4Q5SA

Thermus thermophilus rna polymerase initially transcribing complex containing 6-mer rna
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
226
structure length
226
Chain Sequence
b'SKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase subunit alpha
publication title Structural basis of transcription initiation by bacterial RNA polymerase holoenzyme.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Transcription/dna/rna
total genus 41
structure length 226
sequence length 226
chains with identical sequence B
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2014-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01000 RNA_pol_A_bac RNA polymerase Rpb3/RpoA insert domain
A PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain
A PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.12 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 DNA-directed RNA polymerase, insert domain 4q5sA02
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 4q5sA01
4A3BC 3RZDC 2NVQK 2A69A 4GZYA 4A3DK 3HOZK 2Y0SD 2B63C 4Q4ZA 2R93C 3S15K 4Y52C 3GTMC 3PO2C 5IP7K 3RZOK 3S17K 3S2HK 3I4NC 3FKIC 3S14K 4C3HC 5M3MK 5IP9C 3M3YK 4OIPA 4G7ZA 2O5IA 4AYBD 4A3MC 1I50K 2YU9K 4A3BK 3RZDK 4QJVA 3H3VL 1I3QC 3M4OC 1YNJA 2B63K 2A6HA 4JK1A 5IYBC 2R93K 3GTGC 3GTMK 3PO2K 4NOIA 3I4NK 3FKIK 1TWCC 4Y7NC 4OIQA 3CQZC 4C3HK 5IP9K 2NVYC 3GTJC 1TWAC 2R92C 4A3MK 1TWGC 4C3IC 2JA8C 3HOYC 1I3QK 3M4OK 4OINA 4A3LC 5IYBK 3K7AC 2PPBA 5FJ8K 3GTGK 1SMYA 3PO3C 2E2IC 1TWCK 3CQZK 1IW7A 1K83C 2YU9C 3H3VD 1TWAK 2NVYK 3GTJK 2R92K 1TWGK 4C3IK 3HOUC 2JA8K 3HOYK 4A3LK 4QJVB 4BY7C 3K7AK 4A3KC 2VUMC 3PO3K 5C4JC 2E2IK 2E2HC 1Y1VC 3I4MC 1K83K 3GTPC 4XLNA 3HOXC 3HOVC 1BDFA 3HOUK 4Y52K 3GTOC 4C2MC 5FLMC 4BY7K 2NVTC 2JA6C 4A3KK 5C3EC 4BBSC 2VUMK 4LK0A 4BBRC 4LJZA 4A3CC 1Y1VK 2E2HK 4A3CK 3I4MK 5TMCA 5TMFA 4YFXA 2NVXC 3GTKC 3S2DC 3HOXK 3GTPK 3HOVK 3GTLC 3GTOK 2R7ZC 5IYDC 4OIRA 4C2MK 4Q5SA 2BE5A 1TWHC 5FLMK 4Y7NK 5M3FK 2NVTK 2JA6K 3DXJA 3S1MC 1HQMA 4A3JC 5C3EK 2A68A 4BBSK 4XSXA 1XPPA 3EQLA 4G7HA 4QIWL 4BBRK 2WB1D 2E2JC 5M5YK 3GTKK 2NVXK 4BY1C 3S2DK 4KN4A 3WODA 3H0GC 3S16C 3GTLK 5IYCC 4A3EC 2R7ZK 5IYDK 3S1RC 4A93C 4YG2A 1TWHK 3HOWC 1Y1WC 5M5WK 3S1MK 4A3IC 4MEXA 2CW0A 4C3JC 2WAQL 2WB1L 4LLGA 4A3JK 2A6EA 3GTQC 2E2JK 1ZYRA 3S1QC 3S1NC 4BY1K 1TWFC 2PMZL 3H0GK 4XSZA 2PA8L 4A3GC 4MQ9A 3S16K 4YFNA 4OIOA 4XLPA 5IYCK 5C4JK 5C44C 2JA7C 4A3EK 3S1RK 