1SMYA

Structural basis for transcription regulation by alarmone ppgpp
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
229
structure length
229
Chain Sequence
MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase alpha chain
publication title Structural basis for transcription regulation by alarmone ppGpp
pubmed doi rcsb
molecule tags Transferase
total genus 40
structure length 229
sequence length 229
chains with identical sequence B, K, L
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2004-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01000 RNA_pol_A_bac RNA polymerase Rpb3/RpoA insert domain
A PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain
A PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.12 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 DNA-directed RNA polymerase, insert domain 1smyA02
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 1smyA01
3HOXC 4KN7A 3RZOK 2A68A 1TWGK 2JA8C 2NVQK 3S15C 4OIPA 1I3QC 3M4OC 4BBSC 2R93C 5C44C 3HOZK 2R7ZC 4A3BK 4A3JK 4BY7K 2BE5A 4C3IC 2E2IC 3GTOC 3HOVK 5C4XK 2NVYK 1TWFC 3K7AC 2PMZD 3GTPK 4LJZA 5IYCC 4G7ZA 3HOWC 3HOXK 2JA7K 2E2JC 3GTLC 4A3KC 1SMYA 4C3JC 3S1NC 2JA8K 5M3FK 3S14C 3I4MC 4XLNA 2A6EA 5TMFA 3GTJC 3S15K 3M3YC 1I3QK 2YU9C 4YG2A 4Q4ZA 2NVTC 5C44K 3M4OK 2R7ZK 4BBSK 4OIQA 2B63C 2WAQL 2R93K 4KN4A 3HKZL 2E2HC 4YFXA 4C3IK 5FLMC 2E2IK 3GTOK 4QIWD 1Y1WC 3GTQK 1ZYRA 1TWFK 5IP9C 3K7AK 3S2HC 3S1MC 4Q5SA 5IYCK 2PA8D 5IYDK 2E2JK 3GTLK 4A3KK 3S1NK 1TWHC 3S1QK 3S16C 3S14K 4BXXC 2CW0A 4YFNA 3GTJK 3CQZC 4BY1C 3M3YK 2YU9K 4C3HC 2NVTK 3H3VL 4XSXA 4AYBL 3GTMK 4Y52K 2E2HK 4A3EC 5FLMK 5FJ8K 3H0GK 4C2MC 1Y1WK 2A69A 2WB1D 1HQMA 3RZDC 5IP9K 3HOUC 3S17C 1WCMC 5M5WK 4GZYA 3S1MK 2Y0SD 3S2HK 4KMUA 5C4JC 3GTKC 1TWHK 3FKIC 4A3FC 3S16K 4LK1A 4BXXK 1SFOC 3CQZK 2VUMC 5M3MK 1Y1VC 4C3HK 5IP7C 4A3GC 1I50C 1YNNA 4A3EK 4OIRA 1TWCC 5M5YK 4C2MK 4OIOA 3HOWK 3RZDK 3PO3C 4A3CC 3HOUK 1WCMK 2NVXC 3S17K 4C3JK 4A3MC 3S2DC 5C4JK 1I6HC 4QJVA 3I4MK 3GTKK 3FKIK 4A3FK 2O5JA 4ZH4A 1TWGC 3PO2C 2JA7C 1SFOK 5IYBC 1R9TC 2VUMK 2A6HA 4YFKA 1Y1VK 2B63K 2JA5C 5IP7K 1K83C 4A3GK 1I50K 2PPBA 2PMZL 4G7HA 4OINA 2WAQD 1YNJA 4BBRC 5D4DA 3HKZD 4XSZA 1IW7A 4XLPA 3S1RC 2NVXK 4X6AC 3PO3K 5C4XC 4A3CK 3HOYC 4A3MK 4A3DC 1I6HK 3EQLA 4LLGA 5C3EC 4A3LC 1TWAC 4BY1K 4JK1A 4G7OA 3PO2K 5IYBK 1R9TK 2R92C 1I6VA 3GTGC 4A3IC 3I4NC 1K83K 2JA5K 4MEYA 2JA6C 4QIWL 3H3VD 4AYBD 5TMCA 4MEXA 4BBRK 2PA8L 1XPPA 4Y7NC 4A93C 3S1RK 4X6AK 3GTQC 3RZOC 3HOYK 4A3DK 4NOIA 3WODA 5C3EK 4A3LK 1BDFA 5IYDC 1TWAK 5M5XK 3DXJA 2NVQC 3S1QC 2R92K 3I4NK 3GTGK 4A3IK 3HOZC 1TWCK 2JA6K 4A3BC 4Y52C 4A3JC 4BY7C 3GTMC 2WB1L 3HOVC 2O5IA 2Y0SL 4Y7NK 2NVYC 3GTPC 3S2DK 4A93K 4QJVB 4MQ9A 3H0GC 4LK0A
