3D1OA

Structure of the ptp-like phytase expressed by selenomonas ruminantium at an ionic strength of 300 mm
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
313
structure length
313
Chain Sequence
TVTEPVGSYARAERPQDFEGFVWRLDNDGKEALPRNFRTSADALRAPEKKFHLDAAYVPSREGMDALHISGSSAFTPAQLKNVAAKLREKTAGPIYDVDLRQESHGYLDGIPVSWYGERDWANLGKSQHEALADERHRLHAALHKTVYIAPLGKHKLPEGGEVRRVQKVQTEQEVAEAAGMRYFRIAATDHVWPTPENIDRFLAFYRTLPQDAWLHFHCEAGVGRTTAFMVMTDMLKNPSVSLKDILYRQHEIGGFYYGEFPIKTKDKDSWKTKYYREKIVMIEQFYRYVQENRADGYQTPWSVWLKSHPAKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Myo-inositol hexaphosphate phosphohydrolase
publication title Effect of ionic strength and oxidation on the P-loop conformation of the protein tyrosine phosphatase-like phytase, PhyAsr.
pubmed doi rcsb
source organism Selenomonas ruminantium
total genus 110
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14566 PTPlike_phytase Inositol hexakisphosphate
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1690 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3d1oA01
3.90.190.10 Alpha Beta Alpha-Beta Complex Protein-Tyrosine Phosphatase; Chain A Protein tyrosine phosphatase superfamily 3d1oA02
3QCLA 1V3AA 1U26A 2I4EA 4OHLA 1PH0A 4Y14A 1Q6MA 5KA2A 1OEOX 1Q1MA 3F81A 2Y2FA 5KA4A 1WCHA 5KA3A 4NYHA 5KA9A 3V0EA 1C84A 3QCCA 3CWEA 5K9VA 3V0HA 3QCNA 2CNFA 2YDUA 2M3VA 1XM2A 2H4KA 4RI5A 1XXVA 4HRFA 3ZMQA 2WGPA 2I5XA 4AZ1A 2Q05A 2J16A 3I80A 3MOWA 2I75A 2F70A 2QDMA 5LXQB 2SHPA 5KA0A 2NZ6A 4DGXA 2HXPA 5KABA 2B4UA 2I6MA 1G4US 1RPMA 3D42A 3QCJA 3QKPA 1OHDA 2CNEA 2F6WA 2AHSA 4QAPA 2CMBA 1G7GA 3QCFA 2BGEA 1G1HA 2ZMMA 3B7OA 2I42A 1YTSA 4WU3A 4RHGA 4WU2A 2PA5A 5K9WA 2DXPA 3F41A 1R6HA 4DGPA 4S0GA 1PA1A 1PYNA 5EHRA 2I6JA 3F9BA 3OMHA 2R0BA 2F6YA 1BZCA 3A5JA 1FPRA 2J16B 4D3RA 2NLKA 2CNHA 1YGUA 3N0AA 1ECVA 2C7SA 3BRHA 3MOZA 2F6FA 4R0SA 1XRIA 1PA9A 4TVVA 3LJ8A 1YN9A 1FPZA 1JF7A 2BV5A 4J51A 3V0FA 4GRYA 1LYVA 4RKKA 4JMJA 1MKPA 1YTNA 1PTYA 1OESA 2CMAA 4I8NA 1EEOA 2GP0A 3AWFA 1ZCKA 2ESBA 3AWEA 4RDDA 3D1OA 4ZI4A 1NWEA 4GRZA 4WOHA 1G4WR 4WTYA 1QXKA 1YPTA 5IBMA 1FQ1A 4GFUA 3SMEA 1JLNA 1G1FA 2OUDA 3EAXA 3EB1A 1G1GA 2F71A 2B49A 5KAAA 2G59A 2B4OA 2Y96A 5KA8A 2PI7A 4NX8A 3QCIA 2CM7A 1ONYA 2HCMA 2P6XA 2GJTA 4OHIA 3QCGA 1Q6PA 1BZJA 2H4VA 1C88A 1YZ4A 5GTJA 3S4EA 4NNDA 2FJNA 4B04A 2F6TA 3D9CA 2OZ5A 3V0IA 4GE6A 1LARA 2I6PA 3I7ZA 4Y2EA 1C85A 3RZ2A 3AWGA 4NWFA 2HVLA 2RF6A 1I9SA 2CJZA 1GWZA 4KI9A 2GWOA 2H04A 4H34A 1Q6SA 2FH7A 2I4HA 4GE5A 1AAXA 4QUNA 2NV5A 2HC1A 4D3PA 2NT7A 5MMZB 2B4SA 1D5RA 1A5YA 1KAVA 1PTTA 4ZN5A 1I57A 2A3KA 3EZZA 1U25A 3NMEA 4GFVA 3QCKA 3ZM2A 3RGOA 4BPCA 4ICZA 1WRMA 2HNQA 2VEVA 3GXHA 3S3FA 3V0JA 2VEYA 4QAHA 4JBCA 1LQFA 2CM2A 2ZN7A 2MBCA 3BLTA 3D44A 2A8BA 2PT0A 2G6ZA 1C86A 2QBPA 4HJPA 1YGRA 2HC2A 3H2XA 3O5XA 1OEUA 4ERCA 2I1YA 2B3OA 1C87A 3EMUA 3MMJA 1ZC0A 2NT2A 2JJDA 3OLRA 3F99A 2QEPA 3S4OA 4GE2A 4GWFA 1YTWA 4OHHA 1L8KA 2AZRA 2BIJA 2CFVA 1SUGA 4ZRTA 3S3HA 5KA7A 3QCDA 2PSZA 1XBOA 1X24A 1YWFA 5EHPA 4YR8B 1OEMX 2QBRA 2Q47A 4PVGA 2C46A 1ZZWA 2F6ZA 3RGQA 4BJOA 1Q6TA 4Z6BA 3D1HA 1J4XA 4QUMA 5J8RA 1VHRA 5BZZA 2QDCA 2H02A 1G7FA 2QBQA 3QCEA 1T48A 1YFOA 5K25A 1L8GA 1NL9A 4RH5A 4KYRA 1C83A 2BGDA 4GS0A 2HY3A 3BM8A 2HB1A 2OOQA 3SR9A 3ZM1A 4MBBA 2I4GA 4JMKA 2NTAA 1KAKA 3ZM3A 1NNYA 2H4GA 1QZ0A 2CMCA 3S3KA 3F9AA 3O3LA 4YAAA 5HDEA 3D1QA 3QCBA 3BLUA 2F46A 4QBEA 1EENA 5KA1A 1OETA 2B07A 4R0TA 1M3GA 5KADA 1I9TA 5BZXA 2PBNA 1PTVA 3ZMPA 4NWGA 3O4TA 1Q6JA 1NWLA 1GFYA 1PTUA 1ZCLA 1OHEA 2VEWA 3U96A 5KACA 5K22A 2CNGA 1P15A 3V0DA 3EU0A 3QCHA 2I6OA 1OHCA 2QDPA 2BZLA 3M4UA 1ONZA 3A5KA 1U24A 4QBWA 2J17A 2CM8A 5K23A 2FJMA 1XXPA 4H1OA 3QKQA 3PS5A 2I6IA 1RXDA 4KYQA 4IKCA 5IBSA 3O4UA 1NO6A 2I3RA 2VEUA 2QBSA 1BZHA 1OEVA 2QCTA 3RO1A 2CM3A 4OHEA 1Q6NA 5M43A 2B4PA 3ZM0A 4PYHA 3ZV2A 5AWXA 3S3EA 4OHDA 2E0TA 3CM3A 1T4JA 4JNBA 3O4SA 3V0GA 4HJQA 3QCMA 2F6VA 5I6VA 2HNPA 3GXGA 2OC3A 1T49A 2P4DA 4R30A 5BUGA 5BX1A 5K24A 4D3QA 1WAXA 4RI4A 1NZ7A 2I3UA 2PQ5A 4RH9A 1PXHA 2CNIA 2IMGA 2VEXA 2QCJA 2H03A 3I36A
chains in the Genus database with same CATH superfamily
1NK9A 2GHPA 4HVZA 3MM5A 1O0PA 1EZZB 3NLCA 1AB8A 4X65J 4WXOA 4IG0B 3NS5A 2AYBA 3OR1A 2HZCA 2E29A 3MCOA 2XS7A 3GJTB 2VONA 2XMVA 1CVJA 1TL4A 1N32J 1EJ7L 3EGWB 2CJKA 3TVZA 1HWKA 5GADU 4GVBB 3I80A 4BUCA 4HTJA 1VFJA 5IS2A 2VORA 1S9FA 2GQ2A 3PW4A 2CNKB 3IGVA 1G7GA 3O8WA 1KOOA 2M0GB 5J2QA 2VFTA 1FT8A 2K1RB 1YTSA 2LP4A 3PW7A 4KFBB 4ZHRA 1D0EA 1YI2S 1DJ0A 3FCVA 1B99A 4DV5J 2V4JB 3T1YJ 1S9GA 5DG9A 2XMAA 4X4VA 3K2YA 2Z2ZA 1VRUA 4R0SA 2ZH3A 5KFVA 3QRQA 3HPOA 2MLZA 1S1UB 1U4BA 1LYVA 4UUXA 3GFZA 1S59A 1RZMA 2CQCA 4ECXA 2CJ9A 4BHQA 2GP0A 2I8EA 1HNZF 3AWFA 1RAEB 3D1OA 1NK8A 3SMEA 1G1FA 2F7VA 1NKEA 4WKYA 2VBZA 4HHJA 2C22A 4F67A 2YX7A 2G0CA 2AGQA 1QAJA 5BXIA 4KSEB 3TX8A 4DSEA 3H5YA 3R97A 2B4OA 2DITA 4FP9A 1ONYA 1M90T 2V2VA 2HS4A 1MWYA 3G71S 3V81B 2D3O1 1OO0B 5IM0B 4EBCA 3B4MA 4LR7A 5J1EA 2VFRA 3PYFA 3IR6B 1UJ6A 1NK6A 4LF6J 5HBMB 4YB6A 3DXBA 1EARA 2K3IA 4X84A 3HHLA 2C3UA 5D4NA 4RWWA 2N7YA 5DGAA 1HR0F 2MY8A 1UAGA 2NT7A 3D54A 1GXTA 2CQ2A 2BJ3A 1G2EA 1QJHA 4YS2A 4EI2A 1S77D 2YKPA 2ZBPA 