1G7GA

Human ptp1b catalytic domain complexes with pnu179326
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
297
structure length
297
Chain Sequence
EMEKEFEQIDKSGSWAAIYQDIRHEASDFPCRVAKLPKNKNRNRYRDVSPFDHSRIKLHQEDNDYINASLIKMEEAQRSYILTQGPLPNTCGHFWEMVWEQKSRGVVMLNRVMEKGSLKCAQYWPQKEEKEMIFEDTNLKLTLISEDIKSYYTVRQLELENLTTQETREILHFHYTTWPDFGVPESPASFLNFLFKVRESGSLSPEHGPVVVHCSAGIGRSGTFCLADTCLLLMDKRKDPSSVDIKKVLLEMRKFRMGLIQTADQLRFSYLAVIEGAKFIMGDSSVQDQWKELSHED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Small molecule peptidomimetics containing a novel phosphotyrosine bioisostere inhibit protein tyrosine phosphatase 1B and augment insulin action.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords PROTEIN-TYROSINE PHOSPHATASE, NON-RECEPTOR TYPE 1
total genus 106
structure length 297
sequence length 297
ec nomenclature ec 3.1.3.48: Protein-tyrosine-phosphatase.
pdb deposition date 2000-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00102 Y_phosphatase Protein-tyrosine phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.190.10 Alpha Beta Alpha-Beta Complex Protein-Tyrosine Phosphatase; Chain A Protein tyrosine phosphatase superfamily 1g7gA00
3EAXA 1D5RA 1SUGA 2QDCA 4JBCA 5BZXA 4AZ1A 1OETA 1G4WR 4WU2A 2CFVA 2CMAA 3QCFA 2QDMA 1M3GA 2QCJA 1G7FA 1YFOA 4H34A 3F81A 1FQ1A 5HDEA 1L8KA 2FJMA 3V0DA 1KAKA 3O5XA 2I42A 5KADA 2HXPA 4J51A 3AWFA 2I6IA 2YDUA 1FPRA 2FH7A 3MOZA 3D1HA 2ZMMA 2CNFA 5KA8A 4BPCA 3V0GA 1EENA 4R0TA 1A5YA 5BZZA 4QBWA 4OHLA 2B4UA 2I4HA 2NT7A 2CMCA 5J8RA 3I36A 2QBRA 4MBBA 2R0BA 1ECVA 2F6ZA 4OHHA 1G4US 2I4GA 2OZ5A 2MBCA 2AZRA 1Q1MA 1U25A 3M4UA 2CM2A 1ONZA 3BM8A 2PSZA 3S4EA 3O4UA 2QBSA 1PTUA 2PI7A 1P15A 4Y2EA 3EU0A 1YN9A 3QCNA 3QCKA 1PYNA 1I9TA 5K9VA 1RPMA 2G59A 5K23A 3F99A 2NV5A 3S3HA 2ESBA 1Q6NA 1ZC0A 2SHPA 5KA9A 3S4OA 4RHGA 2B4SA 5BUGA 4YAAA 2C7SA 5MMZB 5KA3A 1LQFA 4NWFA 2BV5A 1NWEA 3A5JA 3ZM0A 1C83A 1WAXA 3RZ2A 4I8NA 1T4JA 1OESA 4QBEA 3BLTA 3QCGA 1C87A 2P4DA 1BZJA 4QUNA 1Q6JA 4OHDA 2H02A 2H03A 1T48A 2B07A 1QZ0A 3B7OA 2NTAA 4HJPA 5M43A 1XBOA 3I80A 4GFVA 1Q6SA 2I3RA 1EEOA 2VEXA 1FPZA 1YPTA 4D3RA 4DGXA 5KA1A 2ZN7A 4ZN5A 2PA5A 2I75A 3V0FA 2CM7A 2CNHA 1PTVA 2VEUA 4ZI4A 1MKPA 1AAXA 1U26A 2BGEA 2F46A 4GRYA 3F9BA 2CNIA 2QBPA 2QEPA 3AWGA 5IBMA 2HB1A 3OMHA 2GJTA 4IKCA 5KA4A 2H4KA 2PT0A 3GXHA 2I1YA 4Z6BA 2CJZA 1R6HA 5IBSA 2CMBA 3QCDA 1G1FA 2BIJA 2DXPA 3D1OA 1ONYA 4ERCA 1C88A 4R30A 2HY3A 2BZLA 2I6OA 4RH9A 2A3KA 1XXVA 3S3FA 2J17A 1YTSA 4Y14A 2PBNA 1XRIA 4GE6A 3N0AA 3F9AA 5KA7A 4DGPA 3BRHA 5GTJA 5BX1A 3RGQA 2GP0A 4GRZA 1Q6TA 1YTWA 2J16A 4GWFA 4KI9A 2OC3A 5I6VA 4S0GA 4QUMA 4WOHA 1WRMA 3V0JA 3EZZA 3ZM2A 2I4EA 4YR8B 2PQ5A 1ZZWA 3QCCA 1C86A 4GE2A 3BLUA 1G7GA 1YZ4A 1ZCLA 4OHIA 2F6WA 3U96A 1PA9A 3MMJA 1X24A 1I57A 5K25A 5K9WA 1G1GA 3S3KA 1YGRA 1BZHA 2HNQA 1YTNA 3D42A 3PS5A 3EB1A 1GWZA 4B04A 4BJOA 2HVLA 1Q6MA 4PYHA 1J4XA 1OHDA 3O3LA 4QAPA 3ZMPA 4D3QA 2F6VA 2FJNA 3D44A 4HJQA 3F41A 2J16B 