4Q5SA

Thermus thermophilus rna polymerase initially transcribing complex containing 6-mer rna
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
226
structure length
226
Chain Sequence
SKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna/rna
molecule keywords DNA-directed RNA polymerase subunit alpha
publication title Structural basis of transcription initiation by bacterial RNA polymerase holoenzyme.
pubmed doi rcsb
source organism Thermus thermophilus
total genus 41
structure length 226
sequence length 226
chains with identical sequence B
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2014-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01000 RNA_pol_A_bac RNA polymerase Rpb3/RpoA insert domain
A PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain
A PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.12 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 DNA-directed RNA polymerase, insert domain 4q5sA02
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 4q5sA01
4YFXA 4OIPA 4C2MC 2BE5A 3DXJA 3HOWC 1TWCK 3S14C 4XSZA 4Y7NC 1Y1VK 5C4JK 3H0GK 2R92K 3S15K 3I4NC 1I3QC 2JA7C 1I50C 4C3JC 4A3MC 4C3HK 3I4MK 4QIWD 2A6HA 4A3FC 5M3FK 1TWAC 5TMCA 5M3MK 1R9TC 3HKZL 4LK1A 3HOVK 2JA6K 3S2DC 3S1NK 2A69A 4KN4A 1HQMA 4BY1K 4A3DC 3S1QK 1ZYRA 4GZYA 1SMYA 3M4OC 1WCMK 5IP9K 3GTOK 2NVQC 2CW0A 3M3YC 3GTMK 4A3GK 4A3EK 1IW7A 2JA8K 3GTQK 1I6HK 3GTLK 1BDFA 4QJVB 4G7ZA 2NVTC 5IYCK 3S1MC 4A3JK 3S2HK 2B63C 3HOZK 1XPPA 4X6AK 4BBRK 3H3VL 2O5JA 4BY7C 3FKIC 2NVYK 3HOUK 2WAQL 4BXXK 1Y1WC 3HOXK 4ZH4A 4XLPA 3S17K 4A3LK 2A6EA 3PO3C 3K7AC 1TWFC 4G7OA 4C3IK 5FLMK 3S16K 2O5IA 5TMFA 2YU9C 1K83K 4A3KK 3GTGK 5C3EK 3RZDC 1YNNA 1TWCC 4YFNA 3HOYC 1Y1VC 1TWGK 5C4JC 1YNJA 3H0GC 2R92C 3S15C 5IYDC 5IP7K 5M5WK 4YFKA 2PPBA 5C44K 4KMUA 3I4MC 2R7ZC 4A93K 1SFOK 3GTJK 5C4XK 4YG2A 3PO2K 3HOVC 2JA6C 3S1NC 3S1RK 2E2JK 4XLNA 1TWHC 4A3BK 2NVXK 4Y52K 2WB1L 4BY1C 4A3CC 3S1QC 4A3IK 3GTOC 5IP9C 1WCMC 4LJZA 2PMZD 4BBSK 2E2IK 3GTMC 4QJVA 4A3EC 3GTQC 2JA8C 3H3VD 4A3GC 4JK1A 2Y0SL 3GTLC 4QIWL 4AYBL 2WAQD 5IYBK 2JA5K 2R93K 5IYCC 4A3JC 2A68A 3HOZC 3S2HC 4X6AC 4BBRC 3CQZK 2NVYC 4KN7A 4OIOA 4BXXC 3GTKK 3HOXC 3S17C 4A3LC 4MQ9A 4G7HA 2PA8L 3GTPK 3RZOK 4C3IC 5FLMC 2VUMK 2E2HK 3S16C 4C2MK 1K83C 3HKZD 4A3KC 1Y1WK 3GTGC 4C3HC 3HOWK 5C3EC 3S14K 4Y7NK 5FJ8K 3I4NK 1I3QK 3EQLA 1I50K 4C3JK 4A3MK 4Q4ZA 2JA7K 5IP7C 4OIQA 4A3FK 5C44C 4A93C 