1SMYA

Structural basis for transcription regulation by alarmone ppgpp
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
229
structure length
229
Chain Sequence
b'MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase alpha chain
publication title Structural basis for transcription regulation by alarmone ppGpp
pubmed doi rcsb
molecule tags Transferase
total genus 40
structure length 229
sequence length 229
chains with identical sequence B, K, L
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2004-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01000 RNA_pol_A_bac RNA polymerase Rpb3/RpoA insert domain
A PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain
A PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.12 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 DNA-directed RNA polymerase, insert domain 1smyA02
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 1smyA01
4LK1A 3RZOK 3HOZC 5IP9C 3PO3K 2E2HK 4Q4ZA 3HOXC 3S15C 3GTPK 2R7ZK 1TWAK 3GTKC 1I6HK 1Y1VC 1Y1WC 2NVTK 2R93C 4Y52C 4A3BK 3H0GK 2NVXC 1BDFA 4A3KK 3HKZD 1R9TK 3S2DK 3GTJK 5TMFA 3S17K 4A3DK 3S16K 3RZDK 2JA6K 3HKZL 4KN7A 4A3JK 2B63K 4X6AK 3GTLK 4Q5SA 4GZYA 4C3HC 5IYBC 2YU9K 3I4MC 4BBSC 5IYCK 3HOYK 5C4JC 4A93K 2O5IA 2E2JK 5C3EK 4BY1K 4MQ9A 4A3GC 1SFOK 4A3LK 3CQZC 4LLGA 4XSXA 4C3JC 3H3VD 3S1QC 4QJVA 4AYBD 5IP9K 4OIOA 3HOXK 4LJZA 4Y7NC 5M5YK 1XPPA 2Y0SD 1TWGC 1Y1VK 1Y1WK 5M3FK 3WODA 4A3IC 4YFKA 3M3YC 2NVXK 4Y52K 2A6HA 4A3CC 2Y0SL 3K7AK 3GTMC 3M4OC 4BY7C 3S1NC 2CW0A 2NVYK 4QIWD 4C3HK 5IYBK 4BBSK 1YNNA 3FKIC 4QIWL 2PMZD 4OIPA 4C2MK 2E2IC 4C3IC 3DXJA 4KMUA 3HOUC 5IYDC 5FLMC 1TWHC 4A3GK 3HOWC 1K83K 2NVQK 1HQMA 3S14C 3S1RC 4C3JK 3S1QK 4YFXA 5M3MK 5M5XK 2BE5A 1WCMC 2PA8D 2R92C 2JA7C 4BXXK 4OIQA 3S1MC 3GTOC 2PA8L 3H3VL 3HOZK 3PO2C 3RZOC 4ZH4A 3GTQC 3PO3C 2E2HC 3S15K 4AYBL 4A3IK 3M3YK 5IP7C 3GTPC 2R7ZC 2A6EA 2VUMC 3GTKK 4A3CK 1I3QC 4G7OA 1I6HC 3GTMK 2R93K 2JA5C 1TWCC 4G7HA 3HOVC 4KN4A 3S1NK 3EQLA 4JK1A 4BBRC 3GTJC 4A3DC 5C4XC 1ZYRA 2WB1D 3RZDC 2JA6C 4A3FC 4MEYA 3FKIK 2A68A 2WB1L 5M5WK 2E2IK 3I4MK 4C3IK 3S2HC 5IYCC 1TWFC 5C4JK 3HOYC 5IYDK 3HOWK 1YNJA 4QJVB 5C3EC 2JA8C 2PMZL 3S14K 5TMCA 1I50C 5C44C 4A3EC 3CQZK 2R92K 2JA7K 3S1MK 3GTOK 3I4NC 1IW7A 4A3MC 1SMYA 3PO2K 3GTQK 5D4DA 4Y7NK 2A69A 3GTGC 5IP7K 2VUMK 1TWGK 1I3QK 2JA5K 1TWCK 3HOVK 1TWAC 2WAQD 4BBRK 3K7AC 2NVTC 2PPBA 4A3BC 5C4XK 3H0GC 2WAQL 1I6VA 4A3KC 3M4OK 4XSZA 1R9TC 3S2DC 4A3FK 3S17C 4BY7K 3S16C 2NVYC 4LK0A 4A3JC 4NOIA 2B63C 4X6AC 4MEXA 3GTLC 1TWFK 3S2HK 4OIRA 4YG2A 2YU9C 4C2MC 2JA8K 3HOUK 5FLMK 1TWHK 5FJ8K 4YFNA 4A93C 1K83C 2E2JC 2NVQC 1I50K 5C44K 4A3EK 4XLPA 3S1RK 4OINA 4G7ZA 4BY1C 3I4NK 1SFOC 4A3MK 4A3LC 1WCMK 4XLNA 4BXXC 2O5JA 3GTGK
