3D1OA

Structure of the ptp-like phytase expressed by selenomonas ruminantium at an ionic strength of 300 mm
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
313
structure length
313
Chain Sequence
TVTEPVGSYARAERPQDFEGFVWRLDNDGKEALPRNFRTSADALRAPEKKFHLDAAYVPSREGMDALHISGSSAFTPAQLKNVAAKLREKTAGPIYDVDLRQESHGYLDGIPVSWYGERDWANLGKSQHEALADERHRLHAALHKTVYIAPLGKHKLPEGGEVRRVQKVQTEQEVAEAAGMRYFRIAATDHVWPTPENIDRFLAFYRTLPQDAWLHFHCEAGVGRTTAFMVMTDMLKNPSVSLKDILYRQHEIGGFYYGEFPIKTKDKDSWKTKYYREKIVMIEQFYRYVQENRADGYQTPWSVWLKSHPAKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Effect of ionic strength and oxidation on the P-loop conformation of the protein tyrosine phosphatase-like phytase, PhyAsr.
pubmed doi rcsb
source organism Selenomonas ruminantium
molecule tags Hydrolase
molecule keywords Myo-inositol hexaphosphate phosphohydrolase
total genus 110
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14566 PTPlike_phytase Inositol hexakisphosphate
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1690 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3d1oA01
3.90.190.10 Alpha Beta Alpha-Beta Complex Protein-Tyrosine Phosphatase; Chain A Protein tyrosine phosphatase superfamily 3d1oA02
4HRFA 4QUNA 2F6YA 1J4XA 3QKPA 2H4GA 3O4TA 4R0TA 1OHEA 2F6VA 2HY3A 2F6TA 1XRIA 1G7FA 2HNQA 2Y96A 3D1QA 1LQFA 2E0TA 2J16B 2OC3A 2CM7A 2HC2A 2GP0A 1PTTA 3MMJA 2B4OA 5LXQB 3NMEA 3EB1A 4WTYA 3BLTA 5KA7A 4BPCA 2ZN7A 2I5XA 2QBPA 4D3PA 3O3LA 2CM3A 4YAAA 3QCFA 4BJOA 4GFUA 1A5YA 5EHPA 2I1YA 2H02A 2BIJA 2VEWA 4QBWA 2I4EA 3S3HA 2I4HA 4RH9A 4D3RA 4Y2EA 3D9CA 3QCLA 1G4US 5KA3A 4RKKA 3U96A 2B07A 1BZCA 1WCHA 1KAKA 2ESBA 4R0SA 4Y14A 2HC1A 4QAHA 3V0HA 5K24A 4QBEA 2QBSA 1C85A 1WAXA 1V3AA 2VEXA 5BZXA 2I75A 2P4DA 1G7GA 2I6MA 2R0BA 3F99A 4NWFA 1ECVA 1VHRA 4GE6A 5BX1A 3D1OA 5IBMA 3EAXA 2NT2A 3V0EA 2G6ZA 3QCGA 2QDPA 1OHCA 1C87A 4KYRA 2F70A 1Q6TA 1YPTA 2CMCA 5KACA 3V0GA 2OUDA 5AWXA 2CFVA 2IMGA 4JMJA 1U25A 1YFOA 3CWEA 5K22A 5K23A 2B4UA 3CM3A 1OHDA 2MBCA 2OZ5A 1FPZA 2P6XA 4KYQA 4AZ1A 2FH7A 1PTVA 1XM2A 5KA1A 2CJZA 3SMEA 1NWEA 1GFYA 2I3RA 4RHGA 2AZRA 3AWFA 4NNDA 5IBSA 5KABA 5BUGA 3QCBA 2J16A 2NT7A 2Q05A 4RDDA 3GXGA 1JF7A 4GRYA 3QCDA 1QZ0A 2GJTA 2HXPA 3EU0A 2A8BA 1D5RA 2CNFA 1GWZA 3BLUA 1I57A 1NWLA 3S4EA 3AWEA 2PSZA 1T4JA 3QCCA 3H2XA 5KA4A 2JJDA 1ONYA 2C46A 3O4SA 3QCIA 3LJ8A 2AHSA 2CNEA 3EZZA 1BZJA 2FJMA 2QBRA 2VEVA 2OOQA 5I6VA 1P15A 1KAVA 3V0JA 3QCMA 5EHRA 3I36A 1XXVA 1YWFA 2NLKA 3V0DA 4PVGA 2QBQA 3EMUA 1EENA 1T49A 2QDCA 2H4KA 1WRMA 3I80A 4GS0A 1NL9A 1U26A 1I9TA 3A5JA 1C83A 5K25A 4OHIA 3S3FA 3D1HA 1JLNA 2PBNA 5KADA 3I7ZA 5KA9A 1XXPA 4ZN5A 1ZZWA 3D44A 5KAAA 2CNGA 2CM8A 3D42A 1NZ7A 3RO1A 1M3GA 3BM8A 3A5KA 4ICZA 1YTSA 4GRZA 4OHHA 2HVLA 2G59A 4WU2A 4RI4A 5KA8A 3O5XA 1G1GA 2CMAA 1NO6A 5GTJA 4R30A 4KI9A 1YTNA 1YZ4A 4H1OA 1OEOX 1OESA 3MOWA 2J17A 2F71A 1PTUA 4HJPA 2B4PA 4DGPA 2I42A 4MBBA 4GWFA 1OEMX 3ZM3A 1EEOA 2CM2A 1C88A 2F6ZA 5BZZA 2H04A 2NTAA 4JBCA 3F81A 3OMHA 2B4SA 3QCEA 2PA5A 4I8NA 3MOZA 1Q6PA 2Y2FA 1PTYA 2NV5A 2BGEA 1R6HA 2QCTA 3B7OA 4ERCA 3F41A 4GE2A 3ZM1A 3QCHA 3S3KA 4D3QA 1OETA 3AWGA 2BZLA 2I6IA 5K9VA 2DXPA 2QCJA 5KA2A 3O4UA 2VEYA 1X24A 2HCMA 1MKPA 3M4UA 4NX8A 3V0FA 2HB1A 5HDEA 4GFVA 1PH0A 3S4OA 1I9SA 3RZ2A 3ZV2A 5K9WA 4YR8B 2QEPA 1XBOA 5KA0A 2SHPA 2CMBA 2CNHA 1YGRA 1LYVA 1T48A 3S3EA 1Q1MA 1ONZA 3ZMPA 5M43A 1C84A 2A3KA 1ZCKA 3QCNA 3BRHA 1Q6MA 2BGDA 4IKCA 3RGQA 1LARA 5MMZB 3SR9A 3ZM0A 2I3UA 4JNBA 3N0AA 4B04A 3GXHA 1SUGA 2HNPA 4NYHA 1G1FA 2F6WA 2I6PA 2QDMA 2H03A 2C7SA 4TVVA 4Z6BA 1QXKA 1L8KA 1FQ1A 1YTWA 3OLRA 3F9AA 2NZ6A 3QCKA 4WOHA 1BZHA 4ZRTA 2RF6A 1OEVA 4OHEA 1C86A 4NWGA 1RPMA 3V0IA 2PQ5A 2ZMMA 2WGPA 4OHLA 4J51A 4PYHA 3F9BA 2PI7A 4RH5A 3ZMQA 4DGXA 3QCJA 1FPRA 2I6OA 1Q6JA 1L8GA 2B3OA 4H34A 1OEUA 2I4GA 1Q6SA 1ZCLA 5J8RA 4OHDA 1AAXA 2CNIA 2F46A 1Q6NA 1PYNA 1PA9A 2VEUA 2PT0A 2I6JA 1PXHA 2BV5A 4QAPA 2Q47A 1YN9A 4QUMA 4S0GA 4WU3A 4JMKA 1U24A 1NNYA 2M3VA 1YGUA 1ZC0A 2GWOA 3RGOA 4GE5A 1RXDA 4HJQA 2H4VA 2B49A 3ZM2A 4RI5A 1PA1A 2YDUA 1G1HA 1G4WR 2FJNA 3QKQA 3PS5A 2F6FA 4ZI4A
chains in the Genus database with same CATH superfamily
1Z2ZA 3QKPA 2F3JA 2VDIA 2MEWA 3HZGA 3L3CA 2ZJRQ 3O4TA 2FJDB 2W2NP 3RR8A 1VS3A 3M30A 2V67A 3D54A 3GJRB 2V50A 4YB7A 4ZJLA 1R6YA 2HY3A 2CRLA 2VPXB 1G7FA 3D1QA 3T1YF 3UDEA 3OVBA 1LQFA 1B0PA 1A6LA 2CZ9A 5F3ZA 2D1CA 2YKOA 2GHPA 3NXZA 1TV6B 4IFVB 5CZXA 4NL5A 3RBZA 2ZUGA 4ZS6A 1VFJA 2VBYA 3I5BA 3NGKA 3E2EA 3QJPA 1WC3A 4E0DA 3OL6A 1CG2A 4OX9J 2CM7A 2XZDB 1X5SA 3NLCA 2M8HA 4ZP6A 4ITSA 1YWXA 4OZNA 5E33A 1BXNA 4E8UA 4OI1A 1S1WB 4F36A 2UUWA 4G3IA 2VONA 2B4OA 3KLEB 2GP0A 5LXQB 2LQ9A 2ABYA 3M9OB 1P31A 1KHWA 1JJ4A 4QYZJ 2G2OA 5EHHA 2DRAA 2BE2B 2E66A 3ITHB 1S6QB 3H4BA 3L7OA 5HL7Q 1P9YA 4H4KA 1YG0A 3BLTA 1FRXA 4RHGA 2MHEA 3GR1A 4BPCA 1HR0F 2B6AB 4G1QB 3M2VA 5J2QA 1CLFA 1YBUA 3EYZA 1HA1A 3OSPA 3IGNA 5B0EA 2WSFC 2EG2A 2M0GB 1BWVA 1YKWA 2DEIA 3CDUA 4Y00A 2XLKA 2RMLA 2QBPA 5KFJA 4D3PA 1ZM2A 3FSYA 1WTBA 2GIQA 1KVIA 2A18A 4CH1A 2XM3A 2OPPA 2BV3A 2ZFHA 2ZITA 3IR7B 1NSQA 1CVJA 2G4BA 4Y2KA 2CM3A 5LXYA 1GK8A 1WHXA 2O67A 4NMXA 4OYWA 4Q5VA 4LFCF 3VAMA 2BOAA 4YAAA 2QMXA 4M94A 