3V0DA

Crystal structure of ciona intestinalis voltage sensor-containing phosphatase (ci-vsp), residues 241-576(c363s)
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
325
structure length
324
Chain Sequence
NKRRYRKDGFDLDLTYVTDHVIAMSFPSSGRQSLFRNPIGEVSRFFKTKHPDKFRIYNLCSERGYDETKFDNHVYRVMIDDHNVPTLVDLLKFIDDAKVWMTSDPDHVIAIHSKGGKGRTGTLVSSWLLEDGKFDTAKEALEYFGSRRTDFEVGDVFQGVTASQIRYVGYFEKIKKNYGGQLPPMKKLKVTGVTITAIQGVGRGNGSDLSMQIVSERQEVLLCKFAEGYNCALQYDATDDCVTCEVKNCPVLAGDIKVRFMSTSKSLPRGYDNCPFYFWFNTSLVEGDHVTLKREEIDNPHKKKTWKIYRDNFTVKLTFSDAED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A glutamate switch controls voltage-sensitive phosphatase function.
pubmed doi rcsb
source organism Ciona intestinalis
molecule tags Hydrolase
molecule keywords Voltage-sensor containing phosphatase
total genus 113
structure length 324
sequence length 325
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00782 DSPc Dual specificity phosphatase, catalytic domain
A PF10409 PTEN_C2 C2 domain of PTEN tumour-suppressor protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1110 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3v0dA02
3.90.190.10 Alpha Beta Alpha-Beta Complex Protein-Tyrosine Phosphatase; Chain A Protein tyrosine phosphatase superfamily 3v0dA01
3F9BA 3ZMQA 5KA3A 1NWEA 2PT0A 3MOZA 3F41A 1YTWA 2F6ZA 2QDCA 2A8BA 4GE2A 3D44A 2FH7A 1V3AA 3I7ZA 4HJPA 5K9VA 2I5XA 1NNYA 4J51A 2P6XA 3ZMPA 5IBSA 4YR8B 2I1YA 2G6ZA 2PI7A 1C83A 3LJ8A 2HCMA 3MMJA 1BZCA 1G4US 1G4WR 2QDMA 4BPCA 3QCFA 2B4SA 4OHEA 2AZRA 1A5YA 3BLTA 1U25A 2GP0A 4GE6A 1ECVA 4Z6BA 2FHBA 2OC3A 1LQFA 4GFVA 1T48A 1XXPA 5BZZA 3OLRA 2I42A 2B3OA 3ZM1A 5BUGA 4NWGA 2BV5A 2NT2A 1YGUA 2F6FA 2I6JA 2BGDA 1M3GA 3OMHA 4GRZA 2I75A 3S3HA 3V0IA 1YN9A 3EAXA 2F6WA 2GJTA 4DGXA 5KA4A 2HNPA 1C86A 3RZ2A 4NNDA 2CMCA 1WCHA 