1SMYA

Structural basis for transcription regulation by alarmone ppgpp
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
229
structure length
229
Chain Sequence
MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords DNA-directed RNA polymerase alpha chain
publication title Structural basis for transcription regulation by alarmone ppGpp
pubmed doi rcsb
total genus 40
structure length 229
sequence length 229
chains with identical sequence B, K, L
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2004-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01000 RNA_pol_A_bac RNA polymerase Rpb3/RpoA insert domain
A PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain
A PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.12 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 DNA-directed RNA polymerase, insert domain 1smyA02
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 1smyA01
3HKZD 3M3YC 4G7OA 4ZH4A 3WODA 2R92C 4A3IK 4MEXA 2WB1D 3HOUC 4MQ9A 4OIQA 1Y1VK 1Y1WC 2JA6K 3GTKK 5IYDK 3GTPK 1R9TC 1WCMC 4A3JK 5IYCC 3H0GK 4BY7K 3M4OK 5C44K 2R93C 3CQZC 3GTQC 3EQLA 3HOYC 4Y52C 4A3EC 3PO2K 3S15C 3HOVC 2JA5C 4KN7A 4XLPA 5IP9C 4A93K 2E2IK 3FKIC 1SMYA 2Y0SD 1K83C 3S1NK 2A6EA 2E2JK 1I3QC 2NVQK 4BBSK 4BY1C 4C3HK 3RZDK 3I4NK 2NVXK 3PO3K 3S16C 4QIWD 4C3IC 3S1MK 4C3JK 2O5IA 3S2HC 4QIWL 3S1QC 1TWAC 1TWCC 2PMZD 2NVYK 5M5WK 2JA8K 4KMUA 2A6HA 2PMZL 5C4JK 3H3VD 3GTMK 1SFOC 2R92K 4Q4ZA 4LJZA 5M3FK 3M3YK 5TMFA 2VUMC 4A3BC 3HOUK 1TWGC 3HKZL 1Y1WK 4YFKA 1R9TK 3HOZC 2WAQD 4C2MC 2WB1L 4XSXA 2B63K 4YG2A 2PA8D 2R93K 2WAQL 3CQZK 3GTQK 5C3EC 4A3EK 4A3KK 3S1RC 4Y52K 3S15K 2NVTC 2JA5K 3HOWC 5IP9K 4BBRC 1BDFA 1TWHC 4X6AK 1TWFK 1I3QK 4G7HA 3GTJC 4A3FC 5M5YK 2Y0SL 2JA7K 4OIOA 4A3LK 3GTGC 4OINA 4BY1K 4A3CK 3S17C 5IYBK 1HQMA 4A3MC 3S2DK 4C3IK 3DXJA 4OIPA 5IP7C 3RZDC 2PPBA 3S2HK 1TWAK 3GTOK 1IW7A 4JK1A 4Y7NC 4G7ZA 4A3IC 2JA6C 5FLMC 3GTPC 4A3BK 4A3JC 2CW0A 2E2HC 3H0GC 3H3VL 3HOXC 4C2MK 5C4XC 1WCMK 4A3GC 5IYCK 4KN4A 5C3EK 3S14K 3RZOC 3HOYK 2YU9C 1I6HC 2NVTK 2PA8L 3HOVK 4QJVA 4BXXC 1TWHK 3FKIK 1K83K 5TMCA 1ZYRA 3K7AC 4OIRA 3I4MC 3GTLC 4A3DC 2NVXC 3PO3C 3S1MC 2O5JA 2R7ZC 4QJVB 4A3MK 1YNJA 4LK0A 3S16K 2JA8C 2B63C 3S14C 5IP7K 4LK1A 1I50C 5C4JC 3GTMC 1TWCK 4AYBD 5M5XK 4Y7NK 3S1QK 4LLGA 1Y1VC 3GTKC 2A68A 5IYDC 4XLNA 4AYBL 5FLMK 1SFOK 2VUMK 2E2HK 1TWGK 5D4DA 4BY7C 4GZYA 3M4OC 1XPPA 5C44C 5C4XK 5M3MK 4A3KC 3PO2C 3HOXK 3HOZK 4A3GK 5FJ8K 4A93C 3RZOK 2YU9K 3S1RK 4XSZA 2E2IC 4NOIA 1I6HK 4X6AC 3S1NC 1TWFC 4BXXK 2E2JC 3HOWK 2JA7C 4A3LC 4MEYA 1I6VA 4A3CC 4BBRK 2NVQC 4BBSC 5IYBC 3K7AK 4C3HC 3GTLK 3GTJK 3I4NC 4A3FK 3I4MK 4A3DK 3S2DC 3GTGK 3S17K 2R7ZK 1YNNA 4C3JC 3GTOC 2A69A 4YFNA 4Q5SA 2NVYC 4YFXA 1I50K 2BE5A
