2A69A

Crystal structure of the t. thermophilus rna polymerase holoenzyme in complex with antibiotic rifapentin
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
229
structure length
229
Chain Sequence
MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Allosteric modulation of the RNA polymerase catalytic reaction is an essential component of transcription control by rifamycins.
pubmed doi rcsb
molecule tags Transferase
molecule keywords DNA-directed RNA polymerase alpha chain
total genus 40
structure length 229
sequence length 229
chains with identical sequence B, K, L
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2005-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01000 RNA_pol_A_bac RNA polymerase Rpb3/RpoA insert domain
A PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain
A PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.12 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 DNA-directed RNA polymerase, insert domain 2a69A02
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 2a69A01
1Y1VC 4YFKA 2E2JC 5TMCA 3PO3K 5C4JC 3GTQC 4BXXC 4BY7K 5IYCK 5M5XK 3M3YK 1SFOC 5FJ8K 3GTPK 5C3EK 1WCMK 2VUMK 5IP9C 3GTKC 4MEYA 5M3MK 4LLGA 3EQLA 4ZH4A 5M3FK 2E2HK 2YU9K 1SFOK 2A68A 2PA8D 3H0GK 5IP9K 3GTKK 2R7ZK 4G7ZA 3HOWC 4A3MC 3I4NK 3RZDC 4AYBD 3HOVK 2YU9C 3S2HC 1K83K 2B63K 1I50K 3H0GC 3I4MK 3PO3C 3HOUC 2E2JK 3WODA 4A3JK 3RZDK 2JA8K 3S16C 3M3YC 4Y52K 4A3KC 4GZYA 1I6HC 4QIWD 4OIOA 4BY1K 4OINA 4A3JC 2JA8C 4C3IK 3S16K 1HQMA 4C2MK 4G7OA 2NVTK 3HOWK 4NOIA 3GTJC 4YFNA 3S1QC 3S15C 4C2MC 1I50C 1ZYRA 2JA5C 1R9TC 3S2DC 2NVYC 4KMUA 3S15K 4KN7A 4A3GK 1R9TK 3I4NC 4BY7C 4A3MK 3GTQK 4BXXK 2NVYK 3HOVC 4AYBL 1WCMC 2BE5A 4OIQA 3HOXK 2WAQL 3K7AK 4BBRK 2E2HC 4MEXA 4C3HK 5C44K 3S1RK 4LJZA 4A3KK 3H3VD 4A3IC 3GTGC 3HOZC 3PO2C 4BBSC 5FLMC 1I3QK 5IP7K 4BBRC 3S2DK 4C3IC 4A93K 1TWCC 1TWHC 5C44C 2NVTC 3H3VL 2PMZL 4X6AK 3GTJK 4Y7NC 1TWGK 3S1MC 1TWCK 1TWHK 1XPPA 2E2IC 2NVQK 3HKZD 1YNJA 1I6HK 5IYDC 4Q5SA 2O5JA 3FKIC 3S1MK 3I4MC 4C3HC 1Y1WC 4A3IK 3GTGK 3GTMK 4A3LC 3HOZK 3PO2K 4BBSK 4XSXA 4A3BC 5M5YK 4XLNA 4C3JC 4A3DK 2A6EA 2JA6C 3HOXC 3S14C 4YFXA 2A6HA 1YNNA 1TWFC 3CQZK 3GTOK 4A3BK 2R93C 2NVQC 4G7HA 2R92K 3S17K 4A3GC 1SMYA 3FKIK 1I3QC 5IP7C 1I6VA 3S1NK 4A3CK 4QIWL 5C4JK 2R93K 1Y1WK 4OIRA 3HOYK 3RZOK 4A3LK 2CW0A 5C3EC 2VUMC 1TWGC 3K7AC 4Y7NK 4A3CC 4QJVA 3S1RC 3S2HK 2WB1L 2WB1D 4A3DC 4C3JK 4Q4ZA 2JA6K 