2A6EA

Crystal structure of the t. thermophilus rna polymerase holoenzyme
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
229
structure length
229
Chain Sequence
MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Allosteric modulation of the RNA polymerase catalytic reaction is an essential component of transcription control by rifamycins.
pubmed doi rcsb
molecule tags Transferase
molecule keywords DNA-directed RNA polymerase alpha chain
total genus 40
structure length 229
sequence length 229
chains with identical sequence B, K, L
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2005-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01000 RNA_pol_A_bac RNA polymerase Rpb3/RpoA insert domain
A PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain
A PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.12 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 DNA-directed RNA polymerase, insert domain 2a6eA02
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 2a6eA01
2E2HK 1Y1VC 4XSXA 2WAQD 1SFOK 4YFNA 1Y1WC 4C2MC 4A3GC 3GTLC 4OIPA 2WB1L 4A3IK 3S16K 5TMFA 5C3EC 3S17C 1YNJA 3HOZC 2R92C 1TWAC 3H3VD 2BE5A 3GTMK 3GTGC 3S14K 2NVYC 4A3JC 5C4JK 5FJ8K 4C3HK 2NVXK 3GTPC 3S1RC 5C3EK 3GTKC 4BBRK 2Y0SL 4BXXC 3GTJK 5IYBK 3S15C 3GTOC 1TWAK 1XPPA 2WAQL 2JA7K 3HOVK 4LJZA 5C44C 4A3CK 3GTMC 5IP7K 4X6AC 2NVYK 3RZOC 1I3QC 4QJVA 3I4MC 3M3YC 4MQ9A 2R93C 1TWGK 4A3KC 2YU9K 3S1QC 4QJVB 5M3FK 4Q5SA 2B63K 3GTKK 3HOWK 1IW7A 2JA8C 2PA8D 4YFXA 4MEXA 3HKZD 4A3BC 1K83C 3H0GK 2R93K 3HOYC 2WB1D 4OIQA 3S1MK 3I4NC 4A3DC 2PA8L 3HOXK 5M5WK 2R92K 3S2HK 2JA5K 4AYBD 3S16C 3K7AK 3PO3C 3HOZK 3S14C 3GTGK 4Y7NK 2NVTK 2A6EA 5M5YK 2JA6C 5FLMK 5C4XK 5D4DA 1TWHK 3GTPK 3EQLA 4GZYA 3I4NK 4C3JC 1BDFA 3RZDC 5IP9K 1HQMA 3GTOK 3S2DK 2NVQC 4C3IC 5C44K 1TWCK 3GTQK 3PO3K 3S15K 2A68A 4OIRA 4LK1A 4XSZA 4BY1C 4A3LC 5IYCC 4G7OA 3PO2K 2PMZD 5M3MK 2Y0SD 4KN7A 3H3VL 3CQZK 2E2JK 5IP9C 4C3JK 4JK1A 3RZDK 4G7ZA 1WCMC 3S1NC 4C3IK 3WODA 1R9TK 2A69A 1YNNA 4OIOA 1K83K 2R7ZK 4YFKA 3FKIK 3M4OK 4LK0A 4BBSK 4A3FC 5IYDK 4XLNA 3HOYK 1I50K 4Y52K 3PO2C 4LLGA 4ZH4A 3HOUC 3S1RK 4BBRC 1SMYA 4C3HC 2NVXC 4OINA 5FLMC 4A3EC 3GTJC 2E2IK 3HOXC 4KN4A 4A3DK 5TMCA 3S2HC 1SFOC 4BY7C 5IYDC 4QIWL 5C4XC 2E2HC 4A3CC 4A3IC 4A3FK 3GTLK 3RZOK 4X6AK 2NVTC 5M5XK 1I3QK 2VUMK 4C2MK 4A3GK 2YU9C 4AYBL 1TWCC 4YG2A 3HOWC 2E2IC 1I6VA 4XLPA 4A3BK 5C4JC 4A3JK 4G7HA 1TWFC 