4MKAA 3QRPA 3Q23A 5ADZA 1RWOB 3RAQA 2UV8A 3TVYA 2ASJA 1RCXB 3EPGA 1FNMA 3BBFA 1URNA 2MBCA 3OTOJ 1NJIT 1KFDA 5H9EJ 4ETZA 3W64A 2GO8A 6AT1B 3AODA 5DM6Q 4KIAA 1QE1B 8RUCA 5K14A 3A3NB 1OEUA 4Q44A 4K4ZA 4I2PA 2H4YB 1KWMA 4A46A 2CAJA 4PG4A 1XEZA 3GCWP 5DZ6A 3ET6A 5KA7A 1SCJB 5CZVA 3KWMA 3KHGA 2PGCA 1T7PA 3BGLA 3LP1A 1DHMA 2VJUA 2YPZA 3JYTA 1ZZWA 3RGQA 1G7CB 1RT6B 2W4PA 4QZVB 4C12A 2ZEJA 1GX6A 4LRFA 2GAGC 3NNAA 3FMBA 2OSQA 1R0AA 2C42A 4NEYA 2IM2A 4EU0A 2MZQA 4PYAA 2XZTB 1JX4A 4FNHA 3LH2S 1RTDA 3MMCB 4EBEA 2CQHA 2EBGA 2ILYA 4MFBB 2DRBA 5KFUA 4PQAA 2CYYA 3KUGA 1RAHB 4K4XA 5GAEU 3C6TB 3T6BA 2D9OA 1JB0C 3T3FA 1NK7A 5GMKa 2AHOB 2YXLA 1EKRA 2XS2A 3MM8A 2EBEA 4ED0A 3I0RA 4WPAA 2W9CA 3TJ9A 4P2XA 2AJ4A 2GV1A 2X51A 2DPIA 3JSBA 2YQ1A 1TKXA 2BZLA 2YNFB 4A8MP 4DR5J 3LP2B 1CJKB 1M1KT 3B4DA 4C3MA 3AJ2A 1PBUA 1NDCA 2KJWA 2L9DA 3A3PB 1FRIA 3HULA 1SIWB 1REVB 2AMCB 4JV1A 2ZWPA 1QM9A 2POKA 2YKMB 2YX4A 1S57A 4USJC 4EEYA 3M30A 3V6KA 2CDRB 2G0IA 3JSYA 1QLNA 4QCLA 1T4JA 3IBFB 4KC5A 4NL5A 3T41A 1Q79A 1L3UA 3W9IA 1WHVA 4OQJA 3TYTA 1KS2A 2DNZA 5LMNJ 5M2UA 4CH1A 1WHYA 3G6YA 2LXFA 2RRNA 1AZSA 3DMJA 2BYCA 1FX2A 3TJ8A 2IA6A 1NJYA 3M8YA 4U9RA 4EYHB 1RCOB 3UDLA 1X4BA 2LXIA 5L8RC 4KKOA 2UXDF 1RAGB 2CPIA 4M5DB 1HA1A 4CNYA 5U47A 2JSXA 4CDIA 4JI1J 4P10A 3MR3A 1T02A 2WGPA 2I2YA 4AZ1A 2NLWA 1IR0A 2GMLA 1OSCA 3R7SB 1KTQA 2B4UA 3JSMA 4E2FB 4CVKA 4LFAF 3QKPA 4J9LA 3RR8A 4CTAB 1RT4B 1WELA 2ZOFA 3U1NA 2BE2A 3CDUA 4DU7A 2ZM6J 4WIQA 2BRKA 1YRTA 1H2VZ 4YP3A 2HK2A 1E6VB 4Q5VA 1EP4B 3MI7X 4PYDA 1Q8KA 3I6PA 2O01C 2ZBRA 1SBRA 1P8GA 2CNHA 4NPOA 2K8GA 3K5OA 1AFJA 4RW7A 3CCTA 1ECVA 4YB7A 3SI8A 2OPQA 4KGKA 4OJ3A 4O44A 3KHRA 2HYIB 3THPA 2KYXA 4A8WA 4CO4A 3QLHA 2Y9HA 4GRYA 2LFVA 2UVVA 1U0HB 1YTNA 4I8NA 4G1QB 1ZTWA 2FJXA 3AWEA 3HHLC 4K4UA 4YUDA 5F8HA 3J81U 4YOEA 2WVBA 3AQOA 3M8QA 1JLGA 4IDKB 2DXEA 3KUHA 2A3JA 3C46A 3QGIA 1QAXA 3EICA 3HF5A 1M1HA 3DI6B 2G0JA 4HACA 1HNXJ 4DV2F 2VG7B 1F5CA 4A8FA 3W66A 5HATA 1LARA 3N2AA 3SYZA 1RKJA 3M32A 1T95A 2MKYA 5KFAA 1TL1A 3C6UA 1CS4B 3CIZA 2RF6A 1SH0A 2BOAA 3BV8A 5E5NA 1GWZA 1FGSA 2OGUA 2H51B 3JS9A 1NU4A 3DYAB 1MNEA 2OI2A 3AD9C 3ZZTA 3T1AA 3DRSA 2WOMB 4U7UD 3DC2A 3GFXA 1HYSB 3SQGA 1YQHA 4EUVA 1ZOTA 3MECB 5IT0A 3MEDB 1LWCA 3G96A 4DFPA 2QL5B 1T9VA 1JWWA 3NMRA 3A1YG 2VF3A 1I94J 4DV4J 3MEKA 2HC2A 4ZPDA 1HBUB 3PCOB 2QC3A 1DARA 1RT5B 4FNIA 1O51A 4ZVQB 3J7YU 3MVNA 2I5JA 1RLCL 2DO0A 4ZJLA 3MMAA 2HBYB 4FPRA 4B08A 4GO7X 2DEJA 2WSCC 5LL6d 5THWA 4Y2AA 1ULRA 2V34A 1UETA 1ZETA 4KGXB 1Q6TA 2XSJB 3BGRA 1KVJA 1VHRA 2L9NA 1Q78A 1W25A 1NK5A 2GJ2A 1G7FA 2MB0B 3D6MB 1F6TA 5HP1B 3E8OA 5KFBA 2BRLA 3E51A 2RHSB 3SR9A 4QWEA 1PCAA 4MIWA 5D0GA 1T9XA 1N33F 3CULA 1X9MA 2L41A 2K7KA 1N0UA 3Q8VA 1LWXA 2QYCA 8AT1B 5E3CA 4PWDB 4FYXB 5CCLA 4FVCA 3IM8A 3X1LB 4A8QA 3OSPA 4LF7F 1P15A 2FDNA 2GA7A 2KRBA 2QDPA 4LSLA 3CW2C 2IRUA 3BYRA 2FVCA 2JFDA 2LDIA 4UTGA 2J17A 4YEAA 2RAQA 4PPZA 2I6IA 1RU1A 2HLTA 4DPTA 1HNZJ 4PXCA 2AEFA 1TL7A 5C7PA 4IOAQ 3VAFA 2MKJA 5GAHI 2LQ5A 1J5OB 5T7LB 3UR0A 2ZH5A 4RKUC 2DNHA 3ZM0A 2QJ3A 4WK3A 3BQ0A 4OYMA 5HANA 2D1CA 3SSSA 3KG4A 2AM1A 3GJQB 2O3DA 1HBOB 1S49A 2OFGX 2AJQA 2HNPA 1I1GA 1LFPA 2QMWA 2ZBIA 3B54A 4X2BA 4PG5A 4D3HA 3ELHA 2AEMA 5C2GA 2RE1A 1LXJA 2ALZA 2EFOA 2J7WA 4RH9A 1TV6B 2Y8YA 2CADA 3W8PA 1N8RT 5LSOA 4FYVB 5DG8A 1SJ3P 4DI6A 2H1YA 2FPHX 5KFCA 4NLOA 2BM1A 2GJIA 3Q83A 3NGDA 4IOCQ 2MPUA 3HT0A 1HR0J 4ID8A 4WFNQ 2OP5A 2Z56B 4F3OA 2VH7A 4DV3F 1H7XA 1Z2LA 4CLUA 4WTOB 1KQFB 3QFWA 5IQ6A 2Z8QA 2R8HA 1U1RA 3SDEA 2ZD1A 2DO4A 2XGPA 3MR2A 2ROPA 3T9ZA 1HI0P 4QOTA 5LXQB 4HEA9 2OSRA 2A10A 3IFEA 2MYFA 4C9DA 4LQ9A 4A4JA 1CSJA 1C4CA 2CMBA 1P9QC 3OT9A 3MWBA 3MTKA 1UEKA 1NK0A 3MUMP 4WU2A 3TUPA 3I5BA 1XNRF 4DGPA 3H2UB 2YKNB 4RW8A 3F9BA 1ZPVA 2DYAA 4DMZA 4F02A 3CWJA 3AJDA 4WBFA 4FKYA 1HNIA 1OJ4A 4JV5F 2N4CA 4FF2A 3DLLQ 1FPZA 3BSOA 3IN5A 3J80U 3OUYB 1FEHA 2DH7A 4L3KA 3VHQA 2CMAA 3UVJA 4DR3F 4GKKJ 2XMKA 2ESBA 2OMOA 4DQIA 1RSCA 3LOUA 4PXBA 3UI3A 3RAXA 3CUNA 4LBIA 4HHHA 3GYNA 3EZUA 2YNIA 4OZ1A 4ZVTB 3EB1A 3DU5A 1TL3A 2BW7A 2B49A 3HVTB 4ZVFA 4DFKA 3MFIA 2PO4A 1B7FA 3NGTA 1R8BA 2P6XA 5J1PA 1Q6PA 3R5DA 3KHHA 3TAPA 2RT3A 1C88A 3TA2A 2VC1A 4HHUA 2OZ5A 1NSPA 3NCRA 4ECVA 3BGOP 4C0BA 5KT2A 2EFPA 2HVLA 4ALZA 4ES2A 4B9LA 2MEWA 2H04A 5L38A 2FC9A 2CPEA 3F44A 4QWBA 3PTWA 4X4SA 3CGIA 4RU9A 3UD3P 2UUWA 4EGLA 4EYIB 3GILA 2CIMA 1UEUA 3W62A 4MIAA 2Y68A 1NLKL 1HPZA 3LUYA 3M8PA 3Q8UA 4H4MA 2CQ4A 3CDWA 1XR5A 2HNDA 1YGRA 3DM2A 3I31A 2AU0A 1T03B 3VAMA 2DK2A 3MMJA 3OLRA 4IG0A 3TUIC 1SQGA 1HD1A 1U8SA 2ZOGA 3CMES 4BWJA 3MAAA 3CC7S 3QCDA 1X8DA 3F73A 2UXDJ 1RB0A 3ENVA 1VLYA 3R7BB 2J6TA 2PI5A 1LW0B 4ED7A 3IGNA 2HFSA 5LXRA 5B0FA 2HNYB 3D1HA 4LBPA 2J8AA 1Y11A 2VZ9A 1ZA1B 3SSQA 4DUZF 2GZOA 2VBYA 1T3OA 5F8JA 2BJ8A 3R5GA 3UCGA 1NL9A 1YRXA 1FE0A 3DHXA 4RH5A 2DNMA 3QBCA 1X60A 4FVMA 4LFAJ 3FSXA 3K58A 2VPWB 2ZH7A 2J7KA 5JUMA 2I4GA 3QWUA 1F0XA 4DBQA 2A1BA 4E98A 1X4CA 2YNHB 3LAMA 1EENA 1OETA 1U1NA 1HWIA 2V4JA 2XBPA 2ZC3A 3VTIA 5CD4A 3BYPA 2LDYA 1MROB 1AXQA 4H4KA 1FJEB 2I6OA 4QWAA 1S1UA 2WCXA 4QBWA 1FF2A 2CQIA 4DX7A 4IRKA 2ERRA 2FLOA 5I3PA 4RO0A 3KK3B 4IKCA 2ALYB 4FF3A 2Y1LB 4ER8A 1OYDA 4K50A 3BDPA 3HLUA 1JLAA 5KFDA 