2A69A

Crystal structure of the t. thermophilus rna polymerase holoenzyme in complex with antibiotic rifapentin
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
229
structure length
229
Chain Sequence
MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Allosteric modulation of the RNA polymerase catalytic reaction is an essential component of transcription control by rifamycins.
pubmed doi rcsb
molecule tags Transferase
molecule keywords DNA-directed RNA polymerase alpha chain
total genus 40
structure length 229
sequence length 229
chains with identical sequence B, K, L
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2005-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01000 RNA_pol_A_bac RNA polymerase Rpb3/RpoA insert domain
A PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain
A PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.12 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 DNA-directed RNA polymerase, insert domain 2a69A02
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 2a69A01
3GTJC 2PMZD 4KMUA 4C2MC 4MEXA 4NOIA 2R93C 2YU9C 3HOVC 5IYDC 3K7AC 4A3CC 2O5IA 3S14C 4OIOA 1WCMC 4LLGA 5C44C 2R92C 5C4XC 3PO3K 3HOXC 3GTJK 2E2JK 3M4OC 3HKZL 2A69A 3S2HC 3I4MK 5IYBC 4Y52C 3PO2K 4A3CK 1Y1VC 4BY7C 3I4NK 4AYBL 4OINA 4A3LK 4A3BK 5C4JC 2PA8D 2YU9K 4YFKA 3S17K 3S1MK 5IP7K 4A3EK 1TWGC 4X6AK 3HOXK 2WAQD 1TWFK 4OIRA 1SFOK 4BY1C 3S1QC 2PMZL 4QJVA 2JA5K 5C44K 3S17C 3S1MC 3S15K 2NVQC 3S2DK 4A3LC 2JA6C 1I50K 4A3DK 1I6VA 4BXXC 4G7OA 3GTQK 4AYBD 1TWHC 4G7ZA 2R7ZC 1I3QK 1XPPA 2B63K 3WODA 2VUMK 3HOVK 3RZOK 2BE5A 3I4NC 2E2HC 3HOZC 4MQ9A 3S1NK 3M4OK 4BY7K 3S1RC 5C4XK 4XSXA 1SFOC 1I6HC 2E2JC 1K83C 4G7HA 4A3KC 4Y7NK 5TMFA 1TWAK 3GTMK 2B63C 5FLMC 2Y0SD 1TWHK 4C3IK 2A6EA 3FKIC 4XLPA 3M3YC 2JA8K 5IYCK 4BBRK 2JA6K 4C2MK 3GTKK 5M3FK 2CW0A 3DXJA 4XSZA 4XLNA 2NVTC 5M5WK 1I3QC 4C3HC 4Q5SA 2WAQL 2R7ZK 3HOYC 2WB1D 4KN7A 1TWCK 4A3FC 4QIWL 2NVYC 3S2DC 2E2IK 4A3JK 5C3EC 4OIQA 4X6AC 2NVQK 2WB1L 4A3MK 3I4MC 2NVXK 4QIWD 3H3VD 4A93C 5IP9K 1Y1WK 1R9TK 4BBSK 3HKZD 3CQZC 4YG2A 3GTGC 3PO3C 3GTLC 4A3FK 2PPBA 3S16C 2O5JA 1I50C 3RZDC 3HOUC 4Q4ZA 4A3DC 1Y1VK 4C3HK 3GTOC 2A6HA 1R9TC 4C3IC 2JA8C 4A3BC 4Y52K 4BBRC 5IYCC 4A3JC 3GTLK 4A3KK 4A3MC 3GTMC 5IP9C 1Y1WC 4OIPA 1K83K 1TWGK 2E2HK 3HOZK 3GTOK 4LK0A 3S1RK 2E2IC 2NVYK 1SMYA 4LJZA 2NVTK 1BDFA 3S16K 4LK1A 3GTQC 3PO2C 2A68A 3K7AK 1TWAC 4A3IC 4C3JK 3GTPK 