4A93C 3H0GC 4MEYA 4BY1K 4A3LK 1I6HC 3CQZC 5IYBC 2VUMC 4A3MK 3HKZL 2PPBA 2PMZL 5IYCK 2JA7C 1WCMK 2A6HA 4NOIA 3HOVC 4Q4ZA 3S1MC 3S1NK 4BXXK 2E2JC 5IP7C 2JA5C 4Y7NC 3FKIC 2CW0A 3K7AC 1TWGC 1TWFK 4A93K 1I50C 1Y1VK 3DXJA 1R9TC 4A3KK 3HOUK 2JA6K 2B63C 1I6HK 1Y1WK 2R7ZC 3M4OC 4BBSC 2O5JA 3I4MK 3M3YK 4A3MC 1TWHC 3S2DC 1ZYRA 4Y52C 3S17K 4A3EK 3S1QK 3GTQC 4KMUA 4BY7K 2O5IA 2JA8K 2NVQK 4QIWD
chains in the Genus database with same CATH superfamily
3SZYA 4OIPA 3S16K 3S17C 1WOPA 1J6WA 3HOZC 4WJ3M 4C45A 3H3VD 2BE5A 3GTMK 2NVYC 4A3JC 3TFHA 4GTFA 3T00A 4C3HK 2NVXK 3FHZA 1TWAK 4WFBS 3GTKA 1WIHA 3GDZA 4LJZA 1EFWA 4ILDA 2E2IA 4QJVA 2R93C 1TWGK 4MQ9A 3GTGA 3AH5A 3S1QC 2B63K 2JA8C 1O29A 2GSOA 4RMFA 2ZJRS 4WFAS 3T01A 1K83C 4P5BA 3H0GK 1BS2A 5IOTA 2CFAA 3I4NC 4A3DC 3S2HK 3S16C 3PO3C 1PJ6A 4Y7NK 2NVTK 2JA6C 3GTQA 3I4NK 1ZBSA 4KMHA 1Y1WA 1TWCK 3ADAC 3CAGA 1EK8A 4G7OA 1K83A 3H0GA 3PO2K 2PMZD 1ISEA 4JK1A 2ZJPS 2A69A 1K83K 4GFQA 3N0BA 5IORA 3GSIA 4G0UA 4LLGA 3HOUC 1C0AA 4C3HC 2NVXC 4OINA 1I3QA 4QIWL 4X6AK 4A3GK 2V6UA 2YU9C 1F7VA 4J3NA 1VGXA 4A3JK 3QX3A 3LPXA 2VUMC 1XZQA 4A3MK 4NOIA 1J98A 3OPFA 5IP7C 4IOCS 2GSNA 4Y7NC 4GTEA 2CW0A 1Y1VK 3HOUK 2JA6K 2B63C 5EGEA 1ZYRA 2ZJQS 4KAWX 2NVQK 1Y1VC 1JOEA 3LYWA 1R9TA 1WSVA 3Q3QA 4WCES 5TMFA 4KASA 1J6XA 3AD7C 3G4CA 2GSUA 2XCOA 4XCHA 5JVOA 5C4JK 3AD8C 3A8KA 5C3EK 1HI9A 3GTJK 1VJEA 1WQHA 3GTOC 2JA7K 2W7VA 5IP7K 4X6AC 3FOFA 2NVYK 1EH1A 2ZUEA 4A3KC 3V4GA 3GTKK 1TWAA 1IW7A 5CHPA 3HOWK 2JH3A 4KM8A 4MEXA 3HKZD 4KARA 2R93K 1O25A 2WB1D 4OIQA 3HOXK 2R92K 1BGWA 5E68A 5D4DA 1TWHK 3GTPK 3EQLA 4GZYA 5IP9K 1BDFA 1HQMA 2GAHC 2B63A 2NVQC 3CF5S 1IQ0A 3A8JA 2JA6A 1O24A 5C44K 1B4AA 4LOWA 2JA7A 1IS1A 2A68A 4OIRA 1TWHA 2ZUFA 4XSZA 3LAJA 5IYCC 5M3MK 4KN7A 1I50A 2V6TA 3CQZK 2E2JK 4C3JK 3GEHA 3RZDK 4G7ZA 1WCMC 3S1NC 4WF9S 4C3IK 5HQHA 3WODA 4KM9A 4OIOA 4BBSK 4LK0A 3HOYK 3S1RK 4P9SA 4BBRC 1WOSA 3VA7A 1X31C 4A3EC 3GTJC 3HOXC 2EBBA 4KN4A 5TMCA 5IYDC 3G4AA 1XXCA 3S0XA 3PIPS 4A3CC 4A3IC 4A3FK 2NVTC 5M5XK 1I3QK 5HL7S 4C2MK 1UV7A 4AYBL 2NVYA 4YG2A 3HOWC 4AH6A 1TWFC 1VRQC 3H0GC 2V6SA 4A3LK 3ERED 5IYBC 2PPBA 2JA7C 2A6HA 3HOVC 1XZQB 3TFJA 3A8IA 3GEIA 3K7AC 1TWGC 4A93K 1I50C 1I6HK 1Y1WK 2R7ZC 3M4OC 2O5JA 3I4MK 3M3YK 4Y52C 4A3EK 4KMUA 1O27A 5IYDK 4QIWD 5FLMK 3TTGA 2E2HK 1V5VA 4XSXA 1SFOK 3T02A 3GIRA 4C2MC 3GTLC 2WB1L 5C3EC 1WOOA 2JA5A 1USMA 3PIOS 4M1XA 2PHCB 3S1RC 2P8TA 3GTKC 4PAAA 2P5MA 5IYBK 1TWCA 2WAQL 3HOVK 5C44C 