5TMCA

Re-refinement of thermus thermopiles dna-directed rna polymerase structure
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
231
structure length
231
Chain Sequence
b'MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase subunit alpha
publication title On the validation of crystallographic symmetry and the quality of structures.
pubmed doi rcsb
molecule tags Transferase
total genus 39
structure length 231
sequence length 231
chains with identical sequence B
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2016-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01000 RNA_pol_A_bac RNA polymerase Rpb3/RpoA insert domain
A PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain
A PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.12 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 DNA-directed RNA polymerase, insert domain 5tmcA02
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 5tmcA01
3K7AC 3HOVC 1I50C 2O5JA 3HOWC 4A3MC 5C44C 4KMUA 3GTOC 4XSXA 3GTJC 4A3IC 4QIWD 1IW7A 2JA7K 5D4DA 4BY1C 4A3EC 3S1MC 1WCMK 4A3DK 1TWGK 3S17C 1ZYRA 4MQ9A 2NVTC 4A3JC 4BY7C 2E2IC 3HOZK 2O5IA 4A93K 4XLNA 4YFNA 4OIQA 3S2DC 1SFOK 2Y0SD 2A68A 4A3FC 3H3VD 2PMZD 3HOYC 3HOVK 2R93K 1TWCK 4OIPA 4A3IK 5TMCA 5C4XK 3S2HC 4BY1K 5M5YK 5IP9C 1TWHK 1I3QK 4A3EK 5TMFA 3S1MK 2NVQK 3S17K 4A3DC 2NVTK 4BY7K 4NOIA 1TWGC 3I4MK 1K83C 3S2DK 3HOZC 3S16C 4GZYA 1TWFC 3HOXC 5FLMC 4X6AC 4KN7A 3GTLK 2R93C 4QIWL 2JA5K 4OINA 3S2HK 2R92C 1TWCC 2PA8L 5IP9K 1BDFA 2YU9K 5IYDK 5C4XC 4JK1A 2B63K 1XPPA 2E2HK 4BXXK 1TWHC 1I3QC 2NVQC 1K83K 2NVXK 3I4MC 3S16K 1TWFK 1R9TK 2Y0SL 3H3VL 2PMZL 3HOXK 5FLMK 3GTQK 2WB1D 4X6AK 4LK0A 3EQLA 3GTLC 3I4NC 2R92K 2JA5C 4LJZA 4QJVA 4C3IC 2YU9C 5C4JK 5IYDC 4Y52C 4XSZA 3DXJA 2B63C 2E2HC 4BXXC 4BBSC 3H0GK 2A6EA 4YG2A 4A3KK 2NVXC 1Y1WK 1R9TC 4A3BK 3FKIK 5IYCC 5IYBK 3GTQC 1YNJA 3I4NK 4C3IK 2BE5A 5FJ8K 4YFXA 2VUMC 3GTKK 4C2MK 4Y52K 4Q5SA 4LLGA 3M4OK 5C4JC 4MEYA 3HKZD 4BBSK 2A69A 3GTMC 4G7HA 3H0GC 2E2JC 5C3EC 2WB1L 4A3KC 3PO3C 1Y1WC 5IYCK 5IP7K 4YFKA 3S1RK 3S14C 4A3BC 3GTGK 3RZOK 3FKIC 5IYBC 4OIOA 4OIRA 2JA8C 4A3CC 2VUMK 3HOYK 1TWAK 4C3JK 1Y1VK 4C2MC 2NVYK 2WAQD 3GTMK 3M4OC 5M3MK 1HQMA 2E2JK 2CW0A 3GTPC 5C3EK 3PO3K 2A6HA 3RZDK 4AYBD 5IP7C 3GTKC 2PPBA 2JA6C 3S14K 4C3HK 5M5WK 3RZOC 3S1RC 3GTGC 4G7OA 2JA8K 4A3CK 2PA8D 4QJVB 3PO2K 4BBRK 1I6HK 2R7ZK 3CQZK 5M5XK 4A3GK 4ZH4A 3HKZL 1TWAC 3S1QC 4C3JC 5M3FK 4A3LK 3HOUK 1Y1VC 2NVYC 4G7ZA 3S1NC 4Y7NK 3K7AK 3GTPK 1I50K 3M3YC 1SMYA 3HOWK 4A3MK 5C44K 2JA6K 3GTOK 3GTJK 3RZDC 4LK1A 3S15K 3S15C 4MEXA 4C3HC 2JA7C 4KN4A 1WCMC 3WODA 4A3JK 3PO2C 1YNNA 2E2IK 3S1QK 4BBRC 1I6HC 2R7ZC 3CQZC 4A3GC 2WAQL 4Q4ZA 4A93C 4A3LC 1I6VA 1SFOC 4A3FK 3S1NK 3HOUC 4XLPA 4AYBL 3M3YK 4Y7NC
