3V0DA

Crystal structure of ciona intestinalis voltage sensor-containing phosphatase (ci-vsp), residues 241-576(c363s)
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
325
structure length
324
Chain Sequence
NKRRYRKDGFDLDLTYVTDHVIAMSFPSSGRQSLFRNPIGEVSRFFKTKHPDKFRIYNLCSERGYDETKFDNHVYRVMIDDHNVPTLVDLLKFIDDAKVWMTSDPDHVIAIHSKGGKGRTGTLVSSWLLEDGKFDTAKEALEYFGSRRTDFEVGDVFQGVTASQIRYVGYFEKIKKNYGGQLPPMKKLKVTGVTITAIQGVGRGNGSDLSMQIVSERQEVLLCKFAEGYNCALQYDATDDCVTCEVKNCPVLAGDIKVRFMSTSKSLPRGYDNCPFYFWFNTSLVEGDHVTLKREEIDNPHKKKTWKIYRDNFTVKLTFSDAED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Voltage-sensor containing phosphatase
publication title A glutamate switch controls voltage-sensitive phosphatase function.
pubmed doi rcsb
source organism Ciona intestinalis
total genus 113
structure length 324
sequence length 325
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00782 DSPc Dual specificity phosphatase, catalytic domain
A PF10409 PTEN_C2 C2 domain of PTEN tumour-suppressor protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1110 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3v0dA02
3.90.190.10 Alpha Beta Alpha-Beta Complex Protein-Tyrosine Phosphatase; Chain A Protein tyrosine phosphatase superfamily 3v0dA01
1LYVA 2QDCA 4GRZA 4RHGA 1RPMA 4R0SA 3V0HA 1NZ7A 2A3KA 2M3VA 2QDMA 3ZMQA 1LQFA 2FJMA 2QBRA 2HC2A 3AWEA 2F46A 3M4UA 3A5JA 5KA8A 2E0TA 3O3LA 1G1GA 4WOHA 4ERCA 2CNHA 3EAXA 2VEXA 2H4KA 4Z6BA 3QCGA 1G1HA 2CMBA 1G4WR 1NO6A 3O4UA 2GWOA 5KA3A 1L8KA 3ZM1A 2SHPA 2PQ5A 4GRYA 2F6WA 2J73A 1C88A 1P15A 1G7GA 1QZ0A 3ZV2A 5K25A 1EEOA 1G4US 5LXQB 5K23A 2PBNA 4GE5A 2YDUA 5KA7A 4OHEA 1C83A 1NWLA 5EHPA 3D42A 4Y14A 5MMZB 4QBWA 2C46A 5KA4A 2FJNA 3BLUA 5J8RA 1G1FA 2J16A 3AWFA 2GJTA 3F9BA 1WRMA 4WU3A 3QCKA 4NWFA 2B4UA 2PI7A 4NYHA 1YPTA 1T4JA 1VHRA 2QCTA 5EHRA 2P4DA 1FPRA 2CM2A 2ZN7A 2CJZA 1PXHA 4IKCA 2CMAA 3I7ZA 3V0IA 2C7SA 2NV5A 2BGEA 3MOZA 1Q6NA 2B49A 1OEMX 3CM3A 3RO1A 1D5RA 1OHEA 2I4HA 1OEUA 3V0DA 2RF6A 2OOQA 4QUMA 2I3UA 3SMEA 5KA9A 3AWGA 3QCBA 2G6ZA 5KACA 1KAKA 3MMJA 4KI9A 4BPCA 1PH0A 4QAPA 2NT7A 5M43A 5HDEA 3H2XA 1OHCA 1LARA 3QCDA 3QCFA 3S3FA 1YTSA 4KYQA 3O4SA 1BZCA 1I9TA 5IBSA 3QCLA 1M3GA 4GFVA 4RI4A 2QBSA 5KA2A 2H04A 3I80A 3U96A 1PA1A 1YGRA 1X24A 1Q6PA 1FPZA 1U25A 5KA1A 3OLRA 2CM7A 2J16B 4ZN5A 1Q6TA 2CNIA 2F70A 2AHSA 4QBEA 2HC1A 3F81A 1SUGA 4NX8A 1XRIA 4RH5A 4D3PA 2J44A 4S0GA 1Q6SA 3BLTA 2H02A 2F6TA 1WAXA 2I4EA 2Q05A 4PVGA 2CFVA 4YR8B 5BZZA 2I6MA 4HJPA 1YTWA 4ZI4A 3QCJA 1I57A 1ZCKA 3QCHA 2A8BA 4QUNA 2CM3A 1OHDA 2BZLA 3LJ8A 5BZXA 3CWEA 1OEVA 1YWFA 2YA1A 3F41A 1ONZA 5I6VA 1PYNA 1Q6MA 5AWXA 2G59A 3S3HA 1XXPA 4HRFA 1PTTA 2F71A 1ZC0A 3N0AA 4R30A 2I75A 5BUGA 4DGXA 1YTNA 5K22A 2CNGA 3I36A 2CM8A 4WU2A 2I1YA 2NZ6A 2VEWA 2F6ZA 1AAXA 2HNPA 4QAHA 4GS0A 2CMCA 3RZ2A 2I42A 3PS5A 4D3QA 3SR9A 1KAVA 2VEYA 1J4XA 3F99A 1T48A 2B4PA 3RGQA 3S3KA 2FHBA 4BJOA 2I4GA 4R0TA 5BX1A 4GFUA 3O5XA 2B4SA 2WGPA 1V3AA 1ZCLA 4JBCA 1C85A 2Q47A 2PSZA 3GXGA 2YOCA 4JNBA 2AZRA 3ZM2A 2HNQA 2B4OA 3QCIA 3ZM3A 3A5KA 4OHIA 2PA5A 1R6HA 2F6VA 4YAAA 2FHFA 1A5YA 4WTYA 2B07A 2J72A 1YN9A 4KYRA 3ZMPA 1Q1MA 4J51A 2HVLA 4NNDA 2I6JA 3BRHA 4NWGA 2I6PA 3F9AA 3V0EA 2H4GA 1NNYA 1NWEA 4B04A 2NT2A 2IMGA 2J71A 3QCCA 3B7OA 2I3RA 3EB1A 2FHCA 4OHDA 2CNEA 2NTAA 1NL9A 1PTUA 3S3EA 4GE2A 3V0JA 3EZZA 2R0BA 2HB1A 1ECVA 1GWZA 2ESBA 1ONYA 1GFYA 1C87A 1BZHA 4TVVA 1FQ1A 3D9CA 1JF7A 1WCHA 5KADA 1XM2A 2H4VA 2QBPA 5IBMA 4PYHA 2Y96A 1YGUA 3S4OA 2QBQA 2J43A 3O4TA 2HCMA 3D1HA 2OC3A 2BV5A 1L8GA 1PTYA 3V0FA 1OETA 2MBCA 4OHHA 3QCEA 5KA0A 1G7FA 4H1OA 2F6YA 2I5XA 2CNFA 4RKKA 1RXDA 1JLNA 1T49A 3QKPA 4Y2EA 3D1OA 2VEVA 3NMEA 3EU0A 2GP0A 4GWFA 3EMUA 2JJDA 1YZ4A 2F6FA 2VEUA 2DXPA 2QCJA 5K24A 4D3RA 3BM8A 1BZJA 4ICZA 1XBOA 1QXKA 1C86A 2H03A 1PA9A 5KABA 2ZMMA 1C84A 4GE6A 1XXVA 5GTJA 3MOWA 4MBBA 5K9VA 4JMKA 1OEOX 1ZZWA 2I6IA 2QEPA 4OHLA 3ZM0A 1U24A 4DGPA 1U26A 1PTVA 3QKQA 2P6XA 3S4EA 1MKPA 3GXHA 1OESA 4RI5A 2I6OA 2OZ5A 4AZ1A 2B3OA 3D44A 2PT0A 1I9SA 2NLKA 2BGDA 1YFOA 2J17A 4ZRTA 4H34A 5KAAA 3RGOA 3D1QA 4RH9A 2QDPA 4RDDA 3OMHA 5K9WA 2OUDA 1Q6JA 4I8NA 3V0GA 1EENA 2Y2FA 4JMJA 4HJQA 2FH7A 2HXPA 2HY3A 2BIJA 3QCNA 3QCMA
chains in the Genus database with same CATH superfamily
3HZVA 1LYVA 3WIHA 2EKJA 2V3FA 5J13B 1JPFB 3NIGE 1BYNA 3GZOA 4W68A 1NAML 1NMBH 2DQHL 5DJ8B 4WHTB 1TCRA 2PWHA 2DLHA 4EO5A 1RUQH 3LQMA 3MA7A 4LAQL 4YMPA 3I9GL 2QSCL 2XV0A 3HMWL 1CUOA 1G7MB 2QBRA 2DQIL 1IAIH 1MH5B 1CLOH 2FATL 3A4FA 4P2QB 3UTTB 2ATAA 4O4YH 3S3CB 1FQ9C 2F46A 1BGXH 3A5JA 4WU7B 5KA8A 1QA9A 2E0TA 2HRLA 3KPOB 1JTOA 4FFWD 3HZMB 2B4CH 5DJ6B 2H1XA 6FABH 1MCWM 5FUZH 1DQKA 5E9NA 3QUML 3RI5F 1OGAA 3BESR 1OY3B 1L7TH 3T9WA 3CFJA 2G9KA 4HKJB 5T3XE 1UZGA 1HSBB 4YDKL 1I8UA 5G2NA 5CJOH 2PO6D 5G4OA 1LLAA 1ZLVK 3X1GA 4G1EB 3JYCA 3DHJA 4N2CA 2WVVA 2X4TA 1XGTB 2IBGA 1I82A 3F7YB 4KWUA 4F7CB 1DBJH 2GUOA 1NBZA 1S7UB 4BHUI 5F89B 2LAGB 1VCBC 4WUUE 3L3OB 1KG0B 4M93B 3CN0A 3ISRA 5T3ZD 2Z31A 5GISL 1F1AA 3TYGL 4U05A 1JCKA 3N42B 1PVHA 1SRDA 3D51A 1WICA 4HSAC 2QQLL 2ZCHL 1IT9L 4XP1L 1I4FB 2V17H 4ZXBC 5I1JH 1RD6A 2D9QB 3ORJA 4U6HA 1WZ1L 5D7SH 1N0XL 2X2JA 1HJCA 5BCAA 