5TMCA

Re-refinement of thermus thermopiles dna-directed rna polymerase structure
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
231
structure length
231
Chain Sequence
MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords DNA-directed RNA polymerase subunit alpha
publication title On the validation of crystallographic symmetry and the quality of structures.
pubmed doi rcsb
total genus 39
structure length 231
sequence length 231
chains with identical sequence B
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2016-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01000 RNA_pol_A_bac RNA polymerase Rpb3/RpoA insert domain
A PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain
A PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.12 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 DNA-directed RNA polymerase, insert domain 5tmcA02
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 5tmcA01
4BXXC 2WB1L 4A3IC 4A3EC 4BBRK 2JA5K 1SFOK 4XLNA 4ZH4A 2NVXC 2VUMC 3GTMK 1Y1WK 4C2MC 4C3IK 3HOYC 4C3JK 2BE5A 2JA7K 5FLMK 4A93C 2WAQD 5IYCC 1K83C 3S1RC 1XPPA 3PO2K 5IYDC 4QIWD 3CQZC 4YFNA 2R7ZK 3RZDC 2A68A 4BXXK 1BDFA 4A3FC 2PMZD 4OIOA 4Y52C 2A6EA 3HKZL 3M4OC 3M3YC 5C4XC 3S17C 4LK1A 3GTOC 3S1MC 3GTGC 3HOZK 4C2MK 4G7ZA 4A3KC 1Y1VC 2NVQC 3HOYK 3GTQK 3GTKC 4BY1C 5C3EK 4A3LC 5IYCK 4A93K 4BBSC 1TWGC 3S1RK 5IYDK 3CQZK 4OINA 5C44C 2B63K 1YNNA 4Q4ZA 1IW7A 1I3QC 3RZOC 4X6AC 5IYBC 3EQLA 3GTJK 4A3JC 3PO3K 4LK0A 4Y52K 1TWAC 3HOWK 3M4OK 3HOVC 2JA6C 1HQMA 3S2HC 4A3GC 2WAQL 5C4XK 4G7HA 2O5JA 4QIWL 4MQ9A 3GTOK 2YU9C 4A3BC 5M5WK 3GTGK 3S1MK 3S1QK 1TWFC 4MEYA 3WODA 4YFXA 2E2HC 5IP7C 4A3MC 2E2IC 1Y1VK 2PMZL 2E2JK 2NVQK 1I50C 4QJVB 3H3VD 4A3LK 1TWHC 5M5YK 4A3IK 4A3EK 4BBSK 1TWGK 3K7AC 5C44K 1SMYA 5IP9C 2NVXK 2NVYC 3HOXC 4Y7NC 3S1NC 5IYBK 2VUMK 4X6AK 3S14C 1TWCC 3S16C 4A3DC 1TWAK 3HOVK 3S2HK 4XLPA 4A3GK 4KN4A 3GTPC 1WCMC 4LLGA 4BY7C 4C3HC 1K83K 1R9TC 3I4NC 2R93C 1TWFK 3FKIC 2YU9K 4A3MK 2E2IK 3RZDK 4YG2A 3S2DC 4AYBD 3GTLC 1I50K 4A3CK 2JA8C 4A3FK 1TWHK 3HOUC 3M3YK 2O5IA 4KN7A 4QJVA 2NVYK 3HOXK 4Y7NK 1I6HC 3S17K 4C3IC 3S1NK 5M3MK 1TWCK 3S16K 4A3DK 4LJZA 4A3KK 3DXJA 2JA7C 3H3VL 5FLMC 2R92C 3GTPK 1WCMK 4GZYA 2Y0SD 4NOIA 4BY1K 3GTKK 4BY7K 4C3HK 1R9TK 2R93K 3FKIK 2PPBA 2R7ZC 5TMFA 4XSZA 3H0GC 1I3QK 3GTLK 3RZOK 3S2DK 1I6VA 2PA8D 4OIPA 4A3JK 5TMCA 2NVTC 2JA8K 2WB1D 3HOUK 4OIQA 4Q5SA 2JA6K 4KMUA 5C4JC 4MEXA 3HOZC 3I4MC 3S15C 4A3BK 1I6HK 1ZYRA 2E2HK 4AYBL 5IP7K 2A6HA 4A3CC 3GTQC 2R92K 5C3EC 4BBRC 4G7OA 2JA5C 5FJ8K 1SFOC 3K7AK 5D4DA 2B63C 2A69A 5IP9K 3GTMC 3GTJC 1Y1WC 3H0GK 3PO3C 3S14K 2NVTK 3HOWC 4YFKA 5M3FK 4C3JC 2Y0SL 5M5XK 5C4JK 3HKZD 4OIRA 3S1QC 3I4MK 3S15K 1YNJA 3PO2C 3I4NK 4JK1A 2E2JC 2CW0A 4XSXA 2PA8L
