2A6EA

Crystal structure of the t. thermophilus rna polymerase holoenzyme
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
229
structure length
229
Chain Sequence
MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase alpha chain
publication title Allosteric modulation of the RNA polymerase catalytic reaction is an essential component of transcription control by rifamycins.
pubmed doi rcsb
molecule tags Transferase
total genus 40
structure length 229
sequence length 229
chains with identical sequence B, K, L
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2005-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01000 RNA_pol_A_bac RNA polymerase Rpb3/RpoA insert domain
A PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain
A PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.12 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 DNA-directed RNA polymerase, insert domain 2a6eA02
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 2a6eA01
1TWFK 4YFKA 4A3IC 1I3QC 4AYBD 2NVTC 4A3KK 3S14C 2A6EA 2JA6C 4A3BC 3CQZC 2NVQK 4XLPA 2R7ZK 4X6AC 4A3CK 3HKZL 4A3MK 1I6HC 3PO3K 4A93C 4MQ9A 2NVXC 4A3IK 4YFXA 1I3QK 2PMZD 2NVTK 4QJVA 2E2HC 4A3FC 5IP7C 4YG2A 3GTOC 3S16C 3CQZK 2JA6K 4A3BK 4X6AK 4OIQA 1R9TC 4C2MC 4A93K 1I6HK 2NVXK 4G7ZA 4OIPA 2PPBA 4A3LC 2E2HK 4JK1A 4A3FK 5IP7K 3GTOK 3S16K 1R9TK 4A3JC 4C2MK 3HOUC 1XPPA 2WAQL 5FJ8K 1BDFA 4C3HC 2R93C 4A3LK 3PO2C 3S2DK 1K83C 3HKZD 1SMYA 4A3JK 3HOUK 2Y0SL 2WB1L 1I6VA 3M4OC 4C3HK 1IW7A 2R93K 3PO2K 3RZDC 1K83K 3HOXC 4A3EC 4MEXA 5M5WK 2A6HA 2A68A 1Y1VC 3M4OK 5IYDC 3RZDK 3M3YC 3DXJA 3HOXK 2E2JC 4LK1A 2O5IA 4A3EK 4Y52C 2WAQD 2VUMC 3S2DC 2B63C 3GTMC 1Y1VK 5M3FK 3K7AC 5IYDK 1YNJA 2PA8L 3M3YK 4LJZA 2E2JK 3S17C 2E2IK 4BXXC 4XLNA 4LLGA 4OIOA 2Y0SD 4C3JC 2WB1D 4A3GC 4Y52K 2VUMK 1HQMA 4KN4A 2A69A 2B63K 1TWGC 3K7AK 1TWCC 4QIWL 5M3MK 3GTMK 4ZH4A 5IP9C 3S17K 4Y7NC 4BXXK 4C3JK 5M5XK 4MEYA 4A3GK 4A3DC 5FLMC 3GTKC 1TWGK 1TWCK 2JA5C 5IP9K 4Y7NK 5C4JC 5TMFA 3H0GC 3GTQC 4XSZA 3GTPC 3S2HC 4A3DK 5FLMK 4BY1C 2O5JA 4BBSC 3GTKK 3WODA 2E2IC 2JA5K 3FKIC 2BE5A 2PA8D 3GTLC 3H3VL 3GTGC 4Q4ZA 3S1RC 5C4XC 3H0GK 5C4JK 3GTQK 4BBRC 5IYCC 4G7HA 3HOYC 3HOVC 3GTPK 3S2HK 4BY1K 4BBSK 3RZOC 2JA8C 4QIWD 5M5YK 3FKIK 1SFOC 3GTLK 3GTGK 5C4XK 1TWHC 3S1RK 3S1QC 3I4NC 4BBRK 2YU9C 3S1MC 5IYCK 3HOVK 1Y1WC 3HOYK 4BY7C 3RZOK 4KMUA 2CW0A 4G7OA 1YNNA 2JA8K 4KN7A 3S15C 1SFOK 1WCMC 1I50C 