4TQEL 5GJSH 2B0SH 2UY6B 4GE5A 1ZS8B 1YYML 3HHSB 3MLTA 3CJJA 7TAAA 2IFGA 3M07A 5IB5A 4A6YA 1BQHB 2F53E 3FB5B 1UOLA 1J8SA 3C60A 5MEPB 5HD8C 5IB4A 5CS7A 2BMKA 3RTQB 1JNLH 1C5BH 3QXWA 2KBGA 4MXVF 4TLKA 4HKZA 5HYJA 5IM7A 5CBAA 4F27A 5KVMC 2V2WB 4YUEH 5E5RB 1OIOA 3PL6C 1DCEA 5GSVA 2HX7A 3O2VH 4G7SB 3K80A 4HCIA 2W92A 1A3RH 1ET7A 4FFTA 4FNSA 3ZN6A 1U42A 2D3NA 1RJZA 3LPPA 4GKNA 1VHRA 5I75C 6CGTA 1AKPA 3PV6B 5AD0B 3FO2A 3JTBA 1NA8A 2E7LC 5LDSA 1JCVA 2JELH 3QEGH 1IAII 2YBRA 2IH8A 2Y2YA 6PAZA 4NQXA 3QZWA 3MNZA 1IFHL 4JCMA 4N0RA 4N9GB 5EU7E 3MBWB 1MWOA 2AMUA 2YPLE 3LSOA 2C7SA 1J5OL 3VMOA 1C16A 2AZUA 1JZIA 3BC9A 3FT3A 1IC7L 1OK8A 2H47C 1KTDA 2Z6FA 1ITBB 3EOTL 3LN5A 4FQXB 5FM5M 4XGZB 3TJEL 5D1XC 3QFJE 4QTHA 2YS4A 4W9DC 1RK0B 3WKNA 1I1YB 1KTCA 3G3LA 1FVCB 1UB5B 2WSDA 1LL1A 1AXTL 1BYOA 1R3LA 4OUUA 3QO1B 1T66C 2IWFA 4AL8C 3WNJA 3S4SB 4UTBH 4HWUA 1VACB 4LU5L 3FFOA 3GPEA 1K8DB 1I1FA 3F83A 1OAJA 4MMZA 1UZ6E 3LVEA 4I89A 1M7IA 2P80D 4NKDB 3VFMB 4X4YB 3KPRB 4NQVA 5EBMB 2PTUA 3QUYC 1WIPA 4Q4IA 4WU5B 3CLFL 1DJZA 2LQRA 3RU8H 4OD1L 3QWRA 5HHQB 2F8IA 3GNMH 3TESA 4Y16A 4QAPA 4HF5H 1RAMA 1U8MB 1M53A 1OQOA 8PAZA 2X42A 5I1CL 2EO9A 5L0QC 3BWUC 3VJ6A 2WJ5A 4OVUA 5DYOB 4PREB 5DFVC 3FU0A 2MNWA 1RUPL 4NQED 4RGOH 4ZUUB 1BDYA 1RU9H 2R7EA 4DPRA 3MJ8A 2FLRT 1NUDA 3K6NA 4AV0A 4G43A 1MIMH 2VZTA 1YGRA 3RNQA 5JQ6H 2FX8L 1UXWA 5L2KD 4FNPA 1C8QA 3ARFC 4X8JB 4BFBD 2QV4A 5AZEH 3T0WA 3WFHB 2W8CA 4XP4L 3K4DA 4I4WB 5H2BA 5KBKA 5DQJA 3DSFH 2XKUA 4PWFA 1WAEA 3APNA 4ZMYA 1WFTA 4FQLH 3HC3H 2H2SD 1U6AL 2JKSA 3V55A 2JWYA 3IWVA 1SNRA 2BZCA 4JM4H 3VO0A 2HFGH 4XO5A 2X0UA 3FONA 4G6AC 5DS1A 4GQRA 4AGNA 5AG9A 5GRVL 3ZT7A 4RRPA 3VTMA 3PHSA 4AXWA 3FB8B 3FQUB 3I75B 4EI5C 1SUGA 3MREA 1JNNL 1RZGB 4YAQB 3OG4B 2VO8A 3KJ6L 4FN0A 2J44A 3BP7B 3U0PB 2WXOA 1A5FL 2Y66A 3M7OA 4L4VA 1I3RB 4NNXB 3ZO9A 4AQEA 4LHJB 5GHWH 3JV4A 5EU3B 3MBEA 4ANWA 1J8RA 1BQLL 1D5ZB 2WQWA 3F64A 2LLGA 3L5IA 4R96B 2KS0A 4YDLC 3H2QA 5IT2H 4N8VG 4ZI4A 3RVTD 3N3EA 2XVLA 4XRCA 5C0DB 4U1IA 4GG6A 3TVMC 1ZY9A 2EXWD 1E40A 1A1MA 2EH8L 3LXAA 5JXED 4J1UA 1HKFA 4G9DB 2XN9B 5JUEH 1MCCA 2F7PA 5TDOB 2EDMA 3RDTB 3KXFE 4N2BA 3GLEA 3MV7E 4YX2L 2J1XA 2GIMA 4HH9A 4WUKL 3LJ8A 1SN2A 2K1MA 5FYLD 4XNYH 1PYNA 1GIGL 1JPSL 2F1AA 4XI5C 3HNVL 2XT1B 3T2NH 3MRJB 3QCTL 2G59A 1KYFA 4OF8A 4YWGL 4YSCA 4BQBA 1CE6A 3OKYA 4Y4KA 3TWCH 4MD5A 1A2YB 4AGMA 3HCVA 3WLWC 1K2DB 2XPZA 5D1ZC 2YMOA 1VGEH 5D7JA 1USZA 2PCFB 4N2DA 2A73A 3U4BL 4K2UL 1JF1B 1KPUA 3FQWB 3HE7A 2JVUA 1MG3C 1YN6A 2DM2A 4BE6A 3C8KA 4C83A 1K3ZA 2NY2B 1EGJL 3V0VA 2YPKB 1G7IB 2FWOA 1HQ4A 4Q56A 4F7EB 3BJ91 1VB9A 4X6CA 3T0ED 4GS0A 5J11B 1FDLL 4WDIB 2ICES 3GGWB 1UC6A 3KHOA 1LP9A 2F8OA 2OZ4H 3P0VL 2O30A 3AM8A 1GL4B 3L48A 3KLAB 3VXRD 2DKSA 1T7XA 2FJGA 3CVHH 2N7BA 5ACMA 2VEYA 1E4XH 3TBTB 2XJAA 1B4LA 5D7HA 2CLZB 1I31A 3L4VA 2XY2A 1T4KB 4NKMB 1CB4A 4Y4FA 3IKCB 2H32H 1QLFB 2OK0L 2YQBA 2VT0A 3WEXA 2DIAA 4QGYA 4G8IA 1UHVA 2HFEA 3O5XA 1V3AA 2NYKA 3VGAB 4R3SB 5DGRA 2EVIA 3GXGA 1QPKA 5F7WC 5JW5B 4K5MA 2FJHB 2AZRA 4RMVA 2WVSA 5EDXA 4WKXA 3FUIA 1FGVH 3EBAA 2WO3B 5E8NB 5FYJU 1LJMA 5IJKC 2KKQA 4JQIL 2XJKA 5GS0L 2Y06H 4P46C 3VG0L 2YPVL 4XPTL 2IQ9H 4J5VA 1OAYL 1RJLB 3FFCB 5I1KL 4P2QD 1R34A 3UTTD 4JZJC 3DROB 3FQTB 5JHDE 5IQOA 3GBMH 2AHIA 1ID5I 2ENQA 1JNHB 4MJ5B 4PTUA 2X4QB 1PQZB 1L5GB 3FW6A 1S7WB 3TONA 3D4GA 3U6RB 1CBVL 2K6ZA 4U1KB 5DRZB 5CLYA 4LLAA 5T33L 2NTAA 4NC0B 2OSLA 1EHAA 4OI7A 2FUQA 5IG7B 3O6FB 3AB0B 3WTTA 1DDHB 4HWZA 4NM4L 3R4DA 3U7YH 4DTGH 2ESBA 1M7XA 1GY1A 4JDTH 4N2HA 3MRNB 4LSSL 3ZGIA 1BZHA 1O9WA 1L4IA 3GSUA 3KPQA 4PJGA 2Z1PA 5HHOB 2HUEA 1MFDL 2WUCL 2E46A 3H3BC 4WO4B 4BSWB 3T6QC 3V52L 1NIAA 2OBGA 2BHZA 4QHLB 1I9RH 2FB4H 2ICWB 5C0FA 4RIRA 1KDIA 4NKIL 1VESA 3EDEA 4WWOA 1DUYB 1J87A 4IK7A 5EC2A 3TO4A 1NMCB 2XV2A 4R5TA 3S5YA 5ICYA 3HFML 2WY3B 2OX5B 2UYLB 4D9RD 4QLRA 2BM3A 2D7NA 1T5XB 4YZFE 1BX2A 4OHHA 4HISA 1VGKA 1JK8B 1DANT 1G7PA 4ZMVA 3L3JB 4G9FA 2F6YA 1PZ2A 4OJFH 2X5OA 4Z3EA 2VNCA 1OK0A 4K94H 2ROXA 2CNFA 2PPFA 2HN7A 3CDFA 3LKSA 4NUMA 4EJ1C 5HDLA 4M3HA 5TPWH 1E4XI 1YEHH 5E0FA 4BDVA 4QJ5B 5CD5C 1R5IA 4MA1C 3K81A 4PP1D 1KC5L 2MJWA 4NIKB 1S9WB 4YNYA 3CZGA 3ZDXB 3B43A 3RTQD 3B7TA 4KKBD 4OZIB 1ZHKA 4CVZA 2CALA 3KBEA 2VC2B 3ELAT 1N3NB 1PA9A 3MODL 2QKIA 1R9FA 3RFRA 3FPXA 4U1NB 4DZBB 2CKBA 3VFRA 4PVLA 2R1WA 5EZIL 4ELKB 4QAMB 5L88H 3MRKB 4GAYA 2DZEA 5GS1A 5DK3A 3LY6A 2QKSA 4JO2L 1ORQB 5D5MA 4AQAA 3G9AB 5A16A 1LK3L 3HC4H 1XB6A 4BH8B 3RILA 2CO7A 3AG1B 3GKZA 4OHLA 3PP3H 1Y1DA 2VDLB 4HK0B 3GMQB 5J3HD 1SLWA 4IBUA 5I1EH 3NJHA 1D5XB 2E8YA 4M7JL 2R23A 2A6KA 3P3TA 2YBGA 5JPMA 3DTXB 4G6FB 1M42A 1YLBB 2N1TE 3QZWG 1T20A 2VGLM 5DEGB 3IDIA 2P5EA 1ODUA 2J4WL 1E30A 3N6YA 4FQXD 4Z7WA 5FDWB 3IMRA 4QHUB 5AKRA 3P9LA 2C1PA 1M6OB 3BUTA 3T3MF 1CFMA 1MHEA 3O3BA 1UM4L 3I02A 3WEAA 1KEML 2R0KH 1Q6JA 1T21B 2AK4B 3NIDE 3QHTC 5JPNA 3FCSA 4OLWL 2I69A 4JAMB 5CIPH 1EENA 3F01A 3CSTA 1KF9B 2ADIA 4XNXL 5CZKA 4L48A 2HXPA 2YAMA 5AZ2L 1JV5A 2DYPA 3KPRD 2WZPD 1VFOA 3BUQA 3QCMA 1QFHA 1XCTA 5I9QC 4ETQA 2QDCA 1N8ZB 1PFOA 2PPAA 2D8KA 4LIQH 3F58H 3SPVB 5I15H 5LN4A 1JMZA 2VIRA 3RVWD 3Q8FA 3ZMQA 3HMXA 5KSBB 2I32A 4XPBH 2AV7A 2H45A 1N5AA 3CZFB 1P6WA 3DPBB 