5TMCA

Re-refinement of thermus thermopiles dna-directed rna polymerase structure
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
231
structure length
231
Chain Sequence
MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title On the validation of crystallographic symmetry and the quality of structures.
pubmed doi rcsb
molecule tags Transferase
molecule keywords DNA-directed RNA polymerase subunit alpha
total genus 39
structure length 231
sequence length 231
chains with identical sequence B
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2016-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01000 RNA_pol_A_bac RNA polymerase Rpb3/RpoA insert domain
A PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain
A PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.12 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 DNA-directed RNA polymerase, insert domain 5tmcA02
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 5tmcA01
2E2IK 4MEXA 2NVXC 3GTLC 4BY1K 1I6HK 3GTPC 4GZYA 4C2MC 5IP9K 5IP9C 4C2MK 1BDFA 2VUMC 4A3MC 3M3YK 2NVYK 4BY7C 2Y0SD 4A3EC 2PA8L 2WB1L 3S16K 4G7ZA 1XPPA 3FKIK 2NVQK 4BXXC 4BXXK 4AYBL 3GTJK 4OINA 2JA8C 3GTKC 3S15C 4A3CK 2O5JA 2R93C 3H0GK 4YFKA 5C44K 2R93K 3GTQC 4LJZA 2A69A 3S1QC 4QJVB 3EQLA 2R7ZK 3PO2C 4BBRK 3HOWC 1Y1WK 1YNNA 4MEYA 1HQMA 2NVXK 3GTLK 1TWCC 1I3QK 1Y1VK 2JA5K 5C4JC 5IYBC 1R9TK 5M5XK 4KMUA 4A3LC 4A3LK 2E2HC 5IP7K 2YU9K 4C3IK 5IYDK 3S1RC 3HOVK 4XSXA 3HOVC 4A3BC 1Y1WC 3HKZL 3HOWK 4A3FK 2PMZD 1TWAK 4G7OA 2PA8D 2O5IA 4QJVA 4A3DC 3S2HK 1TWFK 3H3VL 4Y7NK 4KN7A 2PPBA 3S14C 3S14K 2JA7C 3GTJC 3PO3K 2R92C 4A3EK 4QIWD 3S16C 4OIQA 3GTQK 4A3FC 3M4OK 4QIWL 5IYCC 4A3DK 2WAQD 1TWGC 4MQ9A 4X6AK 2BE5A 4LK1A 4C3HC 4C3HK 5FLMK 4BBSC 5FLMC 3I4MC 5TMCA 4A3JK 4C3JK 3GTPK 1R9TC 3CQZC 3S17K 5M3FK 4Q5SA 5IP7C 2YU9C 3M4OC 2A68A 2NVTK 2PMZL 3GTOC 4A3IK 4OIRA 3GTMC 1TWHK 2A6EA 1SFOC 4BBRC 5M5WK 4Y7NC 4BY1C 1I6HC 2WB1D 2Y0SL 5FJ8K 3I4NC 4AYBD 1WCMK 3H0GC 5C44C 2B63C 4JK1A 3PO3C 4YFXA 4A3KC 5IYDC 1K83K 3K7AK 3S1RK 3S2DC 2WAQL 2E2JK 2R92K 3S2DK 4A3GK 1TWFC 3FKIC 2NVQC 5C4XC 3RZOK 1Y1VC 5C3EK 3I4NK 3HOUC 3S17C 3CQZK 3S1NK 4Y52K 4Y52C 4A3JC 2B63K 3I4MK 4C3JC 4C3IC 2JA7K 5M5YK 2R7ZC 3PO2K 1SFOK 3HOXC 4X6AC 1ZYRA 2NVTC 5C4XK 3GTGC 1TWCK 1I3QC 1SMYA 2JA5C 1I6VA 3RZDC 1I50K 5D4DA 4LLGA 4BBSK 1WCMC 3HOZC 4A93C 4XLPA 3S1QK 2NVYC 4BY7K 3HOYC 3HOYK 2VUMK 4OIPA 3M3YC 4LK0A 4A3MK 4YFNA 2JA6K 1TWAC 3GTMK 1I50C 1TWGK 3RZDK 2A6HA 3S1NC 2E2IC 5C3EC 4Q4ZA 3DXJA 3HOXK 4YG2A 2CW0A 4A3GC 1IW7A 2JA6C 4XLNA 3K7AC 4A3KK 2E2JC 3WODA 5IYCK 1YNJA 3S2HC 3HOUK 3S1MK 4OIOA 2E2HK 4ZH4A 3HOZK 4A93K 3HKZD 4G7HA 3RZOC 5C4JK 2JA8K 3GTKK 4A3BK 4NOIA 4A3CC 3S15K 5TMFA 3GTGK 4A3IC 1K83C 3H3VD 3GTOK 1TWHC 4KN4A 4XSZA 5IYBK 3S1MC 5M3MK