5FJ8K 3CQZK 3GTGK 4YFNA 3H0GC 3H3VL 5D4DA 4ZH4A 1YNJA 3S14K 4Y7NC 3S1NC 1TWCC 2R93K 4QJVB 4GZYA 4A3GK 5M3MK 4KN4A 3FKIK 1YNNA 3RZDK 3HOUK 3M3YK 2JA5C 4JK1A 4YFXA 3S15C 1HQMA 3HOWK 2NVXC 1IW7A 3HOYK 4A93K 2JA7K 4MEYA 5M5XK 5IP7C 1WCMK 2R92K 5M5YK 5C3EK 3RZOC 5TMCA 4BXXK 5C4JK 4BBSC 4A3GC 5IYDK 2PA8L 2JA7C 1ZYRA 2VUMC 5FLMK 3GTKC 3EQLA 3H0GK 4BY1K 3HOWC 2Y0SL 3S2HK 3S1QK 1TWFC 1I6HK 5IYBK 4C3JC 3GTPC 4A3IK 4A3EC
chains in the Genus database with same CATH superfamily
1VGXA 2YU9C 2ZJPS 1USOA 1VRQC 2O5IA 5E68A 3S14C 5C44C 2R92C 5L46A 3GTJK 2RH6A 5DM6S 3M4OC 3HKZL 3I4MK 1PJ6A 1Y1VC 3PIPS 4GTDA 4A3LK 1IS1A 1WIHA 2R93A 4G0WA 2FQTA 3S1MK 3AD8C 1V5VA 4G0VA 1ZVUA 3S17C 3AQOA 1EI6A 1IQ0A 3G4CA 4A3CK 3HOVK 3WODA 2BE5A 4KDDA 3S1NK 3M4OK 2KQ1A 4A3KC 1TWAK 1TWHK 3S14K 1F93A 2JA6K 5M3FK 2CW0A 5M5WK 2R7ZA 1TWCK 4KN7A 5TJ3A 4QIWL 2E2HA 3VA7A 2WB1L 3I4MC 4BBSK 3GTLC 3S16C 3RZDC 4Q4ZA 3GTOC 1R9TC 4C3IC 2JA8C 4BBRC 5IYCC 1ZBSA 4A3KK 4A3MC 1Y1WC 1B4BA 1TWGK 3AH5A 4BKWA 2E2IC 1O28A 1SMYA 4M1XA 1BDFA 1J6VA 1J6XA 5FJ8K 3CQZK 1WCMA 5IOTA 1KQ4A 4ZH4A 4Y7NC 3AD7C 3SZYA 1TWCC 1WQHA 3NUHA 1WOSA 2R93K 4KATA 4KN4A 3RZDK 4RMFA 3MMLB 4KASA 3GTKA 4YFXA 3S15C 1WSVA 3HOYK 3CQZA 3TTGA 4MEYA 5IP7C 1B4AA 1IE0A 4KMAA 3GEHA 2KPUA 2PA8L 4FM9A 1F9NA 1O26A 4P9SA 3S1QK 3HOWC 1XZQA 5IYBK 4A3EC 2V6TA 2PMZD 4C2MC 4NOIA 2JA6A 3CF5S 5IYDC 1YX2A 2JA5A 1WCMC 5JVGS 3PO3K 4LR2A 2E2JK 1EFWA 4Y52C 4GTAA 2XCQA 5IP7K 4X6AK 3HOXK 1WSRA 1TWFK 1SFOA 4QJVA 5HQHA 2ZUFA 2JA5K 3FKIA 5C44K 4WJ4A 3TFIA 3T02A 1XZPB 3S2DK 2JA6C 1I6VA 3GTQK 1TWHC 1XPPA 1R9TA 3I4NC 3ADAC 3HOZC 3GEEA 4MQ9A 2ZUEA 4BY7K 1DD5A 5HL7S 1SFOC 2XCRB 2E2JC 3GIRA 4G7HA 4Y7NK 4WFNS 2B63C 5FLMC 2A6EA 4C2MK 3DXJA 1O25A 4WFAS 1I3QC 3LAJA 2R7ZK 4KM9A 2NVYC 4A3MK 1INNA 4WCES 3H3VD 4A93C 1EH1A 4GTEA 1Y1WK 1R9TK 1USMA 4IOAS 4A3FK 2ZFZA 1XZQB 4C3HK 3IPJA 4PAAA 1EK8A 2KXYA 2JH3A 2ZJRS 4A3BC 4A3JC 1RU0A 5IP9C 3G4AA 1XXCA 4ILDA 3HOZK 3TFJA 3GTQC 1I3QA 3K7AK 1TWAC 4A3IC 3GTGK 3BUEA 2R92A 3V4GA 4U67S 3DLLS 3PIOS 3GTMA 1BJTA 4BLBA 2GSUA 2V6UA 5EGHA 2YU9A 4GZYA 4A3GK 4IOCS 3FKIK 3OEPA 3M3YK 1J6WA 2VUMA 1WQFA 1TWFA 2ZJQS 3HOWK 1IW7A 2P5MA 4A93K 5C3EK 4WILA 3LYWA 5TMCA 4BXXK 5C4JK 5IYDK 2Y3PA 1EQRA 2KWAA 1GE9A 1O24A 2JA7C 2V6SA 5FLMK 4BY1K 1XXAA 4A3IK 3AD9C 3GTJC 4MEXA 4WF9S 2R93C 3K7AC 3ERED 3LPXA 4LLGA 5C4XC 3HOXC 2GSNA 2A69A 3S2HC 2NVXA 5EGEA 1JOEA 2EBBA 5IORA 1PJ7A 4OINA 4A3BK 5C4JC 2PA8D 1VLOA 3FHZA 