chains in the Genus database with same CATH superfamily
1B4AA 2WB1L 2KQ1A 5HQHA 1SFOK 1JOEA 2VUMC 2P5MA 1PJ5A 2BE5A 4DDQA 5IYCC 3S1RC 3PO2K 4QIWD 4BKWA 2B63A 3RZDC 3GTJA 4OIOA 4Y52C 3HKZL 3M4OC 5CHPA 1WQFA 4LK1A 3GTOC 3S1MC 3HOZK 4C2MK 4G7ZA 1XZQB 1J6WA 3HOYK 5DM6S 1TWGC 1J6XA 3GSIA 1DCHA 1IW7A 1USOA 1XZPA 3GEIA 1O25A 4LK0A 3IPJA 4ILDA 1TWAC 1WOSA 1HQMA 4P9SA 5C4XK 2YU9C 4A3BC 5M5WK 3GTGK 1TWFA 2E2HC 1VLOA 2E2IC 1Y1VK 4LOWA 4QJVB 4A3LK 4GTFA 1GE9A 2NVYC 2VUMK 5JVHS 4A3DC 1WORA 1TWCA 3S2HK 4A3GK 1WCMC 5E68A 4LLGA 4C3HC 1R9TC 1DCPA 4KM8A 4A3MK 4WFBS 3RZDK 1I3QA 4AYBD 3GTLA 4KMHA 3N3YA 1TWHK 3MMLB 1G51A 4WJ3M 2JA6A 3S1NK 4Y7NK 2KXYA 1I6HC 4XCHA 3DXJA 2R92A 4GZYA 2Y0SD 4BLAA 2R93K 4KDDA 1EQRA 4XSZA 3TTGA 3H0GA 3SZYA 2NVTC 3OEPA 4OIQA 4KMUA 2KWAA 4A3BK 2XCOA 2E2HK 3A8KA 2A6HA 3FOFA 2Y3PA 5FJ8K 1SFOC 2B63C 4GTCA 2A69A 3GTMA 3GTJC 1Y1WA 3PO3C 1ZVUA 1PJ7A 1L0WA 3S1QC 1IQ0A 3PO2C 2L3UA 2ZJQS 2E2JC 2R7ZA 3ADAC 3BP3A 4A3IC 1JQWA 2JH3A 3CAGA 2JA5K 4ZH4A 2NVXC 3GDZA 4KATA 4C2MC 2ZUEA 3HOYC 1V5VA 2WAQD 4IO9S 3CQZA 3A8IA 2A68A 1BDFA 2PMZD 2A6EA 1XZQA 5C4XC 1WOPA 3S17C 4AH6A 3GTGC 3TFJA 5IOSA 1Y1VC 4A93K 4A3LC 1XXCA 2B63K 1I3QC 5HL7S 3GTJK 3EQLA 4A3JC 1KQ4A 3PO3K 3S2HC 2JA6C 4A3GC 5EGHA 3S1QK 4MEYA 4A3MC 2E2JK 1I50A 2EBBA 3N0BA 1TWHC 5M5YK 4A3IK 4BBSK 3K7AC 2ZUFA 2L5NA 5C44K 1XXAA 5IP9C 3OPFA 2NVXK 4WCES 3S1NC 4Y7NC 1O24A 3HOVK 1F9NA 3GTPA 3GTKA 2RH6A 2R93C 1TWFK 3FKIA 4YG2A 1JVIA 3LAJA 3ERED 1BJTA 4LR2A 2GSOA 2GSNA 3S17K 3AQPA 2XCQA 4KB4A 4P5BA 1TWCK 3S16K 4LJZA 4P5AA 3H3VL 1F7UA 5FLMC 1WSRA 3TFIA 4BY7K 3L4KA 4IOCS 2PPBA 2R7ZC 1DD5A 1I3QK 2P8TA 3GTLK 3S2DK 1WIHA 1I6VA 4OIPA 4A3JK 2WB1D 4PAAA 1EFWA 2JA6K 1O2AA 5JVOA 4MEXA 4KASA 1ZQ1C 1ZYRA 3AD8C 2R92K 5C3EC 2W7VA 2JA5C 3K7AK 5D4DA 4G0VA 5IP9K 3JSTA 3H0GK 2ZFZA 4YFKA 5M3FK 2JA7A 5C4JK 3HKZD 1F93A 3I4MK 4JK1A 4XSXA 2PA8L 1YX2A 1WQGA 3AD7C 4A3EC 4KB2A 4BBRK 1O27A 4XLNA 3LAPA 3OREA 3GTMK 1Y1WK 4G0UA 2V6TA 3PIPS 3T02A 1O2BA 5FLMK 3GTQA 4A93C 1XZPB 1XPPA 4BLBA 4YFNA 2GSUA 2R7ZK 4BXXK 1X31C 1RU0A 3M3YC 1PJ6A 4WFAS 4IOAS 1INNA 3GTOA 