chains in the Genus database with same CATH superfamily
3HOXC 1DCPA 1YX2A 1GE9A 1F7UA 1ZVUA 4IOAS 2KXYA 1EH1A 4OIPA 1WQHA 1TWFA 3HOVK 1JQWA 4WCES 2NVYK 3K7AC 1WCMA 4LJZA 2KQ1A 3HOWC 3AQOA 4C3JC 2JA8K 4WJ4A 3JSTA 2RGRA 2B63A 4Q4ZA 2R93K 5TJ3A 5C44K 2R7ZK 4OIQA 3OEPA 1INNA 4KB2A 2E2HC 3BUEA 1ZQ1C 4A3KK 1J98A 3ERED 1R9TA 2XCQA 1G51A 2EBBA 1K83A 2YU9K 4C3HC 3H3VL 4XSXA 4AYBL 3GTMK 3T01A 1FEUA 3H0GK 1Y1WK 2A69A 3S1MK 1WCMC 4GZYA 4BLBA 2CFAA 1TWHK 1SFOC 2XCOA 3OPFA 4A3EK 4G0VA 5M5YK 1XZQB 4OIOA 3L4JA 3HOUK 3S17K 2CFAB 4ILDA 5C4JK 3GTKK 3FKIK 2GSNA 5IYBC 1R9TC 2A6HA 1USOA 1K83C 4A3GK 2GSUA 2PPBA 4RMFA 3AD8C 1UV7A 3AD9C 3PO3K 1IW7A 3S1RC 1TWAA 4KM9A 3HOYC 1I6HK 3EQLA 2R92A 4GTEA 1VH2A 1B4AA 1WQFA 3N3YA 2GAHC 1VLOA 2GSOA 1WOPA 2E2IA 3GTOA 3LYWA 5TMCA 4WFNS 5JVGS 1O24A 4MEXA 2FQTA 1EFWA 1XPPA 4A93C 2V6UA 4X6AK 3AQPA 1O26A 1BDFA 3LAPA 5M5XK 2NVQC 3GSIA 3I4NK 3GTGK 4WJ3M 4J3NA 3FOFA 4A3BC 3GTMC 2WB1L 1PJ7A 2O5IA 3S2DK 3H0GC 3RZOK 4IOCS 1TWGK 2ZJRS 3PIPS 3OREA 1USMA 1O2FB 3S15C 1I3QC 3M4OC 4P9SA 4A3JK 4C3IC 2E2IC 3GTOC 5C4XK 4G0WA 1X31C 3L4KA 2D6FC 2E2JC 3S1NC 1SMYA 3S14C 1VGXA 3GTJC 4GTBA 3M3YC 2E2HA 4BBSK 1RU0A 1O25A 3HKZL 5HQHA 5FLMC 4KASA 3GTQK 3TFIA 1ZYRA 1TWFK 3S2HC 4Q5SA 4KAWX 5IYCK 5EGEA 5HL8A 3GTLK 3S16C 1L0WA 4O2DA 1F7VA 3LPXA 4Y52K 2NVTK 1JOEA 2W7VA 5FJ8K 5DM6S 5IP9K 5M5WK 3RZDC 3TFJA 1SFOA 4GTCA 4BXXK 3N0CA 2L5NA 1WORA 3CQZK 1Y1VC 1IE0A 2L3UA 5HL7S 1IS1A 4BLAA 4C2MK 4A3CC 1PJ6A 2NVXC 4A3MC 3S2DC 1DD5A 5JVHS 4A3FK 2O5JA 1TWGC 1O2AA 2VUMK 4YFKA 5IP7K 3BP8C 4GTAA 1I50K 2PMZL 4G7HA 1YNJA 4BBRC 2ZJPS 2NVYA 4XSZA 4KARA 5C4XC 1XXCA 1WSRA 1V5VA 4A3LC 1XZPA 3FOEA 4JK1A 4G7OA 3PO2K 2R93A 1I6VA 2XCRB 2JA5K 2JA6C 4QIWL 3H3VD 4C45A 4AYBD 4FM9A 2PA8L 4Y7NC 3QX3A 3GTQC 1ZXOA 4A3DK 4NOIA 1O2BA 5IOTA 4KB4A 4U67S 1XZPB 1BS2A 5C3EK 1TWAK 4WF9S 3HXAA 1YCLA 2ZUEA 5JVOA 2YU9A 2R92K 3GTMA 5L46A 3A8KA 4A3IK 2P5MA 2Y3PA 1TWCK 4Y52C 1B4BA 3H0GA 3HOVC 2Y0SL 2NVYC 3S0XA 4LK0A 5M3FK 2A68A 2ZJQS 1TWHA 2JA8C 1I3QA 1XXAA 2R93C 2RH6A 5C44C 3T00A 2R7ZC 1IL2A 3HOZK 4BY7K 1IBAA 1WIHA 3GTPK 4GTLA 2JA7K 3HOXK 2ZUFA 