4Q5SA

Thermus thermophilus rna polymerase initially transcribing complex containing 6-mer rna
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
226
structure length
226
Chain Sequence
SKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of transcription initiation by bacterial RNA polymerase holoenzyme.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Transcription/dna/rna
molecule keywords DNA-directed RNA polymerase subunit alpha
total genus 41
structure length 226
sequence length 226
chains with identical sequence B
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2014-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01000 RNA_pol_A_bac RNA polymerase Rpb3/RpoA insert domain
A PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain
A PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.12 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 DNA-directed RNA polymerase, insert domain 4q5sA02
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 4q5sA01
3RZOC 1I6HC 1XPPA 1HQMA 1TWGC 4YFXA 5D4DA 3GTPK 3HKZD 5M3MK 3GTJK 5C44C 3EQLA 4LK0A 2PPBA 3GTKC 2YU9K 3HOUK 4A3GC 4MQ9A 4C3JC 4A3JK 1I50C 3DXJA 4Y7NC 3HOXC 3S17C 5C4XK 2R92K 4A3BC 4MEYA 1Y1WK 2VUMK 4OIOA 2A69A 5TMFA 2R7ZC 3GTMC 4KN7A 4C3JK 2B63K 5IYCC 3HOUC 1SMYA 3HOZK 4LJZA 2NVXC 1I50K 4Y7NK 3HOYC 4OIPA 4AYBD 2R92C 3S14K 3GTMK 3HOVK 2PA8D 1I6HK 3I4NK 2YU9C 4LLGA 1YNJA 2JA6K 4C2MC 5IYBC 5C44K 5FLMK 5IP7C 3S1MC 1TWHC 4ZH4A 2NVQK 3GTKK 3CQZC 2E2JC 3S16K 4A3KC 5IP9C 1K83K 3S1QK 1IW7A 4GZYA 2Y0SD 4XSZA 4YG2A 5FLMC 3PO3C 1WCMK 5M3FK 4C3HC 2E2JK 1ZYRA 1I6VA 2NVQC 1K83C 2E2HC 3S16C 4OIQA 1SFOK 3HOWK 3S1NK 1R9TK 3S1RC 5M5WK 3I4NC 4BBSK 2O5JA 2BE5A 3GTQK 3M3YC 3HOZC 2JA5C 1TWCK 5M5YK 3GTQC 4G7ZA 4YFNA 2JA5K 3GTLC 2E2HK 4QIWD 2O5IA 3HKZL 1SFOC 3HOWC 3PO2K 3S17K 1R9TC 3S1NC 2WB1L 4A3EC 4NOIA 4KN4A 2NVTC 3GTPC 1TWGK 2Y0SL 3S1QC 4A3LC 4A3MK 4Y52K 4XSXA 1Y1VK 4QJVA 3K7AK 3I4MC 2R93K 2JA6C 4A3MC 4C2MK 5IYBK 2PMZL 2PMZD 1TWHK 1TWFK 1I3QC 3GTLK 3M4OK 3WODA 3PO2C 2PA8L 3S15K 4A3DK 4A3IC 3RZDC 3H3VD 4BY7C 5C4XC 3HOXK 2NVXK 1Y1WC 3S14C 4QJVB 3HOYK 4BXXK 2B63C 2R7ZK 2A68A 3S1RK 4A3DC 5IYCK 4A3GK 4AYBL 4G7OA 3S2DK 4BY7K 2VUMC 4A3IK 2WAQL 4BBSC 1YNNA 3RZDK 4A3BK 2A6EA 2WB1D 4BBRK 4BXXC 1TWFC 4X6AC 5M5XK 2JA7K 3PO3K 4QIWL 4JK1A 3M4OC 4A93K 4A3KK 4Q4ZA 5IYDK 5IP7K 3H3VL 3S1MK 4A3CC 3CQZK 4C3HK 5IP9K 5TMCA 4Q5SA 2NVYK 4A3EK 5C3EC 3S2DC 