4KMUA 3HOWK 4A93K 1I6HC 1Y1WK 4QIWD 1WCMC 4A3IK 4C3JK 1I6VA 3HKZD 4A3FC 3GTQK 1YNNA 3S1NK 3S1QK 1TWFK 4BXXC 4MEYA 5D4DA 4A3GK 4ZH4A 5C44K 2JA7K 2WAQD 5C4XC 2Y0SL 1I6HK 4X6AC 1R9TC 3HKZL 1WCMK 2O5JA 1SFOC 4A3FK 2PMZD 2JA5C 4G7OA 2PA8D 2NVQC 4YFKA 4KN7A 4LK1A 4AYBL 5M5XK 4A3DC 4BXXK 3HOZC 3S15C 5IP7C 3S17C 3RZOC 5C4XK 3S2HC 4X6AK 1R9TK 3S14C 3M3YC 1SFOK 2JA5K 1I50C
chains in the Genus database with same CATH superfamily
1JQWA 3HOZK 2Y0SD 1GE9A 2R93C 3S17K 3S2HK 1XXAA 3VA7A 1B4BA 3H0GA 2PHCB 4AYBD 1I50K 2VUMA 2EBBA 1YNJA 2B63K 1Y1WA 2V6SA 4JK1A 1EQRA 1WQHA 3FHZA 1ZXOA 3FKIK 4Y7NC 4OIQA 3CQZC 1O28A 3N0BA 2NVYC 4GTDA 4A3MK 1B4AA 4C3IC 3PIOS 3TFJA 2JA8C 1I3QK 2NVXA 5IYBK 2PPBA 3GTGK 1TWCK 1INNA 1TWAK 4O2DA 1TWGK 3HOUC 4DDQA 4A3LK 1EK8A 4QJVB 1VLOA 5C4JC 2E2IK 1JVIA 1K83K 3GTPC 1BDFA 1WOOA 4GTEA 1YCLA 2P8TA 1RU0A 3GTKC 5TMFA 3HOXK 1WCMA 3GTOK 1PJ5A 5IYDC 4C2MK 5EGHA 2KPUA 2JA6K 2KQ1A 5C3EK 5JFEA 1I3QA 4BY1C 1DCPA 3GTLK 1DCHA 3S1RC 4A93C 1USOA 3L4JA 3Q3QA 2WAQL 2CW0A 4C3JC 2W7VA 1HI9A 4LLGA 1TWGA 2A6EA 3OEPA 2PMZL 4XSZA 3S16K 4A3GC 4GTCA 4XLPA 5IYCK 2YU9A 5C44C 2JA7C 4QIWD 2ZUEA 1I6VA 4KMHA 4A3FC 3GTMA 3GTQK 3SZZA 1O25A 4LOWA 4GTAA 4ZH4A 1O29A 4KB2A 3GSIA 5HQHA 4X6AC 4GT9A 2O5JA 2FQTA 1SFOC 2JA5C 1WORA 2PA8D 2NVQC 4KAWX 4BXXK 1C0AA 4P5AA 3GTJA 2KXYA 3S15C 3AD9C 1R9TK 3S14C 5JVOA 1EH1A 4A3BC 4G0WA 3RZDC 4G0VA 2A69A 4WCES 1L0WA 4A3DK 4Q4ZA 2CFAA 3PO2C 1XZQB 3I4NC 2GAGC 4LQYA 4C3HC 1VJEA 1XZPB 5M3MK 2D6FC 1F7VA 1F7UA 3M4OC 1Y1VA 2E2HA 1WOSA 2A6HA 2R93K 1O27A 4NOIA 4IOAS 2R92C 3HOYC 3G4CA 3JSTA 1BS2A 3K7AC 2XCOA 3FOEA 3PO3C 2R7ZA 1FEUA 4KC6A 3CQZK 1TWHA 2NVYK 4C3IK 2JA8K 3A8IA 4A3KC 1DD5A 2VUMC 1UV7A 4G0UA 1IL2A 3HOUK 4Y52K 3FOFA 5FLMC 4BLBA 3ADAC 1TWFA 2NVTC 4BBSC 4BBRC 4A3CC 1PJ7A 4GFQA 1WIHA 3GTPK 3PIPS 2NVXC 3S2DC 3HXAA 4KM9A 1WQFA 4Q5SA 3S1MC 1HQMA 4LR2A 1XPPA 4G7HA 2E2JC 5M5YK 5L46A 3GTKK 4KN4A 3WODA 5IYDK 4YG2A 3BP3A 2RGRA 4KMDA 3LPXA 4FM9A 3S1NC 4BY1K 4YFNA 1I50A 3S1RK 4A93K 1I6HC 3OREA 4WFBS 1WCMC 2B63A 4C3JK 2GAHC 3DLLS 3HKZD 2P5MA 3LAPA 3FKIA 4MEYA 4A3GK 5C44K 2JA7K 2WAQD 5C4XC 3CF5S 3HKZL 3GTPA 4A3FK 3GTGA 2PMZD 1TWCA 4KN7A 1J6XA 3AH5A 1TWAA 3LYWA 3G4AA 5IP7C 3RZOC 4X6AK 3M3YC 1SFOK 4KDDA 1VH2A 4WFAS 2YU9C 2JA5K 2NVQK 2E2IA 3N0CA 1K83A 4C45A 3S15K 3GTMC 1O2AA 3S14K 3BUEA 5IP9C 4OIPA 2O5IA 1ISEA 4A3BK 3RZDK 3IPJA 3H3VL 4KARA 4FZBA 3AD7C 1EI6A 4AH6A 3PO2K 3GTOA 3I4NK 4C3HK 1J6WA 3BP8C 