3D1OA

Structure of the ptp-like phytase expressed by selenomonas ruminantium at an ionic strength of 300 mm
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
313
structure length
313
Chain Sequence
b'TVTEPVGSYARAERPQDFEGFVWRLDNDGKEALPRNFRTSADALRAPEKKFHLDAAYVPSREGMDALHISGSSAFTPAQLKNVAAKLREKTAGPIYDVDLRQESHGYLDGIPVSWYGERDWANLGKSQHEALADERHRLHAALHKTVYIAPLGKHKLPEGGEVRRVQKVQTEQEVAEAAGMRYFRIAATDHVWPTPENIDRFLAFYRTLPQDAWLHFHCEAGVGRTTAFMVMTDMLKNPSVSLKDILYRQHEIGGFYYGEFPIKTKDKDSWKTKYYREKIVMIEQFYRYVQENRADGYQTPWSVWLKSHPAKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myo-inositol hexaphosphate phosphohydrolase
publication title Effect of ionic strength and oxidation on the P-loop conformation of the protein tyrosine phosphatase-like phytase, PhyAsr.
pubmed doi rcsb
source organism Selenomonas ruminantium
molecule tags Hydrolase
total genus 110
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14566 PTPlike_phytase Inositol hexakisphosphate
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1690 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3d1oA01
3.90.190.10 Alpha Beta Alpha-Beta Complex Protein-Tyrosine Phosphatase; Chain A Protein tyrosine phosphatase superfamily 3d1oA02
4QUNA 5KAAA 5EHRA 1XBOA 1OHCA 1L8KA 2QDCA 5GTJA 3AWEA 5BX1A 1OEVA 4KYRA 2G6ZA 1WCHA 1ZZWA 4GRZA 2VEYA 1I57A 4RH5A 2CNFA 1KAVA 3D1OA 2B4OA 1T49A 5M43A 3F9AA 2P4DA 3ZM0A 4WU3A 5BUGA 3N0AA 1G4US 4ZI4A 1R6HA 2AZRA 5KA7A 1Q6MA 4AZ1A 1PTTA 4Z6BA 1T48A 4MBBA 2G59A 1QXKA 2RF6A 2GP0A 1OHDA 1NO6A 3AWGA 1NL9A 4B04A 3D9CA 5K9VA 5KA9A 4BPCA 3ZM2A 1I9TA 2I75A 3GXGA 1EEOA 1Q1MA 1YN9A 1XRIA 1YWFA 4KYQA 3QCMA 2JJDA 1ZCLA 1RXDA 2CM2A 1OHEA 2GWOA 3QCNA 3V0IA 1LARA 2I3RA 2A8BA 4GE6A 3QCKA 4HRFA 1XXPA 3QCIA 2F6FA 1X24A 4NYHA 2BGDA 3EAXA 2I6OA 3EZZA 1GFYA 2ZMMA 5AWXA 4TVVA 5KA8A 4JNBA 2CNHA 3EB1A 2J16A 1PTUA 3V0GA 2PT0A 1PA1A 3D1HA 3A5JA 1PYNA 1Q6PA 4BJOA 4Y2EA 1EENA 2I6IA 1KAKA 2F46A 4QAHA 1BZJA 2I42A 5IBSA 3O4SA 2CM8A 2E0TA 1C84A 5K23A 2CM7A 2I4GA 3D42A 4RHGA 2I6PA 2Y2FA 5K25A 2HNQA 2B49A 2C7SA 1MKPA 2CJZA 2F6ZA 2PBNA 1ONYA 2I5XA 4RH9A 5KACA 4HJQA 2J16B 5KA0A 2H02A 2PQ5A 1Q6JA 2QBRA 3RGOA 1AAXA 3V0HA 2BZLA 3LJ8A 4WOHA 4NNDA 2Y96A 2HY3A 1LYVA 3ZMPA 4QUMA 3MOWA 2NZ6A 4D3PA 2BV5A 2H4VA 1BZHA 4OHDA 2CFVA 2PSZA 1Q6TA 3O4TA 2NLKA 5BZXA 2ZN7A 3ZV2A 2CMBA 4GE2A 5MMZB 4OHHA 4Y14A 1A5YA 4JMKA 1NZ7A 4RI4A 4GS0A 2QEPA 2MBCA 4QAPA 2CMCA 4NX8A 4S0GA 1U24A 1G1HA 3GXHA 4QBEA 3QKQA 2BIJA 1U26A 3NMEA 1M3GA 3QCHA 1FQ1A 1FPZA 1RPMA 2F70A 3OMHA 2FH7A 1L8GA 3D1QA 1C85A 3F41A 1G1FA 1YPTA 2F6VA 2HCMA 4H1OA 2PI7A 5KA2A 3V0FA 3F9BA 1YTWA 3QCEA 4R0SA 1QZ0A 1SUGA 3BLTA 3M4UA 5KADA 2I4HA 5K22A 1GWZA 2BGEA 2H4KA 4OHIA 3QKPA 4RI5A 2R0BA 2OZ5A 3RZ2A 1FPRA 2P6XA 3I80A 1YGUA 5BZZA 3V0EA 1YTNA 3U96A 3O5XA 1I9SA 3PS5A 1G7GA 3BRHA 2AHSA 3S4OA 3I7ZA 1BZCA 1T4JA 2FJNA 2WGPA 4D3QA 1NWEA 2OC3A 3CWEA 5KA4A 4OHLA 1ECVA 4NWFA 2B07A 2F6YA 2CNEA 1PTVA 2YDUA 4RKKA 4H34A 2B4PA 5K9WA 5J8RA 4IKCA 2HNPA 1JLNA 1D5RA 2C46A 2CMAA 3QCJA 1OEUA 2VEVA 3QCGA 5LXQB 2ESBA 2GJTA 2I3UA 3RO1A 4GE5A 1P15A 4R30A 1U25A 4YAAA 3BLUA 3ZM3A 3EMUA 2QBQA 2I6MA 2VEXA 4R0TA 2OOQA 4KI9A 2I4EA 2H03A 2QDMA 2Q47A 3QCFA 5EHPA 1C88A 2CNIA 4GWFA 3MMJA 4WU2A 4ZRTA 3AWFA 1OESA 1G1GA 2IMGA 1YZ4A 3B7OA 4D3RA 4ICZA 2HC2A 4JMJA 2HC1A 2B4SA 4HJPA 4PVGA 3EU0A 3MOZA 1WRMA 5HDEA 2PA5A 1PA9A 4DGXA 3CM3A 3S4EA 3QCLA 3RGQA 5K24A 4NWGA 3S3FA 3BM8A 4GRYA 3D44A 4J51A 1WAXA 1OETA 2QDPA 3QCDA 2NT2A 2CM3A 1PH0A 2DXPA 1YGRA 2OUDA 2CNGA 4PYHA 3H2XA 3V0JA 2M3VA 1C83A 1YFOA 2B4UA 3S3EA 1OEOX 2Q05A 2FJMA 2QBPA 3A5KA 3F99A 1C86A 1Q6SA 2QBSA 1Q6NA 1ZC0A 2B3OA 3F81A 1J4XA 1JF7A 2I6JA 2QCTA 3V0DA 1VHRA 3ZM1A 4I8NA 1NWLA 1LQFA 1YTSA 3QCCA 4ZN5A 4WTYA 4GFVA 2HB1A 5KA1A 5KA3A 3QCBA 5I6VA 4QBWA 3S3KA 2A3KA 2H4GA 2NT7A 2I1YA 2NTAA 4YR8B 2F71A 2VEUA 5IBMA 2SHPA 4GFUA 4DGPA 3I36A 3O4UA 1G4WR 1PXHA 1XXVA 1OEMX 2HXPA 4RDDA 3SR9A 1PTYA 1V3AA 4ERCA 1XM2A 4OHEA 2F6TA 1ZCKA 3S3HA 2QCJA 1NNYA 2F6WA 2VEWA 2NV5A 3SMEA 2HVLA 3ZMQA 3OLRA 1C87A 2H04A 5KABA 1G7FA 3O3LA 2J17A 1ONZA 4JBCA
chains in the Genus database with same CATH superfamily
1S79A 4QW9A 1XBOA 3CJ4A 1L3KA 2VBZA 2JFDA 1XMBA 2N3OA 4RNMA 3PRDA 2WZ1A 3RB0A 3AB4B 1RWKB 2NR0A 2EFPA 1TL5A 4QWEA 3NGDA 1R27B 1LW0A 2FJAB 4AZ1A 1QXKA 5HVFA 3HHNB 4C12A 4K2XA 3I5AA 1UVLA 4M5NA 4I68A 3QCZA 4DHVA 2C42A 1U48A 2Z4PA 1YN9A 5ETQA 1FHTA 3MM8A 3ZZPA 5H9EK 3QCMA 1YZ7A 2DNMA 2JJDA 1RT5B 2IRUA 2FHOB 3I82A 2GWOA 4OX8A 4RW7B 4B02A 3KJFB 1VRTB 2NLWA 1T03B 3GJQB 2BGDA 3X1LB 4DI6A 5B0CA 1WJ9A 5K14A 2CNHA 3DOMA 4NLUA 4DV3J 3BH6B 1IKWA 4ATNA 2XI2A 2DPIA 3OVSA 3OXFA 3BSCA 2YWWA 1UZHA 1TL1B 2JC0A 1C4AA 4GMKA 3BGRA 4A48A 2Y1IA 1X5TA 1JB0C 4LF7J 1PYSB 1FJGJ 3CEDA 1NK9A 2PBNA 3QZ7A 1S6QB 3KHLA 3OVBA 1CSJA 5L1JA 4J90A 4ANEA 1NDCA 1GXTA 3OL9A 2V2VA 2C3YA 3KHGA 5KG6A 2FC8A 1HYSA 5CYMB 3CPWR 1H7XA 1T9WA 1KP6A 1UAGA 3TJAA 4C3KA 2DNOA 3FJ2A 4R25A 3QCHA 1M5OC 3E8OA 4HKQA 3ILLA 4ERDA 4NCBA 1LEOA 2C2OB 1MNEA 5DQIA 1FK9A 2HNZA 3ADAC 1VIOA 2GQ2A 3JS9A 2Y0SD 5KTQA 2YKAA 4HLBA 3QIPB 2NXJA 1OS5A 3SCIE 2P6XA 1BQNB 3MECA 2AJ0A 5HQ8A 4J9VA 3E01B 3KJNB 3HULA 4ICLB 4ENOA 