4R0SA 5KABA 1XM2A 4NYHA 1V3AA 1LYVA 4WU3A 1I9SA 3ZMQA 3QCBA 1OEMX 2Q05A 2I6PA 3A5KA 2CM8A 1C85A 2RF6A 3CWEA 3V0IA 4NWGA 2IMGA 1LARA 4QAHA 3V0HA 2I6MA 2F70A 4JMKA 4GE5A 3QCIA 2G6ZA 1QXKA 3O4TA 4PVGA 2QBQA 2F6TA 2QDPA 2B3OA 4JMJA 3NMEA 1U24A 3V0EA 2NLKA 3LJ8A 1GFYA 2F71A 3QCJA 2NT2A 1JLNA 1OHEA 3MOWA 1OEVA 1NNYA 1YGUA 2I6JA 3O4SA 1YWFA 3EMUA 4D3PA 1T49A 2B49A 2HNPA 3S3EA 3H2XA 4HRFA 2H4GA 4OHEA 2AHSA 5KAAA 5EHPA 1VHRA 2Q47A 3QCMA 4WTYA 5KA2A 1JF7A 2JJDA 5EHRA 1NZ7A 3QKQA 2GWOA 1OEOX 4KYRA 4NX8A 4ICZA 2VEWA 2BGDA 2WGPA 5AWXA 3D1QA 1WCHA 2C46A 3RO1A 1G1HA 2E0TA 3ZV2A 4KYQA 2OUDA 3D9CA 2H4VA 1PTYA 1PTTA 4RDDA 1OEUA 1C84A 5LXQB 3QCEA 4RI4A 1PXHA 2F6FA 2Y2FA 2HC2A 3QKPA 4RI5A 1KAVA 2HCMA 1NWLA 2QCTA 5KACA 2F6YA 1ZCKA 3QCLA 3RGOA 1BZCA 4NNDA 4ZRTA 2OOQA 2M3VA 3AWEA 2VEYA 2HC1A 2A8BA 2Y96A 3GXGA 5K22A 1L8GA 2H04A 4GS0A 3ZM3A 2CM3A 4H1OA 3SR9A 1NO6A 1Q6PA 4JNBA 3SMEA 1XXPA 2I5XA 1NL9A 3QCHA 2B4PA 2B4OA 2NZ6A 3CM3A 4TVVA 2VEVA 3ZM1A 1RXDA 4RH5A 2CNGA 2I3UA 1PA1A 3OLRA 4RKKA 4GFUA 3I7ZA 2CNEA 5K24A 5KA0A 1OHCA 2P6XA 1PH0A
chains in the Genus database with same CATH superfamily
3EAXA 1D5RA 1SUGA 2QDCA 4JBCA 5BZXA 4AZ1A 4C13A 1OETA 1G4WR 4WU2A 2CFVA 2CMAA 3QCFA 2QDMA 1M3GA 2QCJA 1G7FA 1YFOA 4H34A 3F81A 1FQ1A 5HDEA 4QF5A 1L8KA 2FJMA 1GG4A 3V0DA 1KAKA 3O5XA 2I42A 5KADA 2HXPA 4J51A 3AWFA 2I6IA 2YDUA 2F00A 1FPRA 3MOZA 2FH7A 3D1HA 2ZMMA 3ZM6A 2CNFA 5KA8A 4BPCA 3V0GA 1EENA 4R0TA 1A5YA 5BZZA 1EEHA 4QBWA 4OHLA 2B4UA 2I4HA 3HN7A 2WTZA 2NT7A 2CMCA 5J8RA 3I36A 2QBRA 4MBBA 2R0BA 1ECVA 2F6ZA 4OHHA 1G4US 2I4GA 2OZ5A 2MBCA 2AZRA 1Q1MA 1U25A 3M4UA 2CM2A 2UAGA 1ONZA 3BM8A 2PSZA 3S4EA 3MVNA 3O4UA 2QBSA 1PTUA 2PI7A 1P15A 4Y2EA 3EU0A 1YN9A 3QCNA 1P3DA 3QCKA 1PYNA 1I9TA 5K9VA 2JFHA 1RPMA 2G59A 2Y67A 5K23A 3F99A 2NV5A 3S3HA 2ESBA 2XJAA 1Q6NA 1ZC0A 2UUOA 2SHPA 5KA9A 3S4OA 4RHGA 2XPCA 2B4SA 5BUGA 4YAAA 2C7SA 5MMZB 5KA3A 1LQFA 4NWFA 2BV5A 1NWEA 3A5JA 3ZM0A 1C83A 1WAXA 3RZ2A 4I8NA 1T4JA 1OESA 4QBEA 3BLTA 3QCGA 1C87A 2P4DA 1BZJA 4QUNA 1Q6JA 4OHDA 2H02A 2H03A 1T48A 2B07A 1QZ0A 3B7OA 2NTAA 4HJPA 4CVMA 5M43A 1XBOA 3I80A 4GFVA 1Q6SA 2I3RA 1O5ZA 1GQQA 4BUCA 1EEOA 2VEXA 1FPZA 1YPTA 4D3RA 4DGXA 5KA1A 2ZN7A 4ZN5A 2PA5A 2I75A 1J6UA 2VORA 3V0FA 2Y1OA 2CM7A 2CNHA 1PTVA 2VEUA 4ZI4A 1MKPA 1AAXA 1U26A 2BGEA 4ZIYA 2F46A 4GRYA 4C12A 3F9BA 2CNIA 2QBPA 2QEPA 3AWGA 5IBMA 2HB1A 3OMHA 2GJTA 4IKCA 1W7KA 2H4KA 2PT0A 5KA4A 3GXHA 2I1YA 4Z6BA 2CJZA 1R6HA 3ZL8A 5IBSA 2CMBA 3QCDA 1G1FA 2BIJA 2DXPA 4HV4A 3D1OA 1ONYA 4ERCA 1FGSA 2AM2A 1C88A 4R30A 3ZM5A 2HY3A 2BZLA 2I6OA 4RH9A 2GCAA 2A3KA 3N2AA 1XXVA 3S3FA 2J17A 3PYZA 1YTSA 2AM1A 4Y14A 2PBNA 2GCBA 1XRIA 4GE6A 1UAGA 3N0AA 3F9AA 5KA7A 4DGPA 3BRHA 2WJPA 5GTJA 5BX1A 3RGQA 2GP0A 4GRZA 1Q6TA 1YTWA 2J16A 4GWFA 5A5EA 2OC3A 4KI9A 5I6VA 4S0GA 4QUMA 4WOHA 1WRMA 3V0JA 3EZZA 3ZM2A 2I4EA 4YR8B 2PQ5A 1ZZWA 3QCCA 1C86A 4GE2A 3BLUA 1G7GA 1YZ4A 1ZCLA 2GC6A 4OHIA 2F6WA 3U96A 1PA9A 3MMJA 1X24A 1I57A 5K25A 5K9WA 1G1GA 3S3KA 