1TWAK 3RZDK 3HOYK 1R9TK 2WB1D 1SFOC 3GTJC 1I6HC 3S2DK 5IYDK 4MEYA 4LLGA 3PO2C 5C4XC 2E2JC 4A3BC 3S1RC 2R7ZK 4A3DK 4AYBD 4LK0A 2NVXC 4Y52C 2Y0SD 3M4OK 4A3IC 4OIRA 5M5XK 2NVQK 3M3YK 4BBSC 2E2IC 3HOUC 4XSXA 1TWHK 2JA5C 5IYBC 2R93C 2NVTK 3S1MK 4A3CK 2B63K 5D4DA 5M5YK 2PA8D 4BY7K 4NOIA 3FKIK 3CQZC 4MEXA 4OINA 3GTKC 3GTPC 3WODA 3PO3K 3K7AK 1TWFK 1I6VA 4Q5SA 2PMZL 3RZOC 1TWGC 2VUMC 2YU9K 2E2HC
chains in the Genus database with same CATH superfamily
1JVIA 2W7VA 3CQZA 3DXJA 3N0CA 4XSZA 1F7UA 4A3MC 1BS2A 4C3HK 4QIWD 5M3FK 4J3NA 4IOAS 1INNA 3HKZL 4PAAA 3S1NK 4KN4A 1WOPA 4GTBA 1ZYRA 4GZYA 1O24A 1O2BA 1I6HK 4A3GK 3GTQK 3MMLB 2NVTC 2JA5A 3N3YA 3TFIA 2O5JA 4BXXK 4M1XA 1EI6A 4WCES 1TWFC 5TMFA 4KDDA 3HOYC 1TWFA 2JA7A 4A93K 1SFOK 3GTJK 4YG2A 4A3BK 3S1NC 2WB1L 4A3CC 4BLBA 3GDZA 4A3GC 4WFAS 3GTQC 3H3VD 4QIWL 2R93K 2WAQD 3BP8C 2ZJRS 4GFQA 4WFBS 1ISEA 4BXXC 4GTAA 3GTQA 1B4AA 5DM6S 3BP3A 4BLAA 4P5AA 2XCRB 2GAGC 5FJ8K 4C45A 1DCHA 1EFWA 1J6XA 1I3QK 1I50K 1XZQA 3H0GA 2R92A 4A93C 1TWAK 1EK8A 1R9TK 1SFOC 1X31C 2ZUEA 3GTJC 4A3BC 1IQ0A 4A3DK 4LK0A 1ZVUA 5IORA 1XXCA 1SFOA 4XSXA 3PIPS 2JH3A 2R93C 5M5YK 4BY7K 3A8JA 3PO3K 1I6VA 5EGHA 1TWGC 2YU9K 3QX3A 5IOQA 1WQGA 2BE5A 4DDQA 3GTGA 1O26A 1TWCK 5C4JK 3S15K 1PJ5A 1I3QC 3PIOS 1I50C 1TWGA 5JVOA 1XXBA 5JVHS 3LAJA 1O25A 2A6HA 1TWAC 5TMCA 1EQRA 1O27A 3TFHA 1R9TC 3HOVK 1PJ6A 2A69A 1I3QA 1I50A 4A3DC 3S1QK 1WORA 1SMYA 1WCMK 1TWAA 2CW0A 3BUEA 2JA8K 3GTLK 3DLLS 4QJVB 4G7ZA 5HL8A 4KB4A 3HOZK 4X6AK 2GSUA 4BY7C 2Y3PA 1PJ7A 1ZQ1C 3HOUK 1F9NA 3HOXK 3G4CA 4ILDA 3PO3C 3FOFA 1J6WA 2CFAB 4FZBA 3S16K 2YU9C 2EBBA 1YNNA 1TWCC 5C4JC 1J6VA 3S15C 5IYDC 2YU9A 4KMUA 1TWCA 3HOVC 2P8TA 1TWHC 2NVXK 3S1QC 1O2AA 1WCMC 2E2IK 2JA8C 3GTLC 1TWHA 3HOZC 4X6AC 1WCMA 4KN7A 4XCHA 3VA7A 3GTKK 3HOXC 3GTPK 5JFEA 3GTLA 4GTDA 1WSRA 2VUMK 1USMA 2E2HK 2L5NA 5JVGS 1DCPA 3S16C 2ZFZA 4C2MK 1Y1WK 4C3HC 3AD7C 1USOA 3GIRA 3S14K 4GTLA 2V6SA 4C3JK 4OIQA 4A3FK 4WILA 2GSOA 3RZDK 1BJTA 5EGEA 1I6HC 3S2DK 4P5BA 3IPJA 2XCOA 4U67S 3T01A 2R7ZK 4AYBD 2NVXC 2Y0SD 2FQOA 3N0BA 3M4OK 3JSTA 5HL7S 1VRQC 3CAGA 4KATA 2E2IC 1O28A 3OREA 5IOSA 2B63K 2NVXA 2PA8D 4KAWX 3FKIK 1IBAA 4OINA 3GTKC 3GTPC 3WODA 3ADAC 1IS1A 1JOEA 2VUMC 2E2HC 4YFXA 4C2MC 3LAPA 3ERED 3S14C 3GTPA 1B4BA 1Y1VK 3A8KA 2RGRA 3GTKA 1IL2A 1VLOA 4C3JC 2VUMA 3GEEA 2E2HA 1F93A 4RMFA 1VJEA 4A3FC 3FHZA 4G0UA 1J98A 1G51A 2ZJPS 4KC6A 4LK1A 4G0VA 3S2DC 3GTJA 2JA6K 1HQMA 4BKWA 4BY1K 4IO9S 