2A6EA

Crystal structure of the t. thermophilus rna polymerase holoenzyme
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
229
structure length
229
Chain Sequence
MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords DNA-directed RNA polymerase alpha chain
publication title Allosteric modulation of the RNA polymerase catalytic reaction is an essential component of transcription control by rifamycins.
pubmed doi rcsb
total genus 40
structure length 229
sequence length 229
chains with identical sequence B, K, L
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2005-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01000 RNA_pol_A_bac RNA polymerase Rpb3/RpoA insert domain
A PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain
A PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.12 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 DNA-directed RNA polymerase, insert domain 2a6eA02
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 2a6eA01
3M4OK 4QJVA 3S16K 3S1MK 2Y0SD 4KN7A 3S15C 1R9TC 3FKIK 4LJZA 2B63C 4C3HC 2E2HK 2NVQK 2JA7C 1K83K 2E2IK 2R7ZC 3M4OC 5FJ8K 3HOXK 3S16C 3S1MC 4A3IK 3GTGK 3GTQK 4XSXA 1TWGK 2E2HC 1WCMK 4C3IK 1IW7A 3PO2K 4Y52K 2NVQC 4G7ZA 1K83C 2E2IC 1I6HC 3HOXC 2JA8K 3HOZK 3GTGC 3GTQC 4A3IC 2PMZL 1WCMC 1TWGC 3PO2C 4C3IC 4Y52C 1ZYRA 4A93K 4NOIA 3HOZC 1I6VA 3WODA 4LLGA 4YFXA 2JA8C 4GZYA 3S1RK 5C4XC 3H3VL 3S1NK 3PO3K 3S1RC 4BXXK 4A3BC 2WAQD 2NVTK 4BY1K 3S1NC 3RZDK 3HOYK 2JA6K 4A3DK 4YFNA 5FLMK 3PO3C 4C3JK 4BXXC 5C3EK 4OIRA 2O5JA 5IYBK 4X6AK 4BBSK 5TMFA 2PMZD 2NVYK 2NVTC 3HOVK 4LK1A 3RZDC 4BY1C 3HOYC 4A3DC 4ZH4A 5FLMC 4OIQA 4C3JC 4Y7NK 3S17K 5C3EC 3GTKC 4BBSC 2NVXK 3HOVC 3S1QC 1YNJA 3H3VD 1I3QK 4Y7NC 3S17C 2WAQL 3FKIC 3H0GK 2BE5A 5IP9K 5M5XK 2NVXC 3S2HK 1I3QC 3H0GC 1Y1WK 4YG2A 4A3LK 1TWCK 5IYDK 5IP9C 4QJVB 3S2HC 4OIOA 1Y1WC 3GTOK 4XLNA 5M5YK 4A3CK 1I6HK 4A93C 4A3LC 1TWCC 5IYDC 3HKZL 5M5WK 4BY7K 2O5IA 4KMUA 5M3MK 4Q4ZA 3HOWK 4C2MK 5IP7K 4A3CC 4A3MK 2R92K 4BY7C 3I4MK 2WB1L 3HOWC 4C2MC 5IP7C 4A3MC 2R92C 4OINA 2E2JK 2JA6C 2VUMK 3I4MC 1TWHK 3GTMK 4X6AC 5IYBC 1BDFA 2R93K 2NVYC 3RZOK 2E2JC 4G7HA 4MEYA 2VUMC 3HKZD 1TWHC 3GTMC 3GTPK 4A3EK 2R93C 4AYBL 4A3GK 3RZOC 4JK1A 3K7AK 3S14K 3GTPC 3GTJK 2YU9K 1SMYA 4A3EC 1SFOK 5C4JK 2WB1D 4LK0A 4MQ9A 4G7OA 2A6EA 1YNNA 3K7AC 3GTJC 2YU9C 5D4DA 1SFOC 1XPPA 5TMCA 2A69A 4QIWL 4BBRK 1TWFK 4XSZA 3GTOC 2A6HA 4BBRC 4OIPA 5C44K 