3D1OA

Structure of the ptp-like phytase expressed by selenomonas ruminantium at an ionic strength of 300 mm
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
313
structure length
313
Chain Sequence
TVTEPVGSYARAERPQDFEGFVWRLDNDGKEALPRNFRTSADALRAPEKKFHLDAAYVPSREGMDALHISGSSAFTPAQLKNVAAKLREKTAGPIYDVDLRQESHGYLDGIPVSWYGERDWANLGKSQHEALADERHRLHAALHKTVYIAPLGKHKLPEGGEVRRVQKVQTEQEVAEAAGMRYFRIAATDHVWPTPENIDRFLAFYRTLPQDAWLHFHCEAGVGRTTAFMVMTDMLKNPSVSLKDILYRQHEIGGFYYGEFPIKTKDKDSWKTKYYREKIVMIEQFYRYVQENRADGYQTPWSVWLKSHPAKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myo-inositol hexaphosphate phosphohydrolase
publication title Effect of ionic strength and oxidation on the P-loop conformation of the protein tyrosine phosphatase-like phytase, PhyAsr.
pubmed doi rcsb
source organism Selenomonas ruminantium
molecule tags Hydrolase
total genus 110
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14566 PTPlike_phytase Inositol hexakisphosphate
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1690 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3d1oA01
3.90.190.10 Alpha Beta Alpha-Beta Complex Protein-Tyrosine Phosphatase; Chain A Protein tyrosine phosphatase superfamily 3d1oA02
4OHLA 5KA0A 5BUGA 2IMGA 1C86A 4R0SA 2G6ZA 3F9AA 1KAKA 4D3PA 1YGRA 5K9VA 3CWEA 1FPRA 4ZRTA 3EZZA 3QCKA 1NZ7A 1J4XA 3QCHA 1FQ1A 3EB1A 5BX1A 4JMJA 4H34A 2C7SA 2C46A 2Y96A 3QCIA 3S3KA 3AWGA 1ZCKA 3MOWA 3D44A 4GWFA 2NT2A 2PSZA 2CNHA 2CNFA 2HVLA 5IBMA 3QCCA 2BGEA 3QCFA 2HNQA 2BIJA 1G1FA 3B7OA 2H02A 2VEVA 1U25A 4HJQA 1PXHA 4ZN5A 1Q1MA 3NMEA 5M43A 4WTYA 4YAAA 3EAXA 1PTYA 1BZJA 2H03A 5EHPA 4JMKA 4TVVA 2A8BA 3MMJA 1NWLA 4DGXA 5KA8A 2HC1A 2B3OA 3S3EA 1ZC0A 4GE2A 3D1QA 2CNEA 4QUNA 4R30A 3S3FA 2FJMA 4GFVA 3AWEA 1NWEA 2F46A 1EEOA 5LXQB 1M3GA 2VEXA 3CM3A 5K24A 4DGPA 2CFVA 3ZMPA 4QBEA 4RH9A 2A3KA 4QAHA 2CNIA 5J8RA 2I42A 1VHRA 1U24A 5KA4A 3BLUA 1X24A 3M4UA 1Q6NA 2GJTA 1XXVA 1NNYA 4KI9A 5KA9A 2BGDA 1A5YA 1PA1A 4HJPA 1I57A 2I75A 3O3LA 2NZ6A 3F41A 1PYNA 4JBCA 2PI7A 1L8GA 2HXPA 2J17A 1OEMX 1C87A 2I1YA 4KYRA 5K23A 3ZMQA 3PS5A 1XBOA 1NO6A 1PTUA 4GE6A 3ZM2A 4PYHA 2OC3A 5K9WA 3BLTA 4NWFA 3A5JA 3QCJA 1AAXA 2B4OA 2E0TA 3ZM0A 4D3QA 1XXPA 2J16B 5IBSA 3O4SA 4PVGA 1OETA 2QCTA 3S4EA 3U96A 1I9TA 4B04A 1T4JA 3QCEA 2F6YA 2I6IA 3QKPA 2B4PA 4S0GA 1P15A 1U26A 3D1OA 3QCDA 2G59A 2AHSA 2I5XA 3V0HA 1EENA 2DXPA 2I3RA 2QBQA 5MMZB 3OMHA 3F81A 1LQFA 1OHDA 2AZRA 2NTAA 4ZI4A 1LYVA 1ZCLA 4BPCA 2BV5A 3QCGA 4GE5A 4GFUA 3D9CA 3MOZA 1G4US 1T49A 2ESBA 5K25A 2I3UA 1Q6TA 3SMEA 2QDMA 1YN9A 2QCJA 3ZM1A 2Q47A 1G4WR 2QBRA 2B49A 2H4GA 2HC2A 2GWOA 3A5KA 4JNBA 4R0TA 3RGOA 1JLNA 2QDPA 5KA1A 2QEPA 3EMUA 1OEOX 4QUMA 1ONZA 3O4TA 1ECVA 1WAXA 2M3VA 2P6XA 1G7FA 3V0GA 1RPMA 1Q6JA 1Q6MA 2VEWA 5I6VA 3ZM3A 1ONYA 2PQ5A 4WU3A 4HRFA 3F99A 2CM2A 4KYQA 4D3RA 4WOHA 2H4KA 1NL9A 1SUGA 1YTNA 2SHPA 1MKPA 3RZ2A 2HY3A 3V0IA 2F6VA 4YR8B 4NX8A 2MBCA 2VEUA 2ZN7A 1BZCA 1PTVA 2F6TA 3H2XA 1QZ0A 3SR9A 5EHRA 1YGUA 1R6HA 2H4VA 5KAAA 3QCLA 4Z6BA 4MBBA 4OHDA 2OOQA 3OLRA 2PBNA 2FJNA 1WRMA 2F6FA 2H04A 2PA5A 2WGPA 5KACA 1Q6SA 2ZMMA 1YZ4A 2OUDA 1T48A 3QCBA 5K22A 1I9SA 4RI5A 2PT0A 1L8KA 2CJZA 1YTSA 2F71A 1XM2A 4I8NA 3O4UA 2R0BA 1OHEA 1ZZWA 4ERCA 3D42A 1G7GA 3BRHA 3GXGA 2QBSA 2I4HA 3GXHA 3I80A 1C83A 4RH5A 5GTJA 5KA3A 2B07A 4RHGA 2I6OA 2QBPA 1Q6PA 4BJOA 1YWFA 4OHIA 3F9BA 3N0AA 1GWZA 4Y2EA 2I4EA 1KAVA 1OEVA 2F70A 4Y14A 2P4DA 1LARA 2NT7A 4RDDA 1G1GA 2YDUA 2CM3A 4AZ1A 1GFYA 1BZHA 1D5RA 2CMAA 5HDEA 2I6MA 2GP0A 4RI4A 2JJDA 4NWGA 5BZZA 1OHCA 2F6ZA 2NV5A 3AWFA 4J51A 4RKKA 5AWXA 3V0JA 4OHEA 2FH7A 1XRIA 1OESA 2I6JA 1G1HA 4GRZA 2B4SA 4QBWA 1OEUA 3S3HA 4NNDA 2Q05A 2Y2FA 2B4UA 1V3AA 1QXKA 1YTWA 5BZXA 3BM8A 4QAPA 1YFOA 2CM8A 1C85A 3RGQA 2CMCA 3V0EA 4WU2A 3D1HA 2HNPA 3I36A 1RXDA 3RO1A 3ZV2A 4GRYA 1FPZA 2CMBA 5KABA 4ICZA 1C88A 1PA9A 1PTTA 2F6WA 2CM7A 3V0FA 3S4OA 2HCMA 3QCMA 2OZ5A 2NLKA 1C84A 4GS0A 5KA2A 2HB1A 2I4GA 2RF6A 5KADA 3V0DA 4OHHA 1YPTA 1PH0A 2CNGA 3LJ8A 2BZLA 4H1OA 2QDCA 4NYHA 3EU0A 3I7ZA 4IKCA 2J16A 2I6PA 3QCNA 2VEYA 5KA7A 1WCHA 1JF7A 3O5XA 3QKQA
chains in the Genus database with same CATH superfamily
4NLYA 3I0SB 2DPJA 5BUGA 4HTIA 5E3RA 4LRCA 4C3KA 1IBMJ 4TXSA 3AD7C 3K89A 3K0JA 1Q5YA 4C3LA 3KLHA 5CH7B 5KFOA 4C48A 3EB1A 1S1VB 4H34A 4WFBQ 4DV6J 2I5JA 2COLA 4HYKA 5CHCB 4OX9J 4IG3A 3MAHA 4MK8A 3MEGA 2CNFA 1NJZA 1DQ8A 2OI2A 2BIJA 3R5BA 2WW8A 5HJXA 3ET6A 2UVWA 2RU9A 2RQCA 3CD7A 2LXIA 2C2EA 4V19J 3MMJA 2R2UA 4WZQA 2IPOB 2V63A 3SZ2A 1ZC0A 2ZVSA 4X4SA 2BE2B 1S6QA 2VEXA 2HURA 4LF7J 3JSMA 2CFVA 2FVSA 4BLGA 4QAHA 3CDAA 1FKAF 1U24A 2X51A 2GO8A 1RHQB 3WZ0A 4ZP8A 4LRAA 1VRTA 1WDTA 2ZH9A 2XY5A 2VBXA 3IM8A 4ECVA 2EBGA 2BJ7A 3MOJB 4WP9A 3RW7A 2RJZA 4RBUA 4RNHA 1N5SA 5KFTA 3TVKA 1VK8A 2KFZA 5C24A 2M7SA 2VODA 4F4KA 3CF5Q 3K5MA 2HZAA 2MYFA 4YOEA 4OLPA 8ATCB 1VIOA 3SQOP 7AT1B 1CULA 2L9WA 2NXNA 2V8GA 3KLGB 3QWUA 4DX7A 2CWXA 3D1OA 1VOMA 2OD6A 3KDOA 1PBUA 2C3MA 5IT0A 3KMSA 3PJXA 5KFEA 5D6GA 3M4XA 4KH1B 2UUPA 1RWNB 5IS2A 4A8QA 2CJBA 2HQ3A 1TKXB 4A8KA 2QDMA 5A2QY 5EUHA 2MQNA 1GX5A 2GIRA 4ZPBA 2JX2A 3K5NA 3RYLA 1OEOX 1VJQA 3PG9A 3G8TA 1ONZA 1JK9B 2O67A 3EZUA 2HNYA 3MEDA 