chains in the Genus database with same CATH superfamily
2KWAA 3HOZC 2E2HK 5JVOA 1WORA 1Y1VC 4A3BK 3TFHA 2ZJRS 4G0WA 3GTJK 5TMFA 3S17K 1J6XA 1VH2A 4GTAA 4KN7A 4A3JK 3GTLK 3TFIA 4C3HC 1DD5A 5IOQA 1TWHA 5C4JC 1EFWA 4MQ9A 1BJTA 4KAWX 2L5NA 3CQZC 3HOXK 3GTPA 1JQWA 1Y1WK 1TWGC 2NVXK 2Y0SL 3GTMC 1L0WA 4BY7C 3AD9C 5IYBK 4BBSK 1O28A 4QIWL 4OIPA 4IO9S 4C2MK 4C3IC 3DXJA 3LYWA 5IYDC 1XZPB 4A3GK 1HQMA 4PABA 3S14C 4YFXA 3HXAA 1DCPA 3GIRA 2R92C 2JA7C 2RGRA 3PO2C 3A8IA 2E2HC 3M3YK 4A3CK 1DCHA 3OEPA 2JA5C 4G7HA 3S1NK 2W7VA 3GTJC 5C4XC 1F9NA 1O29A 3NUHA 2E2IK 3I4MK 3GEEA 3HOWK 3FOFA 5HL7S 1ZBSA 1I50C 2ZJPS 3GTOK 2P8TA 5D4DA 3A8KA 2R93A 4LR2A 2WAQD 2NVTC 2KXYA 4A3KC 1R9TC 3S2DC 1WSRA 1JOEA 4WFAS 1F7UA 4G0VA 2YU9C 4C2MC 2ZFZA 2JA8K 2KQ1A 1TWHK 4U67S 2RH6A 2E2JC 4A3EK 5CHPA 4OINA 4BY1C 4KDDA 3I4NK 1SFOC 1X31C 1O27A 2GSOA 4XLNA 4KMHA 3GTQA 5HL8A 1PJ6A 5DM7S 3RZOK 2VUMA 1WQHA 2XCOA 1I3QA 5JVHS 3GTPK 1I6HK 4GTEA 1PJ5A 4Y52C 1BDFA 1WIHA 4WJ3M 4A3DK 4KATA 1XXAA 3RZDK 3HKZL 4X6AK 1WQFA 1RU0A 3I4MC 3AD8C 3A8JA 1VLOA 3AQPA 3V4GA 4PAAA 4A3LK 1WCMA 4LLGA 4C3JC 3S1QC 3GTGA 2L3UA 1HI9A 5IP9K 3L4JA 4OIOA 4LJZA 2R7ZA 1TWAA 2Y0SD 3WODA 4A3IC 4YFKA 3H0GA 5EGEA 2JA6A 2B63A 4WCES 1WQGA 4QIWD 1UV7A 3FKIC 1TWHC 4IOAS 4GTFA 3N3YA 2FQTA 3AH5A 4J3NA 3T02A 1O26A 2PA8L 3SZYA 3RZOC 4ZH4A 1Y1VA 5IP7C 3GTPC 1I6HC 2R93K 1TWCC 3HOVC 3T00A 4KN4A 3FOEA 4A3DC 3RZDC 1ZVUA 2WB1L 4KM9A 1TWFC 1K83A 5TMCA 3TFJA 1O2BA 1IE0A 3S1MK 1IW7A 4A3MC 4GTCA 1TWGA 3GTQK 4Y7NK 2A69A 2VUMK 3G4CA 3GTKA 1I3QK 4P5AA 2PHCB 2ZUEA 3GTMA 4BBRK 4A3BC 4KB4A 2ZJQS 1I6VA 3M4OK 4XSZA 4A3FK 3S17C 1B4AA 2P5MA 3OREA 4A3JC 3S2HK 3GTLC 1ZXOA 4BLAA 4YG2A 1USOA 1B4BA 5FLMK 4ILDA 5C44K 3S1RK 2R92A 2JA7A 4XCHA 1WCMK 4RMFA 3GTGK 4LK1A 1PJ7A 4GTLA 2GSUA 4Q4ZA 3HOXC 3QX3A 2JA5A 1IS1A 1TWAK 2R7ZK 1VGXA 1Y1WC 2R93C 3DLLS 3H0GK 2NVXC 1F7VA 3HKZD 1YX2A 1IBAA 2V6UA 3S16K 5HQHA 2JA6K 2B63K 1JVIA 5IYBC 4BBSC 5IYCK 1G51A 4A93K 1O2FB 2O5IA 1I50A 5C3EK 3SZZA 1ISEA 4A3GC 1GE9A 3AQOA 4AYBD 4Y7NC 4BKWA 2V6TA 5M5YK 3PIPS 1XPPA 1Y1VK 3M3YC 2ZUFA 2A6HA 4A3CC 1R9TA 4LOWA 3M4OC 3S1NC 3MMLB 