3H0GK 2E2IK 2NVTK 4C3IC 3GTGC 4BBRC 4X6AK 3HOVC 3GTOK 2A6HA 3FKIC 5C4JK 1TWAK 4A3FK 2JA8K 4YFKA 3M3YK 3GTOC 1TWCC 2WAQD 1I3QK 5C4JC 3FKIK 1BDFA 4OIRA 1TWAC 3GTJC 4A3FC 4MEXA 2JA8C 4XLPA 4A93C 3S15C 5C3EK 5FJ8K 1WCMC 2NVYC 4G7HA 1Y1VC 3K7AC 4A3JC 4C3IK 3H0GC 2E2IC 3GTGK 4BY1C 2CW0A 4A3LK 5IYDC 3S2HK 4OINA 4A3CK 3RZOK 4LK1A 2R93C 3I4MK 4XLNA 4BY1K 4Y52C 3S2HC 4KMUA 2JA7C
chains in the Genus database with same CATH superfamily
4WFNS 2ZJPS 1XXBA 4LK0A 4G0UA 4A3JK 3OPFA 3HOXC 1WSVA 5C4XK 1C0AA 3AD8C 4GTFA 1Y1WK 3H0GA 2E2IA 3HOZK 5IYCC 3SZZA 4LJZA 3GEIA 2KWAA 1I50K 3GSIA 4Y7NK 5CHPA 3HOYC 4LR2A 1XXAA 3HOVK 2PA8D 1I6HK 4GFQA 1ISEA 4LLGA 3FOEA 4C2MC 5FLMK 5JVOA 3S16K 4GZYA 2D6FC 5JFEA 4XSZA 1GE9A 1YX2A 1WCMK 2E2JK 2GSNA 4PABA 5M5WK 2RH6A 4BBSK 4KDDA 3FOFA 1TWCK 1JOEA 5EGHA 3PIOS 1F9NA 3S17K 1R9TC 3ERED 4KN4A 1B4BA 1TWGK 1XZPA 4IO9S 2Y0SL 3AQPA 4G0VA 3GTLA 3AQOA 2R93K 1EH1A 1EQRA 4KMHA 4ILDA 2XCQA 4FM9A 2PMZD 1TWFK 3FHZA 2GAHC 2PA8L 1J6VA 4XCHA 5C4XC 3HOXK 1Y1WC 4WJ4A 4A3DC 5IYCK 4G7OA 2VUMC 4A3IK 2WAQL 1YNNA 5JVGS 4A3BK 1J98A 4BBRK 5HL8A 1DCHA 5M5XK 2JA7K 4A3KK 2CFAA 1VH2A 5IYDK 2YU9A 1IE0A 4C3HK 5IOQA 2L5NA 4A3EK 4C3IC 1YCLA 4O2DA 1TWAA 2V6TA 1K83A 4X6AK 4KARA 3AD9C 2ZUEA 1VLOA 4A3FK 1ZQ1C 1ZXOA 3GTOC 1TWCC 4IOCS 4OIRA 1O25A 4A93C 4GTCA 3S15C 5DM7S 4GTAA 3GTGA 4A3CK 4GTDA 3RZOK 3N0BA 3I4MK 1X31C 4XLNA 1XZQB 4BY1K 4RMFA 1WQHA 2ZFZA 3LAJA 4DDQA 3LYWA 1HQMA 3GTPK 4YFXA 4A93K 3EQLA 2PPBA 2KXYA 3HOUK 4A3GC 1Y1WA 3DXJA 2R92K 4MEYA 5TMFA 3GTMC 4C3JK 1SMYA 2PHCB 3I4NK 5IOSA 4WJ3M 3JSTA 4GTBA 5IP7C 2NVQK 4A3KC 1TWFA 1K83K 5TJ3A 5FLMC 1IL2A 4C3HC 3S16C 4C45A 4KMAA 1L0WA 3HOWK 2NVXA 3S1RC 2XCRB 2BE5A 3M3YC 3GTKA 1DCOA 2KPUA 5E68A 1I3QA 3GTLC 3PO2K 1JVIA 2JA7A 5IORA 1WOOA 3K7AK 1TWHA 4WILA 3I4MC 2JA6C 4A3MC 5IYBK 3CAGA 1O27A 2PMZL 2R93A 1O2AA 1TWHK 3GTLK 3LAPA 3S14C 4QJVB 2A68A 4J3NA 4BY7K 2R7ZA 3ADAC 2A6EA 2WB1D 1TWFC 1ZBSA 3MMLB 1PJ5A 4KASA 4Q4ZA 5IP7K 4A3CC 1BJTA 5TMCA 4LOWA 1WOSA 2B63A 5C3EC 2NVTK 4BBRC 3HOVC 3TFHA 2A6HA 3QX3A 2GSUA 3A8JA 4KM8A 3M3YK 1PJ7A 1G51A 1WQFA 4KC6A 1I3QK 5C4JC 3FKIK 3TFIA 4A3FC 1WCMC 4C3IK 2GAGC 2CW0A 4A3LK 3S2HK 1RU0A 2JA6A 4WFAS 1O29A 3FKIA 3GTMA 1PJ6A 4KMUA 3N0CA 1J6XA 1AB4A 1IQ0A 1BS2A 3HKZD 2YU9K 2XCOA 1O2FB 1USOA 2VUMK 3S17C 4A3BC 4OIOA 2R7ZC 4KN7A 1USMA 3HOUC 4M1XA 3A8IA 3GEEA 3S14K 4OIPA 2R92C 4KB4A 2W7VA 2JH3A 2VUMA 3S1MC 1KQ4A 3CQZC 2E2JC 4WFBS 5IP9C 5HQHA 1XXCA 