2GTWA 2HFFA 3O4LA 1INQB 2NUPA 1TSRA 4M7ZC 4RAUA 1IIIA 2LLNA 2NNXA 5I8KH 4Y5XB 5E1IA 4AYFB 8FABA 3GK8L 3QISA 2CNHA 1JFQH 5T1DH 2VMDA 2V5SA 2XWCA 3EJZD 3QFGA 3KPPB 3BP5B 5FECA 2OMZB 3D4YA 5GRZA 4U6VH 5IB3A 5F2FA 1AZVA 3CAFA 3UPRA 3KDPB 5DF0A 4XWGH 3CDCA 3C5ZA 2WD0A 4IDLA 5HHPB 3U0TB 1S5HA 2YC1A 5KBDA 1EUUA 1TJGH 4JHZA 2EUZA 1AQHA 2EDXA 4P2OC 2V4LA 4IOIB 2CH8A 1M2VB 3DBXA 1M71A 4MSWA 3S96B 4B5EA 1L8KA 5CMAA 4D9LH 3HR5B 4NQDE 2KL6A 2Q76A 4MVBC 3LKRB 1MCSA 4NYLB 4GRYA 1CL7H 3HS0A 4BXVA 2EZ0D 3L8QA 2X9ZA 1O5ZA 3AREB 5CZVL 4J3BA 4J4PA 4IU3A 4RRPG 1FFQA 2A4ZA 4HAKA 5E9DA 4ZUWA 2F19L 2Q7AA 4P5KB 4L0PB 3VXNA 5MEOA 1K6QL 2C9PA 3PNWA 5HVWA 2C3WA 4TSAH 1L9RA 1PZAA 1HHJA 4QNPF 5KA7A 1PG7H 1XZ0A 3QPQC 5GGUA 1FP5A 1GOFA 3L5XL 2FE0A 2HG5A 1TVBB 2JSFA 3RE0A 1YEDA 3DHPA 3D42A 3UFIA 1BFOA 5HXMA 5KVFL 2XN9D 1YEJL 2ENYA 4NUJB 1F8TL 5KSVA 4J3OD 2NY5H 3RDTD 4UQBA 2X4NB 1WBYB 3AS2A 4E41E 2EDLA 4WENB 3VB9A 3WNKA 2CM5A 5I6OA 4LMQI 4KDWA 4JQXC 1EVUA 1SJHA 3AXHA 4ICXA 4WO0A 5JXAL 4PJ7E 1T4JA 1BMZA 2HTLD 1GQQA 4YGAB 1F90H 3ARBA 5K1NA 1VFBA 5EU5A 4E2OA 2J7LA 2ZUXA 3P3YA 1KZYA 4LZKA 4WK0B 3BP6B 5FO2A 2VRQA 2XZAH 4UTAH 1FORH 4XCFL 5J56B 2D03L 3G5ZB 3A0OA 3FFDA 3ZZ1A 2NY2D 1R5WB 1TTAA 3E2HB 5ICXA 3BIKA 3L81A 3MOZA 1KJVB 3V4PL 4FTVE 1SXSA 2PW2A 4QAWA 5IJBC 3UAFA 1XDTT 4HUUA 4WJKB 3HZ3A 4MJ2A 1WFUA 5F9JB 2DM7A 4XB8A 4H8UA 2G9HB 2HVBA 4KI1A 2XA8H 1S7RA 2CDEA 5AW0B 4PGJA 15C8L 3M17A 1EAJA 1KBKA 3DJSA 3NGBC 4X98A 1I8IA 2HLAA 4MNGA 1HZLA 2JMRA 3LB6C 1BVLB 3RLSA 3UJTH 2G0KA 1OTSC 1HQRB 1Q1PA 1N6VA 3CHQA 4MQXC 2VAAB 2CHDA 4K3EL 3QIBB 1HESA 5CJ5A 1CL7I 2VQ1B 3NA9H 5J9PA 1WF5A 5KVEE 4I2XA 4Z78B 5JIIA 2I85A 5I6PA 4IKIA 4TSCL 4AE0A 2NT7A 1ZGLA 1MRCH 1UZ8A 2RA1A 4MNHB 3RVUC 4F57H 5JOPD 2AM1A 2NW3B 4KKLD 4AK2A 3HG3A 3UYRH 5CP7B 3PNRB 4BSJA 3FFCD 2PYEE 1DBBL 3ZE0B 3BZEB 3QCDA 1FZOA 3QDGE 1CFVH 4AMXA 3IJHB 2B3RA 3X1BA 4RSVA 5DZAA 5IBSA 5ISZB 3QCLA 1G9MH 1GZHA 2A0LC 2VN4A 5B1JC 1UD6A 3DOSB 4FLQA 1NUNB 2W94A 2ZNXA 3FUMA 2F7RA 5C0IA 4UI2A 1MHHB 3D8MA 3A3YB 4RI4A 4KZDL 4BFIA 4P5TA 4P4RA 5I2IA 2HPTA 3G04B 1JVOA 3O6FD 2H04A 5I17B 1UD8A 5CLZA 1G1KA 1JZGA 5IEHB 4DKEL 1A7PL 1NOFA 4WEUD 5F7YC 4M1CD 1BYPA 3SGJA 1U8PB 4ODHH 4NM8L 3HJEA 2XNAB 3B2DC 3NFPB 5C6WH 5HHOD 4WO4D 2Z1KA 3HE6C 2M83A 3RAJL 3ALPA 4XPGL 2E5EA 1T83A 5C0AA 5AVTB 2WO2B 3EYOA 2J25A 2AJZB 2J5WA 5K9QI 1HEZA 1S78C 5GRXG 4JRYE 3ISWA 3IB4A 1HCZA 5CN2A 1JYVA 2XIBA 1JRHL 2P24B 2X4PB 2FX9H 1VFUA 3R1GH 1J88A 1WE5A 2JCCF 4Y8AA 5B7EA 4TQHA 2YXVA 3BOVA 1BD2A 1W72A 4KY1H 5EWIH 3SPJA 3F12A 1IKFL 2NTFA 4I18B 1PYWB 2WBJB 4NDMA 1CICD 1UOVA 4XMLL 3BLTA 5IWLA 4X99A 5KAAA 4M5ZH 4OGYH 3Q6FB 4X6FA 1JUFB 3OR6A 2LTQB 1RJYA 1AJ7L 3GSOA 2YARA 3VXSA 5D2LB 1Z9SB 5T1MA 2CQVA 2CJUH 3B7YA 4G83A 4H26B 2WMPA 4L4TE 3TV3L 3QQ9C 5L2JA 1EEHA 2ZOKA 1IAKA 3MACL 2VL4A 4GJTB 5EG6C 2AZAA 3FU9A 3SQBA 4UUJA 3NQIA 1LMIA 1OAQH 4UM9A 3TWYA 3VFNB 1WAPA 4RFNB 3WIFA 4M29A 1O5DT 4YHOL 4LSVL 1T5WB 2XRAL 3ECBB 1NCBH 3DDFA 4ZSOB 5DEJA 4WI0B 3CLEH 2CM3A 1NKOA 4ODSH 1G6RL 2YA2A 3HN8A 4XNUH 1ONZA 1ZSDA 4B0MM 2R0LL 1OZUA 3A6BH 2WSKA 1ND0B 2YQ2A 5TD4A 2VDML 1PEWA 3VYNA 1Z32X 2VABA 3CDYA 3THML 4XNMB 1NC4B 2EIDA 3MCLL 4JZOB 1TPXB 3P73A 2XWJA 4OFYD 4JN1H 2GJZB 3V79C 2A38A 4JCWA 1TOXA 3PJLA 4XZUA 4G6FD 4WHDA 2HNPA 4MCYA 1ZLWK 4ES8A 3GBDA 1GH7A 1WV7T 4YDNA 4JFEA 5HHXL 4I3RL 4L9LC 4FI8A 3F7KA 4GW1B 4PJXF 1RL1A 3RZCA 3KPLB 3V6BR 4NZUL 2I42A 4ZS6D 2IH1A 2ADGA 2FEDD 3LQAH 4MCZA 4F9LC 5IJVB 1HCFX 4QRSB 4PJAA 5I19H 4UOJA 2X6CA 1E4WL 2AK4D 3ZQWA 3F99A 2BVPB 4ELMB 3ZRSA 2C9RA 4QEGA 5D1XE 4PJ6A 1ZE3H 3TBYA 3TTSA 3MRLA 3D3VB 2LGNA 2OTUB 5E1HB 4MXVE 3HI1A 3V6FA 5HI4D 5F3BB 2PUQT 2WGPA 3ABGA 3M1CA 1E5UI 4L18A 3U9UA 3CSYA 2VR9A 2WNXA 2IC2A 4QXVA 3WAKA 3PABA 3HEIB 3RVVC 5FGBC 2OSWA 4EDWL 5FW8A 2XWZA 2WWKT 2W9EL 5EBWB 3CZUB 4TVPE 4U1JB 1UGNA 1DQVA 4M03A 5JW4R 3H7BA 2CE6A 3TN0B 4GSDH 5CGBA 2XV6B 4PU2A 3UCRA 3FTGB 2HT4C 4FL4B 3I6KB 1RUKL 1UQSB 1Z5LA 4WHCA 4P2RE 1T0MA 3VD2A 4FFYA 3LEVL 3B7OA 4Z0BH 3BQUA 3CNKA 3UDWA 4QRTB 4M8UA 3B5TA 5F6IB 2FYYB 2X6AA 4JQVA 3U36B 1D5IL 5AYUH 3VWJB 4YEEA 4HGMA 4Y2DC 5TJWK 5ACLA 4HIIA 2XYCA 4YGVA 3O6LL 2K7PA 1QYGL 1L9OA 3FCTB 4PS4H 4DP6X 4EDXA 2QEJA 4Z7QB 5DRNB 2IDQA 4OGAC 3WD5H 3P0YH 1IGIL 4PV9A 3RJQB 3ZTNH 4X80H 1NCWL 2GSMB 2LVCA 2Y9RT 4PAZA 3G7TA 3TCLB 2C4FU 4UYQA 1CWVA 2R69H 2NZ1A 2AEQL 4ODXA 5I0YA 3M6DA 3CZNA 5DK0B 2HLEB 4HJUA 1K72A 3FUKA 3TBCA 3FN9A 3UAJC 1SN0A 2MBCA 4AUJA 3ARED 2WOBA 4E9YA 3GINA 3SYOA 1JZ4A 2N7SA 3N44B 4ETYA 1KOAA 2FR4A 3I2CH 5SWZE 1QSEE 2ZAIA 3EDFA 1A4KB 4LBEB 5JIHA 3X13A 5BUPA 1NIDA 4MYWB 3CFBB 3GHEH 5DWUH 5E8PA 3VXUB 3VI4E 2J8UF 3CN3A 3S3BB 2GITB 4QXTA 3IXAB 3NRSA 3MLSL 2NNRA 5J7CC 5LBGA 3EMUA 2FNBA 3GRWA 3KMDA 2BNQA 3VDCA 5BZDA 4K5OA 4JNXA 2GTZB 1MQKH 1DE4B 1MREH 3C9NA 3CPLB 3QJQB 4K9JA 4NP9A 4PSPA 4QO1A 4L29A 3A4DA 1QNIA 2G4GA 3QDJE 4NNPL 4AYDC 5A40E 5JMOC 4HPHA 3R0NA 4UQ3A 2BY1A 1SUHA 3SJVA 4OLVL 4I0PA 1MFMA 3CH8A 2AKRA 3RBGA 2XN0A 3IT8D 1NCDL 2ZUYA 4AWJC 1EJ6A 2ERJB 4EVNB 2G3XA 1XXVA 4XMWA 2P7TA 4PIRF 2GJRA 4QYAA 2IOOA 1A6TB 1NEUA 2W80C 4I3GA 4FXLA 4JFHD 5F3HB 4AIEA 1EJ8A 3B3IA 2BVOB 3SDDC 1KXQA 4W4NA 2J57A 2OMUB 4BD4A 2I6IA 