1D8YA 3RB0A 2UXCF 4UOCA 5M43A 2XI2A 2ZJQQ 9ATCB 2VKZG 3H7HB 4Y3CA 3O4SA 2XGQA 5HROB 2VBWA 4FBUA 1GNKA 5D0EA 2IJNA 5IM0A 4DV2J 4WZQA 2DNPA 4EO6A 5KFTA 4C8LA 2EC2A 5HBMA 5KFNA 3W2WA 3FBCA 1NB2A 3G86A 4DG1B 1IKVB 4OYPA 3QCLA 1V3AA 3DRYA 3PXGa 4DU8A 4W92B 2IM1A 3JQKA 1NKCA 2MKHA 4CT8A 1PO6A 2BE7D 1OEOX 3ZZZA 2FJEB 5EX0A 5KA3A 3UAGA 1PJ7A 3I56S 2HWTA 3QAUA 3QWPA 3OFEA 3V0HA 3QT5A 4DL6A 3HN7A 4E0DA 4MT1A 4N41A 2HMIB 1RAIB 4OHVA 4RNOA 4B9TA 1N34F 2J16A 5SUHA 4TKTA 1AROP 5FLXU 1S6QA 2HGMA 3PRBA 2OEKA 1G4US 4V1Ak 4RUBA 1RWNB 3W7BA 3DLEA 1NHUA 4YQWA 5HI7A 1MU2B 4I1TA 1RTJB 1P31A 4C6AA 1WKKA 1CULA 4OJGA 1BZCA 4UOGA 3IM9A 4U95A 1QVFR 1YJUA 2NLKA 1LQ9A 3P45B 4UAGA 3LANA 1L3TA 5KOXA 4OZLA 1DY3A 2GGPA 3CEDA 3ONQA 3M2UB 4J51A 2E7VA 4ECZA 5DZ7A 4RNHA 4JYAF 1ZCKA 5HVFA 4LF9F 4PCQA 4GFUA 1J2VA 4OYIA 1S12A 2C2ZB 1JLNA 3AY0A 1N33J 3C6TA 2VA3A 1XWLA 3QT7A 5KAAA 5KFHA 5LSRA 2ACYA 2NPFA 3MF5A 3QCGA 2CG4A 2Y8WA 4LF7J 4NEZA 3MPDA 1KVKA 3U7JA 4KH0B 1PJ5A 1FDNA 4B9SA 2FJNA 1LFWA 2UUAF 3LP2A 1ZM2A 1S9EB 2M5YA 4LRDA 3PNIA 4NLUA 4A8SA 1S0MA 2LA4A 4QWCA 1HW9A 1SKRA 1PKUA 4DV0F 3KK2B 2HHWA 3RBDA 3HHDA 4WFBQ 3N0VA 3PRVA 3TX0A 2RRAA 3G9CA 4J9SA 3FK4A 3CMQA 4KB7A 3T5KA 1UVLA 2IVMA 2F00A 2DR5A 3ZNJ1 3MMBB 3GSDA 3ZM2A 1KR4A 3GV7B 3ETMA 3GXHA 2DB1A 1CQMA 2QMXA 2V8VA 5BYSA 4KO0B 4AD6A 2Q3PA 1WWHA 3OL9A 4CYUB 1NJZA 3D0IE 1T05B 4JI4F 1ZC0A 2ZHOA 3QJPA 2JJDA 1S1WB 4WE1B 4ED4A 3VAIA 5F8LA 4NCGA 1KQKA 1X24A 2P5VA 2FLPA 3LTOA 4DX6A 4DV3J 4DLGA 3BSCA 2DGTA 2VFVA 5KG3A 2F6ZA 2AGPA 2AIRB 4DEZA 3CD0A 2IJRA 4NZ0A 3M2RA 3US5A 3NY0A 2QFIA 3D4JA 4BWMA 1ZS6A 2ILZA 3LPEA 3R5AA 1RT4A 1VRTA 2QV6A 2YH1A 1B7YB 2OOQA 1F9EB 4ANDA 3MPUB 4ZPWR 1E6VA 5EWGA 4P6QA 3A8JA 3CJ4A 1PG5B 3H5SA 1XNRJ 4JUZA 2YNGB 4FPIA 4UUWA 1ZAXA 2DHGA 2MLYA 1NXIA 3K8WA 3F56A 2HHUA 3SQOP 4JV5J 1X31C 2R7UA 4O4RA 1R7IA 1YJWS 1V3ZA 2OPSA 1U0HA 2FJMA 3DLBA 3CJTA 3NGSA 4ECYA 3R5JB 2JL9A 1UZDA 3KLFA 1EKSA 1BQNB 1WKJA 4A47A 3MUTP 4DR3J 5HLFB 1BZHA 4KT0C 3M2VB 4ZLPA 1JLQB 3GE9A 1YGYA 3WIUA 3DI6A 2LQJA 4PYHA 1HIYA 3QSIA 5FDLA 3I87A 3V4IB 3CM3A 2WRMA 4PEOA 3U1LA 1SQFA 4B02A 2YVSA 3PACA 2DBBA 4ED3A 1WC3A 4UW2A 5KFIA 4DXLA 2IC3B 4CLPA 1Q5YA 4IH7A 3KOAA 5HO4A 2X1GA 1CS4A 3UCZP 4DL7A 3MZIA 1QUPA 3J81j 3EZOA 2ZOMA 3D0HE 4R8UB 3IRWP 1U1MA 2JLGA 4TY8A 2B51A 2YWEA 2KZMA 2WBMA 1RP5A 1WC4A 1IBLF 1N36F 2HWIA 1ZAVA 3F81A 1WCHA 1HYSA 4U7UK 1VC5A 4J5OA 4LSNB 3VGVA 1U1OA 4K4VA 2B9YA 1F2GA 1BC6A 3QMQA 4ZVHA 2QA1A 4MAKA 3M9MB 4PQUA 2HBQB 4HRFA 2Q05A 4F0KA 1Q8LA 3LP0A 4WCEQ 2RVJA 2I75A 5A6WA 2P9GA 2AJ2A 2IDEA 3DLKB 1E8CA 1UVIA 2BANA 2QZ8A 5I3QA 4ZA1A 2KXNB 3OR1B 3GP9A 4RHGA 1EB0A 3ZTRA 3K5MA 1JLEA 3GIJA 3V5RA 2LXUA 1BD6A 1PYNA 1JKHA 3DHWC 3BR9A 5AXMA 2UU9F 2F6YA 3GZ7A 3A5JA 4J90A 3FEXB 2XSJA 2R42A 1IKWA 4F8RA 3HHEA 4NZ7A 2IVFB 4DUZJ 1JF7A 2BV5A 5AJ3F 3HM9A 3V0FA 4N47A 3QRRA 4N7TA 4QU6A 3K59A 1FESA 3H25A 1E0DA 1XJWB 2MKSA 4C8ZA 1TVRA 1IQTA 2EFVA 2GC6A 4I7FA 2Z2MA 1NDPA 4ZHRB 4Y2KA 5K8PA 4HKQA 3GIIA 5G0RB 2KFYA 1FDDA 1S9GB 4USIA 1WG1A 1IKYA 3K17A 2Q43A 4QDIA 1VRUB 2H4VA 2D3ZA 4MKVA 4DX8H 2VL1A 3CCRS 5L9NA 4B04A 2EC0A 4CLLA 4OHXA 5KT3A 2VU5A 3RZAA 3SCIE 3OJSA 2Y3YA 1LNQA 2DGVA 5T7LA 1BLUA 2FTRA 1HD0A 2I4HA 4GE5A 1Q8IA 2HC1A 2UXCJ 5D3GA 1HARA 2Q66A 2DISA 1HBOA 1U25A 2F1FA 2V9KA 2ZH1A 4EZ9A 3C8YA 3W9JA 4Y34A 1UFLA 4CO1A 2C2EA 5J1EB 1C2PA 2C2RA 4ZP7A 4UOHA 2MQMA 2A0FB 2QBPA 1YJ9S 4U8VA 2JVRA 2V63A 3OXLA 1VQ7S 3H2XA 1WHWA 2AZ1A 3PW0A 3HHLB 2VIHA 1C87A 1WDDA 4YR0A 1PAEX 2PMHA 2UXBF 3S4OA 3DLGB 5BJRA 2CFVA 4F3MA 1TZ0A 1BQXA 3KG1A 3OLAA 1ZZNA 4DSIA 4RR5A 2E5LF 1G1XA 1VBXA 1KOHA 2EFNA 2NXUA 2DCLA 4N8OA 2NZCA 4CLKA 1N34J 3H2VE 3ILLA 1MLAA 3MOJB 4JOUA 1L8GA 1WTFA 4NA2A 5AT1B 2KFZA 2ZFHA 5K14B 1HMVA 4I2PB 1SXLA 3FSIA 3FFIA 5H9FK 2NCKL 1VHIA 1KAKA 4HT5A 1QZ0A 3ET6B 1EETA 2DXDA 3NOGA 2CPHA 2EFGA 1F3FA 2V0NA 3TOQA 5CHCB 4ZVOB 3LP1B 3ZL8A 2FLLA 2JC0A 2XY7A 2CDQA 2CWKA 1LWEB 3JQMA 5DQGA 1NWLA 4IQMA 4EZ6A 1ZCLA 3M6VA 4JI2F 4HLBA 3VGTA 3AB2B 2E9ZA 1FKOB 2P9CA 3OUYA 1RA7A 5G4DA 2UUTA 1RTDB 5DETA 5F9NA 2H54B 3Q0AA 1U1PA 3QO9B 5IBSA 3TEGA 4JYAJ 1NO6A 2DGSA 4LF9J 2J0WA 2QCTA 3C2PA 2C1EB 2LMIA 3HVTA 2HKEA 3TJAA 3KJVA 3BBCA 2QA4G 3CDBA 3MM8B 1RT3B 4MMOA 2P2CB 4JNBA 4FDFA 2W9CB 2DNLA 3R6GB 1U45A 1RXOB 1T49A 3A12A 2HHXA 4D3QA 2RKIB 3QGGA 5L9XA 4M94A 4K4TA 2VOSA 1WAXA 3D2WA 4TQRA 5HMYA 2R7SA 2UUAJ 2EFQA 1VK8A 2I3UA 3M8WA 3Q8YA 1IBMF 3GYXB 4F7VA 2JEGA 2QCJA 1T9YA 5KTQA 2HHTA 2B9WA 3M30B 3O6QA 3IG1A 3Q2TC 4DV0J 3H20A 1X7VA 1UWBB 1SJFA 6FDRA 2Y2FA 2BDPA 2BKPA 4XAKA 3H40A 2KG1A 2MQNA 2UUBF 2R3VA 2UV8G 3MR7A 3Q8PB 5KT7A 3HZEA 4CI0B 2E5IA 2GX8A 3TANA 2HQDA 5B7WA 1UPMB 2QDMA 1SKSA 3GJSB 1T03A 3D42A 1GXUA 1IWAA 3DMJB 3CCVS 4TU8A 2W01A 1QTMA 2NXNA 3QCFA 5HMXA 2BKNA 4ZVGA 2IMOA 1X0FA 2WTZA 2Y0BB 2K2PA 4KKOB 2KJVA 3VWSA 4DR2J 4P52A 4MJKA 4IYQA 2XZWA 2EXUA 5KFPA 2CQBA 1YITS 5KG1A 2XYGB 1R6YA 3RB3A 1RISA 3L95X 4QQBA 2DH8A 4LVNP 3GV5B 3JSMB 4DDFA 4B3MF 1QDUB 1GTHA 4J9QA 2FD2A 3UW1A 4GRSA 3FJ2A 4LF4F 3H4BA 4DX5A 2UUCF 5ETMA 1R27B 4UQGA 2HHSA 4A8OA 4FZVA 4ITSA 2UUOA 1HL6A 4CLZA 3UFCX 1WDTA 3WC0A 4RW7B 2AEJA 2O1PA 4NLTA 2PA3A 1MROA 4O44B 4PXDA 1OY9A 3PIOQ 4WWSA 4ECSA 