chains in the Genus database with same CATH superfamily
3T02A 4O2DA 2E2HA 4C2MK 2VUMC 4XCHA 3S16K 1F7UA 3FKIK 3FKIA 1ZVUA 2Y3PA 3GTKC 1O2AA 3S0XA 1UV7A 3GTQC 5IOSA 4LJZA 2A69A 3EQLA 1Y1WK 4KM8A 3GTLA 3SZYA 1TWCC 1TWHA 5C4JC 5M5XK 2E2HC 3GTOA 1WIHA 1WOOA 3HOVK 3GEIA 3HOWK 4BLAA 2ZJQS 5CJ9A 2PMZD 1TWAK 4A3FK 4P5BA 1TWFK 3H3VL 4Y7NK 2FQTA 3S14K 4LR2A 3A8KA 3S16C 3GTQK 4A3FC 2FQOA 1DCHA 3BUEA 1TWGC 4LK1A 4C3HC 3VA7A 5TMCA 2A68A 3GTMC 1SFOC 1IBAA 1WSRA 3AD8C 5FJ8K 1ZQ1C 5IORA 3I4NC 2V6SA 2B63A 3G4AA 4YFXA 5IYDC 3S2DK 1ZXOA 4BLBA 2JH3A 1TWFC 3FKIC 3SZZA 1Y1VC 3LPXA 1IE0A 4P9SA 2R7ZC 3HOXC 4WFBS 3GTMA 1FEUA 1TWCK 1SMYA 1I50K 2XCQA 3HOZC 3T00A 3HOYK 2JA6A 3M3YC 3NUHA 4A3MK 3RZDK 1TWGK 4GTAA 4M1XA 2D6FC 3AH5A 2A6HA 1WOPA 2RH6A 4YG2A 1YCLA 1WORA 5EGEA 1IW7A 2JA6C 1BS2A 1WSVA 1XZQB 4ILDA 3S2HC 3HOUK 4OIOA 1XZPB 5EGHA 3GTKK 2ZJPS 1EQRA 5HL8A 5DM7S 3GTGK 1K83C 3GTOK 4XSZA 4GTLA 5E68A 1DCPA 1HI9A 2E2IK 4BY1K 1I6HK 3AQOA 2XCOA 4C2MC 4PABA 4A3MC 1TWCA 3M3YK 2Y0SD 1V5VA 2PA8L 2WB1L 1Y1VA 1XPPA 4WJ3M 3GTQA 4AYBL 3L4KA 1G51A 4OINA 2R93C 4KDDA 4YFKA 2R7ZA 4QJVB 3S1QC 2R7ZK 3PO2C 2GSOA 4BBRK 3L4JA 2V6UA 1I3QK 5L46A 1R9TK 4KMUA 2YU9K 1PJ5A 2GSUA 3TFIA 5IYDK 2ZFZA 1DCOA 4G7OA 3S2HK 2JA7C 5TJ3A 2R92C 3CQZA 2E2IA 3M4OK 1USOA 5IYCC 4A3DK 1TWAA 2R93A 4C3HK 4C3JK 3GTPK 2RGRA 4WF9S 4KB4A 1XZPA 3GTOC 4WFAS 4G0VA 1TWHK 2A6EA 4GT9A 3OREA 4Y7NC 5M5WK 2KQ1A 3CF5S 4J3NA 3H0GC 5C44C 1JVIA 2B63C 3ADAC 2R92K 1F93A 2WAQL 3GIRA 2NVQC 1O2FB 1VLOA 1BGWA 3S1NK 4WFNS 4Y52C 4GTCA 4C3IC 3DLLS 1VGXA 2JA5C 4KATA 2ZUEA 4BBSK 1WCMC 4IOCS 4XLPA 1PJ7A 2L5NA 5JVGS 3GTJA 2VUMA 2VUMK 4OIPA 4KMDA 4LK0A 1JOEA 2PHCB 4GFQA 3HXAA 3GSIA 5JVHS 5C3EC 4Q4ZA 1WQGA 4IOAS 4A3GC 2E2JC 2ZJRS 3S1MK 3PIPS 2JA7A 4A93K 3HKZD 2JA8K 3QX3A 5DM6S 4KN4A 3S1MC 1O28A 4MEXA 2NVXC 3JSTA 1INNA 5IP9C 1BDFA 1XXCA 3GEHA 4BY7C 1WOSA 4GTDA 4BXXK 3CAGA 1R9TA 1EK8A 3GTJK 4AH6A 4FM9A 3S15C 4A3CK 2O5JA 2R93K 4G0UA 4KARA 1B4BA 3GTPA 4G0WA 1EH1A 2XCRB 3HOWC 1YNNA 1F9NA 3GTLK 1IQ0A 2JA5K 1Y1VK 5IOQA 5IYBC 4KAWX 4A3LK 5IP7K 3MMLB 3S1RC 