chains in the Genus database with same CATH superfamily
2ZJRS 3K7AC 1EQRA 1I50C 2P5MA 3GTOC 4G0VA 1WCMK 3N0CA 3S17C 4BY7C 2XCRB 4YFNA 4G0UA 4P5AA 3OREA 1TWCK 1USMA 1WOOA 5IP9C 2ZUFA 3S17K 4A3DC 4BY7K 3I4MK 3G4CA 1KQ4A 3HOZC 4GZYA 3AD8C 1TWFC 4DDQA 3ERED 2R93C 2JA5K 4OINA 5EGEA 1ISEA 5DM7S 5IP9K 2YU9K 5IYDK 1XPPA 4RMFA 2KXYA 2NVXK 3N0BA 1TWFK 2GSOA 1R9TK 1INNA 4WFNS 2WB1D 3GTLC 1O29A 3H0GA 4QJVA 4XSZA 3FKIA 5EGHA 1WQFA 4A3BK 3GTQC 2YU9A 1VRQC 1B4BA 1USOA 2BE5A 4YFXA 1J6WA 4KMDA 4LLGA 3M4OK 5C4JC 3GSIA 3FOFA 2Y3PA 4G7HA 5IP7K 4U67S 2VUMA 3JSTA 3A8IA 1Y1VA 4BKWA 3GTMA 4WF9S 5L46A 2ZJQS 2NVYK 1HQMA 3GTPC 3GTKC 3OPFA 2PPBA 2JA6C 3TFIA 2L3UA 3RZOC 3GTGC 5M5WK 4G7OA 4KB2A 1O2AA 3PO2K 2R7ZK 1O2FB 5CJ9A 5M5XK 4A3GK 1TWAC 4A3LK 1O27A 5TJ3A 4KMHA 3GTPK 2L5NA 2JA6K 5C44K 3GTJK 4PAAA 4LK1A 3S15C 4KMAA 2JA7C 4A3JK 1I6HC 3GEHA 4A93C 4KC6A 3HOUC 1J6XA 3OEPA 1O2BA 4P9SA 1TWGA 1ZQ1C 3HOWC 4A3MC 4WILA 4KMUA 3S15K 2JA7K 3T02A 4BY1C 1F93A 3SZZA 3S1MC 1EFWA 4MQ9A 3BP8C 2E2IC 4A93K 1WSRA 3BUEA 3HOYC 1TWHA 1I3QA 5TMCA 5C4XK 4BY1K 3S1MK 5TMFA 2NVQK 4NOIA 5IORA 3L4JA 4C45A 3S16C 4WJ3M 2V6UA 2B63A 2E2HA 4GTFA 1K83A 1TWCC 1ZVUA 3I4MC 3S16K 1IQ0A 2Y0SL 3H3VL 2R92A 2PMZL 1WIHA 1DD5A 3I4NC 2W7VA 3CAGA 2JA5C 4WCES 3TFHA 1Y1WA 5HL8A 2YU9C 5IYDC 4Y52C 3DXJA 1J98A 4BBSC 5IOQA 3H0GK 2NVXC 1R9TC 3FKIK 5IYBK 1YNJA 3I4NK 3MMLB 4KASA 2VUMC 3S0XA 4Y52K 2GAHC 4MEYA 4BBSK 4KDDA 3GTMC 3GEIA 2JH3A 1EI6A 4YFKA 2V6SA 4A3BC 2D6FC 1YX2A 2FQOA 4GFQA 1JQWA 2VUMK 1BGWA 3BP3A 4C3JK 1Y1VK 1WSVA 1WOSA 3GTMK 3M4OC 1G51A 5M3MK 1EH1A 2CW0A 2FQTA 5IP7C 2CFAB 5HL7S 1F9NA 1IL2A 1AB4A 1I50A 3HKZL 3S1QC 2NVYC 3S1NC 3FOEA 3AQPA 2V6TA 1FEUA 4M1XA 1DCPA 3PO2C 1YNNA 3S1QK 2WAQL 2R7ZC 4A3GC 1XZPB 4A3LC 3S1NK 4A3FK 5JVHS 3HOVC 3TTGA 5C44C 5E68A 3GTJC 3CF5S 4BLBA 1SFOA 1X31C 1TWGK 5IOSA 1WOPA 4GTLA 4A3JC 4GTDA 1GE9A 2O5IA 4XLNA 4OIQA 4KAWX 2Y0SD 2A68A 3H3VD 1F7UA 2PMZD 3HOVK 1PJ5A 3S2HC 5M5YK 1TWHK 1I3QK 5HQHA 4IOCS 1J6VA 3AD9C 3VA7A 4KM8A 1K83C 4GTAA 5CHPA 5FLMC 3LAPA 4X6AC 4KN7A 1UV7A 4QIWL 3S2HK 2R92C 3AH5A 3A8KA 3GDZA 4GTBA 