2B07A 1FPRA 2GWOA 4R0TA 1YGRA 4ERCA 1JF7A 1LARA 2CM3A 2NZ6A 3F99A 3QCMA 1L8GA 1OEMX 2H4VA 1R6HA 2HY3A 5KABA 2F6TA 1FQ1A 1ZZWA 3QCJA 1EEOA 2FHFA 2J17A 4WU2A 1PTUA 4RKKA 5BX1A 2H4GA 1J4XA 2PA5A 5K23A 1GWZA 3QCIA 4QBWA 1PA1A 3V0FA 3D42A 4ICZA 3CWEA 1PA9A 4PVGA 5I6VA 4RDDA 2J16A 3O3LA 2OOQA 5IBMA 4GRYA 2I6MA 3RO1A 3O5XA 4JNBA 2QBPA 4RHGA 2I6PA 5KADA 3O4UA 4GWFA 3ZM2A 5KA9A 4OHDA 3N0AA 3ZM3A 4R0SA 1D5RA 1YPTA 1QXKA 3CM3A 1Q6JA 1VHRA 1Q6TA 2CFVA 1G1FA 5KAAA 1P15A 5M43A 5K9WA 3ZV2A 1MKPA 4QUNA 4GS0A 1PTTA 2QCTA 3S4OA 2YA1A 3SR9A 2F46A 5LXQB 1BZJA 2J72A 2Y2FA 2HXPA 1G7GA 1T49A 1C85A 1U26A 5EHPA 2I3RA 1OETA 1X24A 4ZI4A 4WOHA 2HVLA 2VEWA 3QCBA 3GXHA 2CNGA 2VEXA 2J71A 2NV5A 3S4EA 2FJNA 1G1GA 5BZXA 2C46A 2I4HA 1WRMA 1XRIA 2HC2A 3EB1A 3BRHA 1G7FA 4H34A 2BGEA 4QUMA 2I6IA 5K24A 4B04A 1QZ0A 4OHIA 2CNHA 2MBCA 3QCCA 3A5KA 2PQ5A 1YZ4A 2SHPA 1I9TA 2VEYA 1YTSA 2OZ5A 4H1OA 1T4JA 3QKPA 1FPZA 2JJDA 1Q6NA 3SMEA 4JMJA 3GXGA 2QBQA 2Q05A 1NO6A 2I4EA 2A3KA 4YAAA 1OESA 2G59A 4KI9A 2CM7A 1GFYA 1Q6SA 2QDPA 3M4UA 3QCNA 2NT7A 1LYVA 2HNQA 4GE5A 4ZN5A 2F6VA 2J16B 2VEVA 1ZCLA 3QCHA 3PS5A 1NWLA 1YWFA 2CMAA 1OHEA 4QAHA 3NMEA 5EHRA 1Q6PA 5KA0A 3V0DA 3EMUA 1OHCA 2RF6A 4QAPA 3AWEA 3I80A 1OEOX 1PTVA 4RI4A 3D1QA 3D9CA 3V0GA 2IMGA 2VEUA 2I3UA 2FHCA 4WTYA 4DGPA 3RGQA 4NWFA 3BLUA 2H04A 1C87A 2YOCA 2YDUA 3S3EA 4Y2EA 1PYNA 1RXDA 5K25A 2C7SA 2CM8A 1OEVA 2ESBA 2F6YA 2CMBA 2P4DA 4RI5A 3V0JA 1YFOA 4PYHA 4D3RA 1XBOA 2F71A 3V0HA 1KAKA 1PXHA 4ZRTA 3EU0A 2J43A 1ONYA 4HJQA 3AWFA 2Q47A 2PSZA 3H2XA 4KYQA 3BM8A 4NYHA 3MOWA 2BIJA 3QKQA 3EZZA 3D1OA 2OUDA 1EENA 4GFUA 3F81A 5KACA 4JMKA 5KA2A 4WU3A 1ZC0A 2CNEA 3A5JA 1YTNA 2HC1A 2I6OA 4BJOA 5KA8A 3AWGA 1XXVA 4MBBA 2Y96A 1Q6MA 1ZCKA 4KYRA 2ZMMA 3QCEA 2B49A 1PH0A 2H03A 1C84A 2AHSA 2B4OA 2CNFA 4RH9A 2E0TA 4OHLA 2HB1A 2F70A 3U96A 2I4GA 2J73A 2FJMA 4RH5A 3O4SA 3QCGA 