3D9CA 4B9NA 3NGRA 2I0XA 2M52A 1IM4A 5T41A 1R3NA 2HK3A 3KK3A 3RZ2A 1KLMA 1BWEA 2MQQA 1PIEA 4JP8A 3J7ZT 3QQCD 4LJMA 5ETTA 4JI7F 2ACMA 2F8MA 3C16B 4OI2A 3MCMA 3ZZPA 1NPKA 1T11A 2NV5A 3CD7A 3OXGA 4HACB 5EGYA 3SZ2A 5HAOA 4Y00A 2JLFA 2F8HA 4OYAA 2OTJS 5HROA 2ZDOA 4BPCA 5F0WA 1K8AT 4AQYF 3B6BA 3R6LB 5IV4A 3M32B 3I96A 2ZN7A 1TL1B 3C6UB 1Q95G 4OL8A 4UT4A 4DV7J 4DG1A 3BKFA 1S0VA 3CDEA 1YBUA 4ERCA 4HYKA 4DSFA 1RTZA 5E3RA 1VC6A 1H98A 3FCWA 1N48A 1IBLJ 1N36J 2ZH6A 3SQGB 3JAMU 3UO0A 1LWCB 2HVHA 1FA0A 2HMIA 1HI8A 2SXLA 2WVEA 1S1TA 2Q47A 2PIIA 3SMZA 1G3OA 3PO4A 1MSWD 1TL5A 4UY85 2DEIA 2R7OA 2VTDA 2IHR1 2FJVA 2J0XA 2AJ1A 3CCLS 3MMAB 3ZFVA 4ZVEA 5DQIA 3KXDA 1UWAA 1AUSL 1WTBA 2RQKA 4Q7AA 3KLIA 1VQKS 3QZ8A 4ZCIA 2CMCA 1MU2A 4X4NA 2XWYA 4O0NA 3AA9A 4IR9A 3V4MA 4DPWA 1S10A 4OLPA 4JI0F 3EJMA 2UUPA 2QIFA 1EHWA 2Z2LA 1OPZA 2UU9J 1D9AA 5GAGI 1U48A 4DN9A 4C0HA 1OHCA 2YWFA 3DOLA 1S99A 1BUXA 3M4UA 4DCPB 3MM6A 3NNHA 1EAYC 3OTDA 3VV2B 1VQPS 2EK1A 2LQ8A 1F5BA 2QLBB 1XXPA 4BC9A 3X3UA 5KFEA 5AJ3J 3D3CJ 4DL3A 3PRDA 3IR7B 1GQQA 4OIXA 1AUDA 2I3RA 2VEUA 1FWKA 4DFJA 1FERA 2GC8A 4OHEA 1NNDA 1ACMB 2HG4A 3SBMA 3H59A 5GMDA 1RT7A 2ZVIA 2QGFB 3KLVA 1OYEA 3V0GA 4PXEA 2JVOA 2PE8A 4F0MA 1R0BG 1VJQA 2E7XA 1S4EA 5AXNA 1ROFA 4PWUA 2HZVA 5A5FA 1YG0A 3DRXA 2IMGA 1QSLA 1TL7B 2V8DA 4I2QA 3LWLA 2R8JA 3IBCB 3HO1A 3RRKA 1U26A 4TXSA 3KFWX 1K9MT 1PH0A 4DUTA 1B3TA 4LVOP 1VQ9S 1KFSA 1VJWA 3MMBA 4YFUA 2E1AA 3UDVA 2L3MA 3ZM6A 4NCBA 4OJ1A 5I3UA 3M7VA 4K4SA 4J9RA 3ZMQA 1RTIA 3M05A 5FD1A 3TEHB 3Q89A 1RBAA 1NO8A 2E5GA 5AE3A 2F9JA 2XO6A 3CJ0A 2AHSA 5F8IA 2XHWA 3IO1A 1S1WA 3NWGA 1FK9B 1RJJA 1JJCB 2UXBJ 4URGA 2FVSA 2HRUA 1T9WA 1Y9OA 1VBZA 3HFKA 3BN7A 3RB6A 3ISND 3FBEA 4TLQA 3IAS9 2E5LJ 2ZD1B 4PG7A 2JLEA 2QSWA 3KJFB 3D6HB 1JLBA 3VR1A 4ZN3A 2YBVA 4TVVA 2CPXA 4OX9F 4XK8C 1KHWA 3QIDA 4ZVUB 2B56A 4RKKA 2MKIA 3DRPB 4CLWA 3NS6A 3AHPA 1HQEB 4RNFA 4HR2A 3TUZC 4IUFA 2LKZA 1SV5A 5HMZA 1WI6A 2W7OA 2AX1A 2KT2A 3IS9B 2AD9A 2YNGA 4OI3A 1MN9A 1UVMA 1NZAA 1HNIB 4USVA 2PA8D 3D0GE 3J7AN 1BZJA 2HS3A 1DZ5A 3HP6A 2NXEA 1YZ4A 4JI2J 2ZZMA 4OJHA 3UCUP 2F6TA 5KG6A 4GC7A 1V3SA 2BEFA 3GU0A 3UVJB 2R7XA 4KGMA 1BQNA 2R7WA 3N4WA 4AT1B 3N5FA 5HLFA 2QLJB 1PILA 2YNIB 1VRQC 2FH7A 2HHPA 5MMZB 4J9UE 2AV5A 1N0VC 1S6PB 3V4IA 2OPPA 1G4CA 3EZZA 5F8NA 3NMEA 4LR8A 2CQ1A 2RU9A 3QCKA 1XIQA 2Y67A 4ICZA 5CH7B 4DUYF 2B7BB 2IC3A 4ZP8A 3AOAA 3D3BJ 3OTEA 2VDHA 4IH6A 4R0EA 2ZHAA 1JBVA 1RHUB 3HSGA 3M8RA 3ICLA 5DDPC 3IP0A 1JIHA 3KMQA 1IBMJ 3H5UA 1V9OA 3N6LA 1YWXA 2N82B 4L73A 1RT1A 1I5OB 3P5TL 4B3OB 2XWXA 3HZGA 5AXLA 4WIIA 2Q6CA 3Q24A 2IBOA 2IA0A 2UUBJ 2B7CB 1MW7A 2H48B 2RQCA 4PVGA 1D8ZA 1F2HA 1JJHA 4OX6A 1J4XA 1HPZB 1XMOF 2DXFA 3KUEA 2V8HA 3MDFA 4TQSA 1L3VA 2HNDB 3DLKA 1YHQS 3A3OB 1YFOA 1WG5A 1KONA 3DM2B 3KK1A 1RI7A 2IJFA 4KYRA 4C11A 3FGVA 1R8AA 1YIJS 4AL7A 2DNKA 2NTAA 4LF8F 2VTEA 1UZHA 3HX9A 1NNYA 2VB6A 3MAAB 4NI2B 4DZ6A 4YAAA 5HDEA 4U7CA 4R5PA 4QBEA 3SFUA 3TNVA 4X4UA 4Z7CA 5BZXA 3N9UC 4RBVA 1RAOA 4DR4F 2O5DA 4GKJF 2CKWA 4NLXA 4DJBA 3OLBA 1VR6A 3ILIA 5E3AA 1FNOA 2V5HG 2X1AA 3MM7B 5D4OA 3T1HF 4B3MJ 4O3RA 3ZC4A 3VVTA 1TK0A 3TWZA 3WC2A 4X4OA 2ZHBA 2VKRA 4PZVA 4LF4J 2OD4A 2DGUA 4K2JA 5GADI 3PR4A 3O4UA 1VQNS 3PFOA 1OEVA 1TU0B 3PHTA 3W63A 2UUCJ 1HBMA 5A8RA 1QD1A 1ITPA 4QR1A 5G0RA 5KFOA 1O5JA 3IRXB 1EIYB 5KFGA 3S3EA 2VD3A 2HBRB 2E0TA 4GVLA 5L1LA 4ZVPB 4FYYB 2OHDA 4ZVSB 4HJQA 3NRSA 2GIRA 3CJKB 4TY9A 1HWLA 4L75A 3WX8A 3KTQA 4DQPA 4C3LA 5BX1A 1IUJA 4ERDA 3M4XA 3S1TA 1Q53A 2X3GA 1DQAA 1WKLA 4WZMA 3TZYA 4JI6F 1U7LA 1JLAB 4LFBJ 3Q22A 4JI7J 4ES1A 5B08A 1S1VB 1UVJA 2XY6A 4L3NA 1U09A 1HQUB 3HJFA 5KA9A 1YJNS 3HHNB 1QAYA 3K5NA 2H4KA 3PYDA 3NWRA 4WFAQ 2QLWA 1ZM3A 3DFEA 3BB5A 3GQCA 4AQYJ 2ASDA 2BA9A 2HFVA 3W2WB 2FUG9 4DGXA 1FFSB 1X5SA 1M5HA 1FRJA 1X5TA 2R8IA 2F6WA 1HWUA 1FX4A 2HEKA 4QPTA 3I82A 3V6HA 2BGEA 3DLGA 1G1HA 4PABA 1IQZA 2U2FA 4CQ1A 4EO8A 4J91A 2VHGA 2R7RA 1YSJA 3M6WA 2C28A 3MEGA 2D3OR 2ZH2A 2XNQA 2BQ3A 4XO0A 1R43A 1FPRA 2J16B 4ZVRB 1S0NA 3CC2S 3B8HA 1S6QB 3GSIA 1AFIA 5IV3A 1RYSA 4YN3B 3CJ5A 3BM7A 3CMAS 3EXCX 3RU0A 5F8GA 3W5ZA 1OESA 2VFUA 4CO5A 3DLEB 3DXSX 1HW8A 1UW4A 3BKTA 2NYIA 1VQSA 5CAAA 3I4PA 5IBMA 2BQRA 1FQ1A 4B3TF 2XYPB 2OUDA 4CVMA 5K8NA 1G1GA 1FEEA 3CCZA 1CULB 1SL0A 1DTQA 1LWEA 3CD5A 2Y96A 4JI0J 4USHA 2RIJA 4P73A 5E0OA 2C2DA 5C2CA 4K7QA 2GGPB 1FKOA 3U02A 2LQBA 3HDSA 4IR1A 1AT1B 3PX6A 1HNWF 1RHMB 4U67Q 2W2PP 4KBIA 3S01A 1FRXA 2BJ1A 3QO9A 1EX8A 1MG7A 1WHXA 3ZZYA 1XMQF 2OEMA 2EW9A 4P2FA 4O3OA 3BO3A 2HSEB 3BPDA 1U1QA 1W26A 2IFXA 3PJ9A 2B4SA 1LW2A 1D5RA 3BN4A 1KAVA 1RT3A 4YMEA 4CO3A 1PTTA 3GIRA 3KJNB 2B43A 1VDHA 2XEXA 2KU7A 1LWFB 1YJ7A 3A4TA 5B0GA 2NQPA 4DL2A 3OSNA 3CJSA 2RKIA 5JVHQ 4ZCKA 1VQYA 2M70A 2FHKA 4JBCA 5A2QY 4PG6A 2PT0A 2G6ZA 1O8BA 2XMMA 4ED5A 1YZ6A 1SKUB 1S0OA 3D5MA 1N5YB 2V50A 5D78A 2FLNA 3PW2A 4K0KF 1B0TA 4ED6A 4LMZA 4KPCA 5HK4A 2GJFA 1UWBA 3G82B 4K4WA 2BJ9A 1OY6A 3MPVA 4ZRTA 2QA4S 3UPFA 2I38A 1SC6A 1SJ4P 5B0BA 2H4WB 3K8VA 5EHPA 2XNRA 3EUNA 3MM9B 3T5LA 2F8EX 4C8MA 2E1CA 1RWVB 4S0MA 5KFKA 3VVUA 5J8RA 3CNQP 4P2MA 1Y00A 1BXNA 1ZZFA 1QY7A 1KP6A 2LVWA 5J1NA 3ZTSA 1N6QA 3PYEA 4L76A 4ZMMA 2FVQA 4NCGB 3ZTOA 3NKYA 1CLFA 3QCBA 1C1BA 5KA1A 