2NVYC 1TWHK 4AYBL 3S1QK 3I4MC 3I4NK 2YU9K 3HOZC 3S1MK 1Y1WK 4LK0A 2JA7C 3S14K 4BY7K 5TMCA 5C44C 3HOWC 3S15K 3H3VD 1WCMK 5C3EC 1I50K 2NVYK 2PMZL 4OINA 4QJVB 5IYBC 3GTJC 4GZYA 4C3IC 3I4MK 3HOZK 2R92C 3S1NC 4Q5SA 2JA7K 1TWAC 4OIRA 4YFNA 4XSXA 5C44K 3HOWK 1TWFC 3EQLA 5C3EK 5IYBK 3GTJK 4A3KC 4C3IK 5D4DA 2R92K 2R7ZC 3S1NK 2NVQC 4NOIA 1TWAK 1ZYRA 4A3CC 4A3MC 3PO3C
chains in the Genus database with same CATH superfamily
4YFKA 2NVTC 2R7ZK 4XLPA 4A3CK 3HKZL 4A3MK 4IOCS 4MQ9A 2NVXC 1USMA 3AH5A 1XZPA 3OEPA 3H0GA 4A3BK 3FOFA 3IPJA 2V6UA 2PPBA 2GAHC 4A3LC 3BUEA 3ERED 2KXYA 3GTMA 2B63A 1HI9A 1R9TK 2WAQL 5FJ8K 1BDFA 3CF5S 4C3HC 3PO2C 1V5VA 4KMAA 2W7VA 1TWCA 2Y0SL 1IW7A 4G0VA 3ADAC 4KM9A 1K83K 1DD5A 3GTKA 4GTLA 3M4OK 3DXJA 3HOXK 2P8TA 1VRQC 4IO9S 1Y1VK 4XCHA 3GTLA 1WIHA 1JVIA 2E2IK 2E2JK 1F7VA 4C3JC 1WSVA 1O2BA 5IORA 2VUMK 3K7AK 5M3MK 2CFAA 4ZH4A 3S17K 4Y7NC 4BXXK 1ISEA 3AD8C 4MEYA 4A3DC 2XCOA 3AD9C 1J6XA 1TWGK 1XXBA 3GEEA 1WOOA 4BKWA 5JVOA 5TMFA 4G0UA 1ZVUA 4LQYA 3GTPC 1XZPB 1DCPA 5FLMK 4BBSC 4PAAA 2E2IC 1O25A 2ZFZA 2PA8D 3GTGC 4Q4ZA 3GTQK 3PIOS 1TWAA 3G4AA 3H0GK 5IOTA 2ZUEA 1GE9A 3S2HK 2PHCB 3RZOC 4QIWD 4U67S 1SFOC 2R7ZA 1TWHC 3N0CA 5IYCK 1Y1WC 4FZBA 3S15C 3NUHA 3BP3A 1I50C 2YU9K 4WFBS 1IL2A 3HOWC 2ZJPS 2KQ1A 5C3EC 1YX2A 4KB2A 5IYBC 3GTJC 2JH3A 1R9TA 3HOZK 2R92C 4Q5SA 4KB4A 4A3KC 4KARA 1TWFK 2L3UA 4A3IC 1I3QC 4AYBD 1K83A 1DCHA 2CFAB 3CQZC 2NVQK 4X6AC 1I6HC 3TTGA 2V6TA 2PMZD 2NVTK 4QJVA 4WJ4A 2E2HC 4A3FC 5IP7C 3GTOC 3GSIA 1Y1VA 2FQTA 3GTPA 4C2MC 2NVXK 2E2IA 4G7ZA 2GAGC 3LPXA 4A3LK 2GSOA 1VGXA 5IOQA 1SMYA 1TWGA 3N3YA 4C3HK 3PO2K 3RZDC 1RU0A 1PJ5A 1WORA 3AQPA 3A8KA 2A68A 3GTQA 5IYDC 1XZQB 2FQOA 3SZYA 4LK1A 3OPFA 3JSTA 1O28A 1O2AA 2PA8L 5JFEA 2D6FC 4XLNA 4LLGA 4A3GC 4M1XA 1ZQ1C 3L4KA 4QIWL 2YU9A 5IP9C 5EGEA 4C3JK 5M5XK 4KMDA 2JA5C 3VA7A 4Y7NK 5C4JC 3FHZA 4GFQA 4XSZA 1WQGA 3G4CA 2KWAA 4A3DK 4BY1C 4KM8A 4P9SA 3FKIC 4P5BA 5C4XC 3S1RC 4BBRC 3GTPK 3HOVC 1TWFA 4BBSK 2JA8C 5M5YK 4KAWX 1BGWA 3GTGK 3S1QC 1EI6A 3TFJA 2P5MA 4BY7C 3RZOK 4G7OA 5IOSA 1SFOK 1WCMC 2NVYC 4AYBL 1TWHK 3TFHA 3LYWA 3I4MC 2RH6A 1Y1WK 2JA7C 3S14K 2NVXA 3BP8C 5C44C 1IBAA 2L5NA 3S15K 1I50K 2PMZL 5DM6S 5L46A 4GZYA 4C3IC 2RGRA 2XCQA 3S1NC 1ZXOA 3TFIA 4GTBA 4YFNA 3GIRA 4XSXA 4KASA 3HOWK 1EFWA 5C3EK 5IYBK 3GTJK 2R92K 4NOIA 3PO3C 1IS1A 3A8IA 4A3KK 3S14C 2A6EA 2JA6C 4A93C 1WQHA 4WJ3M 4A3IK 4YFXA 1I3QK 2JA5A 4O2DA 1ZBSA 3S16C 4WFAS 3CQZK 3LAPA 4X6AK 