3A8JA 3T02A 3GTKA 4A3KC 3GTJA 3NUHA 4P5AA 4XLNA 2YU9C 2V6SA 2KPUA 2WAQL 4KN4A 1BGWA 1Y1WC 1C0AA 3K7AK 3S1MC 5IYDK 1TWHC 3S1QK 1XXBA 2CW0A 4LOWA 1HI9A 3LAJA 2E2HK 4A3EC 3SZZA 2WB1D 4KC6A 3HOUC 3S17C 4KMUA 5C4JC 4WFAS 4GT9A 5DM7S 3CF5S 3GTKC 3FKIC 1Y1VA 2PHCB 2GAGC 4M1XA 3V4GA 5M3MK 3GTGA 4C3HK 4BKWA 4G0UA 1PJ5A 4A3GC 4WILA 4OIRA 2NVXA 1TWCC 3PO3C 1WCMK 1TWGA 1I6HC 4QJVA 3I4MK 3G4AA 1J6VA 1SFOK 3MMLB 2B63K 4KMHA 5E68A 5D4DA 3HKZD 3GIRA 4X6AC 4MQ9A 4BY1K 3PIOS 1EI6A 3IPJA 5IYBK 1R9TK 2JA6A 3N0BA 3I4NC 3GTGC 1K83K 4KMDA 3FHZA 3GTQA 4PABA 3S1RK 3RZOC 1WSVA 3GEIA 3HOYK 1VJEA 3WODA 3GTLA 5IYDC 3DXJA 4GTFA 3S1QC 1O28A 4A3JC 4XCHA 4WFBS 5IORA 4A93K 2ZFZA 1WOOA 3TFHA 4KN7A 3G4CA 1ISEA 2NVQK 3CQZA 3TTGA 2R7ZA 4BBSC 4A3BK 2BE5A 4GTDA 4IO9S 1TWFC 2PMZD 1XZQA 1EK8A 5IYCC 4G7ZA 1EQRA 3VA7A 3GTLC 5IOQA 3I4MC 2VUMA 2A6EA 5TMFA 3S15K 1I3QK 3M4OK 2NVTC 1I50A 1Y1WA 2B63C 4YFXA 4C3IK 2E2IK 3GTOK 4QIWD 3GEEA 5IP9C 1F93A 1ZBSA 2KWAA 2PA8D 5EGHA 2E2JK 3S1NK 3S14K 1AB4A 4BXXC 5CHPA 4YFNA 3GTJK 3CQZC 4BY1C 4KDDA 4LQYA 3M3YK 2JA5A 5FLMK 4C2MC 1HQMA 3S2HK 3FKIA 2Y0SD 1J6XA 3ADAC 4KMAA 4FZBA 4A3FC 3S16K 4LK1A 1F9NA 1IQ0A 2VUMC 1KQ4A 1BJTA 1TWCA 5IP7C 3AH5A 1I50C 1YNNA 3HOWK 3RZDK 4C3JK 5JFEA 3BP3A 2P8TA 4DDQA 4ZH4A 3PO2C 1O29A 1Y1VK 2JA5C 4KM8A 4OINA 2WAQD 3GTPA 1VRQC 4XLPA 4A3CK 2NVXK 2JA7A 2JH3A 4A3MK 4LR2A 4A3DC 2FQOA 3Q3QA 4LLGA 5C3EC 5CJ9A 1TWAC 1DCOA 3A8IA 4GFQA 1O27A 2R92C 1WQGA 4A3IC 1WOSA 2V6TA 4MEYA 4AH6A 3DLLS 1DCHA 4BBRK 3GEHA 3SZYA 4KATA 4PAAA 4A3LK 5IOSA 3AD7C 1J6WA 4P5BA 3HOZC 2JA6K 4BY7C 1JVIA 3GDZA 3CAGA 4Y7NK 3GTPC 4QJVB 4YG2A 2JA7C
chains in the Genus database with same CATH topology
3HOXC 4KN7A 3RZOK 2A68A 1TWGK 2JA8C 2NVQK 3S15C 4OIPA 1I3QC 3M4OC 4BBSC 2R93C 5C44C 3HOZK 2R7ZC 4A3BK 4A3JK 4BY7K 2BE5A 4C3IC 2E2IC 3GTOC 3HOVK 5C4XK 2NVYK 1TWFC 3K7AC 2PMZD 3GTPK 4LJZA 5IYCC 4G7ZA 3HOWC 3HOXK 2JA7K 2E2JC 3GTLC 4A3KC 1SMYA 4C3JC 3S1NC 2JA8K 5M3FK 3S14C 3I4MC 4XLNA 2A6EA 5TMFA 3GTJC 3S15K 3M3YC 1I3QK 2YU9C 4YG2A 4Q4ZA 2NVTC 5C44K 3M4OK 2R7ZK 4BBSK 4OIQA 2B63C 2WAQL 2R93K 4KN4A 3HKZL 2E2HC 4YFXA 4C3IK 5FLMC 2E2IK 3GTOK 4QIWD 1Y1WC 3GTQK 1ZYRA 1TWFK 5IP9C 3K7AK 3S2HC 3S1MC 4Q5SA 5IYCK 2PA8D 5IYDK 2E2JK 3GTLK 4A3KK 3S1NK 1TWHC 3S1QK 3S16C 3S14K 4BXXC 2CW0A 4YFNA 3GTJK 3CQZC 4BY1C 3M3YK 2YU9K 4C3HC 2NVTK 3H3VL 4XSXA 4AYBL 3GTMK 4Y52K 2E2HK 4A3EC 5FLMK 5FJ8K 3H0GK 4C2MC 1Y1WK 2A69A 2WB1D 1HQMA 