5IYDK 4XLPA 3CQZC 4KN4A 2R7ZC 4A93C 1Y1VK 5FLMK 3S14K 3DXJA 3GTLC 5C4XK 2R92C 3S17C 4X6AC 3GTPC 4YG2A 5D4DA 2O5IA 3HOUK 3GTLK 4MQ9A 2A69A 2E2IK 5C4XC 3M4OC 3S1QK 2JA7C 3GTOC 5M5WK 4XSZA 4OIPA 4QJVB 3GTMC 1K83C 4A3EC 2B63C 1TWAK 2PA8L 4LK0A 4A3FK 2NVXC 3M4OK 2PMZD 3S1NC 5TMFA 1BDFA 4JK1A 5IYBC 2PPBA 4Y52C 2Y0SD 1TWAC 4A3FC 3HOYC 3RZOC 2Y0SL 4A3EK 2NVXK 1TWFK 2JA5K 4BY1C 3HKZL 5IYCC 5IYBK 4LK1A 2WAQD 1IW7A 2JA7K
chains in the Genus database with same CATH superfamily
5JVGS 1ISEA 5C4JC 4GTDA 3LYWA 1SFOC 1UV7A 4XCHA 1WCMK 4AH6A 4ZH4A 1IE0A 3HXAA 2R7ZA 4LR2A 3PIOS 3H0GK 4G7ZA 3I4NK 4KC6A 4AYBD 3S2HC 1RU0A 2B63K 3NUHA 1TWHA 2E2JK 3M3YC 4GZYA 5JVOA 3N0CA 4QIWD 4OINA 4A3JC 3CAGA 1TWFA 4C3IK 2NVTK 4GTLA 1XZPA 5HL7S 4YFNA 3QX3A 4KDDA 2JA5C 1BGWA 2RH6A 1EH1A 3JSTA 3S15K 2ZJPS 3V4GA 4P9SA 4A3GK 4BY7C 3GTQK 1XZQB 4KAWX 3K7AK 4MEXA 4A3KK 5CHPA 3HOZC 3T01A 3Q3QA 1I3QK 4A93K 1PJ6A 2GAHC 3SZYA 5C44C 3L4JA 3IPJA 2XCRB 3H3VL 2JA5A 3GTJK 4Y7NC 1TWGK 2P5MA 1XZPB 1TWHK 1XPPA 1TWGA 2E2IC 1YNJA 2P8TA 5DM7S 3N3YA 2ZJQS 4A3IK 1SFOA 4BBSK 4A3BC 2GSNA 2KQ1A 1F7UA 2A6EA 2JA6C 2JH3A 1DCOA 4YFXA 2A6HA 3T00A 3GTOK 2R93C 1J6WA 3GTOA 3N0BA 1SMYA 2V6UA 1XXCA 3G4AA 3S1NK 1EQRA 3A8IA 4OIRA 3S1RC 2KPUA 2JA6K 3CQZC 4KN4A 3AD7C 5FLMK 3DXJA 1IS1A 2ZJRS 5C4XK 2R92C 3S17C 4X6AC 2D6FC 3GTLA 2A69A 1Y1WA 3GTOC 3OREA 3GEHA 4WFBS 3AQOA 4WILA 4IO9S 5JFEA 2PA8L 3M4OK 4LK0A 1EFWA 1BDFA 4JK1A 2PPBA 4WCES 3FHZA 4C45A 5IYCC 4LK1A 2WAQD 4FM9A 3PO3K 3G4CA 3GTQC 4BY7K 1L0WA 1TWAA 3FOEA 1O24A 1F93A 3GTMA 2PA8D 5IP9K 2R7ZK 3HOWC 4LOWA 4O2DA 2YU9C 1XXAA 1DCPA 3GSIA 1GE9A 3H0GC 1TWCA 4KMHA 3PO3C 3WODA 1BJTA 4A3JK 3RZDK 3S16C 3S1QC 2XCOA 3LAJA 3S2DC 2NVYC 4KMUA 2L3UA 4KN7A 3DLLS 1WCMC 4OIQA 3HOXK 4KARA 4FZBA 4LJZA 4A3IC 3GTGA 1VJEA 2NVTC 2XCQA 2PMZL 4KASA 3FOFA 1TWCK 5IYDC 2O5JA 1WQGA 4C3HC 4WF9S 3PO2K 4XSXA 1J6VA 4XLNA 4C3JC 1JOEA 1USOA 3ERED 4KATA 2R92K 3S17K 1WOPA 1I3QC 4A3CK 4QIWL 5C4JK 4KB2A 4PABA 4A3LK 5C3EC 4GTCA 3K7AC 4ILDA 2WB1L 2WB1D 4C3JK 4Q4ZA 3CQZA 4J3NA 4G0UA 4KMAA 3GTPA 4KM9A 2E2HA 5D4DA 2O5IA 3GTLK 4MQ9A 4GTBA 5C4XC 2FQOA 3TFHA 5M5WK 2B63C 4IOCS 4A3FK 3S1NC 4P5BA 1BS2A 3GEIA 3S1QK 2Y0SL 3VA7A 3S2HK 3I4MC 1O2AA 4GT9A 5EGEA 2E2JC 1X31C 5M5XK 2VUMK 3GTKC 4MEYA 2EBBA 2ZUEA 3GDZA 2E2HK 1KQ4A 3A8KA 2A68A 1SFOK 2YU9K 1IBAA 1VH2A 3GTKK 1R9TA 3T02A 1YX2A 3HOVK 3I4MK 3HOUC 4Y52K 4A3KC 2JA8C 1J98A 3S16K 4GTEA 2JA6A 3HOWK 4NOIA 3GTJC 2GSUA 3S15C 