3BP8C 1SFOA 3GTMC 4KMDA 4PABA 3RZOC 3I4MC 3M3YC 4QJVB 3AQOA 1ZQ1C 1O2FB 4GTLA 2KPUA 1YCLA 4GTDA 1DD5A 4A3BC 4KB2A 1IL2A 1WCMA 4O2DA 3LAPA 4GT9A 3OREA 4LR2A 5IOSA 5M5WK 3L4JA 1EI6A 4AYBD 1IE0A 3HOZK 2A6EA 3AQPA 3GTLA 5C4XK 1TWGA 1O2AA 4C3JC 3RZDC 2ZFZA 3GTOK 1WSRA 4C3IC 3PO3K 3S15K 4LK1A 2R7ZA 4BY1C 3H3VL 5IP9C 1DCHA 1L0WA 1R9TK 3OEPA 1YNNA 2R7ZK 4YFKA 3M4OK 3AD9C 3CQZA 1I50K 4Y52K 1EQRA 4ZH4A 1XZPB 3HXAA 2VUMA 3GTOA 1PJ5A 4A3DK 2D6FC 4BY7C 1USOA 1ZVUA 3TFIA 3GTLK 1WORA 4GTCA 1B4BA 3BP3A 1TWCC 2E2IC 1JVIA 1I6VA 1O28A 4G7HA 5IOQA 4BY1K 2CFAB 1I6HC 2XCRB 3CQZC 5DM7S 4IO9S 2NVXA 3HKZL 1PJ7A 2PMZL 2GAGC 4P5AA 1WCMK 5IYCK 3S1NK 1WQFA 5L46A 2E2JC 1DCPA 3FKIC 3BUEA 4A3KK 1F93A 4BBSC 4WILA 4A3MC 1TWHC 3S1QK 3GTQC 4BY7K 2JA8K 1Y1VA 2WAQD 4YFNA 5JVHS 1Y1WC 4A3GC 4A3IK 1ZXOA 3FKIA 1YNJA 2R92C 1TWAC 1TWFA 1IBAA 1GE9A 4DDQA 3GTGC 3S14K 4BKWA 5FJ8K 3FOEA 5JFEA 5EGHA 3GTPC 4FZBA 4GTBA 2Y0SL 4BXXC 4BBRK 4FM9A 3S15C 2R93A 2E2HA 1XPPA 4A3CK 1I3QC 2FQOA 1O26A 2YU9K 5M3FK 4Q5SA 4GTAA 1KQ4A 2PA8D 3IPJA 4YFXA 2KXYA 2XCQA 1JQWA 3GTJA 3HOYC 1FEUA 1BJTA 3S1MK 2PA8L 1O2BA 2JA5K 4G0VA 3GEEA 3K7AK 4KB4A 3S14C 3GTGK 5M5YK 1YX2A 2L3UA 4U67S 1AB4A 1RU0A 3S2DK 2FQTA 3GTQK 3NUHA 2Y3PA 3L4KA 4A3LC 2Y0SD 4BLBA 4IOAS 1WQGA 4WJ4A 3FKIK 5CJ9A 1DCOA 2KQ1A 4A3FC 4XLNA 1XZPA 3SZZA 3PO2C 1XXBA 2RH6A 4LQYA 1SMYA 1INNA 5FLMC 4G0WA 1VLOA 4KATA 2E2IK 3S2HC 1SFOC 2YU9A 3RZOK 5C4XC 2E2HC 1VH2A 3GTPA 2VUMK 1J6VA 4BLAA 4XLPA 4A3BK 1XXAA 5C4JC 3GTMA 5JVGS 4A93C 4MEYA 2R92A 1F9NA 5DM6S 4WFNS 3N3YA 3DLLS 3N0CA 3S1MC 4Q4ZA 1F7UA 4BXXK 1G51A 2JA5C 5HL8A 2RGRA 1TWFK 4KDDA 2KWAA 3DXJA 1R9TC 3JSTA 2L5NA 4KC6A 4KMAA 3S2DC 3S17K 5TJ3A 2O5IA 3MMLB
chains in the Genus database with same CATH topology
2E2HK 1Y1VC 4XSXA 2WAQD 1SFOK 4YFNA 1Y1WC 4C2MC 4A3GC 3GTLC 4OIPA 2WB1L 4A3IK 3S16K 5TMFA 5C3EC 3S17C 1YNJA 3HOZC 2R92C 1TWAC 3H3VD 2BE5A 3GTMK 3GTGC 3S14K 2NVYC 4A3JC 5C4JK 5FJ8K 4C3HK 2NVXK 3GTPC 3S1RC 5C3EK 3GTKC 4BBRK 2Y0SL 4BXXC 3GTJK 5IYBK 3S15C 3GTOC 1TWAK 1XPPA 2WAQL 2JA7K 3HOVK 4LJZA 5C44C 4A3CK 3GTMC 5IP7K 4X6AC 2NVYK 3RZOC 1I3QC 4QJVA 3I4MC 3M3YC 4MQ9A 2R93C 1TWGK 4A3KC 2YU9K 3S1QC 4QJVB 5M3FK 4Q5SA 2B63K 3GTKK 3HOWK 1IW7A 2JA8C 2PA8D 4YFXA 4MEXA 3HKZD 4A3BC 1K83C 3H0GK 2R93K 3HOYC 2WB1D 4OIQA 3S1MK 3I4NC 4A3DC 2PA8L 3HOXK 5M5WK 2R92K 3S2HK 2JA5K 4AYBD 3S16C 3K7AK 3PO3C 3HOZK 3S14C 3GTGK 4Y7NK 2NVTK 2A6EA 5M5YK 2JA6C 5FLMK 5C4XK 5D4DA 1TWHK 