5TMCA

Re-refinement of thermus thermopiles dna-directed rna polymerase structure
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
231
structure length
231
Chain Sequence
MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase subunit alpha
publication title On the validation of crystallographic symmetry and the quality of structures.
pubmed doi rcsb
molecule tags Transferase
total genus 39
structure length 231
sequence length 231
chains with identical sequence B
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2016-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01000 RNA_pol_A_bac RNA polymerase Rpb3/RpoA insert domain
A PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain
A PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.12 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 DNA-directed RNA polymerase, insert domain 5tmcA02
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 5tmcA01
4A3CC 4GZYA 3HOXC 4Y52C 2JA6K 2R7ZK 5FLMC 1Y1VC 4BXXC 4A3EK 3GTLK 3GTKK 3RZDK 1WCMK 3I4MC 1I6HK 4X6AK 4C3IC 2E2JC 3GTOC 3GTGC 5C4XC 2NVXC 4LLGA 1K83C 5M5YK 5IYCC 1I3QC 5TMCA 4BY1K 5C4JK 4A3FK 5M5XK 4A3DK 2A69A 4A3KK 2E2IK 2NVQK 4JK1A 3H3VL 4QJVB 2WB1L 1HQMA 2JA5C 3HOYK 2WB1D 1YNJA 3DXJA 5M3MK 2R92K 3GTQK 4A3GC 3S1MK 3S17K 2NVTC 1I50K 1TWGK 5IYDK 4BBRC 2JA8C 4C3JK 3PO2C 2B63K 3RZOC 1TWAK 4A3JK 3FKIC 4A3CK 3M3YC 4G7OA 3HOXK 4Y52K 2PA8D 5C3EC 1Y1VK 4Q4ZA 4BXXK 3S15K 5IP9C 1Y1WC 4XLNA 2PMZL 3M4OC 3S1QK 2E2JK 3GTOK 3GTGK 3GTMC 2NVXK 3H0GC 2R93C 1K83K 1I3QK 4OIRA 3K7AC 4KN4A 1TWHK 2E2HC 2Y0SL 3EQLA 1TWCK 5M5WK 5IP7C 3PO3C 4A3BC 3S1NC 2VUMC 4Y7NC 3HOUC 3HOWC 1TWFC 3H3VD 2NVTK 4A3LK 4BBSK 1SMYA 4YFXA 4C3HC 4BBRK 5FJ8K 1SFOC 1ZYRA 4OIQA 3PO2K 3S14C 2YU9C 2WAQL 3RZOK 5IYBC 3S2HC 1YNNA 3FKIK 4A3MC 1XPPA 3M3YK 5C3EK 4ZH4A 4C2MC 4A93C 2O5JA 5IP9K 5C4JC 4OINA 3S2DC 2R7ZC 5FLMK 3M4OK 2O5IA 2JA7C 5M3FK 3I4NC 3GTJC 3GTMK 3H0GK 3I4MK 4QJVA 2R93K 3RZDC 4C3IK 2PMZD 5C4XK 1BDFA 3S16C 4LJZA 3K7AK 3GTPC 4QIWL 5IYCK 3CQZC 4QIWD 4XSXA 2E2HK 2CW0A 5IP7K 3PO3K 4A3BK 4BY7C 2E2IC 2VUMK 3WODA 4Y7NK 3HOUK 2Y0SD 4KN7A 4A3IC 1TWFK 4AYBL 2JA5K 3HOWK 4C3HK 2NVYC 3HOZC 3HOVC 1SFOK 4A3GK 3S14K 3S1RC 2YU9K 4YFNA 5C44C 5IYBK 2JA8K 3S2HK 4A3MK 1R9TC 1IW7A 4C3JC 4G7HA 4G7ZA 2WAQD 4YG2A 4YFKA 4A93K 4OIPA 4A3JC 2A6HA 3S2DK 4XSZA 2JA7K 3I4NK 3GTJK 1Y1WK 3S15C 2JA6C 4NOIA 4C2MK 3S1QC 4MQ9A 4A3EC 2PPBA 3GTKC 3GTLC 3S16K 1WCMC 5D4DA 1I6HC 4X6AC 3GTPK 3CQZK 4LK1A 4MEXA 4BY7K 1TWHC 4BY1C 4A3DC 4A3FC 4MEYA 1TWCC 4A3IK 4A3KC 2NVYK 3HOZK 3HOVK 3S1NK 2NVQC 3S1RK 5C44K 4KMUA 4AYBD 3HOYC 4BBSC 4A3LC 1R9TK 2R92C 3GTQC 1I6VA 2A6EA 3S1MC 3S17C 4OIOA 1I50C 1TWGC 5IYDC 2BE5A 2A68A 5TMFA 4XLPA 4LK0A 4Q5SA 2PA8L 2B63C 3HKZL 3HKZD 1TWAC