1TWFC 2PA8D 4AYBD 3GTKK 2PPBA 3DXJA 3HOUK 5C44C 3GTLK 3I4NK 3M3YK 5M3FK 4XLPA 3S2DK 4YFKA 4QIWD 3HOUC 1TWAK 2Y0SL 5C4XK 4A3FK 3S1QK 2A68A 3GTLC 3I4NC 3CQZK 2JA5K 3EQLA 3M3YC 2PA8L 4A3BK 3S2DC 1Y1VK 5IYCK 1TWAC 2CW0A 4A3FC 4A3JK 4Q5SA 3CQZC 2JA5C 1I50K 4A3KK 4A3GC 4KN4A 4MEXA 1Y1VC 5IYCC 3S14C 4A3JC 3S15K 1R9TK 1I50C 1HQMA 5C4JC 4A3KC 4C3HK 2B63K 2JA7K 2R7ZK
chains in the Genus database with same CATH superfamily
3M4OK 4QJVA 2FQOA 2Y0SD 3M4OC 3GTGK 4A3IK 1TWGK 4C3IK 1WOSA 4Y52K 2JA8K 1C0AA 3GTGC 4A3IC 1O26A 1TWGC 4C3IC 4Y52C 4A93K 1J6VA 2RH6A 2JA8C 3TFIA 1J6WA 4G0UA 3S1NK 5E68A 1IBAA 4BY1K 3S1NC 1EQRA 2JA6K 5JVOA 4C3JK 5C3EK 4OIRA 1Y1VA 3PIOS 3S1QK 4BY1C 4Y7NK 4C3JC 1JOEA 5C3EC 1I50A 3GTKC 3S1QC 4Y7NC 1UV7A 4P9SA 2KPUA 2JA7A 3Q3QA 5IOQA 1Y1WK 4YG2A 4PAAA 2XCQA 2E2IA 4QJVB 4OIOA 1Y1WC 3GTOK 4XLNA 5M5YK 4BY7K 1F9NA 5IP7K 2R92K 5JVHS 4BY7C 2V6SA 2WB1L 5IP7C 2R92C 4OINA 4X6AC 5IYBC 1BDFA 1PJ7A 2KWAA 4LQYA 3LAPA 1DD5A 4A3EK 2ZJQS 1O29A 4U67S 3AD7C 4A3EC 1WORA 2WB1D 1XZPA 2XCRB 4G7OA 4ILDA 1YNNA 3H0GA 4WCES 5DM7S 1I3QA 4WFBS 1XPPA 4QIWL 4GTEA 5TMCA 4BBRK 4WILA 4KARA 3FOEA 5EGHA 3SZYA 4BBRC 1TWCA 2Y3PA 1WOPA 5DM6S 3T01A 1O2AA 4YFKA 4QIWD 5C4XK 1L0WA 2JA6A 3OPFA 2EBBA 1Y1VK 3ERED 1I50K 4A3KK 4A3GC 1ISEA 2V6UA 1Y1VC 2PHCB 2XCOA 3S14C 1V5VA 3N0BA 4P5BA 1I50C 4A3KC 1F93A 1BGWA 4C3HK 2JA7K 3S1MK 4KN7A 2YU9A 4LJZA 1SFOA 4C3HC 4WFNS 2NVQK 2JA7C 1F7VA 2E2IK 4FM9A 5FJ8K 3S1MC 3GTOA 2NVQC 1TWFA 4G7ZA 2E2IC 3HOZK 4KMDA 1JQWA 1ZYRA 4LR2A 4NOIA 3HOZC 3MMLB 4YFXA 1O28A 1O24A 4A3BC 3S0XA 2NVTK 4A3DK 3RZDK 1TWAA 3OEPA 3HOYK 4YFNA 5FLMK 4WJ3M 5TMFA 2NVYK 2NVTC 4LK1A 3RZDC 3HOYC 4A3DC 1DCHA 4OIQA 5FLMC 1PJ5A 3S17K 5HQHA 4KAWX 1GE9A 1J6XA 1I3QK 3H0GK 3S17C 4J3NA 1R9TA 2B63A 2BE5A 5M5XK 3IPJA 3S2HK 1VGXA 1I3QC 3H0GC 3GEIA 2CFAB 4WJ4A 4A3LK 1TWCK 5IYDK 3S2HC 5IOTA 3TFHA 3BP8C 4A93C 4A3LC 1TWCC 5IYDC 1WOOA 3HKZL 5M5WK 2FQTA 2L3UA 4C2MK 1RU0A 4BLBA 3GIRA 3OREA 4C2MC 1WQHA 3SZZA 2JA6C 2ZJRS 3RZOK 4G7HA 3HKZD 3GEHA 1WSVA 4DDQA 1BS2A 3RZOC 4JK1A 2GAGC 3K7AK 2KQ1A 2YU9K 2P8TA 1SFOK 5JFEA 5C4JK 3TTGA 3BUEA 4GTCA 4IOAS 3GEEA 4GFQA 3K7AC 2YU9C 5D4DA 1SFOC 2V6TA 3CF5S 1TWFK 3GTOC 4G0VA 2A6HA 1TWFC 5JVGS 3LPXA 4GT9A 1VH2A 3QX3A 3I4NK 4XLPA 3S2DK 1TWAK 3I4NC 5L46A 4G0WA 1AB4A 2L5NA 3S2DC 2NVYA 1EI6A 4KDDA 1TWAC 1VJEA 1TWHA 3GTMA 1J98A 3A8IA 2W7VA 3GTPA 1R9TK 2B63K 1O2BA 1VLOA 1JVIA 3AD8C 3HXAA 3S16K 1R9TC 3FKIK 2B63C 