4KASA 3GTJC 4J3NA 2JA6A 1ZQ1C 3M4OK 4OINA 2ZJPS 1JOEA 5IOSA 2L5NA 5IORA 3GTLA 1SMYA 4BKWA 2CFAB 2R92K 2KWAA 1ZBSA 3HOYK 2V6TA 2V6UA 5DM7S 4BY7C 3K7AK 3PO3K 1EFWA 2E2HC 1Y1VC 1G51A 4KB4A 4P9SA 3I4MC 1YX2A 3T01A 4XLNA 3HOVC 1F93A 3A8KA 4KMAA 1O26A 2XCRB 3GTQA 4A3KK 2VUMK 4M1XA 1BGWA 4LK0A 5TMCA 1IQ0A 2R7ZC 3GEEA 4OIRA 5FLMK 4Y7NK 2BE5A 1TWHC 2Y3PA 2ZFZA 2NVTK 3DXJA 4A3JC 3T00A 4BBSK 4XCHA 4BBRK 4A3CK 3EQLA 2NVXK 3S2DK 1R9TA 1PJ6A 3H0GC 3A8JA 1ZVUA 4A3EC 3HOWC 5IOTA 1Y1WC 5M5WK 3S1MK 4A3IC 4MEXA 3V4GA 3S0XA 2E2JK 1ZYRA 3S1QC 1TWFC 3GEIA 5C4JK 5JVGS 5HL7S 4PABA 4WILA 2R93A 4WJ3M 1USMA 4KM8A 3TFHA 5JVHS 3S1NK 5D4DA 1O24A 2Y0SL 1I6HK 1WCMK 1XXBA 4WJ4A 4G7OA 4LK1A 4AYBL 3CQZA 3HOZC 2NVYA 3S17C 5C4XK 3S2HC 4U67S 1WSRA 4GTBA 5IOQA 1I50C 2ZUFA 4BLAA 1DCOA 4GZYA 2B63C 4Y52C 4GTLA 5IP7K 1AB4A 1IE0A 3RZOK 2ZJRS 3SZYA 3FKIC 3M3YK 4G7ZA 3MMLB 4A3MC 2YU9K 4QJVA 1I3QC 2GSUA 5IYBC 3GTGC 3GTMK 1TWCC 1IBAA 5IP9K 1TWAC 1TWGC 4P5BA 5E68A 2ZJQS 4A3LC 3AD8C 3GTKA 3T02A 5FJ8K 3N3YA 2E2IC 3NUHA 1IW7A 5CJ9A 4GTFA 1K83C 3H3VD 3GTJK 1F9NA 3L4KA 5EGEA 4KATA 3TFIA 3HOXC 3GTOC 4C2MC 5TJ3A 4BY7K 2JA6C 5C3EC 2E2HK 4LJZA 1Y1VK 2JA7A 3ERED 3I4MK 4YFXA 3HOVK 5HL8A 3GTLC 1VGXA 1V5VA 5M3FK 2FQOA 2A68A 3AQPA 3AQOA 5DM6S 4XSXA 4QIWL 2RH6A 2WB1D 4WFNS 1WQGA 3S16C 1X31C 5IYCC 1SFOA 4PAAA 2XCQA 2R7ZK 2JA5A 4ILDA 1TWHK 3QX3A 3OPFA 4A3JK 2WB1L 1KQ4A 3GTQC 3H0GK 2L3UA 2JH3A 2PA8L 4MQ9A 3TTGA 2GSNA 4OIOA 4A3EK 4KMUA 3HOWK 1Y1WK 4A3IK 4IOCS 1YNNA 3S1QK 1TWFK 1BJTA 4BXXC 3GEHA 1O2FB 3GDZA 1XZQA 1J98A 1WOPA 1XZPA 1R9TC 3GIRA 1VRQC 1WSVA 4IO9S 4YFKA 5M5XK 4WF9S 4A3DC 2GSOA 3LAJA 2R92A 5CHPA 1J6VA 1O2BA 4RMFA 1IS1A 1XXCA 3CAGA
chains in the Genus database with same CATH topology
4A3BC 3RZDC 2NVQK 2A69A 4GZYA 4A3DK 3HOZK 2Y0SD 2B63C 4Q4ZA 2R93C 3S15K 4Y52C 3GTMC 3PO2C 5IP7K 3RZOK 3S17K 3S2HK 3I4NC 3FKIC 3S14K 4C3HC 5M3MK 5IP9C 3M3YK 4OIPA 4G7ZA 2O5IA 4AYBD 4A3MC 1I50K 2YU9K 4A3BK 3RZDK 4QJVA 3H3VL 1I3QC 3M4OC 1YNJA 2B63K 2A6HA 4JK1A 5IYBC 2R93K 3GTGC 3GTMK 3PO2K 4NOIA 3I4NK 3FKIK 1TWCC 4Y7NC 4OIQA 3CQZC 4C3HK 5IP9K 2NVYC 3GTJC 1TWAC 2R92C 4A3MK 1TWGC 4C3IC 2JA8C 3HOYC 1I3QK 3M4OK 4OINA 4A3LC 5IYBK 3K7AC 2PPBA 5FJ8K 3GTGK 1SMYA 3PO3C 2E2IC 1TWCK 3CQZK 1IW7A 1K83C 2YU9C 3H3VD 1TWAK 2NVYK 3GTJK 2R92K 1TWGK 4C3IK 3HOUC 2JA8K 3HOYK 4A3LK 4QJVB 4BY7C 3K7AK 4A3KC 2VUMC 3PO3K 5C4JC 2E2IK 2E2HC 1Y1VC 3I4MC 1K83K 3GTPC 4XLNA 3HOXC 3HOVC 1BDFA 