5KG0A 3MZIA 4ZITA 2POKA 4RWWA 3GQCA 2I1YA 2H65B 2OFGX 1Q5VA 1UZDA 3MCNA 2RU9A 3LP1A 1SL1A 2GA7A 1L3VA 4QBWA 4IKAA 4QF5A 1BQNB 4X64F 2GC5A 2OJ3A 2I4EA 1N5SA 4W4MA 5LM7E 4D3RA 4WF9Q 3AD7C 5L9XA 3CC2S 2XCPA 4HHUA 3D9CA 2V2ZA 3DYAA 1UEKA 2MKSA 3M8WA 2QA4S 4UUXA 4IDKA 3A3OB 3FSXA 4EWTA 3I0SB 3QCLA 4OI6A 3D9BA 5K14B 3D7SB 5L1LA 3PRDA 2G13A 2RKIB 3F73A 4R0SA 3ISNC 1X0PA 2EBEA 2R3VA 1RU1A 2X3GA 5BYQA 2A2DA 2JFGA 3I0RB 3MD1A 2H48B 4O4GB 4YUDA 1S0OA 3VAIA 3U1LA 2ZH7A 1W2BR 1JJCB 2PI5A 3UCGA 1S6PB 2VFVA 3CSKA 3IGVA 4LJMA 4OV1A 2MHNA 2XLJA 4CT9A 1VBZA 1UW9A 4WIIA 1ZTWA 5C25A 4YMEA 2HFVA 1WAXA 1ICEB 1B4SA 2MKYA 4L6V3 1RE1B 3ILOA 4LBIA 2B8PA 2BA9A 1C1BB 3R5AA 1N36F 1J5EF 5M2UA 2CWKA 5HMYA 2ALZA 1LWFB 5LXRA 1FCAA 4I64A 3S7RA 5HMZA 5H1SV 2P4DA 3A3PB 3GG0A 2I6MA 5E3CA 3VTIA 2F4FA 3ZTPA 2ALYB 2HQ3A 1R0CB 3MUMP 2P8IA 4RR5A 4H4MA 3OUYB 3FCHA 2D3OR 4C12A 5ETPA 4F2SA 1ECVA 1QAYA 4C7QA 3MWBA 4O3SA 2X7IA 3THPA 1SL0A 2ZHAA 4O0NA 1X4FA 2I9SA 2VJVA 4F0KA 4F4KA 4KHPF 4WP3A 1TL1B 2B5JB 1XMOF 3J81U 1GMWA 4PXBA 4L72B 2KT3A 4KQZA 5K9FA 4DF4A 4WFAQ 4ZVUB 4ZN3A 3V0EA 4USHA 1HI1A 1S9GB 4AE5A 5BYSA 5KT4A 4HHHA 1N88A 2G6ZA 4Z7CA 2NQPA 3W63A 2V4JA 1MN9A 4KYRA 2F70A 2KM8B 1HNVB 4XO0A 1JLAA 1X4CA 5IT9Y 4NX9A 1W7KA 3GFYA 4IO9Q 2J6SA 3RB3A 2IIHA 1CULA 1JBVA 2CMCA 2GQCA 3D66A 4P2MA 5DRKA 2UXBF 4M5DA 1FXLA 1UAGA 5AWXA 3V0GA 1EARA 1V3ZA 1ZA1B 2IMGA 2FVQA 2CVIA 1FDNA 3TA0A 3M32A 3UN5A 4ANCA 2UP1A 1WC4A 3QRPA 3TAPA 4Y2EA 3TVYA 1MMLA 1S99A 1SIZA 4USKA 2CPYA 4DPTA 3CM3A 4IG0A 3FKBA 4I0WA 1K9MT 2HGNA 1HLWA 5DJBA 2P6SA 2B3TB 4B9NA 3D6HB 1YZ4A 2UUPA 2DNKA 4KYQA 3HHLA 2FGCA 1O8BA 1PTVA 3JS9A 5SUHA 3FFIB 3TAMB 2QRRA 3OSNA 2CJZA 4DL3A 3QNWB 1OIAA 1GFYA 5A8RA 5HQMA 1YITS 1S7IA 2I3RA 1JLAB 4M8LA 1HR0J 5HBMB 3CCVS 3WQPA 1NK5A 2C2EA 2OI2A 1RWXB 3BZQA 4ED1A 1ELOA 2CJBA 2UXCJ 5BUGA 4ZKAA 2J16A 4OJHA 1FKPA 2Q05A 2NPFA 2CQCA 3MAQA 4TYBA 2WVBA 2RE1A 5LL6d 1OYDA 1VQ7S 2QA4G 2CJKA 3R6LB 1LWEA 1PAUB 1SUQB 3DLGB 4PG4A 3PXGa 1XMQJ 4C8ZA 2CXEA 3H20A 2CPDA 4F67A 1T0TV 1FE0A 1KFDA 2XZTB 5KFVA 1VYAA 2L9DA 1RWOB 2RKIA 1Q8LA 2ZE2A 2DCLA 3HSJA 1P1TA 2C2OB 4LBPA 4AD6A 2FHJD 1DFDA 1NWLA 1FXRA 3M2RB 2FJXA 1HIYA 2RDIA 5HATA 1T4JA 2KG0A 3H4DA 3N5BA 4J9RA 2KRBA 3RB4A 2HHUA 1C0UB 3EZ5A 2CYYA 3H2XA 1ONYA 3HN7A 4YY3F 4YR3A 2KT5A 1ZPVA 2QLBB 1XR5A 3W5ZA 3MI7X 4N56A 4NCAA 3LJ8A 3QCIA 2DYAA 2QMUB 2CPIA 2H54B 3LA0A 4W92B 2AHSA 3EZZA 3S4OA 2JZ5A 3F56A 2A6MA 3FEZA 4FNIA 2VTDA 3GIJA 2PO4A 5FD1A 3TEHB 5HP1B 3GG1A 3B54A 1BC6A 1WHYA 5I6VA 3WHIA 1P15A 2YQ0A 1EP4A 3V0JA 2I1RA 3MM6B 1GNKA 5A6PA 1URRA 2XMWA 3KG4A 2AQ4A 4YOEA 1PG5B 1XXVA 2YKAA 2BW7A 5DLFA 4HACA 1HW9A 2YTCA 4ZVRB 1GEHA 1WG4A 2C42A 3FBFA 1UFKA 3IMQJ 5HVGA 5BR8F 4OI0A 3UR0A 3CMQA 1HMVA 1MROB 4ALZA 2Y3YA 5FLXY 3RGOA 3NY0A 4ATNA 3PTWA 4NZ7A 2QMWA 3GV5B 4NWBA 1RAFB 2J0WA 3EVOA 4KC5A 2QDCA 2H4KA 1WF1A 2XSJB 4FKYA 1EEHA 1UWAA 2X5OA 1PKUA 3D0GE 3CJ8A 3PCOB 5FDLB 3I80A 2GMJA 1YBTA 5F8HA 2RT3A 1AFIA 2GAHC 4PR6A 2MLXA 4WBFA 3CJ3A 3D1HA 5C24A 3T6BA 2AJQA 2CQ4A 1LK5A 1OYEA 3B8HA 3L95X 3TUJC 1L3SA 1J5OA 4ED2A 2J9CA 3RU0A 3RGIA 3KHHA 4J9MA 4NZ0A 1H73A 1T9TA 4DQSA 2VU5A 4KAIA 3I7ZA 3MR3A 1GX5A 4DR3J 4GKKF 5J1PA 4DV7J 2HNDB 3G6ES 4KHPJ 3OFEA 4KH0B 1PBUA 3HHLD 5KAAA 2XEXA 1Y3KA 3T19A 3D42A 1HNIA 2LMIA 1SI9A 1V3RA 3JQJA 1HNXJ 4DV2F 4IYQA 2ROPA 4ZPDA 1NJWA 4NXMJ 3BBFA 4I68A 5GMDA 1UA1A 2WONA 4K50A 1VRTA 5F9LA 4GRZA 2ZD1B 2HVLA 3AB2B 3GSDA 2KRRA 2WHOA 4LRFA 4K5SA 4RW9A 1WWHA 5KA8A 4LBHA 2OKQA 5T14A 4RX6A 1YJTA 2DR9A 3R7NB 1V5IB 2G0IA 4CO4A 3BREA 2BW2A 1NK0A 3UWTA 3HP6A 4Q7AA 1HHSA 4P10A 4QZVB 6AT1B 3OLAA 1D0EA 3KMQA 1ZM9A 2FPHX 2CNOB 4DV5J 1UMJA 2Z8QA 3G96A 3M8QB 1WOSA 3ZTOA 2KG1A 2ZJQQ 1DBDA 1UJ6A 5B09A 2RF2B 2OIHA 2LDYA 2DNHA 2DNPA 3BR9A 5KFLA 3CJ2A 1N48A 5DM7Q 1NAQA 1X4DA 1C1CB 4B3OA 1IM4A 4BUBA 1R3NA 3D6MB 3MOWA 2J17A 1CJVA 5A2QU 2JNJA 4CVLA 4HJPA 2BX6A 1RK8A 1TKTA 2B4PA 3KJVA 4DGPA 1HD0A 1U8WA 2BM1A 3L09A 5HVHA 1LXJA 4ZDNA 2BKOA 5KFIA 4EYHB 2B9EA 1OEMX 3LANA 4HI1A 2GVDA 2IVFB 2VJUA 4K0KF 3H90A 4RUAA 1HI8A 3UDLA 4X4PA 3Q8QB 4K8RA 2DB1A 2DXFA 5FIIA 2Z0GA 2XO6A 4DL4A 1UCNA 2V2VA 2H04A 2NTAA 4JI2F 4JI7J 4JBCA 3DRXA 1JLEB 3GCXP 5EX0A 3JAMU 3MEDA 3BQ1A 4IFYB 3EPGA 4HH0A 2R7SA 2XY6A 5J2QB 5I42A 4DX5A 2B4SA 2R2TA 3HF5A 1WHVA 4B3MF 3JTOA 1N5VA 2O1PA 5F0WA 1REVB 2DXEA 3MM9A 4DG1A 3TZYA 5J2NA 1ZM3A 2ZZNA 4GMKA 3DI6B 5KFGA 3AFGA 2CG8A 5AE3A 1T9WA 3H2UB 3H7HB 4M5KA 2YX7A 4FDFA 4I8NA 4P75A 1Q6PA 1WDTA 4FBUA 4Q0BB 2I8EA 2WVDA 1NJZA 3R7BB 1SQEA 4FP9A 4O3QA 3AA9A 3HX9A 5KT3A 2QL5B 5A0YA 1QSSA 4IR9A 4WTOB 3NNCA 3H42A 3AD8C 3D3CJ 1R6HA 3F41A 2HVIA 4P6QA 2MZSA 2M70A 3QRQA 1C4AA 1HNVA 2F5GA 2Y1LB 3B4DA 5DGBA 3BO2A 3D6FB 4F3QA 5KFQA 4B3SF 1OETA 2FZKB 2HBYB 2VG6B 3W9HA 4K4TA 3OR1B 2NLWA 3QGPA 2F9JA 2QC3A 2RB7A 5KA2A 2MQ8A 3O4UA 2B5JA 4R0JA 4WJBA 4NEZA 5HLFA 4LREA 2PMZD 3EGZA 2DR6A 1Q81T 4JI7F 2ACYA 2EEYA 4Q2MA 1QAIA 3C16B 2JX2A 3KJQB 1RWNB 4GFVA 1PH0A 1F1BB 3NOCA 4RU9A 3E3XA 4C0BA 2KTQA 1Y7PA 3OTBA 2XI2A 3VF0B 3MR6A 1EETB 2XNQA 4TXSA 3VR1A 4ELUA 2WBRA 1S77D 2LEPA 5CZVA 1U1QA 2HHQA 4PG8A 3VAHA 4G1IA 3QRRA 4RNOA 4ZLLA 2DJWA 4DDFA 1FRIA 1VIXA 1QDUB 2UUCJ 1YGRA 1LYVA 2X51A 4PYAA 2Q43A 