1V5VA 2Y0SD 4YG2A 3PO3C 3GIRA 5M3FK 4BXXK 2NVQC 1I6VA 2E2HC 4OIQA 1SFOK 3LPXA 4WCES 2R92A 3I4NC 4P5BA 3T00A 1O26A 2O5JA 3GTQK 2JA5C 3L4JA 1UV7A 2NVYA 4G7ZA 1Y1VA 5L46A 3HOWC 3L4KA 2WB1L 4A3EC 4NOIA 3GTPC 3S1QC 4A3LC 3BP3A 1WORA 4BKWA 4GTLA 4P9SA 1Y1VK 1VGXA 1O24A 1WQGA 4C2MK 3M4OK 3WODA 3PO2C 3HXAA 1F93A 1TWGA 3BP8C 3S15K 3A8KA 4A3DK 3RZDC 3H3VD 2NVXK 4IOAS 3GTPA 2R7ZK 3DLLS 3N3YA 4AYBL 2JA5A 4BBSC 3SZYA 3T02A 4QIWL 4JK1A 3M4OC 4WF9S 3GTOA 3S1MK 3H3VL 4G0WA 3CQZK 5IOTA 5IP9K 1DD5A 1VRQC 1EFWA 3GTGC 4LQYA 4BLBA 3GTOK 1TWAK 2KQ1A 2JA8K 4YFKA 2V6UA 1F7VA 2P8TA 1XZQA 3GTJC 4XLPA 3PIPS 1I50A 5C3EK 4G7HA 3K7AC 4A3JC 2ZJRS 3OEPA 1O2BA 1WCMA 3S2HC 2JA7C 3RZOC 1I6HC 1XPPA 5CJ9A 1TWCA 1TWGC 5D4DA 5M3MK 3GTJK 5C44C 3GTKC 2L3UA 4MQ9A 4C3JC 2V6SA 1I50C 4Y7NC 1EK8A 2A69A 2B63K 2NVXC 2EBBA 3V4GA 1B4AA 4AYBD 3GTMK 4KMDA 1HI9A 5DM6S 2YU9C 2JA6K 1YNJA 5IYBC 5C44K 3GTKK 4KAWX 1TWHC 4ZH4A 1F7UA 3AH5A 2Y3PA 3S1QK 1IW7A 1BGWA 1SFOA 1ZYRA 1K83C 4GT9A 3Q3QA 3S1NK 1R9TK 3T01A 3CQZA 4PAAA 3HOZC 5M5YK 1ZVUA 3GTQC 1EI6A 2ZJQS 4YFNA 2JA5K 2E2HK 1O28A 4QIWD 2O5IA 1DCPA 1SFOC 3HKZL 3OREA 4GTEA 4KATA 3VA7A 3G4CA 3GEHA 3S1NC 1IS1A 2NVTC 4A3MK 4Y52K 4XSXA 4QJVA 1WOPA 3IPJA 5JVHS 3CF5S 1I3QC 1WIHA 4FZBA 1XZPB 4A3IC 4BY7C 3HOYK 2B63C 3BUEA 3S1RK 4A3GK 1INNA 3S2DK 3RZDK 4AH6A 4BXXC 3PO3K 4X6AC 3GDZA 2GSOA 3AD7C 2FQTA 4U67S 1VJEA 4P5AA 2P5MA 4BLAA 1J6WA 4Q5SA 4KM9A 2NVYK 2FQOA 3S2DC 3H0GK 2E2IK 4KB2A 1JQWA 2CFAB 3TTGA 3TFJA 3GTQA 2ZUFA 5HL7S 3FKIC 5C4JK 2WAQD 3S0XA 1BDFA 1TWAC 4MEXA 2JA8C 1IBAA 5FJ8K 2NVYC 1Y1VC 3GTGK 3H0GC 2E2IC 3NUHA 4BY1C 5IYDC 4OINA 3G4AA 1R9TA 2E2HA 2RGRA 4LK1A 2R93C 3GTJA 5EGEA 1WSRA 1FEUA 4Y52C
chains in the Genus database with same CATH topology
3RZOC 1I6HC 1XPPA 1HQMA 1TWGC 4YFXA 5D4DA 3GTPK 3HKZD 5M3MK 3GTJK 5C44C 3EQLA 4LK0A 2PPBA 3GTKC 2YU9K 3HOUK 4A3GC 4MQ9A 4C3JC 4A3JK 1I50C 3DXJA 4Y7NC 3HOXC 3S17C 5C4XK 2R92K 4A3BC 4MEYA 1Y1WK 2VUMK 4OIOA 2A69A 5TMFA 2R7ZC 3GTMC 4KN7A 4C3JK 2B63K 5IYCC 3HOUC 1SMYA 3HOZK 4LJZA 2NVXC 1I50K 4Y7NK 3HOYC 4OIPA 4AYBD 2R92C 3S14K 3GTMK 3HOVK 2PA8D 1I6HK 3I4NK 2YU9C 4LLGA 1YNJA 2JA6K 4C2MC 5IYBC 5C44K 5FLMK 5IP7C 3S1MC 1TWHC 4ZH4A 2NVQK 3GTKK 3CQZC 2E2JC 3S16K 4A3KC 5IP9C 1K83K 3S1QK 1IW7A 4GZYA 2Y0SD 4XSZA 4YG2A 5FLMC 3PO3C 1WCMK 5M3FK 4C3HC 2E2JK 1ZYRA 1I6VA 2NVQC 1K83C 2E2HC 3S16C 4OIQA 1SFOK 3HOWK 3S1NK 1R9TK 3S1RC 5M5WK 3I4NC 4BBSK 2O5JA 2BE5A 3GTQK 3M3YC 3HOZC 