5HMZA 1EP4B 3DRPA 2LYVA 1JLGA 3W3SA 4UAGA 1WC6A 2W4DA 5DDRC 1Q8LA 4NXNJ 3A8JA 2F6YA 2K3IA 4RL1A 1UVIA 1HBUB 3QFHA 2C22A 1G3OA 3R8YA 3EPIA 3QCGA 4DUZF 1PJ5A 2O3DA 1E6VA 4YEAA 4IFVA 3GIIA 1AXQA 4HDGA 3M7VA 2FLOA 4GO7X 2AGOA 2ZH2A 2MQ8A 2VF3A 4N41A 3QBCA 1AA1B 3C6UA 2NSCA 4K4YA 2HVIA 1VC0A 4OYMA 4LUBA 2I5JB 1RWMB 1VJQA 4XO0A 2ZE2B 4C8KA 5J1EA 2OEJA 1OSCA 5K24A 2ASYA 5HANA 1URRA 4KKOB 2Q66A 4F0KA 5ETOA 3G86A 2CNGA 2RT3A 4HT7A 3ZNUA 3BV8A 1H72C 3G8QA 1TMJA 4FYYB 1LKZA 4EGLA 3D66A 3SYZA 3HSJA 5HLFA 1H38A 1R8BA 2D9OA 4NI2A 5DZ7A 4I8NA 3ZO7A 4ED0A 3L7OA 4IOBA 5I6VA 2F40A 4DS5A 3MR6A 2H4GA 1EETA 1NU4A 3MMAB 5CH7B 1T9YA 3KK1A 4IDKA 4CLSA 3EYZA 1NSAA 3G71S 3G82B 2JZ5A 2HXPA 2OHDA 1OQ6A 2XQCA 1BQXA 1WWHA 4U95A 1S1WA 2HRTA 4N56A 4FS1A 1ZCKA 4DG1B 2XWYA 5F8MA 1Q5VA 3DRXA 4PQUB 3DKDA 4ZP8A 4EBEA 5FD1A 3WC2A 3GE9A 2MQMA 3O3LA 2FIUA 3R6LB 2ASDA 1F2HA 3T5KA 1QVGR 3W9JA 3B78A 2YQ3A 4F3MA 2DRAA 4M5GA 1AYEA 1WSRA 4RH5A 3D4JA 1AROP 4KT0C 4M5IA 2LEAA 2QL9B 2B8PA 3DRRA 3T41A 2AGQA 5D78A 3NS5A 2V34A 5DLFA 4X66F 2A3JA 3ZM6A 4I64A 4PG7A 4WU3A 5D0GA 4RBUA 4LFCJ 3R5DA 2A2CA 4UTGA 3N6NA 4DV1J 1CULB 3THTA 1HBNB 4Q43A 1YJNS 1U6BA 3D9BA 1LWEA 3BN7A 3K7RA 1EEOA 3GQCA 4ZVHA 2VORA 4I69A 1FX2A 1EAYC 3KLHB 4JI4F 2KFZA 1BQMB 5DG7A 4LF5F 1WKLA 1X4FA 4KYQA 1UZDA 3UN5A 3FFIB 4KV8A 4X65F 2JRSA 2WRMA 3QCNA 5E5NA 4IG3B 3L4BC 1EJ7L 3KLFB 4Y2AA 2DHAA 4KHPJ 5IC4B 3GYGA 4F4XA 4RBTA 1DY3A 2DHSA 3M8PB 2ATCB 1XN9A 4NLPA 3MEEA 3MF5A 1YDLA 4K4VA 1FXLA 1NKBA 2IFXA 2BDPA 3GV7B 3MPWA 4ANDA 3V6JA 1BZJA 4O3RA 1ZA2B 1ROFA 2B5JA 3D42A 4PZVA 2I6PA 2GIQA 1VQ7S 5DDQC 1Q4RA 2UXCJ 4J9QA 3KUHA 1KTVA 1RADB 3R5CA 1HI1A 1YBTA 5IT9Y 1TL3A 4CNZA 2CFVA 3VAGA 2CQDA 2ZKUA 2GMJA 1SXLA 1QAXA 1K47A 1NK0A 4JI5F 3UCUP 1YBAA 3D6HB 4WYWA 2Z58B 3VGVA 1O8BA 4JV5J 4NLVA 4JV2A 3PTWA 1VHFA 2VG6A 1WOPA 3S6EA 3OXGA 1K73T 2FZCB 3G4SS 3G6VA 5CD4A 4GVBA 4X64J 5KA2A 2HRUA 3H4DA 4R0SA 2BEFA 5KADA 3I6PA 1RWOB 3H90A 3I56S 2H4KA 4CO4A 1X31C 2FJBB 4CLPA 3EVMA 3CCMS 3R7NB 1JBVA 4MK9A 5I3UA 1WUUA 3RGIA 1X9WA 4DQRA 2R7XA 3JQMA 1UP1A 4OLOA 3S4OA 4B17A 2IC3A 2WGPA 1NJWA 4WJBA 3EMTA 3M4XA 1ECVA 1GFWB 5A5FA 4U7UK 1SL2A 2CZ9A 5GAGI 3A3NB 5KFXA 1JLNA 2O66A 1RKIA 1R0CB 4NE9C 2ZUGA 5HN0A 2VEVA 3UDVA 3UDCA 3DLEA 2V8DA 1PCAA 2XJAA 3DGPA 2FZGB 2LVWA 1ZETA 3KLEA 4DCPB 4NRTA 3TJ8A 1UEUA 2UV8G 5KFJA 5JVGQ 4YQWA 1PSDA 2R7TA 4DL3A 3FEZA 4IO9Q 1KFSA 1GTHA 2XI3A 4RNNA 2IMGA 4ICZA 2HC2A 2BQUA 1IKVA 2U1AA 5KFBA 3BS9A 3KLGB 3C16A 3HHEA 3KJQB 2L48A 1QSYA 2WVEA 2UXDJ 3QCLA 2IMOA 2UU9F 3KDOA 4RUHA 1P3DA 4QWBA 2QL5B 3DCAA 2OUDA 2MQQA 1RT7B 2GVDA 2KRBA 3FKBA 4Y3CA 3S1TA 3MPDA 2Q05A 2XY6A 3QFWA 2XPCA 1VLYA 3WX8A 4A4JA 3F99A 3FQLA 1Q6SA 4LFBF 4DZ6A 4PG4A 3MR3A 1E6YB 2EK1A 3V0DA 4U7CA 2PO4A 2QZ8A 3PIPQ 1VHRA 1LQFA 3JSRA 4E2FB 4DR7J 1HPZB 2AW0A 2VICA 2YNGA 3TVZA 3P49B 2DT9A 2AM2A 4YR8B 2DGVA 2VEUA 5LJ5Y 5F0WA 3ET6A 1S1TA 3OTBA 2KO1A 4KGKA 3SR9A 3N9UC 2D3OR 1XM2A 1KRPA 1XMQJ 4J37A 1JLBB 1YRTA 4XDCA 4FBUA 1W26A 3TEGA 4ELTA 1IVZA 1HQEA 4X4VA 3BYPA 1IR0A 1TTHB 5IZHA 3GSIA 3OLRA 3NEKA 2FYXA 1G7FA 2HHHJ 1KKHA 5K8MA 3Q89A 2NREA 2IM0A 4WFXA 4XPCA 3D0HE 2UUTA 2GVZB 3C6TB 3D0IE 2HG4A 3N28A 3U27A 1X60A 3SXLA 5T14A 1RLCL 4GRZA 1HL6A 2BJDA 4ZVGA 2E1RA 1ZAWA 1QVFR 1VRUA 4QU6A 1NK6A 2WBMA 4NLQA 1SC1B 4F2RA 2Z2YB 3OUYA 2HS0A 3CCJS 2BKPA 3GU0A 4KB7A 4NEYA 5C25A 1Q6MA 4RLEA 1B0TA 4DQIA 2G59A 2U2FA 3QRPA 1HI8A 2JC1A 1S1UB 2RDJA 5KFYA 2B6AA 2BJ7A 2PEBA 4DOZA 4DPOA 1XRIA 3KK3A 3DXBA 1P8GA 4DXLA 1XMOJ 4DSFA 5IWAF 1TK8A 1PC5A 1JLFB 2F8HA 2XCPA 2CWXA 2LDYA 2W7OA 2A8BA 1FVQA 3GILA 4O4GB 3T1AA 1AT1B 1GFYA 2ZHAA 4R5PA 5KA8A 4HEA9 2XMVA 1PTUA 4ED8A 3GCWP 5DJBA 2HHVA 3JTOA 1PA1A 3CDAA 1Q6PA 2AJ1A 1S1VA 3M9NB 2I42A 4DV6F 2MZTA 1HR0F 1U1NA 4OL8A 1VQ6S 4WKYA 4OZNA 4K8RA 4FYDA 3WX4A 4RH9A 3CTRA 4O3PA 1D9DA 1LQ9A 2QBRA 4BBYA 4IKAA 1HWIA 3PKYA 3H5YA 4D3PA 2BV5A 2EBEA 1J5EF 2ZH9A 4JI8J 4RW4A 2PSZA 3BGFA 4ZLJA 2WCXA 2BANB 3MEDA 2ASLA 5H9FK 3SCLE 5MMZB 5IT9U 4QYZJ 2QEPA 1XR7A 4S0GA 4Q0BA 1RLDA 5AT1B 1U0SA 2FVSA 4NYZA 4UOHA 3QQCD 4I7FB 2HHSA 3LAMA 2W9CA 5KG2A 4FDFA 5D4NA 3BLTA 3M4UA 2DITA 1VQPS 1D1UA 2M4MA 4DPTA 1RHRB 4X4PA 4CLUA 3J81j 1WC5A 1S97A 3RUBL 3OLAA 2IY5B 4Z7YA 1SI9A 2RF2A 3JAMY 4MKVA 1UPPA 1RZMA 1SBRA 2CQPA 2DVIA 3R27A 3MI7X 1UVKA 5GAHI 4LR9A 4ZJOA 2L9NA 4RJVA 2B4PA 2HZAA 2ZOFA 5JMNA 4KBIA 2W9BA 5KFCA 3A3PB 2RB7A 5KFKA 3W63A 4ZVPB 1GQEA 2KXNB 2V2QA 4FP9A 2WVBA 4NYOA 3NRBA 2YX4A 2OD4A 3ZM3A 4OZJA 1RT1B 1MROA 2WOMB 2CYYA 4QIFA 2IYGA 2RKIA 1ZZFA 4YB7A 3PHTA 1U2FA 4WU2A 2RRBA 2X1GA 3K5MA 5A8KB 2V5HG 4EUVA 5DGBA 5J2MB 4FBTA 3MOZA 4LFAF 2C2NA 1S6PA 5IQQA 3DOLB 3CMAS 1VI7A 2G0CA 4EBCA 5AXNA 4I56A 4TYBA 3V0JA 2C28A 4ZCIA 3OPKA 2M3VA 3BR9A 2F5GA 2D9PA 1FKOB 1V3SA 4OHVA 1HWKA 3HSGA 3QRRA 1CC7A 5DETA 4WWSA 3IO1A 4ES3A 2FC9A 5CXTA 1SIWB 3HT3A 3UO0A 3OTOJ 3FCWA 2AMCB 1JLQA 3HDSA 4GFVA 3EXYA 4DPYA 2OFHX 2B56A 1NJXA 2CQ0A 1KLNA 4PPZA 2BM0A 2Y1LB 4DR2F 2MJUA 3HFZB 4X62F 1RYSA 1K0VA 1B4SA 4MYUA 1RYRA 4LF6J 2HGMA 2F71A 4RX6A 2F65A 3I36A 3CC7S 4IRCA 4IO1A 2ROPA 1RTIB 3CWJA 4JP8A 4RDDA 4OHEA 1Q81T 4UZCA 3V4IA 3KG0A 4OYBA 1U09A 3HO1A 1OQ3A 3ZMQA 1VDHA 4YP3A 2Y1OA 2GMLA 3WIUA 4A47A 3HVRA 