2A6EA

Crystal structure of the t. thermophilus rna polymerase holoenzyme
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
229
structure length
229
Chain Sequence
MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase alpha chain
publication title Allosteric modulation of the RNA polymerase catalytic reaction is an essential component of transcription control by rifamycins.
pubmed doi rcsb
molecule tags Transferase
total genus 40
structure length 229
sequence length 229
chains with identical sequence B, K, L
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2005-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01000 RNA_pol_A_bac RNA polymerase Rpb3/RpoA insert domain
A PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain
A PF03118 RNA_pol_A_CTD Bacterial RNA polymerase, alpha chain C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.12 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 DNA-directed RNA polymerase, insert domain 2a6eA02
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 2a6eA01
2NVTK 1WCMC 5IP9C 2R7ZC 3GTLK 2R93K 3GTMC 4A3DK 4QIWD 5IP7K 4OIPA 4AYBL 1K83K 3RZOC 4JK1A 2NVTC 4Q4ZA 4XLNA 3GTLC 2R93C 3I4NK 4C3HK 5IP7C 3HOXC 4MEYA 1K83C 4XSXA 4BXXK 4LK0A 3GTOC 2E2HK 1I50K 1SFOC 2R92C 3WODA 2NVXK 3I4NC 4C3HC 5C3EK 3S2HK 3PO3K 4G7HA 4BXXC 1XPPA 3H3VL 2VUMK 5C4XK 2E2HC 1I50C 2NVXC 4BBRK 3GTQK 4XLPA 1Y1WK 5C3EC 3PO3C 3S2HC 5FLMK 3S1QK 4MEXA 2PMZD 3I4MC 5C4XC 2WAQL 2A6EA 4BBRC 2E2JC 4OIQA 2PA8L 3GTQC 2A68A 5IYBK 5C44K 5FLMC 5TMFA 5M3FK 4A3FK 4X6AK 3S1QC 4Q5SA 4A93K 4A3BK 5IYBC 4A3BC 3M3YK 4X6AC 1I6VA 5C44C 4A3FC 5C4JK 1TWGK 4A3DC 3K7AK 3H0GK 4A93C 2JA6K 2A69A 4A3MK 3M3YC 4G7OA 5C4JC 3HOUK 4BY7K 5IYCK 4A3GK 3HKZD 1TWGC 1IW7A 4LJZA 1TWHK 1TWAK 1TWFK 4C3IK 2PPBA 3S15K 4A3MC 4YG2A 4A3JK 4BBSK 4G7ZA 2A6HA 3HOUC 5IYCC 4A3GC 4A3IK 4A3KK 3GTKK 3S17K 1TWHC 1TWFC 4C3IC 4OINA 2WB1D 4NOIA 2NVYK 3S15C 4QIWL 4A3EK 3GTGK 4A3JC 4BBSC 5TMCA 2O5IA 4A3IC 2VUMC 3GTKC 3S17C 3EQLA 3GTJK 2NVYC 2CW0A 3S16K 3GTGC 1Y1WC 1I6HK 5FJ8K 2Y0SD 3HOZK 5M3MK 3GTJC 3S1RK 4C3JK 4YFKA 5IYDK 3M4OK 1R9TK 2JA5K 2JA7K 3HOZC 3S1RC 4OIRA 5IYDC 3M4OC 1I3QK 4BY1K 3HOWK 3S14K 3DXJA 2JA5C 2JA7C 3K7AC 1HQMA 4ZH4A 3H0GC 2PMZL 2JA6C 2E2IK 4Y52K 2O5JA 1BDFA 4BY7C 3GTMK 4A3LK 5M5WK 1I3QC 4BY1C 1TWAC 3HOWC 3HOYK 4KMUA 4Y52C 2E2IC 3H3VD 3FKIK 4LK1A 3HOVK 3S2DK 3CQZK 4A3KC 4A3LC 4C2MK 2YU9K 2BE5A 1TWCK 3HOXK 