3HXAA 2GAHC 3GTOK 5IP9K 3LYWA 3M4OC 4LQYA 3GTMK 5IOTA 1IW7A 2R93A 3S2HK 2B63C 1BGWA 4BBRK 3H3VL 1DD5A 3Q3QA 3FKIC 1WSVA 2NVYK 2V6TA 2GSNA 2WAQL 1WQFA 1O2FB 3S17K 4ZH4A 4XLPA 2A6EA 5FLMK 2B63A 2O5IA 1K83K 4A3KK 4AH6A 3FKIA 3GEIA 5C3EK 4KMAA 4YFNA 1Y1VC 5TJ3A 1YNJA 5M5WK 2PPBA 1XZQB 5C44K 1KQ4A 4KM8A 1ZXOA 1FEUA 1Y1VA 1R9TA 3PO2K 2JA6C 2RH6A 2KXYA 4LOWA 1XXAA 4BY1C 4A3IK 3GTOC 5IP9C 4LJZA 2PMZD 3GTMC 3AQPA 3S0XA 4PABA 4JK1A 2JA5K 3AD8C 2A68A 3S2HC 4BBRC 3GTOA 2NVYC 5L46A 3GTMA 3S17C 4MQ9A 4LR2A 5FLMC 3AQOA 1K83C 4A3KC 3A8IA 1AB4A 3HOWK 5C3EC 4Y7NK 1JQWA 3I4NK 2JA7K 1VGXA 1GE9A 2FQTA 2XCQA 5C44C 1K83A 3HOYK 1XZPB 2WB1D 3PO2C 3AD9C 3LPXA 4A3IC 4IOCS 5M5XK 2NVQK 3M3YK 2ZUFA 3CF5S 3HOUC 4P9SA 2JA5C 3S1MK 4A3CK 5D4DA 4KMDA 5HQHA 1WIHA 3K7AK 4WFNS 2PMZL 1IE0A 2KQ1A 5CHPA 4OIPA 4KM9A 4KARA 3V4GA 2ZJQS 3HOWC 4Y7NC 3L4JA 1WOOA 3H0GK 2R92K 2PHCB 3I4NC 2JA7C 2L3UA 2KWAA 3I4MK 1RU0A 5M3MK 2P5MA 4WF9S 1V5VA 3OEPA 1VH2A 4FM9A 4WJ3M 3FOEA 2NVQC 3M3YC 4GTFA 4A3EK 3SZYA 2E2IA 1BDFA 5IYCK 3S1MC 4A3JK 1XPPA 3TTGA 1Y1WC 1YCLA 4A3LK 1F7VA 1O29A 3K7AC 4G7OA 4C3IK 1L0WA 3OPFA 3GTGK 2V6UA 1Y1WA 3NUHA 3RZDC 3GEHA 1TWGK 3T00A 5DM7S 4G0WA 3H0GC 2R92C 5IP7K 4YFKA 3SZZA 3I4MC 2R7ZC 5C4XK 3G4AA 2E2JK 3S1RK 4XLNA 1YX2A 4Y52K 3GSIA 2R7ZA 4BBSK 5CJ9A 4QJVA 4A3EC 4AYBL 1EH1A 2Y0SL 5IYBK 3L4KA 5IYCC 4A3JC 5E68A 3CQZK 4OIOA 1WOSA 4A3LC 4G7HA 2CFAA 2PA8L 4KASA 4KMHA 3RZOK 2KPUA 4C3IC 3TFJA 3HKZD 3GTGC 1WQHA 4GTCA 3EQLA 4A3MK 4Q4ZA 5IP7C 3AH5A 4GT9A 5IYDK 4MEYA 4LLGA 5C4XC 2E2JC 3S1RC 1XZPA 4O2DA 2JA6A 4Y52C 1ZBSA 1HI9A 4OIRA 4WJ4A 4GTEA 4BBSC 4KB2A 1TWHK 5IYBC 2NVTK 1C0AA 4NOIA 1DCOA 3T02A 3CQZC 1UV7A 4MEXA 2NVYA 1TWFK 4Q5SA 3RZOC 2D6FC
chains in the Genus database with same CATH topology
4YFXA 4OIPA 4C2MC 2BE5A 3DXJA 3HOWC 1TWCK 3S14C 4XSZA 4Y7NC 1Y1VK 5C4JK 3H0GK 2R92K 3S15K 3I4NC 1I3QC 2JA7C 1I50C 4C3JC 4A3MC 4C3HK 3I4MK 4QIWD 2A6HA 4A3FC 5M3FK 1TWAC 5TMCA 5M3MK 1R9TC 3HKZL 4LK1A 3HOVK 2JA6K 3S2DC 3S1NK 2A69A 4KN4A 1HQMA 4BY1K 4A3DC 3S1QK 1ZYRA 4GZYA 1SMYA 3M4OC 1WCMK 5IP9K 3GTOK 2NVQC 2CW0A 3M3YC 3GTMK 4A3GK 4A3EK 1IW7A 2JA8K 3GTQK 1I6HK 3GTLK 1BDFA 4QJVB 4G7ZA 2NVTC 5IYCK 3S1MC 4A3JK 3S2HK 2B63C 3HOZK 1XPPA 4X6AK 4BBRK 3H3VL 2O5JA 4BY7C 3FKIC 2NVYK 3HOUK 2WAQL 4BXXK 1Y1WC 3HOXK 4ZH4A 4XLPA 3S17K 4A3LK 2A6EA 3PO3C 3K7AC 1TWFC 4G7OA 4C3IK 5FLMK 3S16K 2O5IA 5TMFA 2YU9C 1K83K 4A3KK 3GTGK 5C3EK 3RZDC 1YNNA 1TWCC 4YFNA 3HOYC 