5C4XC 2B63K 4BXXK 2E2HK 3GIRA 3GTQA 2NVQC 1K83K 1VLOA 4J3NA 5FLMK 4X6AK 4LK0A 4GTEA 3EQLA 2CFAA 2GSNA 2KWAA 2R92K 4LJZA 2A6EA 4YG2A 3ADAC 4A3KK 1Y1WK 5IYCC 4O2DA 2P8TA 1XXAA 1WQGA 4PABA 3GTKA 4C2MK 4Q5SA 2GSUA 3HKZD 3GTGA 2A69A 1XZPA 1PJ7A 3H0GC 5C3EC 2GAGC 3PO3C 5IYCK 1C0AA 3S1RK 3S14C 1TWAA 3FKIC 2RGRA 5IYBC 4OIOA 4GT9A 4OIRA 1B4AA 1XXCA 4A3CC 3PIPS 4ILDA 1F7VA 2WAQD 1ZXOA 5C3EK 3PO3K 2A6HA 1IS1A 4LOWA 3RZDK 3S14K 4IOAS 4C3HK 3QX3A 3PIOS 4A3CK 2PA8D 3L4KA 1L0WA 1WQHA 4BBRK 3CQZK 4XCHA 1IE0A 4LR2A 5M3FK 4C3JC 2ZJPS 1Y1VC 1PJ6A 4Y7NK 3K7AK 1BS2A 1I50K 1XZQB 1SMYA 3GTOK 2E2IA 4MEXA 2XCQA 4FM9A 3TFJA 3SZYA 4KN4A 1VH2A 3WODA 3NUHA 1VJEA 4KB4A 5DM6S 1I6VA 1SFOC 4XLPA 4AYBL 5JVGS 1WCMA 2O5JA 1ZBSA 3CQZA 4XSXA 4A3IC 4QIWD 1IW7A 5D4DA 4A3EC 1WORA 4A3DK 1ZYRA 2NVTC 3HOZK 5IOTA 3GTOA 4WFBS 3S2DC 1O28A 1TWCA 2XCOA 3T00A 5JVOA 1SFOK 1JOEA 3HXAA 4KM9A 4A3FC 2R93K 4P5BA 3AD7C 4OIPA 4A3IK 1O24A 1O25A 4A3EK 3N3YA 3FHZA 2NVTK 1TWGC 3S2DK 2JA5A 3GEEA 3T01A 3HOXC 1O26A 3GTLK 4G0WA 2NVXA 2PA8L 4FZBA 1BDFA 1TWFA 1R9TA 4JK1A 1TWHC 1I3QC 2R93A 3V4GA 4WJ4A 3HOXK 3GTQK 2KPUA 3A8JA 3AQOA 2RH6A 1JVIA 4C3IC 5C4JK 2B63C 4BXXC 2E2HC 3DLLS 3GTLA 3LYWA 1XZQA 4AH6A 1DCOA 1DCHA 2EBBA 1VGXA 4KATA 4C3IK 5FJ8K 4IO9S 4LQYA 1RU0A 2E2JC 2WB1L 3GTKK 4A3KC 1Y1WC 3RZOK 3GTGK 2NVYA 2JA8C 1TWAK 4KARA 2ZUEA 4C2MC 1BJTA 2E2JK 4WFAS 4AYBD 5JFEA 2R7ZA 3S1RC 3Q3QA 2JA8K 4QJVB 3GTPA 1I6HK 4ZH4A 1HI9A 1XXBA 2JA6A 3GTJA 3HOUK 3LPXA 2PHCB 4G7ZA 3M3YC 4GTCA 3HOWK 4A3MK 2KQ1A 1IBAA 3RZDC 1YCLA 4C3HC 3IPJA 1WCMC 3LAJA 1EK8A 2E2IK 4BBRC 2ZFZA 3CQZC 3G4AA 4BLAA 4Q4ZA 3HOYK 2JA7A 1V5VA 3M3YK 4Y7NC
chains in the Genus database with same CATH topology
3K7AC 3HOVC 1I50C 2O5JA 3HOWC 4A3MC 5C44C 4KMUA 3GTOC 4XSXA 3GTJC 4A3IC 4QIWD 1IW7A 2JA7K 5D4DA 4BY1C 4A3EC 3S1MC 1WCMK 4A3DK 1TWGK 3S17C 1ZYRA 4MQ9A 2NVTC 4A3JC 4BY7C 2E2IC 3HOZK 2O5IA 4A93K 4XLNA 4YFNA 4OIQA 3S2DC 1SFOK 2Y0SD 2A68A 4A3FC 3H3VD 2PMZD 3HOYC 3HOVK 2R93K 1TWCK 4OIPA 4A3IK 5TMCA 5C4XK 3S2HC 4BY1K 5M5YK 5IP9C 1TWHK 1I3QK 4A3EK 5TMFA 3S1MK 2NVQK 3S17K 4A3DC 2NVTK 4BY7K 4NOIA 1TWGC 3I4MK 1K83C 3S2DK 3HOZC 3S16C 4GZYA 1TWFC 3HOXC 5FLMC 4X6AC 4KN7A 3GTLK 2R93C 4QIWL 2JA5K 4OINA 3S2HK 2R92C 1TWCC 2PA8L 5IP9K 1BDFA 2YU9K 5IYDK 5C4XC 4JK1A 2B63K 1XPPA 2E2HK 4BXXK 1TWHC 1I3QC 2NVQC 1K83K 2NVXK 3I4MC 3S16K 1TWFK 1R9TK 2Y0SL 3H3VL 2PMZL 3HOXK 5FLMK 3GTQK 2WB1D 4X6AK 4LK0A 3EQLA 3GTLC 3I4NC 