1WQFA 4OIQA 1I6HK 1IQ0A 4OIPA 1BJTA 4P5AA 2E2HK 4JK1A 5HL7S 4A3FK 5IP7K 3GTOK 1JQWA 4A3JC 4C2MK 3HOUC 4WF9S 3MMLB 2R93C 3S2DK 1EK8A 4GTAA 4KDDA 1I6VA 4G0WA 2KPUA 1WOPA 4A3EC 2EBBA 4MEXA 5M5WK 2A6HA 4GTDA 3RZDK 3M3YC 1O24A 5E68A 2O5IA 4Y52C 2ZJRS 2GSNA 3T02A 3S2DC 2B63C 3GTMC 1INNA 2V6SA 3GTGA 5IYDK 1YNJA 3OREA 4RMFA 2WB1D 3HXAA 1SFOA 4KN4A 2A69A 1TWHA 1TWCC 1Y1WA 5CJ9A 4A3GK 4C45A 3QX3A 4WFNS 1I50A 3GTKC 1YCLA 4KMHA 5IP9K 2ZUFA 4WILA 2O5JA 3WODA 3GTJA 2JA5K 2BE5A 3GTLC 2R92A 5C4JK 3HOYC 4G7HA 2Y3PA 1WOSA 4BY1K 3FKIK 5C4XK 3S1RK 3I4NC 4BBRK 3S1MC 3HOVK 1VJEA 1FEUA 4KC6A 1I3QA 4KMUA 1J6VA 1PJ6A 3SZZA 2JA8K 1PJ7A 3CQZA 5DM7S 3S1QK 1USOA 1B4AA 4BY7K 4FM9A 2E2HA 3H3VD 3GTOA 2NVYK 4IOAS 1WCMK 4QJVB 4OINA 3I4MK 2JA7K 1TWAC 4OIRA 1VLOA 5C44K 5JVGS 3EQLA 3T00A 1AB4A 5TJ3A 4C3IK 1XXAA 5D4DA 2R7ZC 3S1NK 1O26A 1ZYRA 4A3CC 4A3MC 3A8JA 4GTEA 4A3BC 4GT9A 3LAJA 3PO3K 1JOEA 3S0XA 5JVHS 2JA6K 4YG2A 1WSRA 1R9TC 4A93K 5HQHA 1IE0A 3S16K 1EH1A 3GDZA 1XPPA 5HL8A 1K83C 3HKZD 3GEHA 4A3JK 3HOUK 2WB1L 1C0AA 3M4OC 4PABA 5CHPA 2R93K 1F93A 1B4BA 1XXCA 3HOXC 1BS2A 1Y1VC 2XCRB 1EQRA 4J3NA 3T01A 1VH2A 2E2JC 4A3EK 3AQOA 3N0BA 1KQ4A 2WAQD 3FKIA 2VUMC 5M3FK 3DLLS 3K7AC 3L4JA 3M3YK 4LJZA 3S17C 4BLBA 4BLAA 4BXXC 1F9NA 4OIOA 2Y0SD 4Y52K 1HQMA 2B63K 3GTMK 1TWGC 4GTCA 3Q3QA 5FLMC 1WCMA 2NVYA 4GTFA 1TWCK 3V4GA 3GTQC 1XZQA 3H0GC 1F7UA 2JA7A 3S2HC 1O29A 4DDQA 2ZJQS 1O2FB 3GTKK 3H3VL 5IYCC 1X31C 4WCES 3GEIA 3CAGA 3GTLK 3AD7C 3HOYK 2YU9C 4LOWA 2CW0A 1YNNA 4KN7A 2JA6A 1J6WA 1L0WA 3I4NK 3HOZC 3S1MK 4LK0A 1G51A 3FOEA 5TMCA 4LR2A 1J98A 3PIPS 5EGHA 1DCOA 1O27A 2VUMA 4KATA 1TWFC 1UV7A 4ILDA 2GSUA 2NVQC 1TWAK 4AH6A 2R93A
chains in the Genus database with same CATH topology
1TWFK 4YFKA 4A3IC 1I3QC 4AYBD 2NVTC 4A3KK 3S14C 2A6EA 2JA6C 4A3BC 3CQZC 2NVQK 4XLPA 2R7ZK 4X6AC 4A3CK 3HKZL 4A3MK 1I6HC 3PO3K 4A93C 4MQ9A 2NVXC 4A3IK 4YFXA 1I3QK 2PMZD 2NVTK 4QJVA 2E2HC 4A3FC 5IP7C 4YG2A 3GTOC 3S16C 3CQZK 2JA6K 4A3BK 4X6AK 4OIQA 1R9TC 4C2MC 4A93K 1I6HK 2NVXK 4G7ZA 4OIPA 2PPBA 4A3LC 2E2HK 4JK1A 4A3FK 5IP7K 3GTOK 3S16K 1R9TK 4A3JC 4C2MK 3HOUC 1XPPA 2WAQL 5FJ8K 1BDFA 4C3HC 2R93C 4A3LK 3PO2C 3S2DK 1K83C 3HKZD 1SMYA 4A3JK 3HOUK 2Y0SL 2WB1L 1I6VA 3M4OC 4C3HK 1IW7A 2R93K 3PO2K 3RZDC 1K83K 3HOXC 4A3EC 4MEXA 5M5WK 2A6HA 2A68A 1Y1VC 3M4OK 5IYDC 3RZDK 3M3YC 3DXJA 3HOXK 2E2JC 4LK1A 2O5IA 4A3EK 4Y52C 2WAQD 2VUMC 3S2DC 2B63C 3GTMC 1Y1VK 5M3FK 3K7AC 5IYDK 1YNJA 