3RZDC 5IP9K 3HOUC 3S17C 1WCMC 5M5WK 4GZYA 3S1MK 2Y0SD 3S2HK 4KMUA 5C4JC 3GTKC 1TWHK 3FKIC 4A3FC 3S16K 4LK1A 4BXXK 1SFOC 3CQZK 2VUMC 5M3MK 1Y1VC 4C3HK 5IP7C 4A3GC 1I50C 1YNNA 4A3EK 4OIRA 1TWCC 5M5YK 4C2MK 4OIOA 3HOWK 3RZDK 3PO3C 4A3CC 3HOUK 1WCMK 2NVXC 3S17K 4C3JK 4A3MC 3S2DC 5C4JK 1I6HC 4QJVA 3I4MK 3GTKK 3FKIK 4A3FK 2O5JA 4ZH4A 1TWGC 3PO2C 2JA7C 1SFOK 5IYBC 1R9TC 2VUMK 2A6HA 4YFKA 1Y1VK 2B63K 2JA5C 5IP7K 1K83C 4A3GK 1I50K 2PPBA 2PMZL 4G7HA 4OINA 2WAQD 1YNJA 4BBRC 5D4DA 3HKZD 4XSZA 1IW7A 4XLPA 3S1RC 2NVXK 4X6AC 3PO3K 5C4XC 4A3CK 3HOYC 4A3MK 4A3DC 1I6HK 3EQLA 4LLGA 5C3EC 4A3LC 1TWAC 4BY1K 4JK1A 4G7OA 3PO2K 5IYBK 1R9TK 2R92C 1I6VA 3GTGC 4A3IC 3I4NC 1K83K 2JA5K 4MEYA 2JA6C 4QIWL 3H3VD 4AYBD 5TMCA 4MEXA 4BBRK 2PA8L 1XPPA 4Y7NC 4A93C 3S1RK 4X6AK 3GTQC 3RZOC 3HOYK 4A3DK 4NOIA 3WODA 5C3EK 4A3LK 1BDFA 5IYDC 1TWAK 5M5XK 3DXJA 2NVQC 3S1QC 2R92K 3I4NK 3GTGK 4A3IK 3HOZC 1TWCK 2JA6K 4A3BC 4Y52C 4A3JC 4BY7C 3GTMC 2WB1L 3HOVC 2O5IA 2Y0SL 4Y7NK 2NVYC 3GTPC 3S2DK 4A93K 4QJVB 4MQ9A 3H0GC 4LK0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HOX C;  4KN7 A;  3RZO K;  2A68 A;  1TWG K;  2JA8 C;  2NVQ K;  3S15 C;  4OIP A;  1I3Q C;  3M4O C;  4BBS C;  2R93 C;  5C44 C;  3HOZ K;  2R7Z C;  4A3B K;  4A3J K;  4BY7 K;  2BE5 A;  4C3I C;  2E2I C;  3GTO C;  3HOV K;  5C4X K;  2NVY K;  1TWF C;  3K7A C;  2PMZ D;  3GTP K;  4LJZ A;  5IYC C;  4G7Z A;  3HOW C;  3HOX K;  2JA7 K;  2E2J C;  3GTL C;  4A3K C;  1SMY A;  4C3J C;  3S1N C;  2JA8 K;  5M3F K;  3S14 C;  3I4M C;  4XLN A;  2A6E A;  5TMF A;  3GTJ C;  3S15 K;  3M3Y C;  1I3Q K;  2YU9 C;  4YG2 A;  4Q4Z A;  2NVT C;  5C44 K;  3M4O K;  2R7Z K;  4BBS K;  4OIQ A;  2B63 C;  2WAQ L;  2R93 K;  4KN4 A;  3HKZ L;  2E2H C;  4YFX A;  4C3I K;  5FLM C;  2E2I K;  3GTO K;  4QIW D;  1Y1W C;  3GTQ K;  1ZYR A;  1TWF K;  5IP9 C;  3K7A K;  3S2H C;  3S1M C;  4Q5S A;  5IYC K;  2PA8 D;  5IYD K;  2E2J K;  3GTL K;  4A3K K;  3S1N K;  1TWH C;  3S1Q K;  3S16 C;  3S14 K;  4BXX C;  2CW0 A;  4YFN A;  3GTJ K;  3CQZ C;  4BY1 C;  3M3Y K;  2YU9 K;  4C3H C;  2NVT K;  3H3V L;  4XSX A;  4AYB L;  3GTM K;  4Y52 K;  2E2H K;  4A3E C;  5FLM K;  5FJ8 K;  3H0G K;  4C2M C;  1Y1W K;  2A69 A;  2WB1 D;  1HQM A;  3RZD C;  5IP9 K;  3HOU C;  3S17 C;  1WCM C;  5M5W K;  4GZY A;  3S1M K;  2Y0S D;  3S2H K;  4KMU A;  5C4J C;  3GTK C;  1TWH K;  3FKI C;  4A3F C;  3S16 K;  4LK1 A;  4BXX K;  1SFO C;  3CQZ K;  2VUM C;  5M3M