3HOUK 4Y52K 3GTOC 4C2MC 5FLMC 4BY7K 2NVTC 2JA6C 4A3KK 5C3EC 4BBSC 2VUMK 4LK0A 4BBRC 4LJZA 4A3CC 1Y1VK 2E2HK 4A3CK 3I4MK 5TMCA 5TMFA 4YFXA 2NVXC 3GTKC 3S2DC 3HOXK 3GTPK 3HOVK 3GTLC 3GTOK 2R7ZC 5IYDC 4OIRA 4C2MK 4Q5SA 2BE5A 1TWHC 5FLMK 4Y7NK 5M3FK 2NVTK 2JA6K 3DXJA 3S1MC 1HQMA 4A3JC 5C3EK 2A68A 4BBSK 4XSXA 1XPPA 3EQLA 4G7HA 4QIWL 4BBRK 2WB1D 2E2JC 5M5YK 3GTKK 2NVXK 4BY1C 3S2DK 4KN4A 3WODA 3H0GC 3S16C 3GTLK 5IYCC 4A3EC 2R7ZK 5IYDK 3S1RC 4A93C 4YG2A 1TWHK 3HOWC 1Y1WC 5M5WK 3S1MK 4A3IC 4MEXA 2CW0A 4C3JC 2WAQL 2WB1L 4LLGA 4A3JK 2A6EA 3GTQC 2E2JK 1ZYRA 3S1QC 3S1NC 4BY1K 1TWFC 2PMZL 3H0GK 4XSZA 2PA8L 4A3GC 4MQ9A 3S16K 4YFNA 4OIOA 4XLPA 5IYCK 5C4JK 5C44C 2JA7C 4A3EK 3S1RK 4KMUA 3HOWK 4A93K 1I6HC 1Y1WK 4QIWD 1WCMC 4A3IK 4C3JK 1I6VA 3HKZD 4A3FC 3GTQK 1YNNA 3S1NK 3S1QK 1TWFK 4BXXC 4MEYA 5D4DA 4A3GK 4ZH4A 5C44K 2JA7K 2WAQD 5C4XC 2Y0SL 1I6HK 4X6AC 1R9TC 3HKZL 1WCMK 2O5JA 1SFOC 4A3FK 2PMZD 2JA5C 4G7OA 2PA8D 2NVQC 4YFKA 4KN7A 4LK1A 4AYBL 5M5XK 4A3DC 4BXXK 3HOZC 3S15C 5IP7C 3S17C 3RZOC 5C4XK 3S2HC 4X6AK 1R9TK 3S14C 3M3YC 1SFOK 2JA5K 1I50C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A3B C;  3RZD C;  2NVQ K;  2A69 A;  4GZY A;  4A3D K;  3HOZ K;  2Y0S D;  2B63 C;  4Q4Z A;  2R93 C;  3S15 K;  4Y52 C;  3GTM C;  3PO2 C;  5IP7 K;  3RZO K;  3S17 K;  3S2H K;  3I4N C;  3FKI C;  3S14 K;  4C3H C;  5M3M K;  5IP9 C;  3M3Y K;  4OIP A;  4G7Z A;  2O5I A;  4AYB D;  4A3M C;  1I50 K;  2YU9 K;  4A3B K;  3RZD K;  4QJV A;  3H3V L;  1I3Q C;  3M4O C;  1YNJ A;  2B63 K;  2A6H A;  4JK1 A;  5IYB C;  2R93 K;  3GTG C;  3GTM K;  3PO2 K;  4NOI A;  3I4N K;  3FKI K;  1TWC C;  4Y7N C;  4OIQ A;  3CQZ C;  4C3H K;  5IP9 K;  2NVY C;  3GTJ C;  1TWA C;  2R92 C;  4A3M K;  1TWG C;  4C3I C;  2JA8 C;  3HOY C;  1I3Q K;  3M4O K;  4OIN A;  4A3L C;  5IYB K;  3K7A C;  2PPB A;  5FJ8 K;  3GTG K;  1SMY A;  3PO3 C;  2E2I C;  1TWC K;  3CQZ K;  1IW7 A;  1K83 C;  2YU9 C;  3H3V D;  1TWA K;  2NVY K;  3GTJ K;  2R92 K;  1TWG K;  4C3I K;  3HOU C;  2JA8 K;  3HOY K;  4A3L K;  4QJV B;  4BY7 C;  3K7A K;  4A3K C;  2VUM C;  3PO3 K;  5C4J C;  2E2I K;  2E2H C;  1Y1V C;  3I4M C;  1K83 K;  3GTP C;  4XLN A;  3HOX C;  3HOV C;  1BDF A;  3HOU K;  4Y52 K;  3GTO C;  4C2M C;  5FLM C;  4BY7 K;  2NVT C;  2JA6 C;  4A3K K;  5C3E C;  4BBS C;  2VUM K;  4LK0 A;  4BBR C;  4LJZ A;  4A3C C;  1Y1V K;  2E2H K;  4A3C K;  3I4M K;  5TMC A;  5TMF A;  4YFX A;  2NVX C;  3GTK C;  3S2D C;  