4C2MC 1I50C 1ZYRA 4PAAA 3I4NC 4BXXK 3GTJA 2NVYK 3HOVC 4AYBL 4GTFA 2WAQL 1XZQA 2E2HC 4C3HK 4WFAS 3GTGC 3H3VD 3PO2C 5FLMC 5IP7K 3LAPA 4BBRC 1TWCC 1PJ5A 3OPFA 5L46A 3S1MC 1J6XA 1I50A 1K83A 3MMLB 3TFJA 1I6HK 4Q5SA 4BLAA 2Y3PA 4A3LC 1PJ7A 1HI9A 5M5YK 3CF5S 1O27A 5IOQA 1G51A 1F7VA 3HOXC 3TTGA 3AQPA 3CQZK 4A3BK 1YNNA 1ZQ1C 2GSOA 2NVQC 3LPXA 1I6VA 3TFIA 2VUMA 1ZVUA 2R93K 3HOYK 3RZOK 2VUMC 4WFNS 1TWGC 4Y7NK 1C0AA 5CJ9A 2ZUFA 5IYDK 4XLPA 4A93C 2R7ZC 3GTLC 1XXBA 3GTPC 1ZBSA 4YG2A 1O28A 3GTQA 2E2IK 1WORA 5E68A 4QJVB 3GTMC 1K83C 4A3EC 1TWAK 2PMZD 1VRQC 1TWAC 4A3EK 2V6TA 1TWFK 2JA5K 4BY1C 1B4AA 2ZFZA 5IYBK 1WIHA 2JA7A 1V5VA 3AD9C 1IW7A 1Y1VC 4YFKA 1USMA 2GAGC 2KXYA 5TMCA 1WOSA 4BXXC 5IYCK 3M3YK 5FJ8K 1O2FB 3GTPK 5C3EK 5IP9C 5M3MK 4LLGA 3EQLA 5M3FK 1DD5A 4G0VA 3AD8C 2E2IA 5IOSA 2YU9A 3BP3A 4A3MC 3RZDC 1JVIA 1WQFA 1K83K 1I50K 4P5AA 2JA8K 1WSVA 3OEPA 2R92A 1I6HC 1INNA 1B4BA 4BY1K 4OIOA 5EGHA 3GEEA 5HQHA 1HQMA 4C2MK 4G7OA 4GFQA 5HL8A 4KB4A 3L4KA 1DCHA 1EI6A 1O2BA 1O29A 1VLOA 1R9TC 1I3QA 2L5NA 1JQWA 3FKIA 5JVHS 2CFAA 1R9TK 4A3MK 3GTKA 4BLBA 2BE5A 1AB4A 1ZXOA 4BBRK 1WCMA 4WJ3M 4U67S 3S1RK 5C44K 2CFAB 4BBSC 1VGXA 4C3IC 3S2DK 1TWHC 4M1XA 4X6AK 3BP8C 4BKWA 1IL2A 2B63A 4RMFA 2NVQK 3HKZD 1Y1VA 1WSRA 3FKIC 4WJ4A 4KMDA 3S1MK 2PHCB 5DM6S 1Y1WC 3GTGK 3GTMK 3PIPS 3HOZK 4G0WA 4A3DK 4IOAS 1EK8A 3S14C 1TWFC 3ADAC 4G7HA 4DDQA 4A3GC 2KWAA 3FKIK 5IP7C 5TJ3A 2V6SA 1O26A 1FEUA 1Y1WK 3BUEA 2CW0A 3GIRA 4A3CC 4QJVA 4KM8A 4A3DC 3S14K 1Y1VK 2W7VA 2FQTA 4LQYA 1IQ0A 3HOUK 3H0GA 2NVYA 3M4OC 5IORA 2JA7C 4GTAA 4XSZA 1WQHA 4OIPA 3A8JA 3S0XA 3AH5A 2NVXC 5TMFA 1WOOA 1F9NA 5IYBC 3HOYC 3RZOC 4Y52C 2Y0SD 4A3FC 5IOTA 1O25A 2R93A 2NVXA 2NVXK 3HKZL 2RGRA 1YCLA 3SZZA 2JA7K
chains in the Genus database with same CATH topology
1Y1VC 4YFKA 2E2JC 5TMCA 3PO3K 5C4JC 3GTQC 4BXXC 4BY7K 5IYCK 5M5XK 3M3YK 1SFOC 5FJ8K 3GTPK 5C3EK 1WCMK 2VUMK 5IP9C 3GTKC 4MEYA 5M3MK 4LLGA 3EQLA 4ZH4A 5M3FK 2E2HK 2YU9K 1SFOK 2A68A 2PA8D 3H0GK 5IP9K 3GTKK 2R7ZK 4G7ZA 3HOWC 4A3MC 3I4NK 3RZDC 4AYBD 3HOVK 2YU9C 3S2HC 1K83K 2B63K 1I50K 3H0GC 3I4MK 3PO3C 3HOUC 2E2JK 3WODA 4A3JK 3RZDK 2JA8K 3S16C 3M3YC 4Y52K 4A3KC 4GZYA 1I6HC 4QIWD 4OIOA 4BY1K 4OINA 4A3JC 2JA8C 4C3IK 3S16K 1HQMA 4C2MK 4G7OA 2NVTK 3HOWK 4NOIA 3GTJC 4YFNA 3S1QC 3S15C 4C2MC 1I50C 1ZYRA 2JA5C 1R9TC 3S2DC 2NVYC 4KMUA 3S15K 4KN7A 4A3GK 1R9TK 3I4NC 4BY7C 4A3MK 3GTQK 4BXXK 2NVYK 3HOVC 4AYBL 1WCMC 2BE5A 4OIQA 3HOXK 2WAQL 3K7AK 