2PA8L 3M3YK 4LJZA 2E2JK 3S17C 2E2IK 4BXXC 4XLNA 4LLGA 4OIOA 2Y0SD 4C3JC 2WB1D 4A3GC 4Y52K 2VUMK 1HQMA 4KN4A 2A69A 2B63K 1TWGC 3K7AK 1TWCC 4QIWL 5M3MK 3GTMK 4ZH4A 5IP9C 3S17K 4Y7NC 4BXXK 4C3JK 5M5XK 4MEYA 4A3GK 4A3DC 5FLMC 3GTKC 1TWGK 1TWCK 2JA5C 5IP9K 4Y7NK 5C4JC 5TMFA 3H0GC 3GTQC 4XSZA 3GTPC 3S2HC 4A3DK 5FLMK 4BY1C 2O5JA 4BBSC 3GTKK 3WODA 2E2IC 2JA5K 3FKIC 2BE5A 2PA8D 3GTLC 3H3VL 3GTGC 4Q4ZA 3S1RC 5C4XC 3H0GK 5C4JK 3GTQK 4BBRC 5IYCC 4G7HA 3HOYC 3HOVC 3GTPK 3S2HK 4BY1K 4BBSK 3RZOC 2JA8C 4QIWD 5M5YK 3FKIK 1SFOC 3GTLK 3GTGK 5C4XK 1TWHC 3S1RK 3S1QC 3I4NC 4BBRK 2YU9C 3S1MC 5IYCK 3HOVK 1Y1WC 3HOYK 4BY7C 3RZOK 4KMUA 2CW0A 4G7OA 1YNNA 2JA8K 4KN7A 3S15C 1SFOK 1WCMC 1I50C 2NVYC 1TWHK 4AYBL 3S1QK 3I4MC 3I4NK 2YU9K 3HOZC 3S1MK 1Y1WK 4LK0A 2JA7C 3S14K 4BY7K 5TMCA 5C44C 3HOWC 3S15K 3H3VD 1WCMK 5C3EC 1I50K 2NVYK 2PMZL 4OINA 4QJVB 5IYBC 3GTJC 4GZYA 4C3IC 3I4MK 3HOZK 2R92C 3S1NC 4Q5SA 2JA7K 1TWAC 4OIRA 4YFNA 4XSXA 5C44K 3HOWK 1TWFC 3EQLA 5C3EK 5IYBK 3GTJK 4A3KC 4C3IK 5D4DA 2R92K 2R7ZC 3S1NK 2NVQC 4NOIA 1TWAK 1ZYRA 4A3CC 4A3MC 3PO3C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TWF K;  4YFK A;  4A3I C;  1I3Q C;  4AYB D;  2NVT C;  4A3K K;  3S14 C;  2A6E A;  2JA6 C;  4A3B C;  3CQZ C;  2NVQ K;  4XLP A;  2R7Z K;  4X6A C;  4A3C K;  3HKZ L;  4A3M K;  1I6H C;  3PO3 K;  4A93 C;  4MQ9 A;  2NVX C;  4A3I K;  4YFX A;  1I3Q K;  2PMZ D;  2NVT K;  4QJV A;  2E2H C;  4A3F C;  5IP7 C;  4YG2 A;  3GTO C;  3S16 C;  3CQZ K;  2JA6 K;  4A3B K;  4X6A K;  4OIQ A;  1R9T C;  4C2M C;  4A93 K;  1I6H K;  2NVX K;  4G7Z A;  4OIP A;  2PPB A;  4A3L C;  2E2H K;  4JK1 A;  4A3F K;  5IP7 K;  3GTO K;  3S16 K;  1R9T K;  4A3J C;  4C2M K;  3HOU C;  1XPP A;  2WAQ L;  5FJ8 K;  1BDF A;  4C3H C;  2R93 C;  4A3L K;  3PO2 C;  3S2D K;  1K83 C;  3HKZ D;  1SMY A;  4A3J K;  3HOU K;  2Y0S L;  2WB1 L;  1I6V A;  3M4O C;  4C3H K;  1IW7 A;  2R93 K;  3PO2 K;  3RZD C;  1K83 K;  3HOX C;  4A3E C;  4MEX A;  5M5W K;  2A6H A;  2A68 A;  1Y1V C;  3M4O K;  5IYD C;  3RZD K;  3M3Y C;  3DXJ A;  3HOX K;  2E2J C;  4LK1 A;  2O5I A;  4A3E K;  4Y52 C;  2WAQ D;  2VUM C;  3S2D C;  2B63 C;  3GTM C;  1Y1V K;  5M3F K;  3K7A C;  5IYD K;  1YNJ A;  2PA8 L;  3M3Y K;  4LJZ A;  2E2J K;  3S17 C;  2E2I K;  4BXX C;  4XLN A;  4LLG A;  4OIO A;  2Y0S D;  4C3J C;  2WB1 D;  4A3G C;  4Y52 K;  2VUM K;  1HQM A;  4KN4 A;  2A69 A;  2B63 K;  1TWG C;  3K7A K;  1TWC C;  4QIW L;  5M3M K;  3GTM