3HOX K;  3GTP K;  3HOV K;  3GTL C;  3GTO K;  2R7Z C;  5IYD C;  4OIR A;  4C2M K;  4Q5S A;  2BE5 A;  1TWH C;  5FLM K;  4Y7N K;  5M3F K;  2NVT K;  2JA6 K;  3DXJ A;  3S1M C;  1HQM A;  4A3J C;  5C3E K;  2A68 A;  4BBS K;  4XSX A;  1XPP A;  3EQL A;  4G7H A;  4QIW L;  4BBR K;  2WB1 D;  2E2J C;  5M5Y K;  3GTK K;  2NVX K;  4BY1 C;  3S2D K;  4KN4 A;  3WOD A;  3H0G C;  3S16 C;  3GTL K;  5IYC C;  4A3E C;  2R7Z K;  5IYD K;  3S1R C;  4A93 C;  4YG2 A;  1TWH K;  3HOW C;  1Y1W C;  5M5W K;  3S1M K;  4A3I C;  4MEX A;  2CW0 A;  4C3J C;  2WAQ L;  2WB1 L;  4LLG A;  4A3J K;  2A6E A;  3GTQ C;  2E2J K;  1ZYR A;  3S1Q C;  3S1N C;  4BY1 K;  1TWF C;  2PMZ L;  3H0G K;  4XSZ A;  2PA8 L;  4A3G C;  4MQ9 A;  3S16 K;  4YFN A;  4OIO A;  4XLP A;  5IYC K;  5C4J K;  5C44 C;  2JA7 C;  4A3E K;  3S1R K;  4KMU A;  3HOW K;  4A93 K;  1I6H C;  1Y1W K;  4QIW D;  1WCM C;  4A3I K;  4C3J K;  1I6V A;  3HKZ D;  4A3F C;  3GTQ K;  1YNN A;  3S1N K;  3S1Q K;  1TWF K;  4BXX C;  4MEY A;  5D4D A;  4A3G K;  4ZH4 A;  5C44 K;  2JA7 K;  2WAQ D;  5C4X C;  2Y0S L;  1I6H K;  4X6A C;  1R9T C;  3HKZ L;  1WCM K;  2O5J A;  1SFO C;  4A3F K;  2PMZ D;  2JA5 C;  4G7O A;  2PA8 D;  2NVQ C;  4YFK A;  4KN7 A;  4LK1 A;  4AYB L;  5M5X K;  4A3D C;  4BXX K;  3HOZ C;  3S15 C;  5IP7 C;  3S17 C;  3RZO C;  5C4X K;  3S2H C;  4X6A K;  1R9T K;  3S14 C;  3M3Y C;  1SFO K;  2JA5 K;  1I50 C; 
#chains in the Genus database with same CATH topology
 1JQW A;  3HOZ K;  2Y0S D;  1GE9 A;  2R93 C;  3S17 K;  3S2H K;  1XXA A;  3VA7 A;  1B4B A;  3H0G A;  2PHC B;  4AYB D;  1I50 K;  2VUM A;  2EBB A;  1YNJ A;  2B63 K;  1Y1W A;  2V6S A;  4JK1 A;  1EQR A;  1WQH A;  3FHZ A;  1ZXO A;  3FKI K;  4Y7N C;  4OIQ A;  3CQZ C;  1O28 A;  3N0B A;  2NVY C;  4GTD A;  4A3M K;  1B4A A;  4C3I C;  3PIO S;  3TFJ A;  2JA8 C;  1I3Q K;  2NVX A;  5IYB K;  2PPB A;  3GTG K;  1TWC K;  1INN A;  1TWA K;  4O2D A;  1TWG K;  3HOU C;  4DDQ A;  4A3L K;  1EK8 A;  4QJV B;  1VLO A;  5C4J C;  2E2I K;  1JVI A;  1K83 K;  3GTP C;  1BDF A;  1WOO A;  4GTE A;  1YCL A;  2P8T A;  1RU0 A;  3GTK C;  5TMF A;  3HOX K;  1WCM A;  3GTO K;  1PJ5 A;  5IYD C;  4C2M K;  5EGH A;  2KPU A;  2JA6 K;  2KQ1 A;  5C3E K;  5JFE A;  1I3Q A;  4BY1 C;  1DCP A;  3GTL K;  1DCH A;  3S1R C;  4A93 C;  1USO A;  3L4J A;  3Q3Q A;  2WAQ L;  2CW0 A;  4C3J C;  2W7V A;  1HI9 A;  4LLG A;  1TWG A;  2A6E A;  3OEP A;  2PMZ L;  4XSZ A;  3S16 K;  4A3G C;  4GTC A;  4XLP A;  5IYC