1G7FA 3DHXA 4PWDA 1GTEA 2UVUA 3NGKA 4USWA 3M2RA 2YNFA 1Y9OA 1BC6A 3LAKA 4FVMA 2JFFA 5G4DA 4ILMA 2HY3A 4YR3A 4HT7A 2AEFA 3RBEA 1GXUA 4RPFA 2MBCA 4OL8A 2OPQA 2E9RX 2VPWB 1D9DA 1R6HA 3TNVA 3CWJA 4DL5A 2R8JA 3UN2A 2F4VF 2VG6B 2E1MC 4LF1A 2F63A 4DSJA 4PAAA 2ZH8A 2JVOA 5K22A 1N56A 4ZVPB 3UR3C 4IR1A 4ECZA 1MNEA 4ZPCA 3R5DA 2MGZB 2Q1LA 5J2QA 1Y4ZB 3KG0A 3GXHA 2HHHF 2V2KA 5GTJA 4W90B 1QUVA 3KLEB 2M2BA 1RHMB 1Q7YT 1JNZB 3CE8A 4C8NA 4BJOA 2HVEA 1CLFA 4NLGA 3HVTB 2Y1IA 2F70A 2RRNA 4EFAC 2IFXA 4RDDA 1FKOA 4AZ1A 3BYRA 3SSQA 3M32A 5J2MB 1P9YA 3BGLA 5CXTA 3IM9A 4KBIA 3FGVA 4DU8A 2YVSA 2W8KA 1G1HA 1BGXT 5KFUA 2J0SD 5JUMA 1PO6A 4YY3J 1RT6A 2B4UA 1Y0HA 3TUIC 2HS3A 2OSRA 3H2UB 4HL9A 1XQIA 1ZZNA 1FDDA 2BBEA 1FRKA 4AQYJ 1IXKA 2IMWP 4UF4A 1BHNA 3SCLE 3J80Y 2KTQA 2CMBA 2J9DA 3QZ7A 1SC1B 3LOUA 3UVJA 2F6WA 3EUNA 3KLIA 4L75A 3HDSA 4IFVA 4WWSA 3W2WB 2XMUA 5LXYA 3TUJC 5KG7A 2WVDA 4GVBA 2CNGA 2HLUA 2L48A 8RUCA 2KG1A 4Q0BB 4EYIB 3I7ZA 2K1RA 4XDDA 3N0VA 2A18A 5IQ6A 3UNYA 4Y34A 1ZAXA 1SJRA 4FS2A 3G9CA 4R8UB 1F0XA 2HZCA 1KAKA 1FFWB 2YWKA 3FCHA 1NB7A 3NGDA 3UD3P 2BABA 5HLFA 1N33J 3HFVA 4ZCIA 2BW7A 3PTWA 1JXLA 3V81B 2FY8A 4ZMMA 2DHHA 2J6UA 2IVMA 1FERA 2PEHA 4Q2LA 1APSA 4ATNA 2GCFA 2VKRA 4Q45A 3HHEA 5HBMB 4RW6B 4NXNJ 2LQJA 1HQUA 4CT8A 3EAXA 1DBDA 3IAS9 3R5CA 1I6JA 1VQYA 2A8BA 3CCUS 1VHFA 2ZD1B 2HC1A 3S3EA 2VH7A 1RABB 3W61A 4ELVA 1JBVA 2EWHA 1VQOS 1S5ZA 4R30A 1KD1T 2CJYB 2AZ1A 1WHYA 3KNAA 5F8MA 1T02A 1UA1A 2F46A 4WZMA 4B3SF 1RAGB 1N36J 4Q7AA 1IQTA 3BQ0A 5E33A 2IM0A 5T7LA 3SYZA 2RRAA 3LANA 3KXDA 1F9HA 3M4UA 1X9WA 2BR0A 4UW2A 3G82B 1A5YA 2MLXA 4X65F 5KFCA 3C6UA 4HJPA 2Y66A 3HPOA 3PV8A 2BANB 2KB2A 1YJVA 1HFEL 4JBCA 3L4BC 1YJNS 2HIQA 2EW9A 2HXPA 4NLRA 4KSEB 4DR6F 3C15B 2MMYA 2XC9A 2OSQA 3ILJA 1GQEA 5L46A 4RUCA 4GE6A 1JQGA 4K4UA 2XSJB 3CB4A 4RX6A 3A5JA 2X1BA 3MPYA 3HSDA 2VQFJ 3VAGA 1MG7A 3UDCA 4IRDA 2BJ3A 4ES1A 1QAJA 2G2ZA 4BC9A 5KFAA 1RZMA 3E51A 4NA3A 3KLHB 1MN9A 4NLWA 1HNXF 3ZTQA 3V0HA 3GYXB 3F56A 1U47A 2ACYA 2CKWA 5D0RA 2ZC3A 1G2EA 3NS5A 2I5JB 3QGGA 4IG3B 1G4US 4KGKA 3MEGB 2J0XA 1QVGR 4WFYA 2FB0A 3VGTA 2BX6A 1BD6A 2VJVA 1SC6A 4NMXA 3DXBA 1EQMA 2QEPA 2RKIA 4QUMA 1W7WA 2DR8A 3D4JA 1R8AA 1U45A 1RPMA 7FDRA 4IO1A 5AE1A 4LF8J 3CDWA 2PQ5A 2ROEA 3L3CA 5CD4A 3F99A 3ZTRA 1D09B 4K7QA 1X4BA 3Q8QB 1FRMA 3OR2A 3H40A 1S6QB 4DV0J 3FBEA 3L9ZA 5G0RA 3MPWA 4E8UA 3JSMB 5EN1A 3D6FB 1Q8BA 3ZZPA 3R2CJ 4QYZK 3CDBA 5KAAA 1TKZA 3NEKA 4MBBA 1VRTB 4ZDNA 1N5YA 1FFGB 4EUVA 3OTDA 4I64A 2PT0A 3TZWA 5EX3A 3DRRA 1OHEA 1IVZA 1EX8A 1YTYA 1JJHA 2ZBPA 5C24B 1R6VA 4EZ9A 4URSA 4QJVA 2V8PA 1U0HA 4CT9A 1VQ5S 3CJQA 4CLWA 4DR5F 3FZ2A 1NH7A 4OHIA 1CULB 4MMOA 1WKKA 4Y2EA 1B4SA 3KJQB 4U8YA 2B6AA 1IBKJ 5KFZA 3OTOF 4CLSA 1LARA 3CPWR 4QCLA 1I51B 1DRZA 5F8HA 1JLBA 2W4CA 2RSQA 3KDNA 2AJFE 3SIPB 1U8SA 1R0AA 4K2XA 2DNGA 1XMBA 2ALZA 2VOSA 1NHUA 1OESA 2CVEA 1T9XA 2DIVA 1SCJB 4PKDB 1UAWA 1LW0A 2D3OR 5IC6B 1UZDA 3JQKA 2HNPA 4DV4F 4OJHA 2EKNA 5KABA 2HNYB 3MEDB 5B0GA 1HHTP 1O6XA 2CUYA 3BS9A 4PWDB 2AF6A 4F0HA 2AEJA 3M2RB 4ZJLA 2YNFB 3NNCA 4IQXA 2J7UA 2NUUG 3TW0A 1TUWA 4B3MJ 5KA2A 4QWAA 1RBOB 4UUXA 4FNHA 4USJC 2OPQB 1VMBA 5DLGA 3MGJA 2VEYA 4AL6A 1JJCB 4RWWA 4JI1F 2AM1A 1H2VZ 3Q89A 3MM5A 3I9ZA 2RNEA 4ZS6A 2G4BA 3OL8A 2YX4A 4JI7J 4MJKA 5J2QB 1HNIA 2C7SA 3PCOB 4NPOA 3MOWA 4PUOA 4GWFA 1WEXA 2X1AA 5B7WA 3ILOA 4DDFA 4A8MP 4LF2A 2HNDB 1PYOB 2HG4A 2RQ4A 3ZZZA 4Y2MA 1RA6A 2ZE2B 4LSNB 3UD5A 1PXHA 3BH7B 1GMVA 3T5LA 2LQ8A 2C1EB 1FKOB 5EHPA 4P71A 3M32B 2U1AA 4Q5VA 4H4KC 5KT4A 2NPIA 2E66A 1P1TA 1NZAA 1I3OB 1EEOA 2VFVA 3OXLA 3NS6A 3J81Y 4DGPA 3M8PA 3Q22A 2I42A 3LQVA 3GZ7A 3W8GA 5KA4A 3UQSA 2CJ9A 1Q6NA 2LXUA 4ZOSA 3PIPQ 1LWCA 2XM3A 2WONA 2GAHC 4IH5A 2L9NA 2HNZA 3C6TA 3LGNA 1WJ9A 3JQJA 3UVJB 1XIQA 3KFWX 3DLEA 1U2RA 3KLIB 3TRGA 1DJ0A 1TZ0A 3GTYX 2M52A 3CCMS 1TU0B 2W7AA 2ZJPQ 2E9ZA 1CPZA 2YWEA 4GVBB 4NCAA 2E29A 2Q6BA 3IG1A 3OSPA 3QCJA 1S0NA 2LMIA 4DR7F 2K7JA 3QSYB 4BHQA 1PC4A 3Q24A 1C2PA 3TI0A 2KXNB 3QCEA 4JI8F 1U26A 2V34A 2L41A 1GNKA 1TKTA 1C1CA 3IMQJ 5HLFB 1VQ6S 4K50A 3MTJA 4FXDA 4DR2F 5F8NA 2QBQA 2FHJD 2OMOA 4DZDA 3A3PB 3G6VA 1KONA 2UP1A 2VV5A 4PG5A 4GE5A 3LK7A 5AXMA 4UOFA 4DCPB 2Q47A 4PG4A 1GQYA 2D9PA 2EFNA 2PIIA 3EDRB 1HQUB 1PG5B 3N5FA 3AOAA 5IFMA 3DRPA 1RK8A 1O51A 1WELA 2N4CA 3O4TA 4TQRA 3PKYA 4GO7X 2P2CB 1JMTA 2G0JA 1GQQA 5E5NA 2CNKB 1RT4A 2XPCA 1A6LA 5HQMA 2W9CA 4LF9F 2WHOA 1V5IB 3BB5A 1S10A 3MR3A 2PA8D 4OLOA 3RZ2A 4UT4A 4YHHF 3RRHA 2NS1B 2DK2A 4AXIA 5D0HA 3K8VA 1G4CA 1QZ0A 5HMWA 1WWHA 2K7KA 1R0CB 3DRSA 3NKYA 2HGNA 2PBNA 1DAXA 1RWMB 1FNOA 2BUNA 3C6UB 2RDJA 3CC2S 4JI4J 1T48A 1KHWA 3VR1A 3ENWA 1GXLA 3OXGA 2Y1JA 3PYGA 1YX2A 1FE4A 1FKPA 5M2RA 1J2VA 2QBSA 1G7CB 4BDPA 1UPMB 1C83A 4DFKA 1RT3A 2PMZD 1RWXB 1SL2A 3QRRA 3CJ2A 1HLWA 2E9TA 3N5BA 1YWXA 1RTDA 4LRFA 1IR1A 2AGQA 3Q2SC 2LEBA 2H65B 1Q8LA 3V4IA 1IQZA 4RL1A 1L3VA 2XMAA 2I6MA 1R6YA 4DN0A 1A7GE 3RG6A 3K5PA 3ZFVA 1VC6A 4I0WA 4M5IA 2IRUA 1WD6A 5LSLA 1KWMA 3OLBA 3PFEA 4NNDA 1X5SA 3TQ1A 3IC1A 3SQGA 3IRXA 4J91A 3BM8A 1QLNA 3O1LA 2XY7A 2OPRA 2FLLA 4M5DB 1H98A 3UDEA 1GMWD 3KJNB 2RKIB 2K06A 5BYRA 3AOBA 5DQIA 4B9UA 2FVRA 1JLGA 4LSZB 1ZAWA 1FRLA 5KFFA 1F5CA 3FQLA 4TVAB 4WKRA 3P45B 3S4OA 