3GTPK 3EQLA 4GZYA 3I4NK 4C3JC 1BDFA 3RZDC 5IP9K 1HQMA 3GTOK 3S2DK 2NVQC 4C3IC 5C44K 1TWCK 3GTQK 3PO3K 3S15K 2A68A 4OIRA 4LK1A 4XSZA 4BY1C 4A3LC 5IYCC 4G7OA 3PO2K 2PMZD 5M3MK 2Y0SD 4KN7A 3H3VL 3CQZK 2E2JK 5IP9C 4C3JK 4JK1A 3RZDK 4G7ZA 1WCMC 3S1NC 4C3IK 3WODA 1R9TK 2A69A 1YNNA 4OIOA 1K83K 2R7ZK 4YFKA 3FKIK 3M4OK 4LK0A 4BBSK 4A3FC 5IYDK 4XLNA 3HOYK 1I50K 4Y52K 3PO2C 4LLGA 4ZH4A 3HOUC 3S1RK 4BBRC 1SMYA 4C3HC 2NVXC 4OINA 5FLMC 4A3EC 3GTJC 2E2IK 3HOXC 4KN4A 4A3DK 5TMCA 3S2HC 1SFOC 4BY7C 5IYDC 4QIWL 5C4XC 2E2HC 4A3CC 4A3IC 4A3FK 3GTLK 3RZOK 4X6AK 2NVTC 5M5XK 1I3QK 2VUMK 4C2MK 4A3GK 2YU9C 4AYBL 1TWCC 4YG2A 3HOWC 2E2IC 1I6VA 4XLPA 4A3BK 5C4JC 4A3JK 4G7HA 1TWFC 4A93C 3H0GC 4MEYA 4BY1K 4A3LK 1I6HC 3CQZC 5IYBC 2VUMC 4A3MK 3HKZL 2PPBA 2PMZL 5IYCK 2JA7C 1WCMK 2A6HA 4NOIA 3HOVC 4Q4ZA 3S1MC 3S1NK 4BXXK 2E2JC 5IP7C 2JA5C 4Y7NC 3FKIC 2CW0A 3K7AC 1TWGC 1TWFK 4A93K 1I50C 1Y1VK 3DXJA 1R9TC 4A3KK 3HOUK 2JA6K 2B63C 1I6HK 1Y1WK 2R7ZC 3M4OC 4BBSC 2O5JA 3I4MK 3M3YK 4A3MC 1TWHC 3S2DC 1ZYRA 4Y52C 3S17K 4A3EK 3S1QK 3GTQC 4KMUA 4BY7K 2O5IA 2JA8K 2NVQK 4QIWD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E2H K;  1Y1V C;  4XSX A;  2WAQ D;  1SFO K;  4YFN A;  1Y1W C;  4C2M C;  4A3G C;  3GTL C;  4OIP A;  2WB1 L;  4A3I K;  3S16 K;  5TMF A;  5C3E C;  3S17 C;  1YNJ A;  3HOZ C;  2R92 C;  1TWA C;  3H3V D;  2BE5 A;  3GTM K;  3GTG C;  3S14 K;  2NVY C;  4A3J C;  5C4J K;  5FJ8 K;  4C3H K;  2NVX K;  3GTP C;  3S1R C;  5C3E K;  3GTK C;  4BBR K;  2Y0S L;  4BXX C;  3GTJ K;  5IYB K;  3S15 C;  3GTO C;  1TWA K;  1XPP A;  2WAQ L;  2JA7 K;  3HOV K;  4LJZ A;  5C44 C;  4A3C K;  3GTM C;  5IP7 K;  4X6A C;  2NVY K;  3RZO C;  1I3Q C;  4QJV A;  3I4M C;  3M3Y C;  4MQ9 A;  2R93 C;  1TWG K;  4A3K C;  2YU9 K;  3S1Q C;  4QJV B;  5M3F K;  4Q5S A;  2B63 K;  3GTK K;  3HOW K;  1IW7 A;  2JA8 C;  2PA8 D;  4YFX A;  4MEX A;  3HKZ D;  4A3B C;  1K83 C;  3H0G K;  2R93 K;  3HOY C;  2WB1 D;  4OIQ A;  3S1M K;  3I4N C;  4A3D C;  2PA8 L;  3HOX K;  5M5W K;  2R92 K;  3S2H K;  2JA5 K;  4AYB D;  3S16 C;  3K7A K;  3PO3 C;  3HOZ K;  3S14 C;  3GTG K;  4Y7N K;  2NVT K;  2A6E A;  5M5Y K;  2JA6 C;  5FLM K;  5C4X K;  5D4D A;  1TWH K;  3GTP K;  3EQL A;  4GZY A;  3I4N K;  4C3J C;  1BDF A;  3RZD C;  5IP9 K;  1HQM A;  3GTO K;  3S2D K;  2NVQ C;  4C3I C;  5C44 K;  1TWC K;  3GTQ K;  3PO3 K;  3S15 K;  2A68 A;  4OIR A;  4LK1 A;  4XSZ A;  4BY1 C;  4A3L C;  5IYC C;  4G7O A;  3PO2 