2JA5C 1TWCK 5M5YK 3GTQC 4G7ZA 4YFNA 2JA5K 3GTLC 2E2HK 4QIWD 2O5IA 3HKZL 1SFOC 3HOWC 3PO2K 3S17K 1R9TC 3S1NC 2WB1L 4A3EC 4NOIA 4KN4A 2NVTC 3GTPC 1TWGK 2Y0SL 3S1QC 4A3LC 4A3MK 4Y52K 4XSXA 1Y1VK 4QJVA 3K7AK 3I4MC 2R93K 2JA6C 4A3MC 4C2MK 5IYBK 2PMZL 2PMZD 1TWHK 1TWFK 1I3QC 3GTLK 3M4OK 3WODA 3PO2C 2PA8L 3S15K 4A3DK 4A3IC 3RZDC 3H3VD 4BY7C 5C4XC 3HOXK 2NVXK 1Y1WC 3S14C 4QJVB 3HOYK 4BXXK 2B63C 2R7ZK 2A68A 3S1RK 4A3DC 5IYCK 4A3GK 4AYBL 4G7OA 3S2DK 4BY7K 2VUMC 4A3IK 2WAQL 4BBSC 1YNNA 3RZDK 4A3BK 2A6EA 2WB1D 4BBRK 4BXXC 1TWFC 4X6AC 5M5XK 2JA7K 3PO3K 4QIWL 4JK1A 3M4OC 4A93K 4A3KK 4Q4ZA 5IYDK 5IP7K 3H3VL 3S1MK 4A3CC 3CQZK 4C3HK 5IP9K 5TMCA 4Q5SA 2NVYK 4A3EK 5C3EC 3S2DC 3H0GK 2E2IK 2NVTK 4C3IC 3GTGC 4BBRC 4X6AK 3HOVC 3GTOK 2A6HA 3FKIC 5C4JK 1TWAK 4A3FK 2JA8K 4YFKA 3M3YK 3GTOC 1TWCC 2WAQD 1I3QK 5C4JC 3FKIK 1BDFA 4OIRA 1TWAC 3GTJC 4A3FC 4MEXA 2JA8C 4XLPA 4A93C 3S15C 5C3EK 5FJ8K 1WCMC 2NVYC 4G7HA 1Y1VC 3K7AC 4A3JC 4C3IK 3H0GC 2E2IC 3GTGK 4BY1C 2CW0A 4A3LK 5IYDC 3S2HK 4OINA 4A3CK 3RZOK 4LK1A 2R93C 3I4MK 4XLNA 4BY1K 4Y52C 3S2HC 4KMUA 2JA7C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RZO C;  1I6H C;  1XPP A;  1HQM A;  1TWG C;  4YFX A;  5D4D A;  3GTP K;  3HKZ D;  5M3M K;  3GTJ K;  5C44 C;  3EQL A;  4LK0 A;  2PPB A;  3GTK C;  2YU9 K;  3HOU K;  4A3G C;  4MQ9 A;  4C3J C;  4A3J K;  1I50 C;  3DXJ A;  4Y7N C;  3HOX C;  3S17 C;  5C4X K;  2R92 K;  4A3B C;  4MEY A;  1Y1W K;  2VUM K;  4OIO A;  2A69 A;  5TMF A;  2R7Z C;  3GTM C;  4KN7 A;  4C3J K;  2B63 K;  5IYC C;  3HOU C;  1SMY A;  3HOZ K;  4LJZ A;  2NVX C;  1I50 K;  4Y7N K;  3HOY C;  4OIP A;  4AYB D;  2R92 C;  3S14 K;  3GTM K;  3HOV K;  2PA8 D;  1I6H K;  3I4N K;  2YU9 C;  4LLG A;  1YNJ A;  2JA6 K;  4C2M C;  5IYB C;  5C44 K;  5FLM K;  5IP7 C;  3S1M C;  1TWH C;  4ZH4 A;  2NVQ K;  3GTK K;  3CQZ C;  2E2J C;  3S16 K;  4A3K C;  5IP9 C;  1K83 K;  3S1Q K;  1IW7 A;  4GZY A;  2Y0S D;  4XSZ A;  4YG2 A;  5FLM C;  3PO3 C;  1WCM K;  5M3F K;  4C3H C;  2E2J K;  1ZYR A;  1I6V A;  2NVQ C;  1K83 C;  2E2H C;  3S16 C;  4OIQ A;  1SFO K;  3HOW K;  3S1N K;  1R9T K;  3S1R C;  5M5W K;  3I4N C;  4BBS K;  2O5J A;  2BE5 A;  3GTQ K;  3M3Y C;  3HOZ C;  2JA5 C;  1TWC K;  5M5Y K;  3GTQ C;  4G7Z A;  4YFN A;  2JA5 K;  3GTL C;  2E2H K;  4QIW D;  2O5I A;  3HKZ L;  1SFO C;  3HOW C;  3PO2 K;  3S17 K;  1R9T C;  3S1N C;  2WB1 L;  4A3E C;  4NOI A;  4KN4 A;  2NVT C;  3GTP C;  1TWG K;  2Y0S L;  