3S17K 4A3EK 1TWGC 2WAQD 4OIRA 3S1QC 1IL2A 2PMZL 4BLAA 5DM7S 3S1MC 3S0XA 2NVQC 4A3LC 1I50A 4BXXC 3QX3A 2B63K 2R7ZC 1I3QK 2GAGC 3RZOK 2E2HC 4KARA 3Q3QA 3N0BA 3GSIA 5C4XK 1I6HC 3BP3A 4KM8A 5TMFA 1ZQ1C 2Y0SD 4C3IK 4KC6A 4XLPA 2JA8K 3GTKK 5IYCK 4BBRK 4WJ3M 4LQYA 4XLNA 2NVTC 2WAQL 3HOYC 1L0WA 2WB1D 1TWGA 3OREA 2GSOA 3S2DC 4A3JK 4X6AC 1G51A 3JSTA 2NVXK 1Y1WA 4QIWD 5IP9K 2GAHC 3HKZD 3CQZC 5CHPA 3A8JA 2PPBA 2O5JA 1XXBA 1VJEA 1TWHA 5IOQA 1ISEA 1TWCA 4FZBA 2E2HK 3GTOK 4LK0A 2NVYK 1VH2A 3S16K 2A68A 4KB2A 2JA7A 1WOPA 3H0GC 3H3VL 5D4DA 1JQWA 1O27A 3TFHA 1FEUA 2L3UA 1YNNA 5JVHS 2JA5C 3HXAA 1ZXOA 1HQMA 2NVXC 3SZZA 2JA7K 4C45A 2R92K 5M5YK 1PJ5A 3T00A 2XCOA 3CAGA 3GTKC 3H0GK 1I6HK 1K83A 1IBAA 4LOWA 4KMUA 1WOOA 3HOVC 5HL8A 1O2AA 4A3CC 4OIOA 1JVIA 5IYBC 4AH6A 4G0UA 4BY7C 3I4NK 2PHCB 4GTFA 4KAWX 3GDZA 4AYBL 5IOSA 2YU9K 4YFKA 4KMHA 2L5NA 1HI9A 4P5BA 3N0CA 4GTCA 2W7VA 1AB4A 1UV7A 4BY1C 1SFOK 4GT9A 2RGRA 1DCOA 3S15K 3GTJA 1I50K 4GTLA 3BP8C 4KMDA 4A3DK 3PO2K 4G7OA 4AYBD 4G7ZA 3GTQA 4Y52K 1X31C 2P8TA 3L4KA 3S1RC 4XSXA 3FOFA 1J98A 1K83C 3A8IA 2FQOA 3GTMK 1DCPA 2VUMK 3FKIC 3M3YC 1O2BA 4XSZA 2CFAA 4Q5SA 4C3HC 3FOEA 4A3FC 1F7UA 2E2IK 2NVQK 5C3EC 4OIQA 1O2FB 3LAPA 3PO3C 3GTGC 4YG2A 1BS2A 4P5AA 1BGWA 3OPFA 1I50C 3HOUC 4A3DC 1Y1VK 4DDQA 2A6HA 1O29A 3L4JA 3GTLK 3GTMC 3T01A 1C0AA 4OIPA 1K83K 5JFEA 4KB4A 5JVOA 3S1RK 4LJZA 2NVTK 4LK1A 3PO2C 4C3JK 3GTPK 4YFNA 4O2DA 4XCHA 4GTBA 1YNJA 1YCLA 3A8KA 2B63A 3S1NC 5CJ9A 3GEIA 3AQPA 3GTLA 4J3NA 4PABA 4QJVB 5M3MK 3HOUK 3GTOA 4WFBS 1XZPA 2NVYA 4JK1A 1F7VA 3GTPA 3GTGA 5M5XK 1WCMK 3RZOC 3N3YA 2E2IA 4BBSC 4A3GC 1TWAA 1ZYRA 2VUMC 1WQGA 4IO9S 3H0GA 3EQLA 1DCHA 2CFAB 2Y0SL 3S2HK 1TWFC 4C3JC 3GTPC 1Y1VA 1WORA 2D6FC 4GFQA
chains in the Genus database with same CATH topology
3GTJC 2PMZD 4KMUA 4C2MC 4MEXA 4NOIA 2R93C 2YU9C 3HOVC 5IYDC 3K7AC 4A3CC 2O5IA 3S14C 4OIOA 1WCMC 4LLGA 5C44C 2R92C 5C4XC 3PO3K 3HOXC 3GTJK 2E2JK 3M4OC 3HKZL 2A69A 3S2HC 3I4MK 5IYBC 4Y52C 3PO2K 4A3CK 1Y1VC 4BY7C 3I4NK 4AYBL 4OINA 4A3LK 4A3BK 5C4JC 2PA8D 2YU9K 4YFKA 3S17K 3S1MK 5IP7K 4A3EK 1TWGC 4X6AK 3HOXK 2WAQD 1TWFK 4OIRA 1SFOK 4BY1C 3S1QC 2PMZL 4QJVA 2JA5K 5C44K 3S17C 3S1MC 3S15K 2NVQC 3S2DK 4A3LC 2JA6C 1I50K 4A3DK 1I6VA 4BXXC 4G7OA 3GTQK 4AYBD 1TWHC 4G7ZA 2R7ZC 1I3QK 1XPPA 2B63K 3WODA 2VUMK 3HOVK 3RZOK 2BE5A 3I4NC 2E2HC 3HOZC 4MQ9A 3S1NK 3M4OK 4BY7K 3S1RC 5C4XK 4XSXA 1SFOC 1I6HC 2E2JC 1K83C 4G7HA 4A3KC 4Y7NK 5TMFA 1TWAK 3GTMK 