4GFQA 4U67S 1VRQC 2KPUA 3GTKC 4BY1C 5C3EK 4BBSC 1BS2A 1TWGA 5IYDK 3CQZK 4OINA 5C44C 1YNNA 4Q4ZA 1USMA 1C0AA 3DLLS 1TWAA 3HOVC 3BP8C 1WQHA 2FQOA 4KAWX 1EK8A 4QIWL 5HL8A 2YU9A 1K83A 1TWFC 3WODA 3GEEA 5IP7C 2E2IA 2NVQK 2CFAB 1BGWA 1O28A 4FZBA 2GAGC 4GTLA 4A3EK 2V6UA 1SMYA 2NVYA 4X6AK 5IYBK 3S14C 1HI9A 1TWCC 3S16C 1UV7A 1WCMA 4FM9A 4BY7C 4GTAA 5CJ9A 1R9TA 4KARA 1IS1A 5IOTA 4GTDA 3S2DC 3GTLC 1I50K 2ZJPS 3FHZA 4PABA 3M3YK 4LQYA 2V6SA 4QJVA 3HOXK 4C3IC 1WSVA 5M3MK 2JA7C 2R92C 3Q3QA 3GTPK 1J6VA 4NOIA 4BY1K 3GTKK 1O26A 3CF5S 3FKIK 3T01A 3H0GC 2JA8K 5TMCA 3HOUK 4Q5SA 5C4JC 4G0WA 3I4MC 3G4AA 4AYBL 5IP7K 2GAHC 3GTQC 5IOQA 1J98A 5JFEA 4BBRC 1SFOA 4KMAA 1ZBSA 3GTMC 1Y1WC 1B4BA 3S14K 3HOWC 2Y0SL 5M5XK 4OIRA 3S15K 2CW0A 4A3CK 4BXXC 5TJ3A 3G4CA 2NVXA 4C3IK 2JA7K 4C3JK 5JVGS 1EI6A 1DCOA 4RMFA 3AH5A 1K83C 1ISEA 2D6FC 5IYDC 3CQZC 1YCLA 4KMDA 4A3FC 4J3NA 1FEUA 4O2DA 3GTGA 1IE0A 3L4JA 4A3KC 1Y1VA 2NVQC 3BUEA 2PHCB 3GTQK 5IYCK 5DM7S 3S1RK 3FOEA 4C45A 3RZOC 4X6AC 2VUMA 5IYBC 1ZXOA 4Y52K 3HOWK 3M4OK 2WAQL 2RGRA 2CFAA 4G7HA 2O5JA 1AB4A 3T00A 4MQ9A 3GTOK 3S1MK 4YFXA 3QX3A 3AQOA 2PMZL 4KM9A 1I50C 1F7VA 3H3VD 1TWHA 1TWGK 1XXBA 1O2FB 4KC6A 4GTBA 4M1XA 5EGEA 3HOXC 3TFHA 3VA7A 4WFNS 1TWAK 4XLPA 1VH2A 4KN4A 3GTPC 1O29A 2YU9K 1K83K 3I4NC 2R93A 3FKIC 4WF9S 2E2IK 2JA8C 4A3FK 4GT9A 3HOUC 2O5IA 1IBAA 4WILA 4KN7A 3N0CA 2NVYK 5IORA 1EH1A 1VJEA 4GTEA 3AD9C 4A3DK 3PIOS 4A3KK 2E2HA 1WCMK 3GEHA 3LPXA 5L46A 3NUHA 4C3HK 1IL2A 1R9TK 3V4GA 3GIRA 5TMFA 3SZZA 3RZOK 2PA8D 1WOOA 2XCRB 3LYWA 3HOZC 3S15C 1I6HK 3A8JA 4A3CC 4G7OA 2ZJRS 2JA5A 4WJ4A 3S0XA 2NVTK 3HXAA 4C3JC 2FQTA 1VGXA 1YNJA 3I4NK
chains in the Genus database with same CATH topology
4BXXC 2WB1L 4A3IC 4A3EC 4BBRK 2JA5K 1SFOK 4XLNA 4ZH4A 2NVXC 2VUMC 3GTMK 1Y1WK 4C2MC 4C3IK 3HOYC 4C3JK 2BE5A 2JA7K 5FLMK 4A93C 2WAQD 5IYCC 1K83C 3S1RC 1XPPA 3PO2K 5IYDC 4QIWD 3CQZC 4YFNA 2R7ZK 3RZDC 2A68A 4BXXK 1BDFA 4A3FC 2PMZD 4OIOA 4Y52C 2A6EA 3HKZL 3M4OC 3M3YC 5C4XC 3S17C 4LK1A 3GTOC 3S1MC 3GTGC 3HOZK 4C2MK 4G7ZA 4A3KC 1Y1VC 2NVQC 3HOYK 3GTQK 3GTKC 4BY1C 5C3EK 4A3LC 5IYCK 4A93K 4BBSC 1TWGC 3S1RK 5IYDK 3CQZK 4OINA 5C44C 2B63K 1YNNA 4Q4ZA 1IW7A 1I3QC 3RZOC 4X6AC 5IYBC 3EQLA 3GTJK 4A3JC 3PO3K 4LK0A 4Y52K 1TWAC 3HOWK 3M4OK 3HOVC 2JA6C 1HQMA 3S2HC 4A3GC 2WAQL 5C4XK 4G7HA 2O5JA 4QIWL 4MQ9A 3GTOK 2YU9C 4A3BC 5M5WK 3GTGK 3S1MK 3S1QK 1TWFC 4MEYA 3WODA 4YFXA 2E2HC 5IP7C 4A3MC 2E2IC 1Y1VK 2PMZL 2E2JK 