chains in the Genus database with same CATH superfamily
3M3YC 4J3NA 4ZH4A 3WODA 2R92C 4WFBS 3GTPK 4P5AA 1USOA 5IYCC 3H0GK 3GTQC 4Y52C 4KM9A 3A8KA 1VJEA 1SFOA 2JA5C 4A93K 5IP9C 3L4JA 1EFWA 2V6SA 4G0VA 3N3YA 2XCQA 3AQOA 1PJ6A 3S16C 2ZUFA 3S1QC 1ZXOA 5M5WK 4GTAA 3GEEA 3M3YK 3GTGA 3GDZA 2R92K 4LJZA 2VUMC 1TWGC 3HKZL 5E68A 4YFKA 4GTBA 3GSIA 1INNA 3GTQK 5CJ9A 2CFAB 3GTKA 3A8JA 4Y52K 2JA6A 2KXYA 2NVTC 3TFHA 2JA5K 1J6WA 5IP9K 4BBRC 5HQHA 4X6AK 1B4BA 2Y0SL 4A3LK 2P5MA 4WF9S 5HL8A 1IE0A 4U67S 1FEUA 1IW7A 1IS1A 1PJ7A 2KPUA 4G7ZA 4A3IC 5FLMC 1WSVA 1WSRA 4KC6A 4BKWA 3H3VL 5DM6S 1JVIA 1WCMK 1BS2A 4A3GC 1WOOA 1ZBSA 3GTMA 2RGRA 2L3UA 1IQ0A 1VGXA 3RZOC 4RMFA 2YU9C 4AH6A 2NVTK 3HOVK 4BXXC 3FOEA 1YCLA 3K7AC 3I4MC 3PO3C 1O2AA 4QJVB 4LQYA 5L46A 2JA8C 1I3QA 2B63C 5C4JC 1G51A 1TWCK 4AYBD 1Y1VC 2A68A 5FLMK 4KMDA 3AH5A 1TWAA 1EQRA 1DD5A 5M3MK 5C44C 4A3GK 5FJ8K 4ILDA 5EGEA 3RZOK 2YU9K 3S1RK 2E2IC 4NOIA 1X31C 1TWFC 4BXXK 3HOWK 4MEYA 4IOAS 2ZUEA 3BP3A 3K7AK 5IYBC 3I4MK 4A3FK 3S2DC 3FKIA 1K83A 4KB2A 4WJ4A 4Q5SA 4IOCS 2NVYC 2GSUA 1L0WA 2B63K 5IOSA 5IORA 2WB1D 1Y1VK 3FHZA 4OIQA 4KAWX 4A3JK 1WQHA 2R93C 5C44K 2ZJRS 4A3EC 2Y3PA 3S15C 1VRQC 4KN7A 4XLPA 2E2HA 2E2IK 3N0BA 4KM8A 1DCHA 1XXBA 3VA7A 4BY1C 2NVXK 4QIWD 3CAGA 3S2HC 5IOQA 3ADAC 2PMZD 2NVYK 3GTJA 2L5NA 3LYWA 1SFOC 2CFAA 4Q4ZA 2R7ZA 4WFAS 1JOEA 4KB4A 1BGWA 4C2MC 1I50A 2PA8D 1O2FB 2R93K 1UV7A 5C3EC 4A3EK 4A3KK 3S15K 3GTPA 4GTCA 1BDFA 3H0GA 1F9NA 4G7HA 5JVOA 5M5YK 2JA7K 3GTGC 4OINA 4BY1K 4A3CK 4M1XA 3S17C 2RH6A 1HQMA 3N0CA 2JH3A 4A3MC 3CF5S 4GTEA 1J98A 3LAJA 3GEIA 4WJ3M 4OIPA 3RZDC 3S2HK 3GTOK 1WQGA 2JA6C 5CHPA 2ZFZA 2ZJPS 3GIRA 2CW0A 3HOXC 4C2MK 5IYCK 2R92A 5C3EK 1XXCA 1ZQ1C 1I6HC 4QJVA 1ZYRA 3GTLC 4A3DC 2JA5A 3S1MC 3BP8C 5IOTA 4A3MK 3AQPA 3S16K 1WOSA 4O2DA 3S14C 1WOPA 2P8TA 5M5XK 3GTMC 4KMHA 3S1QK 4LR2A 4LLGA 2KQ1A 1F93A 5JVGS 4AYBL 2VUMK 1TWGK 3NUHA 2FQTA 5D4DA 4GZYA 3G4CA 3M4OC 3HOXK 3S0XA 1GE9A 3PO2C 3ERED 1I6HK 4XSZA 4KASA 4KATA 3S1NC 2D6FC 2E2JC 1WCMA 3AD8C 4BBRK 4BBSC 3GTLK 4A3DK 3I4NC 4C3JC 3BUEA 1J6XA 4P5BA 3SZYA 4LOWA 3S14K 2XCRB 5DM7S 2V6UA 3HKZD 