2B63C 5FLMC 2Y0SD 1TWHK 4C3IK 2A6EA 3FKIC 4XLPA 3M3YC 2JA8K 5IYCK 4BBRK 2JA6K 4C2MK 3GTKK 5M3FK 2CW0A 3DXJA 4XSZA 4XLNA 2NVTC 5M5WK 1I3QC 4C3HC 4Q5SA 2WAQL 2R7ZK 3HOYC 2WB1D 4KN7A 1TWCK 4A3FC 4QIWL 2NVYC 3S2DC 2E2IK 4A3JK 5C3EC 4OIQA 4X6AC 2NVQK 2WB1L 4A3MK 3I4MC 2NVXK 4QIWD 3H3VD 4A93C 5IP9K 1Y1WK 1R9TK 4BBSK 3HKZD 3CQZC 4YG2A 3GTGC 3PO3C 3GTLC 4A3FK 2PPBA 3S16C 2O5JA 1I50C 3RZDC 3HOUC 4Q4ZA 4A3DC 1Y1VK 4C3HK 3GTOC 2A6HA 1R9TC 4C3IC 2JA8C 4A3BC 4Y52K 4BBRC 5IYCC 4A3JC 3GTLK 4A3KK 4A3MC 3GTMC 5IP9C 1Y1WC 4OIPA 1K83K 1TWGK 2E2HK 3HOZK 3GTOK 4LK0A 3S1RK 2E2IC 2NVYK 1SMYA 4LJZA 2NVTK 1BDFA 3S16K 4LK1A 3GTQC 3PO2C 2A68A 3K7AK 1TWAC 4A3IC 4C3JK 3GTPK 5FJ8K 3CQZK 3GTGK 4YFNA 3H0GC 3H3VL 5D4DA 4ZH4A 1YNJA 3S14K 4Y7NC 3S1NC 1TWCC 2R93K 4QJVB 4GZYA 4A3GK 5M3MK 4KN4A 3FKIK 1YNNA 3RZDK 3HOUK 3M3YK 2JA5C 4JK1A 4YFXA 3S15C 1HQMA 3HOWK 2NVXC 1IW7A 3HOYK 4A93K 2JA7K 4MEYA 5M5XK 5IP7C 1WCMK 2R92K 5M5YK 5C3EK 3RZOC 5TMCA 4BXXK 5C4JK 4BBSC 4A3GC 5IYDK 2PA8L 2JA7C 1ZYRA 2VUMC 5FLMK 3GTKC 3EQLA 3H0GK 4BY1K 3HOWC 2Y0SL 3S2HK 3S1QK 1TWFC 1I6HK 5IYBK 4C3JC 3GTPC 4A3IK 4A3EC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GTJ C;  2PMZ D;  4KMU A;  4C2M C;  4MEX A;  4NOI A;  2R93 C;  2YU9 C;  3HOV C;  5IYD C;  3K7A C;  4A3C C;  2O5I A;  3S14 C;  4OIO A;  1WCM C;  4LLG A;  5C44 C;  2R92 C;  5C4X C;  3PO3 K;  3HOX C;  3GTJ K;  2E2J K;  3M4O C;  3HKZ L;  2A69 A;  3S2H C;  3I4M K;  5IYB C;  4Y52 C;  3PO2 K;  4A3C K;  1Y1V C;  4BY7 C;  3I4N K;  4AYB L;  4OIN A;  4A3L K;  4A3B K;  5C4J C;  2PA8 D;  2YU9 K;  4YFK A;  3S17 K;  3S1M K;  5IP7 K;  4A3E K;  1TWG C;  4X6A K;  3HOX K;  2WAQ D;  1TWF K;  4OIR A;  1SFO K;  4BY1 C;  3S1Q C;  2PMZ L;  4QJV A;  2JA5 K;  5C44 K;  3S17 C;  3S1M C;  3S15 K;  2NVQ C;  3S2D K;  4A3L C;  2JA6 C;  1I50 K;  4A3D K;  1I6V A;  4BXX C;  4G7O A;  3GTQ K;  4AYB D;  1TWH C;  4G7Z A;  2R7Z C;  1I3Q K;  1XPP A;  2B63 K;  3WOD A;  2VUM K;  3HOV K;  3RZO K;  2BE5 A;  3I4N C;  2E2H C;  3HOZ C;  4MQ9 A;  3S1N K;  3M4O K;  4BY7 K;  3S1R C;  5C4X K;  4XSX A;  1SFO C;  1I6H C;  2E2J C;  1K83 C;  4G7H A;  4A3K C;  4Y7N K;  5TMF A;  1TWA K;  3GTM K;  2B63 C;  5FLM C;  2Y0S D;  1TWH K;  4C3I K;  2A6E A;  3FKI C;  4XLP A;  3M3Y C;  2JA8 K;  5IYC K;  4BBR K;  2JA6 K;  4C2M K;  3GTK K;  5M3F K;  2CW0 A;  3DXJ A;  4XSZ A;  4XLN A;  2NVT C;  5M5W K;  1I3Q C;  4C3H C;  4Q5S A;  2WAQ L;  2R7Z K;  3HOY C;  2WB1 