1YGRA 1BZHA 2HNQA 1YTNA 3D42A 3PS5A 3EB1A 2VTDA 1GWZA 4B04A 4BJOA 2HVLA 1Q6MA 4PYHA 1J4XA 1OHDA 3O3LA 4QAPA 3ZMPA 4D3QA 2F6VA 2FJNA 3D44A 4HJQA 3F41A 2J16B 4R0SA 5KABA 1XM2A 4NYHA 1V3AA 1LYVA 4WU3A 1I9SA 3ZMQA 4QDIA 3QCBA 2Y68A 1OEMX 2UUPA 2Q05A 4CVKA 2I6PA 3A5KA 2CM8A 1C85A 2RF6A 3CWEA 3V0IA 2JFFA 4NWGA 2IMGA 1LARA 4QAHA 3V0HA 2I6MA 2F70A 4JMKA 4GE5A 3QCIA 2G6ZA 2Y66A 1QXKA 3O4TA 4PVGA 2QBQA 2F6TA 2QDPA 2B3OA 4JMJA 3NMEA 1U24A 3V0EA 2NLKA 3LJ8A 1GFYA 2F71A 3QCJA 2NT2A 1JLNA 1OHEA 3MOWA 1OEVA 1NNYA 1YGUA 2I6JA 3O4SA 1YWFA 3EMUA 3UAGA 2GC5A 4D3PA 1T49A 1GQYA 2B49A 2HNPA 3S3EA 3H2XA 4HRFA 2H4GA 4OHEA 2AHSA 5KAAA 5EHPA 1VHRA 2Q47A 3QCMA 4WTYA 5KA2A 1JF7A 2JJDA 5EHRA 1NZ7A 3QKQA 4CVLA 2GWOA 1OEOX 4KYRA 1E8CA 4NX8A 4ICZA 2VEWA 2BGDA 2WGPA 2VTEA 5AWXA 3D1QA 1WCHA 2C46A 3RO1A 1G1HA 2E0TA 1W78A 3ZV2A 4KYQA 2OUDA 3D9CA 2H4VA 1PTYA 1PTTA 2X5OA 4RDDA 1OEUA 1C84A 5LXQB 3QCEA 4RI4A 1PXHA 2F6FA 2Y2FA 2HC2A 3QKPA 4RI5A 1KAVA 2HCMA 1NWLA 2QCTA 5KACA 2F6YA 1ZCKA 3QCLA 2VOSA 3RGOA 5A5FA 1BZCA 4NNDA 4ZRTA 1JBVA 2OOQA 2M3VA 3AWEA 2VEYA 1JBWA 2A8BA 2HC1A 2Y96A 3GXGA 5K22A 1L8GA 3LK7A 2H04A 4GS0A 3ZM3A 2CM3A 4BUBA 4H1OA 3SR9A 1NO6A 1Q6PA 4JNBA 3SMEA 1XXPA 2I5XA 1NL9A 3QCHA 2B4PA 2B4OA 2NZ6A 3CM3A 4TVVA 2VEVA 3ZM1A 1RXDA 4RH5A 1P31A 2JFGA 2CNGA 1E0DA 2I3UA 1PA1A 4UAGA 3OLRA 4RKKA 4GFUA 3I7ZA 2CNEA 5K24A 5KA0A 3NRSA 1OHCA 3QCZA 2P6XA 1PH0A
chains in the Genus database with same CATH topology
3EAXA 1D5RA 1SUGA 2QDCA 4JBCA 5BZXA 4AZ1A 1OETA 1G4WR 4WU2A 2CFVA 2CMAA 3QCFA 2QDMA 1M3GA 2QCJA 1G7FA 1YFOA 4H34A 3F81A 1FQ1A 5HDEA 1L8KA 2FJMA 3V0DA 1KAKA 3O5XA 2I42A 5KADA 2HXPA 4J51A 3AWFA 2I6IA 2YDUA 1FPRA 2FH7A 3MOZA 3D1HA 2ZMMA 2CNFA 5KA8A 4BPCA 3V0GA 1EENA 4R0TA 1A5YA 5BZZA 4QBWA 4OHLA 2B4UA 2I4HA 2NT7A 2CMCA 5J8RA 3I36A 2QBRA 4MBBA 2R0BA 1ECVA 2F6ZA 4OHHA 1G4US 2I4GA 2OZ5A 2MBCA 2AZRA 1Q1MA 1U25A 3M4UA 2CM2A 1ONZA 3BM8A 2PSZA 3S4EA 3O4UA 2QBSA 1PTUA 2PI7A 1P15A 4Y2EA 3EU0A 1YN9A 3QCNA 3QCKA 1PYNA 1I9TA 5K9VA 1RPMA 2G59A 5K23A 3F99A 2NV5A 3S3HA 2ESBA 1Q6NA 1ZC0A 2SHPA 5KA9A 3S4OA 4RHGA 2B4SA 5BUGA 4YAAA 2C7SA 5MMZB 5KA3A 1LQFA 4NWFA 2BV5A 1NWEA 3A5JA 3ZM0A 1C83A 1WAXA 3RZ2A 4I8NA 1T4JA 1OESA 4QBEA 3BLTA 3QCGA 1C87A 2P4DA 1BZJA 4QUNA 1Q6JA 4OHDA 2H02A 2H03A 1T48A 2B07A 1QZ0A 3B7OA 2NTAA 4HJPA 5M43A 1XBOA 3I80A 4GFVA 1Q6SA 2I3RA 1EEOA 2VEXA 1FPZA 1YPTA 4D3RA 4DGXA 5KA1A 2ZN7A 4ZN5A 2PA5A 2I75A 3V0FA 2CM7A 2CNHA 1PTVA 2VEUA 4ZI4A 1MKPA 1AAXA 1U26A 2BGEA 2F46A 4GRYA 3F9BA 2CNIA 2QBPA 2QEPA 3AWGA 5IBMA 2HB1A 3OMHA 2GJTA 4IKCA 5KA4A 2H4KA 2PT0A 3GXHA 2I1YA 4Z6BA 2CJZA 1R6HA 5IBSA 2CMBA 3QCDA 1G1FA 2BIJA 2DXPA 3D1OA 1ONYA 4ERCA 1C88A 4R30A 2HY3A 2BZLA 2I6OA 4RH9A 2A3KA 1XXVA 3S3FA 2J17A 1YTSA 4Y14A 2PBNA 1XRIA 4GE6A 3N0AA 3F9AA 5KA7A 4DGPA 3BRHA 5GTJA 5BX1A 3RGQA 2GP0A 4GRZA 1Q6TA 1YTWA 2J16A 4GWFA 4KI9A 2OC3A 5I6VA 4S0GA 4QUMA 4WOHA 1WRMA 3V0JA 3EZZA 3ZM2A 2I4EA 4YR8B 2PQ5A 1ZZWA 3QCCA 1C86A 4GE2A 3BLUA 1G7GA 1YZ4A 