1Y1VC 1TWGK 5C4JC 1YNJA 3H0GC 2R92C 3S15C 5IYDC 5IP7K 5M5WK 4YFKA 2PPBA 5C44K 4KMUA 3I4MC 2R7ZC 4A93K 1SFOK 3GTJK 5C4XK 4YG2A 3PO2K 3HOVC 2JA6C 3S1NC 3S1RK 2E2JK 4XLNA 1TWHC 4A3BK 2NVXK 4Y52K 2WB1L 4BY1C 4A3CC 3S1QC 4A3IK 3GTOC 5IP9C 1WCMC 4LJZA 2PMZD 4BBSK 2E2IK 3GTMC 4QJVA 4A3EC 3GTQC 2JA8C 3H3VD 4A3GC 4JK1A 2Y0SL 3GTLC 4QIWL 4AYBL 2WAQD 5IYBK 2JA5K 2R93K 5IYCC 4A3JC 2A68A 3HOZC 3S2HC 4X6AC 4BBRC 3CQZK 2NVYC 4KN7A 4OIOA 4BXXC 3GTKK 3HOXC 3S17C 4A3LC 4MQ9A 4G7HA 2PA8L 3GTPK 3RZOK 4C3IC 5FLMC 2VUMK 2E2HK 3S16C 4C2MK 1K83C 3HKZD 4A3KC 1Y1WK 3GTGC 4C3HC 3HOWK 5C3EC 3S14K 4Y7NK 5FJ8K 3I4NK 1I3QK 3EQLA 1I50K 4C3JK 4A3MK 4Q4ZA 2JA7K 5IP7C 4OIQA 4A3FK 5C44C 4A93C 1TWAK 3RZDK 3HOYK 1R9TK 2WB1D 1SFOC 3GTJC 1I6HC 3S2DK 5IYDK 4MEYA 4LLGA 3PO2C 5C4XC 2E2JC 4A3BC 3S1RC 2R7ZK 4A3DK 4AYBD 4LK0A 2NVXC 4Y52C 2Y0SD 3M4OK 4A3IC 4OIRA 5M5XK 2NVQK 3M3YK 4BBSC 2E2IC 3HOUC 4XSXA 1TWHK 2JA5C 5IYBC 2R93C 2NVTK 3S1MK 4A3CK 2B63K 5D4DA 5M5YK 2PA8D 4BY7K 4NOIA 3FKIK 3CQZC 4MEXA 4OINA 3GTKC 3GTPC 3WODA 3PO3K 3K7AK 1TWFK 1I6VA 4Q5SA 2PMZL 3RZOC 1TWGC 2VUMC 2YU9K 2E2HC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YFX A;  4OIP A;  4C2M C;  2BE5 A;  3DXJ A;  3HOW C;  1TWC K;  3S14 C;  4XSZ A;  4Y7N C;  1Y1V K;  5C4J K;  3H0G K;  2R92 K;  3S15 K;  3I4N C;  1I3Q C;  2JA7 C;  1I50 C;  4C3J C;  4A3M C;  4C3H K;  3I4M K;  4QIW D;  2A6H A;  4A3F C;  5M3F K;  1TWA C;  5TMC A;  5M3M K;  1R9T C;  3HKZ L;  4LK1 A;  3HOV K;  2JA6 K;  3S2D C;  3S1N K;  2A69 A;  4KN4 A;  1HQM A;  4BY1 K;  4A3D C;  3S1Q K;  1ZYR A;  4GZY A;  1SMY A;  3M4O C;  1WCM K;  5IP9 K;  3GTO K;  2NVQ C;  2CW0 A;  3M3Y C;  3GTM K;  4A3G K;  4A3E K;  1IW7 A;  2JA8 K;  3GTQ K;  1I6H K;  3GTL K;  1BDF A;  4QJV B;  4G7Z A;  2NVT C;  5IYC K;  3S1M C;  4A3J K;  3S2H K;  2B63 C;  3HOZ K;  1XPP A;  4X6A K;  4BBR K;  3H3V L;  2O5J A;  4BY7 C;  3FKI C;  2NVY K;  3HOU K;  2WAQ L;  4BXX K;  1Y1W C;  3HOX K;  4ZH4 A;  4XLP A;  3S17 K;  4A3L K;  2A6E A;  3PO3 C;  3K7A C;  1TWF C;  4G7O A;  4C3I K;  5FLM K;  3S16 K;  2O5I A;  5TMF A;  2YU9 C;  1K83 K;  4A3K K;  3GTG K;  5C3E K;  3RZD C;  1YNN A;  1TWC C;  4YFN A;  3HOY C;  1Y1V C;  1TWG K;  5C4J C;  1YNJ A;  3H0G C;  2R92 C;  3S15 C;  5IYD C;  5IP7 K;  5M5W K;  4YFK A;  2PPB A;  5C44 K;  4KMU A;  3I4M C;  2R7Z C;  4A93 K;  1SFO K;  3GTJ K;  5C4X K;  4YG2 A;  3PO2 K;  3HOV C;  2JA6 C;  3S1N C;  3S1R K;  2E2J K;  4XLN A;  