3HOYC 4A3EC 1ZYRA 3FKIC 2WAQD 5M5YK 3GTOK 3HOVC 3S2DC 1Y1VK 4Y7NK 1SFOK 3CQZC 5D4DA 2PA8D 4LLGA 1YNJA 4C2MC 2YU9C 2R92K 1TWCC 3HKZL 3RZDK 1I6HC 3S1NK 3S1MK 1Y1VC 4Y7NC 3S16C 4AYBD 2B63K 1YNNA 3RZDC 4A3CK 4KN7A 4C3JC 2WB1L 2NVQK 4QJVB 3I4MK 3S1NC 3PO2K 3S1MC 3GTPK 2JA8K 4YFNA 1R9TC 2B63C 1SMYA 2E2JK 4MQ9A 4YFXA 1WCMK 4A3CC 2NVQC 4KN4A 5IP9K 2R7ZK 3PO2C 5M5XK 4GZYA 3GTPC 4OIOA 2JA8C 3S14C 2Y0SL 4XSZA 3RZOK 4QJVA
chains in the Genus database with same CATH superfamily
3JSTA 1VH2A 3GEHA 5IP9C 2NVTK 3V4GA 5IP7K 4OIPA 3RZOC 1USMA 4JK1A 3GTLC 4WJ3M 5TJ3A 3GTJA 3I4NK 3HOXC 2FQOA 4LK0A 3G4CA 2E2HK 5EGHA 1SFOC 2R92C 4BLBA 3WODA 3PO3K 4G7HA 4LQYA 1JOEA 4WJ4A 1I50C 1F7UA 5FLMK 3S1QK 1C0AA 5IOSA 1IQ0A 2PA8L 1DCPA 2CFAB 4A3FK 5HL7S 4Q5SA 1PJ6A 1YCLA 3FKIA 4A93K 3L4KA 4X6AC 5C44C 5C4JK 2YU9A 1O29A 1G51A 2JA6K 4G7OA 3N0CA 1TWFK 4IO9S 2GSNA 4YG2A 4BBSK 4G7ZA 3HOUC 4A3KK 1TWHC 2NVYK 4GTLA 2WB1D 3GDZA 4QIWL 1EFWA 4A3JC 3GTPA 5TMCA 2O5IA 1FEUA 1F7VA 2Y3PA 1DCOA 1WCMA 2JH3A 3OREA 5M3MK 4C3JK 3FHZA 1XXAA 5L46A 1O24A 4FZBA 1O25A 5IOTA 4OIRA 2V6TA 1INNA 3M4OC 3LAPA 4WCES 3S14K 3DXJA 2JA5C 2JA7C 3H0GC 2E2IK 4P9SA 2E2HA 5M5WK 3HOWC 4BY1C 1WQHA 3H3VD 1YX2A 3HOXK 3HOYC 3GSIA 2ZUEA 2WAQD 1Y1VK 1SFOK 2R92K 3CQZC 3HKZL 2EBBA 3RZDK 5JFEA 4KM8A 1I6HC 3LAJA 2ZUFA 4AYBD 3ERED 1YNNA 4P5AA 2GAHC 3S1NC 4RMFA 2B63C 1SMYA 4MQ9A 4A3CC 2NVQC 2R7ZK 1TWFA 3PO2C 4GZYA 4OIOA 2Y0SL 4XSZA 2VUMA 2FQTA 4KASA 2NVYA 2GSUA 4IOCS 4AYBL 4KATA 4KM9A 1WQGA 2R93C 4GTAA 4C3HK 1X31C 3N0BA 1O28A 1PJ5A 4MEYA 1K83C 4XSXA 2NVXK 5JVGS 1O2AA 5C3EK 4BXXC 5C4XK 2GAGC 3GTQK 4XLPA 3S2HC 2ZJQS 3I4MC 1WOSA 2E2IA 1DD5A 4BBRC 4OIQA 3VA7A 5IYBK 4A3BK 2A68A 4LR2A 5TMFA 1HI9A 3LPXA 3AD8C 3M3YK 1I6VA 3HXAA 4ILDA 1TWGK 4A3DC 1B4AA 3H0GK 3QX3A 4A3MK 1Y1VA 1SFOA 3AQPA 2R92A 1WOPA 4A3GK 2KWAA 1IW7A 3PIOS 1XXCA 4XCHA 4C3IK 3S15K 4O2DA 2A6HA 1XZQA 5IYCC 3GTKK 4OINA 3GTGK 2L3UA 3GEIA 5HQHA 3NUHA 4GFQA 4A3IC 3S17C 3EQLA 2R7ZA 1I6HK 5FJ8K 3HOZK 1RU0A 3GTJC 1JVIA 3S1RK 5IYDK 3A8IA 4WFBS 3BUEA 4KC6A 4KAWX 1I3QK 3K7AC 1XZPB 4Y52K 2O5JA 4AH6A 2NVXA 4A3LK 3AD9C 3TFHA 2ZJPS 1J6WA 3HOVK 3GTQA 5IORA 1TWCK 1ZYRA 1IS1A 4IOAS 3FKIC 3S2DC 2YU9C 4C2MC 1YNJA 3CF5S 4Y7NC 3S16C 3SZYA 1TWGA 2WB1L 1L0WA 4QJVB 3TFJA 3I4MK 3S1MC 1ZVUA 2RH6A 3H0GA 1R9TC 5JVHS 1PJ7A 5IP9K 1V5VA 1IE0A 3GTPC 2JA8C 2GSOA 1F93A 3RZOK 3GTKA 1WCMC 4U67S 3GTLK 1BJTA 3GTMC 3GEEA 4WF9S 4A3DK 3GTGA 1JQWA 1WOOA 2NVTC 4J3NA 