4KASA 2CW0A 4C3HK 2YU9A 1IL2A 4WFBS 1C0AA 3PIOS 1YNNA 2E2IC 4WJ4A 5FLMC 3HOWC 1K83K 2NVQK 1SFOA 4KMAA 3S1RC 1V5VA 1YCLA 5M5XK 2BE5A 1WCMC 2PA8D 1O24A 3LAJA 4OIQA 3GTOC 5IOSA 1XXCA 4WILA 2CFAB 4P5BA 3S15K 4AYBL 5IORA 2R7ZC 3GTKK 4DDQA 3GTMK 2GAGC 4KC6A 2NVYA 3ADAC 5JVGS 2WB1D 2JA6C 1J6WA 4MEYA 3LPXA 3VA7A 5M5WK 4C3IK 4KM8A 5IYCC 3LAPA 5IYDK 1YNJA 4QJVB 5C3EC 2JA8C 1WOSA 3S14K 4KB2A 4A3EC 5IOTA 2R92K 2JA7K 3I4NC 1J98A 4FM9A 3PO2K 2JA5K 1O25A 5EGHA 1EQRA 5C4XK 3FKIA 1INNA 4LK0A 3L4KA 4X6AC 1XZQA 2GSNA 3HOUK 5FJ8K 1IQ0A 1XXBA 1K83C 1I50K 2NVQC 3CQZA 2Y3PA 4A3LC 3GDZA 2O5JA 3GEHA 1USMA 4GT9A 5IP9C 3AD7C 3G4AA 3PO3K 3S15C 3FHZA 1TWCA 4FZBA 2KPUA 3GTKC 1FEUA 1DCOA 2NVTK 3S0XA 3CF5S 4A3KK 1R9TK 3S2DK 2CFAA 4C45A 1F93A 1TWFA 4Q5SA 4GZYA 1O2AA 2YU9K 3HOYK 2JH3A 2E2JK 5DM6S 4BY1K 1SFOK 1EK8A 4XSXA 3H3VD 4KMDA 4QJVA 2E2HA 3GEIA 3CAGA 1WOOA 3IPJA 5JFEA 5M3FK 4Y52K 4M1XA 4WF9S 3K7AK 3ERED 3GTJA 1VRQC 4GTBA 4KARA 3GTLA 2NVYK 3N0CA 4G0UA 2FQOA 2PMZD 3BUEA 4KMUA 3HOUC 1J6VA 4C3JK 3S1QK 4AH6A 5M3MK 2XCRB 4BXXK 3S1MC 3H3VL 3HOZK 1Y1WA 3GTQC 3PO3C 4A3IK 2NVXA 3JSTA 2A6EA 2VUMC 3N0BA 4O2DA 1I3QC 4G7OA 1XZQB 3BP3A 3EQLA 4JK1A 4BBRC 1KQ4A 1ZYRA 3BP8C 4A3FC 3FKIK 2A68A 1EH1A 2D6FC 3Q3QA 5E68A 3S2HC 1BS2A 4BLBA 3HOYC 5C4JK 4IOCS 2PMZL 1WSVA 5C44C 2GAHC 3CQZK 1ZQ1C 1XZPA 3TTGA 5L46A 1SMYA 2V6SA 3GTGC 1BGWA 5IP7K 1TWGK 4P9SA 1TWCK 3HOVK 1TWAC 3K7AC 2PPBA 3H0GC 1VJEA 2WAQL 2XCQA 4BY7K 3S16C 2NVYC 4WFNS 3GSIA 4LQYA 5CJ9A 2E2IA 4NOIA 2B63C 5TJ3A 4MEXA 1TWFK 4OIRA 4GFQA 4GTDA 1WOPA 4YFNA 4A93C 4XLPA 4G7ZA 1EI6A 3GTOA 1AB4A 4A3MK 2EBBA 3OPFA 3T01A 4BXXC
chains in the Genus database with same CATH topology
4LK1A 3RZOK 3HOZC 5IP9C 3PO3K 2E2HK 4Q4ZA 3HOXC 3S15C 3GTPK 2R7ZK 1TWAK 3GTKC 1I6HK 1Y1VC 1Y1WC 2NVTK 2R93C 4Y52C 4A3BK 3H0GK 2NVXC 1BDFA 4A3KK 3HKZD 1R9TK 3S2DK 3GTJK 5TMFA 3S17K 4A3DK 3S16K 3RZDK 2JA6K 3HKZL 4KN7A 4A3JK 2B63K 4X6AK 3GTLK 4Q5SA 4GZYA 4C3HC 5IYBC 2YU9K 3I4MC 4BBSC 5IYCK 3HOYK 5C4JC 4A93K 2O5IA 2E2JK 5C3EK 4BY1K 4MQ9A 4A3GC 1SFOK 4A3LK 3CQZC 4LLGA 4XSXA 4C3JC 3H3VD 3S1QC 4QJVA 4AYBD 5IP9K 4OIOA 3HOXK 4LJZA 4Y7NC 5M5YK 1XPPA 2Y0SD 1TWGC 1Y1VK 1Y1WK 5M3FK 3WODA 4A3IC 4YFKA 3M3YC 2NVXK 4Y52K 2A6HA 4A3CC 2Y0SL 3K7AK 3GTMC 3M4OC 4BY7C 3S1NC 2CW0A 2NVYK 4QIWD 4C3HK 5IYBK 4BBSK 1YNNA 3FKIC 4QIWL 2PMZD 4OIPA 4C2MK 2E2IC 4C3IC 3DXJA 4KMUA 3HOUC 5IYDC 5FLMC 1TWHC 4A3GK 3HOWC 1K83K 2NVQK 1HQMA 3S14C 