I6H C;  4PAB A;  1I6H K;  1J98 A;  1TWH A;  4Y52 K;  2RGR A;  1ZQ1 C;  1WQG A;  4GTC A;  3S1R K;  4LJZ A;  3CQZ C;  2EBB A;  2PA8 L;  1O2A A;  3GTL A;  4AH6 A;  1EK8 A;  5C44 C;  5C44 K;  1G51 A;  3GTO C;  5M5Y K;  1O26 A;  3GTG A;  5IYC C;  2JA8 C;  5IYC K;  2JA8 K;  3H3V L;  4A3B K;  3G4C A;  2BE5 A;  4A3M C;  1EH1 A;  4A3M K;  1V5V A;  2PPB A;  4GZY A;  4BLA A;  4ILD A;  1YNN A;  1WCM A;  3AD9 C;  1BDF A;  2NVX A;  3BUE A;  3H0G C;  3H0G K;  3Q3Q A;  1I50 A;  4A3C K;  3T00 A;  5TJ3 A;  5CJ9 A;  5IYB C;  1ZXO A;  2Y3P A;  3SZZ A;  2V6T A;  3HOZ C;  4LQY A;  5IP9 K;  1O25 A;  4GTD A;  1L0W A;  3GTJ C;  1WSR A;  1XPP A;  2CW0 A;  2V6U A;  3QX3 A;  3GTM C;  2ZUE A;  4A3G C;  4A3G K;  1R9T A;  3HOU K;  4YFX A;  1YX2 A;  3CQZ A;  1PJ5 A;  4A3J K;  3K7A C;  4GTL A;  1WOR A;  4BBR C;  3GTO A;  3H3V D;  1IL2 A;  4C3H K;  1O27 A;  4WFA S;  1PJ7 A;  2XCO A;  3TFI A;  2D6F C;  3GTK C;  2A6E A;  4IOA S;  2ZUF A;  4A3K K;  3H0G A;  1VGX A;  3M4O K;  3PO3 K;  3S14 K;  3ORE A;  4IO9 S;  4C45 A;  1JQW A;  1ZBS A;  5IP7 K;  1XXA A;  1IQ0 A;  1WOS A;  2CFA B;  4JK1 A;  4MQ9 A;  3GTL K;  1RU0 A;  3L4J A;  3GTJ A;  4OIQ A;  2B63 C;  3GEH A;  3GTG K;  3N0C A;  1ISE A;  2CFA A;  3N3Y A;  1I6V A;  1XZP B;  3GDZ A;  1EQR A;  3GTM A;  2A6H A;  1WCM C;  3RZO C;  1WCM K;  3GSI A;  1DD5 A;  4GTB A;  1I50 K;  1TWF C;  3GTP C;  3GTP K;  4YFN A;  4LLG A;  2E2J K;  2KWA A;  1JOE A;  3NUH A;  2O5J A;  1F7U A;  5FLM C;  5FLM K;  4GTE A;  3LAP A;  4KMA A;  5JFE A;  3M3Y C;  3M3Y K;  3AD7 C;  3S1N C;  3S1Q C;  3HKZ L;  3GTK A;  2JA7 C;  4O2D A;  4WF9 S;  1SFO C;  2L3U A;  4C3I C;  3GTQ C;  4C3I K;  5M3F K;  1SFO K;  4KC6 A;  3GTQ K;  4KM8 A;  3HXA A;  1R9T C;  1R9T K;  1TWG C;  1TWG K;  1GE9 A;  4U67 S;  4J3N A;  1UV7 A;  3GEE A;  4BY7 C;  1VJE A;  4BY7 K;  1DCO A;  3CQZ K;  3GEI A;  3CF5 S;  4WJ4 A;  3GTO K;  2B63 A;  4G7O A;  3G4A A;  3FHZ A;  2E2H C;  2E2H K;  2JA5 C;  4IOC S;  5C4X C;  5C4X K;  2JA5 K;  4LOW A;  2R93 C;  2GAG C;  5M5W K;  2R92 C;  1USM A;  3N0B A;  2R92 K;  4OIN A;  1KQ4 A;  1Y1W C;  1BJT A;  1Y1W K;  4AYB L;  1TWF A;  3GTP A;  4XSZ A;  3TFH A;  5IYB K;  2WB1 L;  5M3M K;  3HOZ K;  4WFB S;  4KAW X;  5EGH A;  4QJV A;  5TMF A;  3S2D C;  3GTJ K;  3S15 C;  3S15 K;  2FQO A;  4YG2 A;  1EI6 A;  4KMD A;  2JA7 A;  5JVG S;  5HQH A;  4C2M C;  5JVH S;  5HL8 A;  5IOQ A;  3S2H C;  3S2H K;  1IS1 A;  3GTM K;  1SFO A;  3GTQ A;  4KB2 A;  1TWG A;  4GTF A;  3L4K A;  2NVT C;  2NVT K;  2PA8 D;  2XCQ A;  4LK0 A;  1XXB A;  3K7A K;  4M1X A;  4WJ3 M;  3I4M C;  4BBR K;  