chains in the Genus database with same CATH superfamily
4A3CC 4GZYA 3HOXC 2KWAA 2D6FC 1Y1VC 1B4BA 4GTLA 2E2JC 4WFNS 3GEHA 1XXCA 4LLGA 2KPUA 5IYCC 3N0BA 5JVGS 5M5XK 2A69A 1KQ4A 1BS2A 4JK1A 2RH6A 2E2HA 4WFAS 4QJVB 1HQMA 2JA5C 1BJTA 2FQOA 3DXJA 3GTQK 1PJ5A 4A3GC 1VJEA 1YCLA 4KM9A 1WSRA 4BKWA 3LAPA 1EQRA 1SFOA 3BP3A 4J3NA 3S0XA 2PA8D 3S15K 1FEUA 2PMZL 3M4OC 1O26A 3GTOK 2JA7A 3TFJA 3GTGK 3GTMC 2NVXK 3H0GC 1EH1A 1K83K 3GIRA 3EQLA 3FOFA 3OPFA 2KQ1A 3S1NC 2VUMC 4C45A 1O27A 1O2AA 3HOUC 3HXAA 4KARA 4OIQA 2YU9C 3RZOK 2P5MA 5EGEA 1YNNA 3FKIK 4A3MC 2KXYA 3M3YK 3DLLS 5C3EK 4WILA 1O29A 4OINA 5IORA 3AQPA 3PIOS 1JOEA 1AB4A 3LAJA 5M3FK 3I4NC 3GTJC 1VGXA 2PMZD 5IYCK 4QIWD 3V4GA 1ZBSA 5IP7K 3AD8C 4Y7NK 2JA5K 4A3IC 1TWFK 3HOVC 3AD7C 4A3GK 4IOCS 1J98A 4O2DA 1R9TC 4YFKA 3JSTA 3S2DK 3ADAC 1EFWA 4NOIA 3N0CA 3S1QC 1WIHA 2PPBA 3S16K 5D4DA 3N3YA 3CF5S 3CQZK 4DDQA 1O2BA 1WOOA 1I3QA 1IQ0A 4MEYA 1TWCC 5DM7S 4P9SA 1IL2A 1TWHA 3S1NK 3S1RK 5C44K 4KMUA 2EBBA 4IO9S 4A3LC 3G4AA 3TFHA 3GTQC 2A6EA 1XXAA 2V6SA 2GSNA 1G51A 4IOAS 2B63A 4C3IC 3GTOC 3GTGC 2NVXC 2R93A 5M5YK 1K83C 4BY1K 1USMA 2GSOA 4A3KK 4AH6A 2NVQK 3H3VL 3HOYK 1YNJA 2CFAB 2R92K 3MMLB 4GFQA 1WSVA 3S1MK 1TWGK 2JA8C 3A8IA 2B63K 3RZOC 4PAAA 3FKIC 3M3YC 4Y52K 5C3EC 1L0WA 3SZYA 4ILDA 4BXXK 5IOTA 2ZJRS 4XLNA 3S1QK 1XZQB 1TWCK 5IP7C 4LR2A 4KMDA 4Y7NC 1TWFC 3H3VD 4A3LK 1SMYA 5FJ8K 1F7VA 3PO2K 5TJ3A 1PJ7A 3AH5A 1XPPA 2ZFZA 3S2DC 3PIPS 4KASA 4QJVA 5CHPA 3RZDC 2R7ZA 2JA6A 3TTGA 4C3IK 3A8JA 3S16C 4LJZA 3GTLA 3GTKA 1WQHA 1DD5A 4QIWL 3CQZC 4XSXA 2FQTA 2E2HK 3PO3K 4A3BK 3AD9C 3WODA 3HOWK 4C3HK 2E2IA 1SFOK 3S14K 1WOSA 3S1RC 3A8KA 5C44C 4G0UA 4FM9A 2JA8K 3S2HK 2NVYA 4KATA 3GDZA 4G7HA 4C3JC 4G7ZA 1USOA 4A93K 1I50A 4OIPA 2PHCB 4A3JC 2A6HA 4KDDA 4XSZA 2JA7K 1TWAA 2GSUA 1Y1VA 4GTEA 2V6TA 4KB4A 1EI6A 1WCMA 4MEXA 1TWHC 4BY1C 4A3KC 2NVYK 4BLBA 4GTCA 3HOZK 2NVQC 2RGRA 3HOYC 4BBSC 4KB2A 1V5VA 3BP8C 2R92C 1WQFA 3S1MC 4OIOA 1TWGC 4XLPA 1J6VA 2B63C 4G0WA 2XCQA 3IPJA 3HKZD 1J6XA 3G4CA 4Y52C 1PJ6A 4BXXC 4A3EK 3RZDK 1EK8A 1IE0A 1WCMK 2ZUFA 1I6HK 4X6AK 5C4XC 3GTMA 3H0GA 4A3DK 