4G70B 4OAWA 1ZIAA 5IVXB 4XP9L 1K8IA 3L9RB 4MBOA 1QEWA 1PAZA 1I75A 3LIZA 2VH5L 4YQXH 3MN8A 1FH2A 5E51A 1MKPA 3SE4C 2VDQB 1SQMA 3L3IB 3MRCA 3O41A 3X14B 2BCKB 3NN8B 3RWEB 1M05B 1N19A 1I9SA 4LLVA 4HDIA 2P52A 3IDYB 2VDKH 3C6SB 3HAEA 3QWNA 4JHBA 3ZDZF 4D0DA 3NOIA 4PV8A 3IDNA 1T03L 4FP8H 2HJLA 2DEWX 4YZWA 4JM2B 1MDTA 5FYKL 5EF3A 2AS5M 1H3GA 3V0GA 5J0BA 2E9WA 5LNEA 3GZPA 1W78A 1DJWA 1XGQA 4N0CD 5IB2B 1JV2A 4DERA 3CZLA 4PG2C 4NRYB 1O0VA 3TJHD 3QIBD 3AU0A 4MAUL 4XNZB 5IESH 5D2NC 4KGLA 1U93B 5BS0A 3R18A 2YFNA 1RH8A 4RGND 4Z3FA 4PJ9D 5DD1L 5F1NA 1J9QA 3MJ7A 3MU3A 1MAMH 3ULVF 1ZGLP 1CDHA 1GW0A 4WI3A 3QNYB 2HC2A 1BZQK 4P9HH 3W9EB 1CFNA 4LEXL 2PXYC 3N9GL 4CVMA 5ISZD 2JI3A 2UXVA 4N8VB 5GGTH 4OIAA 4FXTA 4URTB 1M7UA 2XZCL 4X7SH 3SYCA 5K9JH 3TU6A 1FGSA 5FFOA 3H56A 1F5WA 1A4JA 3CFDA 3L5HA 1VEMA 3QCGA 1S8DA 1NFDA 4N3TA 1P9MC 1W0VB 1J9TA 4WIQA 1JP5A 1A6UL 1UM6H 5ABAA 3BKML 1BMGA 1BV8A 2GBUA 3O3UN 3FU7B 2G5UA 3AS3A 4LPCA 4J8RB 1N6QH 2Y7NA 4KVNL 1QLEH 4PTTA 5KA3A 2ZKMX 1LEGA 3ABKB 5DJCA 1RULH 3GXMA 1J9SA 4WW2A 3QUZA 3QEUA 5J1SC 2PQ5A 2ZSWA 1IM3A 1PY0A 2DQEH 2GI7A 3B7RL 2XTJE 1D7DA 5AW3B 4EI6A 4N0YL 1I9IL 3UPCA 3WNOA 3PF2A 5KVDE 2YD5A 1XGUB 4YC2B 3GEFA 1UT1A 3OGCA 3E3QE 2WBJD 1AXSB 3UJIH 1GG4A 4AIZB 1MWAA 5I8OL 3Q2LA 3HN5A 4S0SD 2AANA 3QEQA 4P06A 3VG9C 5DRXA 2ENPA 3GJEB 2IANA 4B9ZA 4ZOAA 3W9DA 5FUCC 3O4OC 1ZPLA 2MHAA 2VC2H 4W9JC 2CBQA 4OHEA 2DMHA 2ADJB 3CQFA 1VERA 1Z9MA 2A83A 4Z3GA 2CA4A 3OX8B 2CM6A 3OJMB 3E6HA 4QKTA 3DURA 3QI9B 2ZSVB 5IF0B 5JLZB 1MUJB 3HN7A 3CBJB 4ESKA 5K9OB 2QHRH 2D7MA 4MTMA 4HT1L 2WXNA 4Z7VB 4JFDA 2AJSL 5J8RA 2MWCA 4R4BA 5LGKA 3KPTA 3ZTEA 4CVUA 7FABH 1NEZA 3T6VA 1JXGA 1WZAA 2PWFA 4M62H 4K8RC 4M6NH 1ZLSL 2ZKHH 2PI7A 3HZVB 1YPTA 3BDBA 3Q8EA 5EA0L 1T3FB 3LVTA 4H4NA 2X9XA 5JHLH 1UT9A 1I85C 1I9JH 2BP0A 1NC4D 5DS2A 4M6OH 4N90D 5E2WH 1TCRB 3T2LA 4PRHE 3W39A 1N0LA 4GQQA 3NSCA 5IHUL 1X9LA 3MA7B 3N2AA 3ARWA 2DQGH 3MCKA 1OGTA 4TSBH 1KBGL 2ZUQB 1ZLUK 4EAEA 3FT9A 3EOBA 3FQ4A 4HS6B 4GW5A 4HLJA 4HWNA 1QA9B 4XVTH 3RWFB 4J39A 5LWYL 2J55A 3CFKA 2Z4QB 4WUUA 5IQNA 2E6PA 4PI0A 1BVNT 1SM3H 4LSRH 3GO1L 4TUOA 1SQ2N 3UO1L 2YA0A 5D70H 3PWPA 2B4CC 1OGAB 5F1IA 3PHAA 1G7HA 5L8LB 2YXFA 2J5LC 4X4ME 4NOFA 1YY8A 3SKUD 4AKPA 4TOYL 1TFPA 2Q5BA 5AVUB 3DX8B 4QLWA 4M43L 3D3VD 3KWTA 1CGXA 3J27A 3VGHA 2IWKA 4IDJL 4XX1G 4AGLA 3NABL 3I3DA 3PY9A 4K71B 3RWJA 2WVVB 4Y5VC 3MMJA 3VGDA 1R24A 2ADFL 1OPOA 5M43A 2F53A 5C0RL 1GA2A 4X9HA 3FTYA 1OHCA 3OMAB 4XVJL 5ESAA 3S48A 4CRPA 2Z31B 5LQBL 1WAAF 2UVEA 2DD8H 3IETB 4JPKH 2KERA 2Y07L 1YZZA 3GSNA 5GZNA 3MRPB 4GRMA 3TN0D 3S3FA 3PWUB 3VM7A 2NX5D 4R4FL 4GRLA 1UXSA 5LJYH 1QX1A 2ZOLA 3Q5OA 1BXXA 1FPTH 3EO0B 4OLXL 3WFEL 3WIIL 4BFJA 3C08H 3FKUS 3OL2A 1W8EA 1GTNA 5CJ8A 1M56B 3VTTA 1UENA 3HI5L 1E0OB 1S7SA 2CHZA 5GXBB 4MNQB 4P07A 1ZHBA 3VWJD 2X88A 3FUDA 2F1EA 5E5MA 4CBPA 1CDUA 2DN7A 3TA3C 1YYCA 5C3TA 3WN5B 4LDEB 3T3ME 2BMKB 4JE0A 2YD9A 3FB7A 3T4AC 2APXA 5IM7B 2DYRB 1NIBA 3FRUA 3TBVA 4Y5YA 5A2JH 2MKLC 5D55A 2SEBA 3OLRA 5KS9B 1E67A 1IAOA 4R26L 5GSVB 4OLEA 4LVOC 2W07B 5C0JA 2YK1H 2JFHA 4A67A 1A3LL 3BPOB 2YLHA 4C4BA 4JDEB 1O9VA 4KRPB 5D96C 3H0TA 4DGVH 3LKPA 3QFJA 1GJUA 2W60B 3EKCA 3LNDA 3KM2A 4JFFE 3DKHA 3IU4H 2FO8A 5IEKB 5AWNL 4RNRA 1A02N 4L2LA 3FO2B 1GCYA 4FULA 3BEVA 4OZIA 1NPUA 3NJMA 4PGDB 2YBRB 5ESVA 4F8PA 2J56A 3QZWB 3BRGC 1LQSR 1JS4A 5I73B 3VXUD 4YBLB 4UQCA 1QBBA 1C16B 1PIGA 4WV1A 2FWLB 4BUQA 3FT3B 2IH3B 3NSYA 1KTDB 1W0YT 1YECH 3LN5B 4HIPA 4EZMA 3JT2A 3GMLA 1CT8B 4DSYA 4U1GC 3QK0A 5AW2B 1R3LB 1YMMB 1SEQH 3L1FA 2DLFH 1ZOXA 2C3XA 1R17A 2R56L 1FN4A 3I6LE 4OB5H 3E1F1 1WGVA 5FGSA 4KTYA 3VVVA 1ES0B 1TG8A 3BQVA 4QJ3B 3L5JA 4E5XG 3CWEA 4YHPA 4GI6A 4AH2A 1FWXA 2P46B 3G5VB 4MMZB 3ZDYF 4K3HA 1TTCA 5JOEA 4U6YA 3ZMNA 5TK4A 3L17A 2DJUA 4NZTH 1XTMA 3JBG7 3SPGA 4C55A 4V33A 1OHQA 4OCWL 3CX5J 3SKOA 3VFGH 5KG9B 3US0A 3FMGH 1E0DA 2WLLA 3L95A 5FK9A 1CD8A 1KN4L 2H1LM 4GKZA 5K22A 1GGYA 1FJ1A 2HKFH 4NN7B 4ODVL 1JERA 2WCPA 4ZI8A 2KT6A 2X7LB 4Y4HA 1C9SA 3TZVC 1E50A 1B88A 2M8XA 1OP3K 1CE1L 4O51A 2NSMA 5ADPL 5J57B 3IVKA 1TQCC 1BM3H 4XP6L 5EEZA 3VJ6B 1HEHC 3DV6A 3UGUA 1H6EA 3IE4A 4K9EL 4UT9L 4N87A 1BBJA 3RDJA 5I1HL 1TJXA 4QRRE 1UJ3C 4AIOA 1F42A 4Y9CA 1C8PA 5D7IF 3EJRA 4KO5A 4LLMA 3DX4A 5EOCL 2NOYA 3MJ8B 1CQYA 3PS5A 2JKTM 1QFWH 3HAEG 3O8XA 3QJRB 4FX5A 3IJYA 3DVGB 4JM2D 4G43B 1XL6A 2YEZA 4S1QH 3T6ZA 4LKXB 1NLBL 1PX4A 1KXVA 1B3JA 2D31A 2OMWB 2Q86A 3BGFC 4POUB 4ZJ9A 3RNQB 4JLRA 4IU2A 1LO0H 1SOQA 1NPNA 2GQHA 5FYJD 2F7IA 5H2BB 4JBCA 1X9RA 2Q47A 4CADA 1RK7A 3UEQA 2ODHA 3SDAD 3EDJA 4WFHD 4N3UA 2B1OA 3OXRB 2N7AA 3MXWL 3LK7A 4HPYH 2AQPA 3FONB 3WXWH 1D9KC 3BPNC 3ZL4H 4DPBX 4AXWB 1F2XK 3GBEA 4OQTL 3MREB 3LRSA 5LCVA 2NMSA 2HTKD 3QW9A 2XXGA 3U7WL 3LYRA 1G7JB 3FF7A 4EUPB 1QFOA 2ICWJ 3DIDA 3MV7A 1MFVA 3VRIB 2WNGA 3SDXF 5D71L 3RWIA 4ZFFA 3WCYA 1L0QA 1J5HA 2KH2B 4ENED 3C09B 4LPUA 4NT6B 1AY1H 4X4XB 4ONFH 2QVMA 4OU3A 2IDTA 4LRNH 2E76C 4WWID 4U1IB 5EZLB 4OZGB 1S7VA 1A1MB 1TTBA 4YEFA 4QXGL 4XBMA 1KJ3L 1KGJA 1Q4NX 4J1UB 1S7TA 2K4WA 2P45B 2X6VA 4ZUSB 4WTWA 2N0KA 1U8OA 3N1GC 4PP2B 4LSPL 3WJMA 1ECZA 1J0JA 1EFXB 1RJCA 4RQQA 2BNUA 3QQXA 1YNTA 2AQ2A 2CCWA 3NA4A 4KTDH 1MW1A 32C2B 