1O27A 5IP7C 3GTOC 4G0VA 1I50K 4WFAS 3I4NC 1J6XA 1BS2A 1WSVA 3H3VL 4KARA 2E2HC 2JA6A 3N3YA 4WFNS 3PO3C 2KXYA 1I3QA 4MEXA 2PMZD 1EK8A 2WAQL 2E2JC 4X6AK 5M3FK 5C44K 5FLMC 3S1QC 2P5MA 1XXBA 2KQ1A 4A3FC 1WSRA 3FOEA 1TWCA 3K7AK 4A93C 2A69A 2CFAA 5C4JC 3HOUK 4FM9A 4M1XA 4GTBA 1TWHK 4LOWA 4GTCA 3L4JA 4A3JK 1EH1A 4KMHA 1EI6A 1TWFC 2D6FC 3AQOA 1VGXA 4BBSC 2VUMC 3T01A 3FOFA 2NVYC 4KMDA 1Y1WC 3S0XA 1ZXOA 3BP8C 3A8JA 2RGRA 3GTLA 3OEPA 1IL2A 3M4OK 5CJ9A 1R9TK 2JA5K 2JA7K 2W7VA 4G0UA 4C45A 3TTGA 4BY1K 3HOWK 4ZH4A 3AH5A 1I50A 4BY7C 3GTMK 4G0WA 1TWAC 3TFIA 3HOYK 2E2IC 4GTEA 3CQZK 5DM6S 4GTDA 4A3EC 2V6UA 5IOQA 3GTOK 1GE9A 2PA8D 4LLGA 5CHPA 3S1NK 1Y1VC 2B63K 2PHCB 3RZDC 1UV7A 4A3CK 2NVQK 1EQRA 3PO2K 2E2JK 1TWHA 5M5XK 1VRQC 2R7ZC 2R93K 2XCQA 4QIWD 4GT9A 4GTFA 1K83K 4Q4ZA 4XLNA 3MMLB 4BXXK 4PABA 1BGWA 5HL8A 4C3HC 3S2HK 3AD7C 3PIPS 2ZFZA 3GIRA 3IPJA 1XPPA 2XCRB 1R9TA 2JA5A 2JA7A 2VUMK 1J98A 5JVOA 2NVXC 4BBRK 1Y1WK 5C3EC 1O2BA 5C4XC 5DM7S 2A6EA 3GTQC 3GTMA 1AB4A 1DCHA 3DLLS 3LYWA 5IYBC 4A3BC 1IBAA 3CQZA 1XZQB 4KB4A 4BLAA 3GTOA 3M3YC 4BY7K 2V6SA 5IYCK 3HKZD 1TWGC 1TWAK 4LJZA 5E68A 2PPBA 4A3MC 1ZBSA 2B63A 4A3IK 4A3GC 3S17K 4C3IC 4A3EK 4PAAA 4NOIA 3S15C 2P8TA 3Q3QA 4P5BA 3GTKC 3GTJK 2CW0A 3GTGC 4KDDA 4DDQA 3T02A 1O2FB 1ZQ1C 2Y0SD 4KMAA 2KPUA 2R93A 4YFKA 4BKWA 3G4AA 1K83A 3HOZC 1ISEA 1O26A 3S1RC 4WILA 5IYDC 3A8KA 3BP3A 2PMZL 1HQMA 2JA6C 1BDFA 1F9NA 1I3QC 2XCOA 1KQ4A 4KB2A 5EGEA 4KMUA 4Y52C 3FKIK 1WQFA 4LK1A 1USOA 3SZZA 3T00A 3S2DK 4A3KC 4A3LC 4C2MK 1VLOA 1XZPA 2BE5A 2YU9K 1Y1WA 1VJEA 5M5YK 3HOVC 1WORA 3OPFA 4Y7NK 3S16K 5D4DA 1B4BA 1TWCC 1WIHA 3S1MK 4KN7A 4C3JC 2ZJRS 3GTPK 2JA8K 3ADAC 4YFNA 4YFXA 1WCMK 4KN4A 1TWAA 3CAGA 1J6VA 3S14C 2L5NA 4QJVA
chains in the Genus database with same CATH topology
2NVTK 1WCMC 5IP9C 2R7ZC 3GTLK 2R93K 3GTMC 4A3DK 4QIWD 5IP7K 4OIPA 4AYBL 1K83K 3RZOC 4JK1A 2NVTC 4Q4ZA 4XLNA 3GTLC 2R93C 3I4NK 4C3HK 5IP7C 3HOXC 4MEYA 1K83C 4XSXA 4BXXK 4LK0A 3GTOC 2E2HK 1I50K 1SFOC 2R92C 3WODA 2NVXK 3I4NC 4C3HC 5C3EK 3S2HK 3PO3K 4G7HA 4BXXC 1XPPA 3H3VL 2VUMK 5C4XK 2E2HC 1I50C 2NVXC 4BBRK 3GTQK 4XLPA 1Y1WK 5C3EC 3PO3C 3S2HC 5FLMK 3S1QK 4MEXA 2PMZD 3I4MC 5C4XC 2WAQL 2A6EA 4BBRC 2E2JC 4OIQA 2PA8L 3GTQC 2A68A 5IYBK 5C44K 5FLMC 5TMFA 5M3FK 4A3FK 4X6AK 3S1QC 4Q5SA 4A93K 4A3BK 5IYBC 4A3BC 3M3YK 4X6AC 1I6VA 5C44C 4A3FC 5C4JK 1TWGK 4A3DC 3K7AK 3H0GK 4A93C 2JA6K 2A69A 4A3MK 3M3YC 4G7OA 5C4JC 3HOUK 4BY7K 5IYCK 4A3GK 3HKZD 