4XSXA 4A3BC 2ZUFA 1Y1WC 2PA8D 2O5IA 2R92A 3LAJA 2PPBA 1JQWA 3PO3K 3GTJC 4QIWD 3T01A 1C0AA 2WAQD 4X6AK 3V4GA 4BBSC 5FLMC 1ISEA 3I4MC 4A3JK 2GSNA 3S17K 4Q5SA 5IP7C 4A3IK 4BBRC 5JFEA 2V6TA 1I6HC 2WB1D 2Y0SL 1J6VA 1Y1WA 1WCMK 3PO3C 1K83K 4A3KC 3K7AK 2E2JK 2L3UA 4DDQA 1K83A 3GTKA 3GEEA 3RZOK 3I4NK 3HOUC 3CQZK 4Y52K 4A3JC 3I4MK 3FOEA 1TWFA 4X6AC 3TFHA 3A8IA 4LQYA 3GTGC 1I3QC 3RZDC 3GDZA 4LLGA 4GTEA 4A93C 3AD9C 3S1QK 4BY7K 1AB4A 1SFOA 1O27A 4YFNA 4C45A 2JA6K 1TWGA 1F7VA 1I50C 4KMAA 3S1NC 4RMFA 3DXJA 4GTFA 5HQHA 4LOWA 3WODA 4GTBA 5IYCK 4KMHA 2E2HK 1B4AA 2JA5A 4A3BK 4A3CC 3S15K 5TMFA 3PIOS 4A3IC 1BJTA 1TWHC 3IPJA 1EFWA 2GAGC 3GTLC 3GTPC 1IL2A 1O2BA 2W7VA 4GZYA 5IP9K 2EBBA 2NVYK 4WJ4A 4A3EC 4G7ZA 2NVQK 5HL7S 4BXXC 3AQPA 2CFAB 2JA8C 1VJEA 3H0GK 5C44K 2P5MA 3H0GA 3A8JA 2NVXA 1XXAA 4MEYA 1HQMA 2NVXK 4P5AA 3Q3QA 4A3LC 4KB2A 4C3IK 3N3YA 2YU9A 3BP8C 3HOVC 4KM9A 3HKZL 2CFAA 4QJVA 4A3DC 3N0BA 4KN7A 3S14C 1VH2A 4A3EK 4OIQA 1O29A 1J6XA 4QIWL 3TTGA 4MQ9A 3BP3A 2BE5A 3G4CA 4U67S 5FLMK 1R9TC 3CQZC 1I50A 5M3FK 2YU9C 3M4OC 1RU0A 2NVTK 2PMZL 4BKWA 4OIRA 4KASA 5CHPA 4BY1C 1ZBSA 4KC6A 4AYBD 4JK1A 4WILA 3FHZA 2JA7K 2P8TA 3S1RK 3S2DC 2KPUA 4A3GK 1X31C 5C4XC 3AD7C 3LYWA 1YX2A 4WCES 2GAHC 5C3EK 3S17C 4IO9S 1EI6A 1XXBA 2B63K 4C3JC 5M5YK 3PO2K 1WQFA 1SFOK 3OPFA 1L0WA 1ZYRA 2NVTC 5C4XK 1WQHA 1I6VA 5D4DA 4FZBA 2NVYC 3ERED 3HOYC 3OEPA 1O25A 4PAAA 1GE9A 1TWAC 3GTMK 1IS1A 1DD5A 1WCMA 2E2IC 1J98A 1O26A 1VRQC 1O24A 3HOXK 2CW0A 3GTGA 4XLNA 3K7AC 4A3KK 1J6WA 2KWAA 1YNJA 3FOFA 3TFJA 1KQ4A 4ZH4A 3HOZK 4G7HA 3RZOC 5C4JK 1I3QA 2KXYA 3LAPA 4NOIA 1PJ6A 3N0CA 2NVYA 5JVOA 3H3VD 1USMA 5IYBK 5M3MK 5IOTA 1XZQA
chains in the Genus database with same CATH topology
2E2IK 4MEXA 2NVXC 3GTLC 4BY1K 1I6HK 3GTPC 4GZYA 4C2MC 5IP9K 5IP9C 4C2MK 1BDFA 2VUMC 4A3MC 3M3YK 2NVYK 4BY7C 2Y0SD 4A3EC 2PA8L 2WB1L 3S16K 4G7ZA 1XPPA 3FKIK 2NVQK 4BXXC 4BXXK 4AYBL 3GTJK 4OINA 2JA8C 3GTKC 3S15C 4A3CK 2O5JA 2R93C 3H0GK 4YFKA 5C44K 2R93K 3GTQC 4LJZA 2A69A 3S1QC 4QJVB 3EQLA 2R7ZK 3PO2C 4BBRK 3HOWC 1Y1WK 1YNNA 4MEYA 1HQMA 2NVXK 3GTLK 1TWCC 1I3QK 1Y1VK 2JA5K 5C4JC 5IYBC 1R9TK 5M5XK 4KMUA 4A3LC 4A3LK 2E2HC 5IP7K 2YU9K 4C3IK 5IYDK 3S1RC 3HOVK 4XSXA 3HOVC 4A3BC 1Y1WC 3HKZL 3HOWK 4A3FK 2PMZD 1TWAK 4G7OA 2PA8D 2O5IA 4QJVA 4A3DC 3S2HK 1TWFK 3H3VL 4Y7NK 4KN7A 2PPBA 3S14C 3S14K 2JA7C 3GTJC 3PO3K 2R92C 4A3EK 4QIWD 3S16C 4OIQA 3GTQK 4A3FC 3M4OK 4QIWL 5IYCC 4A3DK 2WAQD 1TWGC 