K;  2PMZ D;  5M3M K;  2Y0S D;  4KN7 A;  3H3V L;  3CQZ K;  2E2J K;  5IP9 C;  4C3J K;  4JK1 A;  3RZD K;  4G7Z A;  1WCM C;  3S1N C;  4C3I K;  3WOD A;  1R9T K;  2A69 A;  1YNN A;  4OIO A;  1K83 K;  2R7Z K;  4YFK A;  3FKI K;  3M4O K;  4LK0 A;  4BBS K;  4A3F C;  5IYD K;  4XLN A;  3HOY K;  1I50 K;  4Y52 K;  3PO2 C;  4LLG A;  4ZH4 A;  3HOU C;  3S1R K;  4BBR C;  1SMY A;  4C3H C;  2NVX C;  4OIN A;  5FLM C;  4A3E C;  3GTJ C;  2E2I K;  3HOX C;  4KN4 A;  4A3D K;  5TMC A;  3S2H C;  1SFO C;  4BY7 C;  5IYD C;  4QIW L;  5C4X C;  2E2H C;  4A3C C;  4A3I C;  4A3F K;  3GTL K;  3RZO K;  4X6A K;  2NVT C;  5M5X K;  1I3Q K;  2VUM K;  4C2M K;  4A3G K;  2YU9 C;  4AYB L;  1TWC C;  4YG2 A;  3HOW C;  2E2I C;  1I6V A;  4XLP A;  4A3B K;  5C4J C;  4A3J K;  4G7H A;  1TWF C;  4A93 C;  3H0G C;  4MEY A;  4BY1 K;  4A3L K;  1I6H C;  3CQZ C;  5IYB C;  2VUM C;  4A3M K;  3HKZ L;  2PPB A;  2PMZ L;  5IYC K;  2JA7 C;  1WCM K;  2A6H A;  4NOI A;  3HOV C;  4Q4Z A;  3S1M C;  3S1N K;  4BXX K;  2E2J C;  5IP7 C;  2JA5 C;  4Y7N C;  3FKI C;  2CW0 A;  3K7A C;  1TWG C;  1TWF K;  4A93 K;  1I50 C;  1Y1V K;  3DXJ A;  1R9T C;  4A3K K;  3HOU K;  2JA6 K;  2B63 C;  1I6H K;  1Y1W K;  2R7Z C;  3M4O C;  4BBS C;  2O5J A;  3I4M K;  3M3Y K;  4A3M C;  1TWH C;  3S2D C;  1ZYR A;  4Y52 C;  3S17 K;  4A3E K;  3S1Q K;  3GTQ C;  4KMU A;  4BY7 K;  2O5I A;  2JA8 K;  2NVQ K;  4QIW D; 
#chains in the Genus database with same CATH topology
 3SZY A;  4OIP A;  3S16 K;  3S17 C;  1WOP A;  1J6W A;  3HOZ C;  4WJ3 M;  4C45 A;  3H3V D;  2BE5 A;  3GTM K;  2NVY C;  4A3J C;  3TFH A;  4GTF A;  3T00 A;  4C3H K;  2NVX K;  3FHZ A;  1TWA K;  4WFB S;  3GTK A;  1WIH A;  3GDZ A;  4LJZ A;  1EFW A;  4ILD A;  2E2I A;  4QJV A;  2R93 C;  1TWG K;  4MQ9 A;  3GTG A;  3AH5 A;  3S1Q C;  2B63 K;  2JA8 C;  1O29 A;  2GSO A;  4RMF A;  2ZJR S;  4WFA S;  3T01 A;  1K83 C;  4P5B A;  3H0G K;  1BS2 A;  5IOT A;  2CFA A;  3I4N C;  4A3D C;  3S2H K;  3S16 C;  3PO3 C;  1PJ6 A;  4Y7N K;  2NVT K;  2JA6 C;  3GTQ A;  3I4N K;  1ZBS A;  4KMH A;  1Y1W A;  1TWC K;  3ADA C;  3CAG A;  1EK8 A;  4G7O A;  1K83 A;  3H0G A;  3PO2 K;  2PMZ D;  1ISE A;  4JK1 A;  2ZJP S;  2A69 A;  1K83 K;  4GFQ A;  3N0B A;  5IOR A;  3GSI A;  4G0U A;  4LLG A;  3HOU C;  1C0A A;  4C3H C;  2NVX C;  4OIN A;  1I3Q A;  4QIW L;  4X6A K;  4A3G K;  2V6U A;  2YU9 C;  1F7V A;  4J3N A;  1VGX A;  4A3J K;  3QX3 A;  3LPX A;  2VUM C;  1XZQ A;  4A3M K;  4NOI