1NK8A 2BJ3A 1JJCB 4ZHRB 1TVRA 3EGZA 5I4MA 3T5JA 4X4SA 1V3RA 3TOQA 1WCHA 4NLOA 2OGUA 3D5MA 5CZVA 1PIEA 3D1OA 3I31A 4ECTA 4CM2A 2E5LJ 3M30A 5ETNA 5AXMA 2HHWA 1JKHA 4L72B 1WDTA 3QNWB 5IT4A 2EG2A 1G4US 4QWAA 2MHEA 4YR0A 1MMLA 2IAJA 2IHR1 1AW0A 3FSYA 1WTFA 2GP0A 3V6DA 2GCAA 3RR7A 2B3TB 3MM6A 1F0XA 2VC0A 3RG6A 1ELOA 2WW8A 1YWFA 3PW7A 3AA9A 5LMUJ 3F44A 4ZPVR 4Q2MA 5LOQA 1GXLA 3DRSB 4WIQA 3QCKA 1XXPA 5BR8F 2QLBB 2VDHA 5M2PA 4DR1F 4PWDB 1FFWB 2UZAA 4TVVA 1YVFA 2GGPB 4MJKA 4L6V3 3W66A 4AE5A 2EG1A 1FNMA 5KT7A 1PYNA 1SPBP 3NNHA 3R97A 5IBSA 2MKCA 2GMHA 1VMBA 1SUQB 2XNQA 2HKEA 2Q6BA 4AL5A 2C7SA 1JJHA 2CVEA 4HJQA 3HLUA 4ZVFA 4MT1A 3AD7C 4ILRA 1T9TA 4WFYA 5L38A 3MVNA 4QIGA 3LH2S 2YX1A 1UA0A 2UXBJ 3ZV2A 1SV5A 4OV1A 2XTJP 3DLBA 4RI4A 2CQ1A 4OIXA 1DQ8A 2R7OA 3FBBA 2CPJA 2GHPA 4BDPA 3N6MA 1XK8A 5T7LA 2O67A 3KXDA 4NL5A 2ILZA 5JJBA 2QYCA 2VG7A 2RQKA 2D69A 3FZBA 4LVNP 1S4EA 2WTFA 2LEPA 2BV3A 1DQAA 3QKPA 1APSA 4J9UE 2DNPA 1RA6A 2A2DA 2B8QA 4A8MP 2V8PA 1UW9A 2MEWA 2HBZB 3ONQA 3ZZUA 3MMBA 1HQUA 3V0EA 1LFWA 1I9SA 3CMES 1YRUA 2CJAA 3V5RA 4P9SA 1ZPVA 1T0TV 2V4RA 2M8HA 4QCLA 3JAMU 4QU7A 1RTDA 2XY7A 2MPUA 2V4JB 1U0HB 3HVWA 4RKKA 2DR5A 3DYAB 3DU5A 3B54A 2OSQA 2KYXA 4DF4A 3EE3A 4OHYA 3CCRS 2G13A 1HNVB 4XTTA 3BLUA 1IBLJ 1RDRA 1NRKA 3SDEB 3M8QA 3NXZA 2B7CB 6AT1B 3KMSA 1LOUA 4Q45A 1RTJA 3AWFA 2HBRB 1FEHA 3OT9A 5A8RB 3MAAB 3M2RB 2YNHB 2X51A 4PG6A 1WOSA 4C8LA 3VVUA 3QT5A 3BO4A 2D3O1 5B08A 1FEEA 3NKYA 1F9HA 3AD8C 1VYAA 4U8VA 2YNFA 2NUHA 2CM3A 2BJ8A 4PCQA 4TU9A 3KNAA 1FJGF 5I3QA 4X4OA 2HPUA 1YFOA 2B4UA 3DLJA 2WVCA 1TKXA 3NOGA 2E7WA 5KOXA 2F4VJ 3A5KA 4KR0B 1QTNB 3W65A 1F1BB 1SC3B 4K7QA 3DDNA 2EW9A 5J2PA 5E41A 1JF7A 2CNKB 3RW7A 2GO8A 2XZWA 4MFBB 1SJ3P 2EPIA 1HMVA 4F7VA 1TZ0A 3GZ7A 2RDIA 2B0GA 4M1KA 1RT6B 3AB2B 4OZ3A 2HFVA 2ZBIA 4RWXA 1UWAA 4IOCQ 2GIRA 1M5VC 4URGA 4NCGB 1RT2B 4LSLA 3CCSS 2BM1A 4FXDA 4KIAA 2EK6A 4G1PA 2EEYA 3A4TA 3P4UB 1Z2LA 2PFFB 1FTCA 4CVMA 3ENQA 1DTQA 4IUFA 3HVTA 1U1PA 3H40A 5F8LA 2MKHA 4RW6A 1FJ7A 3AFGA 4GC7A 4K2JA 1LW2A 3KJVB 1RTHB 5DO2A 2HQFA 4OI0A 3SSSA 5D4PA 4DSKA 4N5SA 2HRYA 5M2RA 3MR7A 2C2EA 2UUCF 1JLAB 1S0NA 1HHQA 5M43A 4A8WA 2P4DA 5L9XA 2VUGA 3NLCA 1GQYA 2AZRA 2LECA 4LF8F 4ZVUB 4FF4A 1RAFB 1GMVA 4CNYA 2V68A 2MSTA 5B7WA 3MTJA 2R42A 2VBXA 1JLCB 1XC9A 1G6BA 4K4XA 5K8OA 4RW8B 1UTAA 1BD6A 4BPCA 3GP9A 2OSRA 1GEHA 4DR4J 2IJFA 3ISNC 4DR6J 2ZD1B 2RHQB 5EWFA 1REVA 1B3TA 1TQLA 2K1RB 3H5UA 3MZIA 2HNYB 2AJ2A 2A18A 3M6WA 1DLOB 2QN6B 5E0OA 1T3OA 1Q1KA 2COLA 2PIIA 2LQ9A 3PG9A 3I0RA 3AJ2A 2XMTA 4DL0C 2YQ1A 2QA1A 2L9DA 4FNIA 1VRQC 1MWQA 3AJDA 4DX7A 4ECSA 4BJOA 3A13A 3O6QA 3HX9A 3HHLC 1UVMA 2A1BA 5H1SV 4I4BA 1HWUA 1IBMF 5K25A 1IKYB 4EFAC 3LP2B 2XYPB 4QOTA 2HGLA 4FYVB 2ZJRQ 5KT5A 4LREA 4PWUA 3LGHA 1FF2A 1FFSB 2IIHA 1IWAA 1Y9OA 4FF3A 3CCQS 1LYVA 4MK7A 4DL5A 1FKAF 4IOAQ 1OYDA 1C1CB 1MMNA 2HLUA 2V9WA 3GTYX 3DLKA 2I0XA 5KFFA 1G1HA 3NCRA 4ER8A 3GXHA 4LIWA 2ZNYA 4EBDA 1RT5A 4K4WA 2J7UA 2E9RX 2IPOB 4RW7A 1RAIB 4ED5A 1KR4A 4QIWD 3F9BA 5KFUA 3H59A 5ITHA 1VQLS 4NLRA 3C46A 4OHIA 1WI8A 1HNWF 1IJFB 2GO9A 4JV0A 5E2QA 2L08A 2HFNA 1EQMA 1UW4A 2Q6CA 4JV1A 2F8EX 3SQGB 2HGNA 1H74A 3UNGC 4A8SA 3BKTA 3T6BA 3CJ3A 1TAQA 1Z4UA 4FKYA 3J80Y 4UF4A 4HVZA 3PJWA 4O0IA 2LQBA 1MN7A 2NXUA 3D6FB 1NNDA 4IH6A 2W8LA 4PXEA 1LWCB 2KVQE 3AODA 2JFFA 3M6XA 5AJ3J 2GAHC 4TKTA 4YAAA 1NH8A 1V6HA 4CVLA 5HO4A 1GQQA 5GADU 3DRYA 2OFGX 2GC8A 3Q24A 3ZNJ1 4OZ0A 5EHPA 3PX4A 2BOAA 3RZAA 3BO2A 4GWFA 5DRKA 2UVRA 4KHPF 3B7OA 2HC1A 3LTOA 3QO9A 4DV4J 3N2AA 4ZJQA 3DDKA 4HI1A 3SZ2A 3MURP 3QIPA 3PW5A 2HHQA 2HNDA 1WAXA 1BQNA 1RTZA 2QC3A 3VQTA 3SBMA 3KK2B 5IC6B 1OMSA 3E01A 3HSDA 3NGKA 3H2XA 2FLNA 5HATA 2EC0A 3IM8A 1EP4A 2YPZA 2JEIA 4OHWA 1KVJA 5A8WA 3I9ZA 4CLZA 2FJMA 4GVLA 5KFEA 3PYZA 5E3QA 3BSNA 3CIMA 1NSQA 3I96A 1PJ6A 4YR3A 3R1HA 3B6BA 4DWIA 4D3GA 2NCKL 3H42A 3N01A 4KE5A 4AT1B 1M5SA 1GAOA 3K57A 1QAIA 4KRWA 1U45A 4DQQA 4A8XA 3LUYA 2RAQA 1TMMA 4LRAA 3NL0A 2B4VA 1N5QA 3PYDA 3FSXA 1RWWB 6FDRA 4B3OB 5CA5A 4USTA 3ICLA 1CQNA 4Q7AA 1FCAA 1WNEA 2E1CA 1ZTTA 2ZE2A 3TZYA 1R8PA 3TUPA 4DX5A 4JBCA 1NZ8A 3A12A 3BREA 2J7WA 2RIJA 1HA1A 1UJ4A 2HW3A 2I2YA 2IM2A 2PA8D 5ETTA 1RT3A 1RT4B 2FLLA 3R3TA 2DGQA 4USKA 4PXCA 3RBEA 2HQ3A 1L3SA 1WC4A 4YMEA 5JXSA 3EPGA 2HMIA 1RCXB 3IRXA 2Z2LA 1K1QA 4B9VA 5HMXA 1X4EA 3UCZP 1HWLA 4V1Ak 4RO0A 2DXEA 3VGUA 1KOHA 1S59A 3DLGB 3CD0A 4H4MB 3NGSA 1FDDA 1YG0A 1YJWS 5K9VA 1CJUB 3C14B 1VBZA 4ZKAA 4WBFA 3MMAA 1Q7YT 4DV0J 2MSSA 4GKKJ 4Y65A 2H9ZA 1FRLA 2VOSA 3VGSA 2R7WA 1PAEX 2EKYA 2UUBF 3C15B 3G82A 2EFGA 1CJVB 1LW0B 1SJ1A 2NYHA 2YQ0A 4E0DA 2QA4S 4IQXA 4WFBQ 3GJSB 3V4MA 1UA1A 3B4DA 2RUSA 4GKJJ 5LM7E 5LL6d 2BQ3A 4EMDA 3FRZA 2GAGC 1WORA 3JTPA 1WKJA 4ZVOB 2CPYA 1ACMB 5F41A 5AWXA 5KFMA 1NXIA 1F5AA 1FRIA 3I9V9 4PQAA 2PT0A 3H98A 3A5JA 1VQYA 3H5SA 2E9TA 1Y00A 4QAHA 5JVHQ 1NZAA 3DDIA 2MMYA 2J6TA 2BXJA 4X4UA 4L74A 2B49A 4K4TA 2W25A 5K14B 1X9MA 3GYNA 5KA0A 1IKWB 3UWTA 2QEXS 1JNZB 4PG8A 3M8YA 1SIZA 2CFXA 3ENWA 4X4RA 1CULA 2RU3A 1WOOA 3OTDA 2DXDA 2NLKA 2C2RA 2FGOA 1HBNA 3QWPA 5CYJA 3M6UA 3TZWA 2AZ1A 1NZ7A 3BZQA 5D3GA 2FHJA 3EM1A 3ULHA 3KLHA 4B3MJ 1U1QA 1N5YA 2GC5A 3MCMA 3FFIA 1GH8A 3T9NA 4Y2CA 1Q8BA 4ZDNA 1XNQF 2QTWA 