3UN3A 4ATNA 3EX7B 3W5YA 3BPSP 3TO8A 4LUBA 1FD8A 3EXYA 5A5EA 2BZ2A 4X66F 3M2RB 3C14B 5KACA 4TU9A 1QSSA 3BREA 3V0DA 3QCHA 2CQGA 4NWBA 1C0UB 4M5IA 4NZ6A 1TTHB 5DLFA 1N56A 3W60A 3HSZA 1J5EF 4OYXA 4B9UA 4OX9J 3G87A 1VRTB 1VOMA 3VGUA 4KQZA 2OJ3A 2DGXA 3DDNA 2J0SD 1QTNB 2AF6A 1WACA 2DRDA 2W25A 2GW8A 2RMLA 3FBFA 1CBKA 2E5HA 2QBSA 5DS7A 2FB0A 1GTEA 4FBTA 2CNLB 4MYTA 3G2XA 2PEHA 3QATA 4BUBA 3BO2A 3NG8A 2JFKA 3KNGA 2ZWOA 4MYUA 2IM0A 2BOPA 1NPRA 2LEPA 2CQ3A 3T9NA 1X4DA 4R30A 5K24A 2OO4A 4TVAB 3PKYA 2OPSB 3KLFB 1KKHA 5J2PA 2PQ5A 2CNIA 4KPYA 2HS0A 5E3QA 1XBWA 2RDIA 4O3SA 1RACB 3E01A 3C16A 5I42A 3DDKA 4NXMF 2DNYA 5J2MB 1S79A 7AT1B 5KT6A 1Q1MA 4X64F 5FDLB 2HHHF 4NMXA 4DR1F 1JJ2R 5BYQA 1X5PA 5F9LA 2QA2A 4MK9A 3IAM9 4NLPA 4F4YA 4DCJB 3Q2SC 1S7HA 2F40A 1R31A 2NREA 4C8OA 4DUYJ 4A8KA 1WSVA 3TA0A 2HXPA 4LREA 4TY8B 2M9KA 2ADCA 5EWEA 2KL8A 2CNNB 1CC8A 1C0TB 2Q6BA 2FGCA 1RAFB 2QN6B 3OR2B 4Q2LA 1FRKA 2WK4A 4JI3F 5K5MA 1RK8A 3G8SA 2I6WA 3ZXWA 5JVGQ 3R1LA 2XM3A 1ZM9A 5IC4B 2FJBB 3V6JA 2XY5A 4PQUB 1SQEA 4YB5A 5K9FA 2DHHA 1OQ3A 4KGVB 2W9BA 2CUYA 3M8ZA 3C15A 3LP0B 3PZPA 3BRHA 3O2IA 1XMOJ 4F2RA 4FF1A 1UKUA 2A6OA 2FGOA 2BANB 2RUSA 4HH1A 2BABA 1RUSA 3IXQA 2R7VA 4XTTA 3EVOA 3RG6A 4ZI4A 3CVKA 1G4WR 1QXKA 3SSRA 5F3ZA 1JLEB 2KN4A 4I6WA 4LF8J 3ENAA 3FMWA 3EAXA 3DKDA 1JKHB 3KYLA 4IRCA 1ZA2B 1B70B 5GAGU 1I51B 2G59A 1IKWB 3WBZA 2XCAA 4DR4J 4GKJJ 2CQPA 3TI0A 3TZZA 4M1KA 2KT3A 3DGPA 4K2XA 3N79A 3OHBA 5ETRA 4ZPTR 5B0EA 3M9OB 2QL9B 4HDGA 1XNQF 2C3YA 1NH7A 3ILJA 4ILLA 5T14A 1TVRB 3T1HJ 2BVZA 3ZO7A 2DY9A 3V6DB 4I7FB 4NA1A 4WP3A 1NSAA 2R2SA 4D3PA 1BQMA 2LCWA 3QZ7A 3LK7A 2B8PA 3CT9A 3HSDA 2A3KA 4TYBA 1IKYB 4RU2A 3N28A 2F5GA 5D4PA 4FS1A 1U2RA 3UDCA 2CPDA 2VEVA 2HIYA 4WYWA 3OL6A 1F9FA 1VLOA 4MK8A 3S3FA 3POTA 1FRHA 4CLYA 3L9ZA 2IDLA 3AFGA 3DOMB 4JI6J 1SC1B 2V69A 2GVZA 3ETOA 3HT3A 3EMUA 5LSLA 2CJYB 2HGLA 4AXJA 5D3GB 2P8IA 4PKDB 3S3HA 1TQLA 1GMWA 2PSZA 1C1CB 1OIAA 2G13A 3IBWA 4GMKA 4RW4B 1YWFA 2VC0A 1WNEA 3GONA 5K8OA 2QBRA 2D74B 1KQSR 4ZPVR 3CB4A 2J6UA 2YPYA 4F4ZA 1W78A 1UTAA 3MR5A 1K0TA 2ZKTA 3VZIA 5BZZA 1P6TA 4HI1A 2H02A 3CIMA 2QBQA 1HHTP 4I67A 4AUKA 1YK9A 2G2YA 5A8KA 3R3TA 1C83A 3M8SA 2F4VF 5LMNF 4F4WA 1RWMB 3D68A 1FK9A 4XPEA 1UP1A 2ASLA 1TAQA 3ZZUA 3OTCA 4YDXA 3PDNA 3O3LA 1FTRA 1M3GA 2AJ0A 3KLEB 3DLJA 3G6ES 1CJTB 3O4TA 1B64A 2IAJB 1U6FA 3EMTA 2YH0A 1HBNA 4ZK7M 4WFXA 3JTOA 1HMVB 3OPKA 1U24A 2FJDB 3DRPA 3FFIB 5K23A 3DDIA 3DOKA 4L74A 4UOFA 1HQEA 4C98A 4NXNF 1M0SA 1EETB 1Q82T 2MGZA 1SC4B 3IS9A 4B3TJ 4YDDB 4RUAA 1X4HA 1R8PA 4DF4A 1Y10A 2VUGA 1BGXT 4OYOA 4ECUA 2EWHA 1T9UA 4OZ2A 2H5EA 2YWGA 4QF5A 3QCMA 5C25A 4QPXA 2B5JB 1OPIA 4DR6F 3AAWB 3I5AA 3QAEA 1UEVA 4OX7A 2HFUA 2B4VA 1HNWJ 3ZZOA 2DJWA 1XC9A 1PXHA 4KHMA 5MLCV 2Q79A 2WAQD 1RU2A 1L5UA 2CJXB 2DR8A 3OTBA 3M9NB 3W5XA 2WSFC 1A7GE 4JV0A 1XMQJ 4KAIA 2XO7A 2W8LA 1U2FA 2J5AA 2I4EA 4RX6A 3PIPQ 3TQEA 3KJVB 4ZIYA 1Q6MA 3SV3A 1SIZA 1S6PA 1P3DA 4Q45A 4WFYA 4NYHA 2RJZA 1UPPA 3TAMA 3QCCA 4ANCA 4OI1A 5IXUA 2M3VA 4USTA 1F3VA 2CG8A 1MN7A 1A0OB 3DN9A 3CJQA 3UQSA 2XMTA 2UZAA 1HNXF 2KG0A 2XULA 3KMSA 2AM2A 2ZC4A 5F3TA 4F36A 2IYGA 4G3IA 1YBAA 2ROEA 2LEBA 1U47A 4ZDNA 1KN6A 4LRBA 3IG1B 1GG4A 4B3OA 4K0KJ 2UP1A 1CJUA 2HIQA 3CJ8A 2I9SA 3VQTA 4QYZK 2WZ1A 1NRKA 4RW9B 2DT9A 5J2NA 5IT9Y 4NMLA 4A48A 2CZ9A 1XRIA 4H4OA 2UVRA 2MJNA 3GIKA 3PX0A 2WB4A 1A9NB 2OPRA 1ZBTA 3KHLA 2MZRA 1SH2A 2HVEA 3PV8A 1FCAA 3TZXA 4NI2A 3FRZA 1X4GA 1P1TA 2HAFA 3D6TB 1KLNA 2VPXB 2MLXA 3UR3C 2I1RA 1ICEB 2HW3A 2PI7A 1SH3A 4LFCF 1UL3A 3NP5A 1N5SA 2EK6A 2VQEF 3R2CJ 4FN5A 2PFDA 4URSA 4QR2A 4X66J 2ROGA 4USKA 1DQ9A 1FI4A 4U96A 2M4MA 3MM7A 3I7ZA 1RWWB 3ZTQA 1LEOA 1OS5A 3RW7A 1J5EJ 1F5AA 3M6UA 3MD1A 2C3MA 3GJRB 1KTVA 2HNZA 4J9NA 1Q6SA 3IRXA 3JQJA 4C8KA 4Q0BA 4ZN5A 1HNVA 1RTHB 4M63A 3CJKA 1U8WA 1FRLA 1YVFA 4CLSA 2C3PA 2GNKA 1TFYA 1GQEA 4IFYB 1DRZA 3W61A 1KLMB 2CJBA 3DRRB 1X4FA 4HI2A 2W2OP 2JC1A 2R8KA 4O3QA 2HQCA 3CC4S 1S1VA 3CJRA 4NXMJ 1RHJB 2WONA 2QEPA 4F26A 2KH9A 1GH8A 2GHVC 4OZ3A 4F3QA 1HQUA 4XPCA 4X64J 2BUNA 2HHHJ 2KVIA 5HVGA 4DR1J 3PR5B 4L72B 4WP9A 3PX4A 1VQ4S 2CWXA 3BKUA 3RRHA 1VS3A 1M5SA 3LGHA 1ZPWX 4N56A 2BBEA 4QIVA 2CJQA 2GCBA 5K25A 5LXYA 1SVDA 2U1AA 2NSBA 4ZJOA 2MHEA 5IQQA 4YY3F 1T94A 2F63A 2W1BA 4JI3J 4QW9A 3ADAC 4ZCLA 2GIQA 1VQ8S 1FKPA 5ETLA 4PRFA 4OI6A 3VZHA 1TK5A 2B07A 5KADA 4KTQA 2HQ3A 1S1TB 2PBNA 2H5IB 2PMWA 4C97A 3E3XA 2AX0A 3GTYX 4J9KA 4OHYA 5IOLA 4NRUA 5L1IA 1Q86T 4CZCA 1CPZA 1H3DA 5CXTA 2E9TA 4I6YA 5KAKA 4ZLLA 4PUOB 5CABA 1PGZA 1BE4A 3I0SA 3FQLA 3G6VA 2QFJA 3KLIB 3NCPA 4LF2A 3TZWA 2IMWP 2B8QA 3JTPA 2WVFA 4HT7A 1NUEA 4XDCA 2JHEA 1MMLA 5AWXA 1VISA 5F0UA 3OVBA 3K57A 5IC6B 2W2QP 1L3KA 1XK8A 2F3JA 2ZE2A 2OC3A 3DOLB 2P4DA 3IWNC 3MM6B 4F25A 2OFHX 1NEEA 4DS4A 5ETPA 2A18A 1N52B 2QTWA 3H8YA 1XNQJ 3FBBA 1EEHA 3HSJA 2MDAA 4YR3A 2DIUA 2F65A 4JI8F 3GR1A 3I36A 4N77A 4OYZA 1FNXH 4GKKF 5DJBA 4LF5F 4NYZA 1PSDA 1RT7B 4NOHA 3MPYA 4EBDA 2HRTA 1AA1B 2M2BA 4W90B 1LWFA 3QCNA 3MD3A 4EWTA 5KT5A 3VAKA 4RI5A 2KXHA 2E7WA 2Y66A 4IH5A 1H74A 2SHPA 2NZ6A 3LA0A 2ZITA 4I2QB 1N5YA 2CNEA 5KG4A 5KFLA 2KI2A 1I6JA 2RH3A 2W7PA 2MSTA 3G82A 4C3KA 2E44A 4NLRA 1PAUB 2R2TA 5A6PA 4DQSA 3HXMA 2CA9A 2NPIA 