K;  1Y1V C;  4C3H K;  5IP7 C;  4A3G C;  1I50 C;  1YNN A;  4A3E K;  4OIR A;  1TWC C;  5M5Y K;  4C2M K;  4OIO A;  3HOW K;  3RZD K;  3PO3 C;  4A3C C;  3HOU K;  1WCM K;  2NVX C;  3S17 K;  4C3J K;  4A3M C;  3S2D C;  5C4J K;  1I6H C;  4QJV A;  3I4M K;  3GTK K;  3FKI K;  4A3F K;  2O5J A;  4ZH4 A;  1TWG C;  3PO2 C;  2JA7 C;  1SFO K;  5IYB C;  1R9T C;  2VUM K;  2A6H A;  4YFK A;  1Y1V K;  2B63 K;  2JA5 C;  5IP7 K;  1K83 C;  4A3G K;  1I50 K;  2PPB A;  2PMZ L;  4G7H A;  4OIN A;  2WAQ D;  1YNJ A;  4BBR C;  5D4D A;  3HKZ D;  4XSZ A;  1IW7 A;  4XLP A;  3S1R C;  2NVX K;  4X6A C;  3PO3 K;  5C4X C;  4A3C K;  3HOY C;  4A3M K;  4A3D C;  1I6H K;  3EQL A;  4LLG A;  5C3E C;  4A3L C;  1TWA C;  4BY1 K;  4JK1 A;  4G7O A;  3PO2 K;  5IYB K;  1R9T K;  2R92 C;  1I6V A;  3GTG C;  4A3I C;  3I4N C;  1K83 K;  2JA5 K;  4MEY A;  2JA6 C;  4QIW L;  3H3V D;  4AYB D;  5TMC A;  4MEX A;  4BBR K;  2PA8 L;  1XPP A;  4Y7N C;  4A93 C;  3S1R K;  4X6A K;  3GTQ C;  3RZO C;  3HOY K;  4A3D K;  4NOI A;  3WOD A;  5C3E K;  4A3L K;  1BDF A;  5IYD C;  1TWA K;  5M5X K;  3DXJ A;  2NVQ C;  3S1Q C;  2R92 K;  3I4N K;  3GTG K;  4A3I K;  3HOZ C;  1TWC K;  2JA6 K;  4A3B C;  4Y52 C;  4A3J C;  4BY7 C;  3GTM C;  2WB1 L;  3HOV C;  2O5I A;  2Y0S L;  4Y7N K;  2NVY C;  3GTP C;  3S2D K;  4A93 K;  4QJV B;  4MQ9 A;  3H0G C;  4LK0 A; 
#chains in the Genus database with same CATH topology
 3HOX C;  1DCP A;  1YX2 A;  1GE9 A;  1F7U A;  1ZVU A;  4IOA S;  2KXY A;  1EH1 A;  4OIP A;  1WQH A;  1TWF A;  3HOV K;  1JQW A;  4WCE S;  2NVY K;  3K7A C;  1WCM A;  4LJZ A;  2KQ1 A;  3HOW C;  3AQO A;  4C3J C;  2JA8 K;  4WJ4 A;  3JST A;  2RGR A;  2B63 A;  4Q4Z A;  2R93 K;  5TJ3 A;  5C44 K;  2R7Z K;  4OIQ A;  3OEP A;  1INN A;  4KB2 A;  2E2H C;  3BUE A;  1ZQ1 C;  4A3K K;  1J98 A;  3ERE D;  1R9T A;  2XCQ A;  1G51 A;  2EBB A;  1K83 A;  2YU9 K;  4C3H C;  3H3V L;  4XSX A;  4AYB L;  3GTM K;  3T01 A;  1FEU A;  3H0G K;  1Y1W K;  2A69 A;  3S1M K;  1WCM C;  4GZY A;  4BLB A;  2CFA A;  1TWH K;  1SFO C;  2XCO A;  3OPF A;  4A3E K;  4G0V A;  5M5Y K;  1XZQ B;  4OIO A;  3L4J A;  3HOU K;  3S17 K;  2CFA B;  4ILD A;  5C4J K;  3GTK K;  3FKI K;  2GSN A;  5IYB C;  1R9T C;  2A6H A;  1USO A;  1K83 C;  4A3G K;  2GSU A;  2PPB A;  4RMF A;  3AD8 C;  1UV7 A;  3AD9 C;  3PO3 K;  1IW7 A;  3S1R C;  1TWA A;  4KM9 A;  3HOY C;  1I6H K;  3EQL A;  2R92 A;  4GTE A;  1VH2 A;  1B4A A;  1WQF A;  3N3Y A;  2GAH