4MQ9A 4X6AK 2BE5A 4LK1A 4C3HC 4C3HK 5FLMK 4BBSC 5FLMC 3I4MC 5TMCA 4A3JK 4C3JK 3GTPK 1R9TC 3CQZC 3S17K 5M3FK 4Q5SA 5IP7C 2YU9C 3M4OC 2A68A 2NVTK 2PMZL 3GTOC 4A3IK 4OIRA 3GTMC 1TWHK 2A6EA 1SFOC 4BBRC 5M5WK 4Y7NC 4BY1C 1I6HC 2WB1D 2Y0SL 5FJ8K 3I4NC 4AYBD 1WCMK 3H0GC 5C44C 2B63C 4JK1A 3PO3C 4YFXA 4A3KC 5IYDC 1K83K 3K7AK 3S1RK 3S2DC 2WAQL 2E2JK 2R92K 3S2DK 4A3GK 1TWFC 3FKIC 2NVQC 5C4XC 3RZOK 1Y1VC 5C3EK 3I4NK 3HOUC 3S17C 3CQZK 3S1NK 4Y52K 4Y52C 4A3JC 2B63K 3I4MK 4C3JC 4C3IC 2JA7K 5M5YK 2R7ZC 3PO2K 1SFOK 3HOXC 4X6AC 1ZYRA 2NVTC 5C4XK 3GTGC 1TWCK 1I3QC 1SMYA 2JA5C 1I6VA 3RZDC 1I50K 5D4DA 4LLGA 4BBSK 1WCMC 3HOZC 4A93C 4XLPA 3S1QK 2NVYC 4BY7K 3HOYC 3HOYK 2VUMK 4OIPA 3M3YC 4LK0A 4A3MK 4YFNA 2JA6K 1TWAC 3GTMK 1I50C 1TWGK 3RZDK 2A6HA 3S1NC 2E2IC 5C3EC 4Q4ZA 3DXJA 3HOXK 4YG2A 2CW0A 4A3GC 1IW7A 2JA6C 4XLNA 3K7AC 4A3KK 2E2JC 3WODA 5IYCK 1YNJA 3S2HC 3HOUK 3S1MK 4OIOA 2E2HK 4ZH4A 3HOZK 4A93K 3HKZD 4G7HA 3RZOC 5C4JK 2JA8K 3GTKK 4A3BK 4NOIA 4A3CC 3S15K 5TMFA 3GTGK 4A3IC 1K83C 3H3VD 3GTOK 1TWHC 4KN4A 4XSZA 5IYBK 3S1MC 5M3MK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E2I K;  4MEX A;  2NVX C;  3GTL C;  4BY1 K;  1I6H K;  3GTP C;  4GZY A;  4C2M C;  5IP9 K;  5IP9 C;  4C2M K;  1BDF A;  2VUM C;  4A3M C;  3M3Y K;  2NVY K;  4BY7 C;  2Y0S D;  4A3E C;  2PA8 L;  2WB1 L;  3S16 K;  4G7Z A;  1XPP A;  3FKI K;  2NVQ K;  4BXX C;  4BXX K;  4AYB L;  3GTJ K;  4OIN A;  2JA8 C;  3GTK C;  3S15 C;  4A3C K;  2O5J A;  2R93 C;  3H0G K;  4YFK A;  5C44 K;  2R93 K;  3GTQ C;  4LJZ A;  2A69 A;  3S1Q C;  4QJV B;  3EQL A;  2R7Z K;  3PO2 C;  4BBR K;  3HOW C;  1Y1W K;  1YNN A;  4MEY A;  1HQM A;  2NVX K;  3GTL K;  1TWC C;  1I3Q K;  1Y1V K;  2JA5 K;  5C4J C;  5IYB C;  1R9T K;  5M5X K;  4KMU A;  4A3L C;  4A3L K;  2E2H C;  5IP7 K;  2YU9 K;  4C3I K;  5IYD K;  3S1R C;  3HOV K;  4XSX A;  3HOV C;  4A3B C;  1Y1W C;  3HKZ L;  3HOW K;  4A3F K;  2PMZ D;  1TWA K;  4G7O A;  2PA8 D;  2O5I A;  4QJV A;  4A3D C;  3S2H K;  1TWF K;  3H3V L;  4Y7N K;  4KN7 A;  2PPB A;  3S14 C;  3S14 K;  2JA7 C;  3GTJ C;  3PO3 K;  2R92 C;  4A3E K;  4QIW D;  3S16 C;  4OIQ A;  3GTQ K;  4A3F C;  3M4O K;  4QIW L;  5IYC C;  4A3D K;  2WAQ D;  1TWG C;  4MQ9 A;  4X6A K;  2BE5 A;  4LK1 A;  4C3H C;  4C3H K;  5FLM K;  4BBS C;  5FLM C;  3I4M C;  5TMC A;  4A3J K;  4C3J K;  3GTP K;  1R9T C;  3CQZ C;  3S17 K;  5M3F K;  4Q5S A;  5IP7 C;  2YU9 C;  3M4O C;  2A68 A;  2NVT K;  2PMZ L;  3GTO C;  4A3I K;  4OIR A;  3GTM C;  1TWH K;  2A6E A;  1SFO C;  4BBR C;  5M5W K;  4Y7N C;  4BY1 C;  1I6H C;  2WB1 D;  2Y0S L;  5FJ8 K;  3I4N C;  4AYB D;  1WCM K;  3H0G C;  5C44 C;  2B63 C;  4JK1 A;  3PO3 C;  4YFX A;  4A3K C;  5IYD C;  1K83 K;  3K7A K;  3S1R K;  3S2D C;  2WAQ L;  2E2J K;  2R92 K;  3S2D K;  4A3G K;  1TWF C;  3FKI C;  2NVQ C;  5C4X C;  3RZO K;  1Y1V C;  5C3E K;  3I4N K;  3HOU C;  3S17 C;  3CQZ K;  3S1N K;  4Y52 K;  4Y52 C;  4A3J C;  2B63 K;  3I4M K;  4C3J C;  4C3I C;  2JA7 K;  5M5Y K;  2R7Z C;  3PO2 K;  1SFO K;  3HOX C;  4X6A C;  1ZYR A;  2NVT C;  5C4X K;  3GTG C;  1TWC K;  1I3Q C;  1SMY A;  2JA5 C;  1I6V A;  3RZD C;  1I50 K;  5D4D A;  4LLG A;  4BBS K;  1WCM C;  3HOZ C;  4A93 C;  4XLP A;  3S1Q K;  2NVY C;  4BY7 K;  3HOY C;  3HOY K;  2VUM K;  4OIP A;  3M3Y C;  4LK0 A;  4A3M K;  4YFN A;  2JA6 K;  1TWA C;  3GTM K;  1I50 C;  1TWG K;  3RZD K;  2A6H A;  3S1N C;  2E2I C;  5C3E C;  4Q4Z A;  3DXJ A;  3HOX K;  4YG2 A;  2CW0 A;  4A3G C;  1IW7 A;  2JA6 C;  4XLN A;  3K7A C;  4A3K K;  2E2J C;  3WOD A;  5IYC K;  1YNJ A;  3S2H C;  3HOU K;  3S1M K;  4OIO A;  2E2H K;  4ZH4 A;  3HOZ K;  4A93 K;  3HKZ D;  4G7H A;  3RZO C;  5C4J K;  2JA8 K;  3GTK K;  4A3B K;  4NOI A;  4A3C C;  3S15 K;  5TMF A;  3GTG K;  4A3I C;  1K83 C;  3H3V D;  3GTO K;  1TWH C;  4KN4 A;  4XSZ A;  5IYB K;  3S1M C;  5M3M K; 
#chains in the Genus database with same CATH topology
 3T02 A;  4O2D A;  2E2H A;  4C2M K;  2VUM C;  4XCH A;  3S16 K;  1F7U A;  3FKI K;  3FKI A;  1ZVU A;  2Y3P A;  3GTK C;  1O2A A;  3S0X A;  1UV7 A;  3GTQ C;  5IOS A;  4LJZ A;  2A69 A;  3EQL A;  1Y1W K;  4KM8 A;  3GTL A;  3SZY A;  1TWC C;  1TWH A;  5C4J C;  5M5X K;  2E2H C;  3GTO A;  1WIH A;  1WOO A;  3HOV K;  3GEI A;  3HOW K;  4BLA A;  2ZJQ S;  5CJ9 A;  2PMZ D;  1TWA K;  4A3F K;  4P5B A;  1TWF K;  3H3V L;  4Y7N K;  2FQT A;  3S14 K;  4LR2 A;  3A8K A;  3S16 C;  3GTQ K;  4A3F C;  2FQO A;  1DCH A;  3BUE A;  1TWG C;  4LK1 A;  4C3H C;  3VA7 A;  5TMC A;  2A68 A;  3GTM C;  1SFO C;  1IBA A;  1WSR A;  3AD8 C;  5FJ8 K;  1ZQ1 C;  5IOR A;  3I4N C;  2V6S A;  2B63 A;  3G4A A;  4YFX A;  5IYD C;  3S2D K;  1ZXO A;  4BLB A;  2JH3 A;  1TWF C;  3FKI C;  3SZZ A;  1Y1V C;  3LPX A;  1IE0 A;  4P9S A;  2R7Z C;  3HOX C;  4WFB S;  3GTM A;  1FEU A;  1TWC K;  1SMY A;  1I50 K;  2XCQ A;  3HOZ C;  3T00 A;  3HOY K;  2JA6 A;  3M3Y C;  3NUH A;  4A3M K;  3RZD K;  1TWG K;  4GTA A;  4M1X