K;  4ZH4 A;  5IP9 C;  3S17 K;  4Y7N C;  4BXX K;  4C3J K;  5M5X K;  4MEY A;  4A3G K;  4A3D C;  5FLM C;  3GTK C;  1TWG K;  1TWC K;  2JA5 C;  5IP9 K;  4Y7N K;  5C4J C;  5TMF A;  3H0G C;  3GTQ C;  4XSZ A;  3GTP C;  3S2H C;  4A3D K;  5FLM K;  4BY1 C;  2O5J A;  4BBS C;  3GTK K;  3WOD A;  2E2I C;  2JA5 K;  3FKI C;  2BE5 A;  2PA8 D;  3GTL C;  3H3V L;  3GTG C;  4Q4Z A;  3S1R C;  5C4X C;  3H0G K;  5C4J K;  3GTQ K;  4BBR C;  5IYC C;  4G7H A;  3HOY C;  3HOV C;  3GTP K;  3S2H K;  4BY1 K;  4BBS K;  3RZO C;  2JA8 C;  4QIW D;  5M5Y K;  3FKI K;  1SFO C;  3GTL K;  3GTG K;  5C4X K;  1TWH C;  3S1R K;  3S1Q C;  3I4N C;  4BBR K;  2YU9 C;  3S1M C;  5IYC K;  3HOV K;  1Y1W C;  3HOY K;  4BY7 C;  3RZO K;  4KMU A;  2CW0 A;  4G7O A;  1YNN A;  2JA8 K;  4KN7 A;  3S15 C;  1SFO K;  1WCM C;  1I50 C;  2NVY C;  1TWH K;  4AYB L;  3S1Q K;  3I4M C;  3I4N K;  2YU9 K;  3HOZ C;  3S1M K;  1Y1W K;  4LK0 A;  2JA7 C;  3S14 K;  4BY7 K;  5TMC A;  5C44 C;  3HOW C;  3S15 K;  3H3V D;  1WCM K;  5C3E C;  1I50 K;  2NVY K;  2PMZ L;  4OIN A;  4QJV B;  5IYB C;  3GTJ C;  4GZY A;  4C3I C;  3I4M K;  3HOZ K;  2R92 C;  3S1N C;  4Q5S A;  2JA7 K;  1TWA C;  4OIR A;  4YFN A;  4XSX A;  5C44 K;  3HOW K;  1TWF C;  3EQL A;  5C3E K;  5IYB K;  3GTJ K;  4A3K C;  4C3I K;  5D4D A;  2R92 K;  2R7Z C;  3S1N K;  2NVQ C;  4NOI A;  1TWA K;  1ZYR A;  4A3C C;  4A3M C;  3PO3 C; 
#chains in the Genus database with same CATH topology
 4YFK A;  2NVT C;  2R7Z K;  4XLP A;  4A3C K;  3HKZ L;  4A3M K;  4IOC S;  4MQ9 A;  2NVX C;  1USM A;  3AH5 A;  1XZP A;  3OEP A;  3H0G A;  4A3B K;  3FOF A;  3IPJ A;  2V6U A;  2PPB A;  2GAH C;  4A3L C;  3BUE A;  3ERE D;  2KXY A;  3GTM A;  2B63 A;  1HI9 A;  1R9T K;  2WAQ L;  5FJ8 K;  1BDF A;  3CF5 S;  4C3H C;  3PO2 C;  1V5V A;  4KMA A;  2W7V A;  1TWC A;  2Y0S L;  1IW7 A;  4G0V A;  3ADA C;  4KM9 A;  1K83 K;  1DD5 A;  3GTK A;  4GTL A;  3M4O K;  3DXJ A;  3HOX K;  2P8T A;  1VRQ C;  4IO9 S;  1Y1V K;  4XCH A;  3GTL A;  1WIH A;  1JVI A;  2E2I K;  2E2J K;  1F7V A;  4C3J C;  1WSV A;  1O2B A;  5IOR A;  2VUM K;  3K7A K;  5M3M K;  2CFA A;  4ZH4 A;  3S17 K;  4Y7N C;  4BXX K;  1ISE A;  3AD8 C;  4MEY A;  4A3D C;  2XCO A;  3AD9 C;  1J6X A;  1TWG K;  1XXB A;  3GEE A;  1WOO A;  4BKW A;  5JVO A;  5TMF A;  4G0U A;  1ZVU A;  4LQY A;  3GTP C;  1XZP B;  1DCP A;  5FLM K;  4BBS C;  4PAA A;  2E2I C;  1O25 A;  2ZFZ A;  2PA8 D;  3GTG C;  4Q4Z A;  3GTQ K;  3PIO S;  1TWA