C;  1VLO A;  2GSO A;  1WOP A;  2E2I A;  3GTO A;  3LYW A;  5TMC A;  4WFN S;  5JVG S;  1O24 A;  4MEX A;  2FQT A;  1EFW A;  1XPP A;  4A93 C;  2V6U A;  4X6A K;  3AQP A;  1O26 A;  1BDF A;  3LAP A;  5M5X K;  2NVQ C;  3GSI A;  3I4N K;  3GTG K;  4WJ3 M;  4J3N A;  3FOF A;  4A3B C;  3GTM C;  2WB1 L;  1PJ7 A;  2O5I A;  3S2D K;  3H0G C;  3RZO K;  4IOC S;  1TWG K;  2ZJR S;  3PIP S;  3ORE A;  1USM A;  1O2F B;  3S15 C;  1I3Q C;  3M4O C;  4P9S A;  4A3J K;  4C3I C;  2E2I C;  3GTO C;  5C4X K;  4G0W A;  1X31 C;  3L4K A;  2D6F C;  2E2J C;  3S1N C;  1SMY A;  3S14 C;  1VGX A;  3GTJ C;  4GTB A;  3M3Y C;  2E2H A;  4BBS K;  1RU0 A;  1O25 A;  3HKZ L;  5HQH A;  5FLM C;  4KAS A;  3GTQ K;  3TFI A;  1ZYR A;  1TWF K;  3S2H C;  4Q5S A;  4KAW X;  5IYC K;  5EGE A;  5HL8 A;  3GTL K;  3S16 C;  1L0W A;  4O2D A;  1F7V A;  3LPX A;  4Y52 K;  2NVT K;  1JOE A;  2W7V A;  5FJ8 K;  5DM6 S;  5IP9 K;  5M5W K;  3RZD C;  3TFJ A;  1SFO A;  4GTC A;  4BXX K;  3N0C A;  2L5N A;  1WOR A;  3CQZ K;  1Y1V C;  1IE0 A;  2L3U A;  5HL7 S;  1IS1 A;  4BLA A;  4C2M K;  4A3C C;  1PJ6 A;  2NVX C;  4A3M C;  3S2D C;  1DD5 A;  5JVH S;  4A3F K;  2O5J A;  1TWG C;  1O2A A;  2VUM K;  4YFK A;  5IP7 K;  3BP8 C;  4GTA A;  1I50 K;  2PMZ L;  4G7H A;  1YNJ A;  4BBR C;  2ZJP S;  2NVY A;  4XSZ A;  4KAR A;  5C4X C;  1XXC A;  1WSR A;  1V5V A;  4A3L C;  1XZP A;  3FOE A;  4JK1 A;  4G7O A;  3PO2 K;  2R93 A;  1I6V A;  2XCR B;  2JA5 K;  2JA6 C;  4QIW L;  3H3V D;  4C45 A;  4AYB D;  4FM9 A;  2PA8 L;  4Y7N C;  3QX3 A;  3GTQ C;  1ZXO A;  4A3D K;  4NOI A;  1O2B A;  5IOT A;  4KB4 A;  4U67 S;  1XZP B;  1BS2 A;  5C3E K;  1TWA K;  4WF9 S;  3HXA A;  1YCL A;  2ZUE A;  5JVO A;  2YU9 A;  2R92 K;  3GTM A;  5L46 A;  3A8K A;  4A3I K;  2P5M A;  2Y3P A;  1TWC K;  4Y52 C;  1B4B A;  3H0G A;  3HOV C;  2Y0S L;  2NVY C;  3S0X A;  4LK0 A;  5M3F K;  2A68 A;  2ZJQ S;  1TWH A;  2JA8 C;  1I3Q A;  1XXA A;  2R93 C;  2RH6 A;  5C44 C;  3T00 A;  2R7Z C;  1IL2 A;  3HOZ K;  4BY7 K;  1IBA A;  1WIH A;  3GTP K;  4GTL A;  2JA7 K;  3HOX K;  2ZUF A;  3A8J A;  3T02 A;  3GTK A;  4A3K C;  3GTJ A;  3NUH A;  4P5A A;  4XLN A;  2YU9 C;  2V6S A;  2KPU A;  2WAQ L;  4KN4 A;  1BGW A;  1Y1W C;  1C0A A;  3K7A K;  3S1M C;  5IYD K;  1TWH C;  3S1Q K;  1XXB A;  2CW0 A;  4LOW A;  1HI9 A;  3LAJ A;  2E2H K;  4A3E C;  3SZZ A;  2WB1 D;  4KC6 A;  3HOU C;  3S17 C;  4KMU A;  5C4J C;  4WFA S;  4GT9 A;  5DM7 S;  3CF5 S;  3GTK