4G7OA 4FZBA 4A3IK 4MQ9A 1Y1WC 1R9TC 1DCPA 1J6VA 1TWCA 3TFIA 3M4OK 3CQZC 3PO2K 3EQLA 3HOYC 2GAGC 1O28A 1O25A 3FKIC 2Y0SD 3S1NK 1K83C 2A6EA 2E2JK 4BBSK 4WCES 2GAHC 1EI6A 3I4NK 2FQOA 5JFEA 3PO3K 4C3IC 4C3JK 2O5IA 4QIWL 2JA8K 2PMZL 5C4JK 3H3VD 1EH1A 5M3FK 5TMFA 4A3BC 1Y1WK 1F7VA 2B63A 1R9TK 3HOZC 2WAQD 3HXAA 4XSXA 3AD9C 4WFNS 1RU0A 3CQZK 3G4AA 1O26A 1TWHC 3T01A 1TWFK 3GTJC 4OIOA 5IYBK 2E2IA 1YX2A 1EK8A 4C3IK 2GSOA 3S2DK 3DXJA 2KWAA 5IP7C 4JK1A 4Y7NC 2NVXA 3T00A 3GTPC 3JSTA 4A3BK 3H0GC 4G0UA 2PHCB 5JVHS 4KN4A 4PABA 1O29A 1IBAA 3Q3QA 3IPJA 1TWHK 2XCOA 1VLOA 5TMCA 2R93A 4OIRA 3PIOS 3OPFA 3OEPA 3LPXA 2O5JA 3FOFA 1JQWA 4GFQA 3OREA 5IP7K 2JA7A 4LK1A 1V5VA 4Y7NK 3L4KA 4IO9S 2V6TA 3SZZA 3GTKC 5IYDC 1SFOK 3GTOA 1XPPA 4BY7C 3A8IA 4X6AC 1WQFA 1XZPB 4A3LC 1HI9A 1B4AA 2GSNA 2NVQC 3GTQA 4C3HC 4DDQA 4GTDA 3GTGK 3S17K 4C45A 3RZDK 2BE5A 3LAPA 4BLBA 1C0AA 3V4GA 4MEXA 3HOUC 1PJ5A 2ZJQS 3GTKK 5IYDK 2JA6K 1WCMC 1XZQB 4BY7K 4KDDA 3HOVC 2VUMA 3MMLB 1TWGA 1SMYA 1I3QC 2W7VA 1O27A 2NVQK 1ISEA 4C3HK 4WILA 2EBBA 5TJ3A 3S1MK 1AB4A 1TWAC 1TWCC 3GTLA 4KMUA 2A6HA 3GTMK 3HOUK 1WIHA 3PIPS 3GEHA 2WB1L 1O2BA 4YG2A 2WAQL 4FM9A 3S1RC 1KQ4A 3HOWC 1BJTA 3TFJA 1I3QK 4A3FC 5EGHA 1XXAA 2YU9A 4XCHA 2PPBA 1TWAK 4P9SA 1F7UA 3QX3A 4GTLA 4A3JC 2E2HC 5C4XC 1O24A 1VH2A 4GT9A 3HOYK 1Y1VA 1Y1WA 1IL2A 2PA8L 1R9TA 1WORA 3FKIK 3TTGA 3T02A 1K83K 3CQZA 2NVXC 3AD7C 2R7ZC 1YNJA 4LK0A 1TWFA 1ZVUA 4PAAA 1I50C 4KMAA 1USMA 4BLAA 4XLNA 2E2HK 1XZPA 2NVYA 4GTFA 5C4XK 3HOZK 4A3KC 4A93C 1DCOA 2JA7C 1I6VA 4A3CC 4KARA 3GTJK 3DLLS 1TWHA 2R7ZK 1YNNA 3GTOC 2A69A 4YFNA 1XZQA 4G0WA 4YFXA 1I50K 5HL7S
chains in the Genus database with same CATH topology
3HKZD 3M3YC 4G7OA 4ZH4A 3WODA 2R92C 4A3IK 4MEXA 2WB1D 3HOUC 4MQ9A 4OIQA 1Y1VK 1Y1WC 2JA6K 3GTKK 5IYDK 3GTPK 1R9TC 1WCMC 4A3JK 5IYCC 3H0GK 4BY7K 3M4OK 5C44K 2R93C 3CQZC 3GTQC 3EQLA 3HOYC 4Y52C 4A3EC 3PO2K 3S15C 3HOVC 2JA5C 4KN7A 4XLPA 5IP9C 4A93K 2E2IK 3FKIC 1SMYA 2Y0SD 1K83C 3S1NK 2A6EA 2E2JK 1I3QC 2NVQK 4BBSK 4BY1C 4C3HK 3RZDK 3I4NK 2NVXK 3PO3K 3S16C 4QIWD 4C3IC 3S1MK 4C3JK 2O5IA 3S2HC 4QIWL 3S1QC 1TWAC 1TWCC 2PMZD 2NVYK 5M5WK 2JA8K 4KMUA 2A6HA 2PMZL 5C4JK 3H3VD 3GTMK 1SFOC 2R92K 4Q4ZA 4LJZA 5M3FK 3M3YK 5TMFA 2VUMC 4A3BC 3HOUK 1TWGC 3HKZL 1Y1WK 4YFKA 1R9TK 3HOZC 2WAQD 4C2MC 2WB1L 4XSXA 2B63K 4YG2A 2PA8D 2R93K 2WAQL 3CQZK 3GTQK 5C3EC 4A3EK 4A3KK 3S1RC 4Y52K 3S15K 2NVTC 2JA5K 3HOWC 5IP9K 4BBRC 1BDFA 1TWHC 