1IAIM 4Q0XH 5DLMH 1TJHH 1UGKA 3UIYA 4Y4KB 3I6GA 3WO4C 2ZWSA 1CDBA 3HCVB 3X3FL 3QCEA 2J1ZA 4B27A 1CZ8H 2P5WA 2M1KA 3IPFA 3SGDH 1A6AA 5D7JB 4KO6A 5IHZB 3ARZA 1MW0A 3L3GB 2OMNA 1JWSA 3HE7B 2JJSC 3ULUL 3LIZH 3JUYA 1YN6B 4P4KA 4KK8C 3OKMB 5ENWA 4C83B 1G0DA 5GRUH 3V5HB 4WWNA 3EO9L 2GSIB 3V0VB 4FQHB 1EAQA 1QVOA 4LCIL 3BPLC 4C4KO 4S1SH 1CU4H 4X6CB 3B9KD 1QFWI 1TEGA 5K1JA 3D85A 1PLBA 3QI9D 2D4FA 4GSRA 5A6MA 4C12A 4JE4B 3VH8B 4ICZA 5I82A 4JVWA 4N5EC 1CGSH 4ZTPL 2C5DC 2HLFD 4APQA 1QXKA 1G94A 5C7XL 1CF8H 2K8QA 3HI6H 5JHDA 2DQDH 1H15A 2ZKYA 4PJ5E 1VRSA 4I88A 5T1KA 4M61A 4GE6A 2HFEB 4YDIH 2DDQL 1RUAL 2DL9A 4B9JA 4Z95H 2WKGA 3QUMA 5CILL 5DMGC 3X12A 3UBFA 5I1GL 1JZ7A 3IK2A 3K72B 4P23A 1ZZWA 4PJBF 4FQ1L 5C0ND 5F88B 4MA3B 4GSQA 5CJQH 1Q0YH 4L8CB 5E1AB 5FO8B 1AACA 1QZNA 1T0NB 1U8LB 3P40A 5DSCA 4B41A 2XQ0A 5I0DA 3F04A 5BW7A 2EEDA 4JKPL 3GBNL 3PQYE 3X2QB 3RWCB 2QTEA 2BIHA 1Q9LA 3ZBMA 3CXDL 4RDDA 2AXGA 1VZGA 1HHIA 2QPSA 2MQ3A 1UWEH 1DQJA 1OGAD 2OXHB 2PO6C 5TTRA 4JMJA 4GFXA 4QTFA 4JRXA 5F7BA 3TX4A 3ZM6A 4UINH 3IGAA 2F58L 3GSUB 3KPQB 4PJGB 5DDHB 3U2JA 1AD9A 4M3JA 1NGPL 1WS7A 4NJ9H 3TT3H 4H44C 4EMZA 3U9PL 1U21A 1AI1H 2UAGA 1UASA 3HLKA 3FZUD 3SO3C 4NP4H 1JGVL 1GYVA 1WVZA 1CC3A 1IGCL 1ZTXH 3DMMA 4IGBC 3SGDI 3SPCA 3HFFA 4L3EB 3FAXA 2Z31D 1HI6A 3AG4B 1MFCH 2B9AA 1O6SB 2FLMA 4MJIB 4KXAA 4NFBA 4HIEA 5I76B 3GXUB 1VGKB 5DJDA 2ALWA 3M4UA 3IPBA 1ROCA 2BW4A 2YWYA 4G9FB 1CGYA 1CXHA 2WBWB 4JFTA 1L0YA 4IHOB 5H4YA 2A6DA 4ZX5A 3QDMB 2D7TH 1U8HA 1MCFA 4MNQD 3LKSB 4NS0A 4K94C 1MAKA 1Q0EA 1INDH 4DZ8A 5F0MB 3KNBB 4PJXE 5DD3H 4BDVB 5E2TL 1R5IB 3K6SA 3S34H 3QEHA 4ZTOH 5AW6B 1P4UA 1YSOA 4KJWD 2PPDA 4NWTH 4X5RA 4YPJA 1P7QA 1KJ2H 1NLDH 2NY6B 2QPUA 4PJCA 3QXTA 1YC7A 3LTVA 4FE9A 5AOKA 3OKDA 4TL4A 2GWOA 1P84J 3WFCL 4FNRA 1F6AA 1SZNA 4UZGA 3RIFF 1AP2A 1UAGA 3LHAA 2CKBB 3VFRB 4KRPD 3VXMB 2YOAA 5FUOL 5D93B 4GAYB 5GS1B 3WAJA 5EHFA 1K4CB 2ZYSA 4UTCA 5A16B 3LZFH 2PWGA 1KCRL 4IMKC 2Z7WA 3IFOA 2OMYA 3NAAH 4HGWA 4NIYE 4P48A 2KLSA 1C5BL 3FT2A 3QORA 1OE2A 5KYUA 5EU4B 4JFQB 4XN1A 5JPMB 4KMTH 4JVPA 5IW6A 2WXRA 1TTRA 1T20B 3IDIB 3O2VL 1NWLA 4MRCA 1E65A 2BVYA 3VI3F 3SE9H 2HMID 4N9OB 4KHTL 3B4NA 3ZR6A 4J2XA 1YMMD 2MQCA 3I02B 3DO3A 4TL5A 1G5GA 3C6LA 5AAPA 5L8JB 5DC0A 3HZYA 2DQTL 4XWOC 4KQ3H 4PUBL 4PLJC 1IKNC 1ZVYA 4HU8A 2VJXA 3R8BB 3P2TA 5C97A 3TEZA 2DYPB 2VLRE 5C08B 4ETQB 1T04A 4OF6A 2QADC 4D0BA 3W2DH 3U30C 5CM1A 3ZMEA 3LD8B 1LO2L 1CFTB 1UATA 3ARDA 3PXHA 3FH5A 1W6LA 4HIXH 4OCXH 4HEPA 2GCYA 2X4UA 3RKDD 4YHYB 2TRYA 4ZW3A 5AVVB 4TVSa 1VPOH 4MHHG 3I7ZA 3AAZB 1N5AB 2NV5A 2AEIT 5E94B 4AYMC 2HFFB 3V4VA 3OKKB 5FGRA 3VFOA 5TGBA 4IS6A 4UIKH 1AGCB 1YUKB 3CM3A 3KYKL 2DTML 1OHEA 1XF4A 3QRFM 4XPHL 2J8UE 3MXVL 1DVYA 3WELA 2JF1A 4U49A 4HHAA 5FYJH 5KYYA 3NZUA 4UQ9A 5DZ9A 3GNML 5IB3B 3BVXA 1LE9A 2GHWB 2DYSB 3BRDA 1KY7A 1NDGB 3U25A 1DZ0A 2R2BA 3GMRB 1S5HB 4FI6A 1O7DC 5IOPA 3D39E 2IBZX 3C60C 2H2SC 3ERXA 4R7NA 1W8NA 2WVUA 3DK0A 2AW2A 4X8CA 3DBXB 4OZ4B 4GAGH 4R9HA 1MVUB 5CMAB 1R5VB 4M7KH 2GG1A 1WFIA 3H2XA 4FZ8H 1IC5L 3HS0B 4X7TA 4H13C 3SSGA 1WEJH 4XR8C 4DVRH 4BCZA 1LARA 5HDBE 2WQXA 2APWA 2IADA 4U1MB 2HAZA 3CVIL 5D2NE 4E9VA 5BOJA 5JQ6L 3S88H 4YJZL 1BIIB 3FDWA 4IU3B 3K1DA 2NY7L 4PD4K 3ARVA 3ZHDA 3T0VA 4NQQA 1N10A 2AGJH 4IBYA 3VD9A 4G82A 4E41A 5HI5C 3IMTA 2HZHA 3D2TA 4HHWA 4UAGA 2L3BA 3PNWB 3U4EA 1E9PB 1DVFB 2EXWC 4GQZA 2MPAH 4YSRA 1UB6B 1WITA 4PJ7A 4YXKL 5KA2A 1E6OH 1XZ0B 5GGUB 5EUOE 3MLRH 2HG5B 3DX9A 1YEDB 3QXAB 3ZDZE 4ANXA 4F91B 1BFOB 2Q2LA 5E70A 4MZRA 5TDPB 3TH4T 4A2FA 1JOIA 1JHKL 1RIVH 3X1EA 4D2NA 1HZHH 1SHXA 1E5CA 2OJ1A 3RBSA 1EFXD 3AACA 3QIUC 2YUVA 3MLWL 4LHQB 1WQVT 4FTVA 3DX2A 2M26A 4J3VA 5CD3A 2NY5C 4OJYA 3F81A 2BY2A 4Y4KD 1F4YL 5ESQA 3MRGA 1IC4H 4UT6L 5EU5B 4Z7NF 3A5VA 1XCQA 2ORBH 5D7JD 4P0DA 2B2XH 4LCCA 3D4ZA 1JGUH 3HE7D 4GUPB 4PG9B 3P4NA 2YSSA 1NBVH 3QE5A 4O2EB 1YJDH 4Y16C 3BIKB 1N9PA 1BQ5A 1MIEL 1W2KT 5E6IB 3POCA 4RMSA 3IFNH 4HUUB 3RNKA 4PN6A 1DN0A 1EHXA 4JQIA 4LGSB 5MI0C 3OMZA 1LO4H 1OLLA 5BO1H 2CDEB 4QCIA 4GKSA 5FB8B 2O5NA 1ONQB 3MRBA 5EULV 3M17B 5FUCE 3B2UC 2OR8A 3T1FB 2FECI 3MFFA 1Z66A 2PYEA 4MNGB 5E08H 4OLYH 2IWEA 3QDGA 4TNGA 5DRWA 1OEVA 2Y67A 2GUYA 1Z5YD 3TFBA 1UWGH 1ZT4A 4GMSH 5ADOH 4JO4H 5C0BE 1SJEB 3IDGA 1AO7B 4QRPE 4TVUA 3ASNB 2GIXA 3ILEA 1YG9A 4LF3A 4GG6F 5CSZB 1XBRA 1KWGA 5AW9B 1MQ8A 4CMMB 1FRGH 4HZLA 3BGMA 4PJEA 1SYVB 4H25A 4XHJC 1UZ8B 5GS2D 2CM8A 1FIGL 3AXIA 4Z0XA 2GJPA 2OSXA 4FHKA 1S9YB 1SHMA 4G8EA 1RY7B 2BVTA 3BH8A 2BSEA 5LCVH 3E0GA 1EWHA 4R90L 2XWRA 4CGTA 1FZOB 1I1AB 3B7UX 4ODTL 5KYWB 2FBJH 2OR9L 1JGDA 1IE4A 1HIMH 1CTMA 2JXMA 2X41A 1MFUA 3MV9B 4YVUA 1AE6H 3O11A 4D3CH 3K4AA 3BVWA 5C6PB 2EVJA 5JHBA 2JJUA 4NO2B 1UCBH 2X87A 1G9MC 3EGSB 1RP8A 1WLHA 1FZMA 3MBEC 4P4RB 4P5TB 3QCUL 1MELA 1DVUA 3MLZH 1V3JA 5FXCH 5AEAA 1GHFL 3MOQA 3Q6GL 2B4PA 3GKWL 1XO8A 5T5FH 4F1ZA 2V5MA 2LE9A 4EBQL 5I74C 2YMXH 3RX5A 3SBRA 5M95B 1SY6H 2CNZA 3K2UH 1PLGH 3RI5K 1A1OA 4RMWA 4X9FA 3GUTA 3B9VA 4L4TA 1LP9F 1YY9D 2DI7A 4O9HL 1PF3A 3A5KA 2K4AA 4K23H 1F56A 3L3DA 3CC5A 3LS5L 3QJHA 4L3ED 2DWDA 3TA4D 4BE5A 1E8ZA 2IH9A 3ZMPA 4KPHH 2GAZB 3HS9A 4Z7AA 2ZX6A 1BD2B 4MJID 4DTGL 5I18H 4GEIA 3F12B 3GJFB 3ZKXC 1BWMA 3IJSA 