A;  1J98 A;  3OPF A;  5IP7 C;  4IOC S;  2GSN A;  4Y7N C;  4GTE A;  2CW0 A;  1Y1V K;  3HOU K;  2JA6 K;  2B63 C;  5EGE A;  1ZYR A;  2ZJQ S;  4KAW X;  2NVQ K;  1Y1V C;  1JOE A;  3LYW A;  1R9T A;  1WSV A;  3Q3Q A;  4WCE S;  5TMF A;  4KAS A;  1J6X A;  3AD7 C;  3G4C A;  2GSU A;  2XCO A;  4XCH A;  5JVO A;  5C4J K;  3AD8 C;  3A8K A;  5C3E K;  1HI9 A;  3GTJ K;  1VJE A;  1WQH A;  3GTO C;  2JA7 K;  2W7V A;  5IP7 K;  4X6A C;  3FOF A;  2NVY K;  1EH1 A;  2ZUE A;  4A3K C;  3V4G A;  3GTK K;  1TWA A;  1IW7 A;  5CHP A;  3HOW K;  2JH3 A;  4KM8 A;  4MEX A;  3HKZ D;  4KAR A;  2R93 K;  1O25 A;  2WB1 D;  4OIQ A;  3HOX K;  2R92 K;  1BGW A;  5E68 A;  5D4D A;  1TWH K;  3GTP K;  3EQL A;  4GZY A;  5IP9 K;  1BDF A;  1HQM A;  2GAH C;  2B63 A;  2NVQ C;  3CF5 S;  1IQ0 A;  3A8J A;  2JA6 A;  1O24 A;  5C44 K;  1B4A A;  4LOW A;  2JA7 A;  1IS1 A;  2A68 A;  4OIR A;  1TWH A;  2ZUF A;  4XSZ A;  3LAJ A;  5IYC C;  5M3M K;  4KN7 A;  1I50 A;  2V6T A;  3CQZ K;  2E2J K;  4C3J K;  3GEH A;  3RZD K;  4G7Z A;  1WCM C;  3S1N C;  4WF9 S;  4C3I K;  5HQH A;  3WOD A;  4KM9 A;  4OIO A;  4BBS K;  4LK0 A;  3HOY K;  3S1R K;  4P9S A;  4BBR C;  1WOS A;  3VA7 A;  1X31 C;  4A3E C;  3GTJ C;  3HOX C;  2EBB A;  4KN4 A;  5TMC A;  5IYD C;  3G4A A;  1XXC A;  3S0X A;  3PIP S;  4A3C C;  4A3I C;  4A3F K;  2NVT C;  5M5X K;  1I3Q K;  5HL7 S;  4C2M K;  1UV7 A;  4AYB L;  2NVY A;  4YG2 A;  3HOW C;  4AH6 A;  1TWF C;  1VRQ C;  3H0G C;  2V6S A;  4A3L K;  3ERE D;  5IYB C;  2PPB A;  2JA7 C;  2A6H A;  3HOV C;  1XZQ B;  3TFJ A;  3A8I A;  3GEI A;  3K7A C;  1TWG C;  4A93 K;  1I50 C;  1I6H K;  1Y1W K;  2R7Z C;  3M4O C;  2O5J A;  3I4M K;  3M3Y K;  4Y52 C;  4A3E K;  4KMU A;  1O27 A;  5IYD K;  4QIW D;  5FLM K;  3TTG A;  2E2H K;  1V5V A;  4XSX A;  1SFO K;  3T02 A;  3GIR A;  4C2M C;  3GTL C;  2WB1 L;  5C3E C;  1WOO A;  2JA5 A;  1USM A;  3PIO S;  4M1X A;  2PHC B;  3S1R C;  2P8T A;  3GTK C;  4PAA A;  2P5M A;  5IYB K;  1TWC A;  2WAQ L;  3HOV K;  5C44 C;  3BP8 C;  1SFO A;  3GTM C;  4KMD A;  4PAB A;  3RZO C;  3I4M C;  3M3Y C;  4QJV B;  3AQO A;  1ZQ1 C;  1O2F B;  4GTL A;  2KPU A;  1YCL A;  4GTD A;  1DD5 A;  4A3B C;  4KB2 A;  1IL2 A;  1WCM A;  4O2D A;  3LAP A;  4GT9 A;  3ORE A;  4LR2 A;  5IOS A;  5M5W K;  3L4J A;  1EI6 A;  4AYB D;  1IE0 A;  3HOZ K;  2A6E A;  3AQP A;  3GTL A;  5C4X K;  1TWG A;  1O2A A;  4C3J C;  3RZD C;  2ZFZ A;  3GTO K;  1WSR A;  4C3I C;  3PO3 K;  3S15 K;  4LK1 A;  