D;  4KN7 A;  1TWC K;  4A3F C;  4QIW L;  2NVY C;  3S2D C;  2E2I K;  4A3J K;  5C3E C;  4OIQ A;  4X6A C;  2NVQ K;  2WB1 L;  4A3M K;  3I4M C;  2NVX K;  4QIW D;  3H3V D;  4A93 C;  5IP9 K;  1Y1W K;  1R9T K;  4BBS K;  3HKZ D;  3CQZ C;  4YG2 A;  3GTG C;  3PO3 C;  3GTL C;  4A3F K;  2PPB A;  3S16 C;  2O5J A;  1I50 C;  3RZD C;  3HOU C;  4Q4Z A;  4A3D C;  1Y1V K;  4C3H K;  3GTO C;  2A6H A;  1R9T C;  4C3I C;  2JA8 C;  4A3B C;  4Y52 K;  4BBR C;  5IYC C;  4A3J C;  3GTL K;  4A3K K;  4A3M C;  3GTM C;  5IP9 C;  1Y1W C;  4OIP A;  1K83 K;  1TWG K;  2E2H K;  3HOZ K;  3GTO K;  4LK0 A;  3S1R K;  2E2I C;  2NVY K;  1SMY A;  4LJZ A;  2NVT K;  1BDF A;  3S16 K;  4LK1 A;  3GTQ C;  3PO2 C;  2A68 A;  3K7A K;  1TWA C;  4A3I C;  4C3J K;  3GTP K;  5FJ8 K;  3CQZ K;  3GTG K;  4YFN A;  3H0G C;  3H3V L;  5D4D A;  4ZH4 A;  1YNJ A;  3S14 K;  4Y7N C;  3S1N C;  1TWC C;  2R93 K;  4QJV B;  4GZY A;  4A3G K;  5M3M K;  4KN4 A;  3FKI K;  1YNN A;  3RZD K;  3HOU K;  3M3Y K;  2JA5 C;  4JK1 A;  4YFX A;  3S15 C;  1HQM A;  3HOW K;  2NVX C;  1IW7 A;  3HOY K;  4A93 K;  2JA7 K;  4MEY A;  5M5X K;  5IP7 C;  1WCM K;  2R92 K;  5M5Y K;  5C3E K;  3RZO C;  5TMC A;  4BXX K;  5C4J K;  4BBS C;  4A3G C;  5IYD K;  2PA8 L;  2JA7 C;  1ZYR A;  2VUM C;  5FLM K;  3GTK C;  3EQL A;  3H0G K;  4BY1 K;  3HOW C;  2Y0S L;  3S2H K;  3S1Q K;  1TWF C;  1I6H K;  5IYB K;  4C3J C;  3GTP C;  4A3I K;  4A3E C; 
#chains in the Genus database with same CATH topology
 1VGX A;  2YU9 C;  2ZJP S;  1USO A;  1VRQ C;  2O5I A;  5E68 A;  3S14 C;  5C44 C;  2R92 C;  5L46 A;  3GTJ K;  2RH6 A;  5DM6 S;  3M4O C;  3HKZ L;  3I4M K;  1PJ6 A;  1Y1V C;  3PIP S;  4GTD A;  4A3L K;  1IS1 A;  1WIH A;  2R93 A;  4G0W A;  2FQT A;  3S1M K;  3AD8 C;  1V5V A;  4G0V A;  1ZVU A;  3S17 C;  3AQO A;  1EI6 A;  1IQ0 A;  3G4C A;  4A3C K;  3HOV K;  3WOD A;  2BE5 A;  4KDD A;  3S1N K;  3M4O K;  2KQ1 A;  4A3K C;  1TWA K;  1TWH K;  3S14 K;  1F93 A;  2JA6 K;  5M3F K;  2CW0 A;  5M5W K;  2R7Z A;  1TWC K;  4KN7 A;  5TJ3 A;  4QIW L;  2E2H A;  3VA7 A;  2WB1 L;  3I4M C;  4BBS K;  3GTL C;  3S16 C;  3RZD C;  4Q4Z A;  3GTO C;  1R9T C;  4C3I C;  2JA8 C;  4BBR C;  5IYC C;  1ZBS A;  4A3K K;  4A3M C;  1Y1W C;  1B4B A;  1TWG K;  3AH5 A;  4BKW A;  2E2I C;  1O28 A;  1SMY A;  4M1X A;  1BDF A;  1J6V A;  1J6X A;  5FJ8 K;  3CQZ K;  1WCM A;  5IOT A;  1KQ4 A;  4ZH4 A;  4Y7N C;  3AD7 C;  3SZY A;  1TWC C;  1WQH A;  3NUH A;  1WOS A;  2R93 K;  