3BBBA 2PA5A 2JJ4D 3LALA 4ECRA 2M7SA 2DXPA 2P6SA 2MKCA 3MM9A 1OY8A 3PY8A 5I3UB 1IM6A 1DBDA 3MTJA 3JTNA 1RTIB 4X4TA 2GVDB 2WHOA 1FXLA 2ZBQA 2KKHA 2HVIA 1PC4A 2VBXA 4CH0S 1RYRA 3CTRA 1WC1A 2HQIA 2YQ3A 4ECQA 2YY3A 4DPOA 2EEYA 4HL9A 2JDJA 2OTLS 1EQ0A 3MAQA 4ZS6A 2HURA 2IY5B 4V19X 1FD2A 2ATLA 2MQ8A 2F4VJ 2C2NA 2HRYA 4RW6A 1SC3B 2K06A 4WTYA 2GQCA 4B9VA 4OHZA 1LK5A 1RT2A 1VQ5S 1HHQA 3RR7A 1KDNA 3MCNA 2CPJA 4DSJA 1EQMA 4NX8A 1JLBB 2V2QA 4P74A 3NBPB 3QCIA 3CDAA 3UD4P 2J9CA 3HVAA 3C14A 5CYMA 5A0YA 4F4XA 5B09A 2OMLA 3L7PA 1C0UA 4P7TA 3LPYA 4WYLA 3FSYA 4NE9C 2LU2A 3AB4B 4IG3B 3V0IA 2ZKUA 1D3WA 5KFRA 4R0JA 1PYSB 1LKZA 4D3GA 3H2LA 1I9SA 5H9EK 2XTJP 1B0VA 1SV5B 4NXNJ 5EUHA 2FZCB 2MTLA 1TKZA 2Z2YB 4EMDA 4ED2A 3RBZA 1A5YA 5KG7A 2EG2A 3EZ5A 4CM0A 2PEBA 1I57A 2MXYA 2RF2A 1YZ7A 1TK8A 3AJ1A 2V6AA 3OBIA 1IBKF 4DR6J 2OKQA 1YX2A 3W2VA 5HSPA 1NDLA 2PD1A 4MKYA 5J2MA 2Q1LA 3BGUA 1T3NA 2APOA 2RU3A 4GWFA 2C2OB 1L8KA 4QIFA 2OPPB 1J27A 1SUQA 3GWCA 5KFSA 3T5JA 1JNZB 1H6KX 3HVRA 2KHCA 1JBWA 3UNGC 2NXCA 2OIHA 4IKAA 3O44A 3BSNA 2RILA 2WW4A 2X1FA 5EHHA 3CCUS 4ELUA 2Z0GA 2XS5A 3I5CA 2BACA 2YWKA 4URQU 5KFYA 2FJWA 1C0TA 2IPOB 1FJGF 1RT1B 2FHJD 3OR2A 3HVWA 4TLRA 4ENOA 2HY3A 2BJEA 2N3OA 1Y3KA 2IBKA 2G9OA 3WIVA 1IKXB 2AWZA 3ENQA 2AW0A 4BCAA 1PBAA 3GMGA 1AW0A 1MMNA 2B6AA 5KG0A 4XDDA 2XLIA 4R0TA 4ED1A 4CLFA 4MTPA 4K5SA 2NUHA 5CYQB 1PTVA 4CIOA 5JMNA 1TMJA 5C42A 3VF0B 2DD8S 1OHEA 5DO2A 2JH3A 4O0IA 3CCMS 4NLWA 2CNGA 3PM9A 2OH2A 1IBCB 3GFHA 5ETNA 5H9FJ 5D8HB 1REGX 3KK1B 4C11B 2FC8A 1IVZA 4F4AA 3OJUA 2DKOB 1DTTA 4KYQA 2BJ7A 4USUA 1VCTA 3J7A1 1U02A 3QT8A 1YJTA 1TKDA 4R5PB 4FS2A 5C24A 1NHVA 1Q7YT 3HKWA 2V68A 3JSRA 4ID5B 4CH7A 2E9RX 4NLDA 4LFCJ 2VQEJ 2F9DA 3R5CA 4C7QA 5B0AA 3RW6A 3CCWA 3EM1A 3V6DA 5C5JA 3FUYA 4ICLB 3QIPA 2YTCA 3ZNUA 1HBMB 5A8RB 4J7CA 3I32A 4Y14A 2CJAA 5KA2A 3BSAA 4M5LA 1KC8T 5H1SV 2OAUA 4BDPA 2GS8A 5DDQC 1WI8A 5F41A 4DL4A 2H3EB 4W98A 2J9DE 2DGOA 3M1VA 2LLZA 1XM2A 3GYGA 3SCJE 4CO2A 3MOWA 3OD2A 1U0SA 5GAHU 2VG5B 1Q8BA 1VIOA 2KRRA 2BM0A 4DV1F 2CPZA 3DOMA 4X4RA 1KBRA 1RWPB 1TKTA 1IR1A 1FFGB 4DZDA 1S97A 3FEYB 4ZPCA 5GVQA 1JLCA 3VAHA 3RYLA 3ISNC 3R5BA 2ZMMA 2DNOA 2V94A 3BQ1A 1C1CA 3FZ2A 1UJ5A 4HTIA 4RW4A 3TVKA 3F41A 2MQPA 4NA3A 4G1PA 1LK7A 2DR9A 1S6UA 4FXDA 3RBXA 3T5HA 3N0AA 4KV8A 2C7SA 1Y5IB 1Y5LB 4DL5A 4MK7A 2N7CA 4AFFA 2VASA 3H5XA 3KNAA 1MKPA 2QL7B 1FWPA 3L7UA 1YTYA 3R1HA 2JFFA 1NWEA 1RAAB 1VQOS 1MMDA 4YY3J 1QVGR 3OHAA 4M5KA 5D4LA 3KLEA 2PDAA 3MEGB 2YKAA 4KHRA 2F71A 3J81Y 3QFHA 4OZNA 1CJTA 1IJEB 1IXKA 3UNYA 2IAJA 3C66A 4LF1A 1TUVA 5I4MA 4OHIA 2KVQE 1SL1A 2WBRA 2HHQA 1NK4A 2BX6A 1ZTTA 2AGOA 3NEKA 2QE5A 2I6PA 5DRKA 3RB4A 4TYAA 3DLHA 5D0RA 3Q8SB 2EVZA 3FDSA 4QYRA 2GWOA 2EKYA 2KDOA 2IM3A 1X0PA 1AAXA 4AE5A 1RADB 2EI5A 1DTQB 3BEGB 3AH6A 3R7NB 3HHKA 3BH6B 2R7QA 4C48A 1M5VC 2B5JA 3MXHP 1U6BA 3PYGA 1WRMA 4OZ5A 4O4GB 1YJVA 1WEYA 2L9WA 3SV4A 2WVCA 3A8IA 3W8GA 4J9VA 2GMHA 3BLTA 1J6UA 1K1SA 2B9XA 4HJPA 1SI9A 4DN0A 2MQOA 3H98A 3GLJA 1WG4A 4W4MA 1XERA 2HVDA 3O5XA 3MURP 3VAJA 4AXIA 5KFZA 4JI8J 2I1YA 2B3OA 3HFZB 2JZ5A 2NT2A 2QG9B 4ZIWA 1LW2B 1UW9A 4CVLA 3FVYA 3AOBA 5DGBA 4OHHA 4LF5J 4I0WA 2VOOA 3ZM5A 3DGVA 4TN2A 2CXEA 5KG2A 4RBTA 4OV6A 2WSEC 2MZJA 2WJPA 2X3DA 1QUVA 4FF4A 2FJAB 2D3UA 1WJ9A 4HDHA 1NBEB 3SFGA 2GCFA 2B3TB 2JEJA 1WEZA 4I4BA 4E8UA 2OELA 2FYXA 2C2KB 5CYJA 3BM8A 4MBBA 2JEFA 5LJ5Y 2W24A 2H4GA 2R8GA 2N4DA 3TP2A 3F9AA 2HQFA 4ELTA 2ADBA 5CCMA 7FD1A 1RAJA 1JLFA 3ITHA 2VV5A 1I9TA 1F1BB 4RW9A 2DGQA 2M88A 4F2SA 2XSFA 1Q6JA 2CQDA 1IR2A 3BJYA 1WF1A 4IOBA 2QYGA 4F04B 4ZLNA 1P1LA 1S1XB 4J9PA 1N6QB 1D09B 4UZBA 1RQ0A 3I9ZA 2M8HA 4JI4J 1D1UA 3PG9A 5LMUF 2A2DA 3SCLE 3Q8QB 3RO1A 2XPCA 1C1BB 1P27B 2FHOB 4F50A 3FEZA 2IVYA 4U6PA 3GFYA 2JNJA 4C4WA 2KM8C 1U2CA 4NLVA 1UVNA 1A6LA 3BGFA 3NMAA 4GVBA 3EDRB 3JXOA 1XN9A 1Q7LB 2JRSA 1Z2ZA 6FD1A 3O1LA 4ES3A 2DHSA 4HH0A 3KDNA 4DFMA 5HJYA 4KYZA 1SPBP 3MGJA 3TAQA 2G1DA 1DLOB 1JXEA 3EVMA 3AXMA 3AD7C 5KA4A 2K1RA 2IIHA 4ILMA 2D9PA 1RTHA 3BH7B 1C84A 2LYVA 4RL1A 4KFBA 3QJJA 3ULHA 2CNOB 2XG8A 1UA1A 4ED8A 1XXVA 1N88A 3P8BB 3MR6A 2CPYA 1N5QA 4IFYA 2KZZA 3J7Z5 1IBKJ 1SL2A 4WK1A 5J2PB 2F70A 1W2IA 3W3SA 5B0DA 3DRRA 3I4HX 4M5HA 3E01B 4QW8A 2I6MA 1RPMA 5I42B 4KE5A 2V2ZA 4AL5A 4QAPA 1U1LA 4FXWA 1Q16B 1TR0A 2P9EA 5AE2A 3KDOA 4CO0A 1CQNA 3BQ2A 2I42A 3EGZA 5EN1A 2VODA 3LF0A 4NX9A 4S0GA 5E33A 2ZH8A 4IFVB 2OEJA 2R0BA 5CZXA 3OVAA 2GMJA 3IA0A 1S7IA 2YQ0A 4IRDA 2F6FA 3V81A 2DH9A 3KLHB 2MJUA 2AZ3A 2YWWA 5LJ3Y 3UWTA 5DDOC 4I56A 1RBLA 5F8MA 1RHKB 1RA6A 1FJGJ 3HCXA 1IWGA 2CZ4A 3J80Y 4G6VB 1YDLA 4C2MA 3MUVP 3D66A 1NH8A 1ZH5A 2DNGA 2JOQA 3HD1A 3HHLD 3RUBL 3OXFA 4JB8B 4WF9Q 2V4RA 2W9BB 3C15B 1FVSA 2CM7A 3BF4A 2GJTA 2CZVC 2QMUB 2KXFA 3S4EA 1ZM4A 5KFJA 2DHXA 4PUOA 1TP7A 1Y0HA 4FKXA 1QAIA 1YLXA 1LV5A 2C2MB 2H5JB 4P72A 1UVKA 4AL6A 2CJZA 2RHQB 4Y2MA 1QE1A 3NXZA 1U1KA 4C13A 2VG6B 1GEHA 4Y65A 2NR0A 5KT4A 1XQIA 4RBUA 3OV7A 2ZH4A 4ZJQA 3PO5A 3DGPB 4ZCMA 3P49B 2E66A 2E5JA 4WP8A 4ZITA 5HVHA 3OVSA 4N76A 4LIRA 1K47A 4OI4A 1RT6A 4V19J 3CPWR 4P9SA 3HMJG 2A8BA 4QBUA 3HK2A 3OFGA 1NHKL 4O3NA 3TARA 2J7UA 1VQLS 2RDJA 3D67A 2GC5A 1BQMB 3MMCA 3F99A 1U6ZA 3R9LA 2HQGA 3QYYA 2P6TA 2Y1OA 1N5TA 