1ZCLA 4OHIA 2F6WA 3U96A 1PA9A 3MMJA 1X24A 1I57A 5K25A 5K9WA 1G1GA 3S3KA 1YGRA 1BZHA 2HNQA 1YTNA 3D42A 3PS5A 3EB1A 1GWZA 4B04A 4BJOA 2HVLA 1Q6MA 4PYHA 1J4XA 1OHDA 3O3LA 4QAPA 3ZMPA 4D3QA 2F6VA 2FJNA 3D44A 4HJQA 3F41A 2J16B 4R0SA 5KABA 1XM2A 4NYHA 1V3AA 1LYVA 4WU3A 1I9SA 3ZMQA 3QCBA 1OEMX 2Q05A 2I6PA 3A5KA 2CM8A 1C85A 2RF6A 3CWEA 3V0IA 4NWGA 2IMGA 1LARA 4QAHA 3V0HA 2I6MA 2F70A 4JMKA 4GE5A 3QCIA 2G6ZA 1QXKA 3O4TA 4PVGA 2QBQA 2F6TA 2QDPA 2B3OA 4JMJA 3NMEA 1U24A 3V0EA 2NLKA 3LJ8A 1GFYA 2F71A 3QCJA 2NT2A 1JLNA 1OHEA 3MOWA 1OEVA 1NNYA 1YGUA 2I6JA 3O4SA 1YWFA 3EMUA 4D3PA 1T49A 2B49A 2HNPA 3S3EA 3H2XA 4HRFA 2H4GA 4OHEA 2AHSA 5KAAA 5EHPA 1VHRA 2Q47A 3QCMA 4WTYA 5KA2A 1JF7A 2JJDA 5EHRA 1NZ7A 3QKQA 2GWOA 1OEOX 4KYRA 4NX8A 4ICZA 2VEWA 2BGDA 2WGPA 5AWXA 3D1QA 1WCHA 2C46A 3RO1A 1G1HA 2E0TA 3ZV2A 4KYQA 2OUDA 3D9CA 2H4VA 1PTYA 1PTTA 4RDDA 1OEUA 1C84A 5LXQB 3QCEA 4RI4A 1PXHA 2F6FA 2Y2FA 2HC2A 3QKPA 4RI5A 1KAVA 2HCMA 1NWLA 2QCTA 5KACA 2F6YA 1ZCKA 3QCLA 3RGOA 1BZCA 4NNDA 4ZRTA 2OOQA 2M3VA 3AWEA 2VEYA 2HC1A 2A8BA 2Y96A 3GXGA 5K22A 1L8GA 2H04A 4GS0A 3ZM3A 2CM3A 4H1OA 3SR9A 1NO6A 1Q6PA 4JNBA 3SMEA 1XXPA 2I5XA 1NL9A 3QCHA 2B4PA 2B4OA 2NZ6A 3CM3A 4TVVA 2VEVA 3ZM1A 1RXDA 4RH5A 2CNGA 2I3UA 1PA1A 3OLRA 4RKKA 4GFUA 3I7ZA 2CNEA 5K24A 5KA0A 1OHCA 2P6XA 1PH0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EAX A;  1D5R A;  1SUG A;  2QDC A;  4JBC A;  5BZX A;  4AZ1 A;  1OET A;  1G4W R;  4WU2 A;  2CFV A;  2CMA A;  3QCF A;  2QDM A;  1M3G A;  2QCJ A;  1G7F A;  1YFO A;  4H34 A;  3F81 A;  1FQ1 A;  5HDE A;  1L8K A;  2FJM A;  3V0D A;  1KAK A;  3O5X A;  2I42 A;  5KAD A;  2HXP A;  4J51 A;  3AWF A;  2I6I A;  2YDU A;  1FPR A;  2FH7 A;  3MOZ A;  3D1H A;  2ZMM A;  2CNF A;  5KA8 A;  4BPC A;  3V0G A;  1EEN A;  4R0T A;  1A5Y A;  5BZZ A;  4QBW A;  4OHL A;  2B4U A;  2I4H A;  2NT7 A;  2CMC A;  5J8R A;  3I36 A;  2QBR A;  4MBB A;  2R0B A;  1ECV A;  2F6Z A;  4OHH A;  1G4U S;  2I4G A;  2OZ5 A;  2MBC A;  2AZR A;  1Q1M A;  1U25 A;  3M4U A;  2CM2 A;  1ONZ A;  3BM8 A;  2PSZ A;  3S4E A;  3O4U A;  2QBS A;  1PTU A;  2PI7 A;  1P15 A;  4Y2E A;  3EU0 A;  1YN9 A;  3QCN A;  3QCK A;  1PYN A;  1I9T A;  5K9V A;  1RPM A;  2G59 A;  5K23 A;  3F99 A;  2NV5 A;  3S3H A;  2ESB A;  1Q6N A;  1ZC0 A;  2SHP A;  5KA9 A;  3S4O A;  4RHG A;  2B4S A;  5BUG A;  4YAA A;  2C7S A;  5MMZ B;  5KA3 A;  1LQF A;  4NWF A;  2BV5 A;  1NWE A;  3A5J A;  3ZM0 A;  1C83 A;  1WAX A;  3RZ2 A;  4I8N A;  1T4J A;  1OES A;  4QBE A;  3BLT A;  3QCG A;  1C87 A;  2P4D A;  1BZJ A;  4QUN A;  1Q6J A;  4OHD A;  2H02 A;  2H03 A;  1T48 A;  2B07 A;  1QZ0 A;  3B7O A;  2NTA A;  4HJP A;  5M43 A;  1XBO A;  3I80 A;  4GFV A;  1Q6S A;  2I3R A;  1EEO A;  2VEX A;  1FPZ A;  1YPT A;  4D3R A;  4DGX A;  5KA1 A;  2ZN7 A;  4ZN5 A;  2PA5 A;  2I75 A;  3V0F A;  2CM7 A;  2CNH A;  1PTV A;  2VEU A;  4ZI4 A;  1MKP A;  1AAX A;  1U26 A;  2BGE A;  2F46 A;  4GRY A;  3F9B A;  2CNI A;  2QBP A;  2QEP A;  3AWG A;  5IBM A;  2HB1 