3S1RC 4C3JK 3S1QK 4YFXA 5M3MK 5M5XK 2BE5A 1WCMC 2PA8D 2R92C 2JA7C 4BXXK 4OIQA 3S1MC 3GTOC 2PA8L 3H3VL 3HOZK 3PO2C 3RZOC 4ZH4A 3GTQC 3PO3C 2E2HC 3S15K 4AYBL 4A3IK 3M3YK 5IP7C 3GTPC 2R7ZC 2A6EA 2VUMC 3GTKK 4A3CK 1I3QC 4G7OA 1I6HC 3GTMK 2R93K 2JA5C 1TWCC 4G7HA 3HOVC 4KN4A 3S1NK 3EQLA 4JK1A 4BBRC 3GTJC 4A3DC 5C4XC 1ZYRA 2WB1D 3RZDC 2JA6C 4A3FC 4MEYA 3FKIK 2A68A 2WB1L 5M5WK 2E2IK 3I4MK 4C3IK 3S2HC 5IYCC 1TWFC 5C4JK 3HOYC 5IYDK 3HOWK 1YNJA 4QJVB 5C3EC 2JA8C 2PMZL 3S14K 5TMCA 1I50C 5C44C 4A3EC 3CQZK 2R92K 2JA7K 3S1MK 3GTOK 3I4NC 1IW7A 4A3MC 1SMYA 3PO2K 3GTQK 5D4DA 4Y7NK 2A69A 3GTGC 5IP7K 2VUMK 1TWGK 1I3QK 2JA5K 1TWCK 3HOVK 1TWAC 2WAQD 4BBRK 3K7AC 2NVTC 2PPBA 4A3BC 5C4XK 3H0GC 2WAQL 1I6VA 4A3KC 3M4OK 4XSZA 1R9TC 3S2DC 4A3FK 3S17C 4BY7K 3S16C 2NVYC 4LK0A 4A3JC 4NOIA 2B63C 4X6AC 4MEXA 3GTLC 1TWFK 3S2HK 4OIRA 4YG2A 2YU9C 4C2MC 2JA8K 3HOUK 5FLMK 1TWHK 5FJ8K 4YFNA 4A93C 1K83C 2E2JC 2NVQC 1I50K 5C44K 4A3EK 4XLPA 3S1RK 4OINA 4G7ZA 4BY1C 3I4NK 1SFOC 4A3MK 4A3LC 1WCMK 4XLNA 4BXXC 2O5JA 3GTGK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LK1 A;  3RZO K;  3HOZ C;  5IP9 C;  3PO3 K;  2E2H K;  4Q4Z A;  3HOX C;  3S15 C;  3GTP K;  2R7Z K;  1TWA K;  3GTK C;  1I6H K;  1Y1V C;  1Y1W C;  2NVT K;  2R93 C;  4Y52 C;  4A3B K;  3H0G K;  2NVX C;  1BDF A;  4A3K K;  3HKZ D;  1R9T K;  3S2D K;  3GTJ K;  5TMF A;  3S17 K;  4A3D K;  3S16 K;  3RZD K;  2JA6 K;  3HKZ L;  4KN7 A;  4A3J K;  2B63 K;  4X6A K;  3GTL K;  4Q5S A;  4GZY A;  4C3H C;  5IYB C;  2YU9 K;  3I4M C;  4BBS C;  5IYC K;  3HOY K;  5C4J C;  4A93 K;  2O5I A;  2E2J K;  5C3E K;  4BY1 K;  4MQ9 A;  4A3G C;  1SFO K;  4A3L K;  3CQZ C;  4LLG A;  4XSX A;  4C3J C;  3H3V D;  3S1Q C;  4QJV A;  4AYB D;  5IP9 K;  4OIO A;  3HOX K;  4LJZ A;  4Y7N C;  5M5Y K;  1XPP A;  2Y0S D;  1TWG C;  1Y1V K;  1Y1W K;  5M3F K;  3WOD A;  4A3I C;  4YFK A;  3M3Y C;  2NVX K;  4Y52 K;  2A6H A;  4A3C C;  2Y0S L;  3K7A K;  3GTM C;  3M4O C;  4BY7 C;  3S1N C;  2CW0 A;  2NVY K;  4QIW D;  4C3H K;  5IYB K;  4BBS K;  1YNN A;  3FKI C;  4QIW L;  2PMZ D;  4OIP A;  4C2M K;  2E2I C;  4C3I C;  3DXJ A;  4KMU A;  3HOU C;  5IYD C;  5FLM C;  1TWH C;  4A3G K;  3HOW C;  1K83 K;  2NVQ K;  1HQM A;  3S14 C;  3S1R C;  4C3J K;  3S1Q K;  4YFX A;  5M3M K;  5M5X K;  2BE5 A;  1WCM C;  2PA8 D;  2R92 C;  2JA7 C;  4BXX K;  4OIQ A;  3S1M C;  3GTO C;  2PA8 L;  3H3V L;  3HOZ K;  3PO2 C;  3RZO C;  4ZH4 A;  3GTQ C;  3PO3 