3S1Q C;  4A3L C;  4A3M K;  4Y52 K;  4XSX A;  1Y1V K;  4QJV A;  3K7A K;  3I4M C;  2R93 K;  2JA6 C;  4A3M C;  4C2M K;  5IYB K;  2PMZ L;  2PMZ D;  1TWH K;  1TWF K;  1I3Q C;  3GTL K;  3M4O K;  3WOD A;  3PO2 C;  2PA8 L;  3S15 K;  4A3D K;  4A3I C;  3RZD C;  3H3V D;  4BY7 C;  5C4X C;  3HOX K;  2NVX K;  1Y1W C;  3S14 C;  4QJV B;  3HOY K;  4BXX K;  2B63 C;  2R7Z K;  2A68 A;  3S1R K;  4A3D C;  5IYC K;  4A3G K;  4AYB L;  4G7O A;  3S2D K;  4BY7 K;  2VUM C;  4A3I K;  2WAQ L;  4BBS C;  1YNN A;  3RZD K;  4A3B K;  2A6E A;  2WB1 D;  4BBR K;  4BXX C;  1TWF C;  4X6A C;  5M5X K;  2JA7 K;  3PO3 K;  4QIW L;  4JK1 A;  3M4O C;  4A93 K;  4A3K K;  4Q4Z A;  5IYD K;  5IP7 K;  3H3V L;  3S1M K;  4A3C C;  3CQZ K;  4C3H K;  5IP9 K;  5TMC A;  4Q5S A;  2NVY K;  4A3E K;  5C3E C;  3S2D C;  3H0G K;  2E2I K;  2NVT K;  4C3I C;  3GTG C;  4BBR C;  4X6A K;  3HOV C;  3GTO K;  2A6H A;  3FKI C;  5C4J K;  1TWA K;  4A3F K;  2JA8 K;  4YFK A;  3M3Y K;  3GTO C;  1TWC C;  2WAQ D;  1I3Q K;  5C4J C;  3FKI K;  1BDF A;  4OIR A;  1TWA C;  3GTJ C;  4A3F C;  4MEX A;  2JA8 C;  4XLP A;  4A93 C;  3S15 C;  5C3E K;  5FJ8 K;  1WCM C;  2NVY C;  4G7H A;  1Y1V C;  3K7A C;  4A3J C;  4C3I K;  3H0G C;  2E2I C;  3GTG K;  4BY1 C;  2CW0 A;  4A3L K;  5IYD C;  3S2H K;  4OIN A;  4A3C K;  3RZO K;  4LK1 A;  2R93 C;  3I4M K;  4XLN A;  4BY1 K;  4Y52 C;  3S2H C;  4KMU A;  2JA7 C; 
#chains in the Genus database with same CATH topology
 4WFN S;  2ZJP S;  1XXB A;  4LK0 A;  4G0U A;  4A3J K;  3OPF A;  3HOX C;  1WSV A;  5C4X K;  1C0A A;  3AD8 C;  4GTF A;  1Y1W K;  3H0G A;  2E2I A;  3HOZ K;  5IYC C;  3SZZ A;  4LJZ A;  3GEI A;  2KWA A;  1I50 K;  3GSI A;  4Y7N K;  5CHP A;  3HOY C;  4LR2 A;  1XXA A;  3HOV K;  2PA8 D;  1I6H K;  4GFQ A;  1ISE A;  4LLG A;  3FOE A;  4C2M C;  5FLM K;  5JVO A;  3S16 K;  4GZY A;  2D6F C;  5JFE A;  4XSZ A;  1GE9 A;  1YX2 A;  1WCM K;  2E2J K;  2GSN A;  4PAB A;  5M5W K;  2RH6 A;  4BBS K;  4KDD A;  3FOF A;  1TWC K;  1JOE A;  5EGH A;  3PIO S;  1F9N A;  3S17 K;  1R9T C;  3ERE D;  4KN4 A;  1B4B A;  1TWG K;  1XZP A;  4IO9 S;  2Y0S L;  3AQP A;  4G0V A;  3GTL A;  3AQO A;  2R93 K;  1EH1 A;  1EQR A;  4KMH A;  4ILD A;  2XCQ A;  4FM9 A;  2PMZ D;  1TWF K;  3FHZ A;  2GAH C;  2PA8 L;  1J6V A;  4XCH A;  5C4X C;  3HOX K;  1Y1W C;  4WJ4 A;  4A3D C;  5IYC K;  4G7O A;  2VUM C;  4A3I K;  2WAQ L;  1YNN A;  5JVG S;  4A3B K;  1J98 A;  4BBR K;  5HL8 A;  1DCH A;  5M5X K;  