4X6AK 1TWFK 1I3QK 4G7HA 3GTJC 4A3FC 5M5YK 2Y0SL 2JA7K 4OIOA 4A3LK 3GTGC 4OINA 4BY1K 4A3CK 3S17C 5IYBK 1HQMA 4A3MC 3S2DK 4C3IK 3DXJA 4OIPA 5IP7C 3RZDC 2PPBA 3S2HK 1TWAK 3GTOK 1IW7A 4JK1A 4Y7NC 4G7ZA 4A3IC 2JA6C 5FLMC 3GTPC 4A3BK 4A3JC 2CW0A 2E2HC 3H0GC 3H3VL 3HOXC 4C2MK 5C4XC 1WCMK 4A3GC 5IYCK 4KN4A 5C3EK 3S14K 3RZOC 3HOYK 2YU9C 1I6HC 2NVTK 2PA8L 3HOVK 4QJVA 4BXXC 1TWHK 3FKIK 1K83K 5TMCA 1ZYRA 3K7AC 4OIRA 3I4MC 3GTLC 4A3DC 2NVXC 3PO3C 3S1MC 2O5JA 2R7ZC 4QJVB 4A3MK 1YNJA 4LK0A 3S16K 2JA8C 2B63C 3S14C 5IP7K 4LK1A 1I50C 5C4JC 3GTMC 1TWCK 4AYBD 5M5XK 4Y7NK 3S1QK 4LLGA 1Y1VC 3GTKC 2A68A 5IYDC 4XLNA 4AYBL 5FLMK 1SFOK 2VUMK 2E2HK 1TWGK 5D4DA 4BY7C 4GZYA 3M4OC 1XPPA 5C44C 5C4XK 5M3MK 4A3KC 3PO2C 3HOXK 3HOZK 4A3GK 5FJ8K 4A93C 3RZOK 2YU9K 3S1RK 4XSZA 2E2IC 4NOIA 1I6HK 4X6AC 3S1NC 1TWFC 4BXXK 2E2JC 3HOWK 2JA7C 4A3LC 4MEYA 1I6VA 4A3CC 4BBRK 2NVQC 4BBSC 5IYBC 3K7AK 4C3HC 3GTLK 3GTJK 3I4NC 4A3FK 3I4MK 4A3DK 3S2DC 3GTGK 3S17K 2R7ZK 1YNNA 4C3JC 3GTOC 2A69A 4YFNA 4Q5SA 2NVYC 4YFXA 1I50K 2BE5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HKZ D;  3M3Y C;  4G7O A;  4ZH4 A;  3WOD A;  2R92 C;  4A3I K;  4MEX A;  2WB1 D;  3HOU C;  4MQ9 A;  4OIQ A;  1Y1V K;  1Y1W C;  2JA6 K;  3GTK K;  5IYD K;  3GTP K;  1R9T C;  1WCM C;  4A3J K;  5IYC C;  3H0G K;  4BY7 K;  3M4O K;  5C44 K;  2R93 C;  3CQZ C;  3GTQ C;  3EQL A;  3HOY C;  4Y52 C;  4A3E C;  3PO2 K;  3S15 C;  3HOV C;  2JA5 C;  4KN7 A;  4XLP A;  5IP9 C;  4A93 K;  2E2I K;  3FKI C;  1SMY A;  2Y0S D;  1K83 C;  3S1N K;  2A6E A;  2E2J K;  1I3Q C;  2NVQ K;  4BBS K;  4BY1 C;  4C3H K;  3RZD K;  3I4N K;  2NVX K;  3PO3 K;  3S16 C;  4QIW D;  4C3I C;  3S1M K;  4C3J K;  2O5I A;  3S2H C;  4QIW L;  3S1Q C;  1TWA C;  1TWC C;  2PMZ D;  2NVY K;  5M5W K;  2JA8 K;  4KMU A;  2A6H A;  2PMZ L;  5C4J K;  3H3V D;  3GTM K;  1SFO C;  2R92 K;  4Q4Z A;  4LJZ A;  5M3F K;  3M3Y K;  5TMF A;  2VUM C;  4A3B C;  3HOU K;  1TWG C;  3HKZ L;  1Y1W K;  4YFK A;  1R9T K;  3HOZ C;  2WAQ D;  4C2M C;  2WB1 L;  4XSX A;  2B63 K;  4YG2 A;  2PA8 D;  2R93 K;  2WAQ L;  3CQZ K;  3GTQ K;  5C3E C;  4A3E K;  4A3K K;  3S1R C;  4Y52 K;  3S15 K;  2NVT C;  2JA5 K;  3HOW C;  5IP9 K;  4BBR C;  1BDF A;  1TWH C;  4X6A K;  1TWF K;  1I3Q K;  4G7H A;  3GTJ C;  4A3F C;  5M5Y K;  2Y0S L;  2JA7 K;  4OIO A;  4A3L K;  3GTG C;  4OIN A;  4BY1 K;  4A3C K;  3S17 C;  5IYB K;  1HQM A;  4A3M C;  3S2D K;  4C3I K;  3DXJ A;  4OIP