C;  2E2H C;  3S15 K;  4AYB L;  4A3I K;  3M3Y K;  5IP7 C;  3GTP C;  2R7Z C;  2A6E A;  2VUM C;  3GTK K;  4A3C K;  1I3Q C;  4G7O A;  1I6H C;  3GTM K;  2R93 K;  2JA5 C;  1TWC C;  4G7H A;  3HOV C;  4KN4 A;  3S1N K;  3EQL A;  4JK1 A;  4BBR C;  3GTJ C;  4A3D C;  5C4X C;  1ZYR A;  2WB1 D;  3RZD C;  2JA6 C;  4A3F C;  4MEY A;  3FKI K;  2A68 A;  2WB1 L;  5M5W K;  2E2I K;  3I4M K;  4C3I K;  3S2H C;  5IYC C;  1TWF C;  5C4J K;  3HOY C;  5IYD K;  3HOW K;  1YNJ A;  4QJV B;  5C3E C;  2JA8 C;  2PMZ L;  3S14 K;  5TMC A;  1I50 C;  5C44 C;  4A3E C;  3CQZ K;  2R92 K;  2JA7 K;  3S1M K;  3GTO K;  3I4N C;  1IW7 A;  4A3M C;  1SMY A;  3PO2 K;  3GTQ K;  5D4D A;  4Y7N K;  2A69 A;  3GTG C;  5IP7 K;  2VUM K;  1TWG K;  1I3Q K;  2JA5 K;  1TWC K;  3HOV K;  1TWA C;  2WAQ D;  4BBR K;  3K7A C;  2NVT C;  2PPB A;  4A3B C;  5C4X K;  3H0G C;  2WAQ L;  1I6V A;  4A3K C;  3M4O K;  4XSZ A;  1R9T C;  3S2D C;  4A3F K;  3S17 C;  4BY7 K;  3S16 C;  2NVY C;  4LK0 A;  4A3J C;  4NOI A;  2B63 C;  4X6A C;  4MEX A;  3GTL C;  1TWF K;  3S2H K;  4OIR A;  4YG2 A;  2YU9 C;  4C2M C;  2JA8 K;  3HOU K;  5FLM K;  1TWH K;  5FJ8 K;  4YFN A;  4A93 C;  1K83 C;  2E2J C;  2NVQ C;  1I50 K;  5C44 K;  4A3E K;  4XLP A;  3S1R K;  4OIN A;  4G7Z A;  4BY1 C;  3I4N K;  1SFO C;  4A3M K;  4A3L C;  1WCM K;  4XLN A;  4BXX C;  2O5J A;  3GTG K; 
#chains in the Genus database with same CATH topology
 2KWA A;  3HOZ C;  2E2H K;  5JVO A;  1WOR A;  1Y1V C;  4A3B K;  3TFH A;  2ZJR S;  4G0W A;  3GTJ K;  5TMF A;  3S17 K;  1J6X A;  1VH2 A;  4GTA A;  4KN7 A;  4A3J K;  3GTL K;  3TFI A;  4C3H C;  1DD5 A;  5IOQ A;  1TWH A;  5C4J C;  1EFW A;  4MQ9 A;  1BJT A;  4KAW X;  2L5N A;  3CQZ C;  3HOX K;  3GTP A;  1JQW A;  1Y1W K;  1TWG C;  2NVX K;  2Y0S L;  3GTM C;  1L0W A;  4BY7 C;  3AD9 C;  5IYB K;  4BBS K;  1O28 A;  4QIW L;  4OIP A;  4IO9 S;  4C2M K;  4C3I C;  3DXJ A;  3LYW A;  5IYD C;  1XZP B;  4A3G K;  1HQM A;  4PAB A;  3S14 C;  4YFX A;  3HXA A;  1DCP A;  3GIR A;  2R92 C;  2JA7 C;  2RGR A;  3PO2 C;  3A8I A;  2E2H C;  3M3Y K;  4A3C K;  1DCH A;  3OEP A;  2JA5 C;  4G7H A;  3S1N K;  2W7V A;  3GTJ C;  5C4X C;  1F9N A;  1O29 A;  3NUH A;  2E2I K;  3I4M K;  3GEE A;  3HOW K;  3FOF A;  5HL7 S;  1ZBS A;  1I50 C;  2ZJP S;  3GTO K;  2P8T A;  5D4D A;  3A8K A;  2R93 A;  4LR2 A;  2WAQ D;  2NVT C;  2KXY A;  4A3K C;  1R9T C;  3S2D C;  1WSR A;  1JOE A;  4WFA S;  1F7U A;  4G0V A;  2YU9 C;  4C2M