A;  3OMH A;  2GJT A;  4IKC A;  5KA4 A;  2H4K A;  2PT0 A;  3GXH A;  2I1Y A;  4Z6B A;  2CJZ A;  1R6H A;  5IBS A;  2CMB A;  3QCD A;  1G1F A;  2BIJ A;  2DXP A;  3D1O A;  1ONY A;  4ERC A;  1C88 A;  4R30 A;  2HY3 A;  2BZL A;  2I6O A;  4RH9 A;  2A3K A;  1XXV A;  3S3F A;  2J17 A;  1YTS A;  4Y14 A;  2PBN A;  1XRI A;  4GE6 A;  3N0A A;  3F9A A;  5KA7 A;  4DGP A;  3BRH A;  5GTJ A;  5BX1 A;  3RGQ A;  2GP0 A;  4GRZ A;  1Q6T A;  1YTW A;  2J16 A;  4GWF A;  4KI9 A;  2OC3 A;  5I6V A;  4S0G A;  4QUM A;  4WOH A;  1WRM A;  3V0J A;  3EZZ A;  3ZM2 A;  2I4E A;  4YR8 B;  2PQ5 A;  1ZZW A;  3QCC A;  1C86 A;  4GE2 A;  3BLU A;  1G7G A;  1YZ4 A;  1ZCL A;  4OHI A;  2F6W A;  3U96 A;  1PA9 A;  3MMJ A;  1X24 A;  1I57 A;  5K25 A;  5K9W A;  1G1G A;  3S3K A;  1YGR A;  1BZH A;  2HNQ A;  1YTN A;  3D42 A;  3PS5 A;  3EB1 A;  1GWZ A;  4B04 A;  4BJO A;  2HVL A;  1Q6M A;  4PYH A;  1J4X A;  1OHD A;  3O3L A;  4QAP A;  3ZMP A;  4D3Q A;  2F6V A;  2FJN A;  3D44 A;  4HJQ A;  3F41 A;  2J16 B;  4R0S A;  5KAB A;  1XM2 A;  4NYH A;  1V3A A;  1LYV A;  4WU3 A;  1I9S A;  3ZMQ A;  3QCB A;  1OEM X;  2Q05 A;  2I6P A;  3A5K A;  2CM8 A;  1C85 A;  2RF6 A;  3CWE A;  3V0I A;  4NWG A;  2IMG A;  1LAR A;  4QAH A;  3V0H A;  2I6M A;  2F70 A;  4JMK A;  4GE5 A;  3QCI A;  2G6Z A;  1QXK A;  3O4T A;  4PVG A;  2QBQ A;  2F6T A;  2QDP A;  2B3O A;  4JMJ A;  3NME A;  1U24 A;  3V0E A;  2NLK A;  3LJ8 A;  1GFY A;  2F71 A;  3QCJ A;  2NT2 A;  1JLN A;  1OHE A;  3MOW A;  1OEV A;  1NNY A;  1YGU A;  2I6J A;  3O4S A;  1YWF A;  3EMU A;  4D3P A;  1T49 A;  2B49 A;  2HNP A;  3S3E A;  3H2X A;  4HRF A;  2H4G A;  4OHE A;  2AHS A;  5KAA A;  5EHP A;  1VHR A;  2Q47 A;  3QCM A;  4WTY A;  5KA2 A;  1JF7 A;  2JJD A;  5EHR A;  1NZ7 A;  3QKQ A;  2GWO A;  1OEO X;  4KYR A;  4NX8 A;  4ICZ A;  2VEW A;  2BGD A;  2WGP A;  5AWX A;  3D1Q A;  1WCH A;  2C46 A;  3RO1 A;  1G1H A;  2E0T A;  3ZV2 A;  4KYQ A;  2OUD A;  3D9C A;  2H4V A;  1PTY A;  1PTT A;  4RDD A;  1OEU A;  1C84 A;  5LXQ B;  3QCE A;  4RI4 A;  1PXH A;  2F6F A;  2Y2F A;  2HC2 A;  3QKP A;  4RI5 A;  1KAV A;  2HCM A;  1NWL A;  2QCT A;  5KAC A;  2F6Y A;  1ZCK A;  3QCL A;  3RGO A;  1BZC A;  4NND A;  4ZRT A;  2OOQ A;  2M3V A;  3AWE A;  2VEY A;  2HC1 A;  2A8B A;  2Y96 A;  3GXG A;  5K22 A;  1L8G A;  2H04 A;  4GS0 A;  3ZM3 A;  2CM3 A;  4H1O A;  3SR9 A;  1NO6 A;  1Q6P A;  4JNB A;  3SME A;  1XXP A;  2I5X A;  1NL9 A;  3QCH A;  2B4P A;  2B4O A;  2NZ6 A;  3CM3 A;  4TVV A;  2VEV A;  3ZM1 A;  1RXD A;  4RH5 A;  2CNG A;  2I3U A;  1PA1 A;  3OLR A;  4RKK A;  4GFU A;  3I7Z A;  2CNE A;  5K24 A;  5KA0 A;  1OHC A;  2P6X A;  1PH0 A; 
#chains in the Genus database with same CATH topology