A;  3G4A A;  3H0G K;  5IOT A;  2ZUE A;  1GE9 A;  3S2H K;  2PHC B;  3RZO C;  4QIW D;  4U67 S;  1SFO C;  2R7Z A;  1TWH C;  3N0C A;  5IYC K;  1Y1W C;  4FZB A;  3S15 C;  3NUH A;  3BP3 A;  1I50 C;  2YU9 K;  4WFB S;  1IL2 A;  3HOW C;  2ZJP S;  2KQ1 A;  5C3E C;  1YX2 A;  4KB2 A;  5IYB C;  3GTJ C;  2JH3 A;  1R9T A;  3HOZ K;  2R92 C;  4Q5S A;  4KB4 A;  4A3K C;  4KAR A;  1TWF K;  2L3U A;  4A3I C;  1I3Q C;  4AYB D;  1K83 A;  1DCH A;  2CFA B;  3CQZ C;  2NVQ K;  4X6A C;  1I6H C;  3TTG A;  2V6T A;  2PMZ D;  2NVT K;  4QJV A;  4WJ4 A;  2E2H C;  4A3F C;  5IP7 C;  3GTO C;  3GSI A;  1Y1V A;  2FQT A;  3GTP A;  4C2M C;  2NVX K;  2E2I A;  4G7Z A;  2GAG C;  3LPX A;  4A3L K;  2GSO A;  1VGX A;  5IOQ A;  1SMY A;  1TWG A;  3N3Y A;  4C3H K;  3PO2 K;  3RZD C;  1RU0 A;  1PJ5 A;  1WOR A;  3AQP A;  3A8K A;  2A68 A;  3GTQ A;  5IYD C;  1XZQ B;  2FQO A;  3SZY A;  4LK1 A;  3OPF A;  3JST A;  1O28 A;  1O2A A;  2PA8 L;  5JFE A;  2D6F C;  4XLN A;  4LLG A;  4A3G C;  4M1X A;  1ZQ1 C;  3L4K A;  4QIW L;  2YU9 A;  5IP9 C;  5EGE A;  4C3J K;  5M5X K;  4KMD A;  2JA5 C;  3VA7 A;  4Y7N K;  5C4J C;  3FHZ A;  4GFQ A;  4XSZ A;  1WQG A;  3G4C A;  2KWA A;  4A3D K;  4BY1 C;  4KM8 A;  4P9S A;  3FKI C;  4P5B A;  5C4X C;  3S1R C;  4BBR C;  3GTP K;  3HOV C;  1TWF A;  4BBS K;  2JA8 C;  5M5Y K;  4KAW X;  1BGW A;  3GTG K;  3S1Q C;  1EI6 A;  3TFJ A;  2P5M A;  4BY7 C;  3RZO K;  4G7O A;  5IOS A;  1SFO K;  1WCM C;  2NVY C;  4AYB L;  1TWH K;  3TFH A;  3LYW A;  3I4M C;  2RH6 A;  1Y1W K;  2JA7 C;  3S14 K;  2NVX A;  3BP8 C;  5C44 C;  1IBA A;  2L5N A;  3S15 K;  1I50 K;  2PMZ L;  5DM6 S;  5L46 A;  4GZY A;  4C3I C;  2RGR A;  2XCQ A;  3S1N C;  1ZXO A;  3TFI A;  4GTB A;  4YFN A;  3GIR A;  4XSX A;  4KAS A;  3HOW K;  1EFW A;  5C3E K;  5IYB K;  3GTJ K;  2R92 K;  4NOI A;  3PO3 C;  1IS1 A;  3A8I A;  4A3K K;  3S14 C;  2A6E A;  2JA6 C;  4A93 C;  1WQH A;  4WJ3 M;  4A3I K;  4YFX A;  1I3Q K;  2JA5 A;  4O2D A;  1ZBS A;  3S16 C;  4WFA S;  3CQZ K;  3LAP A;  4X6A K;  1WQF A;  4OIQ A;  1I6H K;  1IQ0 A;  4OIP A;  1BJT A;  4P5A A;  2E2H K;  4JK1 A;  5HL7 S;  4A3F K;  5IP7 K;  3GTO K;  1JQW A;  4A3J C;  4C2M K;  3HOU C;  4WF9 S;  3MML B;  2R93 C;  3S2D K;  1EK8 A;  4GTA A;  4KDD A;  1I6V A;  4G0W A;  2KPU A;  1WOP A;  4A3E C;  2EBB A;  4MEX A;  5M5W K;  2A6H A;  4GTD A;  3RZD K;  3M3Y C;  1O24 A;  5E68 A;  2O5I A;  4Y52 C;  2ZJR S;  2GSN A;  3T02 A;  3S2D C;  2B63 C;  3GTM