2JA7 K;  4A3K K;  2CFA A;  1VH2 A;  5IYD K;  2YU9 A;  1IE0 A;  4C3H K;  5IOQ A;  2L5N A;  4A3E K;  4C3I C;  1YCL A;  4O2D A;  1TWA A;  2V6T A;  1K83 A;  4X6A K;  4KAR A;  3AD9 C;  2ZUE A;  1VLO A;  4A3F K;  1ZQ1 C;  1ZXO A;  3GTO C;  1TWC C;  4IOC S;  4OIR A;  1O25 A;  4A93 C;  4GTC A;  3S15 C;  5DM7 S;  4GTA A;  3GTG A;  4A3C K;  4GTD A;  3RZO K;  3N0B A;  3I4M K;  1X31 C;  4XLN A;  1XZQ B;  4BY1 K;  4RMF A;  1WQH A;  2ZFZ A;  3LAJ A;  4DDQ A;  3LYW A;  1HQM A;  3GTP K;  4YFX A;  4A93 K;  3EQL A;  2PPB A;  2KXY A;  3HOU K;  4A3G C;  1Y1W A;  3DXJ A;  2R92 K;  4MEY A;  5TMF A;  3GTM C;  4C3J K;  1SMY A;  2PHC B;  3I4N K;  5IOS A;  4WJ3 M;  3JST A;  4GTB A;  5IP7 C;  2NVQ K;  4A3K C;  1TWF A;  1K83 K;  5TJ3 A;  5FLM C;  1IL2 A;  4C3H C;  3S16 C;  4C45 A;  4KMA A;  1L0W A;  3HOW K;  2NVX A;  3S1R C;  2XCR B;  2BE5 A;  3M3Y C;  3GTK A;  1DCO A;  2KPU A;  5E68 A;  1I3Q A;  3GTL C;  3PO2 K;  1JVI A;  2JA7 A;  5IOR A;  1WOO A;  3K7A K;  1TWH A;  4WIL A;  3I4M C;  2JA6 C;  4A3M C;  5IYB K;  3CAG A;  1O27 A;  2PMZ L;  2R93 A;  1O2A A;  1TWH K;  3GTL K;  3LAP A;  3S14 C;  4QJV B;  2A68 A;  4J3N A;  4BY7 K;  2R7Z A;  3ADA C;  2A6E A;  2WB1 D;  1TWF C;  1ZBS A;  3MML B;  1PJ5 A;  4KAS A;  4Q4Z A;  5IP7 K;  4A3C C;  1BJT A;  5TMC A;  4LOW A;  1WOS A;  2B63 A;  5C3E C;  2NVT K;  4BBR C;  3HOV C;  3TFH A;  2A6H A;  3QX3 A;  2GSU A;  3A8J A;  4KM8 A;  3M3Y K;  1PJ7 A;  1G51 A;  1WQF A;  4KC6 A;  1I3Q K;  5C4J C;  3FKI K;  3TFI A;  4A3F C;  1WCM C;  4C3I K;  2GAG C;  2CW0 A;  4A3L K;  3S2H K;  1RU0 A;  2JA6 A;  4WFA S;  1O29 A;  3FKI A;  3GTM A;  1PJ6 A;  4KMU A;  3N0C A;  1J6X A;  1AB4 A;  1IQ0 A;  1BS2 A;  3HKZ D;  2YU9 K;  2XCO A;  1O2F B;  1USO A;  2VUM K;  3S17 C;  4A3B C;  4OIO A;  2R7Z C;  4KN7 A;  1USM A;  3HOU C;  4M1X A;  3A8I A;  3GEE A;  3S14 K;  4OIP A;  2R92 C;  4KB4 A;  2W7V A;  2JH3 A;  2VUM A;  3S1M C;  1KQ4 A;  3CQZ C;  2E2J C;  4WFB S;  5IP9 C;  5HQH A;  1XXC A;  1V5V A;  2Y0S D;  4YG2 A;  3PO3 C;  3GIR A;  5M3F K;  4BXX K;  2NVQ C;  1I6V A;  2E2H C;  4OIQ A;  1SFO K;  3LPX A;  4WCE S;  2R92 A;  3I4N C;  4P5B A;  3T00 A;  1O26 A;  2O5J A;  3GTQ K;  2JA5 C;  3L4J A;  1UV7 A;  2NVY A;  4G7Z A;  1Y1V A;  5L46 A;  3HOW C;  3L4K A;  2WB1 L;  4A3E C;  4NOI A;  3GTP C;  3S1Q C;  4A3L C;  3BP3 A;  1WOR A;  4BKW A;  4GTL A;  4P9S A;  1Y1V K;  1VGX A;  1O24 A;  1WQG A;  4C2M K;  3M4O K;  3WOD