1TWH C;  4A3B K;  2NVX K;  4Y52 K;  2WB1 L;  4BY1 C;  4A3C C;  3S1Q C;  4A3I K;  3GTO C;  5IP9 C;  1WCM C;  4LJZ A;  2PMZ D;  4BBS K;  2E2I K;  3GTM C;  4QJV A;  4A3E C;  3GTQ C;  2JA8 C;  3H3V D;  4A3G C;  4JK1 A;  2Y0S L;  3GTL C;  4QIW L;  4AYB L;  2WAQ D;  5IYB K;  2JA5 K;  2R93 K;  5IYC C;  4A3J C;  2A68 A;  3HOZ C;  3S2H C;  4X6A C;  4BBR C;  3CQZ K;  2NVY C;  4KN7 A;  4OIO A;  4BXX C;  3GTK K;  3HOX C;  3S17 C;  4A3L C;  4MQ9 A;  4G7H A;  2PA8 L;  3GTP K;  3RZO K;  4C3I C;  5FLM C;  2VUM K;  2E2H K;  3S16 C;  4C2M K;  1K83 C;  3HKZ D;  4A3K C;  1Y1W K;  3GTG C;  4C3H C;  3HOW K;  5C3E C;  3S14 K;  4Y7N K;  5FJ8 K;  3I4N K;  1I3Q K;  3EQL A;  1I50 K;  4C3J K;  4A3M K;  4Q4Z A;  2JA7 K;  5IP7 C;  4OIQ A;  4A3F K;  5C44 C;  4A93 C;  1TWA K;  3RZD K;  3HOY K;  1R9T K;  2WB1 D;  1SFO C;  3GTJ C;  1I6H C;  3S2D K;  5IYD K;  4MEY A;  4LLG A;  3PO2 C;  5C4X C;  2E2J C;  4A3B C;  3S1R C;  2R7Z K;  4A3D K;  4AYB D;  4LK0 A;  2NVX C;  4Y52 C;  2Y0S D;  3M4O K;  4A3I C;  4OIR A;  5M5X K;  2NVQ K;  3M3Y K;  4BBS C;  2E2I C;  3HOU C;  4XSX A;  1TWH K;  2JA5 C;  5IYB C;  2R93 C;  2NVT K;  3S1M K;  4A3C K;  2B63 K;  5D4D A;  5M5Y K;  2PA8 D;  4BY7 K;  4NOI A;  3FKI K;  3CQZ C;  4MEX A;  4OIN A;  3GTK C;  3GTP C;  3WOD A;  3PO3 K;  3K7A K;  1TWF K;  1I6V A;  4Q5S A;  2PMZ L;  3RZO C;  1TWG C;  2VUM C;  2YU9 K;  2E2H C; 
#chains in the Genus database with same CATH topology
 1JVI A;  2W7V A;  3CQZ A;  3DXJ A;  3N0C A;  4XSZ A;  1F7U A;  4A3M C;  1BS2 A;  4C3H K;  4QIW D;  5M3F K;  4J3N A;  4IOA S;  1INN A;  3HKZ L;  4PAA A;  3S1N K;  4KN4 A;  1WOP A;  4GTB A;  1ZYR A;  4GZY A;  1O24 A;  1O2B A;  1I6H K;  4A3G K;  3GTQ K;  3MML B;  2NVT C;  2JA5 A;  3N3Y A;  3TFI A;  2O5J A;  4BXX K;  4M1X A;  1EI6 A;  4WCE S;  1TWF C;  5TMF A;  4KDD A;  3HOY C;  1TWF A;  2JA7 A;  4A93 K;  1SFO K;  3GTJ K;  4YG2 A;  4A3B K;  3S1N C;  2WB1 L;  4A3C C;  4BLB A;  3GDZ A;  4A3G C;  4WFA S;  3GTQ C;  3H3V D;  4QIW L;  2R93 K;  2WAQ D;  3BP8 C;  2ZJR S;  4GFQ A;  4WFB S;  1ISE A;  4BXX C;  4GTA A;  3GTQ A;  1B4A A;  5DM6 S;  3BP3 A;  4BLA A;  4P5A A;  2XCR B;  2GAG C;  5FJ8 K;  4C45 A;  1DCH A;  1EFW A;  1J6X A;  1I3Q K;  1I50 K;  1XZQ A;  3H0G A;  2R92 A;  4A93 C;  1TWA K;  1EK8 A;  1R9T K;  1SFO C;  1X31 C;  2ZUE A;  3GTJ C;  4A3B C;  1IQ0 A;  4A3D K;  4LK0 A;  1ZVU A;  5IOR A;  1XXC A;  1SFO A;  4XSX A;  3PIP S;  2JH3 