4KAT A;  4KN4 A;  3RZD K;  4RMF A;  3MML B;  4KAS A;  3GTK A;  4YFX A;  3S15 C;  1WSV A;  3HOY K;  3CQZ A;  3TTG A;  4MEY A;  5IP7 C;  1B4A A;  1IE0 A;  4KMA A;  3GEH A;  2KPU A;  2PA8 L;  4FM9 A;  1F9N A;  1O26 A;  4P9S A;  3S1Q K;  3HOW C;  1XZQ A;  5IYB K;  4A3E C;  2V6T A;  2PMZ D;  4C2M C;  4NOI A;  2JA6 A;  3CF5 S;  5IYD C;  1YX2 A;  2JA5 A;  1WCM C;  5JVG S;  3PO3 K;  4LR2 A;  2E2J K;  1EFW A;  4Y52 C;  4GTA A;  2XCQ A;  5IP7 K;  4X6A K;  3HOX K;  1WSR A;  1TWF K;  1SFO A;  4QJV A;  5HQH A;  2ZUF A;  2JA5 K;  3FKI A;  5C44 K;  4WJ4 A;  3TFI A;  3T02 A;  1XZP B;  3S2D K;  2JA6 C;  1I6V A;  3GTQ K;  1TWH C;  1XPP A;  1R9T A;  3I4N C;  3ADA C;  3HOZ C;  3GEE A;  4MQ9 A;  2ZUE A;  4BY7 K;  1DD5 A;  5HL7 S;  1SFO C;  2XCR B;  2E2J C;  3GIR A;  4G7H A;  4Y7N K;  4WFN S;  2B63 C;  5FLM C;  2A6E A;  4C2M K;  3DXJ A;  1O25 A;  4WFA S;  1I3Q C;  3LAJ A;  2R7Z K;  4KM9 A;  2NVY C;  4A3M K;  1INN A;  4WCE S;  3H3V D;  4A93 C;  1EH1 A;  4GTE A;  1Y1W K;  1R9T K;  1USM A;  4IOA S;  4A3F K;  2ZFZ A;  1XZQ B;  4C3H K;  3IPJ A;  4PAA A;  1EK8 A;  2KXY A;  2JH3 A;  2ZJR S;  4A3B C;  4A3J C;  1RU0 A;  5IP9 C;  3G4A A;  1XXC A;  4ILD A;  3HOZ K;  3TFJ A;  3GTQ C;  1I3Q A;  3K7A K;  1TWA C;  4A3I C;  3GTG K;  3BUE A;  2R92 A;  3V4G A;  4U67 S;  3DLL S;  3PIO S;  3GTM A;  1BJT A;  4BLB A;  2GSU A;  2V6U A;  5EGH A;  2YU9 A;  4GZY A;  4A3G K;  4IOC S;  3FKI K;  3OEP A;  3M3Y K;  1J6W A;  2VUM A;  1WQF A;  1TWF A;  2ZJQ S;  3HOW K;  1IW7 A;  2P5M A;  4A93 K;  5C3E K;  4WIL A;  3LYW A;  5TMC A;  4BXX K;  5C4J K;  5IYD K;  2Y3P A;  1EQR A;  2KWA A;  1GE9 A;  1O24 A;  2JA7 C;  2V6S A;  5FLM K;  4BY1 K;  1XXA A;  4A3I K;  3AD9 C;  3GTJ C;  4MEX A;  4WF9 S;  2R93 C;  3K7A C;  3ERE D;  3LPX A;  4LLG A;  5C4X C;  3HOX C;  2GSN A;  2A69 A;  3S2H C;  2NVX A;  5EGE A;  1JOE A;  2EBB A;  5IOR A;  1PJ7 A;  4OIN A;  4A3B K;  5C4J C;  2PA8 D;  1VLO A;  3FHZ A;  3S17 K;  4A3E K;  1TWG C;  2WAQ D;  4OIR A;  3S1Q C;  1IL2 A;  2PMZ L;  4BLA A;  5DM7 S;  3S1M C;  3S0X A;  2NVQ C;  4A3L C;  1I50 A;  4BXX C;  3QX3 A;  2B63 K;  2R7Z C;  1I3Q K;  2GAG C;  3RZO K;  2E2H C;  4KAR A;  3Q3Q A;  3N0B A;  3GSI A;  5C4X K;  1I6H C;  3BP3 A;  4KM8 A;  5TMF A;  1ZQ1 C;  2Y0S D;  4C3I K;  4KC6 A;  4XLP A;  2JA8 K;  3GTK K;  5IYC K;  4BBR K;  4WJ3 M;  4LQY A;  4XLN A;  2NVT C;  2WAQ L;  3HOY C;  1L0W A;  2WB1 D;  1TWG A;  3ORE A;  2GSO A;  