1TWGC 1IW7A 4LJZA 1TWHK 1TWAK 1TWFK 4C3IK 2PPBA 3S15K 4A3MC 4YG2A 4A3JK 4BBSK 4G7ZA 2A6HA 3HOUC 5IYCC 4A3GC 4A3IK 4A3KK 3GTKK 3S17K 1TWHC 1TWFC 4C3IC 4OINA 2WB1D 4NOIA 2NVYK 3S15C 4QIWL 4A3EK 3GTGK 4A3JC 4BBSC 5TMCA 2O5IA 4A3IC 2VUMC 3GTKC 3S17C 3EQLA 3GTJK 2NVYC 2CW0A 3S16K 3GTGC 1Y1WC 1I6HK 5FJ8K 2Y0SD 3HOZK 5M3MK 3GTJC 3S1RK 4C3JK 4YFKA 5IYDK 3M4OK 1R9TK 2JA5K 2JA7K 3HOZC 3S1RC 4OIRA 5IYDC 3M4OC 1I3QK 4BY1K 3HOWK 3S14K 3DXJA 2JA5C 2JA7C 3K7AC 1HQMA 4ZH4A 3H0GC 2PMZL 2JA6C 2E2IK 4Y52K 2O5JA 1BDFA 4BY7C 3GTMK 4A3LK 5M5WK 1I3QC 4BY1C 1TWAC 3HOWC 3HOYK 4KMUA 4Y52C 2E2IC 3H3VD 3FKIK 4LK1A 3HOVK 3S2DK 3CQZK 4A3KC 4A3LC 4C2MK 2YU9K 2BE5A 1TWCK 3HOXK 3HOYC 4A3EC 1ZYRA 3FKIC 2WAQD 5M5YK 3GTOK 3HOVC 3S2DC 1Y1VK 4Y7NK 1SFOK 3CQZC 5D4DA 2PA8D 4LLGA 1YNJA 4C2MC 2YU9C 2R92K 1TWCC 3HKZL 3RZDK 1I6HC 3S1NK 3S1MK 1Y1VC 4Y7NC 3S16C 4AYBD 2B63K 1YNNA 3RZDC 4A3CK 4KN7A 4C3JC 2WB1L 2NVQK 4QJVB 3I4MK 3S1NC 3PO2K 3S1MC 3GTPK 2JA8K 4YFNA 1R9TC 2B63C 1SMYA 2E2JK 4MQ9A 4YFXA 1WCMK 4A3CC 2NVQC 4KN4A 5IP9K 2R7ZK 3PO2C 5M5XK 4GZYA 3GTPC 4OIOA 2JA8C 3S14C 2Y0SL 4XSZA 3RZOK 4QJVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NVT K;  1WCM C;  5IP9 C;  2R7Z C;  3GTL K;  2R93 K;  3GTM C;  4A3D K;  4QIW D;  5IP7 K;  4OIP A;  4AYB L;  1K83 K;  3RZO C;  4JK1 A;  2NVT C;  4Q4Z A;  4XLN A;  3GTL C;  2R93 C;  3I4N K;  4C3H K;  5IP7 C;  3HOX C;  4MEY A;  1K83 C;  4XSX A;  4BXX K;  4LK0 A;  3GTO C;  2E2H K;  1I50 K;  1SFO C;  2R92 C;  3WOD A;  2NVX K;  3I4N C;  4C3H C;  5C3E K;  3S2H K;  3PO3 K;  4G7H A;  4BXX C;  1XPP A;  3H3V L;  2VUM K;  5C4X K;  2E2H C;  1I50 C;  2NVX C;  4BBR K;  3GTQ K;  4XLP A;  1Y1W K;  5C3E C;  3PO3 C;  3S2H C;  5FLM K;  3S1Q K;  4MEX A;  2PMZ D;  3I4M C;  5C4X C;  2WAQ L;  2A6E A;  4BBR C;  2E2J C;  4OIQ A;  2PA8 L;  3GTQ C;  2A68 A;  5IYB K;  5C44 K;  5FLM C;  5TMF A;  5M3F K;  4A3F K;  4X6A K;  3S1Q C;  4Q5S A;  4A93 K;  4A3B K;  5IYB C;  4A3B C;  3M3Y K;  4X6A C;  1I6V A;  5C44 C;  4A3F C;  5C4J K;  1TWG K;  4A3D C;  3K7A K;  3H0G K;  4A93 C;  2JA6 K;  2A69 A;  4A3M K;  3M3Y C;  4G7O A;  5C4J C;  3HOU K;  4BY7 K;  5IYC K;  4A3G K;  3HKZ D;  1TWG C;  1IW7 A;  4LJZ A;  1TWH K;  1TWA K;  1TWF K;  4C3I K;  2PPB A;  3S15 K;  4A3M C;  4YG2 A;  4A3J K;  4BBS K;  4G7Z A;  2A6H A;  3HOU C;  5IYC C;  4A3G C;  4A3I K;  4A3K K;  3GTK K;  3S17 K;  1TWH C;  1TWF C;  4C3I C;  4OIN A;  2WB1 D;  4NOI A;  2NVY