4BBRK 2E2HC 4MEXA 4C3HK 5C44K 3S1RK 4LJZA 4A3KK 3H3VD 4A3IC 3GTGC 3HOZC 3PO2C 4BBSC 5FLMC 1I3QK 5IP7K 4BBRC 3S2DK 4C3IC 4A93K 1TWCC 1TWHC 5C44C 2NVTC 3H3VL 2PMZL 4X6AK 3GTJK 4Y7NC 1TWGK 3S1MC 1TWCK 1TWHK 1XPPA 2E2IC 2NVQK 3HKZD 1YNJA 1I6HK 5IYDC 4Q5SA 2O5JA 3FKIC 3S1MK 3I4MC 4C3HC 1Y1WC 4A3IK 3GTGK 3GTMK 4A3LC 3HOZK 3PO2K 4BBSK 4XSXA 4A3BC 5M5YK 4XLNA 4C3JC 4A3DK 2A6EA 2JA6C 3HOXC 3S14C 4YFXA 2A6HA 1YNNA 1TWFC 3CQZK 3GTOK 4A3BK 2R93C 2NVQC 4G7HA 2R92K 3S17K 4A3GC 1SMYA 3FKIK 1I3QC 5IP7C 1I6VA 3S1NK 4A3CK 4QIWL 5C4JK 2R93K 1Y1WK 4OIRA 3HOYK 3RZOK 4A3LK 2CW0A 5C3EC 2VUMC 1TWGC 3K7AC 4Y7NK 4A3CC 4QJVA 3S1RC 3S2HK 2WB1L 2WB1D 4A3DC 4C3JK 4Q4ZA 2JA6K 5IYDK 4XLPA 3CQZC 4KN4A 2R7ZC 4A93C 1Y1VK 5FLMK 3S14K 3DXJA 3GTLC 5C4XK 2R92C 3S17C 4X6AC 3GTPC 4YG2A 5D4DA 2O5IA 3HOUK 3GTLK 4MQ9A 2A69A 2E2IK 5C4XC 3M4OC 3S1QK 2JA7C 3GTOC 5M5WK 4XSZA 4OIPA 4QJVB 3GTMC 1K83C 4A3EC 2B63C 1TWAK 2PA8L 4LK0A 4A3FK 2NVXC 3M4OK 2PMZD 3S1NC 5TMFA 1BDFA 4JK1A 5IYBC 2PPBA 4Y52C 2Y0SD 1TWAC 4A3FC 3HOYC 3RZOC 2Y0SL 4A3EK 2NVXK 1TWFK 2JA5K 4BY1C 3HKZL 5IYCC 5IYBK 4LK1A 2WAQD 1IW7A 2JA7K
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y1V C;  4YFK A;  2E2J C;  5TMC A;  3PO3 K;  5C4J C;  3GTQ C;  4BXX C;  4BY7 K;  5IYC K;  5M5X K;  3M3Y K;  1SFO C;  5FJ8 K;  3GTP K;  5C3E K;  1WCM K;  2VUM K;  5IP9 C;  3GTK C;  4MEY A;  5M3M K;  4LLG A;  3EQL A;  4ZH4 A;  5M3F K;  2E2H K;  2YU9 K;  1SFO K;  2A68 A;  2PA8 D;  3H0G K;  5IP9 K;  3GTK K;  2R7Z K;  4G7Z A;  3HOW C;  4A3M C;  3I4N K;  3RZD C;  4AYB D;  3HOV K;  2YU9 C;  3S2H C;  1K83 K;  2B63 K;  1I50 K;  3H0G C;  3I4M K;  3PO3 C;  3HOU C;  2E2J K;  3WOD A;  4A3J K;  3RZD K;  2JA8 K;  3S16 C;  3M3Y C;  4Y52 K;  4A3K C;  4GZY A;  1I6H C;  4QIW D;  4OIO A;  4BY1 K;  4OIN A;  4A3J C;  2JA8 C;  4C3I K;  3S16 K;  1HQM A;  4C2M K;  4G7O A;  2NVT K;  3HOW K;  4NOI A;  3GTJ C;  4YFN A;  3S1Q C;  3S15 C;  4C2M C;  1I50 C;  1ZYR A;  2JA5 C;  1R9T C;  3S2D C;  2NVY C;  4KMU A;  3S15 K;  4KN7 A;  4A3G K;  1R9T K;  3I4N C;  4BY7 C;  4A3M K;  3GTQ K;  4BXX K;  2NVY K;  3HOV C;  4AYB L;  1WCM C;  2BE5 A;  4OIQ A;  3HOX K;  2WAQ L;  3K7A K;  4BBR K;  2E2H C;  4MEX A;  4C3H K;  5C44 K;  3S1R K;  4LJZ A;  4A3K K;  3H3V D;  4A3I C;  3GTG C;  3HOZ C;  3PO2 C;  4BBS C;  5FLM C;  1I3Q K;  5IP7 K;  4BBR C;  3S2D K;  4C3I C;  4A93 K;  1TWC C;  1TWH C;  5C44 C;  2NVT C;  3H3V L;  2PMZ L;  4X6A K;  