3NG8A 4OYMA 4F4AA 2NLKA 2LYVA 1KRPA 3TX0A 1RBAA 2F3JA 4YR0A 3OR2B 5HI7A 1UFLA 1YPTA 4CWBA 1EJ7L 1O0PA 2J7KA 2QDCA 3RUBL 3AH6A 3PJ9A 3Q8RB 1TKZB 3BQ2A 4BUCA 4B3TF 1EETA 2NZ4A 2J0WA 4L76A 1NKEA 1JF7A 4AD6A 3EE3A 5BYQA 1N5YB 4JYAJ 2G6ZA 3UPFA 4ZVOB 2VDIA 1VBXA 4WF9Q 2OD4A 3D6MB 2V2ZA 1U49A 1R8PA 2OMLA 3PRVA 3KUHA 1S99A 2MXYA 4DR4J 1RWVB 1Y3JA 4PABA 5GMKa 5BX1A 1FX4A 1WF2A 2D3UA 3S3KA 1S9GB 5DQHA 4C97A 3RR7A 3HHLC 3OR1B 3T6JA 3IO1A 2W7OA 4X62F 4ZCLA 3B7OA 1SPBP 3QBCA 1TMMA 2WZ1A 2VA3A 2B6AB 3M6VA 4C6AA 1ZYQA 2UVVA 2BW2A 3KHHA 2H03A 1ZS6A 2XG8A 2W2MP 1JLBB 4MKAA 3IWNC 1QE1A 2UXBF 3IRWP 5DM7Q 3GV7B 3CCTA 2NZCA 3RB3A 2DKOB 3S6EA 3K57A 3D1QA 1R0AB 3GU0A 4M95A 2H9ZA 1N34J 3AD9C 5J1PA 3NWRA 2HBZB 4F4ZA 2MKCA 1TELA 1PBAA 3MR2A 1LW0B 3NMAA 3M8YA 1F3FA 3IAM9 2FD2A 4OYZA 1Z4UA 2UVRA 3LTOA 3DOKA 2KU7A 2M4MA 1RHJB 4DX5A 2HFUA 2Y1OA 2W2QP 4ZN3A 3I6PA 2J9CA 3F41A 4GC7A 1A0OB 4JI0F 4KY3A 2OJ3A 2H5JB 3WIUA 2GX8A 3NCRA 4OZ3A 2C3YA 4FVCA 1RT7A 3BF4A 3IR6B 4K4TA 1CJUA 4HACA 1FNMA 4F67A 2BVZA 2XYPB 3BDPA 2QL7B 4F4XA 2B4OA 3JXOA 3G86A 4CH1A 2XCAA 3X1LB 5HANA 3NXZA 4W92B 3VHQA 4YB1P 3MF5A 4J9UE 5L1JA 2CQ0A 4ED8A 1F9FA 3MM5B 3Q2TC 2F6YA 1T9TA 2DNQA 1F2HA 1MN7A 3BH6B 3CDUA 2JLFA 1M1GA 1GAOA 1Q8IA 2DXPA 2VQEF 3HCXA 4M5HA 4CM0A 1HNIB 3O8WA 1NDPA 2AJ4A 4A48A 4PUOB 3QCGA 4FPRA 1DQ9A 1YN9A 4LFBJ 4U6PA 2IYGA 4FF2A 4JI2J 4Y0FA 2B43A 3EMUA 4E98A 2DD8S 1IBLJ 4A8XA 1CC8A 1RLDA 4ED3A 3MEEB 1HQEA 1NK4A 4QPXA 2CPZA 2C3OA 2YY3A 2QA1A 4H4MA 3BO2A 4OV6A 1UAGA 1Y3KA 1LWFA 4MKVA 2AX0A 3M8PB 1S57A 4PXDA 2W2OP 2M70A 4Y2KA 1U6BA 3I4PA 2LXFA 3C16A 3PVXA 5HQ8A 2WONB 5CQGA 1Q6SA 2ZMMA 1YZ4A 2HNZB 3C6TB 4ETZA 3GFXA 3LPEA 4ZLPA 2YBVA 3WC2A 3K58A 3GYNA 1DY3A 1V3RA 3T9ZA 4A47A 3DLEB 2DH8A 4CO5A 1WOOA 3EGNA 1K8AT 4EMDA 3BRHA 2JVRA 3KWMA 2RE1A 1QJHA 2G2OA 4TU8A 1IKVA 2YNGA 3IG1B 2AT1B 4N8OA 3FEXB 1Q6PA 2CQIA 2DNPA 3F9BA 2FJWA 2QEXS 4JV1A 3OT9A 1OWXA 5IT9Y 1XBWA 5IC4B 4WP8A 3A3NB 1RAFB 1TKTB 1DTQA 4LBHA 1C1CB 3ITHA 1N6QA 2NV5A 4DU7A 5JJBA 5K9FA 1NDKA 2ZM6J 1LWEA 3OPKA 2QG9B 5CYMB 1S1WA 4OYPA 1V3AA 2KYZA 2V8DA 1CJTA 4EBDA 3RGQA 4M8LA 1U02A 2O1PA 5F41A 1EAYC 4CLFA 4DWIA 5AJ3J 4B3RF 3R9LA 2I8EA 3I5AA 1PA9A 3L7PA 2R2SA 5E3AA 3RAXA 3TEGA 1B7FA 3QCMA 1RWWB 2DPIA 5HMXA 1MMDA 3D7SB 3KJFB 2W9CB 2OFHX 5KT6A 3BGUA 2HB1A 2RF6A 4F7VA 5B08A 1PH0A 1JJ4A 2AMCB 4LUBA 1SC4B 3LP1A 4NX9A 3DRSB 1WTBA 4LF5F 3QKQA 1VQNS 4R0EA 2BE9B 4CRJA 3MMCA 4P2XA 3KK1A 1LK5A 1VHIA 2G0CA 2GAGC 5KFVA 2IMOA 2RS8A 4OZ0A 3QCIA 1AXQA 2UZAA 4DPOA 2HWTA 4G1QA 1FWLA 4CLZA 1RT3B 3VQSA 3HT3A 3PW2A 3OQ2A 4MK7A 3Q86A 2PI5A 5B0DA 2YKAA 2RDDA 4RNMA 4DL4A 4X4UA 2LEPA 2GS8A 3JSYA 4HJQA 2PMHA 1MW7A 2C2RA 1BE4A 1RTDB 3CTRA 2AYBA 2FGCA 2K2PA 2IM2A 2NCKL 5DS7A 1BZJA 3D68A 2LU2A 2ZZMA 2A0FB 5EX0A 2GQQA 4DF4A 1N4LA 3MMBA 3D2WA 2XYGB 2QV6A 1NKCA 2QZ8A 4YP3A 4GFVA 5BR8F 4ECWA 4ZIYA 1NWEA 1X8DA 3O5TB 4KGVB 4HI1A 2PD1A 4U7UD 4QU7A 2DNKA 2NYHA 3SQGB 5GAGI 3OXFA 4QW9A 4EK2A 2ZITA 3GJQB 2YKPA 1OO0B 2JDJA 1HI1A 4FYWB 1VHRA 3T1YF 4NLPA 3BLUA 2OPRB 2ZKUA 2KZZA 2H54B 4P7VA 5ETLA 4HT5A 1GTHA 1WUUA 2GIQA 1JLGB 1JXEA 4CI0B 1HWLA 3KMQA 1WHXA 4CQ1A 3ZTOA 3BSNA 3VGSA 2A6OA 4G65A 2MKKA 1SKSA 2H3EB 2PI7A 1L8GA 3BR8A 3GCXP 4PCQA 1UW4A 1C87A 2DB1A 3BZQA 2V50A 4FZVA 3OL7A 3GV5B 1RHRB 3A8IA 2LA4A 2OC3A 4P10A 1AAXA 4B02A 3K7RA 4DJBA 2E0TA 3DLKA 1IKYB 3IFEA 1HW8A 3CC4S 1WI6A 2ZDPA 2MKJA 2WJPA 5D0GA 3H59A 2MKIA 3HF5A 2ZDOA 4ECTA 3KHGA 3DLGB 2HWHA 5DDRC 3M05A 4DQSA 4NEYA 3AXMA 2MZTA 3BREA 1U09A 2WAQD 4JI3F 5DG8A 4O3NA 2HC2A 1N0VC 4RWXA 3GR0A 2QMUB 2JC1A 1P27B 1D9AA 3M9NB 1WAXA 2J8AA 1QE1B 4DR3J 1M5OC 2MY8A 4DZ6A 5FIIA 1UWBA 3LH2S 4V19X 3H90A 1W7KA 2RVJA 3NGUA 3QGIA 1RWOB 4USMA 1UETA 1VR6A 3N28A 1VBZA 1K44A 1R7IA 4PWWA 4RNFA 4WCEQ 4Y65A 2H4VA 1SQGA 2OOQA 2QFIA 5GADI 1Z2ZA 3DOKB 2WGPA 3LP2A 1N32F 3LPYA 1KOHA 1YBUA 2UUAF 4HHJA 3IR5B 3OUYA 5IOLA 4NLUA 4ED2A 4YDXA 1KVJA 1VQKS 3PJWA 2IM1A 4ZP6A 1U1NA 2JZ5A 4NI2A 1G7GA 2I4HA 5KOWA 2JEFA 1RT7B 3GWCA 1CJUB 4HACB 4CO0A 3PIOQ 5KA3A 4OHWA 3RJMB 2X1FA 2UUCF 5A6WA 3JAMU 1YWFA 1S48A 3UN5A 3AODA 3N0AA 2VL1A 5B0BA 3EXCX 4KT0C 1J5EF 2H5EA 2CM3A 2CPFA 1GFYA 1D5RA 2KVQE 3JSBA 2CMAA 1JBWA 3D54A 3GCWP 3DOMA 4F8RA 3KYLA 1FTCA 3X3UA 2DXFA 4Z7YA 2IRYA 3D9BA 3ZC4A 1AZSA 2XWXA 1RAJA 4A8YA 5LMNJ 5IXUA 1X5PA 4FF4A 2BKOA 2HS4A 4I69A 2CFXA 3PXGa 4RNOA 2EPIA 2N4DA 2DH7A 2KRRA 2JRSA 3FFIA 1EQ0A 4PQAA 1YQHA 3KKFA 2CPJA 1RSCA 4AL7A 4USVA 3WBZA 2VKZG 3ADAC 4H4MB 3H20A 3KHLA 2D3O1 5IWAF 1LWFB 5F8LA 3V0DA 2BDPA 2A6MA 2VHGA 4CH0S 2YNHB 4TN2A 3C16B 5KA7A 1UJ4A 2DHXA 5AXNA 4CO4A 1HBUA 4LFCJ 4OHLA 1C86A 5HK4A 2M8DB 1XMOF 3QCHA 2ZVIA 1X4EA 3H5UA 1H73A 1ZA1B 3M1VA 4AE5A 4DV5J 3FJ2A 1GG4A 2AWZA 4IOCQ 4LFAF 5F9NA 1HHSA 3SCJE 4HDGA 2HVLA 1SQFA 4LMZA 1QUPA 1G1FA 2J0QD 4MK9A 1R8CA 4CLTA 3HT0A 2V8VA 3K2YA 2J5AA 4X4RA 4FPIA 2BMBA 1DTQB 3B6BA 1S9EA 4X66J 2WSCC 2D41A 3ITHB 4DV2J 1HA1A 1N6QB 2RHQB 2NLWA 1KC8T 5IZHA 4NLVA 1WHVA 1LWEB 4TLRA 1C0UA 2VG7A 2OHDA 1S1WB 2Z57B 1FX2A 3DOLA 4K5RA 2HVDA 2XULA 5DETA 2V94A 1DARA 5J8RA 1CJTB 4OI0A 3MUMP 3TX8A 4PRFA 1M0SA 4GC6A 4H4OA 3FC9A 1FRHA 3I87A 4LIWA 2NXCA 2FQQB 3FSYA 3D6TB 4NASA 5BXIA 5LOQA 5M2UA 4DPXA 1X31C 1TK8A 