K;  3S15 C;  4QIW L;  4A3E K;  3GTG K;  4A3J C;  4BBS C;  5TMC A;  2O5I A;  4A3I C;  2VUM C;  3GTK C;  3S17 C;  3EQL A;  3GTJ K;  2NVY C;  2CW0 A;  3S16 K;  3GTG C;  1Y1W C;  1I6H K;  5FJ8 K;  2Y0S D;  3HOZ K;  5M3M K;  3GTJ C;  3S1R K;  4C3J K;  4YFK A;  5IYD K;  3M4O K;  1R9T K;  2JA5 K;  2JA7 K;  3HOZ C;  3S1R C;  4OIR A;  5IYD C;  3M4O C;  1I3Q K;  4BY1 K;  3HOW K;  3S14 K;  3DXJ A;  2JA5 C;  2JA7 C;  3K7A C;  1HQM A;  4ZH4 A;  3H0G C;  2PMZ L;  2JA6 C;  2E2I K;  4Y52 K;  2O5J A;  1BDF A;  4BY7 C;  3GTM K;  4A3L K;  5M5W K;  1I3Q C;  4BY1 C;  1TWA C;  3HOW C;  3HOY K;  4KMU A;  4Y52 C;  2E2I C;  3H3V D;  3FKI K;  4LK1 A;  3HOV K;  3S2D K;  3CQZ K;  4A3K C;  4A3L C;  4C2M K;  2YU9 K;  2BE5 A;  1TWC K;  3HOX K;  3HOY C;  4A3E C;  1ZYR A;  3FKI C;  2WAQ D;  5M5Y K;  3GTO K;  3HOV C;  3S2D C;  1Y1V K;  4Y7N K;  1SFO K;  3CQZ C;  5D4D A;  2PA8 D;  4LLG A;  1YNJ A;  4C2M C;  2YU9 C;  2R92 K;  1TWC C;  3HKZ L;  3RZD K;  1I6H C;  3S1N K;  3S1M K;  1Y1V C;  4Y7N C;  3S16 C;  4AYB D;  2B63 K;  1YNN A;  3RZD C;  4A3C K;  4KN7 A;  4C3J C;  2WB1 L;  2NVQ K;  4QJV B;  3I4M K;  3S1N C;  3PO2 K;  3S1M C;  3GTP K;  2JA8 K;  4YFN A;  1R9T C;  2B63 C;  1SMY A;  2E2J K;  4MQ9 A;  4YFX A;  1WCM K;  4A3C C;  2NVQ C;  4KN4 A;  5IP9 K;  2R7Z K;  3PO2 C;  5M5X K;  4GZY A;  3GTP C;  4OIO A;  2JA8 C;  3S14 C;  2Y0S L;  4XSZ A;  3RZO K;  4QJV A; 
#chains in the Genus database with same CATH topology
 3JST A;  1VH2 A;  3GEH A;  5IP9 C;  2NVT K;  3V4G A;  5IP7 K;  4OIP A;  3RZO C;  1USM A;  4JK1 A;  3GTL C;  4WJ3 M;  5TJ3 A;  3GTJ A;  3I4N K;  3HOX C;  2FQO A;  4LK0 A;  3G4C A;  2E2H K;  5EGH A;  1SFO C;  2R92 C;  4BLB A;  3WOD A;  3PO3 K;  4G7H A;  4LQY A;  1JOE A;  4WJ4 A;  1I50 C;  1F7U A;  5FLM K;  3S1Q K;  1C0A A;  5IOS A;  1IQ0 A;  2PA8 L;  1DCP A;  2CFA B;  4A3F K;  5HL7 S;  4Q5S A;  1PJ6 A;  1YCL A;  3FKI A;  4A93 K;  3L4K A;  4X6A C;  5C44 C;  5C4J K;  2YU9 A;  1O29 A;  1G51 A;  2JA6 K;  4G7O A;  3N0C A;  1TWF K;  4IO9 S;  2GSN A;  4YG2 A;  4BBS K;  4G7Z A;  3HOU C;  4A3K K;  1TWH C;  2NVY K;  4GTL A;  2WB1 D;  3GDZ A;  4QIW L;  1EFW A;  4A3J C;  3GTP A;  5TMC A;  2O5I A;  1FEU A;  1F7V A;  2Y3P A;  1DCO A;  1WCM A;  2JH3 A;  3ORE A;  5M3M K;  4C3J K;  3FHZ A;  1XXA A;  5L46 A;  1O24 A;  4FZB A;  1O25 A;  5IOT A;  4OIR A;  2V6T A;  1INN A;  3M4O C;  3LAP A;  4WCE S;  3S14 K;  3DXJ A;  2JA5 C;  2JA7 C;  