3EMTA 5MAOA 4NLQA 5KFSA 3ISND 3DFEA 4JI0J 5D4PA 4MKAA 1TAQA 3MM7B 3N6NA 2XB2D 1NKCA 3ZMPA 2QX0A 1C84A 1EJ7L 5F8NA 3QCNA 2WTFA 3R5BA 4BC9A 5AXLA 4ES3A 1Q6MA 3T3FA 3BRHA 2D9PA 4HV4A 2J8AA 3MPVA 5KFKA 1D9FA 1R89A 4OYOA 1X9SA 5HSPA 2DY9A 1TP7A 2A2CA 2G9OA 2Z2LA 3G86A 5KG6A 3G8SA 3CWJA 4X84A 4ZPWR 4LFAF 3MM8B 1BQXA 3SR9A 4JI8F 3PR5B 5C42A 1BD6A 3CD5A 4RUBA 5C2GA 4J91A 1TL7B 1V5VA 1N6QB 3Q2TC 2VUGA 1P3DA 3IS9A 3KFWX 2F00A 2AYBA 3N6MA 2VICA 5DQGA 3GXHA 1Q53A 1QAXA 4CO2A 3E01A 2LEBA 2ZEJA 3N01A 1JKHA 1PJ6A 2HEKA 2UU9J 4HDGA 1SUGA 1F9EB 2YNFB 4ZJOA 4NYHA 3POTB 5A8WB 3GIIA 1Y5LB 4P71A 1JMTA 3TVKA 1XC9A 4DSKA 4M95A 2DISA 2IDLA 5A76A 1TUVA 3BKFA 2QDMA 4KV8B 1EP4B 1LWXA 3CD6S 2BJ3A 3GFHA 1R8AA 4ZP9A 4QUNA 3Q8RB 3VVUA 3CVKA 3KKFA 2A8BA 5IT0A 2C2MB 1TMJA 3OXLA 2P2CB 5KFZA 3G4SS 3V6KA 4BS2A 3EB1A 1HBNA 5KG3A 1FJEB 2H51B 2EVZA 1GXUA 2DNGA 4QR0A 1VRUB 5ETLA 3IRXA 1Q86T 2DNNA 1NZAA 3DNCA 2E0TA 1SB6A 2HHTA 2NZ6A 1KONA 2QL9B 2IMWP 5D4NA 4I6YA 4DPOA 4UY85 3TA2A 3OVSA 4OFZA 1NHUA 3W7BA 1XQIA 3EX7B 2JEJA 1FDBA 2ROGA 3VHQA 4ZVSB 4YDDB 5IM0A 3J80U 1IWGA 2E5IA 1N5YB 2W2MP 1N33J 1KTQA 1C86A 2F7VA 4LIWA 5F9NA 2ASDA 1T8EA 3W3SA 5KFHA 2E1PA 1WJ9A 3KLVA 1PYSB 2YNIA 1U1MA 4PYHA 2XMKA 3TA1A 3ZZUA 3EGVA 2XO7A 3F9BA 1JLQB 4KE5A 2D9OA 1U1NA 4CTAB 5GMEA 5L1IA 3CT9A 5ETNA 2I6OA 2HSEB 3M9MB 4GVBB 1RAIB 3E8OA 4KO0A 2VG6A 5ETSA 3K17A 5B7WA 2QG9B 4IFVA 1F2HA 4I4BA 3SFUA 3GP9A 1B3TA 2OD4A 3HD2A 1KRPA 4ZHRB 1PJ7A 5LT5A 4C4WA 1GX6A 2F6WA 5DO2A 3C15A 3MTKA 3QZ7A 1FVSA 3RR7A 4V19J 2COLA 2A3JA 2IM2A 4MIAA 4CH7A 1N56A 4ZP7A 3D67A 2VEUA 2XI3A 4OZJA 3RB6A 5C24B 3RRGA 4B08A 3TAMA 4B3TF 1L5UA 4DSJA 4OX9F 3ENWA 5DG9A 2X1FA 2DNRA 3SSSA 2HNYA 4ZOSA 1UFWA 4DV5F 2HURA 3OXGA 3R5DA 4YB1P 4C6AA 2FHOB 2FJEB 4I1TA 4U6PA 1VQOS 3DLBA 2FTRA 2HRYA 1PJ5A 3QWUA 4ECZA 4QYZK 3M32B 3W2VA 3PW0A 3PKMA 2IAJB 4S0GA 1X9WA 3FBCA 3PEJA 3MURP 2M3VA 1J6UA 4K5RA 5E0OA 3SFGA 2C2NA 2QN6B 2W4DA 1BE4A 2E29A 4AQYJ 4U7UD 1KOOA 2VKZG 4GE5A 1HWJA 1RXDA 4A46A 4HJQA 2DHGA 4RI5A 4FS2A 4ILMA 4CO1A 4AYBD 2R7RA 1S4EA 4Y2AA 1JK9B 1HPZA 1A9NB 1G4WR 2PEHA 1U8SA 3BBBA 2HWTA 1R8HA 1SKSA 1JX4A 1N54B 4MT1A 5B0BA 1NH7A 1LWCA 4ELTA 4YFUA 2FIUA 3EZOA 3PJWA 2BJ1A 4CZCA 3PHEA 2KFZA 2C2DA 4ZI4A 5EN1A 4DZDA 5I42B 1UP1A 4LF8J 3BB5A 3THVA 4NLVA 1A0OB 2H4GA 4JV2A 4U9RA 1GQQA 3PW5A 2LDIA 2DGQA 1X9MA 1OHEA 3DLGA 2J9EA 2D3UA 1H38A 4C48A 4L3NA 4QR2A 2VQEJ 3ZTRA 1XRIA 3DDNA 3CB4A 3MM5B 2ZC3A 1QSLA 4R5PB 2MB0B 2KB2A 2X1BA 3CCUS 1EQMA 2RS8A 1R27B 2MQLA 3A8EA 4KGZB 3W65A 4ECSA 1HBNB 3MEGA 1UPMB 3H5SA 4CCHA 4LF4F 1C0TA 4H54A 2C3OA 2D7SA 2MQMA 4HTJA 3W60A 3NS7B 1QD1A 4CYUB 5L1KA 1FRHA 4DF8A 3AB4B 4QQBA 4ECQA 4DR5F 3CNQP 2J16B 1N34F 3S4EA 3RJMB 4O23A 5J1NA 4BWMA 2HC2A 1AUSL 3AXKA 2QTWA 1Z4UA 2F1FA 2ROEA 4F50A 3ZM5A 3CD0A 3LF0A 2FC9A 3NMEA 2B9XA 3MHYA 4OYZA 3K5NA 1SV5B 3PVXA 1KD1T 3SEOA 3VWSA 3MUVP 1EETA 1JNRB 1OS5A 3DRRB 3K0JA 4DR4J 2UZAA 3TQ1A 4MMOA 1GFWB 3W5XA 2DD8S 3NOGA 4I6AA 2WOMA 3LO3A 5IV3A 4ECWA 2J7WA 3LH2S 3VGSA 3QZ8A 1JLGB 3ADAC 1R0AA 1KLMB 4KR0B 3ENAA 2ZC4A 3M6XA 7AT1B 3GFXA 2I5XA 1WKJA 2ZHOA 2PFDA 4Q44A 3AXMA 3MEKA 4JI4J 2I6WA 1AZSA 2VC1A 2CQBA 2HPUA 4NEYA 2P5VA 1FEHA 4FBTA 2P6TA 3DOLA 1NUEA 1UVIA 3GPAA 2C2ZB 3DMJB 2BANB 1KVKA 4HL9A 3ZXWA 2YX4A 1LW0B 2OEJA 2HLUA 4TN2A 5LSRA 3SBMA 1P1LA 1IKXB 4N8OA 2C3UA 4BJOA 1GMVA 1A5YA 3RAXA 2HBRB 5EHPA 3NGSA 3QFWA 1I5OB 2F63A 2KU7A 2NUUG 2V4JB 2WRMA 1ZPWX 3G87A 2GMLA 1BLUA 2YQ3A 2ZBCA 4EFAC 1AT1B 2QIFA 2FHMA 2MQQA 2VEWA 1HBMB 1CS4B 2VBWA 2I4HA 1DQ9A 1CJKA 2EFGA 4RH9A 2MXYA 3BV8A 2ZH4A 3HSZA 4WFBQ 3MR5A 2JC1A 2PE8A 2W25A 3BGRB 3UI3A 2E7WA 2WVEA 2YVSA 2J6TA 3Q89A 1T9XA 1CC8A 2DGVA 3BR8A 4X4SA 4CLWA 4WFNQ 4BHQA 1NZ8A 3W9IA 3I55S 5C2CA 1BZCA 2B07A 3UNGC 2IJFA 3IM9A 4Q45A 4ZVFA 4GC6A 1FRLA 2ESBA 1K47A 4ECYA 1WC6A 3VQTA 1U1PA 3DLLQ 3V0HA 3IBCB 5K24A 3DRPA 2EWHA 2YWKA 3CJSA 3SI8A 3ZM6A 3DC2A 2OSRA 4QIWD 1OSDA 4L73A 3NCQA 1TKZB 1TR0A 4A8XA 1M1KT 2DR5A 4ZVHA 1RLCL 1S6PA 1XTZA 2NR0A 2K7KA 3HVTB 1RT4A 1DURA 4ICLB 3T5KA 4B3OB 2XBPA 2HW3A 5A5EA 1R7IA 2MLZA 3W66A 5CD4H 3AH6A 2AGQA 1NK9A 2OO4A 3C66A 3IFEA 1RT7B 5IT4A 3K5OA 2VEXA 5BZXA 1JKHB 1RAOA 2I75A 3RAMA 2RJZA 2GJFA 3U1MA 4NWFA 4QU6A 2B7BB 3IA0A 1TKXB 5D0GA 3T5LA 3CJQA 3MPYA 4TVAB 3AODA 3QT7A 2QLJB 4YEAA 2EPIA 4WK1A 1JJHA 1U0HA 2ZE2B 5DZ6A 5MLCV 5L1JA 1U45A 2XYHB 3ITHA 1B64A 1H3DA 2CJAA 2OMLA 2YNHA 4Q2LA 1YVFA 4DV1J 2V8PA 4K7QA 4FXDA 2BJEA 4FPIA 4CM0A 3CDBA 3BS9A 3IRXB 5IBMA 1S4FA 2NT2A 4LRAA 2EG1A 2RUGA 4P74A 4XDDA 1KS2A 1TTHB 4ICLA 1B7FA 2XMAA 5H9FJ 1VQPS 1RTHB 2HNZB 4UOFA 5IC6B 4ZN1A 1C87A 1HFEL 1F9FA 2PGCA 5CH7B 3FRZA 1HBOB 3GYNA 4H4OB 3CJRA 5G0RA 3BPSP 3TX0A 1Q6TA 2OD6A 3LWLA 2HHSA 2JDJA 3DRPB 3BYPA 4YQWA 4FPRA 3HKZD 3M6VA 2XY5A 3J7ZT 4FKXA 2HAIA 2CQGA 1VC5A 1K44A 4DUYJ 4ECXA 4JMJA 3ZZZA 4PABA 1P6TA 2ZBQA 2OHDA 4K4XA 3SV3A 2Q66A 2NSCA 2DH9A 4WFZA 2QA2A 2BKPA 4OLOA 5IQ6A 4ZMMA 4WKRA 1OHDA 2NZCA 1JIHA 3C14A 1Q82T 2WB4A 3CULA 5ETVA 4ID8A 4MFBA 3G6XA 2JWNA 3FVYA 4ZVTB 1FPZA 4B3MJ 2VD3A 2DCUB 5KA1A 4WE1A 4C9DA 1W26A 1SUQA 4CO3A 3EZUA 1NWEA 2M7SA 4KHMA 1F3FA 1HNXF 2AZRA 1Y5NB 1NPKA 5E3RA 1S1WA 1RB0A 2B51A 2JOQA 3I87A 3K57A 5J2MA 1FKOA 2BRLA 4NNDA 