1XGYH 3N1MC 3NFNB 4NDMB 3V4PB 5CCJA 2IVFC 1MPAH 4G9FD 1BZ8A 3OMNB 5T3ZL 4WTXA 4Y1SA 5IBUG 2LU3A 1RJYB 2F2HA 5GGVL 3T04D 3QDMD 1QATA 4L8SB 1I3GH 3EB1A 5T1MB 4OHDA 5IBTL 3PREA 3WSQL 3QDAA 4ZMWA 1IAKB 2JKLA 3CGTA 3SQBB 2GBTA 3RY6C 1NAMH 2DQHH 3LXCA 3DO4A 4WW1A 3IJEB 2NY6D 4CSTA 3O9WB 5K59E 3I9GH 2QSCH 2YGQA 5DURD 1KLFA 4M7LL 3HMWH 1QR1B 3QJXA 4PRIB 2H8PB 2DQIH 3ZJAA 2FATH 1MCKA 1U8CA 3AM8C 4JG9A 4MB3A 3QS3A 4OZFG 2E7LA 4ZODA 4MXWL 5DMIL 1ZSDB 2GY5A 3O4TA 5AOZA 3G5WA 1XXDC 3VXMD 4AQ8A 4Z9KB 4APXA 1DSWA 4Y4FC 1HC1A 5LGJA 2ZOTA 7CGTA 2ARJA 1WUNT 4JFWA 3Q48A 2VABB 5SV4A 3G6AA 1HH9B 3P73B 4I85A 4OV6F 1RI8A 5F70A 4UV4L 1PBYA 1IAMA 5D1XA 4YDKH 1X7QA 4A2DA 1KNOA 1D2OA 2R59A 2RJMA 4XZUB 2A4EA 4AVHA 1RXDA 3QKPA 3FH7A 4MCYB 2VEVA 3N06B 3PWNA 3PHOB 4YFEA 3EU0A 2RHEA 4LQ1A 1QBLL 4M8RA 4KJPD 2QCJA 5K24A 4J2QA 3MRIB 2WXHA 1QSVA 1SYSA 3U1SH 4YSOA 4PJAB 5GISH 3TYGH 1A7RL 3U48A 4U7MA 2DLIA 3L13A 1IEBA 1CFBA 5FF6A 4LP5A 3LQAC 3OV6A 2WZAA 5ID0A 2ZMMA 2QQLH 2ZCHH 1IT9H 4XP1H 3MRLB 5FA3A 4LLUA 3V6FB 3HI1B 4ABVA 3NSJA 3QSKB 3L7FB 2DYPD 4P2RA 1IB5A 1M1XB 3P0GB 1WZ1H 4WKZB 4X5XA 1FAIL 1N0XH 5C08D 2O5XL 1NDMA 1ZE3C 1HYRC 4TQEH 3SKJL 3U9UB 3ZKMD 1YYMH 4M4PA 3ZM0A 3RUGE 5C0CE 4AC4A 3X11B 3IMUA 3TXAA 2DWXA 1WO2A 3CV5A 3SCMD 5E99L 3DX6A 3NIFF 3MV8E 4G7RB 3RX9A 1MOEA 2OL3A 2I6OA 4HEPG 3QH3A 5PAZA 4WK2B 5E2VL 3TO4C 3PUCA 1EHNA 3CUPA 4DP4X 1F1GA 1NWOA 1T0MB 3QC5X 1CDCA 4TTDC 5DQ9B 5D5MF 5BRZE 4G7YL 9PCYA 1HYSC 3D1QA 2P42B 1ILUA 3BQUB 1C1EL 4CJ0A 3ARFA 2PLTA 2XG4A 3HNTL 4K7PL 3FRPA 2JTDA 5IVZB 3ARRA 4QOKE 3UAGA 3VXTA 4HIIB 3ASOB 4YGVB 3OKNB 1OLZA 4KK5D 3A6CL 1LM8V 3M46A 2FH7A 1IFHH 5AENA 3QCNA 3G5XA 1QSEA 1GXEA 4PV9B 3GLDA 4JDVA 5IMLA 4Z7WF 1JWMA 1J5OH 3VI4A 5CFAA 3QZBA 4PRBB 2BDNL 4AJYV 1QACA 3F05A 3MRHA 4EUPH 4CN6A 3EOTH 1U92A 3ZDYE 3TJEH 4GLRH 4HUNB 4A2GA 3HRPA 4Y9EA 1G4RA 3KBPA 3DTDA 5F3FA 1SJVA 1AXTH 2OI9C 3DRQA 2UXFA 1ZPUA 2H3KA 3QDJA 3GM0A 2JFFA 2QQQA 2WQSA 5BZWB 2EYTA 2JKIS 4LU5H 5GJTH 4ZMXA 4IKJA 2FR4B 5B7FA 3WE6A 5AVYB 5DXWA 4Y89A 3L4XA 3B8SA 2XQYK 2CHXA 5E8PB 4HMEA 2V5YA 1DVFD 2VITA 3SGEH 4J28A 2ADYA 5F71A 2VEXA 3CLFH 5KOMC 2Z4TA 2NZ9D 4IOSA 4OD1H 1XIWA 4BKLA 2WQUA 4ACPA 2LAAA 4EN3B 3ARQA 4QO1B 4L29B 1R1CA 4E5XB 5I1CH 4UQ3B 1JBWA 4KKZA 1NO6A 1M2OA 5FCUL 4Z3TA 2BC4A 4I0PB 4FZEL 3WUZA 4O02L 3T65A 2BP8B 4MX7A 4RRPM 3B2VL 5BVPL 4PPTA 1W9XA 5CZXD 1X6NA 3REVB 3BUYB 5JPNC 1OOWA 1RUPH 2JIXD 1NBYA 5AB9A 2NRDA 2NUTB 2UVFA 5FYLL 5B3JE 1BZ9A 3VE0B 1QPPA 3RKPA 3WY4A 1CK0L 5FCSH 3UBXA 3US1A 1QZ0A 1NCGA 1K8IB 4Y1AE 3ULSA 1F02I 2PCPA 2ZOWA 3AY4A 2FX8H 2NCEA 4NO0B 1QEWB 3HR6A 1NCOA 4XMKH 4XP4H 2ED9A 3MRCB 4PGCA 5D6CB 3CIAA 5E6ID 4HIJA 4WLCA 4F8TA 4N2IA 4HDIB 4IRZL 5LVEA 1U6AH 5AKVA 1XV8A 3HAEB 1TR7A 1VCAA 4YK4B 4D0DB 1KUMA 4PV8B 4Z7OB 3KPNA 1EX0A 1ZANL 3ES6A 4OBSA 2HJLB 3W0WE 1LXMA 1JNNH 2CXKA 2WWKO 4HETA 5IFAL 3OZLA 4ZFZB 3KJ6H 5T5NF 3M7FB 1G0XA 1A5FH 5HP5A 2XSKA 1JZFA 1S9VB 3QJVB 3K1KC 2WINA 1F4WL 3VU1A 5GS2H 4G8AC 1XGQB 2XYBA 1BQLH 3AG3B 3CHPA 5AOJA 1THAA 4HLZH 1AO7D 1BECA 4GLRI 3QXDA 4NFDA 5DC4B 4NYHA 2X4RB 4MA7L 3C5ZC 4P46A 3TBBA 1G1CA 1GYWA 1ZHLA 2VXSL 4NZJA 2GCAA 3WFBL 5BS0B 1PSKL 3PGFL 5J4MA 4JZJA 4LARL 5ILTL 3L3KB 1ACYL 1OE1A 2EH8H 3MV11 4X4KA 2EH7H 5F1NB 4KFZC 3MJ7B 1PG7W 3SOBL 3PV7A 5IBLD 4F3FA 4HV4A 5F0LB 3VD0A 3MJWA 1I1AD 4YX2H 3APCA 4WUKH 3SGEI 5EH1A 4NQSB 4EIGB 2F9BT 2B9BA 2Z91B 5HPMA 1QMUA 3MV9D 4P9HC 1GIGH 1JPSH 4DP7X 4LLYB 4AQ1B 3QCTH 1LE5A 3DETD 1CMOA 2Y7SA 4YWGH 4PBVC 4QPEA 4XVUC 2HKHL 1Z9PA 4P5TD 5JDSA 1DR9A 3KHQA 3CFDB 3H2PA 2NY4B 3ALWA 3FB6B 1L7IL 1NGWB 3FUHA 1DBML 1KCBA 3ISYA 3U4BH 4K2UH 1H19A 4I3SL 4DK5A 2ILLA 2X12A 1UACL 4A7VA 4UT7L 3PWVB 5JIMA 1E9OB 3TURA 2DY2A 2YIHA 2DLGA 2BVQA 1EGJH 1TZHA 2WYIA 4BPCA 2QPDB 5DJCB 4NLAA 3QHZL 3CPUA 1FDLH 4WW2B 3QUZB 4JANA 2E4FA 3O45A 4KK6D 1J8KA 5HDEA 4U1SA 2ZSWB 1IM3B 3P0VH 4EI6B 3QGVA 3MC0A 1CICC 3MUGA 1BD2D 3G08B 4GO9A 4X2UA 25C8L 3ZE2B 4PJBE 4FKKA 3UH8A 4WJ5B 2A6JA 1G6RA 5E4IA 3PGDB 5D72L 1I9TA 2OK0H 1MWAB 2I25N 2UWEB 3HG5A 3ARBC 3INOA 1FHGA 3RL1A 3MX0B 3CC1A 2A1WL 5IQ9B 4FOMA 1EO8L 4QR7A 2NY3B 4N20A 1LNUA 4OCYL 4WFFD 4BSVA 3M1OA 5C8JB 4FQ2L 1WC7A 4LEBA 2A83B 3NIGB 3D08A 3IDXL 3R1GL 5IIEB 1AQKL 2KPWA 3PDGA 3DURB 1RPKA 2XG5A 3FPYA 3ECQA 1A4CA 4HXAL 4JQIH 3N0PB 5ABZA 2QVTA 4G42A 5GS0H 2E7CA 4ODWA 3O9WD 4PRHA 5DHVH 4GRWF 3VG0H 1JGLL 2EYRA 2YPVH 4XPTH 4PJHE 1OAYH 5AVXB 4BK5A 4PRNB 3MPCA 4PRID 4E9TA 1H5BC 5I1KH 2QZQA 1EBAA 3MGTA 2BOBA 4DN4L 5ACZA 3HKZA 4HJSA 1CBVH 3KVQA 3EZ8A 2AHSA 1FSKC 1MXGA 2C9VA 2R4SL 4N5UA 5T33H 1FL3A 2GY7B 2AM2A 2Z8WC 1LD9B 2G4EA 4N4YB 4BFKA 1NZRA 4G1MB 1AVAA 1ZT7B 4NM4H 3ILPB 4KMLB 4X4MA 3W39B 5IHBA 4FFVD 2A9AA 3UL4A 4LSSH 3PCYA 3JVFC 4N0UB 3TOPA 3VWKC 2B1AH 5I6XB 1TEYA 2WUCH 1MFDH 2UUDK 3V52H 1Z9OA 3SYPA 1BOGA 2XFGB 3EOBB 4CC4C 4GW5B 4FG6D 1KV7A 1WFNA 2V7HA 1SEBB 5AB0A 4NKIH 4ZPVA 5AVWB 4WUUB 4FFZL 4EQ2A 5I0XA 2EKSB 1OAKL 1TQBB 3D5OF 2WXGA 3HFMH 5D4IA 4GB9A 4HJGA 5KTEL 1GZHC 4JN1L 5F1IB 2NY1B 4CBZA 2C7UA 4GI8A 1KXHA 4C56B 2VN6A 3VSUA 4JPSA 5IKCA 1U36A 2ZPKL 1P7HL 3KYNA 4U0RB 3DARA 2EVHA 3HC0A 2YKKA 2EADA 3SGJC 1R24B 3TPUA 4GQPH 4NN6C 1IBHA 3UADA 1HJBC 1SOKA 2ZXAA 3K8LA 