4ID5B 4ECYA 1JX4A 5C2GA 1G1FA 4IG3A 3KLFA 5HVHA 1HYSB 2M3DA 2CQ3A 3BBFA 3LANA 4FF1A 3GV8B 1K9MT 1ZOTA 2VG5B 3M8PA 4RNHA 5IV4A 3FCHA 3CJ8A 2RH3A 3SQOP 2GX8A 1N36J 3LW5C 4DMZA 4WXWA 3TX0A 2LDIA 4I2QB 3UDLA 2WTZA 3CD5A 2XC9A 4FNHA 4ZITA 4NEZA 1R6VA 2SXLA 3BRHA 4CRJA 3AAWB 3O1LA 4OYWA 2YDUA 4UT4A 5K9WA 3J80U 1HLWA 1NHUA 3PW2A 4M5MA 3QCJA 1N4LA 1XNRJ 2XMWA 3HM9A 2XLKA 4O44A 3L3CA 2GJTA 4CI0B 4N76A 5DLGA 3TA0A 2XG8A 1XMOF 3QIDA 3DMJB 4WTOB 3HK2A 3NNCA 2MKJA 4ZRTA 3I0SB 1R31A 2H48B 1BXNA 1YZ4A 2AF6A 3ETMA 3GJTB 2XLJA 3H2VE 3M1VA 1KTQA 1FE4A 2FVCA 1WRMA 4IFVB 2XZTB 3EUNA 1LNQA 5H9EJ 4OX9F 4OZ5A 2MQPA 2MZQA 4N8NA 5BYQA 1IJEB 1J2VA 4OI6A 4CLTA 3JYTA 1WEXA 2ADBA 2W9AA 1YGRA 2BMBA 3IGNA 2DJWA 5CCLA 2CXEA 1S0OA 2PMWA 1T05B 1WDDA 4LR7A 2VQFJ 4TLQA 3W64A 2DR7A 2E1MC 3U1MA 3TW0A 1MLAA 2G0IA 4YDDB 2PMZD 1JJ2R 2EI5A 7FDRA 2R2RA 1YJ9S 1VQ5S 4KHRA 2CADA 2DEIA 4O3SA 2KXHA 2FVRA 2KFNA 1YIJS 3W62A 3CIZA 2G2YA 2A0FB 1G2EA 2ROEA 2BE2B 5IT0A 5HLFB 1FDNA 1UETA 3LF0A 4ES2A 3Q8SB 4NI2B 4Y2KA 4GFUA 2W2NP 3FZ2A 1P27B 1RHUB 2DO4A 5CZXA 1A6LA 2DNZA 5E33A 3CXCR 4CLLA 5A2QY 4CLWA 4NLDA 2C2MB 2YNIA 3NCPA 1PTYA 4OFZA 4LF9F 3S3HA 4YB5A 2AWZA 1EETB 3NBPB 4CO0A 2RD5C 3FBCA 2VC1A 4ZP7A 5KAAA 3VAKA 1NHKL 4KAIA 1RT7A 1RUSA 4W92B 2H3EB 1N6QB 4CH7A 2OTJS 2MB0B 4XK8C 2IM3A 1M1GA 3MM7A 2ZDPA 3POTB 4KSEB 2J8SA 2J0WA 4HYKA 2VEYA 1U47A 4OX6A 3K8WA 1SJ4P 2NPFA 3A8KA 2AEFA 1AFJA 2VBWA 3CCTA 4KGVB 3HJFA 1T9XA 4QPTA 3O5TB 3QGIA 1HNIB 2I8EA 4H54A 3UW1A 1NAQA 1OIAA 4P71A 1AZSB 1T48A 3LP0A 1Y7PA 1OHDA 1NO6A 3VWSA 3UN3A 3AJ1A 3NP5A 1HPZA 1I5OB 1UJ6A 1LK7A 2QJ3A 2P6SA 3D54A 4KC5A 3G6XA 4XAKA 4M5KA 1EIYB 2IDEA 1UFWA 4ZCKA 3IR6B 1UAWA 1ZM4A 1D0EA 4J7CA 1SKUB 4M8LA 4OJGA 5HVGA 1FKPB 4E98A 1JLBA 2CJXB 2YY3A 3FQKA 1LARA 1RP5A 1LXNA 4Z2XA 4GE6A 2F6FA 3QGHA 4B3SJ 2G2ZA 3R2CJ 2Y8WA 9RUBA 2JEFA 4KV8B 1BUXA 2GVZA 3C6TA 2R2TA 3U7JA 2OH2A 2ACYA 4CZCA 5KT6A 2J7KA 1VGYA 2M2BA 4KHMA 1UCNA 2YKPA 5A0YB 1XIQA 3E3XA 1SKSA 3CE8A 3UAGA 2W1BA 2DH8A 5K8PA 4IRKA 2X7IA 3OTOF 3R5JB 3LJ8A 3PW0A 4QUMA 1JNRB 4P2SA 4URQU 3O4TA 1S1UA 2Z2ZA 4DJBA 5KAKA 5LT5A 5LXYA 3BO3A 2R8KA 1FERA 2FHKA 2W8KA 1Q16B 4DS4A 1S0MA 4ALZA 4OYXA 1S10A 2P9CA 3NGTA 3M9MB 2LQ8A 1YX2A 2YWFA 4ED7A 3NMEA 2DCLA 5MAOA 4O3QA 1JLFA 3UNYA 1EQ0A 5A6PA 3N0VA 4LSNB 1UJ5A 5AXLA 4K5SA 1YTWA 4O4GA 1CBKA 2XYGB 4A8KA 4MK8A 3OHBA 3OR1A 2L3MA 1RABB 3T3FA 2Z30B 2R2SA 2LU1A 3L09A 3PV8A 4WIIA 1W2BR 5SZTA 3C66A 2QLWA 2DGUA 2PC6A 4URSA 2LFVA 3O8WA 3WHIA 1RWVB 3LP1B 3R2DJ 4D3QA 3CWEA 1MWYA 4YHHF 5D6GA 2YKNB 2J6SA 5F3ZA 4HT5A 1JXLA 1S9EB 5JUMA 5EX3A 5HROA 2JEGA 4WE1B 2QFJA 3OFGA 2BANA 2HVDA 4F4KA 4WZMA 3FCVA 2IC3B 1KLMB 4P72A 2BX6A 2DNGA 2UUPA 2MGZB 2I6MA 3CC4S 1WF1A 3FBEA 5J2QB 3HHLB 1U1OA 2Q1LA 2H03A 1JMTA 2HQCA 1P1LA 4DR5F 4I7FA 5HI7A 2NXCA 1D8YA 3HJVA 4YN3B 5KFIA 1U8SA 3R7SB 1S9GA 5FDLA 4JMJA 3PKMA 3UD4P 3PY8A 5D0RA 4MTPA 5HDEA 3AOCA 3CM3A 3R9LA 2J5AA 3S4EA 3ZTOA 2H5IB 2QDPA 2PI4A 1S57A 2DEJA 4AYBD 3AQPA 1ZM3A 4DN0A 3ITHA 2VTEA 3TO8A 1IKVB 4G1IA 2GA7A 3VHQA 3IAM9 2HVHA 3ELHA 3G8SA 1CS4A 4USIA 3JB9k 3QYYA 2I6WA 2CQCA 2D3ZA 3OLBA 3RAXA 1NDLA 2ZWPA 4ECUA 1VQKS 2DO0A 4ZN5A 5DG8A 5C42A 3K5PA 3DFEA 5KA1A 5KA3A 4IH5A 1CQMA 1XERA 1LWFB 2IA6A 3L7PA 1IBKJ 2DHHA 4ZVEA 2NZCA 2WOMA 4KO0A 2RRAA 4JI0F 1X4DA 4PYDA 3KDNA 4U8YA 4O3OA 3OR2A 3J7A1 4CCHA 4GC6A 2ZH5A 3AOAA 2AJ4A 5J2MA 2W2PP 1NM2A 5BXIA 2QMUB 3HF5A 5A2QU 1KWMA 3MPVA 2HQGA 1NCLA 1AUDA 2CG8A 2UP1A 4YR2A 3DOLA 4DSIA 2WSEC 1VQ9S 3ET6B 1S1TB 1SC4B 4JI4J 4QUNA 3C8YA 2FY1A 4F4WA 2HLTA 2BZ2A 4CM0A 3BEGB 5HK4A 3ENVA 3AQOA 1FKOA 2KM8B 4TLRA 2CNFA 2CZVC 2P8IA 1NK7A 2BVZA 2V6AA 2CPIA 2J0XA 1MSWD 4WFAQ 3FBFA 5KFRA 3CVKA 3A3OB 1A7GE 3FMBA 3PXGa 4ECZA 2XEXA 2DGXA 1R8CA 3QJLA 2OELA 2VB6A 4WP8A 4WPAA 4MBBA 3ZFVA 1HW8A 2JDJA 5HQLA 4RZRA 2XBPA 3RW6A 4DL2A 5FJ4A 4TYAA 2C3MA 1RCOB 2AD9A 5U47A 2VJUA 1FRJA 1PKUA 4K59A 1VCTA 3BKFA 3RRGA 1YTYA 4Y6IA 3W60A 1ZCLA 4ZJLA 3LPYA 1RWPB 4LT6A 2QA4G 1FNXH 1Y11A 2B9YA 5J2NB 5LSOA 1J5OB 3PZPA 3I87A 5KG3A 1S6UA 1HNZF 1SC6A 3DOKA 3M2UA 4ZHRA 3VGTA 4FXWA 3P3DA 4AL6A 3QT8A 1EX8A 5F3TA 1GNKA 4OYOA 2JOQA 1EENA 2CNNB 1KNZA 2AYBA 1WHYA 2F4VF 4DCJB 2MY7A 1N33F 3RBZA 2R7QA 1RGVA 4R5PB 2BQRA 2CJ9A 5DZ6A 5F8IA 2BACA 2FTRA 4FPIA 2RE1A 1LK5A 1Q6JA 2R8GA 1JXVA 2BZLA 2VH7A 2IDLA 3MOWA 4OHDA 3LGNA 2QSWA 5KFHA 1U1LA 1IR1A 2CPEA 4R8UB 4OHHA 2CQBA 2RILA 2QX0A 3DI6B 1TFYA 2MYFA 1N32J 2KHDA 1S48A 4QBEA 1Q79A 3HN7A 3OTCA 1DHMA 4EK2A 2QYGA 1XJWB 4LMZA 3FRYA 4RW4B 1SJFA 2C1EB 5KG5A 3DRSA 1RA7A 2IVFB 3OV7A 2OEMA 1TKDA 3CCUS 3OFFA 2J9EA 1SUGA 4TN2A 2HURA 4Q0BB 4RI5A 2GGPA 4X4NA 5IXUA 2ZZTA 4MKBA 2AQ4A 3I80A 2PE8A 1FA0A 1SUQA 2V9KA 2K2PA 3KG4A 2ZH4A 5KFGA 3PJ9A 2VFSA 5F8JA 1JBWA 2NYIA 3M2VA 3Q8UA 5IFMA 2ZM6J 4HHJA 3RO1A 4GE5A 1NKEA 3IMQJ 4CH1A 1U6FA 1WG5A 1X5PA 2YH0A 4DR4F 3GPAA 1N0VC 3PHEA 2QBQA 1SB6A 4MIWA 4ZPCA 4LFBJ 2W9BB 3D3BJ 3T5LA 2DRDA 3ZTPA 1P9YA 1OESA 3MEGB 4H4KC 1TKTB 5ETLA 2AYMA 1X0FA 1VLOA 2DIUA 1OYEA 2WB4A 1JLEA 3EU0A 1Q53A 2Z57B 3GFHA 1MROB 3CCVS 4U6PA 1Q0NA 3HMJG 3J81Y 5KFAA 2G2OA 3BM8A 1OETA 4LRFA 2VQEF 3CW2C 2W2QP 3QCDA 3PO5A 3TAMB 2QT7A 1Q95G 3NAIA 2DXPA 3S3EA 1OEOX 2RRNA 4WYLA 2DNQA 1RAOA 2QBSA 