4KASA 3HOXK 1F7UA 3S16C 4XSXA 1WQGA 3PO2K 4M1XA 3HOXC 1B4AA 3A8KA 4C45A 2PMZL 3PO2C 2D6FC 3GSIA 3WODA 4LLGA 4GZYA 3S1RK 5C4XC 3DLLS 3S1RC 2WAQD 2CFAA 2JA5A 2O5JA 4BBSK 2PMZD 4BBSC 3G4CA 4BKWA 3T00A 3N0CA 1YNJA 1DCOA 4GTFA 5IP9K 1HI9A 2R7ZA 4PABA 2E2HA 3NUHA 5IP9C 1K83A 3TFJA 3GTQA 1WCMA 4GTLA 2O5IA 1EFWA 4Q4ZA 3HOWK 3AQPA 3AD9C 4BLAA 4KM9A 3LAJA 3HOWC 1TWHK 3GTMK 2NVYC 1TWHC 3GTMC 4O2DA 3GTPK 1ZQ1C 1WQFA 5HL7S 3GTPC 3FKIA 1SMYA 4LK0A 2NVXA 3GDZA 1ZXOA 1XZQB 2A69A 4KMAA 1PJ6A 4IOCS 2PA8D 3L4KA 3JSTA 2GAHC 4GTDA 3ADAC 3A8JA 2P5MA 4KM8A 4KMHA 2A68A 2RGRA 2JA5K 1G51A 1EH1A 1WIHA 4A3JK 2VUMA 5CJ9A 1VRQC 2JA5C 2R93A 4KN4A 1ZBSA 4A3JC 1IQ0A 3S15K 5C4JC 3GTKK 2R7ZK 5CHPA 4KB4A 3AQOA 3S15C 2E2HK 1ZVUA 3GTJA 1YX2A 1I6HK 1K83K 2R7ZC 3GTQK 1WCMK 2E2HC 1IW7A 1WSRA 1I6HC 1K83C 2ZUEA 3GTQC 4WFAS 1WCMC 2ZUFA 4KB2A 1I6VA 4P5AA 3H3VL 3GTLA 3PO3K 1IL2A 4BXXK 3BP3A 1USOA 1INNA 3PO3C 3CQZA 4BXXC 4X6AK 5IYBK 3VA7A 3HOVK 4ZH4A 5TJ3A 4XCHA 1XXCA 2GSUA 3CAGA 3G4AA 1XXAA 1KQ4A 3HOVC 2NVXK 3H3VD 2WAQL 3FKIC 1EK8A 1BJTA 4KC6A 3FHZA 2NVXC 1O2FB 2KXYA 3V4GA 2GSNA 3GTGA 4A3CK 1TWGA 5IORA 4KATA 1USMA 4KMUA 4RMFA 5M3MK 1X31C 4A3CC 4A3MK 3I4MK 1B4BA 4A3MC 2E2JK 1FEUA 2VUMK 3I4MC 1XZQA 2R93K 2ZJPS 1IE0A 1O25A 2E2JC 4MEYA 2VUMC 1O27A 4LOWA 4IO9S 2R93C 3GTKA 4AYBL 4A3GK 4FZBA 3S14K 2GSOA 4GTAA 3GTJK 2JH3A 5HL8A 4MQ9A 2A6EA 5IOSA 5EGEA 3GTJC 1DCPA 3N3YA 4XSZA 3PIPS 3LYWA 3L4JA 1Y1WA 5C44K 4OIPA 4AYBD 2PPBA 3DXJA 1XXBA 1IS1A 4GTBA 5C44C 1XZPB 3HOUK 3GTLK 3M3YK 5M3FK 1YCLA 2R92A 3HOUC 2Y0SL 4WF9S 4A3FK 3GTLC 3CQZK 3EQLA 3M3YC 2PA8L 4A3BK 3AH5A 5IYCK 2CW0A 4A3FC 4Q5SA 3T02A 3CQZC 4MEXA 5IYCC 4AH6A 2ZFZA 3FOFA 1HQMA
chains in the Genus database with same CATH topology
3M4OK 4QJVA 3S16K 3S1MK 2Y0SD 4KN7A 3S15C 1R9TC 3FKIK 4LJZA 2B63C 4C3HC 2E2HK 2NVQK 2JA7C 1K83K 2E2IK 2R7ZC 3M4OC 5FJ8K 3HOXK 3S16C 3S1MC 4A3IK 3GTGK 3GTQK 4XSXA 1TWGK 2E2HC 1WCMK 4C3IK 1IW7A 3PO2K 4Y52K 2NVQC 4G7ZA 1K83C 2E2IC 1I6HC 3HOXC 2JA8K 3HOZK 3GTGC 3GTQC 4A3IC 2PMZL 1WCMC 1TWGC 3PO2C 4C3IC 4Y52C 1ZYRA 4A93K 4NOIA 3HOZC 1I6VA 3WODA 4LLGA 4YFXA 2JA8C 4GZYA 3S1RK 5C4XC 3H3VL 3S1NK 3PO3K 3S1RC 4BXXK 4A3BC 2WAQD 2NVTK 4BY1K 3S1NC 3RZDK 3HOYK 2JA6K 4A3DK 4YFNA 5FLMK 3PO3C 4C3JK 4BXXC 5C3EK 4OIRA 2O5JA 5IYBK 4X6AK 4BBSK 5TMFA 2PMZD 2NVYK 2NVTC 3HOVK 4LK1A 3RZDC 4BY1C 3HOYC 4A3DC 4ZH4A 5FLMC 4OIQA 4C3JC 4Y7NK 3S17K 5C3EC 3GTKC 4BBSC 2NVXK 3HOVC 3S1QC 1YNJA 3H3VD 