A;  2D6F C;  3AH5 A;  2A6H A;  1WOP A;  2RH6 A;  4YG2 A;  1YCL A;  1WOR A;  5EGE A;  1IW7 A;  2JA6 C;  1BS2 A;  1WSV A;  1XZQ B;  4ILD A;  3S2H C;  3HOU K;  4OIO A;  1XZP B;  5EGH A;  3GTK K;  2ZJP S;  1EQR A;  5HL8 A;  5DM7 S;  3GTG K;  1K83 C;  3GTO K;  4XSZ A;  4GTL A;  5E68 A;  1DCP A;  1HI9 A;  2E2I K;  4BY1 K;  1I6H K;  3AQO A;  2XCO A;  4C2M C;  4PAB A;  4A3M C;  1TWC A;  3M3Y K;  2Y0S D;  1V5V A;  2PA8 L;  2WB1 L;  1Y1V A;  1XPP A;  4WJ3 M;  3GTQ A;  4AYB L;  3L4K A;  1G51 A;  4OIN A;  2R93 C;  4KDD A;  4YFK A;  2R7Z A;  4QJV B;  3S1Q C;  2R7Z K;  3PO2 C;  2GSO A;  4BBR K;  3L4J A;  2V6U A;  1I3Q K;  5L46 A;  1R9T K;  4KMU A;  2YU9 K;  1PJ5 A;  2GSU A;  3TFI A;  5IYD K;  2ZFZ A;  1DCO A;  4G7O A;  3S2H K;  2JA7 C;  5TJ3 A;  2R92 C;  3CQZ A;  2E2I A;  3M4O K;  1USO A;  5IYC C;  4A3D K;  1TWA A;  2R93 A;  4C3H K;  4C3J K;  3GTP K;  2RGR A;  4WF9 S;  4KB4 A;  1XZP A;  3GTO C;  4WFA S;  4G0V A;  1TWH K;  2A6E A;  4GT9 A;  3ORE A;  4Y7N C;  5M5W K;  2KQ1 A;  3CF5 S;  4J3N A;  3H0G C;  5C44 C;  1JVI A;  2B63 C;  3ADA C;  2R92 K;  1F93 A;  2WAQ L;  3GIR A;  2NVQ C;  1O2F B;  1VLO A;  1BGW A;  3S1N K;  4WFN S;  4Y52 C;  4GTC A;  4C3I C;  3DLL S;  1VGX A;  2JA5 C;  4KAT A;  2ZUE A;  4BBS K;  1WCM C;  4IOC S;  4XLP A;  1PJ7 A;  2L5N A;  5JVG S;  3GTJ A;  2VUM A;  2VUM K;  4OIP A;  4KMD A;  4LK0 A;  1JOE A;  2PHC B;  4GFQ A;  3HXA A;  3GSI A;  5JVH S;  5C3E C;  4Q4Z A;  1WQG A;  4IOA S;  4A3G C;  2E2J C;  2ZJR S;  3S1M K;  3PIP S;  2JA7 A;  4A93 K;  3HKZ D;  2JA8 K;  3QX3 A;  5DM6 S;  4KN4 A;  3S1M C;  1O28 A;  4MEX A;  2NVX C;  3JST A;  1INN A;  5IP9 C;  1BDF A;  1XXC A;  3GEH A;  4BY7 C;  1WOS A;  4GTD A;  4BXX K;  3CAG A;  1R9T A;  1EK8 A;  3GTJ K;  4AH6 A;  4FM9 A;  3S15 C;  4A3C K;  2O5J A;  2R93 K;  4G0U A;  4KAR A;  1B4B A;  3GTP A;  4G0W A;  1EH1 A;  2XCR B;  3HOW C;  1YNN A;  1F9N A;  3GTL K;  1IQ0 A;  2JA5 K;  1Y1V K;  5IOQ A;  5IYB C;  4KAW X;  4A3L K;  5IP7 K;  3MML B;  3S1R C;  4XSX A;  4A3B C;  2ZUF A;  1Y1W C;  2PA8 D;  2O5I A;  2R92 A;  3LAJ A;  2PPB A;  1JQW A;  3PO3 K;  3GTJ C;  4QIW D;  3T01 A;  1C0A A;  2WAQ D;  4X6A K;  3V4G A;  4BBS C;  5FLM C;  1ISE A;  3I4M C;  4A3J K;  2GSN A;  3S17 K;  4Q5S A;  5IP7 C;  4A3I K;  4BBR C;  5JFE A;  2V6T A;  1I6H C;  2WB1 D;  2Y0S L;  1J6V A;  1Y1W A;  1WCM K;  3PO3 C;  1K83 K;  4A3K C;  3K7A K;  2E2J K;  2L3U A;  4DDQ A;  1K83 