A;  3PO2 C;  3HXA A;  1F93 A;  1TWG A;  3BP8 C;  3S15 K;  3A8K A;  4A3D K;  3RZD C;  3H3V D;  2NVX K;  4IOA S;  3GTP A;  2R7Z K;  3DLL S;  3N3Y A;  4AYB L;  2JA5 A;  4BBS C;  3SZY A;  3T02 A;  4QIW L;  4JK1 A;  3M4O C;  4WF9 S;  3GTO A;  3S1M K;  3H3V L;  4G0W A;  3CQZ K;  5IOT A;  5IP9 K;  1DD5 A;  1VRQ C;  1EFW A;  3GTG C;  4LQY A;  4BLB A;  3GTO K;  1TWA K;  2KQ1 A;  2JA8 K;  4YFK A;  2V6U A;  1F7V A;  2P8T A;  1XZQ A;  3GTJ C;  4XLP A;  3PIP S;  1I50 A;  5C3E K;  4G7H A;  3K7A C;  4A3J C;  2ZJR S;  3OEP A;  1O2B A;  1WCM A;  3S2H C;  2JA7 C;  3RZO C;  1I6H C;  1XPP A;  5CJ9 A;  1TWC A;  1TWG C;  5D4D A;  5M3M K;  3GTJ K;  5C44 C;  3GTK C;  2L3U A;  4MQ9 A;  4C3J C;  2V6S A;  1I50 C;  4Y7N C;  1EK8 A;  2A69 A;  2B63 K;  2NVX C;  2EBB A;  3V4G A;  1B4A A;  4AYB D;  3GTM K;  4KMD A;  1HI9 A;  5DM6 S;  2YU9 C;  2JA6 K;  1YNJ A;  5IYB C;  5C44 K;  3GTK K;  4KAW X;  1TWH C;  4ZH4 A;  1F7U A;  3AH5 A;  2Y3P A;  3S1Q K;  1IW7 A;  1BGW A;  1SFO A;  1ZYR A;  1K83 C;  4GT9 A;  3Q3Q A;  3S1N K;  1R9T K;  3T01 A;  3CQZ A;  4PAA A;  3HOZ C;  5M5Y K;  1ZVU A;  3GTQ C;  1EI6 A;  2ZJQ S;  4YFN A;  2JA5 K;  2E2H K;  1O28 A;  4QIW D;  2O5I A;  1DCP A;  1SFO C;  3HKZ L;  3ORE A;  4GTE A;  4KAT A;  3VA7 A;  3G4C A;  3GEH A;  3S1N C;  1IS1 A;  2NVT C;  4A3M K;  4Y52 K;  4XSX A;  4QJV A;  1WOP A;  3IPJ A;  5JVH S;  3CF5 S;  1I3Q C;  1WIH A;  4FZB A;  1XZP B;  4A3I C;  4BY7 C;  3HOY K;  2B63 C;  3BUE A;  3S1R K;  4A3G K;  1INN A;  3S2D K;  3RZD K;  4AH6 A;  4BXX C;  3PO3 K;  4X6A C;  3GDZ A;  2GSO A;  3AD7 C;  2FQT A;  4U67 S;  1VJE A;  4P5A A;  2P5M A;  4BLA A;  1J6W A;  4Q5S A;  4KM9 A;  2NVY K;  2FQO A;  3S2D C;  3H0G K;  2E2I K;  4KB2 A;  1JQW A;  2CFA B;  3TTG A;  3TFJ A;  3GTQ A;  2ZUF A;  5HL7 S;  3FKI C;  5C4J K;  2WAQ D;  3S0X A;  1BDF A;  1TWA C;  4MEX A;  2JA8 C;  1IBA A;  5FJ8 K;  2NVY C;  1Y1V C;  3GTG K;  3H0G C;  2E2I C;  3NUH A;  4BY1 C;  5IYD C;  4OIN A;  3G4A A;  1R9T A;  2E2H A;  2RGR A;  4LK1 A;  2R93 C;  3GTJ A;  5EGE A;  1WSR A;  1FEU A;  4Y52 C; 
#chains in the Genus database with same CATH homology