2R7Z A;  4BY1 C;  3H3V L;  5IP9 C;  1DCH A;  1L0W A;  1R9T K;  3OEP A;  1YNN A;  2R7Z K;  4YFK A;  3M4O K;  3AD9 C;  3CQZ A;  1I50 K;  4Y52 K;  1EQR A;  4ZH4 A;  1XZP B;  3HXA A;  2VUM A;  3GTO A;  1PJ5 A;  4A3D K;  2D6F C;  4BY7 C;  1USO A;  1ZVU A;  3TFI A;  3GTL K;  1WOR A;  4GTC A;  1B4B A;  3BP3 A;  1TWC C;  2E2I C;  1JVI A;  1I6V A;  1O28 A;  4G7H A;  5IOQ A;  4BY1 K;  2CFA B;  1I6H C;  2XCR B;  3CQZ C;  5DM7 S;  4IO9 S;  2NVX A;  3HKZ L;  1PJ7 A;  2PMZ L;  2GAG C;  4P5A A;  1WCM K;  5IYC K;  3S1N K;  1WQF A;  5L46 A;  2E2J C;  1DCP A;  3FKI C;  3BUE A;  4A3K K;  1F93 A;  4BBS C;  4WIL A;  4A3M C;  1TWH C;  3S1Q K;  3GTQ C;  4BY7 K;  2JA8 K;  1Y1V A;  2WAQ D;  4YFN A;  5JVH S;  1Y1W C;  4A3G C;  4A3I K;  1ZXO A;  3FKI A;  1YNJ A;  2R92 C;  1TWA C;  1TWF A;  1IBA A;  1GE9 A;  4DDQ A;  3GTG C;  3S14 K;  4BKW A;  5FJ8 K;  3FOE A;  5JFE A;  5EGH A;  3GTP C;  4FZB A;  4GTB A;  2Y0S L;  4BXX C;  4BBR K;  4FM9 A;  3S15 C;  2R93 A;  2E2H A;  1XPP A;  4A3C K;  1I3Q C;  2FQO A;  1O26 A;  2YU9 K;  5M3F K;  4Q5S A;  4GTA A;  1KQ4 A;  2PA8 D;  3IPJ A;  4YFX A;  2KXY A;  2XCQ A;  1JQW A;  3GTJ A;  3HOY C;  1FEU A;  1BJT A;  3S1M K;  2PA8 L;  1O2B A;  2JA5 K;  4G0V A;  3GEE A;  3K7A K;  4KB4 A;  3S14 C;  3GTG K;  5M5Y K;  1YX2 A;  2L3U A;  4U67 S;  1AB4 A;  1RU0 A;  3S2D K;  2FQT A;  3GTQ K;  3NUH A;  2Y3P A;  3L4K A;  4A3L C;  2Y0S D;  4BLB A;  4IOA S;  1WQG A;  4WJ4 A;  3FKI K;  5CJ9 A;  1DCO A;  2KQ1 A;  4A3F C;  4XLN A;  1XZP A;  3SZZ A;  3PO2 C;  1XXB A;  2RH6 A;  4LQY A;  1SMY A;  1INN A;  5FLM C;  4G0W A;  1VLO A;  4KAT A;  2E2I K;  3S2H C;  1SFO C;  2YU9 A;  3RZO K;  5C4X C;  2E2H C;  1VH2 A;  3GTP A;  2VUM K;  1J6V A;  4BLA A;  4XLP A;  4A3B K;  1XXA A;  5C4J C;  3GTM A;  5JVG S;  4A93 C;  4MEY A;  2R92 A;  1F9N A;  5DM6 S;  4WFN S;  3N3Y A;  3DLL S;  3N0C A;  3S1M C;  4Q4Z A;  1F7U A;  4BXX K;  1G51 A;  2JA5 C;  5HL8 A;  2RGR A;  1TWF K;  4KDD A;  2KWA A;  3DXJ A;  1R9T C;  3JST A;  2L5N A;  4KC6 A;  4KMA A;  3S2D C;  3S17 K;  5TJ3 A;  2O5I A;  3MML B; 
#chains in the Genus database with same CATH homology