C;  1INN A;  2V6S A;  3GTG A;  5IYD K;  1YNJ A;  3ORE A;  4RMF A;  2WB1 D;  3HXA A;  1SFO A;  4KN4 A;  2A69 A;  1TWH A;  1TWC C;  1Y1W A;  5CJ9 A;  4A3G K;  4C45 A;  3QX3 A;  4WFN S;  1I50 A;  3GTK C;  1YCL A;  4KMH A;  5IP9 K;  2ZUF A;  4WIL A;  2O5J A;  3WOD A;  3GTJ A;  2JA5 K;  2BE5 A;  3GTL C;  2R92 A;  5C4J K;  3HOY C;  4G7H A;  2Y3P A;  1WOS A;  4BY1 K;  3FKI K;  5C4X K;  3S1R K;  3I4N C;  4BBR K;  3S1M C;  3HOV K;  1VJE A;  1FEU A;  4KC6 A;  1I3Q A;  4KMU A;  1J6V A;  1PJ6 A;  3SZZ A;  2JA8 K;  1PJ7 A;  3CQZ A;  5DM7 S;  3S1Q K;  1USO A;  1B4A A;  4BY7 K;  4FM9 A;  2E2H A;  3H3V D;  3GTO A;  2NVY K;  4IOA S;  1WCM K;  4QJV B;  4OIN A;  3I4M K;  2JA7 K;  1TWA C;  4OIR A;  1VLO A;  5C44 K;  5JVG S;  3EQL A;  3T00 A;  1AB4 A;  5TJ3 A;  4C3I K;  1XXA A;  5D4D A;  2R7Z C;  3S1N K;  1O26 A;  1ZYR A;  4A3C C;  4A3M C;  3A8J A;  4GTE A;  4A3B C;  4GT9 A;  3LAJ A;  3PO3 K;  1JOE A;  3S0X A;  5JVH S;  2JA6 K;  4YG2 A;  1WSR A;  1R9T C;  4A93 K;  5HQH A;  1IE0 A;  3S16 K;  1EH1 A;  3GDZ A;  1XPP A;  5HL8 A;  1K83 C;  3HKZ D;  3GEH A;  4A3J K;  3HOU K;  2WB1 L;  1C0A A;  3M4O C;  4PAB A;  5CHP A;  2R93 K;  1F93 A;  1B4B A;  1XXC A;  3HOX C;  1BS2 A;  1Y1V C;  2XCR B;  1EQR A;  4J3N A;  3T01 A;  1VH2 A;  2E2J C;  4A3E K;  3AQO A;  3N0B A;  1KQ4 A;  2WAQ D;  3FKI A;  2VUM C;  5M3F K;  3DLL S;  3K7A C;  3L4J A;  3M3Y K;  4LJZ A;  3S17 C;  4BLB A;  4BLA A;  4BXX C;  1F9N A;  4OIO A;  2Y0S D;  4Y52 K;  1HQM A;  2B63 K;  3GTM K;  1TWG C;  4GTC A;  3Q3Q A;  5FLM C;  1WCM A;  2NVY A;  4GTF A;  1TWC K;  3V4G A;  3GTQ C;  1XZQ A;  3H0G C;  1F7U A;  2JA7 A;  3S2H C;  1O29 A;  4DDQ A;  2ZJQ S;  1O2F B;  3GTK K;  3H3V L;  5IYC C;  1X31 C;  4WCE S;  3GEI A;  3CAG A;  3GTL K;  3AD7 C;  3HOY K;  2YU9 C;  4LOW A;  2CW0 A;  1YNN A;  4KN7 A;  2JA6 A;  1J6W A;  1L0W A;  3I4N K;  3HOZ C;  3S1M K;  4LK0 A;  1G51 A;  3FOE A;  5TMC A;  4LR2 A;  1J98 A;  3PIP S;  5EGH A;  1DCO A;  1O27 A;  2VUM A;  4KAT A;  1TWF C;  1UV7 A;  4ILD A;  2GSU A;  2NVQ C;  1TWA K;  4AH6 A;  2R93 A; 
#chains in the Genus database with same CATH homology