3S2D C;  4A3J K;  4X6A C;  1G51 A;  3JST A;  2NVX K;  1Y1W A;  4QIW D;  5IP9 K;  2GAH C;  3HKZ D;  3CQZ C;  5CHP A;  3A8J A;  2PPB A;  2O5J A;  1XXB A;  1VJE A;  1TWH A;  5IOQ A;  1ISE A;  1TWC A;  4FZB A;  2E2H K;  3GTO K;  4LK0 A;  2NVY K;  1VH2 A;  3S16 K;  2A68 A;  4KB2 A;  2JA7 A;  1WOP A;  3H0G C;  3H3V L;  5D4D A;  1JQW A;  1O27 A;  3TFH A;  1FEU A;  2L3U A;  1YNN A;  5JVH S;  2JA5 C;  3HXA A;  1ZXO A;  1HQM A;  2NVX C;  3SZZ A;  2JA7 K;  4C45 A;  2R92 K;  5M5Y K;  1PJ5 A;  3T00 A;  2XCO A;  3CAG A;  3GTK C;  3H0G K;  1I6H K;  1K83 A;  1IBA A;  4LOW A;  4KMU A;  1WOO A;  3HOV C;  5HL8 A;  1O2A A;  4A3C C;  4OIO A;  1JVI A;  5IYB C;  4AH6 A;  4G0U A;  4BY7 C;  3I4N K;  2PHC B;  4GTF A;  4KAW X;  3GDZ A;  4AYB L;  5IOS A;  2YU9 K;  4YFK A;  4KMH A;  2L5N A;  1HI9 A;  4P5B A;  3N0C A;  4GTC A;  2W7V A;  1AB4 A;  1UV7 A;  4BY1 C;  1SFO K;  4GT9 A;  2RGR A;  1DCO A;  3S15 K;  3GTJ A;  1I50 K;  4GTL A;  3BP8 C;  4KMD A;  4A3D K;  3PO2 K;  4G7O A;  4AYB D;  4G7Z A;  3GTQ A;  4Y52 K;  1X31 C;  2P8T A;  3L4K A;  3S1R C;  4XSX A;  3FOF A;  1J98 A;  1K83 C;  3A8I A;  2FQO A;  3GTM K;  1DCP A;  2VUM K;  3FKI C;  3M3Y C;  1O2B A;  4XSZ A;  2CFA A;  4Q5S A;  4C3H C;  3FOE A;  4A3F C;  1F7U A;  2E2I K;  2NVQ K;  5C3E C;  4OIQ A;  1O2F B;  3LAP A;  3PO3 C;  3GTG C;  4YG2 A;  1BS2 A;  4P5A A;  1BGW A;  3OPF A;  1I50 C;  3HOU C;  4A3D C;  1Y1V K;  4DDQ A;  2A6H A;  1O29 A;  3L4J A;  3GTL K;  3GTM C;  3T01 A;  1C0A A;  4OIP A;  1K83 K;  5JFE A;  4KB4 A;  5JVO A;  3S1R K;  4LJZ A;  2NVT K;  4LK1 A;  3PO2 C;  4C3J K;  3GTP K;  4YFN A;  4O2D A;  4XCH A;  4GTB A;  1YNJ A;  1YCL A;  3A8K A;  2B63 A;  3S1N C;  5CJ9 A;  3GEI A;  3AQP A;  3GTL A;  4J3N A;  4PAB A;  4QJV B;  5M3M K;  3HOU K;  3GTO A;  4WFB S;  1XZP A;  2NVY A;  4JK1 A;  1F7V A;  3GTP A;  3GTG A;  5M5X K;  1WCM K;  3RZO C;  3N3Y A;  2E2I A;  4BBS C;  4A3G C;  1TWA A;  1ZYR A;  2VUM C;  1WQG A;  4IO9 S;  3H0G A;  3EQL A;  1DCH A;  2CFA B;  2Y0S L;  3S2H K;  1TWF C;  4C3J C;  3GTP C;  1Y1V A;  1WOR A;  2D6F C;  4GFQ A; 
#chains in the Genus database with same CATH homology