2R92K 2JA5C 4LJZA 4QJVA 4C3IC 2YU9C 5C4JK 5IYDC 4Y52C 4XSZA 3DXJA 2B63C 2E2HC 4BXXC 4BBSC 3H0GK 2A6EA 4YG2A 4A3KK 2NVXC 1Y1WK 1R9TC 4A3BK 3FKIK 5IYCC 5IYBK 3GTQC 1YNJA 3I4NK 4C3IK 2BE5A 5FJ8K 4YFXA 2VUMC 3GTKK 4C2MK 4Y52K 4Q5SA 4LLGA 3M4OK 5C4JC 4MEYA 3HKZD 4BBSK 2A69A 3GTMC 4G7HA 3H0GC 2E2JC 5C3EC 2WB1L 4A3KC 3PO3C 1Y1WC 5IYCK 5IP7K 4YFKA 3S1RK 3S14C 4A3BC 3GTGK 3RZOK 3FKIC 5IYBC 4OIOA 4OIRA 2JA8C 4A3CC 2VUMK 3HOYK 1TWAK 4C3JK 1Y1VK 4C2MC 2NVYK 2WAQD 3GTMK 3M4OC 5M3MK 1HQMA 2E2JK 2CW0A 3GTPC 5C3EK 3PO3K 2A6HA 3RZDK 4AYBD 5IP7C 3GTKC 2PPBA 2JA6C 3S14K 4C3HK 5M5WK 3RZOC 3S1RC 3GTGC 4G7OA 2JA8K 4A3CK 2PA8D 4QJVB 3PO2K 4BBRK 1I6HK 2R7ZK 3CQZK 5M5XK 4A3GK 4ZH4A 3HKZL 1TWAC 3S1QC 4C3JC 5M3FK 4A3LK 3HOUK 1Y1VC 2NVYC 4G7ZA 3S1NC 4Y7NK 3K7AK 3GTPK 1I50K 3M3YC 1SMYA 3HOWK 4A3MK 5C44K 2JA6K 3GTOK 3GTJK 3RZDC 4LK1A 3S15K 3S15C 4MEXA 4C3HC 2JA7C 4KN4A 1WCMC 3WODA 4A3JK 3PO2C 1YNNA 2E2IK 3S1QK 4BBRC 1I6HC 2R7ZC 3CQZC 4A3GC 2WAQL 4Q4ZA 4A93C 4A3LC 1I6VA 1SFOC 4A3FK 3S1NK 3HOUC 4XLPA 4AYBL 3M3YK 4Y7NC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K7A C;  3HOV C;  1I50 C;  2O5J A;  3HOW C;  4A3M C;  5C44 C;  4KMU A;  3GTO C;  4XSX A;  3GTJ C;  4A3I C;  4QIW D;  1IW7 A;  2JA7 K;  5D4D A;  4BY1 C;  4A3E C;  3S1M C;  1WCM K;  4A3D K;  1TWG K;  3S17 C;  1ZYR A;  4MQ9 A;  2NVT C;  4A3J C;  4BY7 C;  2E2I C;  3HOZ K;  2O5I A;  4A93 K;  4XLN A;  4YFN A;  4OIQ A;  3S2D C;  1SFO K;  2Y0S D;  2A68 A;  4A3F C;  3H3V D;  2PMZ D;  3HOY C;  3HOV K;  2R93 K;  1TWC K;  4OIP A;  4A3I K;  5TMC A;  5C4X K;  3S2H C;  4BY1 K;  5M5Y K;  5IP9 C;  1TWH K;  1I3Q K;  4A3E K;  5TMF A;  3S1M K;  2NVQ K;  3S17 K;  4A3D C;  2NVT K;  4BY7 K;  4NOI A;  1TWG C;  3I4M K;  1K83 C;  3S2D K;  3HOZ C;  3S16 C;  4GZY A;  1TWF C;  3HOX C;  5FLM C;  4X6A C;  4KN7 A;  3GTL K;  2R93 C;  4QIW L;  2JA5 K;  4OIN A;  3S2H K;  2R92 C;  1TWC C;  2PA8 L;  5IP9 K;  1BDF A;  2YU9 K;  5IYD K;  5C4X C;  4JK1 A;  2B63 K;  1XPP A;  2E2H K;  4BXX K;  1TWH C;  1I3Q C;  2NVQ C;  1K83 K;  2NVX K;  3I4M C;  3S16 K;  1TWF K;  1R9T K;  2Y0S L;  3H3V L;  2PMZ L;  3HOX K;  5FLM K;  3GTQ K;  2WB1 D;  4X6A K;  4LK0 A;  3EQL A;  3GTL C;  3I4N C;  2R92 K;  2JA5 C;  4LJZ A;  4QJV A;  4C3I C;  2YU9 C;  5C4J K;  5IYD C;  4Y52 C;  4XSZ A;  3DXJ A;  2B63 C;  2E2H C;  4BXX C;  4BBS C;  3H0G K;  2A6E A;  4YG2 A;  4A3K K;  2NVX C;  1Y1W K;  1R9T C;  4A3B K;  