2NVQK 1I50C 4QJVB 3H3VD 4A3LK 1TWHC 5M5YK 4A3IK 4A3EK 4BBSK 1TWGK 3K7AC 5C44K 1SMYA 5IP9C 2NVXK 2NVYC 3HOXC 4Y7NC 3S1NC 5IYBK 2VUMK 4X6AK 3S14C 1TWCC 3S16C 4A3DC 1TWAK 3HOVK 3S2HK 4XLPA 4A3GK 4KN4A 3GTPC 1WCMC 4LLGA 4BY7C 4C3HC 1K83K 1R9TC 3I4NC 2R93C 1TWFK 3FKIC 2YU9K 4A3MK 2E2IK 3RZDK 4YG2A 3S2DC 4AYBD 3GTLC 1I50K 4A3CK 2JA8C 4A3FK 1TWHK 3HOUC 3M3YK 2O5IA 4KN7A 4QJVA 2NVYK 3HOXK 4Y7NK 1I6HC 3S17K 4C3IC 3S1NK 5M3MK 1TWCK 3S16K 4A3DK 4LJZA 4A3KK 3DXJA 2JA7C 3H3VL 5FLMC 2R92C 3GTPK 1WCMK 4GZYA 2Y0SD 4NOIA 4BY1K 3GTKK 4BY7K 4C3HK 1R9TK 2R93K 3FKIK 2PPBA 2R7ZC 5TMFA 4XSZA 3H0GC 1I3QK 3GTLK 3RZOK 3S2DK 1I6VA 2PA8D 4OIPA 4A3JK 5TMCA 2NVTC 2JA8K 2WB1D 3HOUK 4OIQA 4Q5SA 2JA6K 4KMUA 5C4JC 4MEXA 3HOZC 3I4MC 3S15C 4A3BK 1I6HK 1ZYRA 2E2HK 4AYBL 5IP7K 2A6HA 4A3CC 3GTQC 2R92K 5C3EC 4BBRC 4G7OA 2JA5C 5FJ8K 1SFOC 3K7AK 5D4DA 2B63C 2A69A 5IP9K 3GTMC 3GTJC 1Y1WC 3H0GK 3PO3C 3S14K 2NVTK 3HOWC 4YFKA 5M3FK 4C3JC 2Y0SL 5M5XK 5C4JK 3HKZD 4OIRA 3S1QC 3I4MK 3S15K 1YNJA 3PO2C 3I4NK 4JK1A 2E2JC 2CW0A 4XSXA 2PA8L
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BXX C;  2WB1 L;  4A3I C;  4A3E C;  4BBR K;  2JA5 K;  1SFO K;  4XLN A;  4ZH4 A;  2NVX C;  2VUM C;  3GTM K;  1Y1W K;  4C2M C;  4C3I K;  3HOY C;  4C3J K;  2BE5 A;  2JA7 K;  5FLM K;  4A93 C;  2WAQ D;  5IYC C;  1K83 C;  3S1R C;  1XPP A;  3PO2 K;  5IYD C;  4QIW D;  3CQZ C;  4YFN A;  2R7Z K;  3RZD C;  2A68 A;  4BXX K;  1BDF A;  4A3F C;  2PMZ D;  4OIO A;  4Y52 C;  2A6E A;  3HKZ L;  3M4O C;  3M3Y C;  5C4X C;  3S17 C;  4LK1 A;  3GTO C;  3S1M C;  3GTG C;  3HOZ K;  4C2M K;  4G7Z A;  4A3K C;  1Y1V C;  2NVQ C;  3HOY K;  3GTQ K;  3GTK C;  4BY1 C;  5C3E K;  4A3L C;  5IYC K;  4A93 K;  4BBS C;  1TWG C;  3S1R K;  5IYD K;  3CQZ K;  4OIN A;  5C44 C;  2B63 K;  1YNN A;  4Q4Z A;  1IW7 A;  1I3Q C;  3RZO C;  4X6A C;  5IYB C;  3EQL A;  3GTJ K;  4A3J C;  3PO3 K;  4LK0 A;  4Y52 K;  1TWA C;  3HOW K;  3M4O K;  3HOV C;  2JA6 C;  1HQM A;  3S2H C;  4A3G C;  2WAQ L;  5C4X K;  4G7H A;  2O5J A;  4QIW L;  4MQ9 A;  3GTO K;  2YU9 C;  4A3B C;  5M5W K;  3GTG K;  3S1M K;  3S1Q K;  1TWF C;  4MEY A;  3WOD A;  4YFX A;  2E2H C;  5IP7 C;  4A3M C;  2E2I C;  1Y1V K;  2PMZ L;  2E2J K;  2NVQ K;  1I50 C;  4QJV B;  3H3V D;  4A3L K;  1TWH C;  5M5Y K;  4A3I K;  4A3E K;  4BBS K;  1TWG K;  3K7A C;  5C44 K;  1SMY A;  5IP9 C;  2NVX K;  2NVY C;  3HOX C;  4Y7N C;  3S1N C;  5IYB K;  2VUM K;  4X6A K;  