3CCZA 3G96A 4WPAA 1XWLA 4OHXA 4B9TA 2UUBJ 3MM8A 3FSIA 4ZJQA 2BKPA 2YKQA 3FVYA 2EK1A 3LP1B 4OMFG 5LJ5Y 2VA2A 4ANDA 3DDIA 1OETA 2YXLA 3HM9A 4DMZA 4YMEA 5J1EA 3OTBA 2CPIA 2I6IA 5I3PA 4S0GA 2KJVA 1FDNA 2ZBCA 3MMCB 4TU9A 4OYXA 2Y1LB 2I5XA 1KN6A 3THTA 3KK1B 2HVIA 3O44A 1T11A 1VIXA 2XGQA 4LQ3A 3F81A 4PXCA 1M5VC 1SQEA 4JB8B 1NBEB 4G1QB 2DGSA 4ZIWA 1ZCLA 3VZIA 2HMIA 1QTMA 4FF3A 3W9HA 2QCJA 5K5MA 5KT5A 3FCVA 1G4WR 3I5BA 1GT8A 5L9NA 1HNWJ 1FJEB 1D8YA 3HKWA 3I4HX 4P2FA 4ES2A 4GKKJ 1NHVA 3EJMA 2K3KA 2B8PA 1HKAA 3MMBB 1IJFB 4HTJA 4CVLA 2Y68A 4WOHA 1FI4A 3GIJA 2I38A 1SI9A 2BZ2A 4JI6F 2NYIA 1BZCA 4TY9A 2UXCJ 3OLAA 3GSDA 3Q8YA 4RUHA 5CABA 3T9NA 4KHPF 3HI9A 2FJNA 1BUXA 1LKZA 2HHPA 3U02A 2UU9F 3E2EA 4DV3F 2CQPA 4J9PA 3AA9A 2CJZA 4TKTA 3PDNA 3ETOA 1Q86T 2QLBB 4CNYA 1K47A 1UEKA 2QJ3A 2FTRA 3NWGA 4DF8A 3VVUA 2XB2D 2BRLA 5LMUJ 4OX8A 1AROP 2HQDA 2I6OA 3CCLS 3DLKB 5GVQA 2NXEA 2BJ1A 2LU1A 3SMZA 1J5OA 1XK8A 4RUBA 3ZZTA 2PFFB 2FJAB 3P4UB 3MI7X 1J27A 3QRPA 3PACA 5HDEA 2CRLA 1TKXA 4FYVB 1V3SA 5K20B 2E1CA 4WXWA 4IRKA 1ZOTA 3FUYA 3NP5A 4EI2A 2Q79A 2F1FA 3ZL8A 2KT5A 2W2NP 2FLPA 2OTJS 4DPTA 3LW5C 4B08A 1Q4RA 2B8QA 1X60A 1EKRA 2CMCA 4ZCMA 4OYOA 4C8ZA 3Q8VA 4ZVHA 3H5YA 3CMES 3HO1A 4L74A 2OEMA 3N79A 5A0YA 1XEZA 2BJDA 3MM9A 2OGUA 3F73A 1UWBB 2Y0SD 2OZ5A 5GADU 3BQ1A 3OL6A 1RE1B 4USKA 2R2RA 4FF1A 2XYHB 1YRXA 4JI5F 2VG6A 3ZTSA 2EFPA 4FDFA 4XK8C 1FXDA 2MDAA 1BXNA 2AQ4A 4DLEA 1H0HB 4GKJF 3U27A 1EARA 4DL6A 2ZEJA 3O5XA 3LP2B 1IM6A 3LA0A 4O3SA 3RRKA 3DLJA 3BGRB 3OUYB 1YGRA 3W9JA 4C11A 1ZPWX 1FQ1A 1YI2S 2Z8QA 4IUFA 6FDRA 4NLDA 4J9MA 3D44A 1VLOA 3DXSX 5J2MA 4DUTA 1J6UA 1RCXB 4OZ2A 1LFWA 3QCCA 2LP4A 5IQQA 2IAJA 1XNRF 1U25A 2EK6A 3TP2A 4ZN5A 4EZ6A 4P75A 3UDVA 2PA3A 3ZXWA 2KVIA 3QGPA 3RAQA 5M43A 2A2DA 1XR6A 3R6GB 1YJ7A 3J7YU 2E5LF 4TVVA 4CLLA 2B3OA 4X64J 5J1NA 3VGVA 2BJEA 3DOMB 2W9BA 2B56A 2CNEA 4QUNA 4RU2A 2FJMA 4ZHRB 2B9XA 3AQOA 1H38A 1AZSB 4NCBA 5LXQB 2WSEC 4FYXB 1S59A 2CG8A 2UV8A 3D0IE 4WYLA 3PW7A 4R0JA 2YQ0A 1S79A 2GHWA 5C2CA 5C5JA 4OHYA 2GJTA 4EO8A 2CPEA 2MZJA 2DGWA 1HBOB 3AXKA 2XS2A 3I0RA 2M8HA 3FFIB 3NNAA 1Q81T 1FJ7A 4BCAA 4P9SA 2ATCB 1JLAA 1R27B 2ZH4A 5KG2A 2YKNA 4I67A 4MTPA 2AV5A 4M5MA 2F4FA 3KK2A 3G71S 3BLTA 2YX7A 1FF2A 1XNQJ 2CZ4A 2EKYA 1M5SA 2YKMA 3V81A 1KVKA 3O4SA 3T1AA 2QT7A 3MECB 1CJKB 4N76A 4RZRA 3QO9A 4RLEA 4X2BA 4C8OA 1KOOA 3WC0A 4KB7A 2B4VA 2Z0GA 3CEDA 1UMJA 2C42A 2IRXA 1TFWA 5H9FK 4O44A 3TQEA 2JL9A 3QT6A 3ISND 1REGX 3T6BA 2LCWA 3LWMA 2CXEA 4L3KA 1LQFA 3TYTA 2NTAA 3EZ5A 1E6VA 1RAHB 2NXUA 1H2UX 1ZTWA 4LVOP 1R0BG 2A10A 2L3MA 2I3UA 2F65A 3R97A 3ZM1A 2J7WA 3N4WA 4RW4A 5H9EJ 2QDPA 5C42A 1EP4B 2HRUA 1AW0A 4DFMA 1Q1KA 4LT6A 1ECVA 2M3VA 4A8OA 1KLNA 3T5HA 1S9EB 4LF6J 4C7QA 1RU2A 3UI3A 4E0DA 4K0KF 1S6UA 4WK3A 4B9VA 3GG0A 4KYQA 3QJJA 1IWGA 2RU3A 1N5TA 1NH8A 5EWGA 5BJRA 1C0UB 2VG7B 2CQ3A 4YB7A 3DOLB 3R1LA 3PRBA 1AA1B 3EX7B 3R8YA 4CLUA 1YJTA 3DRYA 2XTJP 4OHDA 4JP8A 2JFKA 5KACA 4H4OB 3D5MA 2OUDA 2PEBA 2CNLB 1OSCA 1I9SA 4DPWA 4DUZF 4HHUA 1FJGF 4O4GB 1UJ5A 1RYSA 1YLXA 4DQRA 4ZVUB 3L7OA 2NSBA 1SKRA 3FMWA 3GFYA 3MM8B 4XIUA 3CGIA 2M3DA 2RT3A 2HFZA 4NWBA 1IBCB 3PW0A 2XZDB 2DH9A 3FBBA 3JB9k 5HL7Q 1RHKB 3T1HJ 1OYEA 1TKDA 4QU6A 2C2NA 1OS5A 2Y8WA 3DRXA 2MSSA 1HWKA 3CCSS 1B70B 5J1EB 9ATCB 1LFPA 1HNZF 4OHZA 5ETQA 5BZZA 2J6SA 3IN5A 3JYTA 2UXDF 4M94A 2BQ3A 1XRIA 2V2VA 5CYQA 4QBWA 2QYCA 3FK4A 5KG5A 3GV8B 1OEUA 3S3HA 4F02A 4NZ7A 3LF0A 3W5YA 1G1XA 4Z2XA 3N2AA 2HMIB 3BN7A 4O3RA 3GJTB 1URRA 3NOCA 3R6LB 1RTHB 4ELUA 2DY9A 4AXJA 3DYAB 1NRKA 3GONA 4OZ5A 2MQOA 4DQPA 2R8KA 5LL6d 1I94J 5B0CA 1ZAVA 2KH9A 5SZTA 4DV1F 1HR0J 2GW8A 4QWBA 4K5SA 3KHRA 2I4GA 2HBYB 2OLWA 2B5JA 2ZUAA 3GB0A 3IA0A 2GA7A 4LR7A 1PYSB 3QFWA 3EU0A 3BO4A 4P72A 2J16A 2D9OA 3PYEA 1XMQF 1RQ0A 4YB6A 4J9SA 4XO0A 3GFZA 1FXRA 2LQ9A 5KA0A 4FKYA 4CLYA 3J7A1 4JV5J 1FE0A 1PSDA 2VOOA 3PHTA 2R7XA 1YBTA 2JNJA 3CCQS 3EGZA 2G0IA 5ETKA 2LEAA 2C46A 1R3NA 3OBIA 2ZZTA 4YN3B 3QRQA 2NT2A 1UJ6A 2CNHA 5KFYA 1RT2B 1NM2A 4D3HA 5CAAA 4S0MA 1NDCA 5KT3A 4DUYF 3M6WA 1J5OB 4PQUA 2MQMA 3NMEA 3JSRA 4WTOB 4W4MA 2KN4A 2E1RA 4DXLA 1SIWB 5KFMA 4F3QA 3AD8C 4DPUA 2YH1A 3WIVA 1TL3A 1LWXA 4XTTA 4P7TA 2GMLA 1TMJA 3IWLA 1M3GA 4MIWA 5E7OB 5K24A 2DHAA 3POTA 5HO4A 1M1KT 5B0FA 3CNQP 1RADB 1U7LA 4OYWA 3WHIA 2GGPB 3VAIA 5KT7A 5H9EK 5A0YB 5ETRA 3MM9B 2AHOB 2L08A 4OYAA 4C8YA 2KO1A 4DG1A 1N5QA 3MMAB 2OFGX 4WXOA 1RI7A 4O3OA 3BPSP 1SBRA 2HZVA 3QGHA 1MLAA 2HHVA 1WEYA 4F2SA 2FHKA 3ZMQA 3UD4P 1WC6A 3HX9A 4MYUA 4CO2A 5ETTA 5EWEA 4NWFA 3AA8A 2ZOMA 1XXPA 4DV7J 3DHWC 3HP6A 2OO4A 2OEKA 3W1YC 3CJRA 1X9SA 3FNNA 1VQ4S 1VGYA 4ZVQB 5A8KA 1REVB 4I56A 4C11B 1IBMF 2HNDA 1LOUA 2ASJA 2YPYA 5E2QA 2ZE2A 3QIDA 4LSNA 2HFNA 4HDHA 2JFGA 4DV6F 4RW8A 2V2QA 4ZI4A 1C4CA 2XMMA 1T49A 4OX9F 1Q6TA 3P5TL 3BM7A 1Q78A 1YDLA 3A5KA 1U48A 2IAJB 1L5UA 4JNBA 3RGOA 1UVIA 4DFJA 1U4BA 3NCPA 3HD1A 3MD3A 3M2UA 3QYYA 1T9VA 2E7VA 4QYZJ 4KHRA 2V9KA 2QRRA 4U8VA 2W9BB 1S4FA 2FVCA 4X4PA 1Q8KA 1SJ1A 3S01A 1WI8A 1EHWA 5D8HB 2BQRA 2RUSA 3CO0P 2WRMA 1IR2A 4PYDA 4Y00A 2EFGA 1HD1A 2GHVC 3VV2B 2FUG9 3OVSA 2WVCA 3W62A 4LF7F 5D3GA 2BACA 2VD3A 3TJ8A 2DNHA 3NCQA 2OH2A 2MJNA 1KFDA 4LR9A 2K8GA 2IC3A 2XNRA 1U2CA 3EZOA 3I0RB 2CQDA 1UP1A 2DNLA 2CYYA 3W3SA 1ZZWA 1TVRA 1SH2A 2MKYA 2W2PP 3W60A 5KFXA 1AT1B 5DLFA 3A3OB 1JLAB 1K73T 4I6AA 1RAOA 3I80A 2BA9A 2YKNB 3KOAA 2R4FA 2VICA 2P8IA 1WNEA 3KK2B 2KXFA 3ZNUA 3CVKA 1TAQA 3DKDA 1NPPA 3D6HB 2YKMB 4ZCKA 3H7HB 2GNKA 1UPPA 2HQGA 4N47A 3VVTA 3QO9B 2YDUA 1F1BB 2F9JA 3FRZA 2I0XA 5K8PA 4ZLLA 4NXMJ 2HEKA 2MKHA 5GAHI 4O44B 2ADBA 4U95A 5AWXA 3TJ9A 4NLSA 1BMQB 1WKLA 5I3QA 1Q79A 1RA7A 2I6JA 4CVKA 4UOCA 3PW4A 1E6VB 3TAMA 1WOSA 2Y2FA 1QXKA 5D0EA 1N5VA 1D0EA 2X1GA 2KFYA 1YFOA 2CM8A 2H1YA 3MFIA 1SH0A 4K2JA 1PAUB 2VZ9A 3D67A 4RW4B 5KAKA 3R27A 1FGSA 1U1KA 5C42B 1NK7A 4OI4A 4DLGA 1RAEB 1MSWD 4J9KA 1CSJA 3M8RA 3P6YC 2GJIA 3QT7A 2C28A 1NSAA 4B9LA 4P6QA 3H2VE 5DGAA 2QMXA 4EGLA 1SC3B 4OHHA 3PZPA 1BQMB 2AP6A 5F0WA 4IKCA 3PX0A 2BKNA 3GQCA 3LWLA 2WK4A 2XMTA 1IR0A 2MZRA 2JFHA 1HI0P 1FPRA 3MCNA 2VBZA 1VQMS 1Z1ZA 3C66A 4M5LA 2RDIA 5HAOA 5EDWA 4B3OA 1FO1A 4OZJA 4DS5A 1HYSA 1MMNA 1UA0A 4JV2A 2HGLA 1NK8A 2E5HA 1B0PA 2XWYA 1YZ7A 3BEGB 3PW5A 2Q3PA 4HR2A 4IH6A 1EZZB 1SVDA 3K8WA 5T41A 5KFKA 2WTZA 2XZTB 4QOTA 3RBXA 1KR4A 5DRKA 4DGXA 1NWLA 2XS7A 2KL8A 1NPRA 4M5DA 3JYTB 3GMGA 2W8LA 1MROA 3O6QA 3FSXA 5I3UA 3AWEA 5CYQB 3E8OA 1NJYA 4WFAQ 4YY3F 1WORA 2MKSA 4RH9A 2A3KA 3FMBA 1NJWA 5C2GA 1JX4A 3VQTA 5LM7E 3EVWA 3FEZA 4ANEA 2CQHA 4LREA 3H42A 3M6XA 1W78A 1S0OA 4AQYF 3LUYA 2P6TA 3QAEA 2QGFB 3BBBA 2ZKTA 4IKAA 2RQMA 4ED6A 1B64A 2HHWA 2AYMA 1D3WA 2Y0BB 4HLBA 3CMAS 2RIJA 4YR2A 5KT2A 1NCLA 2B5JB 2DRBA 2V4RA 1S7HA 2CPHA 5F3TA 1X4AA 2MQQA 2J16B 5IBSA 3M6UA 4QIEA 3PKMA 1NK9A 4ZVFA 1S9GA 3ZZ0A 2AJQA 2QCTA 1NK5A 4ZP7A 1KBRA 4J9QA 3OR1A 2YWFA 3PNIA 1KDNA 1IM4A 4PG7A 2AHSA 1RTJA 3FKBA 2XHWA 2CQCA 2Z30B 2ZOGA 1NK0A 1N33F 3KTQA 2FDNA 4KE5A 4FBUA 4UQTA 4NEZA 1F6TA 1S4EA 2VPXB 2DR5A 4X4OA 1FNXH 1HBNA 3BKUA 3PFOA 2H4YB 2F8EX 3A13A 1NPKA 3SCKE 4PQUB 4KRWA 4NXNF 3RB6A 3IR7B 2EFVA 3BBCA 2RMLA 1H74A 3M8SA 3G6YA 4DCOB 3B54A 4YQWA 5B09A 4B9MA 5GMDA 4WU3A 1TL3B 5C25B 1HNVA 2U2FA 4HRFA 4F0MA 2HAFA 3EICA 5K8OA 1T7PA 1MKPA 1X4FA 2BYCA 1N36F 3POTB 1H7XA 4QWCA 2HBQB 1GK8A 2V69A 4MKYA 3OLRA 3N01A 1WRMA 4LF4J 3P96A 5F9LA 1B0VA 4FXVA 4QDIA 2DNRA 3QCBA 4DG1B 3QZ8A 4RI5A 3QATA 1C0TA 4KFBA 2CQBA 3O4UA 3DDKA 3GFHA 1R8BA 3GILA 3G8SA 2ZNYA 5ADZA 2EFQA 4ERCA 4M5GA 4DR1J 3B82A 4QIGA 1C4AA 5A2QU 5K14A 2DHGA 2FJBB 5FLXU 4ER8A 3H2LA 3MM7A 2VTDA 2XMWA 2VTEA 1GWZA 2IDLA 4GRSA 2VQFF 3OSNA 2NT7A 4LIRA 1VQLS 5A8KB 2GVZA 5DJBA 4KAIA 3PX4A 5MLCV 4A46A 1FVSA 5ETOA 5AXLA 2ZH3A 1VC0A 5JMNA 4OHEA 1PAEX 3OTEA 4GRZA 4JUZA 1Q82T 4XPEA 4RW8B 5BZXA 3UCUP 2QYGA 4RW7A 3HVAA 3MEEA 5GMEA 2EXUA 3H4DA 3EM1A 3I36A 3ZV2A 3M2UB 4BC7A 1RAAB 3SXLA 4USIA 2XGPA 2CIMA 5BYSA 4F3MA 2H48B 2XLIA 1LNQA 2WOMA 1VLYA 4ZPDA 4LF8F 3DLBA 1TAUA 4NRTA 4KPYA 2X3DA 3FEYB 4ALZA 3CDEA 2XMKA 3TANA 3HSGA 5LJ3Y 4DV0F 1S12A 5D3GB 1V6HA 2F8MA 1TUVA 1T95A 4I68A 2KI2A 2JEIA 3A8JA 2IC3B 1KVIA 2A3JA 4BBYA 5KFGA 3CWEA 2RB7A 1TVRB 4C4WA 1JLQA 1Q0NA 2MPUA 4F25A 2CQ2A 2DGUA 1X0FA 2C2OB 1E8CA 2PMWA 3CT9A 5KFPA 5LT5A 4Y2AA 2JEGA 4HHHA 1I1GA 2HRYA 1A9NB 3QCFA 1V3ZA 2HFVA 4NYPA 4EU0A 3W9IA 2D1CA 1UVNA 4YEAA 1Q1MA 1IBKF 5CYMA 1UEUA 3CCVS 1U1RA 3HKZD 4OQJA 1FCAA 2WW4A 2X7IA 3SV3A 5F8IA 3AB4B 2D69A 3TA1A 2ZZNA 3V5RA 1TQLA 4OIXA 3LALA 4NLOA 3ZTPA 1DHMA 1Q7LB 4MFBB 2QX0A 1AFJA 3TAMB 5CA5A 2CWKA 1WC3A 1YKWA 3CM3A 1TL4A 1AB8A 4QBEA 3SSRA 1FWPA 4CP5A 1WC5A 1Q95G 4MKBA 2HW3A 2YWHA 5E3PA 2W25A 2B9YA 4IRCA 3I5CA 5K8NA 2F4VJ 2BXJA 3PYFA 1F3VA 4R5PA 5KFQA 4PR6A 2R3VA 2JC0A 2LFVA 2ZFHA 3O3LA 2VDHA 4UY8T 3N6NA 2IY5B 3R2DJ 3UE2A 1OIAA 4P73A 2R8GA 2LA6A 2HHHJ 1D8ZA 3PR4A 1N8RT 1XBOA 4HH1A 4IO9Q 4KHMA 3HSZA 4LF4F 4B3MF 2KT2A 3MR7A 4D3QA 3VAMA 1PCAA 3BV8A 1S0VA 1X4GA 3SV4A 2QLWA 3MAAB 1BLUA 4DR1F 4NL5A 1Y00A 2GZOA 1SJ4P 1DTTB 2B4PA 2PN6A 2Y3YA 3NRBA 4B9SA 3KLFB 3CJ4A 1P1LA 1TR0A 1U6ZA 2A1BA 2CG4A 3PM9A 3Q8PB 4JI7F 4B3OB 1HYSB 3A8EA 4ICLA 1LYVA 3I32A 3VZHA 4J90A 3MOZA 2ILYA 3MPUB 1DFDA 3AJDA 2Q66A 2B49A 4UZBA 4CNZA 4LRBA 2AYEA 3CJKB 1U1QA 2F7VA 4AL5A 3U1NA 2ZJQQ 2P6XA 3WDOA 1GEHA 1Q6JA 1L3SA 1WC1A 1H3DA 2MHNA 2DIUA 2GHPA 1MROB 4V1Ak 3JTOA 1SH3A 5I3UB 3PR5B 3QLHA 2QN6B 2GIFA 4MH8A 4YR8B 1KHVA 5ETPA 1I5OB 2VEUA 1YK9A 1NEEA 1TFYA 3MWBA 2EG1A 4ZPTR 2EG2A 3QCLA 1PKUA 2EBEA 2JFDA 4RJVA 3AOCA 4ZLNA 5B0AA 2PFDA 1D9FA 2NXJA 3GIMA 3DU6A 2RAQA 3RU0A 1AFIA 5KFRA 1IKYA 3GXGA 5A76A 4OZLA 3TEHB 1U2FA 4I6WA 2ZC4A 4FBTA 1T9UA 2DYAA 5HJYA 3DLGA 2QBPA 4EEYA 2FVQA 2OELA 4H4KA 1Y5NB 2Z2MA 4K59A 3BR9A 3ZO7A 1G1GA 3CCJS 1ZTTA 3KK3B 1RWUA 1M5HA 1RTJB 1S7IA 1X4DA 2DGTA 1IKXA 4J51A 4U67Q 5FLXY 2ALYB 1RB0A 4FN5A 2LLZA 4B3SJ 1TL7B 5J2NB 3NLCA 1S77D 4DL7A 2R7RA 3SSSA 1ZM3A 2LDIA 1HBNB 2OEJA 3DDNA 3DCAA 1KP6A 2DGQA 3BGFA 3VTIA 2C2KB 3WX8A 2QO3A 4MAKA 1TK5A 4OI2A 2V9WA 4L3NA 4NZ6A 4X65J 1EKSA 4BS2A 4F2RA 4GRYA 3NGSA 1FPZA 3L7UA 3C8YA 1T3NA 5E41A 8AT1B 1CVJA 2CQ4A 1Y11A 1TL1A 3AQPA 1HNVB 4DR6J 3NAHA 4U7UK 1C84A 4TY8A 5HVFA 2ZH6A 4N8NA 1X5OA 5KADA 1RU1A 3RB4A 4OYBA 1YIJS 3TAPA 3LJ8A 2BZLA 4H1OA 2HIYA 5JXSA 2Y67A 4D3GA 3I82A 1PJ7A 4DCJB 1JKHA 1ICEB 3K59A 4NMLA 4N7TA 3CJTA 1XJWB 2L9DA 4O23A 4JI4F 1C0TB 4KFBB 2PGCA 4RW9A 4ZRTA 4Q8FA 1ROFA 1J4XA 1HNXJ 2W7PA 1UWAA 2DJWA 2MJUA 2R7VA 5DDQC 2ROGA 5KFDA 4CTAA 1HQ2A 4O0NA 5K14B 3AWGA 2CZ9A 5M2PA 3AHPA 4WJBA 2PE8A 3IXQA 1TP7A 2QA2A 1JLFA 1LQ9A 3MM7B 5IBMA 3M8ZA 2UUWA 4AT1B 2JEJA 6FD1A 1SJFA 2VONA 2HFSA 2QA4G 2W9AA 4WTYA 1RHUB 4ZIVA 4NYZA 5IM0B 2GVZB 1T03A 3DU5A 3UW1A 4PXBA 1FRXA 1KLMA 3EDQB 4DSLA 1WG5A 1IWAA 1QAIA 3EGVA 3ZMPA 2XO7A 1N88A 1S0MA 4RW7B 4Q8EA 2XS5A 2WCXA 3EPIA 4A4JA 1YRUA 2BGDA 2VFUA 4NA1A 1UTAA 3VCDA 2DTJA 2VUGA 2OPPA 2P5VA 2YNHA 5KG0A 4DHVA 5F8JA 2WOMB 2GJ2A 4UQGA 3I9V9 5HMYA 4B17A 3J7ZT 3GP9A 3LO3A 2I1YA 5K23A 3FZBA 2CADA 4ZKAA 1HMVA 2FZKB 9RUBA 4DR5J 3ZM0A 1XERA 3GIKA 1FDAA 1BQNB 3OTOJ 3V6DA 1SKUB 1VRUB 2QIFA 1KFSA 1CS4A 1T4JA 1CJVB 3QT5A 3QKPA 4JYAF 2HSEB 4U7CA 2MZSA 1VYAA 3H25A 3J81U 4DR4F 3W64A 1JLQB 2HHUA 2V4JA 5D4NA 5E0OA 2DXDA 4KGXB 2F40A 2ABYA 1FK9A 2YWGA 3MEKA 3J7AN 4OX7A 3SMEA 2FJDB 1VQPS 5FDLA 2R7UA 2BOAA 4DV4J 1ZBTA 3MPDA 4MIBA 2FHOB 4DBQA 1QSYA 2XEXA 2OIHA 3L09A 3LP0A 5D4PA 2HHTA 2PI4A 4ECYA 4EBCA 1GFWB 2HHSA 3SCIE 2CM2A 1JJ2R 1QM9A 1Y5LB 1N34F 1XC9A 3BSOA 1YGYA 3MVNA 1U1MA 3SDEA 5EHRA 1WF1A 1RT1A 1SL1A 3G2XA 1WC0A 1CBKA 4G3IA 4P74A 4JI1J 2F6FA 5L1LA 3BKFA 4PG6A 5L1IA 4R5PB 3ISNC 1WF0A 3HHLA 5THWA 2R7TA 4Q43A 2XJAA 4OZ1A 1RT5A 5IV3A 1L8KA 3J81j 2VFTA 4I8NA 4XDCA 5IV4A 1OPZA 4ED4A 2ASDA 1P9QC 2V0NA 2FPHX 4E2FB 3OW2R 2RHSB 3HN7A 1NKBA 1U8WA 3CMQA 3RRGA 1VS3A 3ENQA 3M7VA 3TVZA 4ID5A 2I9SA 3C2PA 1KAVA 1UFWA 2HHQA 5ETVA 2WB1D 1CC7A 1BZHA 1CQMA 1UVKA 3ZM5A 1V9OA 4C12A 1RDRA 4LRDA 2F6ZA 4X4VA 1MU2A 3DGPA 3ET6B 2N7CA 2QE5A 4EYHB 3OFGA 4DL3A 3W7BA 4ICLB 2CJAA 3ZNJ1 1IKWA 3THVA 1ITPA 4PZVA 3GLJA 3UFCX 1YVFA 5KFHA 3TZXA 4LFBF 1Q5VA 5HATA 4OFZA 4JI2F 3R1HA 1H72C 2BE7D 2B9WA 3OVBA 3NY0A 4K4SA 2HPUA 3G87A 1JLCA 5ETSA 1IBLF 1WC4A 4AUKA 3MURP 2UV8G 4DSFA 2MLZA 2FZGB 2YKOA 4K4WA 3QLHB 4DX6A 4GS0A 4Q2MA 2GVDA 2KKHA 4HH0A 3CJ8A 3DLHA 4DR7J 1R31A 2NUHA 3PEJA 1TTHB 1SV5A 3M9OB 4DSIA 2CPYA 1TUGB 1UVJA 4KIAA 1Z2LA 4QR0A 4X4QA 2NQPA 4JI8J 5K9VA 5AT1B 2ASYA 3SBMA 4DQIA 4WIIA 2C2ZB 4DR2J 2CAJA 2Y96A 2M0GB 3MUTP 3E01A 4NCGA 3BYPA 4C0OC 2WTFA 3MM6A 1KTVA 2XLJA 2YH0A 2HNQA 5DZ6A 2R8HA 3MR5A 3F44A 1T9WA 3ZM6A 3S7RA 1OPIA 4MYTA 4RUAA 1TV6A 3K5LA 2IM3A 4YAAA 3UO0A 4QIWD 4ZITA 4JMKA 2WSFC 3QCZA 2BV3A 4F26A 3VAJA 4QPTA 2DGOA 1UFKA 1ELOA 1E0DA 1IKXB 3BKTA 4LF9J 1V5VA 3QT8A 3ULHA 2Z2ZA 3N6LA 2ZM6F 5EGYA 4USUA 4YHHJ 3AAWB 5ETNA 2F9DA 4CYUA 1NHKL 2DCLA 3W65A 4A8SA 2GCAA 4C2MA 3ENVA 1X24A 4ZK7M 4IH7A 3HHNB 1WEZA 4X4TA 1XXVA 2ACMA 5AJ3F 1HHQA 2E5GA 2CPDA 1I57A 2MZ1A 3UAGA 5KFWA 2NZ6A 4ZPVR 2V4QA 3AB2B 1TL1B 2QLFB 2HQFA 4K4XA 2I2YA 3B4DA 3D3BJ 4KYRA 4TY8B 4I6YA 1XTZA 3BGRA 4PYHA 3RAMA 2W4PA 4L72B 3HJFA 4Y2IA 2LVWA 3WQPA 3KG1A 2KT3A 1JKHB 4PVGA 4LSLA 3V4MA 2ZH2A 2ZBIA 4F4YA 5KOXA 4RW9B 2GC6A 4M5JA 1UZHA 2VB6A 3UWTA 1EENA 1D1UA 3EXYA 4CTAB 2AZRA 1RP5A 4BPCA 4ECXA 5K25A 2ESBA 1JLFB 1SIZA 2ASLA 1VQ7S 1GXTA 2DRDA 2WVEA 2H4GA 1HARA 1WSRA 2GWOA 1LW2A 4ZHRA 5KFNA 3BBFA 2MZQA 1B7YB 1RT6B 1SUQA 3CCES 3R5AA 5AE3A 1T03B 4CCHA 3MTKA 2VEWA 1BWVA 2IJFA 5I6VA 1ONYA 1K1QA 4USHA 1KLMB 4PPDA 1HBMA 1N0UA 2HVZA 4F3OA 2YWWA 5I42A 3M8WA 2C22A 4FNIA 5EHHA 3WX4A 1HBOA 4NX8A 4NOHA 4ENOA 5EWFA 2ZN7A 2SXLA 1YGUA 2Z2YB 3N6MA 4B3TJ 2YNIA 3MPVA 4IFVB 4ZVRB 3EVMA 2EI5A 3D28A 1L3UA 2P9EA 4PEOA 3GIIA 1NB2A 2OPPB 1YTSA 1TK0A 2UUTA 3TA2A 1LXJA 2QTWA 3BJYA 1AUSL 2K1RB 3W2VA 4J9OA 1FRJA 2HS0A 4BUBA 3MECA 1CJKA 3N9UC 3HHKA 4UTGA 5A6PA 1QAYA 5L9XA 1HMVB 2CDQA 3KJVA 1XR7A 3CD5A 3DNCA 2JLEA 2OP5A 2E5IA 4X62J 5D78A 4QZVB 1E6YA 2P6SA 4ILLA 2XBPA 4I2QA 2I4EA 3QJPA 3UDLA 3DM2A 3V6DB 1CS4B 3Q0AA 1OJ4A 2WVBA 1HL6A 2O3DA 2UXBJ 2GP0A 3GJSB 1B0TA 1OQ3A 1KS2A 4RKKA 4ZPAA 2V4JB 2AD9A 1EP4A 4J7CA 1U0SA 2F5GA 2Q05A 4Q44A 1F9EB 1YJRA 1FK9B 2BM0A 2FJEB 1WDDA 3UCZP 1S1UA 1GX6A 2O01C 2JHEA 5HVGA 5FDLB 4OI6A 4KH0B 2ZHAA 2MB0B 4WU2A 1L3TA 4C8LA 1HIYA 1YJ9S 4LBIA 1YG0A 2J76E 4IDKA 3LP0B 4ICZA 3IGNA 2BM1A 3A12A 2DR6A 2G13A 4GVLA 5T7LB 4DS4A 2H5IB 4WFZA 2OKQA 2CM7A 4ZVSB 4DR3F 4JI0J 3P3DA 1WOPA 2M9KA 3LAMA 4XPCA 2KG0A 2XY6A 4N56A 2MEWA 1FVQA 2HYIB 4N5SA 4O4GA 1VI7A 4WK1A 3SDEB 5IT9U 5A8WA 1RT1B 2I6PA 2K3IA 1QDUB 1WCHA 4ZVEA 1NUEA 1LK7A 3HHLB 3HMJG 4ED1A 1RT5B 3EZZA 2AZ3A 3QCKA 1NZ7A 3OHAA 1NDLA 4Y6IA 2IA0A 5DG9A 2VQEJ 2FLNA 2DNYA 2AGOA 2QC3A 3DMJA 3OJSA 1VC5A 2ZH7A 4CIOA 1QSSA 3NRSA 1RLCL 5HQLA 1M5KC 1KQSR 2BGEA 2J8SA 3UN3A 5FJ4A 3PYDA 2H51B 5ITHA 4ID5B 5KFLA 2VEVA 4WBFA 4OYIA 2DEJA 4UAGA 1OMSA 2DCUB 4O3QA 2FC8A 1PTYA 3H5SA 2M5YA 2FIUA 4KGMA 1M1HA 4NYOA 5RUBA 3TO8A 1PC5A 4HI2A 1MU2B 3GR1A 2J9EA 3DGPB 5L8RC 2UAGA 3S3FA 5GAGU 1RTHA 1SJQA 4FYDA 5HP1A 3P8BB 1IKWB 3DYAA 5AE2A 1O5JA 1QVFR 3TAQA 1K1SA 5LMNF 2RH3A 2X3GA 4URQU 2XZWA 4DOZA 4QIFA 2QL5B 1KNZA 3R5JB 1NNDA 2HKEA 2ATLA 1ZETA 1PA1A 2AKWB 2V5HG 4DI6A 2FGOA 5IT4A 3Q8SB 5G0RB 1JLCB 1WSVA 1VISA 2I75A 4TU7A 3BO3A 1URNA 3EYZA 2J17A 2XQCA 2GVDB 3ICLA 1PTUA 5C7PA 3A4TA 2VFSA 1K9MT 2OPSA 1UVLA 2LDYA 4ZJOA 5D77A 5H9FJ 4FKXA 2DR7A 3DRRB 1FRIA 4DQQA 1SV5B 4IOAQ 4OHVA 2AEMA 3GPAA 2XLKA 1NO8A 3W5XA 5DG7A 1I9TA 3NMRA 4LFCF 4YDDB 4DSEA 3NBPA 1U0HB 2QMWA 2R7SA 1RT2A 3QCDA 2DO4A 1RTZA 4OI3A 3VAFA 3MDFA 2ZJRQ 4A8FA 4Y28C 2BJ8A 4DV5F 6AT1B 3DC2A 1UCNA 2XCPA 3GIRA 4C0BA 1UL3A 3E01B 2MTLA 4NCGB 5SUHA 4YB5A 2BV5A 