3GTJ K;  4Y7N C;  1TWG K;  3S1M C;  1TWC K;  1TWH K;  1XPP A;  2E2I C;  2NVQ K;  3HKZ D;  1YNJ A;  1I6H K;  5IYD C;  4Q5S A;  2O5J A;  3FKI C;  3S1M K;  3I4M C;  4C3H C;  1Y1W C;  4A3I K;  3GTG K;  3GTM K;  4A3L C;  3HOZ K;  3PO2 K;  4BBS K;  4XSX A;  4A3B C;  5M5Y K;  4XLN A;  4C3J C;  4A3D K;  2A6E A;  2JA6 C;  3HOX C;  3S14 C;  4YFX A;  2A6H A;  1YNN A;  1TWF C;  3CQZ K;  3GTO K;  4A3B K;  2R93 C;  2NVQ C;  4G7H A;  2R92 K;  3S17 K;  4A3G C;  1SMY A;  3FKI K;  1I3Q C;  5IP7 C;  1I6V A;  3S1N K;  4A3C K;  4QIW L;  5C4J K;  2R93 K;  1Y1W K;  4OIR A;  3HOY K;  3RZO K;  4A3L K;  2CW0 A;  5C3E C;  2VUM C;  1TWG C;  3K7A C;  4Y7N K;  4A3C C;  4QJV A;  3S1R C;  3S2H K;  2WB1 L;  2WB1 D;  4A3D C;  4C3J K;  4Q4Z A;  2JA6 K;  5IYD K;  4XLP A;  3CQZ C;  4KN4 A;  2R7Z C;  4A93 C;  1Y1V K;  5FLM K;  3S14 K;  3DXJ A;  3GTL C;  5C4X K;  2R92 C;  3S17 C;  4X6A C;  3GTP C;  4YG2 A;  5D4D A;  2O5I A;  3HOU K;  3GTL K;  4MQ9 A;  2A69 A;  2E2I K;  5C4X C;  3M4O C;  3S1Q K;  2JA7 C;  3GTO C;  5M5W K;  4XSZ A;  4OIP A;  4QJV B;  3GTM C;  1K83 C;  4A3E C;  2B63 C;  1TWA K;  2PA8 L;  4LK0 A;  4A3F K;  2NVX C;  3M4O K;  2PMZ D;  3S1N C;  5TMF A;  1BDF A;  4JK1 A;  5IYB C;  2PPB A;  4Y52 C;  2Y0S D;  1TWA C;  4A3F C;  3HOY C;  3RZO C;  2Y0S L;  4A3E K;  2NVX K;  1TWF K;  2JA5 K;  4BY1 C;  3HKZ L;  5IYC C;  5IYB K;  4LK1 A;  2WAQ D;  1IW7 A;  2JA7 K; 
#chains in the Genus database with same CATH topology
 5JVG S;  1ISE A;  5C4J C;  4GTD A;  3LYW A;  1SFO C;  1UV7 A;  4XCH A;  1WCM K;  4AH6 A;  4ZH4 A;  1IE0 A;  3HXA A;  2R7Z A;  4LR2 A;  3PIO S;  3H0G K;  4G7Z A;  3I4N K;  4KC6 A;  4AYB D;  3S2H C;  1RU0 A;  2B63 K;  3NUH A;  1TWH A;  2E2J K;  3M3Y C;  4GZY A;  5JVO A;  3N0C A;  4QIW D;  4OIN A;  4A3J C;  3CAG A;  1TWF A;  4C3I K;  2NVT K;  4GTL A;  1XZP A;  5HL7 S;  4YFN A;  3QX3 A;  4KDD A;  2JA5 C;  1BGW A;  2RH6 A;  1EH1 A;  3JST A;  3S15 K;  2ZJP S;  3V4G A;  4P9S A;  4A3G K;  4BY7 C;  3GTQ K;  1XZQ B;  4KAW X;  3K7A K;  4MEX A;  4A3K K;  5CHP A;  3HOZ C;  3T01 A;  3Q3Q A;  1I3Q K;  4A93 K;  1PJ6 A;  2GAH C;  3SZY A;  5C44 C;  3L4J A;  3IPJ A;  2XCR B;  3H3V L;  2JA5 A;  3GTJ K;  4Y7N C;  1TWG K;  2P5M A;  1XZP B;  1TWH K;  1XPP A;  1TWG A;  2E2I C;  1YNJ A;  2P8T A;  5DM7 S;  3N3Y A;  2ZJQ S;  4A3I K;  1SFO A;  4BBS K;  4A3B C;  2GSN A;  2KQ1 A;  1F7U A;  2A6E A;  2JA6 C;  2JH3 A;  1DCO A;  4YFX A;  2A6H A;  