A;  2R93 C;  5M5Y K;  4BY7 K;  3A8J A;  3PO3 K;  1I6V A;  5EGH A;  1TWG C;  2YU9 K;  3QX3 A;  5IOQ A;  1WQG A;  2BE5 A;  4DDQ A;  3GTG A;  1O26 A;  1TWC K;  5C4J K;  3S15 K;  1PJ5 A;  1I3Q C;  3PIO S;  1I50 C;  1TWG A;  5JVO A;  1XXB A;  5JVH S;  3LAJ A;  1O25 A;  2A6H A;  1TWA C;  5TMC A;  1EQR A;  1O27 A;  3TFH A;  1R9T C;  3HOV K;  1PJ6 A;  2A69 A;  1I3Q A;  1I50 A;  4A3D C;  3S1Q K;  1WOR A;  1SMY A;  1WCM K;  1TWA A;  2CW0 A;  3BUE A;  2JA8 K;  3GTL K;  3DLL S;  4QJV B;  4G7Z A;  5HL8 A;  4KB4 A;  3HOZ K;  4X6A K;  2GSU A;  4BY7 C;  2Y3P A;  1PJ7 A;  1ZQ1 C;  3HOU K;  1F9N A;  3HOX K;  3G4C A;  4ILD A;  3PO3 C;  3FOF A;  1J6W A;  2CFA B;  4FZB A;  3S16 K;  2YU9 C;  2EBB A;  1YNN A;  1TWC C;  5C4J C;  1J6V A;  3S15 C;  5IYD C;  2YU9 A;  4KMU A;  1TWC A;  3HOV C;  2P8T A;  1TWH C;  2NVX K;  3S1Q C;  1O2A A;  1WCM C;  2E2I K;  2JA8 C;  3GTL C;  1TWH A;  3HOZ C;  4X6A C;  1WCM A;  4KN7 A;  4XCH A;  3VA7 A;  3GTK K;  3HOX C;  3GTP K;  5JFE A;  3GTL A;  4GTD A;  1WSR A;  2VUM K;  1USM A;  2E2H K;  2L5N A;  5JVG S;  1DCP A;  3S16 C;  2ZFZ A;  4C2M K;  1Y1W K;  4C3H C;  3AD7 C;  1USO A;  3GIR A;  3S14 K;  4GTL A;  2V6S A;  4C3J K;  4OIQ A;  4A3F K;  4WIL A;  2GSO A;  3RZD K;  1BJT A;  5EGE A;  1I6H C;  3S2D K;  4P5B A;  3IPJ A;  2XCO A;  4U67 S;  3T01 A;  2R7Z K;  4AYB D;  2NVX C;  2Y0S D;  2FQO A;  3N0B A;  3M4O K;  3JST A;  5HL7 S;  1VRQ C;  3CAG A;  4KAT A;  2E2I C;  1O28 A;  3ORE A;  5IOS A;  2B63 K;  2NVX A;  2PA8 D;  4KAW X;  3FKI K;  1IBA A;  4OIN A;  3GTK C;  3GTP C;  3WOD A;  3ADA C;  1IS1 A;  1JOE A;  2VUM C;  2E2H C;  4YFX A;  4C2M C;  3LAP A;  3ERE D;  3S14 C;  3GTP A;  1B4B A;  1Y1V K;  3A8K A;  2RGR A;  3GTK A;  1IL2 A;  1VLO A;  4C3J C;  2VUM A;  3GEE A;  2E2H A;  1F93 A;  4RMF A;  1VJE A;  4A3F C;  3FHZ A;  4G0U A;  1J98 A;  1G51 A;  2ZJP S;  4KC6 A;  4LK1 A;  4G0V A;  3S2D C;  3GTJ A;  2JA6 K;  1HQM A;  4BKW A;  4BY1 K;  4IO9 S;  3HXA A;  2GAH C;  3GTO K;  5IP9 K;  3LYW A;  3M4O C;  4LQY A;  3GTM K;  5IOT A;  1IW7 A;  2R93 A;  3S2H K;  2B63 C;  1BGW A;  4BBR K;  3H3V L;  1DD5 A;  3Q3Q A;  3FKI C;  1WSV A;  2NVY K;  2V6T A;  2GSN A;  2WAQ L;  1WQF A;  1O2F B;  3S17 K;  4ZH4 A;  4XLP A;  2A6E A;  5FLM K;  2B63 A;  2O5I A;  1K83 K;  4A3K K;  4AH6 A;  3FKI A;  3GEI A;  5C3E K;  4KMA A;  4YFN A;  1Y1V C;  5TJ3 A;  1YNJ A;  5M5W K;  2PPB A;  1XZQ B;  5C44 K;  1KQ4 A;  4KM8 A;  