2PMHA 4V1Ak 5IBSA 4DSFA 4USMA 2V9WA 3R8YA 1FDDA 4AFFA 1F2GA 3CMAS 5HK4A 2ZBRA 3IBFB 1J27A 1QSYA 1VR6A 2F8EX 3H2LA 1KEKA 3MEGB 1D9DA 1IVZA 1V6HA 1H0HB 3GXGA 2AJFE 2UUAF 1VHIA 3P45B 3RW7A 4GRYA 2W7PA 1RCOB 1UTAA 2F8MA 2HFNA 3G8TA 3CCJS 2PD1A 4A47A 4RW8B 3J7AN 1LQ9A 3EU0A 4NRUA 4F0MA 1YHQS 3CC7S 2P9CA 3PYDA 3J7YI 4LR7A 2VIHA 1SH2A 2ZOMA 1T7PA 1U02A 3D0HE 4RW7A 3KXDA 5RUBA 2LXIA 1VQ8S 5IT9U 4OJGA 1IBLJ 3O4SA 3JSYA 2WCXA 2HFSA 5LSLA 4MH8A 1Q78A 2CNEA 1SJ1A 1NSKL 2XG8A 4M5DB 2LKZA 4TYAA 4LF4J 1QY7A 1BZJA 3HVTA 2IMOA 2GQ2A 3FSIA 1ZBTA 2W1BA 3KJFB 3IG1B 3KG0A 1KAVA 1KAKA 2RDDA 5U47A 3QIPA 2R8JA 3JYTB 4B3TJ 3QCMA 5EHRA 4USWA 4QIGA 3BQ0A 1MMNA 3B4MA 5KFAA 1M5KC 2AW0A 2L9WA 1PILA 2BIJA 1AB8A 2HVEA 2B43A 2GJIA 3DGVA 4F3MA 4OMFG 3PYZA 2AJ0A 1U2FA 3AHPA 2X1AA 2VG5A 1NCLA 3K5LA 3RRHA 3Q8SB 2GNKA 1RP5A 4HHJA 2X1GA 3V0DA 3FNNA 4ZIYA 2LXUA 1IR1A 1H6KX 3MEDB 1WELA 1EENA 2IBOA 3GLJA 4DQPA 2OEMA 3I96A 2FVSA 3K58A 1U26A 5E3QA 5KACA 2W8LA 1I94J 2MY8A 4TLQA 1TK5A 4Y34A 4U7CA 1C83A 4Y65A 1YJ9S 3VAKA 4OHIA 5K25A 2QSWA 2EI5A 1IJFB 3C15B 2OTJS 1WC0A 2OEKA 2XMJA 1JLNA 4ZVPB 2GHVC 2PDAA 3AJDA 1PCAA 2CKWA 3R5GA 1OO0B 3GJQB 2MKKA 3LWMA 2YH1A 4JI5F 3DOKB 1Y4ZB 1S57A 2CJXB 3TOQA 5KA9A 3CCMS 2JLEA 4YHHJ 3VZIA 4NLXA 4ZN5A 1UFLA 3KUHA 3MUTP 3DLJA 4IG3B 5LMUJ 1U49A 1C2PA 1FF2A 1WEZA 4EO8A 4UT4A 1NZ7A 4QBEA 3RO1A 1M3GA 3UAGA 4CLYA 4N76A 3A5KA 1HNZJ 1VQSA 3NCPA 1HD1A 4ICZA 1M5PC 1YTSA 4QBUA 4OHHA 3FDSA 2G59A 5ETMA 5CCLA 4ZCLA 1TMMA 2DNQA 2QLWA 1YRUA 4UOGA 4GKJF 1G1GA 3DHWC 1YQHA 1WHWA 1LNQA 4NLDA 3VALA 2OAUA 4RKUC 2ZKUA 4FF3A 1SVDA 5KOWA 3C16A 4C8LA 1NO6A 5GTJA 2JVOA 5L39A 3BSOA 2V69A 4I7FB 5AE2A 1XMQF 4X66J 3HJFA 9ATCB 4PXCA 2FVPA 2XULA 2ZKTA 5GVQA 2CNNB 5HMXA 3O8WA 2R7WA 1OEOX 3V6DB 3OL9A 2BYCA 1S1UA 2KKHA 4R8UB 3GR0A 3ENVA 5KFUA 1JLFB 2Q1LA 1S0NA 1B99A 4IR1A 2CQDA 2W9BB 4X64J 1EB0A 2ZH5A 2F71A 3OR1A 1IQZA 1O5JA 4I2QA 1PTUA 4F4AA 3ETMA 1SJ4P 3QO9B 4EBCA 1WC5A 5K5MA 1RT6A 3VCDA 3N5FA 4MBBA 4OQJA 1S9GA 1RADB 2G2YA 4NMLA 5GADU 1H7XA 5KG1A 2LQ8A 3ILJA 4F4ZA 2DGTA 1NB7A 2DO4A 1LV5A 4Q8FA 4Q43A 2CJQA 2JEIA 1DHMA 1VJWA 2JH3A 1S1VB 2N7YA 4JOUA 4KKOA 4KSEB 4N7TA 1H2TZ 3D4JA 2I2YA 3OFHA 3PM9A 1FK9B 2QO3A 5LMNJ 2F9DA 3IP0A 4HR2A 2OUGA 4NLOA 4J37A 1FXDA 2W8KA 5C7PA 1GTHA 2W9AA 2CZVC 4ES2A 3KWMA 1HMVB 3IC1A 2J9DE 1NDLA 4DPWA 3TI0A 1KTVA 4WFXA 3R27A 2E5LJ 4IQXA 4EBDA 5BYRA 3C19A 2W9CA 2VBXA 2H5JB 1R8PA 1RA7A 3LGMA 3J7Z5 1IKYA 3KK3B 4DR2F 4CO0A 3B7OA 3ZM1A 1X5PA 3QGGA 3S01A 3QIDA 3QCHA 3TARA 4KV8A 3M1VB 1RI7A 3OJSA 5AJ3J 1GT8A 3SQGA 4JUZA 2MZRA 1S10A 4R8UA 2F65A 5K9VA 2V4RA 2HBQB 2RVJA 2DPJA 1FDAA 2PN6A 4DWIA 9RUBA 2VEYA 4CVKA 2NUHA 3N4WA 3PW2A 4X4VA 3T6JA 1MKPA 2CJYB 3BN4A 1X24A 3V6HA 3M4UA 1F9HA 4ER8A 4NX8A 5HDEA 3JXOA 4RNFA 3M2VB 1TL1A 3QSYB 4KFBB 2FC8A 3UFCX 2KDOA 5DQHA 2ZH1A 2VASA 2QBRA 2XWYA 5GAHI 1FJGJ 4OZ0A 1FERA 2Z57B 3S1TA 3RZ2A 3HVWA 4YR8B 1N5YA 1RWVB 2AJ4A 2Y96A 1XBOA 4NLTA 3OPKA 5KA0A 2BKNA 4HEA9 4Z2XA 4K2XA 1Y11A 2CADA 3BKUA 2GMHA 1F60B 2LP4A 1VJQA 2QA1A 4LT6A 1YTYA 2CMBA 4DPUA 3HCXA 4DR2J 3V2UC 3QT8A 2LQ5A 4TQSA 2K3KA 3DM2A 1TKZA 3RB0A 4ERDA 4WXWA 3M9NB 3ILIA 3KLIA 1KBRA 1CJVB 1WEYA 5L8RC 3S6EA 4P52A 2FJBB 2VHGA 2ILYA 3KK2A 1TVRA 2DIUA 1YZ7A 4O3OA 5KG4A 3A12A 5ITHA 1NJIT 1FHTA 3DOLB 3ETOA 4Q8EA 1V3SA 4QOTA 4QU7A 1LFWA 4S0MA 2AT1B 3UD3P 1S12A 5IOLA 4XAKA 4BC7A 2LA4A 1DJ0A 2BM0A 4G65A 4C3MA 3HSGA 3UN3A 3THTA 4ZPTR 2WSCC 1B7YB 3V4IB 2WOMB 4DR4F 3IN5A 2CVEA 2HNYB 2IHR1 2V63A 3BGOP 3OXFA 5C42B 2IDEA 4MYUA 2FZGB 4O44A 1S6UA 3N0AA 3UD4P 2I6PA 4DSIA 4NYOA 2R7VA 3WIVA 1G1FA 4DR3F 2HHWA 2OPQA 4LSNB 1YBAA 4FN5A 4CO5A 1XN9A 2MKCA 1C1BA 1TVRB 4OI2A 2VODA 2K7JA 2YH0A 4MK8A 4K4VA 2H03A 3OHBA 3C6UB 2C7SA 3C8YA 1RHMB 2GGPB 2NXEA 4DOZA 1S6OA 5G0RB 1UA0A 4TVVA 3GB0A 3GZ7A 4JYAF 3DOKA 3UCZP 1G6BA 3VV2B 4DI6A 4Y3CA 4M5HA 3ZZ0A 1J5OB 4LFCJ 4ETXA 2FJWA 2BJ8A 3PYEA 4JI6F 2YKMA 2R8HA 2W9BA 3F9AA 3PX6A 2DIVA 3MMBA 1CBKA 3GJTB 4FXVA 4NYZA 3H98A 3GILA 3FK4A 2DGSA 4WOHA 3CJKB 1VQYA 5I3PA 4O3NA 1HW8A 3MF5A 4F04B 2ZHBA 4A8KA 4KGXB 4USJC 4CLTA 1DZ5A 4OHEA 3M8ZA 4KB7A 4N77A 5EDWA 4YHHF 4ED8A 1H2VZ 5F8JA 2MZQA 4OHLA 1M5OC 5H9EK 4J51A 3HT3A 2BVZA 3MR2A 5EWGA 2AM2A 3D5MA 5D15A 4XPCA 2GC8A 2OGUA 4DGXA 2PI7A 4DL5A 4FYDA 4HT7A 2XTJP 4IG3A 3F44A 2WZ1A 4U8VA 3Q22A 2XYGB 1E6YB 2MTLA 3GU0A 2FUG9 5KOXA 4JI5J 1RTZA 4DR1J 1C0TB 4CYUA 3Q8YA 1NPRA 4DSEA 3TUPA 4C8NA 3ZZRA 1Q79A 5ADZA 4YR0A 1YRTA 2B3OA 1OEUA 4H34A 4QW8A 1WNEA 4DFJA 5LJ5Y 2I4GA 3RG6A 4A8WA 4HI2A 2IAJA 1RYRA 4WE1B 5K8MA 2DGWA 4M5IA 3DI6A 4CRJA 4F4YA 5J8RA 4OHDA 4HH1A 4B3RF 3PNIA 4G6VB 3CDAA 3TUZC 4NI2B 4IQMA 5HJXA 1PYNA 3NNAA 1PA9A 3PO5A 3EGWB 4FF1A 5ETOA 3CGIA 3J7YU 1O6XA 2FVCA 2H4YB 2PIIA 1FK9A 3MMBB 2XHCA 1M5HA 2HIQA 3ENQA 4MK9A 5KFYA 2C28A 3NMRA 4QAPA 2O66A 4O0IA 1VRUA 1YK9A 3N79A 1APSA 1MLAA 3K8VA 4ZIVA 2V68A 2WVFA 4NXMF 2RAQA 4DL2A 1NNYA 1QE1A 1FKPB 1NDCA 4DR6J 2CQIA 3CDEA 4TKTA 2IVMA 1OY8A 2A1BA 5FLXU 4FYYB 3CO0P 1KR4A 3OL8A 2HLTA 1IKXA 2QYGA 5DGAA 1RT6B 4JV5J 4RLEA 4AXJA 4EBEA 2AIRB 2LQJA 2D3ZA 4IO1A 4PG7A 2LVWA 1AUDA 3BLUA 2E1AA 4K59A 2HFOA 2DO0A 2YWGA 3IBWA 4ANDA 1MWZA 1SBRA 3CC4S 1ACMB 5HANA 4CQ1A 2AM1A 2G0JA 2NYIA 3KUEA 