1HBOA 2QV6A 2V4JA 2P9GA 3F81A 2RQMA 2JWNA 2QCTA 3OSNA 1N34J 2HZVA 3ZM1A 2HWIA 4ZCMA 2V8VA 3BYRA 2ZNZA 3CUNA 1V9OA 1IN0A 3CJRA 2DB1A 1R0BG 3NWGA 4AQYF 4DX8H 2NT7A 1I1GA 2NTAA 2FD2A 3N5BA 4TU8A 2XGPA 2GJIA 5IBMA 5A76A 1R7IA 2Z0GA 2AYEA 1C1BA 1SJQA 1JLQB 5A8RA 4B9NA 3MAAA 4EWTA 1IKXB 1ZS6A 5H9FJ 3M2RA 4AD6A 2YNHA 3Q8RB 2AJFE 3G6YA 4QIEA 3ETOA 3VZIA 1PBAA 1VR6A 1PJ7A 3BBBA 4V19X 2MQLA 2B43A 3F56A 4OYAA 4RNFA 4DSJA 3IWNC 1DFDA 2YKOA 2CJKA 3NMRA 2FPHX 2XZDB 5BX1A 3BR8A 3O2IA 3V4IB 1JK9B 3EDRB 2B9XA 3PIOQ 4DR3F 3BBCA 1RHMB 2X3DA 1KAVA 2DGSA 3UI3A 1EZZB 4X4TA 2N7CA 4W4MA 2PEHA 1TVRB 2QLXA 3CT9A 2HHXA 3MD1A 1NEEA 2AIRB 1K8AT 3ZZ0A 4Z6BA 3NAHA 4QR2A 1RAJA 2OP5A 1RT6A 4CO3A 1IM4A 4DV6J 4P52A 2Y67A 2ZKTA 2HVEA 2KB2A 2ZC4A 3MAHA 3PNIA 3M30B 4MKYA 3Q2TC 1EHWA 1Q1MA 1JKHB 2E44A 1RT2A 3CCZA 3Q86A 2AKWB 4HACB 4KYZA 2IAJB 1NBEB 3PFOA 3GONA 3BPSP 4LQ3A 3RAMA 3EGNA 3V2UC 3V6DB 3W61A 1J5EJ 2ASJA 3HP6A 1UEKA 3DN9A 3MM6B 3J7YI 4HRFA 4USWA 1FWLA 3EZZA 2I6OA 4BLGA 3GMGA 3OTEA 2WBRA 4G65A 1WACA 2J16A 4IR1A 1KQGB 3D1HA 2DR9A 1S7IA 3KJVA 2LU2A 1RTHA 4CO1A 3M32B 1F3FA 2R8HA 1KAKA 4CDIA 1X9SA 1C84A 3HKZD 1XR6A 1H2UX 4DV2F 3CJSA 1X4GA 5C5JA 4X4QA 4ZPTR 4NXMF 4ZVRB 4K5RA 2C3OA 1OPZA 2FQQB 4UOCA 3T1HF 4B3RJ 4ECWA 1HNXF 1NPKA 4NNDA 2KG0A 4KGXB 4CYUB 3TZZA 2NZ6A 1NSPA 1JLCA 2VONA 4RW8A 4NLGA 2XNRA 3TNVA 2VFTA 4DPXA 1U2RA 4JMKA 4QF5A 3W2WA 4NX8A 4YY3F 2NXNA 2VASA 3MUVP 3W5YA 1HKAA 2Y0BB 1F9FA 1GMUA 3D1QA 3N79A 2HNYA 4PKDB 1FJCA 1SV5B 2VPWB 1ZYQA 1QZ0A 4KPCA 1M5KC 4IH7A 1GWZA 2CDRB 1QE1A 1KQKA 4J9LA 1Z2ZA 2KKHA 1ZPWX 4ED2A 3MUTP 1S1XB 2DHXA 3OW2R 5T7LB 5DM6Q 3KYLA 1WHVA 4QR1A 3QLHA 1U6ZA 1DZ5A 4M5DA 4NA3A 2F8MA 3CB4A 3A8EA 1YJUA 3NS6A 4U96A 2NS1B 1IKYA 1SL0A 1LXJA 3MM9B 3DC2A 2DNKA 3P5TL 3SFGA 1AFIA 1KONA 4LFAJ 4OYPA 4OHLA 1FI4A 1C0UA 1PTVA 4DPUA 2F9JA 4H34A 3EVWA 3EXCX 1M0SA 1D5RA 1X5SA 2ZC3A 2JL9A 2VZ9A 3IBWA 4USVA 1RISA 3DLHA 3PDNA 3PVXA 4QDIA 1U25A 2YX7A 2JLFA 4ZOSA 4GKKF 2ALYB 9ATCB 2ZZNA 1TKZB 1G7CB 3BPDA 4JB8B 1H2VZ 2ZH6A 4KI9A 1RTDB 2D3UA 4TY8A 2QLJB 3CJ2A 5K9FA 3QCFA 4Y2MA 4EEYA 1RU1A 4LRCA 2E29A 4DPWA 4FYXB 1T9VA 1YKWA 2XGQA 2DTJA 2WVFA 1J6UA 2OPQB 4FYWB 4X62J 1PA9A 4HH0A 3LALA 1CJTB 3MPUB 1N5TA 3DM2B 2JJ4D 4I6WA 4F25A 3SV4A 2M8DB 1CJKA 3J81U 3K58A 2CNLB 3W8GA 2AJQA 8AT1B 1O51A 4ITSA 1X4CA 4Q2LA 3TQ1A 3UCGA 5KFWA 2VU5A 1R89A 3HHKA 3CF5Q 1M1KT 4CLKA 2IVMA 4P2FA 2VA2A 3C2PA 4CH0S 2I6JA 1LWCA 3CJTA 1VQSA 2ZEJA 3P8BB 4F04B 4WTYA 1N0UA 3P96A 5KFTA 4DSEA 4W98A 1XEZA 4OHZA 3MPYA 2ILYA 2CVIA 2I1YA 1PG5B 2B9WA 2Q43A 1WHWA 3NGRA 5J2PB 2ZWOA 3FMWA 1WG1A 3MCNA 2BOPA 4F4AA 1R8HA 2VIHA 1QD1A 4JYAF 3BDPA 1YJRA 3ZC4A 2BKOA 4IFYB 4H4OB 1N36F 3EWGA 3JXOA 3SMEA 1O0PA 1TAUA 2P2CB 2J17A 5G0RB 4LSLB 4DN9A 5LMNF 5EWGA 2UV8A 4IQMA 3K89A 1N5VA 1L8KA 2QDCA 3M05A 1C4CA 2JFHA 4KJIA 3Q8PB 3SMZA 4K0KJ 2XS2A 5BR8J 1MG7A 4DR1J 1DTQB 2M70A 4CLYA 2LQJA 3ZL8A 3U02A 3HVTB 1NJZA 1XNRF 3OVAA 3AXKA 2CPXA 2CQ4A 4C8OA 1LW2B 4DU8A 1C0TA 1AUSL 2MZ1A 2F7VA 1HWJA 3D0GE 2IA0A 2N7YA 2NXEA 1I9TA 3IXQA 1AB8A 2RHSB 1HHTP 4C8ZA 1BLUA 2K7KA 1RXDA 4B3OA 2WJPA 1W7KA 4U9RA 2H1YA 4F26A 4MAKA 2CIMA 3BQ0A 1X24A 1S99A 1D9FA 1IQZA 1DTTA 2K06A 2KI2A 5KG1A 4JNBA 2HFOA 1RHKB 3MMCB 2CDQA 1REVB 1VC6A 2ZITA 3CD7A 5HL7Q 4OX7A 7AT1B 4DU7A 5HP1A 3IS9B 2I6IA 1R8AA 4N8OA 1TL4A 3G6ES 4HHHA 2CJZA 1WC3A 4P2MA 1XWLA 2RJZA 2I5XA 1S72S 3TA2A 1EB0A 3GJRB 1N88A 3LK7A 4DV7F 4ANCA 1VQNS 2ZH7A 2VTDA 4JI2J 3DLGA 1W78A 3HI9A 2K7JA 1I6JA 4H4MA 4JI3F 4OI4A 5GAEU 3FGVA 1CJUA 3C14A 1S5ZA 5CYQB 4OYIA 5I42B 4DDFA 5KFOA 1BY9A 3IG1A 5DDPC 1U49A 1FTRA 4DV5F 4JI6J 2J0QD 4JI1J 3C15A 4DUYF 2BIJA 1CJVA 2KG1A 1FPZA 1FT8A 3PFEA 2KH9A 2XWXA 3WZ0A 3HT0A 3ZTSA 4MMOA 1TUGB 2HK3A 3B8HA 5GMKa 5HJXA 4LF4F 3QCEA 3T1YF 2D74B 1M1HA 2QL7B 5K22A 3W7BA 1FXDA 3DLKB 2OZ5A 1IR2A 3TQEA 4EO6A 1QAYA 3RZ2A 3G87A 2PDAA 4C4WA 3VAIA 2R4FA 3PYEA 2XM3A 2V2ZA 3UR0A 3O5XA 3U96A 1T9UA 2LMIA 3PS5A 1T4JA 1X5OA 1KVIA 1B0VA 5KA4A 2XB2D 1L5UA 4NZ7A 2J8AA 2EWHA 4RUAA 2M88A 4I2PB 1S7HA 2HNPA 1NJYA 3D2WA 5IV3A 2YWHA 2Q3PA 1S4FA 2EVZA 4KFBA 2LLZA 2OPRA 2ZBRA 4R30A 3RB6A 2W01A 1FX4A 2O5DA 2QE5A 2FHJD 1FESA 1WEZA 2IYIA 2ATLA 4J9KA 4NLTA 2Y3YA 2YWEA 2XMMA 4ID5A 4E8UA 3TANA 1I94J 4O23A 5KG0A 1G1GA 5DQHA 3IAS9 2BABA 3JSMB 4B3SF 1PAUB 3NNAA 2KTQA 3I4PA 5FLXY 3E51A 4ETXA 1WC1A 1GXUA 4C0BA 1UPMB 2HAFA 2VG5A 2QMXA 4AL7A 3IBFB 4NZ0A 3GIJA 1Q78A 2QIFA 2EC2A 2CJYB 2C2ZB 4BS2A 3W2VA 3H5XA 4I2QA 5B0FA 2A6MA 3VF0B 1A0OB 1RBOB 1HD0A 2NT2A 4OZ1A 2BJ9A 2FUG9 3WBZA 1U02A 2OTLS 3QO9B 1N48A 1B99A 1C83A 3IA0A 5B0EA 2ZJPQ 1C2PA 5C24A 4HDHA 4CTAB 1ZTWA 2MQNA 1RK8A 5GMDA 3TWZA 2HNDB 4PUOA 4P7VA 1HBMB 1UWBA 1J4XA 5HJYA 3D6TB 3K59A 1TFWA 1IWGA 5BJRA 2HB1A 3R1LA 5A8WB 4X2BA 4M63A 3E2EA 2A10A 3SV3A 4QR0A 1TK5A 3RBXA 2GV1A 1SL1A 2UUCJ 3DMJA 4NA1A 4KY3A 3KWMA 3T6JA 3I0SA 1VIXA 4OJ1A 3GCXP 4LF8J 4CP5A 4ECVA 2M9KA 4J9NA 2X1FA 2VKRA 1BGXT 2VJVA 1FRKA 2DY9A 2DY1A 1A9NB 2VEWA 1SJRA 1U1KA 2HVLA 4DSLA 2H04A 2HSEB 2PGCA 1PILA 4C7QA 2XS7A 5HAOA 4RR5A 3KTQA 3TYTA 4B08A 4WZQA 1MW7A 3THVA 3NY0A 4P73A 2V69A 1PC4A 3TP2A 1T05A 1GK8A 1ZZWA 5CCMA 5GADI 2CJBA 4BUCA 5C2CA 1RBAA 1GMWA 2ZHOA 2AYGA 3ZM0A 3GIRA 3PRBA 4IG0A 