A;  5IP7 C;  3RZD C;  2PPB A;  3S2H K;  1TWA K;  3GTO K;  1IW7 A;  4JK1 A;  4Y7N C;  4G7Z A;  4A3I C;  2JA6 C;  5FLM C;  3GTP C;  4A3B K;  4A3J C;  2CW0 A;  2E2H C;  3H0G C;  3H3V L;  3HOX C;  4C2M K;  5C4X C;  1WCM K;  4A3G C;  5IYC K;  4KN4 A;  5C3E K;  3S14 K;  3RZO C;  3HOY K;  2YU9 C;  1I6H C;  2NVT K;  2PA8 L;  3HOV K;  4QJV A;  4BXX C;  1TWH K;  3FKI K;  1K83 K;  5TMC A;  1ZYR A;  3K7A C;  4OIR A;  3I4M C;  3GTL C;  4A3D C;  2NVX C;  3PO3 C;  3S1M C;  2O5J A;  2R7Z C;  4QJV B;  4A3M K;  1YNJ A;  4LK0 A;  3S16 K;  2JA8 C;  2B63 C;  3S14 C;  5IP7 K;  4LK1 A;  1I50 C;  5C4J C;  3GTM C;  1TWC K;  4AYB D;  5M5X K;  4Y7N K;  3S1Q K;  4LLG A;  1Y1V C;  3GTK C;  2A68 A;  5IYD C;  4XLN A;  4AYB L;  5FLM K;  1SFO K;  2VUM K;  2E2H K;  1TWG K;  5D4D A;  4BY7 C;  4GZY A;  3M4O C;  1XPP A;  5C44 C;  5C4X K;  5M3M K;  4A3K C;  3PO2 C;  3HOX K;  3HOZ K;  4A3G K;  5FJ8 K;  4A93 C;  3RZO K;  2YU9 K;  3S1R K;  4XSZ A;  2E2I C;  4NOI A;  1I6H K;  4X6A C;  3S1N C;  1TWF C;  4BXX K;  2E2J C;  3HOW K;  2JA7 C;  4A3L C;  4MEY A;  1I6V A;  4A3C C;  4BBR K;  2NVQ C;  4BBS C;  5IYB C;  3K7A K;  4C3H C;  3GTL K;  3GTJ K;  3I4N C;  4A3F K;  3I4M K;  4A3D K;  3S2D C;  3GTG K;  3S17 K;  2R7Z K;  1YNN A;  4C3J C;  3GTO C;  2A69 A;  4YFN A;  4Q5S A;  2NVY C;  4YFX A;  1I50 K;  2BE5 A; 
#chains in the Genus database with same CATH topology
 3M3Y C;  4J3N A;  4ZH4 A;  3WOD A;  2R92 C;  4WFB S;  3GTP K;  4P5A A;  1USO A;  5IYC C;  3H0G K;  3GTQ C;  4Y52 C;  4KM9 A;  3A8K A;  1VJE A;  1SFO A;  2JA5 C;  4A93 K;  5IP9 C;  3L4J A;  1EFW A;  2V6S A;  4G0V A;  3N3Y A;  2XCQ A;  3AQO A;  1PJ6 A;  3S16 C;  2ZUF A;  3S1Q C;  1ZXO A;  5M5W K;  4GTA A;  3GEE A;  3M3Y K;  3GTG A;  3GDZ A;  2R92 K;  4LJZ A;  2VUM C;  1TWG C;  3HKZ L;  5E68 A;  4YFK A;  4GTB A;  3GSI A;  1INN A;  3GTQ K;  5CJ9 A;  2CFA B;  3GTK A;  3A8J A;  4Y52 K;  2JA6 A;  2KXY A;  2NVT C;  3TFH A;  2JA5 K;  1J6W A;  5IP9 K;  4BBR C;  5HQH A;  4X6A K;  1B4B A;  2Y0S L;  4A3L K;  2P5M A;  4WF9 S;  5HL8 A;  1IE0 A;  4U67 S;  1FEU A;  1IW7 A;  1IS1 A;  1PJ7 A;  2KPU A;  4G7Z A;  4A3I C;  5FLM C;  1WSV A;  1WSR A;  4KC6 A;  4BKW A;  3H3V L;  5DM6 S;  1JVI A;  1WCM K;  1BS2 A;  4A3G C;  1WOO A;  1ZBS A;  3GTM A;  2RGR A;  2L3U A;  1IQ0 A;  1VGX A;  3RZO C;  4RMF A;  2YU9 C;  4AH6 A;  2NVT K;  3HOV K;  4BXX C;  3FOE A;  1YCL A;  3K7A C;  3I4M C;  3PO3 