1BMQB 3CSKA 4MFBA 3AA8A 4YHHF 3CJ2A 2DPJA 4Q8FA 3MPWA 1KRPA 2VFSA 4YR8B 4DV6F 4O3PA 4OYBA 2DVIA 1QSYA 3POTB 2Y1JA 4DCOB 4ELVA 1JJ4A 4B9MA 4ETXA 5E41A 1TMMA 4UQTA 1RE1B 4TU7A 5RUBA 2YNFA 4DV1J 2GVZB 3EPIA 3CJ3A 1CJKA 1Y5NB 2WVDA 4CNZA 2HB1A 3ZM1A 4JMKA 2CPFA 1GXLA 3ZM3A 3PJXA 3RAMA 1REVA 3PW5A 2YKMA 3E2EA 2GHWA 2GVDA 2WW8A 1SKWA 3NAIA 4DWIA 3RTVA 4ILRA 3C3LA 2NZ4A 3EU0A 5ETKA 2DGWA 2KYZA 2V67A 5IWAF 4Q43A 2DNNA 5A8KB 4M5NA 4JV2A 2G4BA 1V3RA 4L6V3 2HHVA 1D9DA 4GC6A 4QR0A 1V6HA 4USMA 2YX1A 2CM3A 1PC5A 1FHTA 1KEKA 3NBPA 4DR2F 4LSZB 1WOSA 4M5DA 4QIWD 2F6VA 4NYOA 4KJIA 1OSDA 4RUCA 1HBNB 1VI7A 3PJWA 2XC9A 1CJVB 1YRUA 4IG3A 2K3KA 3MAHA 4DPUA 1HKAA 3UD5A 2XJAA 3DOKB 2VA2A 1NZ7A 2A6MA 3KLGB 4H4KC 3TR5A 3LAKA 3HJVA 2L48A 2Z57B 3IR5B 2XHCA 2YWHA 1NSQA 2MGZB 1N4LA 5D77A 4CTAA 4J9MA 2DHAA 3EYZA 4P71A 4OLOA 5EX3A 4K5RA 1DFDA 3FKBA 3G8TA 4DQRA 5DQHA 4Z7YA 5C25B 2ZZTA 1EP4A 5HQ8A 5BR8F 1R0CB 5LT5A 4QWDA 2OUGA 2EKNA 2OD6A 3LO3A 1ZYQA 3WDOA 1KNZA 1NSKL 1DURA 2VPYB 1E6YB 1VQMS 3K5LA 5SZTA 4RZRA 1FJCA 5FLXY 1U49A 2DR6A 2HWHA 2DNRA 1HQ2A 4G1QA 3UE2A 3G4SS 1NKBA 5KFQA 3TAMB 3AD8C 5K9WA 2HBZB 2F4FA 3LWMA 2YKQA 1W7KA 1LXNA 3IWXA 3H42A 2AYGA 1R6HA 4IDKA 2VOPA 1TAUA 3WQPA 2I6JA 2V9WA 2BJDA 4MKBA 5CD4H 4ZP9A 1XTZA 3BZQA 4D3RA 4Y2CA 3O5TB 4LRAA 2LU1A 2DRAA 1N54B 3H0PA 3CCSS 2B9EA 2QO3A 2VG7A 2FZKB 1NCLA 3OFHA 2Y1RI 1S4FA 1PYTA 1X5OA 5KOWA 1CJUB 1IKXA 3B82A 5A8WB 4DV7F 4CP5A 4WOHA 4X4QA 2XLJA 1YPTA 3THTA 3W1YC 2XMJA 2D7SA 1TUGB 4QIGA 2WTFA 2O66A 3DYAA 1R8CA 2W4DA 3OFFA 2AKWB 2D69A 3WHIA 5CYQA 3MEEB 1OWXA 5J2NB 2BQUA 2HFOA 2X7IA 1XR7A 2WOMA 1M5KC 2HCMA 3RJMB 3RGIA 1VC0A 4KHPF 1X4AA 4H4OB 1OQ6A 3MECA 3QSYB 4B3RF 5GTJA 2QRRA 1NB7A 3MEDA 4EFAC 4NNDA 3R27A 3I9V9 3NAHA 2OPRB 3ISZA 4K4YA 1MWQA 3GR0A 1UJ4A 5HJXA 2KT5A 4U8YA 3THVA 3VALA 5LMUJ 1HBUA 1S5ZA 2MZSA 1RT5A 3MM5B 4TNOA 4QUNA 1FKAF 2ZUGA 4ID5A 1WORA 4BC7A 1JMTA 2N3LA 1D9FA 3NOCA 1NM2A 3NNCA 4GFVA 2BE9B 4NRTA 2HNQA 1T9TA 2JX2A 5A2QU 3AXKA 2GIFA 3V0JA 2VEYA 3N6MA 1B0PA 1VBYA 3QGPA 1LQFA 2CM2A 3CF5Q 2PN6A 4B3SF 5HQLA 3EGVA 4NLQA 5FIIA 2HNZB 3R8YA 2ZH9A 4LRCA 4ICLA 2CFXA 1Q81T 5HP1A 4OHWA 2XQCA 3ENWA 1B4SA 3K5PA 1WUUA 2MZTA 5K8MA 2PFFB 4GE2A 5AXKA 4Q0BB 5J2QB 3D7SB 1VK3A 1RKIA 4EK2A 3N5BA 3DCAA 4LQ3A 1HNVB 4GO5X 2Y1IA 2J9DA 4PWDA 1UFWA 4BJOA 3T19A 4DPYA 1P9YA 2FVPA 2VG5A 2BW2A 1O5ZA 2QDCA 2ZZNA 5HMWA 1DAXA 1M5PC 4CM2A 2ATCB 2RSQA 1RWXB 4K8RA 3OQ2A 4GS0A 2WONB 2HZAA 5FJ4A 1Y3JA 5D15A 3Q86A 3PVXA 1J5OA 2NYHA 4QJVA 1O6XA 2ZVSA 2FIUA 2JFGA 2MKKA 2DNQA 1FDAA 2A2CA 3NL0A 1GFYA 2R2RA 3NRBA 5K20B 3P6YC 5ETSA 1GMWD 3WX4A 4PWWA 4NLGA 3N01A 3WZ0A 3AQPA 4OYWA 4H1OA 5HQMA 3PS5A 1KVIA 1CG2A 1YKWA 7FDRA 1RGVA 3QCZA 1H0HB 4P7VA 4JI5F 1TV6A 3IC1A 4KRWA 2RRBA 3TUJC 2BMBA 3SEOA 4PPDA 1FRMA 1FKPB 4DLEA 1JXVA 3VCDA 1RWUA 1R8HA 2RQ4A 2KTQA 2CVEA 2BXJA 1UFKA 1WC5A 5ETVA 3GXGA 1ELOA 4RLEA 5L1KA 4CRJA 1KQGB 4QIEA 3SXLA 2G2OA 3I0SB 4J37A 2MZ1A 3SCKE 2HFNA 2BV3A 2MSSA 3FRYA 2FY8A 1HLWA 1K73T 4CCHA 1SB6A 5M2RA 4DPXA 3W9HA 2NS1B 3ILOA 2PMZD 4FXVA 4OHLA 4DSKA 4Q8EA 1WF0A 4ZKAA 1FWLA 4LT6A 4K59A 1JK9B 4A8YA 3GIMA 3CWEA 2ZE2B 1TELA 2HPUA 3IWLA 5K9VA 2YKNA 4O4GA 3OL8A 2JEIA 5HL7Q 3MHYA 4H54A 3A8EA 2I5XA 3JYTB 1JNRB 2GFFA 1GK8A 4ZP6A 2HFZA 3QGHA 4P75A 4M95A 5KA0A 1BWVA 2AYMA 2H65B 4OZJA 1R0AB 5KG5A 2ZJRQ 2VQFF 3QCJA 1Q5VA 4DR7F 5IFMA 2WB1D 1FXDA 3L7OA 5ETOA 3QT6A 1K1QA 3N6NA 2HAIA 3NGUA 1WOOA 4YHHJ 3OMHA 5GAEI 4MH8A 2HVZA 4DV6J 3S6EA 1Q1KA 2AYEA 1H2TZ 2RDDA 3C19A 2DIVA 3MOZA 3I0RB 2X1BA 1NJWA 3MFHA 1PA9A 3TQ1A 4OV1A 1V5VA 4BBYA 1UCNA 3NGKA 4X62F 1TKXB 1K44A 1CEZA 3P3DA 3CO0P 1K0VA 4ECWA 2XCPA 2NSCA 4RDDA 4I6AA 2W8KA 4GRZA 3VQSA 1FE4A 4OFZA 1Y7PA 2VDIA 5CQGA 2EPIA 3LW5C 4IO9Q 1MWZA 4ZLJA 4QU7A 2QX0A 4BS2A 4M5MA 4DS5A 1S1XA 3TRGA 1SJQA 3CCJS 4GE6A 2QT7A 2IRYA 1FJ7A 1KSPA 5IWAJ 1FO1A 1RHQB 3QPIA 4Y2EA 3JB9k 1C85A 1Z1ZA 2DTJA 3AWGA 2ASYA 4NWFA 1H7WA 1GMVA 4RW6B 3L3CA 1GQYA 2CVIA 4G1IA 4YR2A 2FY1A 4PAAA 2M3DA 1RT2B 4KI9A 1AZSB 4X65F 2XI3A 3A8KA 5DDRC 2KB2A 3CCES 1XMBA 4KR0B 2Z4PA 3U27A 4OZ0A 3BR8A 2ZBCA 2RQMA 5CYMB 5A0YB 1N32F 2UAGA 2R2UA 3RGOA 4X4PA 4A8XA 1RABB 1LW0A 4QAHA 1HI1A 1NMEB 4ZIVA 4Q2MA 2HNYA 3FC9A 3D44A 5EDWA 4C8YA 3OL7A 1VYAA 2ZUAA 2XLKA 5E7OB 3K7RA 5KFFA 1TKZB 4ECTA 2NXJA 1FFWB 1DLOA 5E2QA 2E1RA 1JQGA 1YTWA 2RS8A 2AZRA 2BE2B 1X9WA 4DV5F 2YNHA 2RF2B 2ZJPQ 3GG1A 1NZ8A 1IN0A 3T1YF 5BR8J 1NAQA 4YB1P 4Z6BA 1HFEL 5L1JA 1GAOA 3GPAA 3KKFA 4ANEA 3W2VB 1DQ8A 3QJLA 2OPQB 3OW2R 3HFVA 1T48A 2RB7A 1H72C 2KFNA 2QLXA 3QLHB 2BGDA 1RHRB 4I64A 4UF4A 4ZPAA 3PEJA 4RNMA 3D9BA 1SUQB 5ITHA 4CWBA 5IT4A 4N5SA 4LFBF 3D1QA 2MMYA 3M8QB 2F46A 1JLGB 4IFVA 1WSRA 4LIWA 2XYHB 4Y28C 3ZMPA 2RUGA 1PTUA 2DR7A 3ZTPA 3BO4A 1F9HA 5K22A 2X5OA 2BKOA 5L39A 1C4AA 3GB0A 3KLHA 1WD6A 4BLGA 2EG1A 1ONZA 3A5KA 1HWJA 2FHJA 3TA1A 3QKQA 4LF6F 1GFWB 3FQKA 4KH1B 1NDKA 2B6AB 1BHNA 5EWFA 1WOPA 2ZNYA 3NS7B 1NPPA 1IKVA 2JWNA 1PYOB 1Q6NA 1URRA 2CQ0A 5C42B 3ZZRA 5LOQA 2V2KA 4NCAA 3DRSB 1RDRA 4OI0A 1SJ1A 5KFMA 2L08A 4WXWA 2M8DB 2RNEA 4KHPJ 1BY9A 2QSFA 1VMBA 4B3RJ 3OTOF 3FCHA 1Z4UA 2V8PA 1DTTB 1UA0A 4CT9A 2VEXA 5LM7E 2LEAA 3P5BP 4Y2IA 4UY8T 5C24B 1S6OA 1KHVA 2I5JB 2VG6A 3M6XA 