3RU0A 5ETMA 1EKRA 4KPYA 2QFIA 3ZZYA 1Q5YA 2GQCA 4FN5A 1RT3B 3CNQP 4JI7J 1NL9A 2JSXA 1UEVA 4P10A 2BE2A 4ZPDA 1IBMJ 2UUAJ 2D7SA 5HBMB 2HMIB 3HZGA 3IRXB 1NSKL 2E5JA 3QRQA 1WC0A 1KHVA 4L75A 4PPDA 4XIUA 1OPIA 1M5PC 3MCSA 2CM2A 2GIFA 3F0NA 1YRXA 1OHEA 1KBRA 1HQ2A 1TUVA 4Z37A 1VBYA 2DYAA 2KVIA 2VBYA 5AE1A 1UVJA 3NBPA 1RI7A 3KLIB 1HW9A 3BJYA 2AX0A 1VBKA 3CO0P 4W90B 1KFDA 2LA6A 3H25A 1N6QA 2FJEB 4Y2EA 4UW2A 1E8CA 3POTA 2F46A 4YUDA 5BYRA 4ILLA 1E0DA 5K23A 2CM7A 1NJIT 3RTVA 2OMOA 1MU2B 2JH3A 4DLGA 2BE7D 2HNQA 3Q8QB 2GNKA 5KACA 2MKKA 1HNWJ 1HNIA 2V0NA 2YWKA 2EFOA 1TUWA 4OMFG 2H02A 4WFZA 3RGOA 2OO4A 2RU9A 4WOHA 1AZSA 4F3QA 2Y96A 4PXDA 1VQMS 3CSKA 1Q6TA 1IBKF 2CMBA 5J1PA 4U67Q 4LBIA 3KHRA 2RMLA 2CQ2A 4DV3F 1NO8A 3QKQA 3D3CJ 1U1RA 1FQ1A 3OMHA 1FKPA 1JXEA 1S76D 2LQ5A 3D28A 4LF7F 3C3LA 5D3GB 3FK4A 3UVJB 3HPOA 2R0BA 1N5YB 3L9ZA 1SH0A 1Y0HA 1Q7LB 3IC1A 3UE2A 3WIVA 1XR5A 4LRDA 3HHDA 4DFMA 4IRDA 2F1FA 1VK3A 2HZCA 4G1QB 4UOGA 5A0YA 5BZZA 4RUBA 2GCFA 2M5YA 2VPYB 3IBCB 2GW8A 4WFNQ 4RW9B 4C6AA 2YKMB 4WF9Q 2NPIA 4ZN3A 4J9RA 5DS7A 1R0AA 2WONA 3V6HA 3HXMA 2HBQB 2AV5A 1D09B 1V5VA 5D15A 3K5LA 4L73A 2CRLA 2C46A 3GIMA 2FJDB 5LXQB 4CT9A 4ZLPA 4KGMA 4K4ZA 2QLFB 4M5HA 4Q8FA 4WK3A 1KQFB 3EMUA 2OOQA 2R8IA 3MR2A 1X4HA 1U2CA 3MMJA 5LSRA 4DZDA 2ACMA 3OXLA 4O44B 2HIQA 4LSNA 2VFRA 3CJ5A 5ETKA 4ZIYA 2QG9B 1JQGA 3AT1B 4LVOP 3DLLQ 3TVYA 1GX5A 4NXNF 3NMAA 2Q79A 5FLXU 3PACA 1VK8A 2FLPA 3CMQA 1V3ZA 3UD3P 1QUVA 1PH0A 2N4DA 2J9DE 2GQQA 3M1VB 1FRMA 3FSIA 3ISZA 2AT1B 3LP1A 3PRVA 4NMLA 1QTMA 3V81B 5IOLA 3EGVA 2YKNA 4EYHB 4C11A 1DBDA 1P6TA 2FB0A 1IM6A 1S9EA 3JYTB 1X4AA 3VALA 3OL7A 4WE1A 4C3LA 1WI6A 2GHVC 2AZ3A 1PYTA 2X1AA 5D0HA 5A5EA 2HHUA 3LOUA 5IQ6A 1KLMA 1N32F 1RWUA 3N6LA 5L8RC 5D4OA 2MGZA 3PEHA 4ELVA 4ZK7M 5EX0A 5I3PA 5RUBA 5J2QA 3HHLA 3SI8A 4P74A 1FDAA 2XSJB 4EZ6A 2RS8A 1Y5LB 3CJKA 3TEHB 4PRFA 3W5XA 3UQSA 1PXHA 3KOAA 4UUXA 3JQJA 1T3NA 1FE0A 2AX1A 1RXOB 1SVDA 2E66A 3CCLS 4Z7CA 4CO5A 3ZXWA 4FS2A 4QZVB 3KUGA 1G4CA 2UUBJ 2YNIB 2CQGA 3A1YG 3VAJA 1TL7B 3AA8A 5AXKA 2KZZA 4MIAA 1IXKA 4OZLA 4OV6A 4F8RA 1NKCA 4ELUA 2ZM6F 4ZP6A 4C97A 4TU7A 3MM7B 4K4UA 3GFXA 1OY8A 2R2UA 2XMUA 4B04A 2LP4A 1LWFA 2VKZG 1V5IB 3GLJA 3RRHA 1VRTA 5K5MA 3GYXB 5KT3A 1T03A 3JTNA 4PXBA 2RQCA 5B0GA 2AHOB 3U1NA 3M9OB 2WK4A 2ZVSA 3KFWX 1R3NA 3LP0B 3V0IA 3PJXA 1TL1A 2CPHA 5KFDA 2KZMA 2I3RA 2KN4A 1S49A 1ZAXA 2ZJQQ 1Y10A 2ZMMA 1S6QA 3OD2A 1D9AA 3AXMA 5KG4A 4LFCF 2N4CA 4DUTA 2JFGA 2PA3A 1XNQJ 4DV1F 3CCWA 5HSPA 3O4SA 2HQIA 3R5BA 3MFHA 2KU7A 2OJ3A 5CYMA 4B9MA 3T5HA 1MKPA 2ZBPA 2VFUA 1X7VA 1N34F 2PQ5A 3I4HX 1KC8T 4P2XA 1F5CA 3ZZTA 3L7UA 2HY3A 1QSLA 2KM8C 2VA3A 4O4RA 4FPRA 3BGLA 4C2MA 4GE2A 1KDNA 4PWWA 1N56A 4ZS6A 2EFNA 4NPOA 5MLCV 3RB4A 1RU2A 4K4SA 1NK4A 1XTZA 1U24A 3MUMP 3Q8YA 1U26A 2OPSB 4QJVA 3LGMA 2FH7A 3TARA 1YPTA 5J2NA 2HCMA 4X84A 1L3VA 1J5OA 4J91A 4ICLA 2I4HA 3PEJA 2UXCF 5F8GA 2XS5A 3D7SB 2DPJA 5J1NA 5IM0B 2KT5A 3TAPA 3IN5A 2UVUA 2VV5A 1YI2S 3LWMA 3ILIA 1VQ4S 2WSCC 1HBUA 3QGGA 2FJVA 3RR8A 4HHUA 4N7TA 4CVKA 1GT8A 1SQEA 4CWBA 3J7Z5 3OR1B 5KFLA 1KOOA 3I7ZA 3HFVA 1H7WA 4JV5F 4C48A 1Z1ZA 1BWEA 2OPPB 5LJ3Y 5KT4A 4OX9J 4RUCA 4USHA 1VISA 3MOJB 3NS7B 2H5EA 4ZLLA 4X64F 1HI0P 4ZA1A 4BUBA 5KFQA 1RWNB 4R8UA 1YWXA 1QM9A 3DI6A 2KFYA 1P31A 2R3VA 1CC8A 5EUHA 3P6YC 1CEZA 2PMHA 1VC5A 3OFEA 1RB0A 2I4EA 2I5JA 3OFHA 2QDMA 2XMKA 3IR7B 2NQPA 5HROB 2CNIA 3G2XA 3I55S 1TV6B 2DH9A 4KKOA 2UUOA 2BW2A 4GRSA 3SSQA 2LCWA 3MM5B 4Q8EA 2RNEA 1NMEB 3EJMA 3VAMA 3CDUA 2VDIA 2B51A 4KGZB 3QAEA 1WD6A 4NWGA 3TX8A 4J51A 3UFCX 1XBWA 1G1XA 2AEMA 2IVYA 3MWBA 4M5JA 4YS2A 1S9GB 2XULA 5FDLB 2E5GA 4DBQA 1Y5NB 2M7SA 3QJPA 4LF9J 2HFSA 4AXJA 2KL8A 2LXIA 4B3RF 2MZJA 1L3UA 1Q8IA 2GCBA 2MZSA 2MDAA 4ES1A 1Q8KA 4WKRA 1U7LA 3W5ZA 3ITHB 2A6OA 3US5A 1B0PA 4ILMA 3EZUA 4F2SA 4UY85 4DG1A 4P75A 1CS4B 2UXDF 2OAUA 2HBYB 2NUUG 4PQUA 1GG4A 1D3WA 5F0UA 4IR9A 2Y8YA 1Y3KA 3MEGA 5EHHA 3MM8B 4HTJA 1TKTA 2FJWA 1XXVA 2RSQA 5C42B 3KUEA 3NG8A 1F5BA 2UVWA 3FNNA 3TUZC 2B9EA 3K2YA 4B3TJ 2WW4A 2QCJA 2VOPA 1H0HB 2Y9HA 4KO0B 5L39A 2D1CA 4OHXA 1C87A 2RS2A 2EKNA 1QAJA 1ONZA 3EZOA 4R0JA 4C98A 3TAMA 3DOMB 3VAHA 3OR2B 1OO0B 4NLYA 5E3CA 2I38A 3OJUA 5GTJA 3AWEA 1OEVA 1Y5IB 3SEOA 2AP6A 3KNGA 4DR7F 1S0VA 3VR1A 3BGRB 3CJQA 2OD6A 3W8PA 3VCDA 3HKWA 3PYGA 1RACB 3HSZA 2E1AA 2B4OA 1RHQB 1T94A 3F9AA 4J9OA 8ATCB 3RBDA 1BQMA 5KFPA 5KA7A 4CO2A 2POKA 1XMQF 2RF6A 2QO3A 3J7YU 3CULA 4I67A 2KT2A 3ILOA 2ADCA 4HR2A 1B64A 2HHHF 2LKZA 2P5VA 3BKUA 4TY9A 1DRZA 4ZMMA 4QWCA 4O3NA 2G1HA 1IKXA 2HIYA 1FD2A 5K20B 3TR5A 5GAGU 2DBBA 4TQRA 1FK9B 2HNZB 3TUIC 1T11A 2FY8A 3B4MA 4ID8A 2DGOA 3P5BP 3VTIA 2I9SA 1B7YB 2JEJA 3R7BB 3MECB 3NWRA 4ETZA 2FVQA 3GFZA 2WVDA 2CM8A 2C3UA 3H7HB 2QA2A 2F6ZA 3DOKB 2BYCA 3M2UB 3IWLA 1RJJA 3DRPB 4DFPA 1CLFA 1JLGB 4LBHA 2JNJA 5B0BA 3V0HA 2BBEA 2HAIA 2EFVA 3QZ8A 1DAXA 5SUHA 5F9LA 3ZMPA 2D41A 1LWXA 3TJ9A 5L9NA 1YGYA 4S0MA 1BZHA 4DL6A 2ZN7A 2KT3A 1UKUA 4CQ1A 3BSAA 4OQJA 2JLGA 1QLNA 1E6VB 4QAPA 4NASA 4HACA 1X4BA 4YHHJ 2R8JA 3MTKA 2YVSA 2F70A 4PABA 5GVQA 1C85A 2ERRA 5B0AA 3F41A 3ZTQA 4EZ9A 2PN6A 2F6VA 1HHSA 4Y34A 4MKAA 3C6UB 3CDWA 2DH7A 3DGVA 1Q82T 2M52A 1DJ0A 1RKJA 2JVRA 2DISA 2W7PA 2BA9A 2E1PA 5J1EB 