C;  1O2A A;  4QJV B;  4LQY A;  5L46 A;  2JA8 C;  1I3Q A;  2B63 C;  5C4J C;  1G51 A;  1TWC K;  4AYB D;  1Y1V C;  2A68 A;  5FLM K;  4KMD A;  3AH5 A;  1TWA A;  1EQR A;  1DD5 A;  5M3M K;  5C44 C;  4A3G K;  5FJ8 K;  4ILD A;  5EGE A;  3RZO K;  2YU9 K;  3S1R K;  2E2I C;  4NOI A;  1X31 C;  1TWF C;  4BXX K;  3HOW K;  4MEY A;  4IOA S;  2ZUE A;  3BP3 A;  3K7A K;  5IYB C;  3I4M K;  4A3F K;  3S2D C;  3FKI A;  1K83 A;  4KB2 A;  4WJ4 A;  4Q5S A;  4IOC S;  2NVY C;  2GSU A;  1L0W A;  2B63 K;  5IOS A;  5IOR A;  2WB1 D;  1Y1V K;  3FHZ A;  4OIQ A;  4KAW X;  4A3J K;  1WQH A;  2R93 C;  5C44 K;  2ZJR S;  4A3E C;  2Y3P A;  3S15 C;  1VRQ C;  4KN7 A;  4XLP A;  2E2H A;  2E2I K;  3N0B A;  4KM8 A;  1DCH A;  1XXB A;  3VA7 A;  4BY1 C;  2NVX K;  4QIW D;  3CAG A;  3S2H C;  5IOQ A;  3ADA C;  2PMZ D;  2NVY K;  3GTJ A;  2L5N A;  3LYW A;  1SFO C;  2CFA A;  4Q4Z A;  2R7Z A;  4WFA S;  1JOE A;  4KB4 A;  1BGW A;  4C2M C;  1I50 A;  2PA8 D;  1O2F B;  2R93 K;  1UV7 A;  5C3E C;  4A3E K;  4A3K K;  3S15 K;  3GTP A;  4GTC A;  1BDF A;  3H0G A;  1F9N A;  4G7H A;  5JVO A;  5M5Y K;  2JA7 K;  3GTG C;  4OIN A;  4BY1 K;  4A3C K;  4M1X A;  3S17 C;  2RH6 A;  1HQM A;  3N0C A;  2JH3 A;  4A3M C;  3CF5 S;  4GTE A;  1J98 A;  3LAJ A;  3GEI A;  4WJ3 M;  4OIP A;  3RZD C;  3S2H K;  3GTO K;  1WQG A;  2JA6 C;  5CHP A;  2ZFZ A;  2ZJP S;  3GIR A;  2CW0 A;  3HOX C;  4C2M K;  5IYC K;  2R92 A;  5C3E K;  1XXC A;  1ZQ1 C;  1I6H C;  4QJV A;  1ZYR A;  3GTL C;  4A3D C;  2JA5 A;  3S1M C;  3BP8 C;  5IOT A;  4A3M K;  3AQP A;  3S16 K;  1WOS A;  4O2D A;  3S14 C;  1WOP A;  2P8T A;  5M5X K;  3GTM C;  4KMH A;  3S1Q K;  4LR2 A;  4LLG A;  2KQ1 A;  1F93 A;  5JVG S;  4AYB L;  2VUM K;  1TWG K;  3NUH A;  2FQT A;  5D4D A;  4GZY A;  3G4C A;  3M4O C;  3HOX K;  3S0X A;  1GE9 A;  3PO2 C;  3ERE D;  1I6H K;  4XSZ A;  4KAS A;  4KAT A;  3S1N C;  2D6F C;  2E2J C;  1WCM A;  3AD8 C;  4BBR K;  4BBS C;  3GTL K;  4A3D K;  3I4N C;  4C3J C;  3BUE A;  1J6X A;  4P5B A;  3SZY A;  4LOW A;  3S14 K;  2XCR B;  5DM7 S;  2V6U A;  3HKZ D;  4G7O A;  4FZB A;  4A3I K;  4MQ9 A;  1Y1W C;  1R9T C;  1DCP A;  1J6V A;  1TWC A;  3TFI A;  3M4O K;  3CQZ C;  3PO2 K;  3EQL A;  3HOY C;  2GAG C;  1O28 A;  1O25 A;  3FKI C;  2Y0S D;  3S1N K;  1K83 C;  2A6E A;  2E2J K;  4BBS K;  4WCE S;  2GAH C;  1EI6 A;  3I4N K;  2FQO A;  5JFE A;  3PO3 K;  4C3I C;  4C3J K;  2O5I A;  4QIW L;  2JA8 K;  2PMZ L;  5C4J K;  3H3V