C;  3FKI C;  1Y1V A;  2PHC B;  2GAG C;  4M1X A;  3V4G A;  5M3M K;  3GTG A;  4C3H K;  4BKW A;  4G0U A;  1PJ5 A;  4A3G C;  4WIL A;  4OIR A;  2NVX A;  1TWC C;  3PO3 C;  1WCM K;  1TWG A;  1I6H C;  4QJV A;  3I4M K;  3G4A A;  1J6V A;  1SFO K;  3MML B;  2B63 K;  4KMH A;  5E68 A;  5D4D A;  3HKZ D;  3GIR A;  4X6A C;  4MQ9 A;  4BY1 K;  3PIO S;  1EI6 A;  3IPJ A;  5IYB K;  1R9T K;  2JA6 A;  3N0B A;  3I4N C;  3GTG C;  1K83 K;  4KMD A;  3FHZ A;  3GTQ A;  4PAB A;  3S1R K;  3RZO C;  1WSV A;  3GEI A;  3HOY K;  1VJE A;  3WOD A;  3GTL A;  5IYD C;  3DXJ A;  4GTF A;  3S1Q C;  1O28 A;  4A3J C;  4XCH A;  4WFB S;  5IOR A;  4A93 K;  2ZFZ A;  1WOO A;  3TFH A;  4KN7 A;  3G4C A;  1ISE A;  2NVQ K;  3CQZ A;  3TTG A;  2R7Z A;  4BBS C;  4A3B K;  2BE5 A;  4GTD A;  4IO9 S;  1TWF C;  2PMZ D;  1XZQ A;  1EK8 A;  5IYC C;  4G7Z A;  1EQR A;  3VA7 A;  3GTL C;  5IOQ A;  3I4M C;  2VUM A;  2A6E A;  5TMF A;  3S15 K;  1I3Q K;  3M4O K;  2NVT C;  1I50 A;  1Y1W A;  2B63 C;  4YFX A;  4C3I K;  2E2I K;  3GTO K;  4QIW D;  3GEE A;  5IP9 C;  1F93 A;  1ZBS A;  2KWA A;  2PA8 D;  5EGH A;  2E2J K;  3S1N K;  3S14 K;  1AB4 A;  4BXX C;  5CHP A;  4YFN A;  3GTJ K;  3CQZ C;  4BY1 C;  4KDD A;  4LQY A;  3M3Y K;  2JA5 A;  5FLM K;  4C2M C;  1HQM A;  3S2H K;  3FKI A;  2Y0S D;  1J6X A;  3ADA C;  4KMA A;  4FZB A;  4A3F C;  3S16 K;  4LK1 A;  1F9N A;  1IQ0 A;  2VUM C;  1KQ4 A;  1BJT A;  1TWC A;  5IP7 C;  3AH5 A;  1I50 C;  1YNN A;  3HOW K;  3RZD K;  4C3J K;  5JFE A;  3BP3 A;  2P8T A;  4DDQ A;  4ZH4 A;  3PO2 C;  1O29 A;  1Y1V K;  2JA5 C;  4KM8 A;  4OIN A;  2WAQ D;  3GTP A;  1VRQ C;  4XLP A;  4A3C K;  2NVX K;  2JA7 A;  2JH3 A;  4A3M K;  4LR2 A;  4A3D C;  2FQO A;  3Q3Q A;  4LLG A;  5C3E C;  5CJ9 A;  1TWA C;  1DCO A;  3A8I A;  4GFQ A;  1O27 A;  2R92 C;  1WQG A;  4A3I C;  1WOS A;  2V6T A;  4MEY A;  4AH6 A;  3DLL S;  1DCH A;  4BBR K;  3GEH A;  3SZY A;  4KAT A;  4PAA A;  4A3L K;  5IOS A;  3AD7 C;  1J6W A;  4P5B A;  3HOZ C;  2JA6 K;  4BY7 C;  1JVI A;  3GDZ A;  3CAG A;  4Y7N K;  3GTP C;  4QJV B;  4YG2 A;  2JA7 C; 
#chains in the Genus database with same CATH homology