4A3FK 3ERED 4WJ4A 2WB1D 2VUMA 3S17K 1INNA 5IYDK 4C3JK 3PO2C 2YU9A 4A3JK 4G7OA 1ZQ1C 4P5AA 4Q4ZA 3Q3QA 3GEIA 4BLAA 3GTJA 1Y1WA 1J6WA 1I3QK 5HL8A 1TWHK 4WF9S 1ZXOA 2E2HC 5M5WK 3PO3C 4A3BC 3HOWC 2NVTK 4BBSK 4BBRK 4YFXA 4C3HC 1HI9A 1SFOC 3S14C 5L46A 3BUEA 3S2HC 1R9TA 4ZH4A 4A93C 5IP9K 2R7ZC 3GEEA 5JFEA 3L4KA 1F93A 5IOQA 2JA7C 2R93K 1IBAA 2CFAA 5C4XK 3K7AK 1VRQC 2ZJPS 3SZZA 3GTPA 2E2IC 1WQGA 4AYBL 2P8TA 2NVYC 3HOZC 5DM6S 3T01A 4YFNA 5IYBK 4GTDA 3GTQA 1IW7A 1XZQA 4YG2A 1JQWA 3OEPA 3AQOA 2XCOA 4MQ9A 4A3EC 4RMFA 1WCMC 1I6HC 3GTPK 4X6AC 3GTOA 3GTGA 1F7UA 2NVXA 4BY7K 1K83A 4A3DC 4A3FC 3QX3A 1YX2A 4LQYA 4AYBD 1UV7A 1ISEA 5HL7S 2GAGC 3S17C 3LPXA 5IYDC 2A68A 4GTAA 4LK0A 4Q5SA 1XXBA 3HKZL 1GE9A 1X31C 3FKIA 2JA6K 2R7ZK 4KMHA 5FLMC 5JVOA 3GTKK 3GTLK 3I4MC 1XZPB 3LYWA 4LOWA 1I3QC 5TMCA 4KMAA 2E2IK 2WB1L 1VLOA 1JVIA 5M3MK 2JA5A 1TWFA 1DCOA 2NVTC 1I50K 1XZPA 4BBRC 3OREA 1B4AA 4PABA 3T02A 1ZVUA 1TWAK 4A3CK 3HOXK 2L3UA 2JH3A 4KC6A 1Y1VK 3VA7A 5IP9C 1Y1WC 5IOSA 2E2JK 1VH2A 2R93C 4FZBA 4P5BA 2V6UA 4OIRA 5CJ9A 2XCRB 3K7AC 4KN4A 2W7VA 3CQZA 2Y0SL 3TFIA 2ZJQS 4GTFA 1O24A 4WCES 1ZYRA 3NUHA 2WAQL 1O28A 5IYBC 4GTBA 4C2MC 2O5JA 5C4JC 4M1XA 5FLMK 3M4OK 2O5IA 3GTMK 3H0GK 3I4MK 3FOEA 1BDFA 4U67S 1C0AA 3GTPC 1IS1A 5HQHA 5JVHS 1DCHA 2CW0A 1WOPA 4BY7C 2VUMK 2Y3PA 3HOUK 2Y0SD 4KN7A 1BGWA 2YU9K 4GT9A 2GAHC 5E68A 4A3MK 2R92A 5EGHA 1F9NA 2WAQD 3L4JA 1TWGA 4WJ3M 3I4NK 3GTJK 1Y1WK 3S15C 4XCHA 2JA6C 1WORA 1O2FB 3FHZA 1O25A 3GTKC 4G0VA 3GTLC 3CAGA 4KM8A 4LK1A 3T00A 1DCPA 3GSIA 4A3IK 2L5NA 3HOVK 2ZUEA 1TWCA 1RU0A 1R9TK 1I6VA 1I50C 2BE5A 5TMFA 4WFBS 4KAWX 2PA8L 4C2MK 5C4JK 1TWAC
chains in the Genus database with same CATH topology
4A3CC 4GZYA 3HOXC 4Y52C 2JA6K 2R7ZK 5FLMC 1Y1VC 4BXXC 4A3EK 3GTLK 3GTKK 3RZDK 1WCMK 3I4MC 1I6HK 4X6AK 4C3IC 2E2JC 3GTOC 3GTGC 5C4XC 2NVXC 4LLGA 1K83C 5M5YK 5IYCC 1I3QC 5TMCA 4BY1K 5C4JK 4A3FK 5M5XK 4A3DK 2A69A 4A3KK 2E2IK 2NVQK 4JK1A 3H3VL 4QJVB 2WB1L 1HQMA 2JA5C 3HOYK 2WB1D 1YNJA 3DXJA 5M3MK 2R92K 3GTQK 4A3GC 3S1MK 3S17K 2NVTC 1I50K 1TWGK 5IYDK 4BBRC 2JA8C 4C3JK 3PO2C 2B63K 3RZOC 1TWAK 4A3JK 3FKIC 4A3CK 3M3YC 4G7OA 3HOXK 4Y52K 2PA8D 5C3EC 1Y1VK 4Q4ZA 4BXXK 3S15K 5IP9C 1Y1WC 4XLNA 2PMZL 3M4OC 3S1QK 2E2JK 3GTOK 3GTGK 3GTMC 2NVXK 3H0GC 2R93C 1K83K 1I3QK 4OIRA 3K7AC 4KN4A 1TWHK 2E2HC 2Y0SL 3EQLA 1TWCK 5M5WK 5IP7C 3PO3C 4A3BC 3S1NC 2VUMC 4Y7NC 3HOUC 3HOWC 1TWFC 3H3VD 2NVTK 4A3LK 4BBSK 1SMYA 4YFXA 