3H0G C;  2E2I K;  4P9S A;  2E2H A;  5M5W K;  3HOW C;  4BY1 C;  1WQH A;  3H3V D;  1YX2 A;  3HOX K;  3HOY C;  3GSI A;  2ZUE A;  2WAQ D;  1Y1V K;  1SFO K;  2R92 K;  3CQZ C;  3HKZ L;  2EBB A;  3RZD K;  5JFE A;  4KM8 A;  1I6H C;  3LAJ A;  2ZUF A;  4AYB D;  3ERE D;  1YNN A;  4P5A A;  2GAH C;  3S1N C;  4RMF A;  2B63 C;  1SMY A;  4MQ9 A;  4A3C C;  2NVQ C;  2R7Z K;  1TWF A;  3PO2 C;  4GZY A;  4OIO A;  2Y0S L;  4XSZ A;  2VUM A;  2FQT A;  4KAS A;  2NVY A;  2GSU A;  4IOC S;  4AYB L;  4KAT A;  4KM9 A;  1WQG A;  2R93 C;  4GTA A;  4C3H K;  1X31 C;  3N0B A;  1O28 A;  1PJ5 A;  4MEY A;  1K83 C;  4XSX A;  2NVX K;  5JVG S;  1O2A A;  5C3E K;  4BXX C;  5C4X K;  2GAG C;  3GTQ K;  4XLP A;  3S2H C;  2ZJQ S;  3I4M C;  1WOS A;  2E2I A;  1DD5 A;  4BBR C;  4OIQ A;  3VA7 A;  5IYB K;  4A3B K;  2A68 A;  4LR2 A;  5TMF A;  1HI9 A;  3LPX A;  3AD8 C;  3M3Y K;  1I6V A;  3HXA A;  4ILD A;  1TWG K;  4A3D C;  1B4A A;  3H0G K;  3QX3 A;  4A3M K;  1Y1V A;  1SFO A;  3AQP A;  2R92 A;  1WOP A;  4A3G K;  2KWA A;  1IW7 A;  3PIO S;  1XXC A;  4XCH A;  4C3I K;  3S15 K;  4O2D A;  2A6H A;  1XZQ A;  5IYC C;  3GTK K;  4OIN A;  3GTG K;  2L3U A;  3GEI A;  5HQH A;  3NUH A;  4GFQ A;  4A3I C;  3S17 C;  3EQL A;  2R7Z A;  1I6H K;  5FJ8 K;  3HOZ K;  1RU0 A;  3GTJ C;  1JVI A;  3S1R K;  5IYD K;  3A8I A;  4WFB S;  3BUE A;  4KC6 A;  4KAW X;  1I3Q K;  3K7A C;  1XZP B;  4Y52 K;  2O5J A;  4AH6 A;  2NVX A;  4A3L K;  3AD9 C;  3TFH A;  2ZJP S;  1J6W A;  3HOV K;  3GTQ A;  5IOR A;  1TWC K;  1ZYR A;  1IS1 A;  4IOA S;  3FKI C;  3S2D C;  2YU9 C;  4C2M C;  1YNJ A;  3CF5 S;  4Y7N C;  3S16 C;  3SZY A;  1TWG A;  2WB1 L;  1L0W A;  4QJV B;  3TFJ A;  3I4M K;  3S1M C;  1ZVU A;  2RH6 A;  3H0G A;  1R9T C;  5JVH S;  1PJ7 A;  5IP9 K;  1V5V A;  1IE0 A;  3GTP C;  2JA8 C;  2GSO A;  1F93 A;  3RZO K;  3GTK A;  1WCM C;  4U67 S;  3GTL K;  1BJT A;  3GTM C;  3GEE A;  4WF9 S;  4A3D K;  3GTG A;  1JQW A;  1WOO A;  2NVT C;  4J3N A;  1O27 A;  5IP7 C;  3GTO C;  4G0V A;  1I50 K;  4WFA S;  3I4N C;  1J6X A;  1BS2 A;  1WSV A;  3H3V L;  4KAR A;  2E2H C;  2JA6 A;  3N3Y A;  4WFN S;  3PO3 C;  2KXY A;  1I3Q A;  4MEX A;  2PMZ D;  1EK8 A;  2WAQ L;  2E2J C;  4X6A K;  5M3F K;  5C44 K;  5FLM C;  3S1Q C;  2P5M A;  1XXB A;  2KQ1 A;  4A3F C;  1WSR A;  3FOE A;  1TWC A;  3K7A K;  4A93 C;  2A69 A;  2CFA A;  5C4J C;  3HOU K;  4FM9 A;  4M1X A;  4GTB A;  1TWH K;  4LOW A;  4GTC A;  3L4J A;  4A3J K;  1EH1 A;  4KMH A;  