K;  2YU9 A;  5C44 C;  2JA7 C;  4QIW D;  2ZUE A;  1I6V A;  4KMH A;  4A3F C;  3GTM A;  3GTQ K;  3SZZ A;  1O25 A;  4LOW A;  4GTA A;  4ZH4 A;  1O29 A;  4KB2 A;  3GSI A;  5HQH A;  4X6A C;  4GT9 A;  2O5J A;  2FQT A;  1SFO C;  2JA5 C;  1WOR A;  2PA8 D;  2NVQ C;  4KAW X;  4BXX K;  1C0A A;  4P5A A;  3GTJ A;  2KXY A;  3S15 C;  3AD9 C;  1R9T K;  3S14 C;  5JVO A;  1EH1 A;  4A3B C;  4G0W A;  3RZD C;  4G0V A;  2A69 A;  4WCE S;  1L0W A;  4A3D K;  4Q4Z A;  2CFA A;  3PO2 C;  1XZQ B;  3I4N C;  2GAG C;  4LQY A;  4C3H C;  1VJE A;  1XZP B;  5M3M K;  2D6F C;  1F7V A;  1F7U A;  3M4O C;  1Y1V A;  2E2H A;  1WOS A;  2A6H A;  2R93 K;  1O27 A;  4NOI A;  4IOA S;  2R92 C;  3HOY C;  3G4C A;  3JST A;  1BS2 A;  3K7A C;  2XCO A;  3FOE A;  3PO3 C;  2R7Z A;  1FEU A;  4KC6 A;  3CQZ K;  1TWH A;  2NVY K;  4C3I K;  2JA8 K;  3A8I A;  4A3K C;  1DD5 A;  2VUM C;  1UV7 A;  4G0U A;  1IL2 A;  3HOU K;  4Y52 K;  3FOF A;  5FLM C;  4BLB A;  3ADA C;  1TWF A;  2NVT C;  4BBS C;  4BBR C;  4A3C C;  1PJ7 A;  4GFQ A;  1WIH A;  3GTP K;  3PIP S;  2NVX C;  3S2D C;  3HXA A;  4KM9 A;  1WQF A;  4Q5S A;  3S1M C;  1HQM A;  4LR2 A;  1XPP A;  4G7H A;  2E2J C;  5M5Y K;  5L46 A;  3GTK K;  4KN4 A;  3WOD A;  5IYD K;  4YG2 A;  3BP3 A;  2RGR A;  4KMD A;  3LPX A;  4FM9 A;  3S1N C;  4BY1 K;  4YFN A;  1I50 A;  3S1R K;  4A93 K;  1I6H C;  3ORE A;  4WFB S;  1WCM C;  2B63 A;  4C3J K;  2GAH C;  3DLL S;  3HKZ D;  2P5M A;  3LAP A;  3FKI A;  4MEY A;  4A3G K;  5C44 K;  2JA7 K;  2WAQ D;  5C4X C;  3CF5 S;  3HKZ L;  3GTP A;  4A3F K;  3GTG A;  2PMZ D;  1TWC A;  4KN7 A;  1J6X A;  3AH5 A;  1TWA A;  3LYW A;  3G4A A;  5IP7 C;  3RZO C;  4X6A K;  3M3Y C;  1SFO K;  4KDD A;  1VH2 A;  4WFA S;  2YU9 C;  2JA5 K;  2NVQ K;  2E2I A;  3N0C A;  1K83 A;  4C45 A;  3S15 K;  3GTM C;  1O2A A;  3S14 K;  3BUE A;  5IP9 C;  4OIP A;  2O5I A;  1ISE A;  4A3B K;  3RZD K;  3IPJ A;  3H3V L;  4KAR A;  4FZB A;  3AD7 C;  1EI6 A;  4AH6 A;  3PO2 K;  3GTO A;  3I4N K;  4C3H K;  1J6W A;  3BP8 C;  4KAS A;  3GTJ C;  4J3N A;  2JA6 A;  1ZQ1 C;  3M4O K;  4OIN A;  2ZJP S;  1JOE A;  5IOS A;  2L5N A;  5IOR A;  3GTL A;  1SMY A;  4BKW A;  2CFA B;  2R92 K;  2KWA A;  1ZBS A;  3HOY K;  2V6T A;  2V6U A;  5DM7 S;  4BY7 C;  3K7A K;  3PO3 K;  1EFW A;  2E2H C;  1Y1V C;  1G51 A;  4KB4 A;  4P9S A;  3I4M C;  1YX2 A;  3T01 A;  4XLN A;  3HOV C;  1F93 A;  3A8K A;  4KMA A;  1O26 A;  2XCR B;  3GTQ A;  4A3K K;  2VUM K;  4M1X A;  1BGW