2XCR B;  2E2H A;  2GAH C;  2JA5 A;  4Y7N C;  2R93 A;  4KN4 A;  3GTK K;  4KN7 A;  2A69 A;  2JA6 A;  4GFQ A;  1Y1V C;  2Y0S L;  1Y1V K;  5FJ8 K;  2R92 A;  3ERE D;  4G7Z A;  4X6A C;  4WCE S;  1Y1W A;  4X6A K;  4AYB D;  2P5M A;  3HOY C;  4P5B A;  1YNJ A;  1IW7 A;  2R7Z C;  1TWA C;  1TWA K;  3A8I A;  4PAA A;  4KAR A;  3WOD A;  2E2I C;  3HOW C;  2E2I K;  1BGW A;  1O2B A;  3HOW K;  3MML B;  2B63 K;  4KB4 A;  2V6S A;  5DM7 S;  4A3F C;  4KMH A;  3AQO A;  1F7V A;  4OIO A;  4A3E C;  3RZO K;  1USO A;  3V4G A;  3BP8 C;  2PMZ L;  5CHP A;  1TWF K;  5IOS A;  3S1M C;  4P5A A;  4BLB A;  1YCL A;  5TMC A;  4LR2 A;  2FQT A;  1BS2 A;  1VRQ C;  1B4B A;  4P9S A;  2ZJQ S;  3S1N K;  3I4N C;  3S1Q K;  2ZJR S;  3BP3 A;  4BBS C;  2JA7 K;  4BBS K;  2Y0S D;  1Y1V A;  1INN A;  3JST A;  4BKW A;  2ZFZ A;  3FOF A;  4A93 C;  4A93 K;  3OEP A;  2R7Z A;  1TWA A;  4BXX C;  3ADA C;  2L5N A;  2VUM C;  4QIW L;  2VUM K;  4A3D C;  4Q5S A;  1XZQ A;  4A3D K;  2E2I A;  3AH5 A;  4XLN A;  2NVY C;  3GIR A;  2WAQ L;  3PO2 C;  3S16 C;  1WQH A;  3S16 K;  5JVO A;  1ZVU A;  4WIL A;  1C0A A;  4KAS A;  4DDQ A;  2R93 K;  2JA6 C;  3FKI C;  2JA6 K;  3FKI K;  5IYD C;  5IYD K;  3EQL A;  4Y52 C;  3PIP S;  2YU9 A;  4QJV B;  2PMZ D;  3TFJ A;  3S1R C;  3HOX C;  3HOX K;  1F93 A;  4XSX A;  1O2F B;  3PIO S;  1O28 A;  4A3B C;  2GSO A;  1K83 C;  1K83 K;  1I3Q C;  3S2D K;  1I3Q K;  3HKZ D;  2KPU A;  2W7V A;  1EFW A;  1WQF A;  1ZYR A;  4C2M K;  4C3J C;  5C4J C;  4C3J K;  5C4J K;  1B4A A;  4A3C C;  1JVI A;  4YFK A;  3FOE A;  4OIP A;  4BY1 C;  1DCP A;  4BY1 K;  5IP9 C;  4QIW D;  2VUM A;  4G0U A;  1WOP A;  3AD8 C;  4KAT A;  3I4M K;  3T01 A;  4XLP A;  2WAQ D;  2NVY A;  3RZD C;  3RZD K;  4RMF A;  3LPX A;  4LK1 A;  1J6V A;  3SZY A;  3DXJ A;  4XCH A;  5EGE A;  2KXY A;  1VLO A;  4KMU A;  4WFN S;  2A68 A;  4ZH4 A;  1F9N A;  4Y7N K;  3T02 A;  3FKI A;  1TWC C;  3LYW A;  4Q4Z A;  1TWC K;  5IOT A;  3HOU C;  3VA7 A;  2ZJP S;  1AB4 A;  3HOY K;  4A3J C;  4GT9 A;  2R7Z K;  2WB1 D;  2GSU A;  4FZB A;  2NVQ C;  2GSN A;  2NVQ K;  5L46 A;  4C3H C;  3S0X A;  3TTG A;  3DLL S;  1FEU A;  3S17 C;  1X31 C;  1K83 A;  3S17 K;  1I3Q A;  5D4D A;  2PHC B;  1O24 A;  3A8K A;  5IOR A;  1WIH A;  1O29 A;  2KQ1 A;  4A3K C;  2RH6 A;  3M4O C;  4A3F K;  3PO3 C;  3S14 C;  5M5X K;  1TWH C;  1TWH K;  1J6W A;  2YU9 C;  4A3E K;  2YU9 K;  5IP7 C;  4KM9 A;  1PJ6 A; 
#chains in the Genus database with same CATH homology