 3EAX A;  1D5R A;  1SUG A;  2QDC A;  4JBC A;  5BZX A;  4AZ1 A;  4C13 A;  1OET A;  1G4W R;  4WU2 A;  2CFV A;  2CMA A;  3QCF A;  2QDM A;  1M3G A;  2QCJ A;  1G7F A;  1YFO A;  4H34 A;  3F81 A;  1FQ1 A;  5HDE A;  4QF5 A;  1L8K A;  2FJM A;  1GG4 A;  3V0D A;  1KAK A;  3O5X A;  2I42 A;  5KAD A;  2HXP A;  4J51 A;  3AWF A;  2I6I A;  2YDU A;  2F00 A;  1FPR A;  3MOZ A;  2FH7 A;  3D1H A;  2ZMM A;  3ZM6 A;  2CNF A;  5KA8 A;  4BPC A;  3V0G A;  1EEN A;  4R0T A;  1A5Y A;  5BZZ A;  1EEH A;  4QBW A;  4OHL A;  2B4U A;  2I4H A;  3HN7 A;  2WTZ A;  2NT7 A;  2CMC A;  5J8R A;  3I36 A;  2QBR A;  4MBB A;  2R0B A;  1ECV A;  2F6Z A;  4OHH A;  1G4U S;  2I4G A;  2OZ5 A;  2MBC A;  2AZR A;  1Q1M A;  1U25 A;  3M4U A;  2CM2 A;  2UAG A;  1ONZ A;  3BM8 A;  2PSZ A;  3S4E A;  3MVN A;  3O4U A;  2QBS A;  1PTU A;  2PI7 A;  1P15 A;  4Y2E A;  3EU0 A;  1YN9 A;  3QCN A;  1P3D A;  3QCK A;  1PYN A;  1I9T A;  5K9V A;  2JFH A;  1RPM A;  2G59 A;  2Y67 A;  5K23 A;  3F99 A;  2NV5 A;  3S3H A;  2ESB A;  2XJA A;  1Q6N A;  1ZC0 A;  2UUO A;  2SHP A;  5KA9 A;  3S4O A;  4RHG A;  2XPC A;  2B4S A;  5BUG A;  4YAA A;  2C7S A;  5MMZ B;  5KA3 A;  1LQF A;  4NWF A;  2BV5 A;  1NWE A;  3A5J A;  3ZM0 A;  1C83 A;  1WAX A;  3RZ2 A;  4I8N A;  1T4J A;  1OES A;  4QBE A;  3BLT A;  3QCG A;  1C87 A;  2P4D A;  1BZJ A;  4QUN A;  1Q6J A;  4OHD A;  2H02 A;  2H03 A;  1T48 A;  2B07 A;  1QZ0 A;  3B7O A;  2NTA A;  4HJP A;  4CVM A;  5M43 A;  1XBO A;  3I80 A;  4GFV A;  1Q6S A;  2I3R A;  1O5Z A;  1GQQ A;  4BUC A;  1EEO A;  2VEX A;  1FPZ A;  1YPT A;  4D3R A;  4DGX A;  5KA1 A;  2ZN7 A;  4ZN5 A;  2PA5 A;  2I75 A;  1J6U A;  2VOR A;  3V0F A;  2Y1O A;  2CM7 A;  2CNH A;  1PTV A;  2VEU A;  4ZI4 A;  1MKP A;  1AAX A;  1U26 A;  2BGE A;  4ZIY A;  2F46 A;  4GRY A;  4C12 A;  3F9B A;  2CNI A;  2QBP A;  2QEP A;  3AWG A;  5IBM A;  2HB1 A;  3OMH A;  2GJT A;  4IKC A;  1W7K A;  2H4K A;  2PT0 A;  5KA4 A;  3GXH A;  2I1Y A;  4Z6B A;  2CJZ A;  1R6H A;  3ZL8 A;  5IBS A;  2CMB A;  3QCD A;  1G1F A;  2BIJ A;  2DXP A;  4HV4 A;  3D1O A;  1ONY A;  4ERC A;  1FGS A;  2AM2 A;  1C88 A;  4R30 A;  3ZM5 A;  2HY3 A;  2BZL A;  2I6O A;  4RH9 A;  2GCA A;  2A3K A;  3N2A A;  1XXV A;  3S3F A;  2J17 A;  3PYZ A;  1YTS A;  2AM1 A;  4Y14 A;  2PBN A;  2GCB A;  1XRI A;  4GE6 A;  1UAG A;  3N0A A;  3F9A A;  5KA7 A;  4DGP A;  3BRH A;  2WJP A;  5GTJ A;  5BX1 A;  3RGQ A;  2GP0 A;  4GRZ A;  1Q6T A;  1YTW A;  2J16 A;  4GWF A;  5A5E A;  2OC3 A;  4KI9 A;  5I6V A;  4S0G A;  4QUM A;  4WOH A;  1WRM A;  3V0J A;  3EZZ A;  3ZM2 A;  2I4E A;  4YR8 B;  2PQ5 A;  1ZZW A;  3QCC A;  1C86 A;  4GE2 A;  3BLU A;  1G7G A;  1YZ4 A;  1ZCL A;  2GC6 A;  4OHI A;  2F6W A;  3U96 A;  1PA9 A;  3MMJ A;  1X24 A;  1I57 A;  5K25 A;  5K9W A;  1G1G A;  3S3K A;  1YGR A;  1BZH A;  2HNQ A;  1YTN A;  3D42 A;  3PS5 A;  3EB1 A;  2VTD A;  1GWZ A;  4B04 A;  4BJO A;  2HVL A;  1Q6M A;  4PYH A;  1J4X A;  1OHD A;  3O3L A;  4QAP A;  3ZMP A;  4D3Q A;  2F6V A;  2FJN A;  3D44 A;  4HJQ A;  3F41 A;  2J16 B;  4R0S A;  5KAB A;  1XM2 A;  4NYH A;  1V3A A;  1LYV A;  4WU3 A;  1I9S A;  3ZMQ A;  4QDI A;  3QCB A;  2Y68 A;  1OEM X;  2UUP A;  2Q05 A;  4CVK A;  2I6P A;  3A5K A;  2CM8 A;  1C85 A;  2RF6 A;  3CWE A;  3V0I A;  2JFF A;  4NWG A;  2IMG A;  1LAR A;  4QAH