3FKI K;  5IYC C;  5IYB K;  3GTQ C;  1YNJ A;  3I4N K;  4C3I K;  2BE5 A;  5FJ8 K;  4YFX A;  2VUM C;  3GTK K;  4C2M K;  4Y52 K;  4Q5S A;  4LLG A;  3M4O K;  5C4J C;  4MEY A;  3HKZ D;  4BBS K;  2A69 A;  3GTM C;  4G7H A;  3H0G C;  2E2J C;  5C3E C;  2WB1 L;  4A3K C;  3PO3 C;  1Y1W C;  5IYC K;  5IP7 K;  4YFK A;  3S1R K;  3S14 C;  4A3B C;  3GTG K;  3RZO K;  3FKI C;  5IYB C;  4OIO A;  4OIR A;  2JA8 C;  4A3C C;  2VUM K;  3HOY K;  1TWA K;  4C3J K;  1Y1V K;  4C2M C;  2NVY K;  2WAQ D;  3GTM K;  3M4O C;  5M3M K;  1HQM A;  2E2J K;  2CW0 A;  3GTP C;  5C3E K;  3PO3 K;  2A6H A;  3RZD K;  4AYB D;  5IP7 C;  3GTK C;  2PPB A;  2JA6 C;  3S14 K;  4C3H K;  5M5W K;  3RZO C;  3S1R C;  3GTG C;  4G7O A;  2JA8 K;  4A3C K;  2PA8 D;  4QJV B;  3PO2 K;  4BBR K;  1I6H K;  2R7Z K;  3CQZ K;  5M5X K;  4A3G K;  4ZH4 A;  3HKZ L;  1TWA C;  3S1Q C;  4C3J C;  5M3F K;  4A3L K;  3HOU K;  1Y1V C;  2NVY C;  4G7Z A;  3S1N C;  4Y7N K;  3K7A K;  3GTP K;  1I50 K;  3M3Y C;  1SMY A;  3HOW K;  4A3M K;  5C44 K;  2JA6 K;  3GTO K;  3GTJ K;  3RZD C;  4LK1 A;  3S15 K;  3S15 C;  4MEX A;  4C3H C;  2JA7 C;  4KN4 A;  1WCM C;  3WOD A;  4A3J K;  3PO2 C;  1YNN A;  2E2I K;  3S1Q K;  4BBR C;  1I6H C;  2R7Z C;  3CQZ C;  4A3G C;  2WAQ L;  4Q4Z A;  4A93 C;  4A3L C;  1I6V A;  1SFO C;  4A3F K;  3S1N K;  3HOU C;  4XLP A;  4AYB L;  3M3Y K;  4Y7N C; 
#chains in the Genus database with same CATH topology
 2ZJR S;  3K7A C;  1EQR A;  1I50 C;  2P5M A;  3GTO C;  4G0V A;  1WCM K;  3N0C A;  3S17 C;  4BY7 C;  2XCR B;  4YFN A;  4G0U A;  4P5A A;  3ORE A;  1TWC K;  1USM A;  1WOO A;  5IP9 C;  2ZUF A;  3S17 K;  4A3D C;  4BY7 K;  3I4M K;  3G4C A;  1KQ4 A;  3HOZ C;  4GZY A;  3AD8 C;  1TWF C;  4DDQ A;  3ERE D;  2R93 C;  2JA5 K;  4OIN A;  5EGE A;  1ISE A;  5DM7 S;  5IP9 K;  2YU9 K;  5IYD K;  1XPP A;  4RMF A;  2KXY A;  2NVX K;  3N0B A;  1TWF K;  2GSO A;  1R9T K;  1INN A;  4WFN S;  2WB1 D;  3GTL C;  1O29 A;  3H0G A;  4QJV A;  4XSZ A;  3FKI A;  5EGH A;  1WQF A;  4A3B K;  3GTQ C;  2YU9 A;  1VRQ C;  1B4B A;  1USO A;  2BE5 A;  4YFX A;  1J6W A;  4KMD A;  4LLG A;  3M4O K;  5C4J C;  3GSI A;  3FOF A;  2Y3P A;  4G7H A;  5IP7 K;  4U67 S;  2VUM A;  3JST A;  3A8I A;  1Y1V A;  4BKW A;  3GTM A;  4WF9 S;  5L46 A;  2ZJQ S;  2NVY K;  1HQM A;  3GTP C;  3GTK C;  3OPF A;  2PPB A;  2JA6 C;  3TFI A;  2L3U A;  3RZO C;  3GTG C;  5M5W K;  4G7O A;  4KB2 A;  1O2A A;  3PO2 K;  2R7Z K;  1O2F B;  5CJ9 