 4BXX C;  2WB1 L;  4A3J K;  3K7A C;  2VUM C;  5M3M K;  4QIW L;  3GTL C;  2VUM K;  3HOZ K;  3S1M K;  4A3D C;  4Q5S A;  4A3D K;  3HOV C;  4BBR C;  3HOV K;  3H3V D;  3GTG C;  4QJV A;  5TMF A;  4XLN A;  4C3H K;  3S2D C;  2NVY C;  3GTJ K;  2WAQ L;  3S15 C;  3S15 K;  3PO2 C;  4YG2 A;  3GTK C;  2A6E A;  3S16 C;  3S16 K;  4A3L C;  4A3L K;  4C2M C;  4NOI A;  3I4N K;  2R93 K;  3S2H C;  2JA6 C;  3FKI C;  2JA6 K;  3FKI K;  4MEY A;  5IYD C;  3S2H K;  5IYD K;  2NVX C;  3GTM K;  3EQL A;  2NVX K;  4Y52 C;  4A3K K;  1I50 C;  3M4O K;  3PO3 K;  3S14 K;  4QJV B;  2PMZ D;  3S1R C;  2E2J C;  5IP7 K;  2NVT C;  2NVT K;  2PA8 D;  3HOX C;  3HOX K;  5C3E C;  5C3E K;  4BXX K;  4LK0 A;  4JK1 A;  4G7H A;  3K7A K;  4MQ9 A;  3GTL K;  4XSX A;  3I4M C;  4MEX A;  1SMY A;  4A3B C;  4OIQ A;  4BBR K;  2B63 C;  3GTG K;  1K83 C;  1K83 K;  1I3Q C;  2NVY K;  1I3Q K;  3S2D K;  3HKZ D;  4A3I C;  4Y7N C;  4A3I K;  3PO2 K;  4KN4 A;  1I6V A;  4KN7 A;  2A69 A;  3GTK K;  1ZYR A;  1HQM A;  4C2M K;  4C3J C;  1Y1V C;  5C4J C;  1Y1V K;  2O5I A;  2Y0S L;  2A6H A;  4OIR A;  1WCM C;  3RZO C;  1WCM K;  4C3J K;  5FJ8 K;  5C4J K;  4G7Z A;  4A3C C;  1I6H C;  4X6A C;  1I6H K;  4YFK A;  4X6A K;  4AYB D;  4Y52 K;  3HOY C;  1I50 K;  1TWF C;  1YNJ A;  1IW7 A;  4OIP A;  4BY1 C;  2R7Z C;  3GTP C;  4YFN A;  1TWA C;  4BY1 K;  1TWA K;  3S1R K;  4LLG A;  4LJZ A;  3CQZ C;  5IP9 C;  2PA8 L;  4QIW D;  2E2J K;  2O5J A;  5FLM C;  5FLM K;  3WOD A;  5C44 C;  5C44 K;  5M5Y K;  2E2I C;  3GTO C;  3HOW C;  2E2I K;  5IYC C;  2JA8 C;  5IYC K;  2JA8 K;  3HOW K;  3M3Y C;  3H3V L;  4XLP A;  2WAQ D;  3I4M K;  3RZD C;  3M3Y K;  3RZD K;  4A3B K;  3S1N C;  3GTP K;  2B63 K;  4LK1 A;  2BE5 A;  3DXJ A;  3S1Q C;  4A3M C;  3HKZ L;  4A3M K;  2JA7 C;  4KMU A;  2A68 A;  4ZH4 A;  4Y7N K;  2PPB A;  4GZY A;  1TWC C;  1YNN A;  4Q4Z A;  1TWC K;  1BDF A;  1SFO C;  4C3I C;  4A3F C;  3GTQ C;  4C3I K;  5M3F K;  1SFO K;  3GTQ K;  3H0G C;  3RZO K;  4OIO A;  4A3E C;  3H0G K;  3HOU C;  4A3C K;  1R9T C;  1R9T K;  5IYB C;  1TWG C;  1TWG K;  3HOY K;  2PMZ L;  1TWF K;  4A3J C;  2R7Z K;  2WB1 D;  3S1M C;  4BY7 C;  3HOZ C;  4BY7 K;  3CQZ K;  5IP9 K;  2NVQ C;  2NVQ K;  4C3H C;  5TMC A;  3GTJ C;  3GTO K;  4G7O A;  3S17 C;  3S17 K;  1XPP A;  5D4D A;  3S1N K;  2E2H C;  2E2H K;  2CW0 A;  2JA5 C;  5C4X C;  3I4N C;  5C4X K;  2JA5 K;  2R93 C;  3S1Q K;  4BBS C;  2JA7 K;  4BBS K;  2Y0S D;  3GTM C;  5M5W K;  2R92 C;  4A3K C;  4A3G C;  2R92 K;  4A3G K;  4OIN A;  3M4O C;  4A3F K;  3PO3 C;  3S14 C;  5M5X K;  1Y1W C;  1TWH C;  1Y1W K;  1TWH K;  2YU9 C;  4A3E K;  2YU9 K;  5IP7 C;  4AYB L;  3HOU K;  4A93 C;  4YFX A;  4A93 K;  4XSZ A;  5IYB K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...