C;  2ZFZ A;  2JA8 K;  2KQ1 A;  1TWH K;  4U67 S;  2RH6 A;  2E2J C;  4A3E K;  5CHP A;  4OIN A;  4BY1 C;  4KDD A;  3I4N K;  1SFO C;  1X31 C;  1O27 A;  2GSO A;  4XLN A;  4KMH A;  3GTQ A;  5HL8 A;  1PJ6 A;  5DM7 S;  3RZO K;  2VUM A;  1WQH A;  2XCO A;  1I3Q A;  5JVH S;  3GTP K;  1I6H K;  4GTE A;  1PJ5 A;  4Y52 C;  1BDF A;  1WIH A;  4WJ3 M;  4A3D K;  4KAT A;  1XXA A;  3RZD K;  3HKZ L;  4X6A K;  1WQF A;  1RU0 A;  3I4M C;  3AD8 C;  3A8J A;  1VLO A;  3AQP A;  3V4G A;  4PAA A;  4A3L K;  1WCM A;  4LLG A;  4C3J C;  3S1Q C;  3GTG A;  2L3U A;  1HI9 A;  5IP9 K;  3L4J A;  4OIO A;  4LJZ A;  2R7Z A;  1TWA A;  2Y0S D;  3WOD A;  4A3I C;  4YFK A;  3H0G A;  5EGE A;  2JA6 A;  2B63 A;  4WCE S;  1WQG A;  4QIW D;  1UV7 A;  3FKI C;  1TWH C;  4IOA S;  4GTF A;  3N3Y A;  2FQT A;  3AH5 A;  4J3N A;  3T02 A;  1O26 A;  2PA8 L;  3SZY A;  3RZO C;  4ZH4 A;  1Y1V A;  5IP7 C;  3GTP C;  1I6H C;  2R93 K;  1TWC C;  3HOV C;  3T00 A;  4KN4 A;  3FOE A;  4A3D C;  3RZD C;  1ZVU A;  2WB1 L;  4KM9 A;  1TWF C;  1K83 A;  5TMC A;  3TFJ A;  1O2B A;  1IE0 A;  3S1M K;  1IW7 A;  4A3M C;  4GTC A;  1TWG A;  3GTQ K;  4Y7N K;  2A69 A;  2VUM K;  3G4C A;  3GTK A;  1I3Q K;  4P5A A;  2PHC B;  2ZUE A;  3GTM A;  4BBR K;  4A3B C;  4KB4 A;  2ZJQ S;  1I6V A;  3M4O K;  4XSZ A;  4A3F K;  3S17 C;  1B4A A;  2P5M A;  3ORE A;  4A3J C;  3S2H K;  3GTL C;  1ZXO A;  4BLA A;  4YG2 A;  1USO A;  1B4B A;  5FLM K;  4ILD A;  5C44 K;  3S1R K;  2R92 A;  2JA7 A;  4XCH A;  1WCM K;  4RMF A;  3GTG K;  4LK1 A;  1PJ7 A;  4GTL A;  2GSU A;  4Q4Z A;  3HOX C;  3QX3 A;  2JA5 A;  1IS1 A;  1TWA K;  2R7Z K;  1VGX A;  1Y1W C;  2R93 C;  3DLL S;  3H0G K;  2NVX C;  1F7V A;  3HKZ D;  1YX2 A;  1IBA A;  2V6U A;  3S16 K;  5HQH A;  2JA6 K;  2B63 K;  1JVI A;  5IYB C;  4BBS C;  5IYC K;  1G51 A;  4A93 K;  1O2F B;  2O5I A;  1I50 A;  5C3E K;  3SZZ A;  1ISE A;  4A3G C;  1GE9 A;  3AQO A;  4AYB D;  4Y7N C;  4BKW A;  2V6T A;  5M5Y K;  3PIP S;  1XPP A;  1Y1V K;  3M3Y C;  2ZUF A;  2A6H A;  4A3C C;  1R9T A;  4LOW A;  3M4O C;  3S1N C;  3MML B;  4KAS A;  2CW0 A;  4C3H K;  2YU9 A;  1IL2 A;  4WFB S;  1C0A A;  3PIO S;  1YNN A;  2E2I C;  4WJ4 A;  5FLM C;  3HOW C;  1K83 K;  2NVQ K;  1SFO A;  4KMA A;  3S1R C;  1V5V A;  1YCL A;  5M5X K;  2BE5 A;  1WCM C;  2PA8 D;  1O24 A;  3LAJ A;  4OIQ A;  3GTO C;  5IOS A;  1XXC A;  4WIL A;  2CFA B;  4P5B A;  3S15 K;  4AYB L;  5IOR A;  2R7Z C;  3GTK K;  4DDQ A;  3GTM