1I3QK 4Y7NC 3S17C 2WAQL 3FKIC 3H0GK 2BE5A 5IP9K 5M5XK 2NVXC 3S2HK 1I3QC 3H0GC 1Y1WK 4YG2A 4A3LK 1TWCK 5IYDK 5IP9C 4QJVB 3S2HC 4OIOA 1Y1WC 3GTOK 4XLNA 5M5YK 4A3CK 1I6HK 4A93C 4A3LC 1TWCC 5IYDC 3HKZL 5M5WK 4BY7K 2O5IA 4KMUA 5M3MK 4Q4ZA 3HOWK 4C2MK 5IP7K 4A3CC 4A3MK 2R92K 4BY7C 3I4MK 2WB1L 3HOWC 4C2MC 5IP7C 4A3MC 2R92C 4OINA 2E2JK 2JA6C 2VUMK 3I4MC 1TWHK 3GTMK 4X6AC 5IYBC 1BDFA 2R93K 2NVYC 3RZOK 2E2JC 4G7HA 4MEYA 2VUMC 3HKZD 1TWHC 3GTMC 3GTPK 4A3EK 2R93C 4AYBL 4A3GK 3RZOC 4JK1A 3K7AK 3S14K 3GTPC 3GTJK 2YU9K 1SMYA 4A3EC 1SFOK 5C4JK 2WB1D 4LK0A 4MQ9A 4G7OA 2A6EA 1YNNA 3K7AC 3GTJC 2YU9C 5D4DA 1SFOC 1XPPA 5TMCA 2A69A 4QIWL 4BBRK 1TWFK 4XSZA 3GTOC 2A6HA 4BBRC 4OIPA 5C44K 1TWFC 2PA8D 4AYBD 3GTKK 2PPBA 3DXJA 3HOUK 5C44C 3GTLK 3I4NK 3M3YK 5M3FK 4XLPA 3S2DK 4YFKA 4QIWD 3HOUC 1TWAK 2Y0SL 5C4XK 4A3FK 3S1QK 2A68A 3GTLC 3I4NC 3CQZK 2JA5K 3EQLA 3M3YC 2PA8L 4A3BK 3S2DC 1Y1VK 5IYCK 1TWAC 2CW0A 4A3FC 4A3JK 4Q5SA 3CQZC 2JA5C 1I50K 4A3KK 4A3GC 4KN4A 4MEXA 1Y1VC 5IYCC 3S14C 4A3JC 3S15K 1R9TK 1I50C 1HQMA 5C4JC 4A3KC 4C3HK 2B63K 2JA7K 2R7ZK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M4O K;  4QJV A;  3S16 K;  3S1M K;  2Y0S D;  4KN7 A;  3S15 C;  1R9T C;  3FKI K;  4LJZ A;  2B63 C;  4C3H C;  2E2H K;  2NVQ K;  2JA7 C;  1K83 K;  2E2I K;  2R7Z C;  3M4O C;  5FJ8 K;  3HOX K;  3S16 C;  3S1M C;  4A3I K;  3GTG K;  3GTQ K;  4XSX A;  1TWG K;  2E2H C;  1WCM K;  4C3I K;  1IW7 A;  3PO2 K;  4Y52 K;  2NVQ C;  4G7Z A;  1K83 C;  2E2I C;  1I6H C;  3HOX C;  2JA8 K;  3HOZ K;  3GTG C;  3GTQ C;  4A3I C;  2PMZ L;  1WCM C;  1TWG C;  3PO2 C;  4C3I C;  4Y52 C;  1ZYR A;  4A93 K;  4NOI A;  3HOZ C;  1I6V A;  3WOD A;  4LLG A;  4YFX A;  2JA8 C;  4GZY A;  3S1R K;  5C4X C;  3H3V L;  3S1N K;  3PO3 K;  3S1R C;  4BXX K;  4A3B C;  2WAQ D;  2NVT K;  4BY1 K;  3S1N C;  3RZD K;  3HOY K;  2JA6 K;  4A3D K;  4YFN A;  5FLM K;  3PO3 C;  4C3J K;  4BXX C;  5C3E K;  4OIR A;  2O5J A;  5IYB K;  4X6A K;  4BBS K;  5TMF A;  2PMZ D;  2NVY K;  2NVT C;  3HOV K;  4LK1 A;  3RZD C;  4BY1 C;  3HOY C;  4A3D C;  4ZH4 A;  5FLM C;  4OIQ A;  4C3J C;  4Y7N K;  3S17 K;  5C3E C;  3GTK C;  4BBS C;  2NVX K;  3HOV C;  3S1Q C;  1YNJ A;  3H3V D;  1I3Q K;  4Y7N C;  3S17 C;  2WAQ L;  3FKI C;  3H0G K;  2BE5 A;  5IP9 K;  5M5X K;  2NVX C;  3S2H K;  1I3Q C;  3H0G C;  1Y1W K;  4YG2 A;  4A3L K;  1TWC K;  5IYD K;  5IP9 C;  4QJV B;  3S2H C;  4OIO A;  1Y1W C;  3GTO K;  4XLN A;  5M5Y