3O2IA 4WE1A 5F0UA 1RWKB 3GJRB 2ERRA 3MM6B 3PO4A 2ZHOA 3C3LA 2XO6A 5DDOC 2Z2LA 4EO6A 4KC5A 5A8RA 4B3RJ 2CJKA 1TV6B 3JAMY 2IJNA 2XMJA 3ILLA 3OD2A 2VF3A 4X66F 2X5OA 2B7BB 4DV2F 2GGPA 4ZP9A 4F50A 1YSJA 2NPFA 4WKYA 1X9MA 2H4KA 1NL9A 1G6BA 2KHDA 3CW2C 3R7BB 3KG4A 4CYUB 3MMAA 1FD8A 2MLYA 1ZA2B 2F6TA 2EC0A 4OZNA 4G1IA 4ZVGA 4LF5J 1HPZA 2IIHA 5E3CA 3HVWA 3U1LA 1W26A 3DN9A 5HSPA 3H98A 2E44A 3TJAA 4UOHA 2IDEA 4DPYA 1LV5A 1U1LA 4ED5A 1SKWA 1VJWA 3V6HA 1T8EA 1ZH5A 4ZPWR 3M30A 3HHDA 2ZH1A 2ZBRA 2UUBF 1X7VA 1REVA 4QR2A 3MAQA 5GAEI 3G8QA 3CIMA 3TWZA 2EEYA 2W1BA 4F0KA 4LSLB 2R2TA 3VWSA 2MHEA 3JS9A 1JNRB 2G9OA 1P31A 2JH3A 4J9VA 2GJFA 2O66A 1RKJA 5BR8J 3AY0A 3RGIA 1R8HA 2B4SA 2LECA 2HHXA 1M90T 3HZEA 4QR1A 4C3MA 3PEHA 1CQNA 4HKQA 3I31A 3T1YJ 4QAPA 4TYAA 4DL2A 5A5EA 1LW2B 4J37A 1MWZA 1HD0A 1NJXA 1HNWF 3TZZA 3OVAA 2G1HA 3CXCR 3W5ZA 4L6V3 3RO1A 1QAXA 1FDBA 2DXEA 4GKKF 1SUQB 2IVYA 1ZM2A 2ZH5A 4EBEA 3R7SB 3I56S 4W98A 3OHBA 2HCMA 3MD1A 2E7XA 1CEZA 1HBMB 3NNHA 1XN9A 1FWKA 1FEHA 1LWCB 1Q16B 1ZM9A 2D74B 3MCSA 5I42B 5JVHQ 2B7CB 2ZNZA 2XSFA 1S6PA 3HULA 3PX6A 1WKJA 1GMUA 4LQ9A 2B51A 1IJEB 2UXCF 1RBLA 2VG5A 1DZ5A 2A2CA 2YNIB 2R9LA 4NLTA 3ILIA 1H7WA 2CJXB 4YFUA 2IBKA 2IMGA 1SJ3P 2HQIA 3QPIA 3TVYA 1CG2A 3KUEA 5KFJA 4WFNQ 1ZPVA 1C1BA 4I1TA 3W2VB 4JMJA 2DISA 2Q6CA 2VFRA 3SFGA 2CPXA 4JI3J 5LMUF 3KJVB 3US5A 3IBWA 3VAKA 2DNMA 1E6YB 3UNGC 5AXKA 5KFBA 4U96A 2C3UA 1N54B 4I2QB 4UOGA 2AIRB 3MCMA 1YZ6A 4QIVA 2FHMA 1JWWA 3DM2B 2MQ8A 3ZZOA 4C8MA 2DRAA 1IN0A 4QYRA 5DZ7A 1KQFB 3ETMA 5T14A 4IYQA 3UR0A 3NGRA 1P3DA 2V6AA 3HLUA 2IYIA 2GO9A 5DQGA 3DRPB 1NXIA 2CA9A 2KRBA 1BWEA 2HWIA 2XHCA 2V67A 3FRYA 1S1UB 4NZ0A 2F8HA 2V8HA 4KKOA 1RT4B 2KM8B 5CD4H 1K0TA 2YTCA 3H4BA 2E5JA 2Y9HA 3Q83A 1N32J 3MXHP 5KA9A 2UUAJ 4IDKB 3M9MB 3ISZA 1UW9A 5D15A 1BQMA 3MZIA 4ERDA 1PYNA 4FYYB 5D4OA 2G2YA 1WG1A 3OV7A 1AYEA 1PILA 3CSKA 1OEMX 4YS2A 2RF2A 3PS5A 2JSXA 2N3OA 5K9WA 3VGUA 2UUCJ 5A8WB 1RTIA 1T3OA 1VQSA 1FKPB 2ZWOA 3P5BP 3A1YG 1T05A 2DY1A 5CYJA 1J5EJ 1RWPB 2LKZA 3RZAA 2HK3A 2XMVA 2UUOA 4B04A 5J2PA 4ED7A 2QFJA 2J6TA 3OTCA 1P15A 4OJGA 1F5AA 3CD6S 2G59A 4ES3A 2AJ2A 4YUDA 1EB0A 4R25A 2VJUA 2B3TB 3DMJB 5MMZB 3TARA 1PYTA 2MQLA 3OFEA 2LQ5A 4OX6A 3V4IB 1DQAA 4RR5A 3CJSA 3H5XA 1FA0A 1VFJA 3T41A 2QBRA 1N52B 1KTQA 3KLVA 1Q53A 4LJMA 1JLNA 3H8YA 2AJ0A 5H1SV 4C13A 2BJ9A 2MQPA 3IRXB 3DI6A 1M5PC 1X4HA 1YBAA 4X64F 3IBFB 2YX1A 4QW8A 2VOPA 1BQXA 3GYGA 2D3ZA 4NE9C 3M2VA 4GO5X 1IUJA 2HBRB 3GSIA 1RJJA 3CJ3A 3JQMA 5HP1B 5IWAJ 4ILRA 4LVNP 2DVIA 4I2PA 2AGPA 1HI8A 1Y7PA 2N82B 5L38A 1FTRA 3SR9A 4BWJA 4JOUA 2QL9B 2CVIA 2KM8C 2MSTA 2XNQA 3TZYA 1DURA 1X0PA 4P2MA 3DLLQ 2F71A 1XM2A 1XMOJ 2GC8A 1SL0A 4LFAJ 2VASA 3RBDA 5HROA 1EETB 4RH5A 4K4VA 4X84A 2NR0A 5F8GA 2B07A 4Y3CA 2OPSB 3CD0A 5LSOA 3HJVA 4K4YA 3MHYA 1OSDA 2LQBA 3PYZA 2R7QA 1XNQF 1VK3A 1OEVA 4IG0A 2VBWA 4Z7CA 4C9DA 4ELTA 3C14A 1NAQA 2BEFA 4WYWA 4I7FA 1NMEB 2DNOA 3NBPB 4C8KA 1H2TZ 2HLTA 2FC9A 4RI4A 2Y1RI 5CZVA 3AWFA 4QF5A 2I6WA 3UCGA 3EGWB 4CVMA 2FH7A 4DL0C 2RRBA 2VU5A 2GC5A 1G3OA 3FBFA 1S1TA 5HMZA 4WE1B 1S6OA 3S8SA 4RBVA 4BWMA 4MIAA 4FS1A 5C25A 2W24A 2BQUA 1SXLA 1S97A 3MR6A 5A8RB 2AW0A 2DGXA 3FDSA 2F00A 3VAHA 2EVZA 2ILZA 1PTTA 3V0FA 4LF6F 4QQBA 1DLOA 2AU0A 2Y8YA 1HWJA 1OY6A 3VF0B 3HXMA 2R7OA 2IVFB 4L73A 3EMTA 4TLQA 4J9NA 5CCLA 3SI8A 1NZ8A 2GV1A 3I55S 2R7WA 3QCNA 4CO3A 2GQ2A 1HPZB 3C46A 1RKIA 2ZHBA 2CQGA 5GAEU 2VC1A 4R0SA 3F9AA 5CZXA 2IA6A 4CLKA 3CCRS 2HAIA 3OFHA 5KFIA 3T19A 4HEA9 4KV8A 4RBTA 3LGMA 3M30B 3ZZUA 4B9NA 2VORA 2DITA 3V2UC 2WBRA 4ANCA 4O0IA 3PRDA 1RCOB 4F4WA 4X4NA 4IFYA 4O3PA 3T5KA 4ZLJA 4RNNA 1WG4A 3T1HF 2DEIA 4DFPA 2W4DA 3PHEA 3IS9A 4U9RA 4ID8A 3D66A 1RUSA 5KA8A 3J7YI 3SFUA 3NOGA 4KTQA 2FJXA 4PXEA 2CNOB 2FY1A 2HQCA 4JI6J 4G6VB 3HVRA 1T9YA 2FHJA 2CNIA 3IBCB 3R7NB 1HQEB 1RGVA 3W63A 3EVOA 4KHPJ 4KI9A 2BOPA 3VALA 3RBZA 2UU9J 4DV3J 1FD2A 1QD1A 5L1KA 1R43A 3NS7B 1B99A 2ZBQA 2WBMA 4J5OA 1KKHA 3DGVA 1I94F 2ADCA 2CJQA 3JTPA 4K4ZA 3RR8A 1P6TA 1HR0F 4OJ1A 1NSQA 2GFFA 1ACMB 4DX8H 1FESA 1NO6A 1VCTA 3ZM2A 4TYBA 5KG4A 1S6PB 1P8GA 4H54A 2AM2A 5LXRA 2FJVA 2VG5B 1WTFA 4NLXA 1MWQA 1RACB 2ROPA 3U96A 3BGOP 1KQGB 3FQKA 1LEOA 2YQ1A 1IKVB 2YNGB 4IOBA 4JV5F 3QQCD 1QY7A 1C1BB 4XAKA 1EEHA 4TQSA 3CCWA 2I3RA 3MCOA 4KO0A 2C2DA 3OMHA 5I4MA 1OHDA 2RD5C 4DEZA 4RKUC 4GFUA 3D9CA 3NGTA 2IJRA 2FZCB 4K8RA 3QNWB 1S9FA 2KHCA 3G6XA 4WP3A 3GE9A 2V68A 1FJCA 4R0TA 3HZGA 3T3FA 4M5KA 4WIQA 1H6KX 3TA0A 4MFBA 3TUZC 1YITS 1OY8A 3GG1A 1FEEA 3QSIA 4FP9A 1VBKA 4TNOA 1JLEA 3A8KA 4UY85 4I4BA 2NREA 3ZM3A 3T5JA 3OL9A 2OAUA 2VIHA 4CO1A 4N77A 1S1XA 4JI5J 3QIPA 1SUGA 1YTNA 2SHPA 2PDAA 4C98A 2CDRB 3M8QA 7FD1A 4OJ3A 2IBOA 3B4MA 1F5BA 2GMHA 4CDIA 5LSRA 4QWEA 4G1PA 3HK2A 3H2XA 4KKOB 3JTNA 4GKJJ 5CCMA 1YHQS 5U47A 2H04A 3Q8UA 3IGVA 2RUGA 3MFHA 2M88A 1UVMA 3I0SA 1GMWA 3TR5A 2DHSA 4ECUA 1VRQC 2N7YA 2RILA 2W01A 3QFHA 2R0BA 3QJLA 1OQ6A 1S1VA 3MAAA 1VQ9S 3BSAA 3SEOA 2JOQA 2RF2B 1ZM4A 5F3ZA 4OI1A 1RXOB 1JIHA 1DTTA 3KLFA 5KFSA 1WACA 1RTIB 5KG6A 4P2SA 1XNRJ 4IQMA 4DV7F 1AUDA 1T05B 2O5DA 4KGZB 4Y14A 2VC0A 2E5LJ 5J2PB 2H4WB 2Q43A 1JXVA 2R42A 1X4CA 2JJDA 5HVHA 1QTNB 1OHCA 2XI2A 3AJ2A 3V0JA 2BE2A 2DR9A 3CJKA 4KR0B 1WHWA 5K8MA 