A;  4LK0 A;  5TMC A;  1IQ0 A;  2R7Z C;  3GEE A;  4OIR A;  5FLM K;  4Y7N K;  2BE5 A;  1TWH C;  2Y3P A;  2ZFZ A;  2NVT K;  3DXJ A;  4A3J C;  3T00 A;  4BBS K;  4XCH A;  4BBR K;  4A3C K;  3EQL A;  2NVX K;  3S2D K;  1R9T A;  1PJ6 A;  3H0G C;  3A8J A;  1ZVU A;  4A3E C;  3HOW C;  5IOT A;  1Y1W C;  5M5W K;  3S1M K;  4A3I C;  4MEX A;  3V4G A;  3S0X A;  2E2J K;  1ZYR A;  3S1Q C;  1TWF C;  3GEI A;  5C4J K;  5JVG S;  5HL7 S;  4PAB A;  4WIL A;  2R93 A;  4WJ3 M;  1USM A;  4KM8 A;  3TFH A;  5JVH S;  3S1N K;  5D4D A;  1O24 A;  2Y0S L;  1I6H K;  1WCM K;  1XXB A;  4WJ4 A;  4G7O A;  4LK1 A;  4AYB L;  3CQZ A;  3HOZ C;  2NVY A;  3S17 C;  5C4X K;  3S2H C;  4U67 S;  1WSR A;  4GTB A;  5IOQ A;  1I50 C;  2ZUF A;  4BLA A;  1DCO A;  4GZY A;  2B63 C;  4Y52 C;  4GTL A;  5IP7 K;  1AB4 A;  1IE0 A;  3RZO K;  2ZJR S;  3SZY A;  3FKI C;  3M3Y K;  4G7Z A;  3MML B;  4A3M C;  2YU9 K;  4QJV A;  1I3Q C;  2GSU A;  5IYB C;  3GTG C;  3GTM K;  1TWC C;  1IBA A;  5IP9 K;  1TWA C;  1TWG C;  4P5B A;  5E68 A;  2ZJQ S;  4A3L C;  3AD8 C;  3GTK A;  3T02 A;  5FJ8 K;  3N3Y A;  2E2I C;  3NUH A;  1IW7 A;  5CJ9 A;  4GTF A;  1K83 C;  3H3V D;  3GTJ K;  1F9N A;  3L4K A;  5EGE A;  4KAT A;  3TFI A;  3HOX C;  3GTO C;  4C2M C;  5TJ3 A;  4BY7 K;  2JA6 C;  5C3E C;  2E2H K;  4LJZ A;  1Y1V K;  2JA7 A;  3ERE D;  3I4M K;  4YFX A;  3HOV K;  5HL8 A;  3GTL C;  1VGX A;  1V5V A;  5M3F K;  2FQO A;  2A68 A;  3AQP A;  3AQO A;  5DM6 S;  4XSX A;  4QIW L;  2RH6 A;  2WB1 D;  4WFN S;  1WQG A;  3S16 C;  1X31 C;  5IYC C;  1SFO A;  4PAA A;  2XCQ A;  2R7Z K;  2JA5 A;  4ILD A;  1TWH K;  3QX3 A;  3OPF A;  4A3J K;  2WB1 L;  1KQ4 A;  3GTQ C;  3H0G K;  2L3U A;  2JH3 A;  2PA8 L;  4MQ9 A;  3TTG A;  2GSN A;  4OIO A;  4A3E K;  4KMU A;  3HOW K;  1Y1W K;  4A3I K;  4IOC S;  1YNN A;  3S1Q K;  1TWF K;  1BJT A;  4BXX C;  3GEH A;  1O2F B;  3GDZ A;  1XZQ A;  1J98 A;  1WOP A;  1XZP A;  1R9T C;  3GIR A;  1VRQ C;  1WSV A;  4IO9 S;  4YFK A;  5M5X K;  4WF9 S;  4A3D C;  2GSO A;  3LAJ A;  2R92 A;  5CHP A;  1J6V A;  1O2B A;  4RMF A;  1IS1 A;  1XXC A;  3CAG A; 
#chains in the Genus database with same CATH homology