A;  3V0H A;  2I6M A;  2F70 A;  4JMK A;  4GE5 A;  3QCI A;  2G6Z A;  2Y66 A;  1QXK A;  3O4T A;  4PVG A;  2QBQ A;  2F6T A;  2QDP A;  2B3O A;  4JMJ A;  3NME A;  1U24 A;  3V0E A;  2NLK A;  3LJ8 A;  1GFY A;  2F71 A;  3QCJ A;  2NT2 A;  1JLN A;  1OHE A;  3MOW A;  1OEV A;  1NNY A;  1YGU A;  2I6J A;  3O4S A;  1YWF A;  3EMU A;  3UAG A;  2GC5 A;  4D3P A;  1T49 A;  1GQY A;  2B49 A;  2HNP A;  3S3E A;  3H2X A;  4HRF A;  2H4G A;  4OHE A;  2AHS A;  5KAA A;  5EHP A;  1VHR A;  2Q47 A;  3QCM A;  4WTY A;  5KA2 A;  1JF7 A;  2JJD A;  5EHR A;  1NZ7 A;  3QKQ A;  4CVL A;  2GWO A;  1OEO X;  4KYR A;  1E8C A;  4NX8 A;  4ICZ A;  2VEW A;  2BGD A;  2WGP A;  2VTE A;  5AWX A;  3D1Q A;  1WCH A;  2C46 A;  3RO1 A;  1G1H A;  2E0T A;  1W78 A;  3ZV2 A;  4KYQ A;  2OUD A;  3D9C A;  2H4V A;  1PTY A;  1PTT A;  2X5O A;  4RDD A;  1OEU A;  1C84 A;  5LXQ B;  3QCE A;  4RI4 A;  1PXH A;  2F6F A;  2Y2F A;  2HC2 A;  3QKP A;  4RI5 A;  1KAV A;  2HCM A;  1NWL A;  2QCT A;  5KAC A;  2F6Y A;  1ZCK A;  3QCL A;  2VOS A;  3RGO A;  5A5F A;  1BZC A;  4NND A;  4ZRT A;  1JBV A;  2OOQ A;  2M3V A;  3AWE A;  2VEY A;  1JBW A;  2A8B A;  2HC1 A;  2Y96 A;  3GXG A;  5K22 A;  1L8G A;  3LK7 A;  2H04 A;  4GS0 A;  3ZM3 A;  2CM3 A;  4BUB A;  4H1O A;  3SR9 A;  1NO6 A;  1Q6P A;  4JNB A;  3SME A;  1XXP A;  2I5X A;  1NL9 A;  3QCH A;  2B4P A;  2B4O A;  2NZ6 A;  3CM3 A;  4TVV A;  2VEV A;  3ZM1 A;  1RXD A;  4RH5 A;  1P31 A;  2JFG A;  2CNG A;  1E0D A;  2I3U A;  1PA1 A;  4UAG A;  3OLR A;  4RKK A;  4GFU A;  3I7Z A;  2CNE A;  5K24 A;  5KA0 A;  3NRS A;  1OHC A;  3QCZ A;  2P6X A;  1PH0 A; 
#chains in the Genus database with same CATH homology
 3EAX A;  1D5R A;  1SUG A;  2QDC A;  4JBC A;  5BZX A;  4AZ1 A;  1OET A;  1G4W R;  4WU2 A;  2CFV A;  2CMA A;  3QCF A;  2QDM A;  1M3G A;  2QCJ A;  1G7F A;  1YFO A;  4H34 A;  3F81 A;  1FQ1 A;  5HDE A;  1L8K A;  2FJM A;  3V0D A;  1KAK A;  3O5X A;  2I42 A;  5KAD A;  2HXP A;  4J51 A;  3AWF A;  2I6I A;  2YDU A;  1FPR A;  2FH7 A;  3MOZ A;  3D1H A;  2ZMM A;  2CNF A;  5KA8 A;  4BPC A;  3V0G A;  1EEN A;  4R0T A;  1A5Y A;  5BZZ A;  4QBW A;  4OHL A;  2B4U A;  2I4H A;  2NT7 A;  2CMC A;  5J8R A;  3I36 A;  2QBR A;  4MBB A;  2R0B A;  1ECV A;  2F6Z A;  4OHH A;  1G4U S;  2I4G A;  2OZ5 A;  2MBC A;  2AZR A;  1Q1M A;  1U25 A;  3M4U A;  2CM2 A;  1ONZ A;  3BM8 A;  2PSZ A;  3S4E A;  3O4U A;  2QBS A;  1PTU A;  2PI7 A;  1P15 A;  4Y2E A;  3EU0 A;  1YN9 A;  3QCN A;  3QCK A;  1PYN A;  1I9T A;  5K9V A;  1RPM A;  2G59 A;  5K23 A;  3F99 A;  2NV5 A;  3S3H A;  2ESB A;  1Q6N A;  1ZC0 A;  2SHP A;  5KA9 A;  3S4O A;  4RHG A;  2B4S A;  5BUG A;  4YAA A;  2C7S A;  5MMZ B;  5KA3 A;  1LQF A;  4NWF A;  2BV5 A;  1NWE A;  3A5J A;  3ZM0 A;  1C83 A;  1WAX A;  3RZ2 A;  4I8N A;  1T4J A;  1OES A;  4QBE A;  3BLT A;  3QCG A;  1C87 A;  2P4D A;  1BZJ A;  4QUN A;  1Q6J A;  4OHD A;  2H02 A;  2H03 A;  1T48 A;  2B07 A;  1QZ0 A;  3B7O A;  2NTA A;  4HJP A;  5M43 A;  1XBO A;  3I80 A;  4GFV A;  