 3RZO C;  1I6H C;  1XPP A;  1HQM A;  1TWG C;  4YFX A;  5D4D A;  3GTP K;  3HKZ D;  5M3M K;  3GTJ K;  5C44 C;  3EQL A;  4LK0 A;  2PPB A;  3GTK C;  2YU9 K;  3HOU K;  4A3G C;  4MQ9 A;  4C3J C;  4A3J K;  1I50 C;  3DXJ A;  4Y7N C;  3HOX C;  3S17 C;  5C4X K;  2R92 K;  4A3B C;  4MEY A;  1Y1W K;  2VUM K;  4OIO A;  2A69 A;  5TMF A;  2R7Z C;  3GTM C;  4KN7 A;  4C3J K;  2B63 K;  5IYC C;  3HOU C;  1SMY A;  3HOZ K;  4LJZ A;  2NVX C;  1I50 K;  4Y7N K;  3HOY C;  4OIP A;  4AYB D;  2R92 C;  3S14 K;  3GTM K;  3HOV K;  2PA8 D;  1I6H K;  3I4N K;  2YU9 C;  4LLG A;  1YNJ A;  2JA6 K;  4C2M C;  5IYB C;  5C44 K;  5FLM K;  5IP7 C;  3S1M C;  1TWH C;  4ZH4 A;  2NVQ K;  3GTK K;  3CQZ C;  2E2J C;  3S16 K;  4A3K C;  5IP9 C;  1K83 K;  3S1Q K;  1IW7 A;  4GZY A;  2Y0S D;  4XSZ A;  4YG2 A;  5FLM C;  3PO3 C;  1WCM K;  5M3F K;  4C3H C;  2E2J K;  1ZYR A;  1I6V A;  2NVQ C;  1K83 C;  2E2H C;  3S16 C;  4OIQ A;  1SFO K;  3HOW K;  3S1N K;  1R9T K;  3S1R C;  5M5W K;  3I4N C;  4BBS K;  2O5J A;  2BE5 A;  3GTQ K;  3M3Y C;  3HOZ C;  2JA5 C;  1TWC K;  5M5Y K;  3GTQ C;  4G7Z A;  4YFN A;  2JA5 K;  3GTL C;  2E2H K;  4QIW D;  2O5I A;  3HKZ L;  1SFO C;  3HOW C;  3PO2 K;  3S17 K;  1R9T C;  3S1N C;  2WB1 L;  4A3E C;  4NOI A;  4KN4 A;  2NVT C;  3GTP C;  1TWG K;  2Y0S L;  3S1Q C;  4A3L C;  4A3M K;  4Y52 K;  4XSX A;  1Y1V K;  4QJV A;  3K7A K;  3I4M C;  2R93 K;  2JA6 C;  4A3M C;  4C2M K;  5IYB K;  2PMZ L;  2PMZ D;  1TWH K;  1TWF K;  1I3Q C;  3GTL K;  3M4O K;  3WOD A;  3PO2 C;  2PA8 L;  3S15 K;  4A3D K;  4A3I C;  3RZD C;  3H3V D;  4BY7 C;  5C4X C;  3HOX K;  2NVX K;  1Y1W C;  3S14 C;  4QJV B;  3HOY K;  4BXX K;  2B63 C;  2R7Z K;  2A68 A;  3S1R K;  4A3D C;  5IYC K;  4A3G K;  4AYB L;  4G7O A;  3S2D K;  4BY7 K;  2VUM C;  4A3I K;  2WAQ L;  4BBS C;  1YNN A;  3RZD K;  4A3B K;  2A6E A;  2WB1 D;  4BBR K;  4BXX C;  1TWF C;  4X6A C;  5M5X K;  2JA7 K;  3PO3 K;  4QIW L;  4JK1 A;  3M4O C;  4A93 K;  4A3K K;  4Q4Z A;  5IYD K;  5IP7 K;  3H3V L;  3S1M K;  4A3C C;  3CQZ K;  4C3H K;  5IP9 K;  5TMC A;  4Q5S A;  2NVY K;  4A3E K;  5C3E C;  3S2D C;  3H0G K;  2E2I K;  2NVT K;  4C3I C;  3GTG C;  4BBR C;  4X6A K;  3HOV C;  3GTO K;  2A6H A;  3FKI C;  5C4J K;  1TWA K;  4A3F K;  2JA8 K;  4YFK A;  3M3Y K;  3GTO C;  1TWC C;  2WAQ D;  1I3Q K;  5C4J C;  3FKI K;  1BDF A;  4OIR A;  1TWA C;  3GTJ C;  4A3F C;  4MEX A;  2JA8 C;  4XLP A;  4A93 C;  3S15 C;  5C3E K;  5FJ8 K;  1WCM C;  2NVY C;  4G7H A;  1Y1V C;  3K7A C;  4A3J C;  4C3I K;  3H0G C;  2E2I C;  3GTG K;  4BY1 C;  2CW0 A;  4A3L K;  5IYD C;  3S2H K;  4OIN A;  4A3C K;  3RZO K;  4LK1 A;  2R93 C;  3I4M K;  4XLN A;  4BY1 K;  4Y52 C;  3S2H C;  4KMU A;  2JA7 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...