1ZXO A;  1FEU A;  1Y1V A;  1R9T A;  3PO2 K;  2JA6 C;  2RH6 A;  2KXY A;  4LOW A;  1XXA A;  4BY1 C;  4A3I K;  3GTO C;  5IP9 C;  4LJZ A;  2PMZ D;  3GTM C;  3AQP A;  3S0X A;  4PAB A;  4JK1 A;  2JA5 K;  3AD8 C;  2A68 A;  3S2H C;  4BBR C;  3GTO A;  2NVY C;  5L46 A;  3GTM A;  3S17 C;  4MQ9 A;  4LR2 A;  5FLM C;  3AQO A;  1K83 C;  4A3K C;  3A8I A;  1AB4 A;  3HOW K;  5C3E C;  4Y7N K;  1JQW A;  3I4N K;  2JA7 K;  1VGX A;  1GE9 A;  2FQT A;  2XCQ A;  5C44 C;  1K83 A;  3HOY K;  1XZP B;  2WB1 D;  3PO2 C;  3AD9 C;  3LPX A;  4A3I C;  4IOC S;  5M5X K;  2NVQ K;  3M3Y K;  2ZUF A;  3CF5 S;  3HOU C;  4P9S A;  2JA5 C;  3S1M K;  4A3C K;  5D4D A;  4KMD A;  5HQH A;  1WIH A;  3K7A K;  4WFN S;  2PMZ L;  1IE0 A;  2KQ1 A;  5CHP A;  4OIP A;  4KM9 A;  4KAR A;  3V4G A;  2ZJQ S;  3HOW C;  4Y7N C;  3L4J A;  1WOO A;  3H0G K;  2R92 K;  2PHC B;  3I4N C;  2JA7 C;  2L3U A;  2KWA A;  3I4M K;  1RU0 A;  5M3M K;  2P5M A;  4WF9 S;  1V5V A;  3OEP A;  1VH2 A;  4FM9 A;  4WJ3 M;  3FOE A;  2NVQ C;  3M3Y C;  4GTF A;  4A3E K;  3SZY A;  2E2I A;  1BDF A;  5IYC K;  3S1M C;  4A3J K;  1XPP A;  3TTG A;  1Y1W C;  1YCL A;  4A3L K;  1F7V A;  1O29 A;  3K7A C;  4G7O A;  4C3I K;  1L0W A;  3OPF A;  3GTG K;  2V6U A;  1Y1W A;  3NUH A;  3RZD C;  3GEH A;  1TWG K;  3T00 A;  5DM7 S;  4G0W A;  3H0G C;  2R92 C;  5IP7 K;  4YFK A;  3SZZ A;  3I4M C;  2R7Z C;  5C4X K;  3G4A A;  2E2J K;  3S1R K;  4XLN A;  1YX2 A;  4Y52 K;  3GSI A;  2R7Z A;  4BBS K;  5CJ9 A;  4QJV A;  4A3E C;  4AYB L;  1EH1 A;  2Y0S L;  5IYB K;  3L4K A;  5IYC C;  4A3J C;  5E68 A;  3CQZ K;  4OIO A;  1WOS A;  4A3L C;  4G7H A;  2CFA A;  2PA8 L;  4KAS A;  4KMH A;  3RZO K;  2KPU A;  4C3I C;  3TFJ A;  3HKZ D;  3GTG C;  1WQH A;  4GTC A;  3EQL A;  4A3M K;  4Q4Z A;  5IP7 C;  3AH5 A;  4GT9 A;  5IYD K;  4MEY A;  4LLG A;  5C4X C;  2E2J C;  3S1R C;  1XZP A;  4O2D A;  2JA6 A;  4Y52 C;  1ZBS A;  1HI9 A;  4OIR A;  4WJ4 A;  4GTE A;  4BBS C;  4KB2 A;  1TWH K;  5IYB C;  2NVT K;  1C0A A;  4NOI A;  1DCO A;  3T02 A;  3CQZ C;  1UV7 A;  4MEX A;  2NVY A;  1TWF K;  4Q5S A;  3RZO C;  2D6F C; 
#chains in the Genus database with same CATH homology