4XCYA 3IMWA 1J05B 4HW6A 2F53B 2L04A 2QQNL 4GKLA 4X6DE 3VFWA 4WU2A 1KC5H 1WS8A 1KB5B 2DAVA 4CW1B 5IW1B 3SKMA 4HIHA 1BLNA 3GSNB 4GRMB 4RAVA 2D2CC 3OPZL 1IBDA 1LO3L 2APBA 3MODH 4GRLB 1UXSB 4TLSA 1TZOA 1ZLDA 2CRMA 2ZOLB 3WU1A 2LW3A 3N41B 1XCXA 5IREA 1DJYA 3KJ4C 2XWTB 4NKOA 2CSPA 4RSYA 4LIQE 3BQUD 5EZIH 4G8FA 4O2FB 5IWLC 1RVFL 3AMKA 3MGOB 4JO2H 1ZHNB 4JFFA 1LK3H 3GMPA 4P2OA 4PS7A 3ZPDA 1BXUA 3VI3E 3PG2A 4WGWB 1I7UB 2VLKB 3FRPG 4LK4A 4JW3A 4ZFOA 2FRGP 2E74C 3FB7B 4M7JH 4OJDH 3GXDA 3TBVB 4O2CA 2EXTA 2P49B 2SEBB 2YPLB 1J1OL 2J21A 3OLGA 4BUGA 1IZJA 2VRAA 4BYHA 2PSZA 1EERB 2GKIA 2VERN 2HNQA 1PD1A 2J4WH 1FFPB 1PKQB 2EP6A 3CCHA 4YAAA 1JE6A 1Z5HA 3QFJB 4PCYA 2I60L 5F7NC 4QRAA 3AREC 2B07A 3RVXD 1PG7X 4P04A 3UBHA 5EO1A 5I5RA 2MTPA 2J20A 5LGHL 1KEMH 5J6HB 2BX5A 3BEVB 1GKEA 2EECA 4RBPK 5ESVB 5ICUA 2K70A 3V4LA 2Z9TA 4XNXH 3U6XS 2I3RA 5AZ2H 4Q7DA 4W93A 1NGYA 1VEOA 2J8OA 3LKOA 4WNSA 2Q6WA 4WV1B 1G9NC 1PNDA 5A2IH 4L5FL 1WBZB 3V0JA 1XF3A 3ZTCC 5EU6A 3BUIA 3GMLB 1UWXK 2XCMC 3QJOA 2IDFA 1BF5A 4X5LA 3FUJA 1WFOA 2O6CA 2VQUA 4EN3D 3V8CA 4A38A 4JQXA 4TVVA 3NZHL 3STZA 3D48R 5ALCL 3WS3B 5AKSA 4I0PD 3RZCC 3CFUA 2BOLA 2XQYG 2EEAA 5E00A 3NRFA 5A3ID 3G6JE 4YHPB 4AH2B 2AEOA 3QHFL 4LDLB 1TITA 1UADC 3NPSB 1NCCL 4QRRA 2C1OA 3GK8H 1ZWIA 3UTOA 2DI8A 1Q1JL 4R0LA 1KCKA 1CXLA 2BIOA 2BINA 5FFGA 3VFPB 4M5TA 5HVHC 3UP1A 1MQKL 4LVEA 5E8OB 2BSTB 3H9YA 4G6KL 4NO0D 3FUFA 5AW7B 4LB8A 1WRFA 3UBXG 4Y8DC 4CVLA 1M3IA 3FHQA 1K5NA 3RWGB 3MRRA 3OHXC 3SOTA 4AJWA 3IPEA 3DV6B 3T4YA 2GP0A 4GWFA 5LKNA 2JJDA 5D9SB 2CIIA 1IC0A 4LLMB 3WEMA 2E59A 5GRJL 1OP5K 3QWOB 3FQRA 3WTWA 4MAYA 1P7KA 2PN5A 5B4MD 1U3HD 5DK2A 2YEZB 3CFQA 1F97A 5CZVH 5DTFA 2D4DA 5GGSY 4IU2B 1KCUL 4JQVC 5HGBA 2F19H 4KC3B 2AV1A 4FRWA 3CIQA 2DWEB 1GGBL 4GAJL 2ENJA 2IXQB 1K6QH 2I5YL 4RGNC 3SBPA 4PJ9C 5BS0D 3L5XH 1BFTA 4FP8L 3CN2A 5EUKA 2NPLX 3DX7A 5KVFH 2I7OA 4AENB 1NWPA 2IQAA 1YEJH 2VLJE 3DV4A 2IAMA 3DXAA 1F8TH 4Z7NE 1TMQA 5A6IA 3KXFB 3T8XB 4JFPB 2B3OA 3W3BA 3R06B 3U9WA 2XWBB 1GZQA 3DSNB 4YXHH 5LHDA 1IGML 1Q94A 4RMRA 5C2BL 4HX1A 3MUY1 1LWRA 2ESVB 5JXAH 2XPYA 3VFVB 1K4DB 4AEIL 2V3DA 3L4WA 5D7KD 5IQ7L 3KLSA 2V2TB 4I8NA 1ILSA 1SBBA 2NY4D 2X5PA 3U46B 1EA9C 1JWUA 1MAML 3UXFA 4EIZC 3G9VA 5E4OA 2BIJA 4L4VE 4S11A 4XCFH 4F7MA 2D03H 2K7QA 1ZGLM 1CYXA 1C12B 1U8OB 4LCYA 5GGTL 1DJXA 2B16A 3V4PH 1IBBA 1MFAL 2G2NA 2COVD 2BNUB 4YSPA 4R0SA 3GHBL 3QUZD 3KPSE 1IM3D 4GG6E 3TC9A 3I6GB 3PWJA 1KN2L 5G5DA 4H5SA 2X0VA 15C8H 4H0IA 4JY6B 4ZQKB 1QZ1A 2V37A 3BPCA 3WNNA 1BFSA 1A6AB 3O3AA 4XAWL 2JE8A 3E80A 1OCWL 1IFGA 2QTVA 5ENWB 3PP4L 1SXNA 3KLLA 4PJ5A 3GMOA 3D07A 4K3EH 4XC1L 1DVQA 1AZRA 3S98A 1P5UA 1QVOB 2NY3D 2UXTA 4HJJL 5FV1L 3LS4L 3H9SD 1V3KA 2NYZA 2EDOA 3OJVC 4N26A 1JZ3A 3ZE1B 4TSCH 2XI9A 1HEJC 2A99A 5IB1A 3EHBB 1DQLL 4M1GL 4DKDC 5C09E 1G1HA 1HL5A 4F8NA 4JPQA 3PFQA 5AZUA 1VFMA 1KTKE 1CXIA 4APQB 1E4JA 3DJRA 4UQ2B 2VKXA 2EUWA 1YDPA 3II3A 1DBBH 3AGVA 5LBVA 4KKAD 3OBAA 4OFVA 4ZDHA 3KLHC 1Y6MR 2CG9X 5T1KB 5MEQA 3PQYA 2VC2L 3S7GA 4DFIA 1TUPA 2NXYB 2HH0L 2ZXDA 1DVZA 4KZDH 1CD1B 3QCZA 1LP9E 2E7DA 4JGNA 4UANA 4P23B 1NFDF 4WHYH 3MYJA 4DKEH 5TQ0L 1A7PH 2QHRL 3OJ2C 3F7VA 3CVBA 2OCCB 1HOEA 4NM8H 4XBPB 2EDRA 4H0LC 2UZXB 2JKWA 5AAWC 4E36A 2V2TA 4F9LA 4BWWA 3RAJH 2VDLL 4XPGH 4AGOA 2ATPA 2EIZA 4YPGA 3L9EA 4MXQD 1FVEB 1B2YA 5BXFB 5A2KH 3LDBB 1PW3A 3PHQA 4C58B 2KZWA 4UOW0 1JRHH 2Y25A 3EYVB 5CUSL 3WTUA 2XU9A 5AB2A 1I9JL 2Y69B 1DQJB 2WNKA 5F7UA 4OCRL 5F96L 2FJNA 1IKFH 4XHQA 2WLIA 4C56D 5JHMA 3RGVA 4Z8FL 4JX0A 2W59A 5FGBA 1KULA 3EYFB 4IBVA 2B4UA 3MBXL 4JG1L 4P8QA 3D6GA 4OGZA 3NIGF 2K78A 1FYHB 2F74B 3QPXL 3TV3H 5J12B 3MACH 2WLNA 1Y1UA 3O3EA 3QULB 1QUNB 4XC3L 4IRSB 4PJXA 3T77B 1OD7A 1Q0XL 1WGOA 3W56A 4YHOH 4LSVH 1H8OA 1KPRA 2XRAH 1SLXA 2W5PA 4KMQA 4PMFA 4A2MA 4XNDA 1ZJAA 4HIEB 3DBSA 5IBUB 3KCPB 1OALA 4QUOA 4HKBB 5IROD 2BS8A 1TENA 5EZJA 3ARSA 4GRLD 1MHCA 1G6RH 2WAQA 4G6JL 5K39A 1N4XL 1K5WA 1WYJA 3RO1A 1EQWA 4PI2A 3VWJC 3QUKB 1XGRA 3QUXB 2R0LH 5INDB 1DQTA 2VDMH 4BKTC 2GK0B 4L2YA 2UY7B 4NNYA 3B37A 2P5PA 3KE0A 3P9MB 3MRMA 3THMH 3UZQB 1FAKT 1CR9L 1N8OE 1NC2D 2VLKD 3MCLH 4PWEA 1TTFA 3HS8A 1FO0A 3FBKA 4OZFB 4BXSV 4L3CB 3UPAA 1OL0A 2FIKA 1KJMA 2XVKA 3UAJA 1CFSA 4ERSL 2YPLD 3CBRA 4JS7A 4ELDA 4Z6AT 3K71A 3OKDB 3S35L 1VADA 2HWZL 3PJSA 5C07A 1F6AB 3JWOL 5HHXH 5LDUA 4I3RH 1AP2B 4FJ6A 3QFJD 3BMWA 4NZUH 4MB1A 5I71B 3VD7A 3SBWC 4PJ8B 5EOQH 2R0ZH 5DMYA 5DMJB 1E4WH 7PAZA 3FU8A 3IFOB 3NIDB 4FMKA 4B7IA 1BZCA 1A7OL 1HHGB 2YAEA 2ZX7A 4PBXA 1QFWM 1AHWC 3NIFE 4GO8A 3Q5YA 5E6YA 4GYBA 3C5JB 4Q97A 5IW6B 1JRHI 2VLRA 2YK1L 5EOTB 5A7EA 3EFOA 5B8CB 1A14H 3FO0L 2DH2A 3GIVA 3I80A 1V55B 2E86A 4EDWH 1CVRA 1E8YA 2DQMA 1WFJA 2W9EH 1OSZA 2YAHA 3H9ZA 4WCYL 3T0BA 4NQUA 4A7SA 1PZSA 3AQZA 2O6DA 3C6LB 4GS7B 5F21B 3SDDA 4HUWA 5EC1B 2XN9E 3GIZL 3IRZA 3ELQA 3ZZLA 5E24E 1A9EB 4FHJA 1RUKH 1DL7L 2P5EE 3LEVH 3CFEA 4XBGA 3ULVL 3D7PA 4KXZH 1D5IH 2Y5EA 4KBPA 4KAQH 4UDTA 4YBQD 5KSAC 3O6LH 1QYGH 2X70A 4F2FA 3SEPA 3LH9A 3MJ9L 3EDKA 1F11A 3JWNH 4U6XA 4LVHB 2YUZA 4X50A 1IGIH 2OXGA 3Q9QA 4KZEL 1ETB1 4PRAA 1J9CT 4H8PA 1NCWH 3VFOB 2R1YA 4IS6B 4DF9A 3FCUB 4JPWL 1ETZA 1I57A 2WN2A 1XF4B 4NQDB 2AEQH 4RZCA 5D7LA 2H6PB 