A;  5M5X K;  4A3G K;  1TWA C;  4A3L K;  1O27 A;  5TJ3 A;  4KMH A;  3GTP K;  2L5N A;  2JA6 K;  5C44 K;  3GTJ K;  4PAA A;  4LK1 A;  3S15 C;  4KMA A;  2JA7 C;  4A3J K;  1I6H C;  3GEH A;  4A93 C;  4KC6 A;  3HOU C;  1J6X A;  3OEP A;  1O2B A;  4P9S A;  1TWG A;  1ZQ1 C;  3HOW C;  4A3M C;  4WIL A;  4KMU A;  3S15 K;  2JA7 K;  3T02 A;  4BY1 C;  1F93 A;  3SZZ A;  3S1M C;  1EFW A;  4MQ9 A;  3BP8 C;  2E2I C;  4A93 K;  1WSR A;  3BUE A;  3HOY C;  1TWH A;  1I3Q A;  5TMC A;  5C4X K;  4BY1 K;  3S1M K;  5TMF A;  2NVQ K;  4NOI A;  5IOR A;  3L4J A;  4C45 A;  3S16 C;  4WJ3 M;  2V6U A;  2B63 A;  2E2H A;  4GTF A;  1K83 A;  1TWC C;  1ZVU A;  3I4M C;  3S16 K;  1IQ0 A;  2Y0S L;  3H3V L;  2R92 A;  2PMZ L;  1WIH A;  1DD5 A;  3I4N C;  2W7V A;  3CAG A;  2JA5 C;  4WCE S;  3TFH A;  1Y1W A;  5HL8 A;  2YU9 C;  5IYD C;  4Y52 C;  3DXJ A;  1J98 A;  4BBS C;  5IOQ A;  3H0G K;  2NVX C;  1R9T C;  3FKI K;  5IYB K;  1YNJ A;  3I4N K;  3MML B;  4KAS A;  2VUM C;  3S0X A;  4Y52 K;  2GAH C;  4MEY A;  4BBS K;  4KDD A;  3GTM C;  3GEI A;  2JH3 A;  1EI6 A;  4YFK A;  2V6S A;  4A3B C;  2D6F C;  1YX2 A;  2FQO A;  4GFQ A;  1JQW A;  2VUM K;  1BGW A;  3BP3 A;  4C3J K;  1Y1V K;  1WSV A;  1WOS A;  3GTM K;  3M4O C;  1G51 A;  5M3M K;  1EH1 A;  2CW0 A;  2FQT A;  5IP7 C;  2CFA B;  5HL7 S;  1F9N A;  1IL2 A;  1AB4 A;  1I50 A;  3HKZ L;  3S1Q C;  2NVY C;  3S1N C;  3FOE A;  3AQP A;  2V6T A;  1FEU A;  4M1X A;  1DCP A;  3PO2 C;  1YNN A;  3S1Q K;  2WAQ L;  2R7Z C;  4A3G C;  1XZP B;  4A3L C;  3S1N K;  4A3F K;  5JVH S;  3HOV C;  3TTG A;  5C44 C;  5E68 A;  3GTJ C;  3CF5 S;  4BLB A;  1SFO A;  1X31 C;  1TWG K;  5IOS A;  1WOP A;  4GTL A;  4A3J C;  4GTD A;  1GE9 A;  2O5I A;  4XLN A;  4OIQ A;  4KAW X;  2Y0S D;  2A68 A;  3H3V D;  1F7U A;  2PMZ D;  3HOV K;  1PJ5 A;  3S2H C;  5M5Y K;  1TWH K;  1I3Q K;  5HQH A;  4IOC S;  1J6V A;  3AD9 C;  3VA7 A;  4KM8 A;  1K83 C;  4GTA A;  5CHP A;  5FLM C;  3LAP A;  4X6A C;  4KN7 A;  1UV7 A;  4QIW L;  3S2H K;  2R92 C;  3AH5 A;  3A8K A;  3GDZ A;  4GTB A;  5C4X C;  2B63 K;  4BXX K;  2E2H K;  3GIR A;  3GTQ A;  2NVQ C;  1K83 K;  1VLO A;  4J3N A;  5FLM K;  4X6A K;  4LK0 A;  4GTE A;  3EQL A;  2CFA A;  2GSN A;  2KWA A;  2R92 K;  4LJZ A;  2A6E A;  4YG2 A;  3ADA C;  4A3K K;  1Y1W K;  5IYC C;  4O2D A;  2P8T A;  1XXA A;  1WQG A;  4PAB A;  3GTK A;  4C2M K;  4Q5S A;  2GSU A;  3HKZ D;  3GTG A;  2A69 A;  1XZP A;  1PJ7 A;  3H0G C;  5C3E C;  