1Q6S A;  2I3R A;  1EEO A;  2VEX A;  1FPZ A;  1YPT A;  4D3R A;  4DGX A;  5KA1 A;  2ZN7 A;  4ZN5 A;  2PA5 A;  2I75 A;  3V0F A;  2CM7 A;  2CNH A;  1PTV A;  2VEU A;  4ZI4 A;  1MKP A;  1AAX A;  1U26 A;  2BGE A;  2F46 A;  4GRY A;  3F9B A;  2CNI A;  2QBP A;  2QEP A;  3AWG A;  5IBM A;  2HB1 A;  3OMH A;  2GJT A;  4IKC A;  5KA4 A;  2H4K A;  2PT0 A;  3GXH A;  2I1Y A;  4Z6B A;  2CJZ A;  1R6H A;  5IBS A;  2CMB A;  3QCD A;  1G1F A;  2BIJ A;  2DXP A;  3D1O A;  1ONY A;  4ERC A;  1C88 A;  4R30 A;  2HY3 A;  2BZL A;  2I6O A;  4RH9 A;  2A3K A;  1XXV A;  3S3F A;  2J17 A;  1YTS A;  4Y14 A;  2PBN A;  1XRI A;  4GE6 A;  3N0A A;  3F9A A;  5KA7 A;  4DGP A;  3BRH A;  5GTJ A;  5BX1 A;  3RGQ A;  2GP0 A;  4GRZ A;  1Q6T A;  1YTW A;  2J16 A;  4GWF A;  4KI9 A;  2OC3 A;  5I6V A;  4S0G A;  4QUM A;  4WOH A;  1WRM A;  3V0J A;  3EZZ A;  3ZM2 A;  2I4E A;  4YR8 B;  2PQ5 A;  1ZZW A;  3QCC A;  1C86 A;  4GE2 A;  3BLU A;  1G7G A;  1YZ4 A;  1ZCL A;  4OHI A;  2F6W A;  3U96 A;  1PA9 A;  3MMJ A;  1X24 A;  1I57 A;  5K25 A;  5K9W A;  1G1G A;  3S3K A;  1YGR A;  1BZH A;  2HNQ A;  1YTN A;  3D42 A;  3PS5 A;  3EB1 A;  1GWZ A;  4B04 A;  4BJO A;  2HVL A;  1Q6M A;  4PYH A;  1J4X A;  1OHD A;  3O3L A;  4QAP A;  3ZMP A;  4D3Q A;  2F6V A;  2FJN A;  3D44 A;  4HJQ A;  3F41 A;  2J16 B;  4R0S A;  5KAB A;  1XM2 A;  4NYH A;  1V3A A;  1LYV A;  4WU3 A;  1I9S A;  3ZMQ A;  3QCB A;  1OEM X;  2Q05 A;  2I6P A;  3A5K A;  2CM8 A;  1C85 A;  2RF6 A;  3CWE A;  3V0I A;  4NWG A;  2IMG A;  1LAR A;  4QAH A;  3V0H A;  2I6M A;  2F70 A;  4JMK A;  4GE5 A;  3QCI A;  2G6Z A;  1QXK A;  3O4T A;  4PVG A;  2QBQ A;  2F6T A;  2QDP A;  2B3O A;  4JMJ A;  3NME A;  1U24 A;  3V0E A;  2NLK A;  3LJ8 A;  1GFY A;  2F71 A;  3QCJ A;  2NT2 A;  1JLN A;  1OHE A;  3MOW A;  1OEV A;  1NNY A;  1YGU A;  2I6J A;  3O4S A;  1YWF A;  3EMU A;  4D3P A;  1T49 A;  2B49 A;  2HNP A;  3S3E A;  3H2X A;  4HRF A;  2H4G A;  4OHE A;  2AHS A;  5KAA A;  5EHP A;  1VHR A;  2Q47 A;  3QCM A;  4WTY A;  5KA2 A;  1JF7 A;  2JJD A;  5EHR A;  1NZ7 A;  3QKQ A;  2GWO A;  1OEO X;  4KYR A;  4NX8 A;  4ICZ A;  2VEW A;  2BGD A;  2WGP A;  5AWX A;  3D1Q A;  1WCH A;  2C46 A;  3RO1 A;  1G1H A;  2E0T A;  3ZV2 A;  4KYQ A;  2OUD A;  3D9C A;  2H4V A;  1PTY A;  1PTT A;  4RDD A;  1OEU A;  1C84 A;  5LXQ B;  3QCE A;  4RI4 A;  1PXH A;  2F6F A;  2Y2F A;  2HC2 A;  3QKP A;  4RI5 A;  1KAV A;  2HCM A;  1NWL A;  2QCT A;  5KAC A;  2F6Y A;  1ZCK A;  3QCL A;  3RGO A;  1BZC A;  4NND A;  4ZRT A;  2OOQ A;  2M3V A;  3AWE A;  2VEY A;  2HC1 A;  2A8B A;  2Y96 A;  3GXG A;  5K22 A;  1L8G A;  2H04 A;  4GS0 A;  3ZM3 A;  2CM3 A;  4H1O A;  3SR9 A;  1NO6 A;  1Q6P A;  4JNB A;  3SME A;  1XXP A;  2I5X A;  1NL9 A;  3QCH A;  2B4P A;  2B4O A;  2NZ6 A;  3CM3 A;  4TVV A;  2VEV A;  3ZM1 A;  1RXD A;  4RH5 A;  2CNG A;  2I3U A;  1PA1 A;  3OLR A;  4RKK A;  4GFU A;  3I7Z A;  2CNE A;  5K24 A;  5KA0 A;  1OHC A;  2P6X A;  1PH0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...