D;  1EH1 A;  5M3F K;  5TMF A;  4A3B C;  1Y1W K;  1F7V A;  2B63 A;  1R9T K;  3HOZ C;  2WAQ D;  3HXA A;  4XSX A;  3AD9 C;  4WFN S;  1RU0 A;  3CQZ K;  3G4A A;  1O26 A;  1TWH C;  3T01 A;  1TWF K;  3GTJ C;  4OIO A;  5IYB K;  2E2I A;  1YX2 A;  1EK8 A;  4C3I K;  2GSO A;  3S2D K;  3DXJ A;  2KWA A;  5IP7 C;  4JK1 A;  4Y7N C;  2NVX A;  3T00 A;  3GTP C;  3JST A;  4A3B K;  3H0G C;  4G0U A;  2PHC B;  5JVH S;  4KN4 A;  4PAB A;  1O29 A;  1IBA A;  3Q3Q A;  3IPJ A;  1TWH K;  2XCO A;  1VLO A;  5TMC A;  2R93 A;  4OIR A;  3PIO S;  3OPF A;  3OEP A;  3LPX A;  2O5J A;  3FOF A;  1JQW A;  4GFQ A;  3ORE A;  5IP7 K;  2JA7 A;  4LK1 A;  1V5V A;  4Y7N K;  3L4K A;  4IO9 S;  2V6T A;  3SZZ A;  3GTK C;  5IYD C;  1SFO K;  3GTO A;  1XPP A;  4BY7 C;  3A8I A;  4X6A C;  1WQF A;  1XZP B;  4A3L C;  1HI9 A;  1B4A A;  2GSN A;  2NVQ C;  3GTQ A;  4C3H C;  4DDQ A;  4GTD A;  3GTG K;  3S17 K;  4C45 A;  3RZD K;  2BE5 A;  3LAP A;  4BLB A;  1C0A A;  3V4G A;  4MEX A;  3HOU C;  1PJ5 A;  2ZJQ S;  3GTK K;  5IYD K;  2JA6 K;  1WCM C;  1XZQ B;  4BY7 K;  4KDD A;  3HOV C;  2VUM A;  3MML B;  1TWG A;  1SMY A;  1I3Q C;  2W7V A;  1O27 A;  2NVQ K;  1ISE A;  4C3H K;  4WIL A;  2EBB A;  5TJ3 A;  3S1M K;  1AB4 A;  1TWA C;  1TWC C;  3GTL A;  4KMU A;  2A6H A;  3GTM K;  3HOU K;  1WIH A;  3PIP S;  3GEH A;  2WB1 L;  1O2B A;  4YG2 A;  2WAQ L;  4FM9 A;  3S1R C;  1KQ4 A;  3HOW C;  1BJT A;  3TFJ A;  1I3Q K;  4A3F C;  5EGH A;  1XXA A;  2YU9 A;  4XCH A;  2PPB A;  1TWA K;  4P9S A;  1F7U A;  3QX3 A;  4GTL A;  4A3J C;  2E2H C;  5C4X C;  1O24 A;  1VH2 A;  4GT9 A;  3HOY K;  1Y1V A;  1Y1W A;  1IL2 A;  2PA8 L;  1R9T A;  1WOR A;  3FKI K;  3TTG A;  3T02 A;  1K83 K;  3CQZ A;  2NVX C;  3AD7 C;  2R7Z C;  1YNJ A;  4LK0 A;  1TWF A;  1ZVU A;  4PAA A;  1I50 C;  4KMA A;  1USM A;  4BLA A;  4XLN A;  2E2H K;  1XZP A;  2NVY A;  4GTF A;  5C4X K;  3HOZ K;  4A3K C;  4A93 C;  1DCO A;  2JA7 C;  1I6V A;  4A3C C;  4KAR A;  3GTJ K;  3DLL S;  1TWH A;  2R7Z K;  1YNN A;  3GTO C;  2A69 A;  4YFN A;  1XZQ A;  4G0W A;  4YFX A;  1I50 K;  5HL7 S; 
#chains in the Genus database with same CATH homology