4M1KA 1YTWA 5DM6Q 3D3CJ 3ENAA 3V0EA 1PJ5A 1HW9A 3HHLD 3TOQA 2CNNB 2GQCA 5JVGQ 2WVFA 2KZMA 1Y5IB 2KDOA 2AJ1A 1RXDA 5DO2A 3HSJA 4M5NA 2DBBA 1C88A 1W2IA 4PPZA 3DI6B 4M63A 2XI3A 3M2VB 2VPZB 3G6ES 2P9GA 4RU9A 1ULRA 2HGMA 4I2PB 3D0HE 3FCWA 3KUGA 1KSPA 1VBYA 2Z4PA 2DNNA 3EPGA 4PWUA 4NA2A 2VBYA 3BN4A 3KLGA 4URGA 2J9DE 2B0GA 3HFZB 1BY9A 4D3PA 1NJIT 1OYDA 3CUNA 2Z58B 5A5FA 5KG1A 1YJUA 3OJUA 3PY8A 2RS2A 1GH8A 3K5OA 1U1OA 2YPZA 5HROB 3W66A 1ZCKA 2PSZA 1KEKA 3KK3A 4Y2CA 1JB0C 4OV1A 1OY9A 1NK6A 2H02A 4LBPA 4IG0B 3C14B 1TL7A 5J2NA 4I7FB 2DNZA 2JJ4D 3QWPA 4K0KJ 1KQKA 4NXMF 4GE2A 2C2MB 2P9CA 3DFEA 4CZCA 3OFFA 3P49B 2QLJB 4KQZA 5E3QA 1S1TB 4P52A 4USTA 3FBCA 4RO0A 4O4RA 3LGHA 5KTQA 3MUVP 2VPYB 1S76D 2E7WA 3Q23A 2BRKA 1NNYA 3TUPA 5FD1A 4JV0A 4AYBD 2PC6A 1S49A 4ECQA 1K0VA 1FT8A 4DUZJ 1FJGJ 3G4SS 1HWUA 4ECRA 2EFOA 4N41A 4IR9A 2HK2A 4ZA1A 1DLOB 4QWDA 2MGZA 3CIZA 2R8IA 3RTVA 5MAOA 2CQ1A 4GMKA 3K17A 4PG8A 3D0GE 3KLEA 2DO0A 4HVZA 5KG3A 1RYRA 1PIEA 2QLXA 4KPCA 3S1TA 3KNGA 3QAUA 3RB0A 3HVTA 4NI2B 4J9RA 3F0NA 3AT1B 4ZN1A 3RW6A 3S4EA 4QBUA 1EIYB 3C19A 1HNZJ 5ETMA 1B3TA 1U1PA 1PJ6A 3IP0A 3ZZRA 3W8PA 2UXDJ 3H0PA 3ONQA 3V6JA 1U6FA 3BDEA 3E3XA 2IHR1 4KV8B 4ECSA 1UKUA 1T0TV 2ZUGA 1W25A 4UZCA 2NSCA 1LXNA 3BPDA 5HN0A 1HWIA 5IM0A 3NL0A 3HD2A 2KFNA 4IFYB 4A8WA 2B9EA 1TL5A 1NSKL 2AYGA 2FVPA 5KA1A 1FFSB 3L95X 3IS9B 2KXHA 4PYAA 2AX1A 2KYXA 4LR8A 3U1MA 4ITSA 2CZVC 3V0GA 1Q6MA 3CC7S 4F04B 4DV1J 3J7Z5 2I1RA 4CM2A 2HVHA 4D3RA 3W2WA 1PGZA 3AJ1A 2D7SA 1VDHA 3V0IA 3I96A 2F6VA 3B8HA 3PO5A 1PTVA 4AFFA 5DDPC 2KJWA 1NU4A 4Q0BA 2HFOA 1XMQJ 4Z6BA 4WFXA 2PA5A 2G1DA 2ZOFA 4KYZA 4CH7A 5L39A 4Z37A 4R8UA 4ZVTB 3CJ5A 2EC2A 3NAIA 2FLOA 4DSKA 4DN9A 4ETXA 1BQNA 3B78A 3D42A 4F36A 1QSLA 3THPA 1VRUA 1HBUB 2RQKA 1UEVA 1FHTA 1CJVA 1RAIB 3U7JA 1XR5A 4RHGA 1NLKL 4ED0A 2E1AA 2OUGA 3AFGA 4DUYJ 2FYXA 5HBMA 4RW6A 3M1VB 2DGVA 3QMQA 1N48A 2P4DA 2QSWA 2GCBA 2JWNA 3IWXA 2JLGA 5GAHU 4C0HA 4KJIA 1S72S 2ZD1A 2C3PA 4FXWA 1FXLA 2HRTA 3J80U 4NWGA 1T94A 2QA4S 2POKA 2WB4A 4EWTA 1ZZFA 3EWGA 4NRUA 4KO0B 3HFKA 2APOA 1VQ8S 1RISA 2YQ3A 4UUWA 4HV4A 3R3TA 2MY7A 5B0EA 5DGBA 1C85A 1O8BA 2DT9A 1R89A 3CJ0A 1F60B 1X5TA 3D1HA 1Y10A 1MMLA 2GMJA 4NLQA 3G82A 1SB6A 3V6KA 3CO9A 1YJWS 1JLEB 2N3LA 2E1PA 3ZZYA 2BANA 5D4LA 2Z56B 1L3KA 1F2GA 1YRTA 3C15A 1S1XB 3QIPB 2OTLS 3M8QB 4CLPA 3BSCA 4MT1A 4J9LA 3CULA 2XSJA 1O5ZA 1NSPA 1W2BR 4NYHA 3R5GA 3ELHA 1MWYA 2ZWPA 2PO4A 2QSFA
chains in the Genus database with same CATH topology
1LK7A 4NLYA 3I0SB 3HHLB 1HI0P 2DPJA 4HTIA 3HMJG 1VQNS 4R0EA 5BUGA 5E3RA 4ED1A 4C3KA 1RT5B 4TXSA 1FPRA 3K0JA 3EZZA 4C3LA 3QCKA 1NZ7A 2VBZA 3MMCA 3OHAA 5CH7B 3KLHA 1VQMS 1Z1ZA 4Y6IA 2IA0A 5KFOA 3EB1A 3KK1A 1LK5A 1S1VB 3C66A 5DG9A 2FLNA 2RDIA 2G0CA 5KFVA 2IMOA 4H34A 2RS8A 2DNYA 4OZ0A 4WFBQ 3DMJA 5EDWA 2AGOA 4B3OA 3QCIA 1FO1A 4OZJA 4DS5A 1AXQA 3OJSA 2UZAA 1HYSA 4DPOA 1VC5A 2HWTA 1MMNA 2ZH7A 4G1QA 4CIOA 1RT3B 1QSSA 2I5JA 2COLA 3VQSA 1UA0A 3HT3A 5CHCB 4HYKA 4IG3A 3PW2A 3MAHA 3OQ2A 4MK7A 4MK8A 2HGLA 2PI5A 5B0DA 4JV2A 1NK8A 3MEGA 1M5KC 2E5HA 2CNFA 1B0PA 1NJZA 2YKAA 1KQSR 4RNMA 4DL4A 2BGEA 2XWYA 1DQ8A 4X4UA 2LEPA 5FJ4A 3BEGB 3JSYA 3PW5A 2BIJA 3R5BA 5ITHA 2WW8A 4ID5B 5KFLA 2Q3PA 2VEVA 4HJQA 2PMHA 1MW7A 2C2RA 2UVWA 4IH6A 1RTDB 3CTRA 2AYBA 2FGCA 3K8WA 2RU9A 5T41A 5KFKA 2DCUB 4O3QA 4QOTA 2FC8A 2K2PA 2IM2A 5DS7A 2RQCA 1PTYA 1BZJA 1KR4A 5DRKA 3H5SA 3CD7A 2LXIA 2M5YA 2FIUA 2LU2A 4KGMA 2C2EA 4V19J 3MMJA 1NWLA 4DGXA 4NYOA 2R2UA 4WZQA 3SZ2A 3TO8A 2ZZMA 1PC5A 5EX0A 1ZC0A 2GQQA 4DF4A 1N4LA 2XS7A 3MMBA 4HI2A 4M5DA 3D2WA 1MU2B 3JYTB 3GR1A 2J9EA 2QV6A 2ZVSA 3GMGA 5L8RC 2W8LA 1NKCA 4X4SA 1MROA 2BE2B 3O6QA 3S3FA 2QZ8A 3FSXA 5GAGU 4YP3A 1RTHA 1SJQA 5I3UA 4GFVA 4FYDA 3AWEA 5BR8F 4ECWA 5CYQB 5HP1A 1NWEA 1X8DA 3O5TB 4HI1A 2PD1A 1IKWB 3DYAA 1S6QA 3E8OA 4QU7A 2DNKA 5AE2A 1NJYA 2VEXA 4WFAQ 3SQGB 4YY3F 5GAGI 3JSMA 3OXFA 4QW9A 1O5JA 2MKSA 2FVSA 2ZITA 3TAQA 1QVFR 2CFVA 4RH9A 2A3KA 4QAHA 3FMBA 1K1SA 5LMNF 1NJWA 2YKPA 1OO0B 2JDJA 3CDAA 1HI1A 1JX4A 1FKAF 1VHRA 3T1YF 2RH3A 4NLPA 2X3GA 4URQU 3VQTA 1U24A 2XZWA 3FEZA 3BLUA 4DOZA 2OPRB 2X51A 2ZKUA 2CQHA 2GO8A 2KZZA 3M6XA 4QIFA 3WZ0A 1S0OA 2SHPA 4P7VA 1KNZA 4HT5A 4ZP8A 4AQYF 1VRTA 3LUYA 1NNDA 2P6TA 1GTHA 3QAEA 2ZH9A 2GIQA 2ATLA 2XY5A 2VBXA 1ZETA 1PA1A 2V5HG 5IT4A 2FGOA 3Q8SB 1JLGB 1JXEA 4ECVA 2EBGA 5G0RB 1JLCB 4CI0B 2ZKTA 1HWLA 3MOJB 2I75A 3KMQA 1WHXA 3RW7A 4CQ1A 3BSNA 4TU7A 4IKAA 2MKKA 2RJZA 3BO3A 2RQMA 4ED6A 1SKSA 2PI7A 1URNA 1B64A 1L8GA 2HHWA 4RBUA 4RNHA 3EYZA 1N5SA 3BR8A 5KFTA 2AYMA 4PCQA 1UW4A 3TVKA 2J17A 1C87A 1VK8A 2KFZA 5C24A 1D3WA 2DB1A 2M7SA 3BZQA 2VODA 4HLBA 4F4KA 3CF5Q 3ICLA 3CMAS 1PTUA 2RIJA 4FZVA 2VFSA 3OL7A 3K5MA 1K9MT 4YR2A 3GV5B 5KT2A 2MYFA 2B5JB 2LA4A 2OPSA 2DRBA 2OC3A 4YOEA 1UVLA 2LDYA 1AAXA 4OLPA 2V4RA 1VIOA 1S7HA 5D77A 3K7RA 5H9FJ 4B02A 4DJBA 2DR7A 2E0TA 2CPHA 3DLKA 3DRRB 5F3TA 1FRIA 4DQQA 1X4AA 1SV5B 2MQQA 4IOAQ 4OHVA 2J16B 2L9WA 3M6UA 4QIEA 5IBSA 2V8GA 1IKYB 3KLGB 3QWUA 3PKMA 1NK9A 2XLKA 3IFEA 1HW8A 4ZVFA 1S9GA 3ZZ0A 1NO8A 2AJQA 2QCTA 3CC4S 1NK5A 4ZP7A 5DG7A 1WI6A 1I9TA 2ZDPA 3NMRA 2MKJA 4J9QA 4LFCF 3OR1A 4YDDB 4DSEA 3H59A 3NBPA 2YWFA 3PNIA 2MKIA 2QMWA 3HF5A 2ZDOA 4ECTA