 4A3B C;  3RZD C;  2NVQ K;  2A69 A;  4GZY A;  4A3D K;  3HOZ K;  2Y0S D;  2B63 C;  4Q4Z A;  2R93 C;  3S15 K;  4Y52 C;  3GTM C;  3PO2 C;  5IP7 K;  3RZO K;  3S17 K;  3S2H K;  3I4N C;  3FKI C;  3S14 K;  4C3H C;  5M3M K;  5IP9 C;  3M3Y K;  4OIP A;  4G7Z A;  2O5I A;  4AYB D;  4A3M C;  1I50 K;  2YU9 K;  4A3B K;  3RZD K;  4QJV A;  3H3V L;  1I3Q C;  3M4O C;  1YNJ A;  2B63 K;  2A6H A;  4JK1 A;  5IYB C;  2R93 K;  3GTG C;  3GTM K;  3PO2 K;  4NOI A;  3I4N K;  3FKI K;  1TWC C;  4Y7N C;  4OIQ A;  3CQZ C;  4C3H K;  5IP9 K;  2NVY C;  3GTJ C;  1TWA C;  2R92 C;  4A3M K;  1TWG C;  4C3I C;  2JA8 C;  3HOY C;  1I3Q K;  3M4O K;  4OIN A;  4A3L C;  5IYB K;  3K7A C;  2PPB A;  5FJ8 K;  3GTG K;  1SMY A;  3PO3 C;  2E2I C;  1TWC K;  3CQZ K;  1IW7 A;  1K83 C;  2YU9 C;  3H3V D;  1TWA K;  2NVY K;  3GTJ K;  2R92 K;  1TWG K;  4C3I K;  3HOU C;  2JA8 K;  3HOY K;  4A3L K;  4QJV B;  4BY7 C;  3K7A K;  4A3K C;  2VUM C;  3PO3 K;  5C4J C;  2E2I K;  2E2H C;  1Y1V C;  3I4M C;  1K83 K;  3GTP C;  4XLN A;  3HOX C;  3HOV C;  1BDF A;  3HOU K;  4Y52 K;  3GTO C;  4C2M C;  5FLM C;  4BY7 K;  2NVT C;  2JA6 C;  4A3K K;  5C3E C;  4BBS C;  2VUM K;  4LK0 A;  4BBR C;  4LJZ A;  4A3C C;  1Y1V K;  2E2H K;  4A3C K;  3I4M K;  5TMC A;  5TMF A;  4YFX A;  2NVX C;  3GTK C;  3S2D C;  3HOX K;  3GTP K;  3HOV K;  3GTL C;  3GTO K;  2R7Z C;  5IYD C;  4OIR A;  4C2M K;  4Q5S A;  2BE5 A;  1TWH C;  5FLM K;  4Y7N K;  5M3F K;  2NVT K;  2JA6 K;  3DXJ A;  3S1M C;  1HQM A;  4A3J C;  5C3E K;  2A68 A;  4BBS K;  4XSX A;  1XPP A;  3EQL A;  4G7H A;  4QIW L;  4BBR K;  2WB1 D;  2E2J C;  5M5Y K;  3GTK K;  2NVX K;  4BY1 C;  3S2D K;  4KN4 A;  3WOD A;  3H0G C;  3S16 C;  3GTL K;  5IYC C;  4A3E C;  2R7Z K;  5IYD K;  3S1R C;  4A93 C;  4YG2 A;  1TWH K;  3HOW C;  1Y1W C;  5M5W K;  3S1M K;  4A3I C;  4MEX A;  2CW0 A;  4C3J C;  2WAQ L;  2WB1 L;  4LLG A;  4A3J K;  2A6E A;  3GTQ C;  2E2J K;  1ZYR A;  3S1Q C;  3S1N C;  4BY1 K;  1TWF C;  2PMZ L;  3H0G K;  4XSZ A;  2PA8 L;  4A3G C;  4MQ9 A;  3S16 K;  4YFN A;  4OIO A;  4XLP A;  5IYC K;  5C4J K;  5C44 C;  2JA7 C;  4A3E K;  3S1R K;  4KMU A;  3HOW K;  4A93 K;  1I6H C;  1Y1W K;  4QIW D;  1WCM C;  4A3I K;  4C3J K;  1I6V A;  3HKZ D;  4A3F C;  3GTQ K;  1YNN A;  3S1N K;  3S1Q K;  1TWF K;  4BXX C;  4MEY A;  5D4D A;  4A3G K;  4ZH4 A;  5C44 K;  2JA7 K;  2WAQ D;  5C4X C;  2Y0S L;  1I6H K;  4X6A C;  1R9T C;  3HKZ L;  1WCM K;  2O5J A;  1SFO C;  4A3F K;  2PMZ D;  2JA5 C;  4G7O A;  2PA8 D;  2NVQ C;  4YFK A;  4KN7 A;  4LK1 A;  4AYB L;  5M5X K;  4A3D C;  4BXX K;  3HOZ C;  3S15 C;  5IP7 C;  3S17 C;  3RZO C;  5C4X K;  3S2H C;  4X6A K;  1R9T K;  3S14 C;  3M3Y C;  1SFO K;  2JA5 K;  1I50 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...