4C3HC 4BBRK 5FJ8K 1SFOC 1ZYRA 4OIQA 3PO2K 3S14C 2YU9C 2WAQL 3RZOK 5IYBC 3S2HC 1YNNA 3FKIK 4A3MC 1XPPA 3M3YK 5C3EK 4ZH4A 4C2MC 4A93C 2O5JA 5IP9K 5C4JC 4OINA 3S2DC 2R7ZC 5FLMK 3M4OK 2O5IA 2JA7C 5M3FK 3I4NC 3GTJC 3GTMK 3H0GK 3I4MK 4QJVA 2R93K 3RZDC 4C3IK 2PMZD 5C4XK 1BDFA 3S16C 4LJZA 3K7AK 3GTPC 4QIWL 5IYCK 3CQZC 4QIWD 4XSXA 2E2HK 2CW0A 5IP7K 3PO3K 4A3BK 4BY7C 2E2IC 2VUMK 3WODA 4Y7NK 3HOUK 2Y0SD 4KN7A 4A3IC 1TWFK 4AYBL 2JA5K 3HOWK 4C3HK 2NVYC 3HOZC 3HOVC 1SFOK 4A3GK 3S14K 3S1RC 2YU9K 4YFNA 5C44C 5IYBK 2JA8K 3S2HK 4A3MK 1R9TC 1IW7A 4C3JC 4G7HA 4G7ZA 2WAQD 4YG2A 4YFKA 4A93K 4OIPA 4A3JC 2A6HA 3S2DK 4XSZA 2JA7K 3I4NK 3GTJK 1Y1WK 3S15C 2JA6C 4NOIA 4C2MK 3S1QC 4MQ9A 4A3EC 2PPBA 3GTKC 3GTLC 3S16K 1WCMC 5D4DA 1I6HC 4X6AC 3GTPK 3CQZK 4LK1A 4MEXA 4BY7K 1TWHC 4BY1C 4A3DC 4A3FC 4MEYA 1TWCC 4A3IK 4A3KC 2NVYK 3HOZK 3HOVK 3S1NK 2NVQC 3S1RK 5C44K 4KMUA 4AYBD 3HOYC 4BBSC 4A3LC 1R9TK 2R92C 3GTQC 1I6VA 2A6EA 3S1MC 3S17C 4OIOA 1I50C 1TWGC 5IYDC 2BE5A 2A68A 5TMFA 4XLPA 4LK0A 4Q5SA 2PA8L 2B63C 3HKZL 3HKZD 1TWAC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A3C C;  4GZY A;  3HOX C;  4Y52 C;  2JA6 K;  2R7Z K;  5FLM C;  1Y1V C;  4BXX C;  4A3E K;  3GTL K;  3GTK K;  3RZD K;  1WCM K;  3I4M C;  1I6H K;  4X6A K;  4C3I C;  2E2J C;  3GTO C;  3GTG C;  5C4X C;  2NVX C;  4LLG A;  1K83 C;  5M5Y K;  5IYC C;  1I3Q C;  5TMC A;  4BY1 K;  5C4J K;  4A3F K;  5M5X K;  4A3D K;  2A69 A;  4A3K K;  2E2I K;  2NVQ K;  4JK1 A;  3H3V L;  4QJV B;  2WB1 L;  1HQM A;  2JA5 C;  3HOY K;  2WB1 D;  1YNJ A;  3DXJ A;  5M3M K;  2R92 K;  3GTQ K;  4A3G C;  3S1M K;  3S17 K;  2NVT C;  1I50 K;  1TWG K;  5IYD K;  4BBR C;  2JA8 C;  4C3J K;  3PO2 C;  2B63 K;  3RZO C;  1TWA K;  4A3J K;  3FKI C;  4A3C K;  3M3Y C;  4G7O A;  3HOX K;  4Y52 K;  2PA8 D;  5C3E C;  1Y1V K;  4Q4Z A;  4BXX K;  3S15 K;  5IP9 C;  1Y1W C;  4XLN A;  2PMZ L;  3M4O C;  3S1Q K;  2E2J K;  3GTO K;  3GTG K;  3GTM C;  2NVX K;  3H0G C;  2R93 C;  1K83 K;  1I3Q K;  4OIR A;  3K7A C;  4KN4 A;  1TWH K;  2E2H C;  2Y0S L;  3EQL A;  1TWC K;  5M5W K;  5IP7 C;  3PO3 C;  4A3B C;  3S1N C;  2VUM C;  4Y7N C;  3HOU C;  3HOW C;  1TWF C;  3H3V D;  2NVT K;  4A3L K;  4BBS K;  1SMY A;  4YFX A;  4C3H C;  4BBR K;  5FJ8 K;  1SFO C;  1ZYR A;  4OIQ A;  3PO2 K;  3S14 C;  2YU9 C;  2WAQ L;  3RZO K;  5IYB C;  3S2H C;  1YNN A;  3FKI K;  4A3M C;  1XPP A;  3M3Y K;  5C3E K;  4ZH4 A;  4C2M C;  4A93 C;  2O5J A;  5IP9 