3T00 A;  3GTO K;  2R93 C;  1J6W A;  3GTO A;  3N0B A;  1SMY A;  2V6U A;  1XXC A;  3G4A A;  3S1N K;  1EQR A;  3A8I A;  4OIR A;  3S1R C;  2KPU A;  2JA6 K;  3CQZ C;  4KN4 A;  3AD7 C;  5FLM K;  3DXJ A;  1IS1 A;  2ZJR S;  5C4X K;  2R92 C;  3S17 C;  4X6A C;  2D6F C;  3GTL A;  2A69 A;  1Y1W A;  3GTO C;  3ORE A;  3GEH A;  4WFB S;  3AQO A;  4WIL A;  4IO9 S;  5JFE A;  2PA8 L;  3M4O K;  4LK0 A;  1EFW A;  1BDF A;  4JK1 A;  2PPB A;  4WCE S;  3FHZ A;  4C45 A;  5IYC C;  4LK1 A;  2WAQ D;  4FM9 A;  3PO3 K;  3G4C A;  3GTQ C;  4BY7 K;  1L0W A;  1TWA A;  3FOE A;  1O24 A;  1F93 A;  3GTM A;  2PA8 D;  5IP9 K;  2R7Z K;  3HOW C;  4LOW A;  4O2D A;  2YU9 C;  1XXA A;  1DCP A;  3GSI A;  1GE9 A;  3H0G C;  1TWC A;  4KMH A;  3PO3 C;  3WOD A;  1BJT A;  4A3J K;  3RZD K;  3S16 C;  3S1Q C;  2XCO A;  3LAJ A;  3S2D C;  2NVY C;  4KMU A;  2L3U A;  4KN7 A;  3DLL S;  1WCM C;  4OIQ A;  3HOX K;  4KAR A;  4FZB A;  4LJZ A;  4A3I C;  3GTG A;  1VJE A;  2NVT C;  2XCQ A;  2PMZ L;  4KAS A;  3FOF A;  1TWC K;  5IYD C;  2O5J A;  1WQG A;  4C3H C;  4WF9 S;  3PO2 K;  4XSX A;  1J6V A;  4XLN A;  4C3J C;  1JOE A;  1USO A;  3ERE D;  4KAT A;  2R92 K;  3S17 K;  1WOP A;  1I3Q C;  4A3C K;  4QIW L;  5C4J K;  4KB2 A;  4PAB A;  4A3L K;  5C3E C;  4GTC A;  3K7A C;  4ILD A;  2WB1 L;  2WB1 D;  4C3J K;  4Q4Z A;  3CQZ A;  4J3N A;  4G0U A;  4KMA A;  3GTP A;  4KM9 A;  2E2H A;  5D4D A;  2O5I A;  3GTL K;  4MQ9 A;  4GTB A;  5C4X C;  2FQO A;  3TFH A;  5M5W K;  2B63 C;  4IOC S;  4A3F K;  3S1N C;  4P5B A;  1BS2 A;  3GEI A;  3S1Q K;  2Y0S L;  3VA7 A;  3S2H K;  3I4M C;  1O2A A;  4GT9 A;  5EGE A;  2E2J C;  1X31 C;  5M5X K;  2VUM K;  3GTK C;  4MEY A;  2EBB A;  2ZUE A;  3GDZ A;  2E2H K;  1KQ4 A;  3A8K A;  2A68 A;  1SFO K;  2YU9 K;  1IBA A;  1VH2 A;  3GTK K;  1R9T A;  3T02 A;  1YX2 A;  3HOV K;  3I4M K;  3HOU C;  4Y52 K;  4A3K C;  2JA8 C;  1J98 A;  3S16 K;  4GTE A;  2JA6 A;  3HOW K;  4NOI A;  3GTJ C;  2GSU A;  3S15 C;  4C2M C;  1I50 C;  1ZYR A;  4PAA A;  3I4N C;  4BXX K;  3GTJ A;  2NVY K;  3HOV C;  4AYB L;  4GTF A;  2WAQ L;  1XZQ A;  2E2H C;  4C3H K;  4WFA S;  3GTG C;  3H3V D;  3PO2 C;  5FLM C;  5IP7 K;  3LAP A;  4BBR C;  1TWC C;  1PJ5 A;  3OPF A;  5L46 A;  3S1M C;  1J6X A;  1I50 A;  1K83 A;  3MML B;  3TFJ A;  1I6H K;  4Q5S A;  4BLA A;  2Y3P A;  4A3L C;  1PJ7 A;  1HI9 A;  5M5Y K;  3CF5 S;  1O27 A;  5IOQ A;  1G51 A;  1F7V A;  3HOX C;  3TTG A;  3AQP A;  3CQZ K;  4A3B K;  1YNN A;  