2M3VA 2PBNA 3RGOA 5MMZB 2NLKA 2J44A 2NTAA 2R0BA 1NL9A 3V0EA 3S3FA 5K22A 1I57A 4R30A 2QBSA 3S3KA 1L8KA 1RPMA 2ZN7A 4OHHA 4JBCA 2CJZA 4HRFA 2QBRA 2QCJA 2H4KA 1PTYA 5HDEA 2H02A 2CM2A 1Q1MA 4D3PA 2B4UA 1ONZA 5AWXA 1G1HA 4IKCA 4D3QA 1XM2A 1WAXA 3QCKA 2WGPA 4TVVA 4Y14A 2CNIA 1U24A 5KA7A 3O4TA 2DXPA 4QBEA 3B7OA 3QCLA 4I8NA 3ZM0A 5GTJA 1SUGA 3D1HA 4AZ1A 5KA1A 3I36A 5J8RA 1AAXA 1KAVA 3QCDA 2B4PA 1OEUA 1JLNA 2QEPA 3F9AA 4NX8A 4S0GA 1OHDA 1BZHA 1NZ7A 1I9SA 1C88A 2BZLA
chains in the Genus database with same CATH superfamily
2IPTL 4DN3L 4W9GC 4Z7WA 1IM9A 5D7JD 2GCAA 3B3IB 3MU3A 3QXAA 1J8RA 5IUSA 3M88A 4YBQD 1ZSHA 5AZ2H 3QDJD 3SDCC 4OZGA 4KTEL 4NM4H 3ARBD 4NQSB 4P23B 3OJDA 4PUBL 1VZHA 1OP3H 5E8EA 4H13C 3GB7B 3V4PB 1AKJA 4IRJD 4PJXA 2FJFA 3L13A 3IF1A 4JO8A 2D4FA 4KZCA 4ZO6A 3VCLB 1PNCA 5CD5D 1GGTA 1CFVL 4JO1L 1O7DC 3QNZB 5DUPH 4JRYB 4M9PA 3BGMA 4PRID 3EH3B 5ALCL 3H6AA 4TLSA 4R90L 1XGQB 2WQAA 3IDNA 1N9PA 3HG2A 5EWIL 1KTCA 4PJCE 2DQHH 3ZTEA 5T1LA 2Z93A 1QASA 4KI5D 4WHYH 3G5XB 5I8KL 5ID1A 2KMWA 2EE6A 3NFNA 2TRYA 2IWFA 4QF1B 3KPMB 3U4BH 4Q2ZB 4GE6A 4KTDH 1JPFB 1RULH 1XF3A 1LVEA 4GW5B 2HFGH 3BC9A 1DUYA 4L4VB 3BAXA 1EEUA 4OGZA 3CLFH 3QCUH 5E00A 1MF2L 4AV5A 2FX7H 2GHWB 4AQEA 1OPGH 2OYMA 4X4ZA 3L3GA 3TA3A 1Q4NX 1I9JL 4KVCH 4X4MA 1AYRA 3WN5A 1FV1A 2BOBB 4LSQL 2XV2A 2NY2D 3QWOB 4RAHA 3OMHA 1F4HA 2GY7B 5DD6B 3IDNB 4OI9A 3HI1B 4FNLH 2QVFB 5GISL 4LVOB 3EGDB 2RGSA 3CSPA 4M6NL 4M7LL 2YN5A 5F89B 1CU4L 4CW1B 1UYWH 5KVDL 2XC8A 3NG5A 3DARA 3MNVA 3QS2A 3RWIB 1BP3B 4YHYB 4LL4A 3L5WA 2PTTB 2UZIL 4NYLA 2BRRH 4LKXA 3UROR 1DBJH 5C0JA 1WCHA 1F4YH 4AZ8B 5EZPA 3NVQA 5F72S 3S6CA 4Q9QH 5I2IA 5C7XH 2FQDA 2WNWA 4XNYH 1D5BA 3VDCA 2PYEA 3O3DB 3EGSB 2BHZA 2AK4B 2WZ6A 2H8PA 4NZJA 2MNJB 4N3TA 2AQQA 4IHOA 5F7EH 4K2UL 4Y5XC 4OQTA 3UMTA 5D2LE 4J3OH 2NX5D 1TXKA 2DEYX 5DRXA 3MJ9H 3HBPA 2EDRA 5AVUB 2AV1B 