A;  3GTK A;  3GEE A;  3RZO K;  3I4N K;  3HOU C;  3CQZ K;  4Y52 K;  4A3J C;  3I4M K;  3FOE A;  1TWF A;  4X6A C;  3TFH A;  3A8I A;  4LQY A;  3GTG C;  1I3Q C;  3RZD C;  3GDZ A;  4LLG A;  4GTE A;  4A93 C;  3AD9 C;  3S1Q K;  4BY7 K;  1AB4 A;  1SFO A;  1O27 A;  4YFN A;  4C45 A;  2JA6 K;  1TWG A;  1F7V A;  1I50 C;  4KMA A;  3S1N C;  4RMF A;  3DXJ A;  4GTF A;  5HQH A;  4LOW A;  3WOD A;  4GTB A;  5IYC K;  4KMH A;  2E2H K;  1B4A A;  2JA5 A;  4A3B K;  4A3C C;  3S15 K;  5TMF A;  3PIO S;  4A3I C;  1BJT A;  1TWH C;  3IPJ A;  1EFW A;  2GAG C;  3GTL C;  3GTP C;  1IL2 A;  1O2B A;  2W7V A;  4GZY A;  5IP9 K;  2EBB A;  2NVY K;  4WJ4 A;  4A3E C;  4G7Z A;  2NVQ K;  5HL7 S;  4BXX C;  3AQP A;  2CFA B;  2JA8 C;  1VJE A;  3H0G K;  5C44 K;  2P5M A;  3H0G A;  3A8J A;  2NVX A;  1XXA A;  4MEY A;  1HQM A;  2NVX K;  4P5A A;  3Q3Q A;  4A3L C;  4KB2 A;  4C3I K;  3N3Y A;  2YU9 A;  3BP8 C;  3HOV C;  4KM9 A;  3HKZ L;  2CFA A;  4QJV A;  4A3D C;  3N0B A;  4KN7 A;  3S14 C;  1VH2 A;  4A3E K;  4OIQ A;  1O29 A;  1J6X A;  4QIW L;  3TTG A;  4MQ9 A;  3BP3 A;  2BE5 A;  3G4C A;  4U67 S;  5FLM K;  1R9T C;  3CQZ C;  1I50 A;  5M3F K;  2YU9 C;  3M4O C;  1RU0 A;  2NVT K;  2PMZ L;  4BKW A;  4OIR A;  4KAS A;  5CHP A;  4BY1 C;  1ZBS A;  4KC6 A;  4AYB D;  4JK1 A;  4WIL A;  3FHZ A;  2JA7 K;  2P8T A;  3S1R K;  3S2D C;  2KPU A;  4A3G K;  1X31 C;  5C4X C;  3AD7 C;  3LYW A;  1YX2 A;  4WCE S;  2GAH C;  5C3E K;  3S17 C;  4IO9 S;  1EI6 A;  1XXB A;  2B63 K;  4C3J C;  5M5Y K;  3PO2 K;  1WQF A;  1SFO K;  3OPF A;  1L0W A;  1ZYR A;  2NVT C;  5C4X K;  1WQH A;  1I6V A;  5D4D A;  4FZB A;  2NVY C;  3ERE D;  3HOY C;  3OEP A;  1O25 A;  4PAA A;  1GE9 A;  1TWA C;  3GTM K;  1IS1 A;  1DD5 A;  1WCM A;  2E2I C;  1J98 A;  1O26 A;  1VRQ C;  1O24 A;  3HOX K;  2CW0 A;  3GTG A;  4XLN A;  3K7A C;  4A3K K;  1J6W A;  2KWA A;  1YNJ A;  3FOF A;  3TFJ A;  1KQ4 A;  4ZH4 A;  3HOZ K;  4G7H A;  3RZO C;  5C4J K;  1I3Q A;  2KXY A;  3LAP A;  4NOI A;  1PJ6 A;  3N0C A;  2NVY A;  5JVO A;  3H3V D;  1USM A;  5IYB K;  5M3M K;  5IOT A;  1XZQ A; 
#chains in the Genus database with same CATH homology