 3HOX C;  4KN7 A;  3RZO K;  2A68 A;  1TWG K;  2JA8 C;  2NVQ K;  3S15 C;  4OIP A;  1I3Q C;  3M4O C;  4BBS C;  2R93 C;  5C44 C;  3HOZ K;  2R7Z C;  4A3B K;  4A3J K;  4BY7 K;  2BE5 A;  4C3I C;  2E2I C;  3GTO C;  3HOV K;  5C4X K;  2NVY K;  1TWF C;  3K7A C;  2PMZ D;  3GTP K;  4LJZ A;  5IYC C;  4G7Z A;  3HOW C;  3HOX K;  2JA7 K;  2E2J C;  3GTL C;  4A3K C;  1SMY A;  4C3J C;  3S1N C;  2JA8 K;  5M3F K;  3S14 C;  3I4M C;  4XLN A;  2A6E A;  5TMF A;  3GTJ C;  3S15 K;  3M3Y C;  1I3Q K;  2YU9 C;  4YG2 A;  4Q4Z A;  2NVT C;  5C44 K;  3M4O K;  2R7Z K;  4BBS K;  4OIQ A;  2B63 C;  2WAQ L;  2R93 K;  4KN4 A;  3HKZ L;  2E2H C;  4YFX A;  4C3I K;  5FLM C;  2E2I K;  3GTO K;  4QIW D;  1Y1W C;  3GTQ K;  1ZYR A;  1TWF K;  5IP9 C;  3K7A K;  3S2H C;  3S1M C;  4Q5S A;  5IYC K;  2PA8 D;  5IYD K;  2E2J K;  3GTL K;  4A3K K;  3S1N K;  1TWH C;  3S1Q K;  3S16 C;  3S14 K;  4BXX C;  2CW0 A;  4YFN A;  3GTJ K;  3CQZ C;  4BY1 C;  3M3Y K;  2YU9 K;  4C3H C;  2NVT K;  3H3V L;  4XSX A;  4AYB L;  3GTM K;  4Y52 K;  2E2H K;  4A3E C;  5FLM K;  5FJ8 K;  3H0G K;  4C2M C;  1Y1W K;  2A69 A;  2WB1 D;  1HQM A;  3RZD C;  5IP9 K;  3HOU C;  3S17 C;  1WCM C;  5M5W K;  4GZY A;  3S1M K;  2Y0S D;  3S2H K;  4KMU A;  5C4J C;  3GTK C;  1TWH K;  3FKI C;  4A3F C;  3S16 K;  4LK1 A;  4BXX K;  1SFO C;  3CQZ K;  2VUM C;  5M3M K;  1Y1V C;  4C3H K;  5IP7 C;  4A3G C;  1I50 C;  1YNN A;  4A3E K;  4OIR A;  1TWC C;  5M5Y K;  4C2M K;  4OIO A;  3HOW K;  3RZD K;  3PO3 C;  4A3C C;  3HOU K;  1WCM K;  2NVX C;  3S17 K;  4C3J K;  4A3M C;  3S2D C;  5C4J K;  1I6H C;  4QJV A;  3I4M K;  3GTK K;  3FKI K;  4A3F K;  2O5J A;  4ZH4 A;  1TWG C;  3PO2 C;  2JA7 C;  1SFO K;  5IYB C;  1R9T C;  2VUM K;  2A6H A;  4YFK A;  1Y1V K;  2B63 K;  2JA5 C;  5IP7 K;  1K83 C;  4A3G K;  1I50 K;  2PPB A;  2PMZ L;  4G7H A;  4OIN A;  2WAQ D;  1YNJ A;  4BBR C;  5D4D A;  3HKZ D;  4XSZ A;  1IW7 A;  4XLP A;  3S1R C;  2NVX K;  4X6A C;  3PO3 K;  5C4X C;  4A3C K;  3HOY C;  4A3M K;  4A3D C;  1I6H K;  3EQL A;  4LLG A;  5C3E C;  4A3L C;  1TWA C;  4BY1 K;  4JK1 A;  4G7O A;  3PO2 K;  5IYB K;  1R9T K;  2R92 C;  1I6V A;  3GTG C;  4A3I C;  3I4N C;  1K83 K;  2JA5 K;  4MEY A;  2JA6 C;  4QIW L;  3H3V D;  4AYB D;  5TMC A;  4MEX A;  4BBR K;  2PA8 L;  1XPP A;  4Y7N C;  4A93 C;  3S1R K;  4X6A K;  3GTQ C;  3RZO C;  3HOY K;  4A3D K;  4NOI A;  3WOD A;  5C3E K;  4A3L K;  1BDF A;  5IYD C;  1TWA K;  5M5X K;  3DXJ A;  2NVQ C;  3S1Q C;  2R92 K;  3I4N K;  3GTG K;  4A3I K;  3HOZ C;  1TWC K;  2JA6 K;  4A3B C;  4Y52 C;  4A3J C;  4BY7 C;  3GTM C;  2WB1 L;  3HOV C;  2O5I A;  2Y0S L;  4Y7N K;  2NVY C;  3GTP C;  3S2D K;  4A93 K;  4QJV B;  4MQ9 A;  3H0G C;  4LK0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...