K;  4A3C K;  1I6H K;  4A93 C;  4A3L C;  1TWC C;  5IYD C;  3HKZ L;  5M5W K;  4BY7 K;  2O5I A;  4KMU A;  5M3M K;  4Q4Z A;  3HOW K;  4C2M K;  5IP7 K;  4A3C C;  4A3M K;  2R92 K;  4BY7 C;  3I4M K;  2WB1 L;  3HOW C;  4C2M C;  5IP7 C;  4A3M C;  2R92 C;  4OIN A;  2E2J K;  2JA6 C;  2VUM K;  3I4M C;  1TWH K;  3GTM K;  4X6A C;  5IYB C;  1BDF A;  2R93 K;  2NVY C;  3RZO K;  2E2J C;  4G7H A;  4MEY A;  2VUM C;  3HKZ D;  1TWH C;  3GTM C;  3GTP K;  4A3E K;  2R93 C;  4AYB L;  4A3G K;  3RZO C;  4JK1 A;  3K7A K;  3S14 K;  3GTP C;  3GTJ K;  2YU9 K;  1SMY A;  4A3E C;  1SFO K;  5C4J K;  2WB1 D;  4LK0 A;  4MQ9 A;  4G7O A;  2A6E A;  1YNN A;  3K7A C;  3GTJ C;  2YU9 C;  5D4D A;  1SFO C;  1XPP A;  5TMC A;  2A69 A;  4QIW L;  4BBR K;  1TWF K;  4XSZ A;  3GTO C;  2A6H A;  4BBR C;  4OIP A;  5C44 K;  1TWF C;  2PA8 D;  4AYB D;  3GTK K;  2PPB A;  3DXJ A;  3HOU K;  5C44 C;  3GTL K;  3I4N K;  3M3Y K;  5M3F K;  4XLP A;  3S2D K;  4YFK A;  4QIW D;  3HOU C;  1TWA K;  2Y0S L;  5C4X K;  4A3F K;  3S1Q K;  2A68 A;  3GTL C;  3I4N C;  3CQZ K;  2JA5 K;  3EQL A;  3M3Y C;  2PA8 L;  4A3B K;  3S2D C;  1Y1V K;  5IYC K;  1TWA C;  2CW0 A;  4A3F C;  4A3J K;  4Q5S A;  3CQZ C;  2JA5 C;  1I50 K;  4A3K K;  4A3G C;  4KN4 A;  4MEX A;  1Y1V C;  5IYC C;  3S14 C;  4A3J C;  3S15 K;  1R9T K;  1I50 C;  1HQM A;  5C4J C;  4A3K C;  4C3H K;  2B63 K;  2JA7 K;  2R7Z K; 
#chains in the Genus database with same CATH topology
 3M4O K;  4QJV A;  2FQO A;  2Y0S D;  3M4O C;  3GTG K;  4A3I K;  1TWG K;  4C3I K;  1WOS A;  4Y52 K;  2JA8 K;  1C0A A;  3GTG C;  4A3I C;  1O26 A;  1TWG C;  4C3I C;  4Y52 C;  4A93 K;  1J6V A;  2RH6 A;  2JA8 C;  3TFI A;  1J6W A;  4G0U A;  3S1N K;  5E68 A;  1IBA A;  4BY1 K;  3S1N C;  1EQR A;  2JA6 K;  5JVO A;  4C3J K;  5C3E K;  4OIR A;  1Y1V A;  3PIO S;  3S1Q K;  4BY1 C;  4Y7N K;  4C3J C;  1JOE A;  5C3E C;  1I50 A;  3GTK C;  3S1Q C;  4Y7N C;  1UV7 A;  4P9S A;  2KPU A;  2JA7 A;  3Q3Q A;  5IOQ A;  1Y1W K;  4YG2 A;  4PAA A;  2XCQ A;  2E2I A;  4QJV B;  4OIO A;  1Y1W C;  3GTO K;  4XLN A;  5M5Y K;  4BY7 K;  1F9N A;  5IP7 K;  2R92 K;  5JVH S;  4BY7 C;  2V6S A;  2WB1 L;  5IP7 C;  2R92 C;  4OIN A;  4X6A C;  5IYB C;  1BDF A;  1PJ7 A;  2KWA A;  4LQY A;  3LAP A;  1DD5 A;  4A3E K;  2ZJQ S;  1O29 A;  4U67 S;  3AD7 C;  4A3E C;  1WOR A;  2WB1 D;  1XZP A;  2XCR B;  4G7O A;  4ILD A;  1YNN A;  3H0G A;  4WCE S;  5DM7 S;  1I3Q A;  4WFB S;  1XPP A;  4QIW L;  4GTE