2GAG C;  3PO3 C;  5IYC K;  1C0A A;  3S1R K;  3S14 C;  1TWA A;  3FKI C;  2RGR A;  5IYB C;  4OIO A;  4GT9 A;  4OIR A;  1B4A A;  1XXC A;  4A3C C;  3PIP S;  4ILD A;  1F7V A;  2WAQ D;  1ZXO A;  5C3E K;  3PO3 K;  2A6H A;  1IS1 A;  4LOW A;  3RZD K;  3S14 K;  4IOA S;  4C3H K;  3QX3 A;  3PIO S;  4A3C K;  2PA8 D;  3L4K A;  1L0W A;  1WQH A;  4BBR K;  3CQZ K;  4XCH A;  1IE0 A;  4LR2 A;  5M3F K;  4C3J C;  2ZJP S;  1Y1V C;  1PJ6 A;  4Y7N K;  3K7A K;  1BS2 A;  1I50 K;  1XZQ B;  1SMY A;  3GTO K;  2E2I A;  4MEX A;  2XCQ A;  4FM9 A;  3TFJ A;  3SZY A;  4KN4 A;  1VH2 A;  3WOD A;  3NUH A;  1VJE A;  4KB4 A;  5DM6 S;  1I6V A;  1SFO C;  4XLP A;  4AYB L;  5JVG S;  1WCM A;  2O5J A;  1ZBS A;  3CQZ A;  4XSX A;  4A3I C;  4QIW D;  1IW7 A;  5D4D A;  4A3E C;  1WOR A;  4A3D K;  1ZYR A;  2NVT C;  3HOZ K;  5IOT A;  3GTO A;  4WFB S;  3S2D C;  1O28 A;  1TWC A;  2XCO A;  3T00 A;  5JVO A;  1SFO K;  1JOE A;  3HXA A;  4KM9 A;  4A3F C;  2R93 K;  4P5B A;  3AD7 C;  4OIP A;  4A3I K;  1O24 A;  1O25 A;  4A3E K;  3N3Y A;  3FHZ A;  2NVT K;  1TWG C;  3S2D K;  2JA5 A;  3GEE A;  3T01 A;  3HOX C;  1O26 A;  3GTL K;  4G0W A;  2NVX A;  2PA8 L;  4FZB A;  1BDF A;  1TWF A;  1R9T A;  4JK1 A;  1TWH C;  1I3Q C;  2R93 A;  3V4G A;  4WJ4 A;  3HOX K;  3GTQ K;  2KPU A;  3A8J A;  3AQO A;  2RH6 A;  1JVI A;  4C3I C;  5C4J K;  2B63 C;  4BXX C;  2E2H C;  3DLL S;  3GTL A;  3LYW A;  1XZQ A;  4AH6 A;  1DCO A;  1DCH A;  2EBB A;  1VGX A;  4KAT A;  4C3I K;  5FJ8 K;  4IO9 S;  4LQY A;  1RU0 A;  2E2J C;  2WB1 L;  3GTK K;  4A3K C;  1Y1W C;  3RZO K;  3GTG K;  2NVY A;  2JA8 C;  1TWA K;  4KAR A;  2ZUE A;  4C2M C;  1BJT A;  2E2J K;  4WFA S;  4AYB D;  5JFE A;  2R7Z A;  3S1R C;  3Q3Q A;  2JA8 K;  4QJV B;  3GTP A;  1I6H K;  4ZH4 A;  1HI9 A;  1XXB A;  2JA6 A;  3GTJ A;  3HOU K;  3LPX A;  2PHC B;  4G7Z A;  3M3Y C;  4GTC A;  3HOW K;  4A3M K;  2KQ1 A;  1IBA A;  3RZD C;  1YCL A;  4C3H C;  3IPJ A;  1WCM C;  3LAJ A;  1EK8 A;  2E2I K;  4BBR C;  2ZFZ A;  3CQZ C;  3G4A A;  4BLA A;  4Q4Z A;  3HOY K;  2JA7 A;  1V5V A;  3M3Y K;  4Y7N C; 
#chains in the Genus database with same CATH homology