3LAKA 3M32A 4DR5J 4DQPA 4JI8F 3K17A 2OMLA 4USMA 4C0OC 4K0KF 2ABYA 3PR4A 1TR0A 1YTNA 2EFQA 1G7GA 1N8RT 2XHCA 1BZCA 2E5IA 3BGOP 2XSFA 1GX6A 4ZP9A 2JVOA 1U8WA 4C0HA 2KHCA 2DR8A 3GIKA 4EO8A 4CYUA 2CPFA 2UAGA 3X3UA 5EDWA 1YK9A 1NH7A 2HFUA 2ESBA 5BYSA 4MIBA 5D8HB 5FIIA 1UFLA 5EGYA 3KLGA 2CWKA 2HK2A 5E3RA 2IJRA 3M2VB 2O01C 1F9EB 3KK1B 4IDKB 4LQ9A 1FRHA 2JX2A 2ZFHA 3TVKA 2Y1JA 3NGUA 4KH1B 4BC9A 4PAAA 2P9EA 4HJPA 3OL6A 2GJFA 2Y1RI 2ZBQA 3H0PA 1S1WB 3HVAA 1S1XA 2PA5A 2MXYA 5M2UA 5KG7A 3J7ZT 3S01A 3S3FA 4GRYA 4JI0J 5AE2A 5GMEA 1E6YA 4NRUA 3GSDA 1PYOB 5L46A 1SCJB 1YSJA 3KKFA 3RB3A 2Z2MA 1LFPA 2DGTA 2BR0A 5L1LA 4FVCA 6FD1A 3MM9A 1JLEB 3RJMB 1EEHA 1WG4A 2QBPA 2J6UA 3IWXA 2LXUA 4QYRA 3OQ2A 1RAHB 2W24A 3DRRB 4JI2F 1O6XA 3UR3C 2B3OA 4QYZK 3EX7B 2IJNA 1Y3JA 1H73A 2BJEA 4Y2IA 3Q83A 1NWLA 3EGWB 5ETSA 1TKZA 4JI6F 1VOMA 4JI1F 1URNA 1HBOB 3UDEA 1LWEB 3VQSA 1ZAVA 4OYZA 3M8RA 4DCOB 5ETRA 2L41A 3QJJA 2CNOB 5ETPA 2OPQA 5E3PA 2GC6A 4ECRA 1NNYA 2F6WA 4RPFA 1CJTA 1T7PA 2ZH3A 4G3IA 3DM2A 3H2LA 3MGJA 3AOBA 1C1BB 2W4CA 3DXSX 1HARA 5KOWA 5EHRA 3MEEB 2MKSA 4DL4A 4M5LA 2DNLA 4WK1A 3LA0A 1KEKA 4O0NA 2B5JB 2ROGA 4LF6F 1HNZJ 4UY8T 2LEBA 2R7UA 1HD1A 1T49A 3AH6A 4EYIB 3H20A 4ZI4A 1R6HA 3HD2A 2ZZMA 5CD4H 1KD1T 5CABA 1QSSA 4AUKA 4MH8A 1HIYA 2OLWA 1TL3B 2N3LA 1H98A 2VL1A 1N33J 1SH2A 5KA9A 1NDPA 3T9ZA 1T95A 4DUZJ 3ZM2A 4GO5X 2I75A 2VFVA 4PR6A 1I94F 1JWWA 4J5OA 2XMJA 5GAHU 2VG6B 2IBOA 4JUZA 2F9DA 4UZBA 4F02A 2JHEA 1QY7A 4IFYA 2WAQD 4H4OA 5K8NA 4GVBB 4B9LA 3BM7A 2X1BA 4TNOA 2E7VA 2H4YB 2E5LF 2WHOA 4P6QA 2VD3A 3EAXA 3P45B 5G0RA 4Y28C 3IP0A 3EZ5A 3EB1A 1REGX 4FXVA 3WC0A 4F4YA 1Y4ZB 1ZA1B 5I3UB 3FEXB 1IQTA 2P6TA 1RAAB 2FVPA 2HHPA 2LXFA 3WDOA 1TU0B 2R7SA 2KJWA 4RHGA 3M8SA 2V67A 5A6WA 5KFVA 4ECXA 3QSYB 2CPDA 2BE9B 4QW8A 2J16B 1CPZA 5LMUF 2R7RA 1FRXA 1RSCA 4WXOA 2MZRA 4K50A 1FGSA 5EN1A 4HI2A 1F6TA 2RQ4A 2H4VA 2EBGA 2MLXA 2V50A 5ADZA 3HFKA 3LQVA 4BWMA 3UD5A 1JJ4A 3DLEB 2HYIB 4OI1A 2KRRA 3DGPB 3K0JA 2V94A 3O44A 4CLFA 1F2GA 2MLYA 5KFNA 4B9SA 3Q0AA 2ZH8A 4NX9A 3KLEB 1M3GA 4LF2A 4DEZA 4OLPA 2WB1D 3JQKA 1H6KX 2NSBA 4V19J 4Q5VA 1W2IA 1FNOA 1WF0A 3MAQA 1F3VA 1QDUB 3GR1A 3C16B 3Q8VA 3W2WB 1FO1A 2VODA 3MMCA 4U7UD 3GG0A 1FPRA 3IS9A 1YGUA 3BDEA 1YJVA 3VV2B 2UXBF 1I51B 2GVDB 1QE1B 4DX6A 4NOHA 4QIVA 4AFFA 4HTIA 4YB1P 3HZEA 3BQ1A 2CNEA 1RT1A 3QLHB 2HHTA 4M5DB 2VQEJ 4JI7F 4X66J 3UPFA 1U4BA 2XYHB 2XMAA 5A8KA 2H5JB 2UUAF 5CYQA 2EXUA 5I42A 1P15A 5D77A 1ZM2A 2ZOGA 4EI2A 4R0TA 1C0UB 2G9OA 2YNGB 1OJ4A 4IYQA 1MWZA 3QSIA 2DK2A 2AM1A 1C88A 4RBVA 1S77D 1FDBA 4YDXA 4D3RA 3OBIA 4A8OA 4LF5J 1YZ6A 3PO4A 4ED1A 4USUA 4NLWA 4X65J 1K44A 2FHMA 1VQOS 4NWBA 4XPEA 2X3GA 1HQEB 5E7OB 4AQYJ 4TY8B 2BKNA 4NLXA 2Z56B 4QBUA 1YITS 1IUJA 1X0PA 2H51B 2AGPA 2FJXA 4RKUC 1Q86T 2KXFA 1CG2A 2G0JA 3KMQA 4F36A 3ILJA 5HQMA 1IBLF 5DQGA 1KQSR 3U1LA 3GB0A 2YBVA 4ZN1A 7FD1A 1Q6NA 1ZC0A 1BMQB 1VRUB 4I2PA 5CAAA 2NZ4A 4TVAB 1CJKB 3CD6S 2XO6A 4ZVQB 3OUYB 1L3TA 4I6AA 1RTIA 1YTSA 2DD8S 5C25B 4WCEQ 3OSPA 2XY5A 1YJTA 3BGUA 3CJ0A 4DR3J 2B6AB 2W2MP 1QUPA 2QMWA 3I5BA 4ED3A 4B9UA 3A8IA 2ZH1A 1S9FA 3HCXA 4JI5J 5D4LA 4ED6A 2SHPA 3KK3B 2Y68A 4QQBA 3O4UA 1G4WR 1DURA 1UL3A 4PEOA 2GJ2A 3JSMA 1ICEB 3TA1A 2HS4A 2AU0A 4ERCA 2FGCA 3GWCA 4N47A 2F6TA 3D6MB 1YHQS 1BE4A 2DIVA 2BRKA 1ULRA 2W7AA 2DXFA 2ZHBA 5KABA 3ZM5A 1R43A 3Q22A 2J0SD 2XLIA 3PYFA 3CDEA 4LJMA 4BCAA 3W9HA 4TQSA 2DKOB 1UFKA 3F73A 4Q44A 1LV5A 3PX6A 1S1VB 4LF1A 4R0EA 4LSZB 4WP3A 1KSPA 1I57A 4CTAA 1HBMA 3JSYA 2BUNA 1JIHA 2JLEA 3ZZOA 2YKQA 3S7RA 3PR5B 2BW7A 1PTTA 4OJHA 3ZZRA 4LIRA 3AWGA 3R5AA 3D9CA 3MEDB 3D68A 2HS3A 4Y0FA 4DV2J 2WSFC 3SCJE 5HMWA 4PWDA 3I32A 4NXMJ 3K8VA 4YOEA 2C3PA 1RAGB 4UQGA 3T1HJ 3W9IA 1C0TB 1HNXJ 1BHNA 3J7AN 1KHWA 1VBXA 1TP7A 1NHVA 2W9CB 4RWWA 3RRKA 4DQSA 5T41A 3QCIA 1FXRA 4NYHA 1O5JA 4HH1A 1KVKA 3G8TA 3VZHA 4YY3J 2G4BA 4ED4A 1KN6A 3MFIA 2AEJA 4ZIWA 1TELA 2ZBCA 3MD3A 1NB7A 4WP9A 4CIOA 1ZH5A 2ZOMA 2W2OP 3TZXA 2UU9J 4A8FA 4L76A 1RE1B 2E0TA 3CC2S 4JOUA 4ZVSB 3N5FA 1F60B 1DTTB 2RF2B 4I0WA 4YFUA 4H4KA 4FZVA 2DGWA 3ZTRA 4UUWA 4DR6F 2GHWA 2OEKA 1GMWD 4UQTA 2HEKA 1T8EA 5HP1B 2F63A 3N4WA 4B9TA 2V63A 4D3HA 5BZXA 2MJNA 3H8YA 3I5CA 1FWKA 4F4ZA 4Y14A 1A5YA 5HBMA 4GS0A 2J9DA 1DARA 3IRWP 5E3AA 4ECQA 1VJWA 4C8MA 3BN4A 4Y00A 2RKIB 4BHQA 2DRBA 4NLSA 1NB2A 3OHAA 4DFJA 4H1OA 2PI7A 2UVVA 1VQ8S 3KLIA 1W7WA 3IG1B 1ZBTA 3L95X 1N5SA 3QPIA 3AD9C 3FUYA 1S6PB 1R6YA 2CQIA 2MY8A 1ITPA 1U0HA 2APOA 2FZKB 3DYAA 3M6VA 3EICA 4N77A 1N54B 1BWVA 3NRSA 1MU2A 3R6GB 3TI0A 4USJC 1EKSA 1WF2A 3IM9A 1MN9A 1HNVA 5F8NA 1YBUA 2L9WA 1MMDA 3SDEA 2OC3A 3NCQA 3W1YC 1SKRA 4QPXA 2OI2A 4NZ6A 2IBKA 2MLZA 1OEUA 3DHWC 1NPPA 2ZUAA 2J9CA 3MCOA 4J9PA 2B7BB 4KH0B 4LR8A 4YB6A 4HV4A 3VAFA 2Q47A 3B82A 3PM9A 2BJ1A 4NYPA 2F00A 1P1TA 4OJ3A 2CA9A 2YWGA 2MHNA 2MTLA 4KFBB 1RQ0A 4G6VB 2RDDA 2OPRB 3BQ2A 3UVJA 5IWAJ 4PVGA 3M8ZA 2H65B 2CG4A 1VFJA 2F4FA 1YQHA 4MYTA 2MKYA 4NMXA 3D44A 2OKQA 3RYLA 3LWLA 1KS2A 2CZ4A 1NDKA 4BC7A 1ZM9A 4G1QA 1K1SA 5IS2A 4MFBA 5GAEI 4JYAJ 4F50A 5AJ3F 2C2DA 2G1DA 4RW9A 3ENAA 1SQFA 1OY9A 2XHWA 2YKMA 4DFKA 1HR0J 2X5OA 3TAQA 4OI2A 3VVTA 3W2VB 3FC9A 5D0EA 4NCGA 3MDFA 5LMNJ 3TUJC 4C9DA 3QCCA 3GFYA 5DG9A 3QT6A 4DV4F 3AY0A 