K;  5C4J C;  4OIN A;  3S2D C;  2R7Z C;  5FLM K;  3M4O K;  2O5I A;  2JA7 C;  5M3F K;  3I4N C;  3GTJ C;  3GTM K;  3H0G K;  3I4M K;  4QJV A;  2R93 K;  3RZD C;  4C3I K;  2PMZ D;  5C4X K;  1BDF A;  3S16 C;  4LJZ A;  3K7A K;  3GTP C;  4QIW L;  5IYC K;  3CQZ C;  4QIW D;  4XSX A;  2E2H K;  2CW0 A;  5IP7 K;  3PO3 K;  4A3B K;  4BY7 C;  2E2I C;  2VUM K;  3WOD A;  4Y7N K;  3HOU K;  2Y0S D;  4KN7 A;  4A3I C;  1TWF K;  4AYB L;  2JA5 K;  3HOW K;  4C3H K;  2NVY C;  3HOZ C;  3HOV C;  1SFO K;  4A3G K;  3S14 K;  3S1R C;  2YU9 K;  4YFN A;  5C44 C;  5IYB K;  2JA8 K;  3S2H K;  4A3M K;  1R9T C;  1IW7 A;  4C3J C;  4G7H A;  4G7Z A;  2WAQ D;  4YG2 A;  4YFK A;  4A93 K;  4OIP A;  4A3J C;  2A6H A;  3S2D K;  4XSZ A;  2JA7 K;  3I4N K;  3GTJ K;  1Y1W K;  3S15 C;  2JA6 C;  4NOI A;  4C2M K;  3S1Q C;  4MQ9 A;  4A3E C;  2PPB A;  3GTK C;  3GTL C;  3S16 K;  1WCM C;  5D4D A;  1I6H C;  4X6A C;  3GTP K;  3CQZ K;  4LK1 A;  4MEX A;  4BY7 K;  1TWH C;  4BY1 C;  4A3D C;  4A3F C;  4MEY A;  1TWC C;  4A3I K;  4A3K C;  2NVY K;  3HOZ K;  3HOV K;  3S1N K;  2NVQ C;  3S1R K;  5C44 K;  4KMU A;  4AYB D;  3HOY C;  4BBS C;  4A3L C;  1R9T K;  2R92 C;  3GTQ C;  1I6V A;  2A6E A;  3S1M C;  3S17 C;  4OIO A;  1I50 C;  1TWG C;  5IYD C;  2BE5 A;  2A68 A;  5TMF A;  4XLP A;  4LK0 A;  4Q5S A;  2PA8 L;  2B63 C;  3HKZ L;  3HKZ D;  1TWA C; 
#chains in the Genus database with same CATH topology
 4A3C C;  4GZY A;  3HOX C;  2KWA A;  2D6F C;  1Y1V C;  1B4B A;  4GTL A;  2E2J C;  4WFN S;  3GEH A;  1XXC A;  4LLG A;  2KPU A;  5IYC C;  3N0B A;  5JVG S;  5M5X K;  2A69 A;  1KQ4 A;  1BS2 A;  4JK1 A;  2RH6 A;  2E2H A;  4WFA S;  4QJV B;  1HQM A;  2JA5 C;  1BJT A;  2FQO A;  3DXJ A;  3GTQ K;  1PJ5 A;  4A3G C;  1VJE A;  1YCL A;  4KM9 A;  1WSR A;  4BKW A;  3LAP A;  1EQR A;  1SFO A;  3BP3 A;  4J3N A;  3S0X A;  2PA8 D;  3S15 K;  1FEU A;  2PMZ L;  3M4O C;  1O26 A;  3GTO K;  2JA7 A;  3TFJ A;  3GTG K;  3GTM C;  2NVX K;  3H0G C;  1EH1 A;  1K83 K;  3GIR A;  3EQL A;  3FOF A;  3OPF A;  2KQ1 A;  3S1N C;  2VUM C;  4C45 A;  1O27 A;  1O2A A;  3HOU C;  3HXA A;  4KAR A;  4OIQ A;  2YU9 C;  3RZO K;  2P5M A;  5EGE A;  1YNN A;  3FKI K;  4A3M C;  2KXY A;  3M3Y K;  3DLL S;  5C3E K;  4WIL A;  1O29 A;  4OIN A;  5IOR A;  3AQP A;  3PIO S;  1JOE A;  1AB4 A;  3LAJ A;  5M3F K;  3I4N C;  3GTJ C;  1VGX A;  2PMZ D;  5IYC K;  4QIW D;  3V4G A;  1ZBS A;  5IP7 K;  3AD8 C;  4Y7N K;  2JA5 K;  4A3I