K;  2GAG C;  4KC6 A;  2NVY A;  3ADA C;  5JVG S;  2WB1 D;  2JA6 C;  1J6W A;  4MEY A;  3LPX A;  3VA7 A;  5M5W K;  4C3I K;  4KM8 A;  5IYC C;  3LAP A;  5IYD K;  1YNJ A;  4QJV B;  5C3E C;  2JA8 C;  1WOS A;  3S14 K;  4KB2 A;  4A3E C;  5IOT A;  2R92 K;  2JA7 K;  3I4N C;  1J98 A;  4FM9 A;  3PO2 K;  2JA5 K;  1O25 A;  5EGH A;  1EQR A;  5C4X K;  3FKI A;  1INN A;  4LK0 A;  3L4K A;  4X6A C;  1XZQ A;  2GSN A;  3HOU K;  5FJ8 K;  1IQ0 A;  1XXB A;  1K83 C;  1I50 K;  2NVQ C;  3CQZ A;  2Y3P A;  4A3L C;  3GDZ A;  2O5J A;  3GEH A;  1USM A;  4GT9 A;  5IP9 C;  3AD7 C;  3G4A A;  3PO3 K;  3S15 C;  3FHZ A;  1TWC A;  4FZB A;  2KPU A;  3GTK C;  1FEU A;  1DCO A;  2NVT K;  3S0X A;  3CF5 S;  4A3K K;  1R9T K;  3S2D K;  2CFA A;  4C45 A;  1F93 A;  1TWF A;  4Q5S A;  4GZY A;  1O2A A;  2YU9 K;  3HOY K;  2JH3 A;  2E2J K;  5DM6 S;  4BY1 K;  1SFO K;  1EK8 A;  4XSX A;  3H3V D;  4KMD A;  4QJV A;  2E2H A;  3GEI A;  3CAG A;  1WOO A;  3IPJ A;  5JFE A;  5M3F K;  4Y52 K;  4M1X A;  4WF9 S;  3K7A K;  3ERE D;  3GTJ A;  1VRQ C;  4GTB A;  4KAR A;  3GTL A;  2NVY K;  3N0C A;  4G0U A;  2FQO A;  2PMZ D;  3BUE A;  4KMU A;  3HOU C;  1J6V A;  4C3J K;  3S1Q K;  4AH6 A;  5M3M K;  2XCR B;  4BXX K;  3S1M C;  3H3V L;  3HOZ K;  1Y1W A;  3GTQ C;  3PO3 C;  4A3I K;  2NVX A;  3JST A;  2A6E A;  2VUM C;  3N0B A;  4O2D A;  1I3Q C;  4G7O A;  1XZQ B;  3BP3 A;  3EQL A;  4JK1 A;  4BBR C;  1KQ4 A;  1ZYR A;  3BP8 C;  4A3F C;  3FKI K;  2A68 A;  1EH1 A;  2D6F C;  3Q3Q A;  5E68 A;  3S2H C;  1BS2 A;  4BLB A;  3HOY C;  5C4J K;  4IOC S;  2PMZ L;  1WSV A;  5C44 C;  2GAH C;  3CQZ K;  1ZQ1 C;  1XZP A;  3TTG A;  5L46 A;  1SMY A;  2V6S A;  3GTG C;  1BGW A;  5IP7 K;  1TWG K;  4P9S A;  1TWC K;  3HOV K;  1TWA C;  3K7A C;  2PPB A;  3H0G C;  1VJE A;  2WAQ L;  2XCQ A;  4BY7 K;  3S16 C;  2NVY C;  4WFN S;  3GSI A;  4LQY A;  5CJ9 A;  2E2I A;  4NOI A;  2B63 C;  5TJ3 A;  4MEX A;  1TWF K;  4OIR A;  4GFQ A;  4GTD A;  1WOP A;  4YFN A;  4A93 C;  4XLP A;  4G7Z A;  1EI6 A;  3GTO A;  1AB4 A;  4A3M K;  2EBB A;  3OPF A;  3T01 A;  4BXX C; 
#chains in the Genus database with same CATH homology