1EI6 A;  1TWF C;  2D6F C;  3AQO A;  1VGX A;  4BBS C;  2VUM C;  3T01 A;  3FOF A;  2NVY C;  4KMD A;  1Y1W C;  3S0X A;  1ZXO A;  3BP8 C;  3A8J A;  2RGR A;  3GTL A;  3OEP A;  1IL2 A;  3M4O K;  5CJ9 A;  1R9T K;  2JA5 K;  2JA7 K;  2W7V A;  4G0U A;  4C45 A;  3TTG A;  4BY1 K;  3HOW K;  4ZH4 A;  3AH5 A;  1I50 A;  4BY7 C;  3GTM K;  4G0W A;  1TWA C;  3TFI A;  3HOY K;  2E2I C;  4GTE A;  3CQZ K;  5DM6 S;  4GTD A;  4A3E C;  2V6U A;  5IOQ A;  3GTO K;  1GE9 A;  2PA8 D;  4LLG A;  5CHP A;  3S1N K;  1Y1V C;  2B63 K;  2PHC B;  3RZD C;  1UV7 A;  4A3C K;  2NVQ K;  1EQR A;  3PO2 K;  2E2J K;  1TWH A;  5M5X K;  1VRQ C;  2R7Z C;  2R93 K;  2XCQ A;  4QIW D;  4GT9 A;  4GTF A;  1K83 K;  4Q4Z A;  4XLN A;  3MML B;  4BXX K;  4PAB A;  1BGW A;  5HL8 A;  4C3H C;  3S2H K;  3AD7 C;  3PIP S;  2ZFZ A;  3GIR A;  3IPJ A;  1XPP A;  2XCR B;  1R9T A;  2JA5 A;  2JA7 A;  2VUM K;  1J98 A;  5JVO A;  2NVX C;  4BBR K;  1Y1W K;  5C3E C;  1O2B A;  5C4X C;  5DM7 S;  2A6E A;  3GTQ C;  3GTM A;  1AB4 A;  1DCH A;  3DLL S;  3LYW A;  5IYB C;  4A3B C;  1IBA A;  3CQZ A;  1XZQ B;  4KB4 A;  4BLA A;  3GTO A;  3M3Y C;  4BY7 K;  2V6S A;  5IYC K;  3HKZ D;  1TWG C;  1TWA K;  4LJZ A;  5E68 A;  2PPB A;  4A3M C;  1ZBS A;  2B63 A;  4A3I K;  4A3G C;  3S17 K;  4C3I C;  4A3E K;  4PAA A;  4NOI A;  3S15 C;  2P8T A;  3Q3Q A;  4P5B A;  3GTK C;  3GTJ K;  2CW0 A;  3GTG C;  4KDD A;  4DDQ A;  3T02 A;  1O2F B;  1ZQ1 C;  2Y0S D;  4KMA A;  2KPU A;  2R93 A;  4YFK A;  4BKW A;  3G4A A;  1K83 A;  3HOZ C;  1ISE A;  1O26 A;  3S1R C;  4WIL A;  5IYD C;  3A8K A;  3BP3 A;  2PMZ L;  1HQM A;  2JA6 C;  1BDF A;  1F9N A;  1I3Q C;  2XCO A;  1KQ4 A;  4KB2 A;  5EGE A;  4KMU A;  4Y52 C;  3FKI K;  1WQF A;  4LK1 A;  1USO A;  3SZZ A;  3T00 A;  3S2D K;  4A3K C;  4A3L C;  4C2M K;  1VLO A;  1XZP A;  2BE5 A;  2YU9 K;  1Y1W A;  1VJE A;  5M5Y K;  3HOV C;  1WOR A;  3OPF A;  4Y7N K;  3S16 K;  5D4D A;  1B4B A;  1TWC C;  1WIH A;  3S1M K;  4KN7 A;  4C3J C;  2ZJR S;  3GTP K;  2JA8 K;  3ADA C;  4YFN A;  4YFX A;  1WCM K;  4KN4 A;  1TWA A;  3CAG A;  1J6V A;  3S14 C;  2L5N A;  4QJV A; 
#chains in the Genus database with same CATH homology