 3GTJ C;  2PMZ D;  4KMU A;  4C2M C;  4MEX A;  4NOI A;  2R93 C;  2YU9 C;  3HOV C;  5IYD C;  3K7A C;  4A3C C;  2O5I A;  3S14 C;  4OIO A;  1WCM C;  4LLG A;  5C44 C;  2R92 C;  5C4X C;  3PO3 K;  3HOX C;  3GTJ K;  2E2J K;  3M4O C;  3HKZ L;  2A69 A;  3S2H C;  3I4M K;  5IYB C;  4Y52 C;  3PO2 K;  4A3C K;  1Y1V C;  4BY7 C;  3I4N K;  4AYB L;  4OIN A;  4A3L K;  4A3B K;  5C4J C;  2PA8 D;  2YU9 K;  4YFK A;  3S17 K;  3S1M K;  5IP7 K;  4A3E K;  1TWG C;  4X6A K;  3HOX K;  2WAQ D;  1TWF K;  4OIR A;  1SFO K;  4BY1 C;  3S1Q C;  2PMZ L;  4QJV A;  2JA5 K;  5C44 K;  3S17 C;  3S1M C;  3S15 K;  2NVQ C;  3S2D K;  4A3L C;  2JA6 C;  1I50 K;  4A3D K;  1I6V A;  4BXX C;  4G7O A;  3GTQ K;  4AYB D;  1TWH C;  4G7Z A;  2R7Z C;  1I3Q K;  1XPP A;  2B63 K;  3WOD A;  2VUM K;  3HOV K;  3RZO K;  2BE5 A;  3I4N C;  2E2H C;  3HOZ C;  4MQ9 A;  3S1N K;  3M4O K;  4BY7 K;  3S1R C;  5C4X K;  4XSX A;  1SFO C;  1I6H C;  2E2J C;  1K83 C;  4G7H A;  4A3K C;  4Y7N K;  5TMF A;  1TWA K;  3GTM K;  2B63 C;  5FLM C;  2Y0S D;  1TWH K;  4C3I K;  2A6E A;  3FKI C;  4XLP A;  3M3Y C;  2JA8 K;  5IYC K;  4BBR K;  2JA6 K;  4C2M K;  3GTK K;  5M3F K;  2CW0 A;  3DXJ A;  4XSZ A;  4XLN A;  2NVT C;  5M5W K;  1I3Q C;  4C3H C;  4Q5S A;  2WAQ L;  2R7Z K;  3HOY C;  2WB1 D;  4KN7 A;  1TWC K;  4A3F C;  4QIW L;  2NVY C;  3S2D C;  2E2I K;  4A3J K;  5C3E C;  4OIQ A;  4X6A C;  2NVQ K;  2WB1 L;  4A3M K;  3I4M C;  2NVX K;  4QIW D;  3H3V D;  4A93 C;  5IP9 K;  1Y1W K;  1R9T K;  4BBS K;  3HKZ D;  3CQZ C;  4YG2 A;  3GTG C;  3PO3 C;  3GTL C;  4A3F K;  2PPB A;  3S16 C;  2O5J A;  1I50 C;  3RZD C;  3HOU C;  4Q4Z A;  4A3D C;  1Y1V K;  4C3H K;  3GTO C;  2A6H A;  1R9T C;  4C3I C;  2JA8 C;  4A3B C;  4Y52 K;  4BBR C;  5IYC C;  4A3J C;  3GTL K;  4A3K K;  4A3M C;  3GTM C;  5IP9 C;  1Y1W C;  4OIP A;  1K83 K;  1TWG K;  2E2H K;  3HOZ K;  3GTO K;  4LK0 A;  3S1R K;  2E2I C;  2NVY K;  1SMY A;  4LJZ A;  2NVT K;  1BDF A;  3S16 K;  4LK1 A;  3GTQ C;  3PO2 C;  2A68 A;  3K7A K;  1TWA C;  4A3I C;  4C3J K;  3GTP K;  5FJ8 K;  3CQZ K;  3GTG K;  4YFN A;  3H0G C;  3H3V L;  5D4D A;  4ZH4 A;  1YNJ A;  3S14 K;  4Y7N C;  3S1N C;  1TWC C;  2R93 K;  4QJV B;  4GZY A;  4A3G K;  5M3M K;  4KN4 A;  3FKI K;  1YNN A;  3RZD K;  3HOU K;  3M3Y K;  2JA5 C;  4JK1 A;  4YFX A;  3S15 C;  1HQM A;  3HOW K;  2NVX C;  1IW7 A;  3HOY K;  4A93 K;  2JA7 K;  4MEY A;  5M5X K;  5IP7 C;  1WCM K;  2R92 K;  5M5Y K;  5C3E K;  3RZO C;  5TMC A;  4BXX K;  5C4J K;  4BBS C;  4A3G C;  5IYD K;  2PA8 L;  2JA7 C;  1ZYR A;  2VUM C;  5FLM K;  3GTK C;  3EQL A;  3H0G K;  4BY1 K;  3HOW C;  2Y0S L;  3S2H K;  3S1Q K;  1TWF C;  1I6H K;  5IYB K;  4C3J C;  3GTP C;  4A3I K;  4A3E C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...