 3HKZ D;  3M3Y C;  4G7O A;  4ZH4 A;  3WOD A;  2R92 C;  4A3I K;  4MEX A;  2WB1 D;  3HOU C;  4MQ9 A;  4OIQ A;  1Y1V K;  1Y1W C;  2JA6 K;  3GTK K;  5IYD K;  3GTP K;  1R9T C;  1WCM C;  4A3J K;  5IYC C;  3H0G K;  4BY7 K;  3M4O K;  5C44 K;  2R93 C;  3CQZ C;  3GTQ C;  3EQL A;  3HOY C;  4Y52 C;  4A3E C;  3PO2 K;  3S15 C;  3HOV C;  2JA5 C;  4KN7 A;  4XLP A;  5IP9 C;  4A93 K;  2E2I K;  3FKI C;  1SMY A;  2Y0S D;  1K83 C;  3S1N K;  2A6E A;  2E2J K;  1I3Q C;  2NVQ K;  4BBS K;  4BY1 C;  4C3H K;  3RZD K;  3I4N K;  2NVX K;  3PO3 K;  3S16 C;  4QIW D;  4C3I C;  3S1M K;  4C3J K;  2O5I A;  3S2H C;  4QIW L;  3S1Q C;  1TWA C;  1TWC C;  2PMZ D;  2NVY K;  5M5W K;  2JA8 K;  4KMU A;  2A6H A;  2PMZ L;  5C4J K;  3H3V D;  3GTM K;  1SFO C;  2R92 K;  4Q4Z A;  4LJZ A;  5M3F K;  3M3Y K;  5TMF A;  2VUM C;  4A3B C;  3HOU K;  1TWG C;  3HKZ L;  1Y1W K;  4YFK A;  1R9T K;  3HOZ C;  2WAQ D;  4C2M C;  2WB1 L;  4XSX A;  2B63 K;  4YG2 A;  2PA8 D;  2R93 K;  2WAQ L;  3CQZ K;  3GTQ K;  5C3E C;  4A3E K;  4A3K K;  3S1R C;  4Y52 K;  3S15 K;  2NVT C;  2JA5 K;  3HOW C;  5IP9 K;  4BBR C;  1BDF A;  1TWH C;  4X6A K;  1TWF K;  1I3Q K;  4G7H A;  3GTJ C;  4A3F C;  5M5Y K;  2Y0S L;  2JA7 K;  4OIO A;  4A3L K;  3GTG C;  4OIN A;  4BY1 K;  4A3C K;  3S17 C;  5IYB K;  1HQM A;  4A3M C;  3S2D K;  4C3I K;  3DXJ A;  4OIP A;  5IP7 C;  3RZD C;  2PPB A;  3S2H K;  1TWA K;  3GTO K;  1IW7 A;  4JK1 A;  4Y7N C;  4G7Z A;  4A3I C;  2JA6 C;  5FLM C;  3GTP C;  4A3B K;  4A3J C;  2CW0 A;  2E2H C;  3H0G C;  3H3V L;  3HOX C;  4C2M K;  5C4X C;  1WCM K;  4A3G C;  5IYC K;  4KN4 A;  5C3E K;  3S14 K;  3RZO C;  3HOY K;  2YU9 C;  1I6H C;  2NVT K;  2PA8 L;  3HOV K;  4QJV A;  4BXX C;  1TWH K;  3FKI K;  1K83 K;  5TMC A;  1ZYR A;  3K7A C;  4OIR A;  3I4M C;  3GTL C;  4A3D C;  2NVX C;  3PO3 C;  3S1M C;  2O5J A;  2R7Z C;  4QJV B;  4A3M K;  1YNJ A;  4LK0 A;  3S16 K;  2JA8 C;  2B63 C;  3S14 C;  5IP7 K;  4LK1 A;  1I50 C;  5C4J C;  3GTM C;  1TWC K;  4AYB D;  5M5X K;  4Y7N K;  3S1Q K;  4LLG A;  1Y1V C;  3GTK C;  2A68 A;  5IYD C;  4XLN A;  4AYB L;  5FLM K;  1SFO K;  2VUM K;  2E2H K;  1TWG K;  5D4D A;  4BY7 C;  4GZY A;  3M4O C;  1XPP A;  5C44 C;  5C4X K;  5M3M K;  4A3K C;  3PO2 C;  3HOX K;  3HOZ K;  4A3G K;  5FJ8 K;  4A93 C;  3RZO K;  2YU9 K;  3S1R K;  4XSZ A;  2E2I C;  4NOI A;  1I6H K;  4X6A C;  3S1N C;  1TWF C;  4BXX K;  2E2J C;  3HOW K;  2JA7 C;  4A3L C;  4MEY A;  1I6V A;  4A3C C;  4BBR K;  2NVQ C;  4BBS C;  5IYB C;  3K7A K;  4C3H C;  3GTL K;  3GTJ K;  3I4N C;  4A3F K;  3I4M K;  4A3D K;  3S2D C;  3GTG K;  3S17 K;  2R7Z K;  1YNN A;  4C3J C;  3GTO C;  2A69 A;  4YFN A;  4Q5S A;  2NVY C;  4YFX A;  1I50 K;  2BE5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...