 2NVT K;  1WCM C;  5IP9 C;  2R7Z C;  3GTL K;  2R93 K;  3GTM C;  4A3D K;  4QIW D;  5IP7 K;  4OIP A;  4AYB L;  1K83 K;  3RZO C;  4JK1 A;  2NVT C;  4Q4Z A;  4XLN A;  3GTL C;  2R93 C;  3I4N K;  4C3H K;  5IP7 C;  3HOX C;  4MEY A;  1K83 C;  4XSX A;  4BXX K;  4LK0 A;  3GTO C;  2E2H K;  1I50 K;  1SFO C;  2R92 C;  3WOD A;  2NVX K;  3I4N C;  4C3H C;  5C3E K;  3S2H K;  3PO3 K;  4G7H A;  4BXX C;  1XPP A;  3H3V L;  2VUM K;  5C4X K;  2E2H C;  1I50 C;  2NVX C;  4BBR K;  3GTQ K;  4XLP A;  1Y1W K;  5C3E C;  3PO3 C;  3S2H C;  5FLM K;  3S1Q K;  4MEX A;  2PMZ D;  3I4M C;  5C4X C;  2WAQ L;  2A6E A;  4BBR C;  2E2J C;  4OIQ A;  2PA8 L;  3GTQ C;  2A68 A;  5IYB K;  5C44 K;  5FLM C;  5TMF A;  5M3F K;  4A3F K;  4X6A K;  3S1Q C;  4Q5S A;  4A93 K;  4A3B K;  5IYB C;  4A3B C;  3M3Y K;  4X6A C;  1I6V A;  5C44 C;  4A3F C;  5C4J K;  1TWG K;  4A3D C;  3K7A K;  3H0G K;  4A93 C;  2JA6 K;  2A69 A;  4A3M K;  3M3Y C;  4G7O A;  5C4J C;  3HOU K;  4BY7 K;  5IYC K;  4A3G K;  3HKZ D;  1TWG C;  1IW7 A;  4LJZ A;  1TWH K;  1TWA K;  1TWF K;  4C3I K;  2PPB A;  3S15 K;  4A3M C;  4YG2 A;  4A3J K;  4BBS K;  4G7Z A;  2A6H A;  3HOU C;  5IYC C;  4A3G C;  4A3I K;  4A3K K;  3GTK K;  3S17 K;  1TWH C;  1TWF C;  4C3I C;  4OIN A;  2WB1 D;  4NOI A;  2NVY K;  3S15 C;  4QIW L;  4A3E K;  3GTG K;  4A3J C;  4BBS C;  5TMC A;  2O5I A;  4A3I C;  2VUM C;  3GTK C;  3S17 C;  3EQL A;  3GTJ K;  2NVY C;  2CW0 A;  3S16 K;  3GTG C;  1Y1W C;  1I6H K;  5FJ8 K;  2Y0S D;  3HOZ K;  5M3M K;  3GTJ C;  3S1R K;  4C3J K;  4YFK A;  5IYD K;  3M4O K;  1R9T K;  2JA5 K;  2JA7 K;  3HOZ C;  3S1R C;  4OIR A;  5IYD C;  3M4O C;  1I3Q K;  4BY1 K;  3HOW K;  3S14 K;  3DXJ A;  2JA5 C;  2JA7 C;  3K7A C;  1HQM A;  4ZH4 A;  3H0G C;  2PMZ L;  2JA6 C;  2E2I K;  4Y52 K;  2O5J A;  1BDF A;  4BY7 C;  3GTM K;  4A3L K;  5M5W K;  1I3Q C;  4BY1 C;  1TWA C;  3HOW C;  3HOY K;  4KMU A;  4Y52 C;  2E2I C;  3H3V D;  3FKI K;  4LK1 A;  3HOV K;  3S2D K;  3CQZ K;  4A3K C;  4A3L C;  4C2M K;  2YU9 K;  2BE5 A;  1TWC K;  3HOX K;  3HOY C;  4A3E C;  1ZYR A;  3FKI C;  2WAQ D;  5M5Y K;  3GTO K;  3HOV C;  3S2D C;  1Y1V K;  4Y7N K;  1SFO K;  3CQZ C;  5D4D A;  2PA8 D;  4LLG A;  1YNJ A;  4C2M C;  2YU9 C;  2R92 K;  1TWC C;  3HKZ L;  3RZD K;  1I6H C;  3S1N K;  3S1M K;  1Y1V C;  4Y7N C;  3S16 C;  4AYB D;  2B63 K;  1YNN A;  3RZD C;  4A3C K;  4KN7 A;  4C3J C;  2WB1 L;  2NVQ K;  4QJV B;  3I4M K;  3S1N C;  3PO2 K;  3S1M C;  3GTP K;  2JA8 K;  4YFN A;  1R9T C;  2B63 C;  1SMY A;  2E2J K;  4MQ9 A;  4YFX A;  1WCM K;  4A3C C;  2NVQ C;  4KN4 A;  5IP9 K;  2R7Z K;  3PO2 C;  5M5X K;  4GZY A;  3GTP C;  4OIO A;  2JA8 C;  3S14 C;  2Y0S L;  4XSZ A;  3RZO K;  4QJV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...