3S14 C;  1TWC C;  3S16 C;  4A3D C;  1TWA K;  3HOV K;  3S2H K;  4XLP A;  4A3G K;  4KN4 A;  3GTP C;  1WCM C;  4LLG A;  4BY7 C;  4C3H C;  1K83 K;  1R9T C;  3I4N C;  2R93 C;  1TWF K;  3FKI C;  2YU9 K;  4A3M K;  2E2I K;  3RZD K;  4YG2 A;  3S2D C;  4AYB D;  3GTL C;  1I50 K;  4A3C K;  2JA8 C;  4A3F K;  1TWH K;  3HOU C;  3M3Y K;  2O5I A;  4KN7 A;  4QJV A;  2NVY K;  3HOX K;  4Y7N K;  1I6H C;  3S17 K;  4C3I C;  3S1N K;  5M3M K;  1TWC K;  3S16 K;  4A3D K;  4LJZ A;  4A3K K;  3DXJ A;  2JA7 C;  3H3V L;  5FLM C;  2R92 C;  3GTP K;  1WCM K;  4GZY A;  2Y0S D;  4NOI A;  4BY1 K;  3GTK K;  4BY7 K;  4C3H K;  1R9T K;  2R93 K;  3FKI K;  2PPB A;  2R7Z C;  5TMF A;  4XSZ A;  3H0G C;  1I3Q K;  3GTL K;  3RZO K;  3S2D K;  1I6V A;  2PA8 D;  4OIP A;  4A3J K;  5TMC A;  2NVT C;  2JA8 K;  2WB1 D;  3HOU K;  4OIQ A;  4Q5S A;  2JA6 K;  4KMU A;  5C4J C;  4MEX A;  3HOZ C;  3I4M C;  3S15 C;  4A3B K;  1I6H K;  1ZYR A;  2E2H K;  4AYB L;  5IP7 K;  2A6H A;  4A3C C;  3GTQ C;  2R92 K;  5C3E C;  4BBR C;  4G7O A;  2JA5 C;  5FJ8 K;  1SFO C;  3K7A K;  5D4D A;  2B63 C;  2A69 A;  5IP9 K;  3GTM C;  3GTJ C;  1Y1W C;  3H0G K;  3PO3 C;  3S14 K;  2NVT K;  3HOW C;  4YFK A;  5M3F K;  4C3J C;  2Y0S L;  5M5X K;  5C4J K;  3HKZ D;  4OIR A;  3S1Q C;  3I4M K;  3S15 K;  1YNJ A;  3PO2 C;  3I4N K;  4JK1 A;  2E2J C;  2CW0 A;  4XSX A;  2PA8 L; 
#chains in the Genus database with same CATH topology
 1B4A A;  2WB1 L;  2KQ1 A;  5HQH A;  1SFO K;  1JOE A;  2VUM C;  2P5M A;  1PJ5 A;  2BE5 A;  4DDQ A;  5IYC C;  3S1R C;  3PO2 K;  4QIW D;  4BKW A;  2B63 A;  3RZD C;  3GTJ A;  4OIO A;  4Y52 C;  3HKZ L;  3M4O C;  5CHP A;  1WQF A;  4LK1 A;  3GTO C;  3S1M C;  3HOZ K;  4C2M K;  4G7Z A;  1XZQ B;  1J6W A;  3HOY K;  5DM6 S;  1TWG C;  1J6X A;  3GSI A;  1DCH A;  1IW7 A;  1USO A;  1XZP A;  3GEI A;  1O25 A;  4LK0 A;  3IPJ A;  4ILD A;  1TWA C;  1WOS A;  1HQM A;  4P9S A;  5C4X K;  2YU9 C;  4A3B C;  5M5W K;  3GTG K;  1TWF A;  2E2H C;  1VLO A;  2E2I C;  1Y1V K;  4LOW A;  4QJV B;  4A3L K;  4GTF A;  1GE9 A;  2NVY C;  2VUM K;  5JVH S;  4A3D C;  1WOR A;  1TWC A;  3S2H K;  4A3G K;  1WCM C;  5E68 A;  4LLG A;  4C3H C;  1R9T C;  1DCP A;  4KM8 A;  4A3M K;  4WFB S;  3RZD K;  1I3Q A;  4AYB D;  3GTL A;  4KMH A;  3N3Y A;  1TWH K;  3MML B;  1G51 A;  4WJ3 M;  2JA6 A;  3S1N K;  4Y7N K;  2KXY A;  1I6H C;  4XCH A;  3DXJ A;  2R92 A;  4GZY A;  2Y0S D;  4BLA A;  2R93 K;  4KDD A;  1EQR A;  4XSZ A;  3TTG A;  3H0G A;  3SZY A;  2NVT C;  3OEP A;  4OIQ A;  4KMU A;  2KWA A;  4A3B K;  2XCO A;  2E2H K;  3A8K A;  2A6H A;  3FOF A;  2Y3P A;  5FJ8 K;  1SFO C;  2B63 C;  4GTC A;  2A69 A;  3GTM A;  3GTJ C;  1Y1W A;  3PO3 C;  1ZVU A;  1PJ7 A;  1L0W A;  3S1Q C;  1IQ0 A;  3PO2 C;  2L3U A;  2ZJQ S;  2E2J C;  2R7Z A;  3ADA C;  3BP3 A;  4A3I C;  1JQW A;  2JH3 A;  3CAG A;  2JA5 K;  4ZH4 A;  2NVX C;  3GDZ A;  4KAT A;  4C2M C;  2ZUE A;  3HOY C;  1V5V A;  2WAQ D;  4IO9 S;  3CQZ A;  3A8I A;  2A68 A;  1BDF A;  2PMZ D;  2A6E A;  1XZQ A;  5C4X C;  1WOP A;  3S17 C;  4AH6 A;  3GTG C;  3TFJ A;  5IOS A;  1Y1V C;  4A93 K;  4A3L C;  1XXC A;  2B63 K;  1I3Q C;  5HL7 S;  3GTJ K;  3EQL A;  4A3J C;  1KQ4 A;  3PO3 K;  3S2H C;  2JA6 C;  4A3G C;  5EGH A;  3S1Q K;  4MEY A;  4A3M C;  2E2J K;  1I50 A;  2EBB A;  3N0B A;  1TWH C;  5M5Y K;  4A3I K;  4BBS K;  3K7A C;  2ZUF A;  2L5N A;  5C44 K;  1XXA A;  5IP9 C;  3OPF A;  2NVX K;  4WCE S;  3S1N C;  4Y7N C;  1O24 A;  3HOV K;  1F9N A;  3GTP A;  3GTK A;  2RH6 A;  2R93 C;  1TWF K;  3FKI A;  4YG2 A;  1JVI A;  3LAJ A;  3ERE D;  1BJT A;  4LR2 A;  2GSO A;  2GSN A;  3S17 K;  3AQP A;  2XCQ A;  4KB4 A;  4P5B A;  1TWC K;  3S16 K;  4LJZ A;  4P5A A;  3H3V L;  1F7U A;  5FLM C;  1WSR A;  3TFI A;  4BY7 K;  3L4K A;  4IOC S;  2PPB A;  2R7Z C;  1DD5 A;  1I3Q K;  2P8T A;  3GTL K;  3S2D K;  1WIH A;  1I6V A;  4OIP A;  4A3J K;  2WB1 D;  4PAA A;  1EFW A;  2JA6 K;  1O2A A;  5JVO A;  4MEX A;  4KAS A;  1ZQ1 C;  1ZYR A;  3AD8 C;  2R92 K;  5C3E C;  2W7V A;  2JA5 C;  3K7A K;  5D4D A;  4G0V A;  5IP9 K;  3JST A;  3H0G K;  2ZFZ A;  4YFK A;  5M3F K;  2JA7 A;  5C4J K;  3HKZ D;  1F93 A;  3I4M K;  4JK1 A;  4XSX A;  2PA8 L;  1YX2 A;  1WQG A;  3AD7 C;  4A3E C;  4KB2 A;  4BBR K;  1O27 A;  4XLN A;  3LAP A;  3ORE A;  3GTM K;  1Y1W K;  4G0U A;  2V6T A;  3PIP S;  3T02 A;  1O2B A;  5FLM K;  3GTQ A;  4A93 C;  1XZP B;  1XPP A;  4BLB A;  4YFN A;  2GSU A;  2R7Z K;  4BXX K;  1X31 C;  1RU0 A;  3M3Y C;  1PJ6 A;  4WFA S;  4IOA S;  1INN A;  3GTO A;  4GFQ A;  4U67 S;  1VRQ C;  2KPU A;  3GTK C;  4BY1 C;  5C3E K;  4BBS C;  1BS2 A;  1TWG A;  5IYD K;  3CQZ K;  4OIN A;  5C44 C;  1YNN A;  4Q4Z A;  1USM A;  1C0A A;  3DLL S;  1TWA A;  3HOV C;  3BP8 C;  1WQH A;  2FQO A;  4KAW X;  1EK8 A;  4QIW L;  5HL8 A;  2YU9 A;  1K83 A;  1TWF C;  3WOD A;  3GEE A;  5IP7 C;  2E2I A;  2NVQ K;  2CFA B;  1BGW A;  1O28 A;  4FZB A;  2GAG C;  4GTL A;  