2B15A 1A4JA 2J1WA 5EFIB 2A1WL 2XCMC 2ZCLH 4IBTA 4TS6A 1HEHC 3T0EA 1GL4B 4J3OC 3KZ8A 5HHVH 2WBJB 2JV6A 2Q87A 3I9GH 1P69B 4YLCA 3FN0H 3V0FA 5LKNA 2H32H 5L7XL 4JG1L 5B7FA 4W6YB 1CL7L 1JHTB 4CVLA 1MCIA 4YK4C 5AB0A 3ZTCC 1PKQB 3LEYH 5ESAB 4N5EC 2RHEA 3IMWA 2CWRA 3SKOB 3GI8H 3VG0L 3LEVL 2QMJA 2XG4B 4WFED 5L6YH 2BY3A 3COOA 2BVPA 4HEPA 2JSFA 3WG7B 3FUFA 5F1IB 3C75A 2YK1L 4XHJD 5MEOA 2Z7UA 4W81A 4PB9L 2LOEA 3UTTE 2ZP0T 5DQJA 3EO1B 2B20A 3KPRB 4X9HA 4I0PC 4ODXB 5BS0A 3MKKA 5D1XA 5SX4H 3MRIA 4FI6A 1I9RH 1HCFX 4PGDB 1U42A 2N7BA 4UZSA 5LGJB 2NY5C 2C34A 5IB1A 2OMWB 5F6HJ 4PJ9A 1IB5A 2CO6B 1NJ9B 5G5DB 4BSWB 1NBZB 2Z1PA 2XVKA 4WFHD 3ILQC 3L3HB 5KYXB 4X5WA 1YN7B 1AZRA 5F3BB 1KYOK 1OSYA 2R2BA 1HHGA 5D96B 1HTYA 2C3HA 1MAJA 2D7PA 2ZX8A 5K9WA 1PYWB 1JBJA 1OARL 4H8QA 3T08A 4EEEA 1J9CT 3DECA 5HYIA 2Y4SA 4Q8BA 4PJDA 5I6NA 5KOVC 4X8JB 5KSUB 3Q06A 2XTJB 4Z8FH 2LTQC 3CZJA 3LKQA 4DKEH 4UILH 3QPXL 1HCZA 1UG9A 3PHAA 4NHUA 4Z3IA 5J13B 3FT9A 4NKQB 3SDYL 3MJ7B 3TH3T 3UPCA 3I74A 2R56H 4HWBA 1A7NH 1T6WA 3GLDA 5EZJB 3ELAT 3LX9A 2IWEA 3MRCA 3VVWA 2P8MA 3QWOA 5ABZA 3MC0A 4AQEB 4WNJA 5IHUH 5HHMB 2NV5A 2HFTA 5AYUH 5EBLA 3L3GB 4G1EB 1CURA 2EEXA 2I4HA 1AR1C 4M56A 5IREA 1FGSA 4PG2C 2QVMA 1MVYA 5IBUB 2D7MA 4UQBA 2K0RA 1YEJH 2NTFA 4J3VA 4NPJA 1RZIB 2VR7A 2OM5A 5HYSB 4G8GE 4XP6L 3HS8A 3QDJB 3QISA 3WTSA 3QFJD 2G30A 4KXAA 1EHLH 2YZ8A 4WUUD 4OHIA 4IRZH 3BH9A 3QCCA 3CNKA 4N0RA 4ICXA 3FAWA 4GRWB 3WSQH 2ZWSA 4YUEH 3AG2B 4MQXC 3VM7A 4HUXB 4L8BB 1R5VA 5GHWL 3GXMA 4E41D 1R5WB 1NICA 1OEZW 1JNNL 1PZSA 1O75A 1I1FA 4JDEB 1UTDA 1KN4L 4LVHC 3DOSA 4RGNB 1QUPA 2GAZA 4QRBA 1JN6B 2PPDA 3NJFA 1DYZA 7FABL 1QSEA 2AQSA 1Z1WA 3BZEA 2LLLA 2DKUA 1IM9B 2GJ6A 1FRGL 5D2NE 5IQNA 4GLRI 4PJXF 4GSDL 3QXAB 1MJJB 3RTQB 3C6LB 1OF2A 3M4UA 1AQKH 5SWSE 1Q72H 1P9MA 4A6YB 3FOMA 1CK0H 2FLMA 3ARWA 2HH0L 1F11A 2YRBA 1J86A 1INDH 2B5IC 