 2E2H K;  1Y1V C;  4XSX A;  2WAQ D;  1SFO K;  4YFN A;  1Y1W C;  4C2M C;  4A3G C;  3GTL C;  4OIP A;  2WB1 L;  4A3I K;  3S16 K;  5TMF A;  5C3E C;  3S17 C;  1YNJ A;  3HOZ C;  2R92 C;  1TWA C;  3H3V D;  2BE5 A;  3GTM K;  3GTG C;  3S14 K;  2NVY C;  4A3J C;  5C4J K;  5FJ8 K;  4C3H K;  2NVX K;  3GTP C;  3S1R C;  5C3E K;  3GTK C;  4BBR K;  2Y0S L;  4BXX C;  3GTJ K;  5IYB K;  3S15 C;  3GTO C;  1TWA K;  1XPP A;  2WAQ L;  2JA7 K;  3HOV K;  4LJZ A;  5C44 C;  4A3C K;  3GTM C;  5IP7 K;  4X6A C;  2NVY K;  3RZO C;  1I3Q C;  4QJV A;  3I4M C;  3M3Y C;  4MQ9 A;  2R93 C;  1TWG K;  4A3K C;  2YU9 K;  3S1Q C;  4QJV B;  5M3F K;  4Q5S A;  2B63 K;  3GTK K;  3HOW K;  1IW7 A;  2JA8 C;  2PA8 D;  4YFX A;  4MEX A;  3HKZ D;  4A3B C;  1K83 C;  3H0G K;  2R93 K;  3HOY C;  2WB1 D;  4OIQ A;  3S1M K;  3I4N C;  4A3D C;  2PA8 L;  3HOX K;  5M5W K;  2R92 K;  3S2H K;  2JA5 K;  4AYB D;  3S16 C;  3K7A K;  3PO3 C;  3HOZ K;  3S14 C;  3GTG K;  4Y7N K;  2NVT K;  2A6E A;  5M5Y K;  2JA6 C;  5FLM K;  5C4X K;  5D4D A;  1TWH K;  3GTP K;  3EQL A;  4GZY A;  3I4N K;  4C3J C;  1BDF A;  3RZD C;  5IP9 K;  1HQM A;  3GTO K;  3S2D K;  2NVQ C;  4C3I C;  5C44 K;  1TWC K;  3GTQ K;  3PO3 K;  3S15 K;  2A68 A;  4OIR A;  4LK1 A;  4XSZ A;  4BY1 C;  4A3L C;  5IYC C;  4G7O A;  3PO2 K;  2PMZ D;  5M3M K;  2Y0S D;  4KN7 A;  3H3V L;  3CQZ K;  2E2J K;  5IP9 C;  4C3J K;  4JK1 A;  3RZD K;  4G7Z A;  1WCM C;  3S1N C;  4C3I K;  3WOD A;  1R9T K;  2A69 A;  1YNN A;  4OIO A;  1K83 K;  2R7Z K;  4YFK A;  3FKI K;  3M4O K;  4LK0 A;  4BBS K;  4A3F C;  5IYD K;  4XLN A;  3HOY K;  1I50 K;  4Y52 K;  3PO2 C;  4LLG A;  4ZH4 A;  3HOU C;  3S1R K;  4BBR C;  1SMY A;  4C3H C;  2NVX C;  4OIN A;  5FLM C;  4A3E C;  3GTJ C;  2E2I K;  3HOX C;  4KN4 A;  4A3D K;  5TMC A;  3S2H C;  1SFO C;  4BY7 C;  5IYD C;  4QIW L;  5C4X C;  2E2H C;  4A3C C;  4A3I C;  4A3F K;  3GTL K;  3RZO K;  4X6A K;  2NVT C;  5M5X K;  1I3Q K;  2VUM K;  4C2M K;  4A3G K;  2YU9 C;  4AYB L;  1TWC C;  4YG2 A;  3HOW C;  2E2I C;  1I6V A;  4XLP A;  4A3B K;  5C4J C;  4A3J K;  4G7H A;  1TWF C;  4A93 C;  3H0G C;  4MEY A;  4BY1 K;  4A3L K;  1I6H C;  3CQZ C;  5IYB C;  2VUM C;  4A3M K;  3HKZ L;  2PPB A;  2PMZ L;  5IYC K;  2JA7 C;  1WCM K;  2A6H A;  4NOI A;  3HOV C;  4Q4Z A;  3S1M C;  3S1N K;  4BXX K;  2E2J C;  5IP7 C;  2JA5 C;  4Y7N C;  3FKI C;  2CW0 A;  3K7A C;  1TWG C;  1TWF K;  4A93 K;  1I50 C;  1Y1V K;  3DXJ A;  1R9T C;  4A3K K;  3HOU K;  2JA6 K;  2B63 C;  1I6H K;  1Y1W K;  2R7Z C;  3M4O C;  4BBS C;  2O5J A;  3I4M K;  3M3Y K;  4A3M C;  1TWH C;  3S2D C;  1ZYR A;  4Y52 C;  3S17 K;  4A3E K;  3S1Q K;  3GTQ C;  4KMU A;  4BY7 K;  2O5I A;  2JA8 K;  2NVQ K;  4QIW D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...