 3K7A C;  3HOV C;  1I50 C;  2O5J A;  3HOW C;  4A3M C;  5C44 C;  4KMU A;  3GTO C;  4XSX A;  3GTJ C;  4A3I C;  4QIW D;  1IW7 A;  2JA7 K;  5D4D A;  4BY1 C;  4A3E C;  3S1M C;  1WCM K;  4A3D K;  1TWG K;  3S17 C;  1ZYR A;  4MQ9 A;  2NVT C;  4A3J C;  4BY7 C;  2E2I C;  3HOZ K;  2O5I A;  4A93 K;  4XLN A;  4YFN A;  4OIQ A;  3S2D C;  1SFO K;  2Y0S D;  2A68 A;  4A3F C;  3H3V D;  2PMZ D;  3HOY C;  3HOV K;  2R93 K;  1TWC K;  4OIP A;  4A3I K;  5TMC A;  5C4X K;  3S2H C;  4BY1 K;  5M5Y K;  5IP9 C;  1TWH K;  1I3Q K;  4A3E K;  5TMF A;  3S1M K;  2NVQ K;  3S17 K;  4A3D C;  2NVT K;  4BY7 K;  4NOI A;  1TWG C;  3I4M K;  1K83 C;  3S2D K;  3HOZ C;  3S16 C;  4GZY A;  1TWF C;  3HOX C;  5FLM C;  4X6A C;  4KN7 A;  3GTL K;  2R93 C;  4QIW L;  2JA5 K;  4OIN A;  3S2H K;  2R92 C;  1TWC C;  2PA8 L;  5IP9 K;  1BDF A;  2YU9 K;  5IYD K;  5C4X C;  4JK1 A;  2B63 K;  1XPP A;  2E2H K;  4BXX K;  1TWH C;  1I3Q C;  2NVQ C;  1K83 K;  2NVX K;  3I4M C;  3S16 K;  1TWF K;  1R9T K;  2Y0S L;  3H3V L;  2PMZ L;  3HOX K;  5FLM K;  3GTQ K;  2WB1 D;  4X6A K;  4LK0 A;  3EQL A;  3GTL C;  3I4N C;  2R92 K;  2JA5 C;  4LJZ A;  4QJV A;  4C3I C;  2YU9 C;  5C4J K;  5IYD C;  4Y52 C;  4XSZ A;  3DXJ A;  2B63 C;  2E2H C;  4BXX C;  4BBS C;  3H0G K;  2A6E A;  4YG2 A;  4A3K K;  2NVX C;  1Y1W K;  1R9T C;  4A3B K;  3FKI K;  5IYC C;  5IYB K;  3GTQ C;  1YNJ A;  3I4N K;  4C3I K;  2BE5 A;  5FJ8 K;  4YFX A;  2VUM C;  3GTK K;  4C2M K;  4Y52 K;  4Q5S A;  4LLG A;  3M4O K;  5C4J C;  4MEY A;  3HKZ D;  4BBS K;  2A69 A;  3GTM C;  4G7H A;  3H0G C;  2E2J C;  5C3E C;  2WB1 L;  4A3K C;  3PO3 C;  1Y1W C;  5IYC K;  5IP7 K;  4YFK A;  3S1R K;  3S14 C;  4A3B C;  3GTG K;  3RZO K;  3FKI C;  5IYB C;  4OIO A;  4OIR A;  2JA8 C;  4A3C C;  2VUM K;  3HOY K;  1TWA K;  4C3J K;  1Y1V K;  4C2M C;  2NVY K;  2WAQ D;  3GTM K;  3M4O C;  5M3M K;  1HQM A;  2E2J K;  2CW0 A;  3GTP C;  5C3E K;  3PO3 K;  2A6H A;  3RZD K;  4AYB D;  5IP7 C;  3GTK C;  2PPB A;  2JA6 C;  3S14 K;  4C3H K;  5M5W K;  3RZO C;  3S1R C;  3GTG C;  4G7O A;  2JA8 K;  4A3C K;  2PA8 D;  4QJV B;  3PO2 K;  4BBR K;  1I6H K;  2R7Z K;  3CQZ K;  5M5X K;  4A3G K;  4ZH4 A;  3HKZ L;  1TWA C;  3S1Q C;  4C3J C;  5M3F K;  4A3L K;  3HOU K;  1Y1V C;  2NVY C;  4G7Z A;  3S1N C;  4Y7N K;  3K7A K;  3GTP K;  1I50 K;  3M3Y C;  1SMY A;  3HOW K;  4A3M K;  5C44 K;  2JA6 K;  3GTO K;  3GTJ K;  3RZD C;  4LK1 A;  3S15 K;  3S15 C;  4MEX A;  4C3H C;  2JA7 C;  4KN4 A;  1WCM C;  3WOD A;  4A3J K;  3PO2 C;  1YNN A;  2E2I K;  3S1Q K;  4BBR C;  1I6H C;  2R7Z C;  3CQZ C;  4A3G C;  2WAQ L;  4Q4Z A;  4A93 C;  4A3L C;  1I6V A;  1SFO C;  4A3F K;  3S1N K;  3HOU C;  4XLP A;  4AYB L;  3M3Y K;  4Y7N C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...