2ZXQA 4NLAA 4UIMA 4Y7OC 5HSFA 1GOFA 2I9TB 1JNHB 5SX5K 2HTLD 3A67H 1LO3H 3QUZC 3L9RA 4OSUL 2HG5B 2P5WD 4X7SH 4W1TA 1S5IH 1OHEA 4YFLF 3N55A 3VFUB 3QUZD 3TVMB 1JPSL 3HNVL 4XP1L 4LVHB 2G60L 4P5TD 4RGNC 4MRBA 2X6AA 3JWOL 4W93A 4OQTH 2NCMA 3QRFM 3RX9A 3BW9A 4Q4IA 4JRXA 5DDHA 3U6RA 4HOZA 3TESA 3RIFK 3IKCB 5B3NA 5MEND 3VX0A 4WTYA 5AW2B 4X98B 4PRHD 3ZDYB 4WW1A 5E4AA 2NTSP 2VDQH 2H04A 4J23A 3EDKA 3RFZA 2QDWA 5HTSA 1PZCA 4PFEA 1O6TA 4HFUH 2FVNA 3RGVC 4FQHA 3GBMH 1RZFL 4PY7B 3LJ3A 4WCYL 1YPZE 4JLRB 4KRPD 1NUNB 4PYHA 3U6XA 3DPBA 2VDRH 4AZUA 3V0HA 1EK3A 5FCUH 2UYLA 2WUCH 4NM8H 1MFBH 1ZV5A 2ZG3A 4PBDA 2IANE 3KS0H 1QBLL 1KCUH 1NBYA 4TKWA 1GC1C 2N4IA 2V7NB 2VO5A 3ARSA 4B0MB 2Z0BA 3RZWA 3ECQA 2IIJA 1YEIL 4L3EE 1G7QA 4ZQKB 4X7DC 4KXBA 1BZOA 4TXVB 5E23A 3UJJH 1W0VB 2IXQB 3OMNB 2Q5BA 3V9CA 2BIJA 2W92A 4JO2L 3UC0L 3IVKB 3Q05A 1XH3B 3X13B 1ZWIA 2I26N 2EADA 4K94C 4NC1E 1Z32X 4N8VA 3HAEA 2PPEA 2XY2A 4JMKA 1FZJA 1NANI 1J8HE 3QJOA 4UAOB 3MLPA 4WU3A 1HQRB 1ZC0A 3L4WA 1YMHA 4YXKL 2I6OA 1EX0A 1T2QH 3EZJB 5D1QA 4KXDA 5EUOA 4ANXA 1CFVH 5KA8A 1N8ZA 2C9VA 2ILLA 4JO1H 4KFZC 1MWOA 2HAZA 1P7QB 3EYUL 1MFCL 4QTFA 4G71B 3TN0A 2YGOA 4G7VH 2Z8RA 4HXAL 1HXMB 2NLJA 5D93B 5EWIH 4AQ1A 5KBDA 3O2WH 2H03A 3B83A 1C84A 3O9WC 2AJXL 2CJSA 4ZMPA 3IGUA 1X3DA 3LKOB 3AQDA 4G7SB 3C5JB 5GGSB 1BIIA 1JZ7A 3UOAB 4MJ5B 3SYPA 4UAGA 2ARWA 4H8PA 4H88L 2HFGL 4XBGA 3BMWA 3C60B 1MFAL 4NJAL 4L1DA 4LPTA 5I1HL 4QXUH 4GO8A 1R5VB 1TO5A 5C09A 5F0LB 2NY3D 2NY1D 5C0DB 1U3HC 2M3VA 1HIML 2E7MA 1I1FB 4OJEH 3WCYA 1WEJH 4MMZB 2AANA 4IQHA 4HEMA 3O3AB 4N2NA 4G5AA 3VI4B 1BVLB 3AU1B 4WU7B 1KJ2H 2OXHB 1E3ZA 5D2LA 3T1WA 2I60L 3KLAB 2GK2A 2O5XH 1XCTB 5DA0B 2GG1A 1F45A 4HPOL 2OMYA 2OPCA 1Q9KB 4AYDC 1UYWL 3HE7C 4MAYA 4QAMB 5KVDH 4CNIA 2L7EA 4AITA 4D9LH 4MZRA 2WP3O 3N1MC 3X11A 3A0OA 2H4KA 3ILPA 3QO0B 3U9PH 3U30C 3ZQWA 1QR1B 1F58H 4KI1A 