1ZQ1 C;  2GSO A;  2NVQ C;  3LPX A;  1I6V A;  3TFI A;  2VUM A;  1ZVU A;  2R93 K;  3HOY K;  3RZO K;  2VUM C;  4WFN S;  1TWG C;  4Y7N K;  1C0A A;  5CJ9 A;  2ZUF A;  5IYD K;  4XLP A;  4A93 C;  2R7Z C;  3GTL C;  1XXB A;  3GTP C;  1ZBS A;  4YG2 A;  1O28 A;  3GTQ A;  2E2I K;  1WOR A;  5E68 A;  4QJV B;  3GTM C;  1K83 C;  4A3E C;  1TWA K;  2PMZ D;  1VRQ C;  1TWA C;  4A3E K;  2V6T A;  1TWF K;  2JA5 K;  4BY1 C;  1B4A A;  2ZFZ A;  5IYB K;  1WIH A;  2JA7 A;  1V5V A;  3AD9 C;  1IW7 A;  1Y1V C;  4YFK A;  1USM A;  2GAG C;  2KXY A;  5TMC A;  1WOS A;  4BXX C;  5IYC K;  3M3Y K;  5FJ8 K;  1O2F B;  3GTP K;  5C3E K;  5IP9 C;  5M3M K;  4LLG A;  3EQL A;  5M3F K;  1DD5 A;  4G0V A;  3AD8 C;  2E2I A;  5IOS A;  2YU9 A;  3BP3 A;  4A3M C;  3RZD C;  1JVI A;  1WQF A;  1K83 K;  1I50 K;  4P5A A;  2JA8 K;  1WSV A;  3OEP A;  2R92 A;  1I6H C;  1INN A;  1B4B A;  4BY1 K;  4OIO A;  5EGH A;  3GEE A;  5HQH A;  1HQM A;  4C2M K;  4G7O A;  4GFQ A;  5HL8 A;  4KB4 A;  3L4K A;  1DCH A;  1EI6 A;  1O2B A;  1O29 A;  1VLO A;  1R9T C;  1I3Q A;  2L5N A;  1JQW A;  3FKI A;  5JVH S;  2CFA A;  1R9T K;  4A3M K;  3GTK A;  4BLB A;  2BE5 A;  1AB4 A;  1ZXO A;  4BBR K;  1WCM A;  4WJ3 M;  4U67 S;  3S1R K;  5C44 K;  2CFA B;  4BBS C;  1VGX A;  4C3I C;  3S2D K;  1TWH C;  4M1X A;  4X6A K;  3BP8 C;  4BKW A;  1IL2 A;  2B63 A;  4RMF A;  2NVQ K;  3HKZ D;  1Y1V A;  1WSR A;  3FKI C;  4WJ4 A;  4KMD A;  3S1M K;  2PHC B;  5DM6 S;  1Y1W C;  3GTG K;  3GTM K;  3PIP S;  3HOZ K;  4G0W A;  4A3D K;  4IOA S;  1EK8 A;  3S14 C;  1TWF C;  3ADA C;  4G7H A;  4DDQ A;  4A3G C;  2KWA A;  3FKI K;  5IP7 C;  5TJ3 A;  2V6S A;  1O26 A;  1FEU A;  1Y1W K;  3BUE A;  2CW0 A;  3GIR A;  4A3C C;  4QJV A;  4KM8 A;  4A3D C;  3S14 K;  1Y1V K;  2W7V A;  2FQT A;  4LQY A;  1IQ0 A;  3HOU K;  3H0G A;  2NVY A;  3M4O C;  5IOR A;  2JA7 C;  4GTA A;  4XSZ A;  1WQH A;  4OIP A;  3A8J A;  3S0X A;  3AH5 A;  2NVX C;  5TMF A;  1WOO A;  1F9N A;  5IYB C;  3HOY C;  3RZO C;  4Y52 C;  2Y0S D;  4A3F C;  5IOT A;  1O25 A;  2R93 A;  2NVX A;  2NVX K;  3HKZ L;  2RGR A;  1YCL A;  3SZZ A;  2JA7 K; 
#chains in the Genus database with same CATH homology