4A3E K;  2V6U A;  1SMY A;  2NVY A;  4X6A K;  5IYB K;  3S14 C;  1HI9 A;  1TWC C;  3S16 C;  1UV7 A;  1WCM A;  4FM9 A;  4BY7 C;  4GTA A;  5CJ9 A;  1R9T A;  4KAR A;  1IS1 A;  5IOT A;  4GTD A;  3S2D C;  3GTL C;  1I50 K;  2ZJP S;  3FHZ A;  4PAB A;  3M3Y K;  4LQY A;  2V6S A;  4QJV A;  3HOX K;  4C3I C;  1WSV A;  5M3M K;  2JA7 C;  2R92 C;  3Q3Q A;  3GTP K;  1J6V A;  4NOI A;  4BY1 K;  3GTK K;  1O26 A;  3CF5 S;  3FKI K;  3T01 A;  3H0G C;  2JA8 K;  5TMC A;  3HOU K;  4Q5S A;  5C4J C;  4G0W A;  3I4M C;  3G4A A;  4AYB L;  5IP7 K;  2GAH C;  3GTQ C;  5IOQ A;  1J98 A;  5JFE A;  4BBR C;  1SFO A;  4KMA A;  1ZBS A;  3GTM C;  1Y1W C;  1B4B A;  3S14 K;  3HOW C;  2Y0S L;  5M5X K;  4OIR A;  3S15 K;  2CW0 A;  4A3C K;  4BXX C;  5TJ3 A;  3G4C A;  2NVX A;  4C3I K;  2JA7 K;  4C3J K;  5JVG S;  1EI6 A;  1DCO A;  4RMF A;  3AH5 A;  1K83 C;  1ISE A;  2D6F C;  5IYD C;  3CQZ C;  1YCL A;  4KMD A;  4A3F C;  4J3N A;  1FEU A;  4O2D A;  3GTG A;  1IE0 A;  3L4J A;  4A3K C;  1Y1V A;  2NVQ C;  3BUE A;  2PHC B;  3GTQ K;  5IYC K;  5DM7 S;  3S1R K;  3FOE A;  4C45 A;  3RZO C;  4X6A C;  2VUM A;  5IYB C;  1ZXO A;  4Y52 K;  3HOW K;  3M4O K;  2WAQ L;  2RGR A;  2CFA A;  4G7H A;  2O5J A;  1AB4 A;  3T00 A;  4MQ9 A;  3GTO K;  3S1M K;  4YFX A;  3QX3 A;  3AQO A;  2PMZ L;  4KM9 A;  1I50 C;  1F7V A;  3H3V D;  1TWH A;  1TWG K;  1XXB A;  1O2F B;  4KC6 A;  4GTB A;  4M1X A;  5EGE A;  3HOX C;  3TFH A;  3VA7 A;  4WFN S;  1TWA K;  4XLP A;  1VH2 A;  4KN4 A;  3GTP C;  1O29 A;  2YU9 K;  1K83 K;  3I4N C;  2R93 A;  3FKI C;  4WF9 S;  2E2I K;  2JA8 C;  4A3F K;  4GT9 A;  3HOU C;  2O5I A;  1IBA A;  4WIL A;  4KN7 A;  3N0C A;  2NVY K;  5IOR A;  1EH1 A;  1VJE A;  4GTE A;  3AD9 C;  4A3D K;  3PIO S;  4A3K K;  2E2H A;  1WCM K;  3GEH A;  3LPX A;  5L46 A;  3NUH A;  4C3H K;  1IL2 A;  1R9T K;  3V4G A;  3GIR A;  5TMF A;  3SZZ A;  3RZO K;  2PA8 D;  1WOO A;  2XCR B;  3LYW A;  3HOZ C;  3S15 C;  1I6H K;  3A8J A;  4A3C C;  4G7O A;  2ZJR S;  2JA5 A;  4WJ4 A;  3S0X A;  2NVT K;  3HXA A;  4C3J C;  2FQT A;  1VGX A;  1YNJ A;  3I4N K; 
#chains in the Genus database with same CATH homology