C;  1TWF K;  3HOV C;  3AD7 C;  4A3G K;  4IOC S;  1J98 A;  4O2D A;  1R9T C;  4YFK A;  3JST A;  3S2D K;  3ADA C;  1EFW A;  4NOI A;  3N0C A;  3S1Q C;  1WIH A;  2PPB A;  3S16 K;  5D4D A;  3N3Y A;  3CF5 S;  3CQZ K;  4DDQ A;  1O2B A;  1WOO A;  1I3Q A;  1IQ0 A;  4MEY A;  1TWC C;  5DM7 S;  4P9S A;  1IL2 A;  1TWH A;  3S1N K;  3S1R K;  5C44 K;  4KMU A;  2EBB A;  4IO9 S;  4A3L C;  3G4A A;  3TFH A;  3GTQ C;  2A6E A;  1XXA A;  2V6S A;  2GSN A;  1G51 A;  4IOA S;  2B63 A;  4C3I C;  3GTO C;  3GTG C;  2NVX C;  2R93 A;  5M5Y K;  1K83 C;  4BY1 K;  1USM A;  2GSO A;  4A3K K;  4AH6 A;  2NVQ K;  3H3V L;  3HOY K;  1YNJ A;  2CFA B;  2R92 K;  3MML B;  4GFQ A;  1WSV A;  3S1M K;  1TWG K;  2JA8 C;  3A8I A;  2B63 K;  3RZO C;  4PAA A;  3FKI C;  3M3Y C;  4Y52 K;  5C3E C;  1L0W A;  3SZY A;  4ILD A;  4BXX K;  5IOT A;  2ZJR S;  4XLN A;  3S1Q K;  1XZQ B;  1TWC K;  5IP7 C;  4LR2 A;  4KMD A;  4Y7N C;  1TWF C;  3H3V D;  4A3L K;  1SMY A;  5FJ8 K;  1F7V A;  3PO2 K;  5TJ3 A;  1PJ7 A;  3AH5 A;  1XPP A;  2ZFZ A;  3S2D C;  3PIP S;  4KAS A;  4QJV A;  5CHP A;  3RZD C;  2R7Z A;  2JA6 A;  3TTG A;  4C3I K;  3A8J A;  3S16 C;  4LJZ A;  3GTL A;  3GTK A;  1WQH A;  1DD5 A;  4QIW L;  3CQZ C;  4XSX A;  2FQT A;  2E2H K;  3PO3 K;  4A3B K;  3AD9 C;  3WOD A;  3HOW K;  4C3H K;  2E2I A;  1SFO K;  3S14 K;  1WOS A;  3S1R C;  3A8K A;  5C44 C;  4G0U A;  4FM9 A;  2JA8 K;  3S2H K;  2NVY A;  4KAT A;  3GDZ A;  4G7H A;  4C3J C;  4G7Z A;  1USO A;  4A93 K;  1I50 A;  4OIP A;  2PHC B;  4A3J C;  2A6H A;  4KDD A;  4XSZ A;  2JA7 K;  1TWA A;  2GSU A;  1Y1V A;  4GTE A;  2V6T A;  4KB4 A;  1EI6 A;  1WCM A;  4MEX A;  1TWH C;  4BY1 C;  4A3K C;  2NVY K;  4BLB A;  4GTC A;  3HOZ K;  2NVQ C;  2RGR A;  3HOY C;  4BBS C;  4KB2 A;  1V5V A;  3BP8 C;  2R92 C;  1WQF A;  3S1M C;  4OIO A;  1TWG C;  4XLP A;  1J6V A;  2B63 C;  4G0W A;  2XCQ A;  3IPJ A;  3HKZ D;  1J6X A;  3G4C A;  4Y52 C;  1PJ6 A;  4BXX C;  4A3E K;  3RZD K;  1EK8 A;  1IE0 A;  1WCM K;  2ZUF A;  1I6H K;  4X6A K;  5C4X C;  3GTM A;  3H0G A;  4A3D K;  4A3F K;  3ERE D;  4WJ4 A;  2WB1 D;  2VUM A;  3S17 K;  1INN A;  5IYD K;  4C3J K;  3PO2 C;  2YU9 A;  4A3J K;  4G7O A;  1ZQ1 C;  4P5A A;  4Q4Z A;  3Q3Q A;  3GEI A;  4BLA A;  3GTJ A;  1Y1W A;  1J6W A;  1I3Q K;  5HL8 A;  1TWH K;  4WF9 S;  1ZXO A;  2E2H C;  5M5W K;  3PO3 C;  4A3B C;  3HOW C;  2NVT K;  4BBS K;  4BBR K;  4YFX A;  4C3H C;  1HI9 A;  1SFO C;  3S14 C;  5L46 A;  