 2E2I K;  4MEX A;  2NVX C;  3GTL C;  4BY1 K;  1I6H K;  3GTP C;  4GZY A;  4C2M C;  5IP9 K;  5IP9 C;  4C2M K;  1BDF A;  2VUM C;  4A3M C;  3M3Y K;  2NVY K;  4BY7 C;  2Y0S D;  4A3E C;  2PA8 L;  2WB1 L;  3S16 K;  4G7Z A;  1XPP A;  3FKI K;  2NVQ K;  4BXX C;  4BXX K;  4AYB L;  3GTJ K;  4OIN A;  2JA8 C;  3GTK C;  3S15 C;  4A3C K;  2O5J A;  2R93 C;  3H0G K;  4YFK A;  5C44 K;  2R93 K;  3GTQ C;  4LJZ A;  2A69 A;  3S1Q C;  4QJV B;  3EQL A;  2R7Z K;  3PO2 C;  4BBR K;  3HOW C;  1Y1W K;  1YNN A;  4MEY A;  1HQM A;  2NVX K;  3GTL K;  1TWC C;  1I3Q K;  1Y1V K;  2JA5 K;  5C4J C;  5IYB C;  1R9T K;  5M5X K;  4KMU A;  4A3L C;  4A3L K;  2E2H C;  5IP7 K;  2YU9 K;  4C3I K;  5IYD K;  3S1R C;  3HOV K;  4XSX A;  3HOV C;  4A3B C;  1Y1W C;  3HKZ L;  3HOW K;  4A3F K;  2PMZ D;  1TWA K;  4G7O A;  2PA8 D;  2O5I A;  4QJV A;  4A3D C;  3S2H K;  1TWF K;  3H3V L;  4Y7N K;  4KN7 A;  2PPB A;  3S14 C;  3S14 K;  2JA7 C;  3GTJ C;  3PO3 K;  2R92 C;  4A3E K;  4QIW D;  3S16 C;  4OIQ A;  3GTQ K;  4A3F C;  3M4O K;  4QIW L;  5IYC C;  4A3D K;  2WAQ D;  1TWG C;  4MQ9 A;  4X6A K;  2BE5 A;  4LK1 A;  4C3H C;  4C3H K;  5FLM K;  4BBS C;  5FLM C;  3I4M C;  5TMC A;  4A3J K;  4C3J K;  3GTP K;  1R9T C;  3CQZ C;  3S17 K;  5M3F K;  4Q5S A;  5IP7 C;  2YU9 C;  3M4O C;  2A68 A;  2NVT K;  2PMZ L;  3GTO C;  4A3I K;  4OIR A;  3GTM C;  1TWH K;  2A6E A;  1SFO C;  4BBR C;  5M5W K;  4Y7N C;  4BY1 C;  1I6H C;  2WB1 D;  2Y0S L;  5FJ8 K;  3I4N C;  4AYB D;  1WCM K;  3H0G C;  5C44 C;  2B63 C;  4JK1 A;  3PO3 C;  4YFX A;  4A3K C;  5IYD C;  1K83 K;  3K7A K;  3S1R K;  3S2D C;  2WAQ L;  2E2J K;  2R92 K;  3S2D K;  4A3G K;  1TWF C;  3FKI C;  2NVQ C;  5C4X C;  3RZO K;  1Y1V C;  5C3E K;  3I4N K;  3HOU C;  3S17 C;  3CQZ K;  3S1N K;  4Y52 K;  4Y52 C;  4A3J C;  2B63 K;  3I4M K;  4C3J C;  4C3I C;  2JA7 K;  5M5Y K;  2R7Z C;  3PO2 K;  1SFO K;  3HOX C;  4X6A C;  1ZYR A;  2NVT C;  5C4X K;  3GTG C;  1TWC K;  1I3Q C;  1SMY A;  2JA5 C;  1I6V A;  3RZD C;  1I50 K;  5D4D A;  4LLG A;  4BBS K;  1WCM C;  3HOZ C;  4A93 C;  4XLP A;  3S1Q K;  2NVY C;  4BY7 K;  3HOY C;  3HOY K;  2VUM K;  4OIP A;  3M3Y C;  4LK0 A;  4A3M K;  4YFN A;  2JA6 K;  1TWA C;  3GTM K;  1I50 C;  1TWG K;  3RZD K;  2A6H A;  3S1N C;  2E2I C;  5C3E C;  4Q4Z A;  3DXJ A;  3HOX K;  4YG2 A;  2CW0 A;  4A3G C;  1IW7 A;  2JA6 C;  4XLN A;  3K7A C;  4A3K K;  2E2J C;  3WOD A;  5IYC K;  1YNJ A;  3S2H C;  3HOU K;  3S1M K;  4OIO A;  2E2H K;  4ZH4 A;  3HOZ K;  4A93 K;  3HKZ D;  4G7H A;  3RZO C;  5C4J K;  2JA8 K;  3GTK K;  4A3B K;  4NOI A;  4A3C C;  3S15 K;  5TMF A;  3GTG K;  4A3I C;  1K83 C;  3H3V D;  3GTO K;  1TWH C;  4KN4 A;  4XSZ A;  5IYB K;  3S1M C;  5M3M K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...