 4BXX C;  2WB1 L;  4A3I C;  4A3E C;  4BBR K;  2JA5 K;  1SFO K;  4XLN A;  4ZH4 A;  2NVX C;  2VUM C;  3GTM K;  1Y1W K;  4C2M C;  4C3I K;  3HOY C;  4C3J K;  2BE5 A;  2JA7 K;  5FLM K;  4A93 C;  2WAQ D;  5IYC C;  1K83 C;  3S1R C;  1XPP A;  3PO2 K;  5IYD C;  4QIW D;  3CQZ C;  4YFN A;  2R7Z K;  3RZD C;  2A68 A;  4BXX K;  1BDF A;  4A3F C;  2PMZ D;  4OIO A;  4Y52 C;  2A6E A;  3HKZ L;  3M4O C;  3M3Y C;  5C4X C;  3S17 C;  4LK1 A;  3GTO C;  3S1M C;  3GTG C;  3HOZ K;  4C2M K;  4G7Z A;  4A3K C;  1Y1V C;  2NVQ C;  3HOY K;  3GTQ K;  3GTK C;  4BY1 C;  5C3E K;  4A3L C;  5IYC K;  4A93 K;  4BBS C;  1TWG C;  3S1R K;  5IYD K;  3CQZ K;  4OIN A;  5C44 C;  2B63 K;  1YNN A;  4Q4Z A;  1IW7 A;  1I3Q C;  3RZO C;  4X6A C;  5IYB C;  3EQL A;  3GTJ K;  4A3J C;  3PO3 K;  4LK0 A;  4Y52 K;  1TWA C;  3HOW K;  3M4O K;  3HOV C;  2JA6 C;  1HQM A;  3S2H C;  4A3G C;  2WAQ L;  5C4X K;  4G7H A;  2O5J A;  4QIW L;  4MQ9 A;  3GTO K;  2YU9 C;  4A3B C;  5M5W K;  3GTG K;  3S1M K;  3S1Q K;  1TWF C;  4MEY A;  3WOD A;  4YFX A;  2E2H C;  5IP7 C;  4A3M C;  2E2I C;  1Y1V K;  2PMZ L;  2E2J K;  2NVQ K;  1I50 C;  4QJV B;  3H3V D;  4A3L K;  1TWH C;  5M5Y K;  4A3I K;  4A3E K;  4BBS K;  1TWG K;  3K7A C;  5C44 K;  1SMY A;  5IP9 C;  2NVX K;  2NVY C;  3HOX C;  4Y7N C;  3S1N C;  5IYB K;  2VUM K;  4X6A K;  3S14 C;  1TWC C;  3S16 C;  4A3D C;  1TWA K;  3HOV K;  3S2H K;  4XLP A;  4A3G K;  4KN4 A;  3GTP C;  1WCM C;  4LLG A;  4BY7 C;  4C3H C;  1K83 K;  1R9T C;  3I4N C;  2R93 C;  1TWF K;  3FKI C;  2YU9 K;  4A3M K;  2E2I K;  3RZD K;  4YG2 A;  3S2D C;  4AYB D;  3GTL C;  1I50 K;  4A3C K;  2JA8 C;  4A3F K;  1TWH K;  3HOU C;  3M3Y K;  2O5I A;  4KN7 A;  4QJV A;  2NVY K;  3HOX K;  4Y7N K;  1I6H C;  3S17 K;  4C3I C;  3S1N K;  5M3M K;  1TWC K;  3S16 K;  4A3D K;  4LJZ A;  4A3K K;  3DXJ A;  2JA7 C;  3H3V L;  5FLM C;  2R92 C;  3GTP K;  1WCM K;  4GZY A;  2Y0S D;  4NOI A;  4BY1 K;  3GTK K;  4BY7 K;  4C3H K;  1R9T K;  2R93 K;  3FKI K;  2PPB A;  2R7Z C;  5TMF A;  4XSZ A;  3H0G C;  1I3Q K;  3GTL K;  3RZO K;  3S2D K;  1I6V A;  2PA8 D;  4OIP A;  4A3J K;  5TMC A;  2NVT C;  2JA8 K;  2WB1 D;  3HOU K;  4OIQ A;  4Q5S A;  2JA6 K;  4KMU A;  5C4J C;  4MEX A;  3HOZ C;  3I4M C;  3S15 C;  4A3B K;  1I6H K;  1ZYR A;  2E2H K;  4AYB L;  5IP7 K;  2A6H A;  4A3C C;  3GTQ C;  2R92 K;  5C3E C;  4BBR C;  4G7O A;  2JA5 C;  5FJ8 K;  1SFO C;  3K7A K;  5D4D A;  2B63 C;  2A69 A;  5IP9 K;  3GTM C;  3GTJ C;  1Y1W C;  3H0G K;  3PO3 C;  3S14 K;  2NVT K;  3HOW C;  4YFK A;  5M3F K;  4C3J C;  2Y0S L;  5M5X K;  5C4J K;  3HKZ D;  4OIR A;  3S1Q C;  3I4M K;  3S15 K;  1YNJ A;  3PO2 C;  3I4N K;  4JK1 A;  2E2J C;  2CW0 A;  4XSX A;  2PA8 L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...