3BUE A;  3S2H C;  1R9T A;  4ZH4 A;  4A93 C;  5IP9 K;  2R7Z C;  3GEE A;  5JFE A;  3L4K A;  1F93 A;  5IOQ A;  2JA7 C;  2R93 K;  1IBA A;  2CFA A;  5C4X K;  3K7A K;  1VRQ C;  2ZJP S;  3SZZ A;  3GTP A;  2E2I C;  1WQG A;  4AYB L;  2P8T A;  2NVY C;  3HOZ C;  5DM6 S;  3T01 A;  4YFN A;  5IYB K;  4GTD A;  3GTQ A;  1IW7 A;  1XZQ A;  4YG2 A;  1JQW A;  3OEP A;  3AQO A;  2XCO A;  4MQ9 A;  4A3E C;  4RMF A;  1WCM C;  1I6H C;  3GTP K;  4X6A C;  3GTO A;  3GTG A;  1F7U A;  2NVX A;  4BY7 K;  1K83 A;  4A3D C;  4A3F C;  3QX3 A;  1YX2 A;  4LQY A;  4AYB D;  1UV7 A;  1ISE A;  5HL7 S;  2GAG C;  3S17 C;  3LPX A;  5IYD C;  2A68 A;  4GTA A;  4LK0 A;  4Q5S A;  1XXB A;  3HKZ L;  1GE9 A;  1X31 C;  3FKI A;  2JA6 K;  2R7Z K;  4KMH A;  5FLM C;  5JVO A;  3GTK K;  3GTL K;  3I4M C;  1XZP B;  3LYW A;  4LOW A;  1I3Q C;  5TMC A;  4KMA A;  2E2I K;  2WB1 L;  1VLO A;  1JVI A;  5M3M K;  2JA5 A;  1TWF A;  1DCO A;  2NVT C;  1I50 K;  1XZP A;  4BBR C;  3ORE A;  1B4A A;  4PAB A;  3T02 A;  1ZVU A;  1TWA K;  4A3C K;  3HOX K;  2L3U A;  2JH3 A;  4KC6 A;  1Y1V K;  3VA7 A;  5IP9 C;  1Y1W C;  5IOS A;  2E2J K;  1VH2 A;  2R93 C;  4FZB A;  4P5B A;  2V6U A;  4OIR A;  5CJ9 A;  2XCR B;  3K7A C;  4KN4 A;  2W7V A;  3CQZ A;  2Y0S L;  3TFI A;  2ZJQ S;  4GTF A;  1O24 A;  4WCE S;  1ZYR A;  3NUH A;  2WAQ L;  1O28 A;  5IYB C;  4GTB A;  4C2M C;  2O5J A;  5C4J C;  4M1X A;  5FLM K;  3M4O K;  2O5I A;  3GTM K;  3H0G K;  3I4M K;  3FOE A;  1BDF A;  4U67 S;  1C0A A;  3GTP C;  1IS1 A;  5HQH A;  5JVH S;  1DCH A;  2CW0 A;  1WOP A;  4BY7 C;  2VUM K;  2Y3P A;  3HOU K;  2Y0S D;  4KN7 A;  1BGW A;  2YU9 K;  4GT9 A;  2GAH C;  5E68 A;  4A3M K;  2R92 A;  5EGH A;  1F9N A;  2WAQ D;  3L4J A;  1TWG A;  4WJ3 M;  3I4N K;  3GTJ K;  1Y1W K;  3S15 C;  4XCH A;  2JA6 C;  1WOR A;  1O2F B;  3FHZ A;  1O25 A;  3GTK C;  4G0V A;  3GTL C;  3CAG A;  4KM8 A;  4LK1 A;  3T00 A;  1DCP A;  3GSI A;  4A3I K;  2L5N A;  3HOV K;  2ZUE A;  1TWC A;  1RU0 A;  1R9T K;  1I6V A;  1I50 C;  2BE5 A;  5TMF A;  4WFB S;  4KAW X;  2PA8 L;  4C2M K;  5C4J K;  1TWA C; 
#chains in the Genus database with same CATH homology