 1TWF K;  4YFK A;  4A3I C;  1I3Q C;  4AYB D;  2NVT C;  4A3K K;  3S14 C;  2A6E A;  2JA6 C;  4A3B C;  3CQZ C;  2NVQ K;  4XLP A;  2R7Z K;  4X6A C;  4A3C K;  3HKZ L;  4A3M K;  1I6H C;  3PO3 K;  4A93 C;  4MQ9 A;  2NVX C;  4A3I K;  4YFX A;  1I3Q K;  2PMZ D;  2NVT K;  4QJV A;  2E2H C;  4A3F C;  5IP7 C;  4YG2 A;  3GTO C;  3S16 C;  3CQZ K;  2JA6 K;  4A3B K;  4X6A K;  4OIQ A;  1R9T C;  4C2M C;  4A93 K;  1I6H K;  2NVX K;  4G7Z A;  4OIP A;  2PPB A;  4A3L C;  2E2H K;  4JK1 A;  4A3F K;  5IP7 K;  3GTO K;  3S16 K;  1R9T K;  4A3J C;  4C2M K;  3HOU C;  1XPP A;  2WAQ L;  5FJ8 K;  1BDF A;  4C3H C;  2R93 C;  4A3L K;  3PO2 C;  3S2D K;  1K83 C;  3HKZ D;  1SMY A;  4A3J K;  3HOU K;  2Y0S L;  2WB1 L;  1I6V A;  3M4O C;  4C3H K;  1IW7 A;  2R93 K;  3PO2 K;  3RZD C;  1K83 K;  3HOX C;  4A3E C;  4MEX A;  5M5W K;  2A6H A;  2A68 A;  1Y1V C;  3M4O K;  5IYD C;  3RZD K;  3M3Y C;  3DXJ A;  3HOX K;  2E2J C;  4LK1 A;  2O5I A;  4A3E K;  4Y52 C;  2WAQ D;  2VUM C;  3S2D C;  2B63 C;  3GTM C;  1Y1V K;  5M3F K;  3K7A C;  5IYD K;  1YNJ A;  2PA8 L;  3M3Y K;  4LJZ A;  2E2J K;  3S17 C;  2E2I K;  4BXX C;  4XLN A;  4LLG A;  4OIO A;  2Y0S D;  4C3J C;  2WB1 D;  4A3G C;  4Y52 K;  2VUM K;  1HQM A;  4KN4 A;  2A69 A;  2B63 K;  1TWG C;  3K7A K;  1TWC C;  4QIW L;  5M3M K;  3GTM K;  4ZH4 A;  5IP9 C;  3S17 K;  4Y7N C;  4BXX K;  4C3J K;  5M5X K;  4MEY A;  4A3G K;  4A3D C;  5FLM C;  3GTK C;  1TWG K;  1TWC K;  2JA5 C;  5IP9 K;  4Y7N K;  5C4J C;  5TMF A;  3H0G C;  3GTQ C;  4XSZ A;  3GTP C;  3S2H C;  4A3D K;  5FLM K;  4BY1 C;  2O5J A;  4BBS C;  3GTK K;  3WOD A;  2E2I C;  2JA5 K;  3FKI C;  2BE5 A;  2PA8 D;  3GTL C;  3H3V L;  3GTG C;  4Q4Z A;  3S1R C;  5C4X C;  3H0G K;  5C4J K;  3GTQ K;  4BBR C;  5IYC C;  4G7H A;  3HOY C;  3HOV C;  3GTP K;  3S2H K;  4BY1 K;  4BBS K;  3RZO C;  2JA8 C;  4QIW D;  5M5Y K;  3FKI K;  1SFO C;  3GTL K;  3GTG K;  5C4X K;  1TWH C;  3S1R K;  3S1Q C;  3I4N C;  4BBR K;  2YU9 C;  3S1M C;  5IYC K;  3HOV K;  1Y1W C;  3HOY K;  4BY7 C;  3RZO K;  4KMU A;  2CW0 A;  4G7O A;  1YNN A;  2JA8 K;  4KN7 A;  3S15 C;  1SFO K;  1WCM C;  1I50 C;  2NVY C;  1TWH K;  4AYB L;  3S1Q K;  3I4M C;  3I4N K;  2YU9 K;  3HOZ C;  3S1M K;  1Y1W K;  4LK0 A;  2JA7 C;  3S14 K;  4BY7 K;  5TMC A;  5C44 C;  3HOW C;  3S15 K;  3H3V D;  1WCM K;  5C3E C;  1I50 K;  2NVY K;  2PMZ L;  4OIN A;  4QJV B;  5IYB C;  3GTJ C;  4GZY A;  4C3I C;  3I4M K;  3HOZ K;  2R92 C;  3S1N C;  4Q5S A;  2JA7 K;  1TWA C;  4OIR A;  4YFN A;  4XSX A;  5C44 K;  3HOW K;  1TWF C;  3EQL A;  5C3E K;  5IYB K;  3GTJ K;  4A3K C;  4C3I K;  5D4D A;  2R92 K;  2R7Z C;  3S1N K;  2NVQ C;  4NOI A;  1TWA K;  1ZYR A;  4A3C C;  4A3M C;  3PO3 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...