The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
14
|
sequence length |
86
|
structure length |
86
|
Chain Sequence |
RDPTLTLSLIAKNTPANSMIMTKLPSVRVKTEGYNPSINVNELFAYVDLSGSEPGEHDYEVKVEPIPNIKIVEISPRVVTLQLEHH
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Crystal structure of YbbR family protein Dhaf_0833 from Desulfitobacterium hafniense DCB-2. Northeast Structural Genomics Consortium target id DhR29B
rcsb |
| molecule tags |
Structural genomics, unknown function
|
| source organism |
Desulfitobacterium hafniense
|
| molecule keywords |
YbbR family protein
|
| total genus |
14
|
| structure length |
86
|
| sequence length |
86
|
| ec nomenclature | |
| pdb deposition date | 2010-02-28 |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Beta | Beta Complex | RNA Polymerase Alpha Subunit; Chain A, domain 2 | RNA Polymerase Alpha Subunit; Chain A, domain 2 |
#chains in the Genus database with same CATH superfamily 2KPU A; 3LYW A; 2KQ1 A; 2L3U A; 2L5N A; 5HQH A; #chains in the Genus database with same CATH topology 4Q4Z A; 3S2H C; 3GTO C; 3I4N C; 4BY1 C; 2WAQ D; 4XSX A; 3HOY C; 4A3B C; 2A6H A; 5IP7 C; 4IO9 S; 3S16 C; 1ZYR A; 5C4X C; 3HOX C; 2CW0 A; 3M4O C; 4QIW D; 1I6V A; 4KN7 A; 5C44 C; 3HOZ C; 4C3H C; 4A3L C; 3PO3 C; 4BXX C; 5DM7 S; 1BDF A; 2O5I A; 4WF9 S; 3H0G C; 1Y1W C; 4MEY A; 2NVY C; 1HQM A; 3K7A C; 4WFB S; 3RZO C; 2JA5 C; 3GTM C; 4MEX A; 1SFO C; 2PMZ D; 2R93 C; 3DLL S; 3GTJ C; 4A3K C; 2E2H C; 3HOW C; 4OIP A; 3WOD A; 4LLG A; 2R92 C; 3M3Y C; 4A3D C; 4Q5S A; 4C3J C; 4YG2 A; 5D4D A; 4WFA S; 1TWA C; 2L3U A; 4A3I C; 4A3M C; 2JA8 C; 3EQL A; 3HKZ D; 1R9T C; 2BE5 A; 2KXY A; 2R7Z C; 2E2J C; 3S14 C; 4XLP A; 3GTL C; 3I4M C; 3S1R C; 2Y0S D; 1FEU A; 4XLN A; 4A93 C; 4G7O A; 2ZJP S; 2A6E A; 2NVX C; 4C3I C; 4YFN A; 5JVH S; 3PO2 C; 1IW7 A; 4AYB D; 3S1N C; 2NVT C; 3RZD C; 5HL7 S; 1I3Q C; 5TMC A; 2L5N A; 4NOI A; 4LK0 A; 2PPB A; 5IYD C; 2YU9 C; 3HOV C; 4OIR A; 4GZY A; 5JVG S; 3CQZ C; 3FKI C; 4QJV A; 4U67 S; 5IP9 C; 1I6H C; 2JA7 C; 3PIO S; 2A69 A; 2ZJR S; 4X6A C; 1TWF C; 3S17 C; 2ZJQ S; 4BBS C; 1SMY A; 2KQ1 A; 4ZH4 A; 3S1Q C; 4WCE S; 4MQ9 A; 4A3G C; 1K83 C; 4A3C C; 4IOA S; 2PA8 D; 4OIQ A; 2VUM C; 1YNN A; 4OIN A; 2JA6 C; 4JK1 A; 3S1M C; 5IYC C; 2NVQ C; 1WCM C; 4YFX A; 4A3E C; 3DXJ A; 4KN4 A; 1TWG C; 5FLM C; 3HOU C; 3PIP S; 3S15 C; 2KPU A; 5C3E C; 1I50 C; 4XSZ A; 4C2M C; 4G7H A; 4A3F C; 4LJZ A; 4IOC S; 4Y52 C; 4WFN S; 4BBR C; 3GTP C; 4A3J C; 3GTQ C; 2B63 C; 3S2D C; 2A68 A; 3LYW A; 2WB1 D; 1TWH C; 3GTK C; 3H3V D; 4BY7 C; 1YNJ A; 2O5J A; 5HQH A; 5IYB C; 3GTG C; 4LK1 A; 4OIO A; 1TWC C; 2E2I C; 3CF5 S; 4Y7N C; 4KMU A; 5DM6 S; 4G7Z A; 4YFK A; 5TMF A; 5C4J C; 1Y1V C; #chains in the Genus database with same CATH homology 2KPU A; 3LYW A; 2KQ1 A; 2L3U A; 2L5N A; 5HQH A; 2KXY A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