A;  5TMC A;  4BBR K;  4WIL A;  4KAR A;  3FOE A;  5EGH A;  3SZY A;  4BBR C;  1TWC A;  2Y3P A;  1WOP A;  5DM6 S;  3T01 A;  1O2A A;  4YFK A;  4QIW D;  5C4X K;  1L0W A;  2JA6 A;  3OPF A;  2EBB A;  1Y1V K;  3ERE D;  1I50 K;  4A3K K;  4A3G C;  1ISE A;  2V6U A;  1Y1V C;  2PHC B;  2XCO A;  3S14 C;  1V5V A;  3N0B A;  4P5B A;  1I50 C;  4A3K C;  1F93 A;  1BGW A;  4C3H K;  2JA7 K;  3S1M K;  4KN7 A;  2YU9 A;  4LJZ A;  1SFO A;  4C3H C;  4WFN S;  2NVQ K;  2JA7 C;  1F7V A;  2E2I K;  4FM9 A;  5FJ8 K;  3S1M C;  3GTO A;  2NVQ C;  1TWF A;  4G7Z A;  2E2I C;  3HOZ K;  4KMD A;  1JQW A;  1ZYR A;  4LR2 A;  4NOI A;  3HOZ C;  3MML B;  4YFX A;  1O28 A;  1O24 A;  4A3B C;  3S0X A;  2NVT K;  4A3D K;  3RZD K;  1TWA A;  3OEP A;  3HOY K;  4YFN A;  5FLM K;  4WJ3 M;  5TMF A;  2NVY K;  2NVT C;  4LK1 A;  3RZD C;  3HOY C;  4A3D C;  1DCH A;  4OIQ A;  5FLM C;  1PJ5 A;  3S17 K;  5HQH A;  4KAW X;  1GE9 A;  1J6X A;  1I3Q K;  3H0G K;  3S17 C;  4J3N A;  1R9T A;  2B63 A;  2BE5 A;  5M5X K;  3IPJ A;  3S2H K;  1VGX A;  1I3Q C;  3H0G C;  3GEI A;  2CFA B;  4WJ4 A;  4A3L K;  1TWC K;  5IYD K;  3S2H C;  5IOT A;  3TFH A;  3BP8 C;  4A93 C;  4A3L C;  1TWC C;  5IYD C;  1WOO A;  3HKZ L;  5M5W K;  2FQT A;  2L3U A;  4C2M K;  1RU0 A;  4BLB A;  3GIR A;  3ORE A;  4C2M C;  1WQH A;  3SZZ A;  2JA6 C;  2ZJR S;  3RZO K;  4G7H A;  3HKZ D;  3GEH A;  1WSV A;  4DDQ A;  1BS2 A;  3RZO C;  4JK1 A;  2GAG C;  3K7A K;  2KQ1 A;  2YU9 K;  2P8T A;  1SFO K;  5JFE A;  5C4J K;  3TTG A;  3BUE A;  4GTC A;  4IOA S;  3GEE A;  4GFQ A;  3K7A C;  2YU9 C;  5D4D A;  1SFO C;  2V6T A;  3CF5 S;  1TWF K;  3GTO C;  4G0V A;  2A6H A;  1TWF C;  5JVG S;  3LPX A;  4GT9 A;  1VH2 A;  3QX3 A;  3I4N K;  4XLP A;  3S2D K;  1TWA K;  3I4N C;  5L46 A;  4G0W A;  1AB4 A;  2L5N A;  3S2D C;  2NVY A;  1EI6 A;  4KDD A;  1TWA C;  1VJE A;  1TWH A;  3GTM A;  1J98 A;  3A8I A;  2W7V A;  3GTP A;  1R9T K;  2B63 K;  1O2B A;  1VLO A;  1JVI A;  3AD8 C;  3HXA A;  3S16 K;  1R9T C;  3FKI K;  2B63 C;  4KAS A;  3HOX K;  1F7U A;  3S16 C;  4XSX A;  1WQG A;  3PO2 K;  4M1X A;  3HOX C;  1B4A A;  3A8K A;  4C45 A;  2PMZ L;  3PO2 C;  2D6F C;  3GSI A;  3WOD A;  4LLG A;  4GZY A;  3S1R K;  5C4X C;  3DLL S;  3S1R C;  2WAQ D;  2CFA A;  2JA5 A;  2O5J A;  4BBS K;  2PMZ D;  4BBS C;  3G4C A;  4BKW A;  3T00 A;  3N0C A;  1YNJ A;  1DCO A;  4GTF A;  5IP9 K;  1HI9 A;  2R7Z A;  4PAB A;  2E2H A;  3NUH A;  5IP9 C;  1K83 A;  3TFJ A;  3GTQ A;  1WCM A;  4GTL A;  2O5I A;  1EFW A;  4Q4Z A;  3HOW K;  3AQP A;  3AD9 C;  4BLA A;  4KM9 A;  3LAJ A;  3HOW C;  1TWH K;  3GTM K;  2NVY C;  1TWH C;  3GTM C;  4O2D A;  3GTP K;  1ZQ1 C;  1WQF A;  5HL7 S;  3GTP C;  3FKI A;  1SMY A;  4LK0 A;  2NVX A;  3GDZ A;  1ZXO A;  1XZQ B;  2A69 A;  4KMA A;  1PJ6 A;  4IOC S;  2PA8 D;  3L4K A;  3JST A;  2GAH C;  4GTD A;  3ADA C;  3A8J A;  2P5M A;  4KM8 A;  4KMH A;  2A68 A;  2RGR A;  2JA5 K;  1G51 A;  1EH1 A;  1WIH A;  4A3J K;  2VUM A;  5CJ9 A;  1VRQ C;  2JA5 C;  2R93 A;  4KN4 A;  1ZBS A;  4A3J C;  1IQ0 A;  3S15 K;  5C4J C;  3GTK K;  2R7Z K;  5CHP A;  4KB4 A;  3AQO A;  3S15 C;  2E2H K;  1ZVU A;  3GTJ A;  1YX2 A;  1I6H K;  1K83 K;  2R7Z C;  3GTQ K;  1WCM K;  2E2H C;  1IW7 A;  1WSR A;  1I6H C;  1K83 C;  2ZUE A;  3GTQ C;  4WFA S;  1WCM C;  2ZUF A;  4KB2 A;  1I6V A;  4P5A A;  3H3V L;  3GTL A;  3PO3 K;  1IL2 A;  4BXX K;  3BP3 A;  1USO A;  1INN A;  3PO3 C;  3CQZ A;  4BXX C;  4X6A K;  5IYB K;  3VA7 A;  3HOV K;  4ZH4 A;  5TJ3 A;  4XCH A;  1XXC A;  2GSU A;  3CAG A;  3G4A A;  1XXA A;  1KQ4 A;  3HOV C;  2NVX K;  3H3V D;  2WAQ L;  3FKI C;  1EK8 A;  1BJT A;  4KC6 A;  3FHZ A;  2NVX C;  1O2F B;  2KXY A;  3V4G A;  2GSN A;  3GTG A;  4A3C K;  1TWG A;  5IOR A;  4KAT A;  1USM A;  4KMU A;  4RMF A;  5M3M K;  1X31 C;  4A3C C;  4A3M K;  3I4M K;  1B4B A;  4A3M C;  2E2J K;  1FEU A;  2VUM K;  3I4M C;  1XZQ A;  2R93 K;  2ZJP S;  1IE0 A;  1O25 A;  2E2J C;  4MEY A;  2VUM C;  1O27 A;  4LOW A;  4IO9 S;  2R93 C;  3GTK A;  4AYB L;  4A3G K;  4FZB A;  3S14 K;  2GSO A;  4GTA A;  3GTJ K;  2JH3 A;  5HL8 A;  4MQ9 A;  2A6E A;  5IOS A;  5EGE A;  3GTJ C;  1DCP A;  3N3Y A;  4XSZ A;  3PIP S;  3LYW A;  3L4J A;  1Y1W A;  5C44 K;  4OIP A;  4AYB D;  2PPB A;  3DXJ A;  1XXB A;  1IS1 A;  4GTB A;  5C44 C;  1XZP B;  3HOU K;  3GTL K;  3M3Y K;  5M3F K;  1YCL A;  2R92 A;  3HOU C;  2Y0S L;  4WF9 S;  4A3F K;  3GTL C;  3CQZ K;  3EQL A;  3M3Y C;  2PA8 L;  4A3B K;  3AH5 A;  5IYC K;  2CW0 A;  4A3F C;  4Q5S A;  3T02 A;  3CQZ C;  4MEX A;  5IYC C;  4AH6 A;  2ZFZ A;  3FOF A;  1HQM A; 
#chains in the Genus database with same CATH homology