 4LK1 A;  3RZO K;  3HOZ C;  5IP9 C;  3PO3 K;  2E2H K;  4Q4Z A;  3HOX C;  3S15 C;  3GTP K;  2R7Z K;  1TWA K;  3GTK C;  1I6H K;  1Y1V C;  1Y1W C;  2NVT K;  2R93 C;  4Y52 C;  4A3B K;  3H0G K;  2NVX C;  1BDF A;  4A3K K;  3HKZ D;  1R9T K;  3S2D K;  3GTJ K;  5TMF A;  3S17 K;  4A3D K;  3S16 K;  3RZD K;  2JA6 K;  3HKZ L;  4KN7 A;  4A3J K;  2B63 K;  4X6A K;  3GTL K;  4Q5S A;  4GZY A;  4C3H C;  5IYB C;  2YU9 K;  3I4M C;  4BBS C;  5IYC K;  3HOY K;  5C4J C;  4A93 K;  2O5I A;  2E2J K;  5C3E K;  4BY1 K;  4MQ9 A;  4A3G C;  1SFO K;  4A3L K;  3CQZ C;  4LLG A;  4XSX A;  4C3J C;  3H3V D;  3S1Q C;  4QJV A;  4AYB D;  5IP9 K;  4OIO A;  3HOX K;  4LJZ A;  4Y7N C;  5M5Y K;  1XPP A;  2Y0S D;  1TWG C;  1Y1V K;  1Y1W K;  5M3F K;  3WOD A;  4A3I C;  4YFK A;  3M3Y C;  2NVX K;  4Y52 K;  2A6H A;  4A3C C;  2Y0S L;  3K7A K;  3GTM C;  3M4O C;  4BY7 C;  3S1N C;  2CW0 A;  2NVY K;  4QIW D;  4C3H K;  5IYB K;  4BBS K;  1YNN A;  3FKI C;  4QIW L;  2PMZ D;  4OIP A;  4C2M K;  2E2I C;  4C3I C;  3DXJ A;  4KMU A;  3HOU C;  5IYD C;  5FLM C;  1TWH C;  4A3G K;  3HOW C;  1K83 K;  2NVQ K;  1HQM A;  3S14 C;  3S1R C;  4C3J K;  3S1Q K;  4YFX A;  5M3M K;  5M5X K;  2BE5 A;  1WCM C;  2PA8 D;  2R92 C;  2JA7 C;  4BXX K;  4OIQ A;  3S1M C;  3GTO C;  2PA8 L;  3H3V L;  3HOZ K;  3PO2 C;  3RZO C;  4ZH4 A;  3GTQ C;  3PO3 C;  2E2H C;  3S15 K;  4AYB L;  4A3I K;  3M3Y K;  5IP7 C;  3GTP C;  2R7Z C;  2A6E A;  2VUM C;  3GTK K;  4A3C K;  1I3Q C;  4G7O A;  1I6H C;  3GTM K;  2R93 K;  2JA5 C;  1TWC C;  4G7H A;  3HOV C;  4KN4 A;  3S1N K;  3EQL A;  4JK1 A;  4BBR C;  3GTJ C;  4A3D C;  5C4X C;  1ZYR A;  2WB1 D;  3RZD C;  2JA6 C;  4A3F C;  4MEY A;  3FKI K;  2A68 A;  2WB1 L;  5M5W K;  2E2I K;  3I4M K;  4C3I K;  3S2H C;  5IYC C;  1TWF C;  5C4J K;  3HOY C;  5IYD K;  3HOW K;  1YNJ A;  4QJV B;  5C3E C;  2JA8 C;  2PMZ L;  3S14 K;  5TMC A;  1I50 C;  5C44 C;  4A3E C;  3CQZ K;  2R92 K;  2JA7 K;  3S1M K;  3GTO K;  3I4N C;  1IW7 A;  4A3M C;  1SMY A;  3PO2 K;  3GTQ K;  5D4D A;  4Y7N K;  2A69 A;  3GTG C;  5IP7 K;  2VUM K;  1TWG K;  1I3Q K;  2JA5 K;  1TWC K;  3HOV K;  1TWA C;  2WAQ D;  4BBR K;  3K7A C;  2NVT C;  2PPB A;  4A3B C;  5C4X K;  3H0G C;  2WAQ L;  1I6V A;  4A3K C;  3M4O K;  4XSZ A;  1R9T C;  3S2D C;  4A3F K;  3S17 C;  4BY7 K;  3S16 C;  2NVY C;  4LK0 A;  4A3J C;  4NOI A;  2B63 C;  4X6A C;  4MEX A;  3GTL C;  1TWF K;  3S2H K;  4OIR A;  4YG2 A;  2YU9 C;  4C2M C;  2JA8 K;  3HOU K;  5FLM K;  1TWH K;  5FJ8 K;  4YFN A;  4A93 C;  1K83 C;  2E2J C;  2NVQ C;  1I50 K;  5C44 K;  4A3E K;  4XLP A;  3S1R K;  4OIN A;  4G7Z A;  4BY1 C;  3I4N K;  1SFO C;  4A3M K;  4A3L C;  1WCM K;  4XLN A;  4BXX C;  2O5J A;  3GTG K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...