 1Y1V C;  4YFK A;  2E2J C;  5TMC A;  3PO3 K;  5C4J C;  3GTQ C;  4BXX C;  4BY7 K;  5IYC K;  5M5X K;  3M3Y K;  1SFO C;  5FJ8 K;  3GTP K;  5C3E K;  1WCM K;  2VUM K;  5IP9 C;  3GTK C;  4MEY A;  5M3M K;  4LLG A;  3EQL A;  4ZH4 A;  5M3F K;  2E2H K;  2YU9 K;  1SFO K;  2A68 A;  2PA8 D;  3H0G K;  5IP9 K;  3GTK K;  2R7Z K;  4G7Z A;  3HOW C;  4A3M C;  3I4N K;  3RZD C;  4AYB D;  3HOV K;  2YU9 C;  3S2H C;  1K83 K;  2B63 K;  1I50 K;  3H0G C;  3I4M K;  3PO3 C;  3HOU C;  2E2J K;  3WOD A;  4A3J K;  3RZD K;  2JA8 K;  3S16 C;  3M3Y C;  4Y52 K;  4A3K C;  4GZY A;  1I6H C;  4QIW D;  4OIO A;  4BY1 K;  4OIN A;  4A3J C;  2JA8 C;  4C3I K;  3S16 K;  1HQM A;  4C2M K;  4G7O A;  2NVT K;  3HOW K;  4NOI A;  3GTJ C;  4YFN A;  3S1Q C;  3S15 C;  4C2M C;  1I50 C;  1ZYR A;  2JA5 C;  1R9T C;  3S2D C;  2NVY C;  4KMU A;  3S15 K;  4KN7 A;  4A3G K;  1R9T K;  3I4N C;  4BY7 C;  4A3M K;  3GTQ K;  4BXX K;  2NVY K;  3HOV C;  4AYB L;  1WCM C;  2BE5 A;  4OIQ A;  3HOX K;  2WAQ L;  3K7A K;  4BBR K;  2E2H C;  4MEX A;  4C3H K;  5C44 K;  3S1R K;  4LJZ A;  4A3K K;  3H3V D;  4A3I C;  3GTG C;  3HOZ C;  3PO2 C;  4BBS C;  5FLM C;  1I3Q K;  5IP7 K;  4BBR C;  3S2D K;  4C3I C;  4A93 K;  1TWC C;  1TWH C;  5C44 C;  2NVT C;  3H3V L;  2PMZ L;  4X6A K;  3GTJ K;  4Y7N C;  1TWG K;  3S1M C;  1TWC K;  1TWH K;  1XPP A;  2E2I C;  2NVQ K;  3HKZ D;  1YNJ A;  1I6H K;  5IYD C;  4Q5S A;  2O5J A;  3FKI C;  3S1M K;  3I4M C;  4C3H C;  1Y1W C;  4A3I K;  3GTG K;  3GTM K;  4A3L C;  3HOZ K;  3PO2 K;  4BBS K;  4XSX A;  4A3B C;  5M5Y K;  4XLN A;  4C3J C;  4A3D K;  2A6E A;  2JA6 C;  3HOX C;  3S14 C;  4YFX A;  2A6H A;  1YNN A;  1TWF C;  3CQZ K;  3GTO K;  4A3B K;  2R93 C;  2NVQ C;  4G7H A;  2R92 K;  3S17 K;  4A3G C;  1SMY A;  3FKI K;  1I3Q C;  5IP7 C;  1I6V A;  3S1N K;  4A3C K;  4QIW L;  5C4J K;  2R93 K;  1Y1W K;  4OIR A;  3HOY K;  3RZO K;  4A3L K;  2CW0 A;  5C3E C;  2VUM C;  1TWG C;  3K7A C;  4Y7N K;  4A3C C;  4QJV A;  3S1R C;  3S2H K;  2WB1 L;  2WB1 D;  4A3D C;  4C3J K;  4Q4Z A;  2JA6 K;  5IYD K;  4XLP A;  3CQZ C;  4KN4 A;  2R7Z C;  4A93 C;  1Y1V K;  5FLM K;  3S14 K;  3DXJ A;  3GTL C;  5C4X K;  2R92 C;  3S17 C;  4X6A C;  3GTP C;  4YG2 A;  5D4D A;  2O5I A;  3HOU K;  3GTL K;  4MQ9 A;  2A69 A;  2E2I K;  5C4X C;  3M4O C;  3S1Q K;  2JA7 C;  3GTO C;  5M5W K;  4XSZ A;  4OIP A;  4QJV B;  3GTM C;  1K83 C;  4A3E C;  2B63 C;  1TWA K;  2PA8 L;  4LK0 A;  4A3F K;  2NVX C;  3M4O K;  2PMZ D;  3S1N C;  5TMF A;  1BDF A;  4JK1 A;  5IYB C;  2PPB A;  4Y52 C;  2Y0S D;  1TWA C;  4A3F C;  3HOY C;  3RZO C;  2Y0S L;  4A3E K;  2NVX K;  1TWF K;  2JA5 K;  4BY1 C;  3HKZ L;  5IYC C;  5IYB K;  4LK1 A;  2WAQ D;  1IW7 A;  2JA7 K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...