2CKWA 1S6OA 3K5OA 3QCBA 5C24B 4PUOB 1SH3A 1UWBB 2DR6A 4RU9A 2IRYA 4DGPA 2V8GA 2KDOA 4PYAA 4M94A 4A46A 4RU2A 1NPRA 2RUGA 3NOCA 2GZOA 4ZVTB 2R7VA 2ZDOA 4C8YA 2E9ZA 2GS8A 1T02A 2NV5A 3QATA 1EARA 3QGPA 1JLAA 1WEYA 1PO6A 1FVSA 1NLKL 5LXRA 4A8YA 1OHCA 2DNHA 2Z8QA 3ISND 4KYRA 2G6ZA 2MKIA 2RVJA 3H2UB 3V81A 1M5HA 1PGZA 2FDNA 3CGIA 3T19A 2KJVA 4PG5A 3G96A 4F0MA 2XCAA 5KFSA 3OL8A 5BUGA 3G9CA 3N0AA 2PI5A 3SCKE 2ZD1A 1H2TZ 3IFEA 3FVYA 5DM7Q 1RHJB 2DNRA 4HL9A 4F0HA 3MR5A 3K5NA 2K1RA 4CT8A 3RAQA 1FJEB 4A8QA 3JSBA 1DLOA 1TK0A 2XSJA 3HHLD 5THWA 1ZZNA 3GXGA 3TRGA 4NCAA 1O5ZA 2H54B 3BB5A 1RWXB 2HQDA 4IG0B 5CHCB 4DV7J 3THPA 8RUCA 2M0GB 1FFGB 3V6KA 4JI3J 2VG7B 1WSVA 2C2KB 4FVMA 4XDDA 1PBUA 4NA2A 4F67A 1W25A 2V8HA 3LP2A 3ZZZA 3DNCA 4C13A 3SSRA 4DV5J 2CQHA 2W4PA 3DHXA 4BWJA 3V0GA 4DUYJ 4M95A 2VOOA 1OWXA 2HWTA 2E7XA 2I1RA 3PW4A 1TL7A 2VHGA 2I4GA 3MMBB 1C1CA 1HQUB 2Y2FA 4I6YA 4LF4J 2KYZA 3T1YJ 1SKWA 3GG1A 4DV0F 1ONYA 3MHYA 3LPEA 2DHGA 2CJQA 1DQ9A 3PX0A 1AAXA 3OJSA 4OI3A 3KLVA 3Q2SC 4LBPA 4GKJF 3QAUA 1RBLA 2DNNA 3BH7B 4AXIA 3HD1A 5DDOC 2MBCA 4LRBA 2V4QA 2CMCA 3MEKA 1QJHA 4DR2J 3M8QB 2LA4A 1NK5A 5B09A 4ZPWR 2OUGA 1RPMA 1L8GA 4C8NA 3S8SA 1J27A 1YLXA 1M90T 4B3TF 1RTJB 2GFFA 4KTQA 3SQGA 4ZPAA 3V0FA 4ZLNA 1P9QC 1I3OB 2BGEA 3C19A 2K8GA 4UOFA 1UMJA 5EWEA 3KG1A 4L3KA 4J9MA 1YJ7A 2YNFB 5F8HA 2CAJA 1FD8A 2O1PA 2PFDA 2H4WB 5L1IA 3SIPB 4C3MA 1S12A 1B7FA 2AHSA 1TKXB 4B3MF 2FJNA 1NWEA 2XO7A 4DF8A 3D67A 4NWFA 1RAEB 2B07A 3MXHP 5KFZA 3CDBA 5J8RA 1CVJA 4IKCA 2CMAA 1WTBA 4L3NA 1D8ZA 3IR5B 1HMVB 3EVOA 2I3UA 1GTEA 2VPXB 2VEXA 1VHIA 1R0AB 5DGAA 2WONB 1WHXA 2OPSA 2E5HA 3M8WA 5AE3A 5B0DA 2HWHA 2V2KA 2IM1A 4EU0A 4DL7A 1SQGA 2IRXA 3KK2A 4P7TA 2QSFA 2HVZA 2HFZA 1FWPA 4F3OA 2YXLA 2ZVIA 1WELA 2YH1A 2B4SA 4ZPBA 1H3DA 1N52B 3FDSA 5IM0A 5KT2A 4DGXA 4FKXA 2MQOA 3WQPA 3RGQA 3DU6A 2PD1A 2N82B 4I1TA 3CCES 4RW6B 3GV5B 1OY6A 4RNOA 3QWUA 4PYHA 1WKKA 2CPZA 3PCOB 3LO3A 1UVNA 5G4DA 3Q23A 3FEYB 3R5GA 3KHHA 3EDQB 1IBCB 3AHPA 4ZIVA 1C86A 3CO9A 3QMQA 2OPPA 2YTCA 2IMWP 3H4BA 4J9SA 3BSOA 1OSDA 2K3KA 2CUYA 1BC6A 1B70B 2BRLA 2F3JA 5C7PA 2R9LA 3BF4A 1U1MA 4ZCLA 5F9NA 4QBWA 3S3KA 2J76E 2QRRA 2A3KA 4C11B 2OIHA 1VS3A 5HMYA 3QT7A 2VPZB 3IGVA 5ETVA 3SFUA 4DLEA 2ALZA 1TV6A 4OZ2A 1XQIA 2JFKA 3GR0A 5LSLA 1OEMX 5CQGA 3MM5A 1V3AA 2Y66A 2DCUB 1HFEL 4FF2A 1NUEA 2YPYA 3UN2A 1X8DA 5L1KA 2VQFF 1K0TA 4KQZA 4TXSA 1RT4A 4QWDA 2DNYA 3I0RB 2QGFB 2UUWA 3CJKB
chains in the Genus database with same CATH topology
3HVTA 1U1PA 3H40A 4R0JA 2MKHA 5F8LA 2YKOA 4RW6A 3TAMA 4C98A 3VAHA 1FJ7A 3OR2B 1S79A 4QW9A 2CJKA 1OO0B 1XBOA 4NLYA 3CJ4A 3NMRA 2FPHX 4GC7A 1L3KA 1LW2A 2I38A 5E3CA 3OJUA 3KJVB 3AWEA 5GTJA 3BR8A 1RTHB 5BX1A 2VBZA 3O2IA 1Y5IB 2JFDA 3V4IB 1OEVA 3SEOA 5DO2A 2AP6A 1XMBA 2N3OA 1JK9B 4OI0A 3KNGA 4DR7F 1S0VA 2B9XA 3SSSA 3VR1A 4RNMA 3BGRB 3PIOQ 4DR3F 3PRDA 2OD6A 3VCDA 3HKWA 5D4PA 3RB0A 4DSKA 3AB4B 4N5SA 2NR0A 1KAVA 2DGSA 2HRYA 5M2RA 2E1AA 2C2EA 2B4OA 3UI3A 2UUCF 1JLAB 2EFPA 1S0NA 1T94A 5M43A 4X4TA 4A8WA 3F9AA 2P4DA 1TL5A 2N7CA 5L9XA 2PEHA 4J9OA 1TVRB 2QLXA 3RBDA 2VUGA 1BQMA 3NLCA 5KFPA 3CT9A 4QWEA 2AZRA 5KA7A 3NGDA 2LECA 2HHXA 3MD1A 4LF8F 1NEEA 4CO2A 1R27B 4FF4A 1LW0A 1K8AT 2FJAB 4CNYA 3ZZ0A 4AZ1A 4Z6BA 2POKA 1XMQF 3NAHA 4QR2A 2MSTA 1QXKA 1RAJA 2OP5A 2RF6A 5B7WA 3HHNB 1RT6A 3MTJA 4CO3A 2QO3A 1IM4A 2VBXA 1JLCB 3I5AA 4K2XA 3J7YU 1XC9A 1UVLA 3CULA 1G6BA 4K4XA 4I67A 5K8OA 2KT2A 2ZKTA 4I68A 4RW8B 2ADCA 2KB2A 2ZC4A 1BD6A 3MAHA 3PNIA 4BPCA 4DHVA 3M30B 4MKYA 3Q2TC 2C42A 1Q1MA 1JKHB 1U48A 2OSRA 1B64A 2Z4PA 2HHHF 2E44A 1YN9A 1RT2A 3CCZA 2IJFA 2LKZA 2P5VA 1FHTA 3ISNC 2ZD1B 3MM8A 3ZZPA 4TY9A 2IAJB 3QCMA 2DNMA 5EWFA 1DRZA 2JJDA 4ZMMA 1REVA 4QWCA 3PFOA 4O3NA 1IKXA 1RT5B 1FD2A 1TQLA 4LQ3A 2K1RB 3RAMA 3TR5A 5GAGU 3H5UA 2IRUA 2FHOB 3MZIA 3EGNA 3I82A 3V2UC 3V6DB 2GWOA 4OX8A 2HNYB 2ASJA 3HP6A 2A18A 2DBBA 3M6WA 3DN9A 4RW7B 1DLOB 4TQRA 3MM6B 4B02A 5E0OA 1VRTB 1T3OA 3J7YI 4HRFA 1Q1KA 2COLA 2NLWA 2PIIA 1T03B 2LQ9A 1FK9B 2HNZB 3I0RA 3AJ2A 3TUIC 3IWNC 2BGDA 3X1LB 2I6OA 3EZZA 2XMTA 3GMGA 4DL0C 5B0CA 3OTEA 2WBRA 1WACA 2QA1A 5K14A 3B4MA 2CNHA 2L9DA 3DOMA 4ID8A 2J16A 4FNIA 4NLUA 2DGOA 1IKWA 3VTIA 4IR1A 1KQGB 2I9SA 3D1HA 2DR9A 4ATNA 2XI2A 4ECSA 4BJOA 3KJVA 2LU2A 2JEJA 2DPIA 3OVSA 1RTHA 4CO1A 3OXFA 3MECB 3SR9A 3M32B 2R8HA 3O6QA 4ETZA 2FVQA 1KAKA 3HX9A 3BSCA 3HHLC 1UVMA 1TL1B 2JC0A 2A1BA 3GFZA 1C4AA 4GMKA 3BGRA 5H1SV 2CM8A 1X9SA 4I4BA 1C84A 3HKZD 4A48A 1XR6A 2C3UA 1HWUA 2Y1IA 1X5TA 1H2UX 1JB0C 1IBMF 5K25A 1IKYB 2QA2A 4DV2F 4EFAC 3DOKB 2F6ZA 2BYCA 3M2UB 3IWLA 1X4GA 3CEDA 3LP2B 1NK9A 2PBNA 1RJJA 5C5JA 3DRPB 3QZ7A 1S6QB 4X4QA 4DFPA 4QOTA 4ZPTR 3KHLA 1JLGB 4NXMF 1CLFA 2HGLA 3OVBA 1CSJA 2ZJRQ 5L1JA 5KT5A 4K5RA 2C3OA 1OPZA 4PWUA 4UOCA 5B0BA 1FF2A 1GXTA 3T1HF 3OL9A 3V0HA 2BBEA 2HAIA 2EFVA 3QZ8A 4ECWA 1HNXF 1DAXA 5SUHA 2KG0A 4NNDA 1Y9OA 5F9LA 4FF3A 3CCQS 1LYVA 3ZMPA 2D41A 2NZ6A 5L9NA 1YGYA 1BZHA 2C3YA 4MK7A 4DL5A 4DL6A 1FKAF 4IOAQ 1JLCA 3KHGA 5KG6A 2VONA 1C1CB 2ZN7A 2FC8A 1HYSA 2KT3A 5CYMB 1MMNA 2HLUA 4RW8A 4NLGA 3CPWR 2V9WA 2XNRA 3TNVA 2VFTA 1H7XA 1UKUA 4CQ1A 1U2RA 3BSAA 4OQJA 4JMKA 2JLGA 1QLNA 3DLKA 1E6VB 4QAPA 3W2WA 2I0XA 4YY3F 4C3KA 1X4BA 4NX8A