1E43A 1U9KA 4EZLA 5KYYB 2G75A 4MB4A 3GRGA 2HVJA 5JYMA 3M1BB 1LE9B 1PZ3A 5IUSA 1FZKA 3K46A 4H2AA 4Q6IA 4ZZKA 3BZFB 1E2WA 5DVMA 5IJDC 4H20L 1AQDB 2EEBA 5AWXA 1CDJA 4LKCB 3SDAC 1S6NA 5HI3D 5IOPB 4LFHG 5MERA 2IMNA 4B53A 2F15A 4PVNA 3MLSH 3ARGD 1XSJA 1E27B 2HP4A 2X4SB 5B38B 2I75A 1PCSA 4FQJL 4Y5YC 5EU7C 2N1KA 2PXYA 5EUOA 5F7FA 4KKCC 2HKAA 4DH2A 1UUNA 1Q38A 3OXSA 4X7TB 2I1YA 4NNPH 1NBCA 2IADB 5CGYD 2F6ZA 2CHWA 3N43F 4HC1L 4OLVH 3KXFD 4LDCA 4ENEC 3GSRB 2WWNA 1H0DA 2UV3A 1IKOP 1NCDH 3DA0A 1VFAA 4E41B 4GEJA 4XN7A 1P9MA 1T1ZB 2W65A 4Y9BA 1KFAL 2ESVD 1QSFB 2XKSA 1BJ1H 3FF8A 3K2IA 3NJLA 1ZIBA 4M56A 4ZS7L 5IK3B 4LPVA 3JZ7A 1UXLA 5GZOA 5I66A 1WIUA 2WO4A 3ZXAC 3DX9B 3OKLB 2F61A 2O26U 3TIDB 5DZOA 2FHBA 4XP9H 1N5YH 2F5AL 3GMNB 4PHZA 4JPVL 4OKVB 2Q10A 3V6ZA 3SKNA 2VH5H 3QQDA 5E9DE 1H3UA 3E1ZA 5EO9A 5TFSL 1EZVX 3OKOA 3H53A 4MJ6A 5JIQA 2YOCA 1QNZL 5HHOE 4FTVB 2WLJA 5CD3B 5AVSB 1SUJA 4XVOA 3BJLA 2J2ZB 1A9BB 4DOHE 5DHYB 4A39A 3JTTA 4KYRA 4EQ3A 3ARUA 3FTSA 3MRGB 1T03H 1OTUD 4PCTA 5TK2A 2QLYA 2IDSA 4NZRL 5FYKH 1IQDA 3ZKSD 4JFXA 4JG0L 3V0EA 3ILQD 2HX9A 3MOBL 3VFUB 4E9QA 1CXEA 1P5VA 1H9VA 3BZ4A 1P3DA 3P4NB 2FAUA 5HY9A 4D0CA 3B9KC 1FA4A 1FG2A 1IBZA 1OF0A 1YCSA 5C0BA 4QRPA 1IBGL 3D9AL 4MAUH 4HMDA 4ZMLA 3AC0A 4NERA 4LVNC 4G8GA 3I3BA 2KZBA 2DMCA 1TKWA 2R0BA 4Y4HC 4XH2B 1YJDC 1Q90A 2WGNB 3D0LA 2V8MA 2HLFC 1JPTL 3C87A 4DK6A 3EHBD 4A37A 3O6ML 1ADQL 4OIBA 2VXQA 4HJ1A 1ACCA 3EG9B 4GKSB 5DD1H 1OF2B 4APQD 4X6EB 5KN5A 4W9LC 3MNMA 2Y24A 4OZIE 3VGEA 4BK8A 1RHHA 2XY1A 2ZUSA 4LEXH 1I85A 3N9GH 3BUDA 2PPEA 3O8XC 5T1KD 4KKRA 1E90A 4OKDA 4YFLI 4XXCA 5TF1H 3K8KA 1FG9C 1KXVC 4H8WC 4LF3B 5C0NC 4BUBA 5FA4A 4OFDA 5IQMA 1ETJA 4U2ZA 3QPKA 4JPIA 3HUJF 3OM3B 4P23D 5ECJE 1LEIA 3AXLA 4HZLB 3BGMB 2VSKB 3LN4A 3HLAA 3IDUA 2K6WA 4H25B 4BZ1H 2Y1OA 3FOLB 4Z0XB 1TCMA 4MD4A 2VN3A 1A6UH 3I85A 3BKMH 2AQ1A 4Q9QL 3AFLA 4GBXD 2DJMA 1BZOA 2Q9OA 4KY2A 4M4RB 4DKTA 1FLRL 1YNTF 2F18A 1ZT1A 5GGRA 2UUOA 4KVNH 1JGDB 3P1VA 4K73A 5CJXC 3U1QA 3IRPX 4JRYB 3O11B 3U83A 4DCQA 3QWQB 4C59B 2BSCA 1U91A 4N0YH 3WXVL 1I9IH 3F7RA 1FZMB 3K6FA 4ZYKB 3VSQA 5CP3A 1UA6L 3BAKA 1HDMA 4UAHA 4Z7UA 4X6BB 4FQPA 3VA2C 3DHMA 43CAB 1MEXL 4N1EA 5C2UB 1PPIA 3BSHA 1B0GA 3QZMA 3E6FB 4QWWD 5H94B 1KSRA 4MBBA 3BW9A 3HKFA 5EEXA 1A1OB 4F1SA 5IMMA 1KPVB 3AQXA 4L4TB 1X3DA 1C5DA 4W9IC 4YN3A 1XAUA 1YEGL 2IDCA 3AU1A 4IRSD 3L3DB 4N0FB 3SPHA 1U24A 2A74C 4ZXBB 3GI8L 1UWEL 3QJHB 3BLPX 5HGAA 3KLQA 1KGUA 3FT1A 5J06A 1HINL 1HS6A 2CO6A 1F13A 3L1OL 4HT1H 1KGCE 4LOUD 5HHNA 2V2XA 4KV5F 3TA3A 2PR9A 2AJUL 4WFED 5C0EB 3RGOA 1NSNL 3QUXD 2D7PA 4Z3JA 2Q7YA 1ZLSH 1ET8A 4FS0A 3ROLB 5EA0H 3VYPA 1ZA3A 4P4KC 3EFFA 1EAOA 1XF2A 3PL6B 2QLVB 4GNKB 1KCSL 4KNTA 1EAPA 2GSGA 4PJFF 1OSEA 4JL2A 2H0EA 5IHUH 2ICEC 1NM9A 3SDCC 1CTOA 1KLFB 3QA3A 4LLWA 3BDYL 3FYIB 4UM8A 3BPOC 3LNGA 5I75B 1KBGH 4TLUA 2R83A 3LMJL 3VXSE 5LWYH 4E9RA 1XTLA 2AC0A 1DVXA 5AAMA 4LCUA 3KGUA 4LAJH 3P4MB 4JKKA 1INDL 5B39B 5EBLB 4PJ8D 4YZFF 1FVDB 1D5MA 3GO1H 3UO1H 1CD9B 1I53A 2WBXA 5HVGB 1ZVSA 2J1WA 2VXVL 2BY3A 2CJSA 4FKHA 3W81A 1FYTB 1HSAB 5JNYA 2YRPA 4S0HA 3ENEA 2NNAA 2EXSA 4NPKA 5D1XB 4TOYH 2P8PA 3BAYA 2A9BA 3TNMB 1TQTA 4M43H 4LO9A 3K0YA 5D4JA 4ZTEA 3TIEA 1YN7B 3D25A 3OLIA 4IDJH 5KOVC 4P57B 3NABH 2VL5B 5KBNC 3PWNB 4R6UA 5SWQB 4YHZL 4XVSL 1T2JA 2ADFH 2XBTA 4RESB 1TIUA 1JXDA 2DIJA 3RUGA 4W9ZA 5C0CA 4HAGA 2OM5A 2FO4A 5C0RH 3O2DL 4XVJH 4B6ZA 1KDJA 1U8JA 4N2EA 2K45A 5LQBH 5K33A 1HHHA 2Y07H 3QUYB 5IHWA 1SHSA 3C6LD 4LCWB 1WCBB 3MV8A 5FF6B 5DYFA 4TUJA 4R4FH 1MNNA 5C0GA 1A7NL 3BSZL 4XCEB 1KGIA 4BGDA 4DKAA 3MO1A 4LESA 5FA3B 4OLXH 1BZ7A 3WFEH 3WIIH 5F72S 4DHLA 3QR1A 2WQRA 3HI5H 4POZD 1EXGA 1CPUA 3IJ8A 2GABA 5L0QB 3COOA 4MA8L 3RKDC 4I48A 1G7GA 3VGBA 1ASQA 2O61A 4PJCF 3APDA 2HVKA 3MLXL 1GY2A 1XF5B 4EOWL 1MCLA 1RZ7L 3DMMC 4MB5A 2NLJB 1AS6A 4PW9A 1RERA 3ZK0A 3CUPB 4R26H 3WFDL 2G2PA 3BVDB 3WI9A 5EHPA 3OAWA 2W1NA 3I74A 4NQDD 4Y14A 2VDQL 5JO5A 5LBSH 4RWHA 3AS0A 3ARFB 1GJIA 2D0GA 4S1DD 3IE9A 4HKXA 4QBWA 1BP3B 5AWNH 3HB3C 3K5RA 4G7QB 1DLHB 1XMWA 1NANH 2APVA 2CRZA 2MEJB 1DJGA 3EO1A 4LGRB 4PFEA 3MUUA 1KY6A 3S37H 3Q1SL 5IZ7A 5E03A 3ZO0A 2XFXA 3FTUA 3G5XB 1QSEB 5SWZB 1D9KA 4J3UA 4JDVB 5HYSA 4EI5B 4UIKL 4DQOL 1AMYA 1KXTA 2ZOUA 3QIWA 1DP0A 1MVYA 1NMAH 2H2PD 4P05A 4NCDA 2QGCA 1SFDA 4XNQB 3DVFA 3IU3B 3CD4A 1EHKB 3CH1B 1X5AA 3Q0HA 3LV3A 1E7VA 3UTPD 1SLUA 1BJ1J 4RLDA 2B3IA 5MP6L 2AJ3A 3QDJB 4RGNE 2R56H 4YDLB 4IBWA 2FSEB 2EYTB 2WCSA 4UU9A 2ZP8A 3TVMB 3JTSA 3MLYL 3LIUA 4N86A 1IV8A 4RFOL 5SX5H 2VITB 3DTUB 1QSFD 3QORC 5DD6B 1OT1A 2P3YA 3A47A 4OCWH 5KWYC 5LNGA 4BKLB 2AMGA 2CPCA 5K1VA 2I3UA 1C08B 5DEZA 1CI5A 1KN4H 4Y1AA 4CN4A 2XPGA 5AB1A 1J8HE 1LHZA 4NQCA 4ODVH 1BQRA 4FNTA 2JQAA 3CN4A 4J23A 1CXFA 3DUHA 1KIQB 1QAWA 1CE1H 3CSBA 3O81A 3T65B 4ODUA 5ADPH 2GIYA 4XP6H 1WFMA 3KYOB 3RFZC 5D1ZB 4RAHA 4K9EH 4UT9H 4GINA 4OI9A 5I1HH 2A9DA 4IRJA 3KYMA 4E0RA 3RWDB 2W9DL 4DK3A 2DQFA 1AFVL 2JJSA 1INEL 1W6WA 3NYKA 2BNQE 1VIWA 1HWWA 5EOCH 1P0SE 3VX1A 3BN9D 3OAZH 4JY4A 1BZ9B 1QG3A 4YHNB 3W0WA 4F7PB 3UBXB 3WGUB 3Q5TA 4JN2A 1NLBH 4N2NA 1H3PL 4AJ0A 2H3NA 1QOKA 3MAWA 5ANMB 5BQ7A 4AUUA 3NZ8A 4U3XA 4ENZA 1VENA 2VAJA 4MS8C 5C3IA 3ARDC 1YEFL 1AGFA 2NR6C