 4YFX A;  4OIP A;  4C2M C;  2BE5 A;  3DXJ A;  3HOW C;  1TWC K;  3S14 C;  4XSZ A;  4Y7N C;  1Y1V K;  5C4J K;  3H0G K;  2R92 K;  3S15 K;  3I4N C;  1I3Q C;  2JA7 C;  1I50 C;  4C3J C;  4A3M C;  4C3H K;  3I4M K;  4QIW D;  2A6H A;  4A3F C;  5M3F K;  1TWA C;  5TMC A;  5M3M K;  1R9T C;  3HKZ L;  4LK1 A;  3HOV K;  2JA6 K;  3S2D C;  3S1N K;  2A69 A;  4KN4 A;  1HQM A;  4BY1 K;  4A3D C;  3S1Q K;  1ZYR A;  4GZY A;  1SMY A;  3M4O C;  1WCM K;  5IP9 K;  3GTO K;  2NVQ C;  2CW0 A;  3M3Y C;  3GTM K;  4A3G K;  4A3E K;  1IW7 A;  2JA8 K;  3GTQ K;  1I6H K;  3GTL K;  1BDF A;  4QJV B;  4G7Z A;  2NVT C;  5IYC K;  3S1M C;  4A3J K;  3S2H K;  2B63 C;  3HOZ K;  1XPP A;  4X6A K;  4BBR K;  3H3V L;  2O5J A;  4BY7 C;  3FKI C;  2NVY K;  3HOU K;  2WAQ L;  4BXX K;  1Y1W C;  3HOX K;  4ZH4 A;  4XLP A;  3S17 K;  4A3L K;  2A6E A;  3PO3 C;  3K7A C;  1TWF C;  4G7O A;  4C3I K;  5FLM K;  3S16 K;  2O5I A;  5TMF A;  2YU9 C;  1K83 K;  4A3K K;  3GTG K;  5C3E K;  3RZD C;  1YNN A;  1TWC C;  4YFN A;  3HOY C;  1Y1V C;  1TWG K;  5C4J C;  1YNJ A;  3H0G C;  2R92 C;  3S15 C;  5IYD C;  5IP7 K;  5M5W K;  4YFK A;  2PPB A;  5C44 K;  4KMU A;  3I4M C;  2R7Z C;  4A93 K;  1SFO K;  3GTJ K;  5C4X K;  4YG2 A;  3PO2 K;  3HOV C;  2JA6 C;  3S1N C;  3S1R K;  2E2J K;  4XLN A;  1TWH C;  4A3B K;  2NVX K;  4Y52 K;  2WB1 L;  4BY1 C;  4A3C C;  3S1Q C;  4A3I K;  3GTO C;  5IP9 C;  1WCM C;  4LJZ A;  2PMZ D;  4BBS K;  2E2I K;  3GTM C;  4QJV A;  4A3E C;  3GTQ C;  2JA8 C;  3H3V D;  4A3G C;  4JK1 A;  2Y0S L;  3GTL C;  4QIW L;  4AYB L;  2WAQ D;  5IYB K;  2JA5 K;  2R93 K;  5IYC C;  4A3J C;  2A68 A;  3HOZ C;  3S2H C;  4X6A C;  4BBR C;  3CQZ K;  2NVY C;  4KN7 A;  4OIO A;  4BXX C;  3GTK K;  3HOX C;  3S17 C;  4A3L C;  4MQ9 A;  4G7H A;  2PA8 L;  3GTP K;  3RZO K;  4C3I C;  5FLM C;  2VUM K;  2E2H K;  3S16 C;  4C2M K;  1K83 C;  3HKZ D;  4A3K C;  1Y1W K;  3GTG C;  4C3H C;  3HOW K;  5C3E C;  3S14 K;  4Y7N K;  5FJ8 K;  3I4N K;  1I3Q K;  3EQL A;  1I50 K;  4C3J K;  4A3M K;  4Q4Z A;  2JA7 K;  5IP7 C;  4OIQ A;  4A3F K;  5C44 C;  4A93 C;  1TWA K;  3RZD K;  3HOY K;  1R9T K;  2WB1 D;  1SFO C;  3GTJ C;  1I6H C;  3S2D K;  5IYD K;  4MEY A;  4LLG A;  3PO2 C;  5C4X C;  2E2J C;  4A3B C;  3S1R C;  2R7Z K;  4A3D K;  4AYB D;  4LK0 A;  2NVX C;  4Y52 C;  2Y0S D;  3M4O K;  4A3I C;  4OIR A;  5M5X K;  2NVQ K;  3M3Y K;  4BBS C;  2E2I C;  3HOU C;  4XSX A;  1TWH K;  2JA5 C;  5IYB C;  2R93 C;  2NVT K;  3S1M K;  4A3C K;  2B63 K;  5D4D A;  5M5Y K;  2PA8 D;  4BY7 K;  4NOI A;  3FKI K;  3CQZ C;  4MEX A;  4OIN A;  3GTK C;  3GTP C;  3WOD A;  3PO3 K;  3K7A K;  1TWF K;  1I6V A;  4Q5S A;  2PMZ L;  3RZO C;  1TWG C;  2VUM C;  2YU9 K;  2E2H C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...