 4A3C C;  4GZY A;  3HOX C;  4Y52 C;  2JA6 K;  2R7Z K;  5FLM C;  1Y1V C;  4BXX C;  4A3E K;  3GTL K;  3GTK K;  3RZD K;  1WCM K;  3I4M C;  1I6H K;  4X6A K;  4C3I C;  2E2J C;  3GTO C;  3GTG C;  5C4X C;  2NVX C;  4LLG A;  1K83 C;  5M5Y K;  5IYC C;  1I3Q C;  5TMC A;  4BY1 K;  5C4J K;  4A3F K;  5M5X K;  4A3D K;  2A69 A;  4A3K K;  2E2I K;  2NVQ K;  4JK1 A;  3H3V L;  4QJV B;  2WB1 L;  1HQM A;  2JA5 C;  3HOY K;  2WB1 D;  1YNJ A;  3DXJ A;  5M3M K;  2R92 K;  3GTQ K;  4A3G C;  3S1M K;  3S17 K;  2NVT C;  1I50 K;  1TWG K;  5IYD K;  4BBR C;  2JA8 C;  4C3J K;  3PO2 C;  2B63 K;  3RZO C;  1TWA K;  4A3J K;  3FKI C;  4A3C K;  3M3Y C;  4G7O A;  3HOX K;  4Y52 K;  2PA8 D;  5C3E C;  1Y1V K;  4Q4Z A;  4BXX K;  3S15 K;  5IP9 C;  1Y1W C;  4XLN A;  2PMZ L;  3M4O C;  3S1Q K;  2E2J K;  3GTO K;  3GTG K;  3GTM C;  2NVX K;  3H0G C;  2R93 C;  1K83 K;  1I3Q K;  4OIR A;  3K7A C;  4KN4 A;  1TWH K;  2E2H C;  2Y0S L;  3EQL A;  1TWC K;  5M5W K;  5IP7 C;  3PO3 C;  4A3B C;  3S1N C;  2VUM C;  4Y7N C;  3HOU C;  3HOW C;  1TWF C;  3H3V D;  2NVT K;  4A3L K;  4BBS K;  1SMY A;  4YFX A;  4C3H C;  4BBR K;  5FJ8 K;  1SFO C;  1ZYR A;  4OIQ A;  3PO2 K;  3S14 C;  2YU9 C;  2WAQ L;  3RZO K;  5IYB C;  3S2H C;  1YNN A;  3FKI K;  4A3M C;  1XPP A;  3M3Y K;  5C3E K;  4ZH4 A;  4C2M C;  4A93 C;  2O5J A;  5IP9 K;  5C4J C;  4OIN A;  3S2D C;  2R7Z C;  5FLM K;  3M4O K;  2O5I A;  2JA7 C;  5M3F K;  3I4N C;  3GTJ C;  3GTM K;  3H0G K;  3I4M K;  4QJV A;  2R93 K;  3RZD C;  4C3I K;  2PMZ D;  5C4X K;  1BDF A;  3S16 C;  4LJZ A;  3K7A K;  3GTP C;  4QIW L;  5IYC K;  3CQZ C;  4QIW D;  4XSX A;  2E2H K;  2CW0 A;  5IP7 K;  3PO3 K;  4A3B K;  4BY7 C;  2E2I C;  2VUM K;  3WOD A;  4Y7N K;  3HOU K;  2Y0S D;  4KN7 A;  4A3I C;  1TWF K;  4AYB L;  2JA5 K;  3HOW K;  4C3H K;  2NVY C;  3HOZ C;  3HOV C;  1SFO K;  4A3G K;  3S14 K;  3S1R C;  2YU9 K;  4YFN A;  5C44 C;  5IYB K;  2JA8 K;  3S2H K;  4A3M K;  1R9T C;  1IW7 A;  4C3J C;  4G7H A;  4G7Z A;  2WAQ D;  4YG2 A;  4YFK A;  4A93 K;  4OIP A;  4A3J C;  2A6H A;  3S2D K;  4XSZ A;  2JA7 K;  3I4N K;  3GTJ K;  1Y1W K;  3S15 C;  2JA6 C;  4NOI A;  4C2M K;  3S1Q C;  4MQ9 A;  4A3E C;  2PPB A;  3GTK C;  3GTL C;  3S16 K;  1WCM C;  5D4D A;  1I6H C;  4X6A C;  3GTP K;  3CQZ K;  4LK1 A;  4MEX A;  4BY7 K;  1TWH C;  4BY1 C;  4A3D C;  4A3F C;  4MEY A;  1TWC C;  4A3I K;  4A3K C;  2NVY K;  3HOZ K;  3HOV K;  3S1N K;  2NVQ C;  3S1R K;  5C44 K;  4KMU A;  4AYB D;  3HOY C;  4BBS C;  4A3L C;  1R9T K;  2R92 C;  3GTQ C;  1I6V A;  2A6E A;  3S1M C;  3S17 C;  4OIO A;  1I50 C;  1TWG C;  5IYD C;  2BE5 A;  2A68 A;  5TMF A;  4XLP A;  4LK0 A;  4Q5S A;  2PA8 L;  2B63 C;  3HKZ L;  3HKZ D;  1TWA C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...