3M05A 3PACA 5AT1B 4E98A 1R0AB 4KRWA 3ILLA 2DTJA 2AU0A 3QJJA 1EHWA 2OH2A 3M8QA 4HRFA 2C3YA 2QJ3A 4DJBA 3H2VE 2DNLA 4ETZA 2DHSA 2AYGA 1RKJA 1J4XA 1VQ5S 1XR7A 1RGVA 4ZPBA 2HVDA 2XGPA 4PQUB 2Z56B 4DR7F 2B6AA 4G1QA 2DEJA 3MCSA 1JQGA 4A8OA 3NBPA 2B56A 4C11B 1RHJB 1K0TA 4I2PA 3P4UB 2F6VA 3PV8A 1NKEA 4C0OC 1M5SA 3ZC4A 2H9ZA 3CJ5A 3ZNJ1 3IRWP 3LPYA 5DQIA 2ATCB 3SCLE 1L3UA 3AQPA 4JYAJ 2HNQA 5IXUA 1U1LA 4KYZA 1W25A 4J90A 3GIKA 1YJWS 3DLHA 4C3KA 3MM6A 1FT8A 1X4BA 3NS6A 4LRBA 4KGVB 4DUTA 3A3NB 4XIUA 2PA3A 4BDPA 1OJ4A 3DDIA 3LAKA 1ZZNA 2HK3A 1SKRA 1JLCB 4YY3J 4X4QA 2BR0A 1Q8KA 2RH3A 1FJGF 1QLNA 4EYIB 1C1CA 3MMCA 3OFGA 3QJLA 4GVBA 4KO0B 4L3KA 4LVOP 4J9SA 5K20B 4WKYA 2CPEA 2J7KA 2BDPA 4UOHA 4K4YA 3W2VB 4ZVQB 3OVAA 2KVIA 1DTQA 3CCZA 1S72S 2AZ3A 1OMSA 1X8DA 1EX8A 1Q1KA 4I2PB 2B0GA 4YDXA 3DKDA 2I5JB 4CLKA 5JUMA 4YB6A 5KA7A 5KFDA 1IQTA 3BM7A 3M30B 2CQ0A 3D3BJ 4USTA 3KLGA 2ZH2A 3KNAA 1G7CB 4DMZA 1UWBA 1AYEA 1N5QA 1RU2A 3FCWA 3HFVA 5D0EA 2QLFB 1C4CA 2FYXA 3I32A 4ILRA 3SSRA 4DR1F 5M2PA 4ZLPA 2R7UA 3TW0A 4FF2A 5JMNA 2HQFA 3O3LA 3QGHA 4LF6F 4MJKA 2AX1A 1FNOA 2GJ2A 2GHWA 2W01A 4OYPA 2R9LA 2RQCA 4QW9A 3KUGA 4M1KA 1WI8A 4P7VA 3UQSA 1RT2B 3W1YC 4A8MP 2N82B 3R2CJ 3FC9A 1HQEB 4GFUA 4DL6A 3JYTA 4A8YA 3HPOA 1HBOA 3LPEA 4H4OA 2FB0A 1S1XA 4PPDA 3UW1A 4NCBA 2UXDF 4F26A 2Q3PA 4RJVA 4Q0BA 3CW2C 5CYQA 4W98A 4X65F 3KDOA 1J5EJ 3S3HA 3HHLB 4FYWB 2E7VA 1QUPA 1XJWB 4IH5A 1NHVA 2N7CA 4DV4J 1HBUA 2DBBA 2IM3A 4PYDA 2DHXA 3UE2A 2RU3A 1PO6A 4DQQA 2FY1A 2XNRA 3V4IA 4ED5A 1S5ZA 2DXDA 5DDPC 1AFJA 1G4US 2Q6BA 4EZ6A 1WG5A 2IRUA 2VFUA 2YQ1A 4NLGA 1FWPA 1MWQA 1X5OA 2KJWA 4GVLA 5HI7A 3HVRA 8AT1B 2AD9A 2WW4A 3HDSA 2VC0A 4GO5X 4DS5A 1IKWB 4KHRA 2FLPA 4Y14A 2ZZTA 2AWZA 3FRYA 3T9NA 1JXEA 1VRTB 4KTQA 2HRUA 4QAHA 3PKYA 2IM1A 1QVGR 3NAIA 1N32F 5KFWA 3CD7A 1VOMA 3BH7B 1R43A 1CSJA 2EW9A 1F3VA 3PYGA 1ZETA 1C85A 3DLKA 1VIOA 3T1AA 2EC0A 3L4BC 2DRDA 2R42A 4USVA 2PEBA 3FQLA 4U8YA 2BACA 3VQSA 1JLQA 5BXIA 5B0CA 1M5VC 4OHZA 3V4MA 2WTZA 1REGX 2JLFA 3DLEA 1V3AA 2OLWA 3HT0A 2VOSA 1TQLA 3I82A 4A8FA 4JI2J 3E51A 1SQGA 4DEZA 4GKJJ 4PG5A 1RAGB 3SQOP 5KFEA 4DV6F 4IRDA 3EXYA 1U6ZA 2CQ1A 4XTTA 3A13A 5K8NA 4DLGA 2OMOA 4C11A 5DDRC 1VHRA 5CD4A 4GE6A 5T41A 4CVMA 2KYZA 1E0DA 2VDHA 2CUYA 4OYAA 4F2RA 1TKXA 1FFWB 2MZTA 5GAHU 1XERA 3I56S 1U4BA 2H1YA 1SV5A 5DG8A 5BX1A 4I6WA 1U2RA 2QFIA 4O3PA 2YKNA 3TWZA 7FD1A 1VBXA 2Y9HA 4KKOB 2ZVIA 4DUZJ 3MTJA 1FNMA 5DDQC 1KKHA 5ETRA 2JHEA 2XHWA 4HKQA 4QPXA 2FDNA 2AEJA 3LP0B 2QLXA 1FRJA 3QFHA 2XC9A 5DDOC 2J0SD 2NREA 1OHCA 3QCGA 3ZNUA 5KFOA 1TL3B 1TV6A 5AE1A 4F3OA 3DMJA 1U2CA 3NAHA 1QE1B 4LUBA 3KOAA 2HMIB 1SC3B 1OPIA 2MKHA 2Y1JA 1VI7A 1NK7A 2YPZA 1W78A 3OD2A 3SSQA 3LGNA 2VTEA 1IKYB 4OJ1A 3TUIC 1VQNS 2CFVA 3HJVA 4OHVA 2IA0A 4FZVA 2CDRB 2JEGA 2NXUA 3UCUP 2F4VF 1U25A 1YFOA 3MFHA 5GAEU 3PEHA 2R2UA 1JXVA 4IOAQ 4DV2J 5K22A 2B4UA 5IC4B 3TR5A 2RQKA 3J81j 3RTVA 1YJ7A 1IXKA 3ULHA 4A4JA 2R7XA 4PRFA 2JFHA 3TJ8A 1DTTA 4BBYA 4DPXA 2XPCA 4M5NA 3UPFA 3M8PA 2WBMA 2UUOA 5HLFB 2VPZB 1KP6A 2WONB 3ZZPA 2AP6A 3PX0A 5FJ4A 2B7CB 1PC4A 3SMEA 1RTIA 1RISA 3G82A 2HMIA 1BHNA 3QT6A 5GADI 2XY7A 2K06A 2DH7A 1TKTB 1CQNA 4A48A 4KGMA 4O4RA 5IV4A 4ZA1A 2FQQB 5F8MA 1L3TA 2VBZA 1IBKJ 4YR2A 4C8KA 5KFXA 4DN0A 1KN6A 1XIQA 1S1TA 5AXNA 2UUBJ 4B9LA 1Q7LB 4RDDA 4W90B 1VDHA 4OYXA 3VAFA 2E9ZA 4N8NA 3OW2R 1FD8A 1YIJS 1HHTP 2IY5B 3OTEA 2RF2A 1UW4A 2DY1A 4IRCA 1JF7A 4O3RA 3QCDA 3I4PA 4DPYA 5B08A 5BJRA 1MG7A 3T1HJ 2ZWPA 4Y6IA 5CXTA 3WC2A 2IYIA 2ZM6J 3Q24A 1HYSB 1NJYA 1I1GA 3OQ2A 5AXMA 1LW2A 4ZLNA 2R7TA 5AXKA 4UAGA 1FRMA 3I9V9 2BJDA 2W24A 5CAAA 1MMDA 5J2NB 3HM9A 2KXFA 4H4KC 1VISA 1KQSR 4IG0B 1GWZA 1FI4A 1I57A 2V0NA 2AEFA 3MAHA 2Y0BB 3MR7A 3QT5A 4RNMA 1N32J 3AWEA 2Y1IA 3QCCA 3R1LA 8RUCA 4CLUA 2ZD1A 2HKEA 1NM2A 4DFPA 2DRBA 4FF4A 2VG7B 2RQ4A 1HARA 1AROP 2D74B 1S48A 4UZCA 3KLEA 4C97A 3TAQA 2GCBA 2AZ1A 2JL9A 3GIMA 1CULB 1JLCA 3MDFA 3Q86A 4NLPA 5GAGI 2FJMA 3SZ2A 4RBVA 2O5DA 1RHKB 2GX8A 2XQCA 5GAGU 4DV3J 2QEXS 4LVNP 1T9VA 4N5SA 3UN2A 4JV0A 4LF9J 3QO9A 1FO1A 3MGJA 2IVYA 1LK7A 5D0RA 3I36A 3C46A 4Z37A 4B3RJ 1RHUB 3TQEA 2RDJA 2M5YA 2ZOFA 2R2RA 3CXCR 3E01B 5E2QA 2NLKA 3U1NA 1JLBA 1N0VC 2HK2A 4PWWA 3R5CA 2GIFA 3NWRA 2YNFA 3D2WA 4OX6A 3M2UA 2DGOA 5D3GA 3PY8A 2NXCA 4ZCMA 1QTNB 2E44A 1RA6A 4PVGA 2QBQA 1BQMB 2OPSB 4U95A 4CDIA 1T49A 3O6QA 1R0BG 2L08A 3UDVA 3AOAA 2ZZMA 1NL9A 4GS0A 1T3OA 3U7JA 1SJFA 3A5JA 2Z2MA 1FKAF 3JSBA 3TJ9A 2OSQA 3R3TA 4Y0FA 3KLHA 2HAFA 4C98A 3ZFVA 2E7XA 2M52A 4ECRA 1KFSA 1NDPA 4RUCA 3BM8A 2BZ2A 2PBNA 1SJQA 3QYYA 5CYMB 1UEUA 4C8MA 3JTPA 2WB1D 5M2RA 2HFZA 3PRBA 3BGUA 2J76E 1SCJB 3AJ2A 4ZHRA 1UAWA 4J9KA 1XXPA 1LXNA 3H25A 1X5TA 1ZZWA 2CNGA 3W64A 1SQFA 2FLLA 1FKOB 1GXLA 2MLYA 4I67A 1RDRA 4Z7YA 5J2MB 3CJ4A 3W2WA 2HHHF 1X0FA 3NKYA 4UQGA 4O4GA 2HBZB 1CC7A 1U0SA 4JI6J 4WU2A 2NCKL 2W2OP 4KIAA 4Y2MA 1MN7A 1S76D 2Y67A 2EXUA 4RI4A 1KSPA 5EWFA 2VOOA 3AJ1A 3N9UC 5GAEI 3QLHA 5L46A 2CQPA 2ASLA 3DU5A 2CMAA 1GQEA 2HRTA 3LGHA 1TUWA 2MYFA 1QJHA 3CIZA 2CZ4A 2FD2A 3PHTA 2YBVA 3AY0A 3ISZA 3QATA 4NLUA 4RBTA 3N2AA 4KI9A 3I9ZA 1RXOB 3LUYA 2R8KA 4RW8A 1UETA 1OESA 4HYKA 4ELVA 2A6OA 4NXNJ 2UUBF 1W2IA 2BQ3A 3SQGB 2GV1A 3KHRA 3W9JA 1NKBA 4HACB 3FJ2A 