 3M4O K;  4QJV A;  3S16 K;  3S1M K;  2Y0S D;  4KN7 A;  3S15 C;  1R9T C;  3FKI K;  4LJZ A;  2B63 C;  4C3H C;  2E2H K;  2NVQ K;  2JA7 C;  1K83 K;  2E2I K;  2R7Z C;  3M4O C;  5FJ8 K;  3HOX K;  3S16 C;  3S1M C;  4A3I K;  3GTG K;  3GTQ K;  4XSX A;  1TWG K;  2E2H C;  1WCM K;  4C3I K;  1IW7 A;  3PO2 K;  4Y52 K;  2NVQ C;  4G7Z A;  1K83 C;  2E2I C;  1I6H C;  3HOX C;  2JA8 K;  3HOZ K;  3GTG C;  3GTQ C;  4A3I C;  2PMZ L;  1WCM C;  1TWG C;  3PO2 C;  4C3I C;  4Y52 C;  1ZYR A;  4A93 K;  4NOI A;  3HOZ C;  1I6V A;  3WOD A;  4LLG A;  4YFX A;  2JA8 C;  4GZY A;  3S1R K;  5C4X C;  3H3V L;  3S1N K;  3PO3 K;  3S1R C;  4BXX K;  4A3B C;  2WAQ D;  2NVT K;  4BY1 K;  3S1N C;  3RZD K;  3HOY K;  2JA6 K;  4A3D K;  4YFN A;  5FLM K;  3PO3 C;  4C3J K;  4BXX C;  5C3E K;  4OIR A;  2O5J A;  5IYB K;  4X6A K;  4BBS K;  5TMF A;  2PMZ D;  2NVY K;  2NVT C;  3HOV K;  4LK1 A;  3RZD C;  4BY1 C;  3HOY C;  4A3D C;  4ZH4 A;  5FLM C;  4OIQ A;  4C3J C;  4Y7N K;  3S17 K;  5C3E C;  3GTK C;  4BBS C;  2NVX K;  3HOV C;  3S1Q C;  1YNJ A;  3H3V D;  1I3Q K;  4Y7N C;  3S17 C;  2WAQ L;  3FKI C;  3H0G K;  2BE5 A;  5IP9 K;  5M5X K;  2NVX C;  3S2H K;  1I3Q C;  3H0G C;  1Y1W K;  4YG2 A;  4A3L K;  1TWC K;  5IYD K;  5IP9 C;  4QJV B;  3S2H C;  4OIO A;  1Y1W C;  3GTO K;  4XLN A;  5M5Y K;  4A3C K;  1I6H K;  4A93 C;  4A3L C;  1TWC C;  5IYD C;  3HKZ L;  5M5W K;  4BY7 K;  2O5I A;  4KMU A;  5M3M K;  4Q4Z A;  3HOW K;  4C2M K;  5IP7 K;  4A3C C;  4A3M K;  2R92 K;  4BY7 C;  3I4M K;  2WB1 L;  3HOW C;  4C2M C;  5IP7 C;  4A3M C;  2R92 C;  4OIN A;  2E2J K;  2JA6 C;  2VUM K;  3I4M C;  1TWH K;  3GTM K;  4X6A C;  5IYB C;  1BDF A;  2R93 K;  2NVY C;  3RZO K;  2E2J C;  4G7H A;  4MEY A;  2VUM C;  3HKZ D;  1TWH C;  3GTM C;  3GTP K;  4A3E K;  2R93 C;  4AYB L;  4A3G K;  3RZO C;  4JK1 A;  3K7A K;  3S14 K;  3GTP C;  3GTJ K;  2YU9 K;  1SMY A;  4A3E C;  1SFO K;  5C4J K;  2WB1 D;  4LK0 A;  4MQ9 A;  4G7O A;  2A6E A;  1YNN A;  3K7A C;  3GTJ C;  2YU9 C;  5D4D A;  1SFO C;  1XPP A;  5TMC A;  2A69 A;  4QIW L;  4BBR K;  1TWF K;  4XSZ A;  3GTO C;  2A6H A;  4BBR C;  4OIP A;  5C44 K;  1TWF C;  2PA8 D;  4AYB D;  3GTK K;  2PPB A;  3DXJ A;  3HOU K;  5C44 C;  3GTL K;  3I4N K;  3M3Y K;  5M3F K;  4XLP A;  3S2D K;  4YFK A;  4QIW D;  3HOU C;  1TWA K;  2Y0S L;  5C4X K;  4A3F K;  3S1Q K;  2A68 A;  3GTL C;  3I4N C;  3CQZ K;  2JA5 K;  3EQL A;  3M3Y C;  2PA8 L;  4A3B K;  3S2D C;  1Y1V K;  5IYC K;  1TWA C;  2CW0 A;  4A3F C;  4A3J K;  4Q5S A;  3CQZ C;  2JA5 C;  1I50 K;  4A3K K;  4A3G C;  4KN4 A;  4MEX A;  1Y1V C;  5IYC C;  3S14 C;  4A3J C;  3S15 K;  1R9T K;  1I50 C;  1HQM A;  5C4J C;  4A3K C;  4C3H K;  2B63 K;  2JA7 K;  2R7Z K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...