3J7YI 4NYPA 4XIUA 1IJFB 2J6SA 1S76D 2IRXA 3HI9A 2GO9A 4KGZB 2MY7A 3V0EA 2XB2D 4C8NA 1HHSA 1RTJA 3S7RA 2CNFA 2YDUA 9RUBA 3PHEA 1TUWA 3SIPB 2R4FA 2LECA 5IZHA 4RNNA 4NLSA 2J0QD 4HV4A 3HKZD 3K89A 2W4CA 3BGRB 2YKOA 1VQ6S 5KABA 3F0NA 4B3SJ 2HGNA 2ZDPA 3QIPB 5JJBA 1W2BR 3LGNA 2O67A 5GMEA 4RWXA 3M2UA 1OHDA 2FHMA 2OLWA 1RWKB 4G65A 2FQQB 1VHFA 1VIXA 5E3PA 3B78A 3B7OA 2UVUA 4WU3A 2HLUA 1OMSA 4FYWB 4OMFG 1CC7A 5KFXA 5IT9U 1Q4RA 1PA1A 3M1VB 3EGNA 5EHRA 2E1MC 4I68A 4OX8A 4R25A 3EVWA 3GV8B 5DLGA 1YGUA 1M1GA 1VBKA 4DQQA 3BS9A 3KJQB 2KM8B 1AYEA 2RS2A 2V8GA 3TW0A 3DU6A 2NUUG 4DF8A 4DR5F 1N5VA 3LJ8A 1GT8A 1YN9A 1RLDA 3D28A 1TKTB 4LSLB 4FYDA 2FZGB 2LA6A 3CO9A 3R2DJ 4JMJA 1PTYA 1EEOA 1JLCB 4WFZA 1S9EA 4ZPBA 2W2MP 4QYZJ 3CE8A 1UAWA 2PI4A 2V4QA 3KK2A 3D6FB 1RBOB 1FXRA 5KA8A 2W2NP 4KV8B 2GCAA 2UVWA 4ZOSA 4LR9A 4IQXA 1SJRA 1G6BA 2R9LA 2JFHA 5D0HA 3W65A 2Z30B 3U1MA 3ZZ0A 3CCQS 1JXLA 2ZNZA 3PYZA 2B0GA 2RD5C 5CA5A 4NASA 1S48A 2AJFE 5AE1A 3FZBA 2QEXS 1YJRA 4KO0A 3EE3A 4JI5J 3EWGA 4CYUA 4H34A 3GG0A 2GQQA 1W7WA 1T05A 3G6XA 4LBHA 3NCQA 1F60B 4RUHA 1H2UX 2D41A 4WE1A 1S72S 2K7JA 1R89A 5MAOA 3UN2A 2W7AA 1PJ6A 4J9OA 4JI1F 1KD1T 2COLA 4PG8A 5M2PA 3H90A 1R6VA 1CJVA 1WC6A 2CRLA 3MCSA 1TFWA 2G2ZA 3LQVA 3SDEB 3UDEA 2LQ9A 4PR6A 3KLGA 5JXSA 2G1HA 2BR0A 5KFWA 3VAGA 1YBTA 1C86A 1T0TV 1Y4ZB 4RPFA 1WEXA 4MIBA 1H73A 2R7TA 2AT1B 2VICA 2XZDB 2Z58B 2ZM6F 3RBEA 2E1PA 5ETQA 4AYBD 4F0HA 4C0OC 2IYIA 2BIJA 1SUGA 2MQLA 4O23A 3PFEA 3UN5A 1XBOA 5DM7Q 4CLTA 2C3OA 1GMUA 4RW8B 2ABYA 3A13A 1OEMX 5L46A 3AOCA 4WJBA 4P2SA 3JAMY 3VGSA 2C46A 4DL0C 1LOUA 4Y6IA 2GAHC 4QUMA 2KO1A 1E6YA 2J9EA 2KHDA 2XMWA 1Q0NA 5D6GA 3PEHA 4IO1A 3QCEA 2VPZB 3FNNA 2VQFJ 3G8QA 4DHVA 4F4KA 4DR7J 4Z2XA 2Y0SD 3P4UB 4RJVA 1WF2A 4NLYA 2MHNA 3S3KA 2PC6A 3H4DA 4M8LA 3BLUA 1WC0A 3M2VA 1L3SA 1GX5A 1XR6A 1I3OB 1JLQA 1TL3B 3LGMA 3K0JA 1FVQA 3Q8RB 4NWGA 2DY1A 2XMUA 5B0CA 1H38A 4ZN1A 2VEWA 3U96A 2J76E 1X4EA 5DG7A 4DSLA 4B17A 3GCXP 4WKRA 3QNWB 2CM8A 5HN0A 1X9SA 3HD2A 4X62J 2J8SA 3RRGA 5A8WA 3I55S 3T6JA 1RXDA 1M5OC 4N8NA 3S8SA 1UMJA 3IMQJ 1FDBA 2VJVA 4R8UA 3KG0A 1ZAWA 4M5JA 4DOZA 3DNCA 1JLFB 3ITHB 3MEEA 3L09A 4I69A 2B4PA 2H9ZA 3ZV2A 1VGYA 4OHDA 2AP6A 2AQ4A 1APSA 1NJXA 1V5IB 4LSNA 3V2UC 5I6VA 3P96A 3L4BC 5A76A 2W9AA 5BUGA 3EDQB 4Y0FA 3BDEA 2DCUB 3CD6S 4RI4A 4KY3A 2QLFB 4Z37A 1T8EA 1I94F 3PKMA 4USWA 4DV4F 2FVRA 3CXCR 3M8PB 1FTCA 4H4MB 4UZCA 4M5GA 5BYRA 2H03A 3AT1B 8ATCB
chains in the Genus database with same CATH topology
2B51A 3O1LA 4ES3A 1NK9A 2DHSA 2GHPA 2YWEA 5I42A 3DDKA 4NXMF 4HVZA 3MM5A 4HH0A 4DFMA 2DNYA 1O0PA 5J2MB 2KZMA 2WBMA 1S79A 3MGJA 3TAQA 3NLCA 1RP5A 1IBLF 2G1DA 1N36F 1DLOB 1JXEA 4WXOA 5KT6A 4IG0B 2HWIA 1ZAVA 1Q1MA 3F81A 4X64F 5KA4A 5FDLB 3NS5A 2K1RA 2AYBA 2HHHF 1WCHA 3OR1A 1HYSA 4ILMA 2HZCA 2E29A 4U7UK 4DR1F 2XS7A 1JJ2R 5BYQA 1VC5A 2VONA 2D9PA 1RTHA 1C84A 1X5PA 4J5OA 4LSNB 1U1OA 2LYVA 4K4VA 5F9LA 2B9YA 2XMVA 4KFBA 1TL4A 2QA2A 1CVJA 3QJJA 1F2GA 4MK9A 3ULHA 1BC6A 3QMQA 3IAM9 4NLPA 4ZVHA 4F4YA 2QA1A 3EGWB 2XG8A 4MAKA 1UA1A 2CJKA 4ED8A 2W7PA 3TVZA 3M9MB 4PQUA 3Q2SC 1HWKA 1N88A 1S7HA 1R31A 2F40A 3MR6A 2NREA 1XXVA 4HRFA 4C8OA 2CPYA 1N5QA 4IFYA 2Q05A 1Q8LA 5GADU 2KZZA 3I80A 3LP0A 4WCEQ 2RVJA 3J7Z5 1SL2A 4WK1A 5J2PB 2I75A 4A8KA 2F70A 5A6WA 1W2IA 3TA0A 4HTJA 3W3SA 2P9GA 5B0DA 1VFJA 3DRRA 5IS2A 3I4HX 2HXPA 3E01B 1S9FA 4QW8A 2I6MA 3DLKB 4TY8B 2M9KA 2GQ2A 2ADCA 1RPMA 5EWEA 5I42B 3PW4A 4KE5A 1UVIA 2BANA 2QZ8A 1CC8A 3IGVA 4AL5A 1C0TB 2Q6BA 2FGCA 4QAPA 1G7GA 1U1LA 3O8WA 1KOOA 4Q2LA 3OR2B 1FRKA 2WK4A 2M0GB 4JI3F 5K5MA 1RK8A 4FXWA 1Q16B 5I3QA 1TR0A 2P9EA 4ZA1A 5AE2A 3G8SA 5J2QA 4CO0A 2VFTA 1CQNA 3BQ2A 1FT8A 2K1RB 2I42A 3EGZA 2KXNB 1YTSA 3OR1B 5EN1A 5JVGQ 4RHGA 3R1LA 3K5MA 1JLEA 1ZM9A 3GIJA 3V5RA 2LXUA 3PW7A 2VODA 3LF0A 4KFBB 4ZHRA 4NX9A 1BD6A 4S0GA 1D0EA 1YI2S 5E33A 1PYNA 2ZH8A 4IFVB 1DJ0A 1JKHA 2FJBB 3V6JA 2XY5A 4PQUB 2R0BA 1SQEA 3DHWC 3BR9A 2V4JB 5AXMA 2UU9F 4YB5A 2F6YA 5K9FA 3GZ7A 3A5JA 1OQ3A 5CZXA 3OVAA 2GMJA 3IA0A 2W9BA 3FEXB 3LP0B 3PZPA 2XSJA 4IRDA 1IKWA 1S9GA 4F8RA 5DG9A 3BRHA 2F6FA 4X4VA 3K2YA 4R0SA 1VRUA 3O2IA 2ZH3A 3HHEA 5KFVA 4F2RA 3V81A 4FF1A 2DH9A 3KLHB 4NZ7A 1UKUA 2IVFB 3HPOA 1JF7A 2BV5A 2FGOA 5AJ3F 2BANB 2MJUA 3HM9A 3V0FA 4HH1A 4N47A 2BABA 1S1UB 5LJ3Y 1U4BA 3UWTA 1LYVA 4QU6A 3K59A 1FESA 4UUXA 3IXQA 5DDOC 3GFZA 2R7VA 4I56A 2CQCA 3H25A 5F8MA 2CJ9A 4BHQA 4ECXA 2I8EA 2GP0A 1RA6A 2MKSA 1HNZF 2CZ4A 3J80Y 4C8ZA 3AWFA 1TVRA 1IQTA 3D1OA 4ZI4A 3CVKA 4G6VB 2EFVA 1NK8A 1G4WR 1QXKA 3SSRA 5F3ZA 1JLEB 4I7FA 4C2MA 2KN4A 3SMEA 2Z2MA 4I6WA 3MUVP 1G1FA 2F7VA 1NKEA 4WKYA 4ZHRB 3FMWA 2VBZA 1NH8A 4Y2KA 1ZH5A 2DNGA 3EAXA 2JOQA 4HHJA 2C22A 5K8PA 4F67A 3HHLD 1JKHB 2YX7A 3KYLA 4IRCA 2G0CA 3OXFA 2AGQA 1QAJA 4HKQA 3GIIA 4KSEB 3TX8A 4DSEA 5G0RB 5GAGU 3H5YA 4WF9Q 2B4OA 2V4RA 2W9BB 2G59A 2DITA 2KFYA 1FVSA 4FP9A 2CM7A 1IKWB 1FDDA 1S9GB 4USIA 1WG1A 3WBZA 1ONYA 1M90T 2XCAA 3BF4A 2GJTA 1IKYA 2CZVC 2CQPA 2Q43A 3TI0A 1VRUB 2HS4A 2H4VA 2D3ZA 1MWYA 4M1KA 2KT3A 3G71S 2KXFA 4DX8H 3V81B 3S4EA 1OO0B 1ZM4A 3DGPA 5KFJA 2VL1A 4K2XA 3N79A 3OHBA 3CCRS 5L9NA 4B04A 4ZPTR 5B0EA 2EC0A 3M9OB 5IM0B 2DHXA 4EBCA 4PUOA 1TP7A 3B4MA 1Y0HA 4OHXA 4HDGA 5J1EA 5KT3A