4WP9A 3KLFA 3NGDA 3JSRA 1M90T 1CPZA 3A1YG 1TAUA 4DV6J 4CLSA 3EDQB 1RAJA 2AHOB 1N4LA 2HHXA 3FZBA 4F7VA 2J5AA 3KMSA 3MXHP 5A2QY 5A8KA 1X60A 4B3SJ 5F8LA 3EGNA 2WJPA 4GWFA 2XLIA 5DZ7A 4CM2A 5D6GA 1E6VB 3PW7A 3HFKA 2V4QA 3FBBA 4HT5A 2ZH6A 3PO4A 2CNLB 5CYMA 1IJEB 1IKWA 1RTIB 1ZS6A 2RNEA 3G82B 2F40A 2M3DA 2YNGB 3NWGA 4BCAA 1EEOA 3P3DA 3R9LA 1XMOJ 2CM2A 1XNQF 3HULA 1RZMA 4LF2A 2YWWA 1RWWB 1X4HA 2BXJA 3TNVA 4RW4A 4TU8A 5KT7A 1U48A 7FDRA 1N33F 3OMHA 5IS2A 4LF1A 3GCWP 4IH7A 4J9QA 2M8DB 3QCEA 2VG5B 5B0DA 2FHKA 5D78A 2QE5A 2JFDA 1S6QA 2PA5A 3NRSA 1YX2A 1T02A 4DFKA 1AA1B 5I3UA 4MKYA 1LWCB 1HQ2A 5IFMA 3MOZA 2XMVA 3HHLC 4FVCA 2KXHA 1U09A 3OTCA 1CJTA 2Y2FA 2FJAB 3KNGA 1PTYA 1XR6A 4Y2CA 1VQMS 1CEZA 3PG9A 2HWIA 3QMQA 2HGLA 2UUCF 2QCTA 1HQEA 1JB0C 4GE2A 4J9NA 1VMBA 3C6UA 5HN0A 2VQFF 2IYGA 2YKQA 3Q8PB 3S3KA 4BUCA 4D3QA 1YLXA 2GW8A 2U2FA 3BF4A 3CO9A 5KTQA 2BE7D 4HLBA 2MGZA 1BUXA 2JSXA 3GE9A 4R0EA 3MECA 3POTA 3CIMA 5A8WA 2I6IA 4DXLA 3OTOF 1Q0NA 2MY7A 3TP2A 4EU0A 4C2MA 5IWAJ 2QCJA 2RQMA 4OJ3A 2MJUA 4TY8A 2B4VA 3FFIA 5D4LA 5GMKa 1DRZA 1S1UB 1VCTA 1M0SA 2YNHB 2YX1A 3FCVA 2V5HG 4DX6A 2KVQE 5HROB 4C8OA 4X2BA 2HB1A 3AT1B 2B9WA 2AYEA 4PWUA 1SPBP 1TL7A 2K1RB 4FYVB 4UZBA 2HYIB 3GWCA 1RT3B 1SJRA 4URGA 1SXLA 2P9GA 4K4WA 4AXIA 4PQUA 1I9SA 4OX7A 2E9RX 1RHQB 1A7GE 2VF3A 2MKIA 2XS2A 1WOOA 4ZPAA 5ETQA 4DSLA 4KJIA 1PAEX 5E5NA 1S59A 2DHHA 1WD6A 1DLOA 2C3PA 3BO4A 4QWCA 4X62F 3IR5B 5B0GA 3D68A 3VZHA 3UNYA 2SHPA 4RNHA 2C22A 1N6QA 2CNHA 1IN0A 5D4OA 4JI3F 1ZOTA 1G3OA 1OEVA 2JJ4D 1QAJA 1MSWD 2J6UA 2VOPA 1Q1MA 3PYFA 1FWKA 1HWLA 1Y5IB 1E6YA 2V8VA 2EKNA 2R7QA 2Z2ZA 4NYPA 1JXLA 2H5EA 2HNDA 5M43A 2A3KA 1TZ0A 4JI4F 2VA2A 4XDCA 3EE3A 3GJSB 2FZCB 1EKSA 3SCKE 2ZH9A 3DDKA 1TK0A 2OTLS 1WKKA 1H74A 3AWFA 4RZRA 4RW6A 4M5GA 3V0IA 3R7SB 5I4MA 2B8QA 6FDRA 4IKCA 3OTDA 1RSCA 3C14B 3JQMA 3QPIA 1KLNA 2V8DA 4QYRA 3KYLA 2EKYA 3H5XA 1LOUA 2CJ9A 1LARA 5MMZB 2XS7A 1U7LA 1U47A 2GAGC 3TZXA 1N36J 3EJMA 3HI9A 3IAS9 3HK2A 2RHQB 2HHHJ 2OFHX 4QWEA 4NI2A 2E1CA 4JNBA 2ZH3A 5F3TA 2W7OA 4B04A 2CPJA 2M88A 3OUYA 2BE2A 2RRBA 2BE9B 3BSCA 4OYBA 1Z1ZA 2PA8D 4NPOA 1HBUB 3IXQA 2YKMB 3BN7A 2HNPA 3VGUA 2B9YA 1ZM4A 2NS1B 2J0XA 1HQUA 2ACMA 3CTRA 1T03A 1RAEB 5A8KB 4M5LA 2E9TA 4D3GA 1T95A 3JB9k 5KFBA 2KM8C 3PRVA 4LRDA 1D3WA 1RT4B 2VFSA 1PSDA 3A4TA 4MK7A 5KFPA 1RKIA 2D69A 4D3HA 2QFJA 2AGOA 1O51A 5E3PA 4Z6BA 1FTRA 3MM7A 2GFFA 4ZVOB 1KOHA 3WX8A 3KK3A 2AGPA 4IOBA 4ZP8A 1RBAA 3KDNA 5HP1A 2ILZA 2UV8A 3DRSB 3UVJB 2UXDJ 3J7A1 3RZAA 1Y10A 3MM5A 1XNRJ 4X65J 5EX3A 4RW7B 4Y2IA 5T7LB 3RRKA 4RUHA 2L9NA 5F8IA 3J80Y 3UO0A 2LU2A 3FZ2A 1U0HB 3BBCA 4XK8C 1BZHA 1P8GA 1BWEA 1RT5A 4C3LA 2XSFA 4P2XA 3A8JA 1JLGA 4P72A 1RLDA 3U27A 2IRXA 1JLEA 1WF0A 3B78A 2MQPA 4GC7A 3RBEA 1UPPA 2C2RA 4KY3A 3HHNB 3NGTA 4NCGA 1U1RA 4JP8A 4DU8A 1RAHB 1WF2A 2EK1A 2NXNA 2HGMA 3OR2B 2R8IA 1PYTA 2YNGA 2DK2A 2LFVA 3PFEA 1RT7A 2IRYA 3BYRA 3ZO7A 2XCAA 5I3QA 4EI2A 3HMJG 3CCRS 3DXSX 4J9OA 4TU7A 1F5BA 3CDWA 2HHVA 1F5AA 2OPRB 4GKKJ 4C0HA 1FPRA 3QCJA 3G6YA 2KZMA 3NRBA 2IJRA 2L41A 3NNHA 1SC1B 2V2KA 3MECB 1UVLA 2KZZA 3G8QA 1I94F 3UDCA 2ZDPA 1M1GA 4BLGA 4L75A 1ZH5A 3WDOA 2W4CA 3H40A 4AL7A 4LFAJ 4EZ9A 4QWAA 3KLFB 4WZMA 3NP5A 3K5PA 3TVZA 1QVFR 5KAKA 5HQLA 4ZPVR 1VQLS 1Q6SA 3M8PB 1OY9A 3JSMB 3J81Y 5LMNF 1H72C 2G1HA 2Z2YB 4NCGB 3TZZA 1S7HA 1FE4A 4NXNF 3T41A 5KFTA 2ZM6F 2HS3A 3HFZB 3X3UA 3SXLA 2FLNA 1FA0A 1AAXA 2F46A 2I6JA 1KQKA 2Y1RI 4OHWA 1JNZB 1Q6NA 1R8BA 5F41A 1UL3A 1Y9OA 1T3NA 3LP2B 3GYXB 2PT0A 4DV0J 2VPYB 1S9EB 2UXCF 2I5JA 1S9FA 2MJNA 4QIFA 4HVZA 3BDPA 1PXHA 2ASYA 2W2PP 3HVAA 4RO0A 4RW4B 2BV5A 2VORA 1VHFA 3ZTQA 2Y0SD 4J5OA 3SDEA 2Q47A 4FVMA 1HBMA 3NGRA 2BABA 5A6WA 1NNDA 2PC6A 3BDEA 4DU7A 2YKPA 4QDIA 1CJKB 1U24A 1UJ5A 4OZ1A 1KQFB 2P9EA 1FWLA 1G1XA 1MNEA 1YGUA 1BQNA 1ZC0A 4C8YA 3MPWA 3TRGA 3LP1B 2UVRA 4IUFA 4ZIWA 2D41A 3CCSS 4J9PA 4DR6F 4LFBF 2B49A 2BJ9A 2H4VA 2IPOB 2YDUA 4JB8B 3CCTA 1TL4A 4QIVA 5L9NA 2OPQB 4LSNA 4MAKA 4ED0A 2FJNA 3QKQA 3PS5A 1IR2A 2BANA 2OPRA 1VLYA 2M2BA 3HHEA 4OL8A 2YWHA 2OPPB 4X4UA 4DCOB 1RTDA 1R6VA 3RBXA 2F6FA 5DS7A 5H9EJ 2DGUA 4NA1A 2VH7A 1YGYA 1IM6A 2YPYA 4UW2A 2XWXA 3RUBL 2JLGA 3K5MA 1TU0B 1SKWA 2F6YA 3KK1A 3K89A 3AQOA 3ZZYA 2GQQA 2JFKA 3QGIA 3WZ0A 4EUVA 1HNZF 3MEEA 4KPYA 1D9AA 2IFXA 3ET6A 4R0TA 1OSCA 2HZAA 5C5JA 3H5YA 1NJXA 2KT2A 3CJKA 3TYTA 3ZZTA 1N8RT 3FMBA 4OHXA 2NPIA 1HYSA 2F6TA 2AX0A 4LR8A 3C2PA 4KH1B 2Y68A 4IH6A 3JAMY 4RBUA 2QL7B 1Q4RA 1NRKA 2N3OA 5IWAF 2ASJA 4ZJQA 5JVGQ 3QQCD 3K8WA 4PCQA 4R25A 4URSA 2BOPA 1O0PA 3G9CA 3NMAA 1XNRF 2MGZB 4F4XA 3VVTA 4J9UE 3B82A 2M9KA 3SCJE 5HVFA 2U1AA 2R8GA 1S0VA 2IM0A 3L7PA 2XS5A 2OC3A 3CCWA 1JLFA 1PTTA 2ZDOA 2R7OA 3MMJA 2YNIB 2JC0A 3NG8A 4PAAA 1T03B 1Q7YT 2VFTA 4PKDB 2N3LA 3MAAA 3W8PA 2XYPB 1F6TA 1FD2A 1C0UA 1XWLA 1NB2A 1VK8A 1W7WA 2C1EB 2LA6A 4P73A 3GTYX 4WTYA 4KT0C 4LMZA 4HDHA 3EVWA 3TZWA 4DUZF 2UVUA 1RT3A 3OR2A 5HQ8A 1XK8A 4LSLA 4WK3A 1ZAWA 1YZ6A 3FEYB 4OZLA 5B0FA 3UD5A 5IM0B 5J1EB 4J9LA 4F8RA 2HVZA 1D09B 1KDNA 1NO8A 2ZN7A 3P8BB 1UVJA 1J2VA 2CQ2A 3A8KA 1RTJA 3S8SA 1S1VA 3O2IA 4TNOA 5D3GB 4B9TA 1GG4A 5T7LA 1ZYQA 4MIWA 2JVRA 4JI3J 4DS4A 2XGQA 2KN4A 4DHVA 1FRKA 2D3O1 4V19X 2GVDB 2NYHA 1N0UA 3BEGB 4JI0F 2UXBJ 1VQ9S 3QCFA 4USUA 3GONA 2CFXA 3MCMA 3QCZA 2Z58B 2G1DA 3LP0A 4ID5A 1TL3A 3KG1A 4USIA 1RWPB 3BJYA 3V6JA 3RW6A 4C13A 4JI1J 2H02A 2E5JA 2FHJA 4LF5F 1FESA 1BMQB 1PYOB 4DL0C 4P9SA 2KHDA 3NGUA 2JEFA 2QYCA 4FNHA 1S9EA 2LECA 1ROFA 2RSQA 4CI0B 4DV4F 4FXWA 4I7FA 3PDNA 4ZCKA 5HO4A 1DAXA 2PFFB 2MQNA 2UUAJ 3MM8A 4AT1B 5HMWA 4RKKA 1FTCA 4P7TA 5KA3A 3U96A 3MVNA 1WCHA 1MROA 1PIEA 1ULRA 3N28A 1HWKA 1WACA 1NDKA 3W5YA 1IBLF 4P2FA 3PIPQ 1VQ6S 2M4MA 3DLEB 2ERRA 2HC1A 1BY9A 2GCAA 4DL7A 3HSDA 2FJVA 2V8GA 1I51B 2EK6A 3DOMB 3BPDA 4RW6B 1VLOA 4DLEA 1TK8A 2QBSA 2ZVSA 3OTOJ 3FBEA 2UU9F 1G2EA 2MSSA 3QIPB 2SXLA 2BUNA 4DV0F 2DR7A 5HJYA 2I38A 2K8GA 1VK3A 4AUKA 1P27B 1UVKA 4WPAA 2VQFJ 2IA6A 3EUNA 4ZVGA 2Y66A 4OV6A 1RBLA 3RYLA 1NPPA 2KH9A 5A0YB 4FS1A 3ZTSA 1NHKL 4DX7A 2E1RA 4ES1A 3V81B 1WUUA 2KXNB 2DITA 2A10A 4MKBA 1G7GA 1WDDA 1R8CA 1RBOB 4LIRA 2R0BA 3PR4A 3F99A 3ZM3A 4O44B 3SMZA 5JVHQ 1X7VA 1SC6A 1NK4A 3M8SA 4L74A 5JXSA 3RBDA 3BGRA 3QSIA 1HKAA 2GZOA 3IWXA 4LQ9A 4KPCA 4YP3A 4LSZB 2QEPA 5E7OB 2K3IA 1X4EA 2DT9A 1FVQA 4GO7X 4RW9B 3OL7A 3IO1A 1SIWB 2E5HA 3L9ZA 4LR9A 4OI3A 3D1OA 3WX4A 4RU2A 1Y3JA 1LWFA 2AV5A 1WC1A 3JTNA 1D8ZA 3FMWA 1UZHA 2IC3B 2N4DA 2CWXA 4X62J 4WCEQ 3HHDA 4UY8T 2KFNA 3EAXA 4TY8B 3BSNA 5DLGA 3KTQA 1YJRA 1SJ3P 2QDPA 2ZNYA 3BH6B 4NASA 4RL1A 4CP5A 1NU4A 4DCPB 2E1MC 1ITPA 3GFZA 2H5IB 1U1KA 4U96A 4OLPA 1NSPA 1RT2A 3MMAA 4UQTA 5E41A 1BGXT 2MSTA 3DOMA 5AJ3F 1YPTA 1LKZA 1OPZA 3PJ9A 2N4CA 2OUDA 1HWUA 2F8HA 2MPUA 4ZLJA 1RAAB 3I4HX 3OJUA 3EWGA 4YN3B 2HZVA 3NBPB 4LQ3A 2LXFA 2RRNA 3CCES 3SCIE 4X4RA 4AL5A 1EQ0A 4MTPA 1K0VA 3CWEA 5SZTA 2YWEA 1TFYA 3B6BA 1WSVA 3M7VA 1DQ8A 1N34J 1JJ2R 3AD9C 1BQMA 2OPSA 1U1OA 5K23A 1YJVA 3GIRA 1NSAA 1EAYC 1VBKA 3FEXB 3FGVA 4OI4A 3Q0AA 3US5A 1AW0A 3LAMA 3GMGA 4WYLA 4AL6A 3DGPA 4LRCA 2HQDA 4H4MB 2OZ5A 2I0XA 2P6XA 4AZ1A 5HROA 2FH7A 1CS4A 4MKVA 1OQ3A 1XM2A 4ILLA 2UUTA 3JSMA 1UVMA 5E3AA 1HWIA 3L7UA 3VGVA 2MKJA 4EK2A 1S0MA 4LF7F 2V9KA 3CCQS 4F02A 1HNIB 1VBYA 2QT7A 3K2YA 4M63A 2L48A 4RPFA 1IKVB 4QCLA 3LOUA 5KABA 3X1LB 4U67Q 1RWKB 3AOCA 1SKUB 2VZ9A 1HI0P 3QCBA 4CWBA 3PZPA 1IBKF 2V94A 4F4WA 2NT7A 2FVRA 3DLKB 1Q8BA 1B0TA 3VAJA 4A8SA 2HZCA 2XMMA 4LF5J 3H5UA 4CIOA 1NMEB 3H0PA 2JFFA 1QZ0A 3BQ2A 1HL6A 2GJTA 2C3MA 2HXPA 4ED4A 3MEEB 3R1HA 5KG7A 1KHVA 2UVVA 1D5RA 2CNFA 3QLHB 4ED6A 2JRSA 5H9FK 5DETA 1LW2B 2PSZA 3CE8A 1O5ZA 3CJ0A 3Q2SC 5J2PB 3K59A 2VQEF 1RACB 3LTOA 3NS5A 4B02A 2MZ1A 2JJDA 5KA4A 1T05A 4M5MA 2C46A 2XZWA 2A0FB 2J8SA 3MCOA 3GSIA 4WFYA 5KFCA 2VKRA 1S79A 1IBMF 1GAOA 2ZOGA 4B17A 4ED7A 2C2KB 4WZQA 2ZBIA 1DY3A 2EFQA 2FY8A 1L3KA 3W2WB 4ZK7M 2Y8WA 5D8HB 1F0XA 2OOQA 2VEVA 1DQAA 3N0VA 2VPWB 4NLRA 2FGOA 1ZTTA 4DV3F 5DG7A 3AA8A 1RQ0A 2MDAA 3NEKA 1LEOA 4TLRA 2R2SA 1YWFA 1Q16B 2MBCA 1XBWA 2DR8A 2L3MA 2LEAA 3MPUB 1D1UA 2KL8A 1T9YA 3R97A 4KBIA 3M6WA 3WIUA 1AZSB 2GIRA 2W9CB 4MFBB 2PI4A 4DG1B 1E8CA 1FFGB 3HXMA 3HD1A 3G2XA 4ED3A 1F5CA 2BQRA 1NBEB 1X31C 1WOPA 5LMUF 1IBMJ 3EMUA 3IAM9 3I0SA 3CF5Q 2E5GA 3TO8A 1WRMA 3M8YA 3W8GA 2AMCB 1FFSB 5F8GA 3P5BP 5ETTA 1B70B 1I9TA 4QWBA 1YSJA 3O5TB 2HHPA 2QV6A 5EWEA 2ADBA 1RT1A 2V8HA 4OYIA 4X4NA 2OELA 2CDQA 5KG5A 1WTFA 3S3FA 2KHCA 2J9DA 1Q5YA 3ONQA 3WC0A 4RNNA 1UVNA 4ECVA 3EXCX 2RUSA 1KNZA 5KADA 2H4WB 1CJUA 4FYXB 4DV7F 3MMCB 1E6VA 3CJTA 2ZJPQ 3G71S 1GH8A 3Q23A 1IWAA 1EZZB 3OLBA 1RTHA 2HNZA 3IWLA 1LW0A 4DV1F 3D44A 4ENOA 5A5FA 4NZ6A 5HBMA 2CM8A 1YRXA 2GVZB 3C6TA 3EICA 2IC3A 2NXJA 3TEGA 1ZAVA 2YXLA 4WIQA 4OZ2A 3T9ZA 3EM1A 4OZ5A 1H98A 1V9OA 1Y00A 3SDEB 3CMES 4X4TA 4CLZA 5K8PA 4LFBJ 2CPXA 1T11A 3O5XA 3DGPB 1MU2B 2DHAA 2WAQD 1Q8IA 3DCAA 2VL1A 1PGZA 3MFIA 2Z30B 4OYMA 5KFFA 1YI2S 4R30A 1SC4B 1YTNA 4QWDA 1FGSA 2BRKA 4PUOB 3HKWA 1SH3A 4DFMA 4RWXA 4QR1A 5CYJA 2HIYA 3P49B 2BBEA 2J0QD 3PJXA 1JLBB 4JV5F 1DARA 1URNA 1FJ7A 3R5JB 4PG6A 3MD3A 5CYQB 2GO8A 1RHRB 4NLSA 4DCJB 3PFOA 3TJAA 4JV1A 2LQBA 2UV8G 4OX8A 4PZVA 3KHGA 4K4SA 2ZUAA 1U6BA 1FX4A 1U6FA 4J7CA 3WBZA 2I42A 2BQUA 1XEZA 1NLKL 4IRKA 1WG1A 4CTAA 2V6AA 2BEFA 1KC8T 4UF4A 3LALA 2GC6A 5KFRA 3BGFA 5I3UB 1WEXA 3KLHB 2YWFA 2WVCA 2HQCA 1QUVA 1RWUA 2MZJA 3Q8VA 5CQGA 3SYZA 3I5AA 4EEYA 2ATLA 1C88A 2F6ZA 5BZZA 4N47A 3DRYA 3QWPA 2AEMA 4UOCA 4U7UK 1TKDA 5J2PA 1K8AT 4F0HA 5EGYA 2OP5A 2EFNA 4PQAA 6FD1A 5JJBA 3F81A 4KFBA 5HAOA 3LP2A 1TELA 1Q95G 3DXBA 4NOHA 5FDLA 4E2FB 1IUJA 1NH8A 3CEDA 3OFFA 4PWDA 4ANEA 5KFNA 1GTEA 1RABB 3IWNC 3DRRA 3H59A 2RHSB 5F0UA 5DM6Q 1RTDB 3BO3A 2Y1OA 1FEEA 3P6YC 5KFMA 4OHYA 2VV5A 1N52B 4YB5A 1H2UX 4QPTA 5CHCB 4CNZA 1WKLA 2X3DA 1VC0A 2LLZA 4K2JA 2CQHA 4TU9A 2BGEA 2NV5A 2VA3A 3AAWB 2V34A 3BGLA 3MMAB 4ERCA 3DM2B 3LW5C 1FQ1A 5C25B 4AQYF 3KJVB 2HQGA 4CNYA 4NE9C 1NK6A 4MYTA 3ZZOA 3OBIA 2DNMA 2BZLA 4K4ZA 1KQGB 2LCWA 4YS2A 2DXPA 1S97A 2CQ3A 3ICLA 4H1OA 1DLOB 2RRAA 1RTJB 3HHKA 3I5CA 2HCMA 2FLOA 4CT8A 2CPZA 3I6PA 2CAJA 2APOA 1QTMA 3FQKA 3V0FA 4Y28C 8ATCB 1H7WA 3H8YA 3KLGB 2YKNB 3N6LA 2MMYA 4EMDA 2VB6A 5KT2A 3MOJB 4DUYF 4BWJA 2ADCA 3IM8A 1K73T 4X4OA 2NSBA 3M2RA 4XPEA 2E5LF 4UTGA 4B9SA 4LF8F 1FJCA 3ZV2A 1RCXB 1SH0A 2EBGA 2R4FA 1JWWA 2KO1A 1NXIA 1RUSA 3D28A 3MAAB 2HG4A 1G4CA 3C3LA 1UKUA 3IR6B 4M5JA 3M6UA 1HHQA 2HWHA 3EVMA 5CCMA 4OZ3A 4KGKA 1OQ6A 3LK7A 5D77A 1GQYA 1T48A 3S3EA 4DZ6A 1MWYA 2GVZA 3C6TB 3QAUA 4QJVA 1OY6A 5G4DA 2WW8A 4WP8A 4CLFA 3P5TL 3G6VA 4LF7J 3M1VA 1XNQJ 1ONZA 2W7AA 3ELHA 4PXEA 4QIEA 1RJJA 4MIBA 2RS2A 1ZCKA 1Z2LA 2RD5C 4R5PA 1CQMA 3TANA 4DQIA 3BKTA 4J9VA 5EUHA 4B9UA 4DR5J 2BGDA 4DN9A 1GXTA 2DGXA 3M8RA 4K4UA 5A8RB 2NZ4A 4DBQA 3PX4A 2H3EB 4JI8J 1DTTB 3D0IE 1FX2A 3RGQA 4NA3A 2DPIA 3HZEA 2W4PA 2EC2A 4IFYA 3ZM0A 1TUGB 2KJVA 1REVA 3MM9B 4NA2A 5L38A 3OHAA 1YJNS 2QGFB 5J1EA 3T5HA 2XJAA 4EGLA 3W62A 4K0KJ 3DYAB 2WK4A 2EFPA 3FUYA 5K14A 1D8YA 2I3UA 3AWGA 1WSRA 2VFRA 2DNOA 2ZWOA 3M2UB 1YDLA 3GV7B 1NK8A 3JQKA 1R31A 1YJUA 4WYWA 3LQVA 3UVJA 1I3OB 2YY3A 2CPHA 2DNYA 1ZAXA 3PIOQ 3ZL8A 3V81A 3A8IA 1HPZB 1K1SA 3NL0A 3D6TB 2CIMA 3AOBA 3O1LA 3KHLA 3TX8A 3CUNA 1VQ4S 2LYVA 4OIXA 3KLIB 2GCFA 5B0AA 2Z4PA 4B9VA 1N5TA 2DKOB 2Y8YA 1QXKA 1CJUB 4I56A 3IG1A 4G1PA 2BJ7A 4DR7J 4TQRA 1L8KA 1M1HA 2EFOA 3EDRB 3K7RA 3R2DJ 3OV7A 1YTWA 2J7UA 2ZH8A 3OLRA 1T05B 3T1HF 1RYSA 2CG4A 5ETKA 3P96A 3CCLS 5IQQA 4CH0S 1ZZFA 4TY9A 3EPIA 1KWMA 3QCKA 2HFUA 5THWA 3KJNB 5K8OA 2VG7A 2LU1A 4ZRTA 3QAEA 4LF6J 2CA9A 3M4XA 1X4AA 4WWSA 4CLLA 1UWBB 1I6JA 1ZA2B 3VGTA 2RF6A 1PC5A 1JBWA 1FNXH 1XMBA 4NWGA 1RPMA 3KK1B 1X4GA 1RT5B 3BSAA 2K1RA 2AYMA 2PQ5A 1MU2A 2CNKB 2IJNA 2DNZA 3GV8B 3I31A 2WGPA 2ZMMA 1PBAA 4NLYA 3W61A 2EFVA 2AJ2A 4PUOA 4RH5A 3ZMQA 3KK2B 1T9UA 3DN9A 5LJ3Y 2KFYA 3HO1A 3SIPB 5BR8J 1Q6JA 4P2SA 1IKVA 2O3DA 1HNWF 1S1XB 2AJ1A 1WORA 2ZBPA 1T94A 2K2PA 4HTIA 4A8QA 1L8GA 1K1QA 2GGPA 1VC6A 4ECTA 1EIYB 4IOCQ 4CLPA 4NLWA 3VAGA 2IBKA 4UUWA 3DHXA 2UVWA 3GYGA 2GS8A 2DH8A 4PEOA 1RT1B 1TL5A 4L76A 3V6DA 4B9MA 3PW4A 3UR3C 3CPWR 5LSOA 2W2QP 3ET6B 3I0RA 4GRSA 4I69A 2BMBA 4EO6A 4LF9F 2XMUA 5KT5A 1ZCLA 3V5RA 1KLMA 1AXQA 1P9QC 4URQU 1SL2A 3IS9B 3T5JA 2CNIA 3DU6A 1IR0A 2HQIA 3R6GB 1MW7A 4X66F 1IBCB 1NEEA 1S49A 2XSJA 1VQKS 1QM9A 1TFWA 2KYXA 2RILA 3O44A 4LSLB 2O01C 1Y0HA 1GMWD 5D0HA 2G0CA 2HS0A 4IDKB 4F25A 1GMUA 1DTQB 2Q79A 2V2QA 1LWEB 1KVJA 2DVIA 3SV4A 1YN9A 3RAQA 1UEVA 3DRSA 2F4VJ 4JI1F 4QUMA 4WU3A 3NCRA 4JMKA 5KG2A 2PMWA 5IZHA 3Q8UA 2XMTA 3HLUA 3Q83A 2MQOA 4ECUA 4DQRA 3T1YJ 2GWOA 1RWMB 1HNWJ 1S1TB 2KI2A 5LOQA 2RIJA 2QZ8A 2HS4A 5CA5A 3ZM2A 1WI6A 3U02A 1PA1A 4ID5B 1G1HA 1VRQC 2CPFA 1B0VA 2G2ZA 4WXOA 4DX8H 2Q6CA 1EKRA 1HQUB 3QBCA 1CJTB 1LFPA 1OWXA 2AKWB 4I2QB 4PPZA 5CABA 4ZVEA 5KT6A 4ZPCA 4N41A 2UAGA 2WSEC 2HVHA 5K9WA 2QSFA 2ZNZA 3F0NA 4ZCIA 1UJ4A 2GO9A 3MPDA 4PXDA 4NRTA 2AF6A 1VGYA 4PWDB 3OT9A
chains in the Genus database with same CATH topology
1Z2ZA 3QKPA 2F3JA 3HZGA 3L3CA 2ZJRQ 3O4TA 2FJDB 3RR8A 1VS3A 3M30A 3D54A 4YB7A 1R6YA 2HY3A 2CRLA 2VPXB 1G7FA 3D1QA 3T1YF 3OVBA 1LQFA 1B0PA 1A6LA 5F3ZA 2D1CA 2YKOA 2GHPA 4IFVB 1TV6B 5CZXA 4NL5A 2ZUGA 4ZS6A 1VFJA 2VBYA 3I5BA 3NGKA 3E2EA 3QJPA 4E0DA 3OL6A 1CG2A 2CM7A 3NLCA 1X5SA 4ZP6A 2M8HA 4E8UA 4ITSA 1YWXA 4OZNA 5E33A 1N6QB 1S76D 4OI1A 1S1WB 4G3IA 2UUWA 2VONA 2GP0A 2B4OA 3KLEB 5LXQB 2LQ9A 2ABYA 3M9OB 1KHWA 1JJ4A 4QYZJ 5EHHA 2DRAA 2BE2B 2E66A 3ITHB 1S6QB 3H4BA 3L7OA 5HL7Q 4H4KA 3BLTA 1YG0A 1FRXA 4BPCA 2MHEA 3GR1A 1HR0F 2B6AB 4G1QB 3M2VA 5J2QA 1CLFA 3EYZA 1HA1A 3OSPA 3IGNA 5B0EA 2WSFC 2EG2A 2M0GB 3CDUA 2QBPA 4Y00A 2RMLA 5KFJA 4D3PA 1ZM2A 3FSYA 1WTBA 2GIQA 1KVIA 2A18A 4CH1A 1CVJA 2OPPA 2BV3A 2ZFHA 2ZITA 3IR7B 2G4BA 2CM3A 4Y2KA 5LXYA 1WHXA 2O67A 4LFCF 4Q5VA 4YAAA 3VAMA 2QMXA 4M94A 5KG0A 3MZIA 2POKA 4RWWA 3GQCA 2I1YA 2OFGX 1SL1A 2RU9A 3LP1A 1L3VA 2GA7A 4QBWA 4IKAA 1BQNB 4X64F 2OJ3A 2I4EA 1N5SA 4D3RA 4WF9Q 5L9XA 3CC2S 2XCPA 3D9CA 3DYAA 2MKSA 2QA4S 4UUXA 4IDKA 3FSXA 4EWTA 3QCLA 3I0SB 4OI6A 5K14B 5L1LA 3PRDA 2G13A 2RKIB 3F73A 4R0SA 3ISNC 1X0PA 2EBEA 2X3GA 5BYQA 2A2DA 3I0RB 3MD1A 4O4GB 4YUDA 1S0OA 3VAIA 3U1LA 2ZH7A 1W2BR 2PI5A 1S6PB 2VFVA 3CSKA 3IGVA 4LJMA 4OV1A 2MHNA 2XLJA 4CT9A 1VBZA 4WIIA 1ZTWA 5C25A 4YMEA 1WAXA 4L6V3 2BA9A 3R5AA 1C1BB 1J5EF 1N36F 5M2UA 5HMYA 2ALZA 1LWFB 5LXRA 1FCAA 4I64A 3S7RA 5HMZA 5H1SV 2P4DA 2I6MA 3GG0A 5E3CA 3VTIA 2HQ3A 3MUMP 2D3OR 3OUYB 4H4MA 3FCHA 4F2SA 1ECVA 1QAYA 4C7QA 3MWBA 4O3SA 3THPA 1SL0A 1X4FA 2I9SA 4F4KA 4KHPF 1TL1B 2B5JB 1XMOF 4PXBA 4L72B 2KT3A 4KQZA 5K9FA 4DF4A 4WFAQ 3V0EA 4USHA 1HI1A 1S9GB 4AE5A 5BYSA 5KT4A 2G6ZA 1N88A 2NQPA 2V4JA 4KYRA 2F70A 2KM8B 1HNVB 4XO0A 1JLAA 1X4CA 5IT9Y 4NX9A 3GFYA 4IO9Q 2J6SA 3RB3A 2CMCA 2GQCA 5DRKA 2UXBF 3V0GA 4M5DA 1FXLA 5AWXA 5KACA 1V3ZA 2IMGA 2FVQA 2CVIA 1FDNA 3TA0A 3M32A 2UP1A 3TAPA 3TVYA 1MMLA 1S99A 1SIZA 2CPYA 3CM3A 4IG0A 4I0WA 1K9MT 2HGNA 5DJBA 2P6SA 2B3TB 4B9NA 4KYQA 2DNKA 3HHLA 2FGCA 1O8BA 1PTVA 5SUHA 3FFIB 3TAMB 2QRRA 3OSNA 2CJZA 4DL3A 1OIAA 1GFYA 5A8RA 1YITS 2I3RA 4RHGA 1JLAB 4M8LA 3CCVS 1NK5A 2C2EA 3BZQA 4ED1A 1ELOA 2CJBA 5BUGA 4ZKAA 2J16A 4OJHA 1FKPA 2Q05A 2NPFA 2CQCA 3MAQA 4TYBA 5LL6d 2RE1A 1VQ7S 2CJKA 2QA4G 1LWEA 1SUQB 3DLGB 4PG4A 3PXGa 3H20A 2CPDA 4F67A 1FE0A 1KFDA 5KFVA 2L9DA 2ZE2A 2RKIA 1Q8LA 2A8BA 2DCLA 1P1TA 2FHJD 1DFDA 1NWLA 1FXRA 3M2RB 2FJXA 2RDIA 1T4JA 2KG0A 3H4DA 3N5BA 4J9RA 2KRBA 3RB4A 2HHUA 1C0UB 3EZ5A 2CYYA 3H2XA 1ONYA 4YY3F 4YR3A 2KT5A 1ZPVA 4N56A 1XR5A 3QCIA 3MI7X 4NCAA 3LJ8A 2CPIA 4W92B 2AHSA 3EZZA 2JZ5A 3F56A 4FNIA 3FEZA 3GIJA 2PO4A 5FD1A 5HP1B 3GG1A 1BC6A 1WHYA 5I6VA 1P15A 1EP4A 3V0JA 2I1RA 3MM6B 1GNKA 5A6PA 1URRA