3S36H 7PCYA 4PJFE 4X7TB 4X6DE 3W11C 4AM0A 4H7VA 2BSCA 1CICB 4OFDA 1K3IA 4Y14A 4XNYL 5AVZB 2PWHA 2CO7A 4K5LA 1D7FA 2IAMC 3B7OA 4QBEA 1SEQH 5C07D 4CBPA 4C13A 3CK0L 3R8BB 3RHWF 5JLZA 4NCC1 1NWPA 4UM9B 3GMNA 4YHIA 4NHUB 1ID5I 1AZVA 2BNRD 2RCSL 1HAUA 4NQED 4X5XA 2X1PA 5DHDA 4OH2A 2BNRE 1K3ZA 4IRSA 4FNSA 2BZCA 5EUOE 3PE9A 4X9IA 2V37A 3QUXB 5TK4A 5C07E 4JJOA 3QUYC 5HHVL 3GKZA 1I1AB 1BZHA 5CJQH 4C47A 4MJHA 3MROB 4EIUA 3ZMQA 2WUBH 5HGAA 3BXNA 4PGCB 4ZYKB 5LUMA 2K8QA 2V7NA 5JTWA 4MXVF 3C6LA 1YVLA 3NIGF 3DX6B 3QZLA 4HVBA 3FSZA 2BW4A 3ZMEA 3P4OB 4Y2DA 3C9NA 1NBZA 5L6YL 3D44A 4IOIA 4X99A 2F74B 4NC2B 5C6WH 5EHFA 3MREB 3S34L 2IV8A 1RQ5A 1SFDA 4AGMA 1OOAA 2H2PD 3F8UB 2AJZA 1ZA6A 3KH3A 4MJIA 4J6IA 3BE1L 2E3VA 1S3KH 2MNUA 2K8MA 2XYBA 4N8VB 5CWSB 3BH4A 4JPSA 4IMLA 3GZOA 4FI7A 3WE6A 2NCEA 3TEZA 4F9LC 4MD5B 3F6JA 1KB5H 1WFTA 4TNWK 3SO5A 2YPKB 2ZKHL 2QV4A 1J9QA 32C2A 5GSVB 4UV4L 1HSAA 1QTSA 2E75C 3H85A 3KVDD 1YLBB 4OFKA 4U3SB 4AVIA 2XV0A 3QDHA 1TZHA 2ICEC 5CIPA 4AJWA 3QPQC 1XL4A 2GTZB 3O41B 1U0QA 3SCMD 2AZRA 1E5ZA 4PWEA 1CD9B 5PCYA 2V3DA 5IK3A 3H9ZA 4CVXB 2DYPB 1GJUA 5FO9B 4WTQA 2A83A 1QRNB 3NJGA 4QRRD 1ZGLA 1OARH 2W9LA 4QGTA 4HOMA 1RZKH 2IMNA 1XXPA 1KDIA 5HGDA 3U4AA 1E4XI 4IHBA 2VH5L 4RGNE 4AGQA 4H20H 4M5YH 2GB2A 2XN9E 4XH2B 4QHKJ 2C3GA 4HKBA 2XN9D 2WNXA 2PPAA 2ZOKB 3FPXA 2VLLA 3EJYC 3QPXH 4N9GA 4DKEL 4HJJH 1J10A 4OCNC 4I2XA 2YAFA 3DLQR 2CUAA 4J7RA 2PPFA 1U8OB 4YSQA 4FQ2H 3SDXE 1T1WB 3TURA 1I85C 1U8LB 2V9RA 1ZRUA 5EIVA 3HRZA 4RRPA 3GPSA 1KSRA 4WWOA 5ACMA 2X2JA 1GGBL 1DLFH 2OMBA 3MVSA 5E8OA 1OSZA 4I0CC 5I28A 3DTXA 5AYUL 5JW4N 3WHXA 4YBQC 2J8UB 4W68A 4P2RE 2CKBL 3BP5A 1QX1A 2VL4A 4JN2B 5D7JC 4L8BA 3CN3A 4CGUB 5AALA 3LRSB 1J12A 1TNNA 2ICWA 2C3VB 2YAPA 2G5RA 4N85A 3GMMB 4WTXA 1KF9B 3T8XA 1BIHA 3DNKA 3VXME 3MBWA 3WELA 2Q7NA 2XVBA 1A6ZA 3HB3C 5FYJD 3W39B 5TGBA 3V6OA 4NENB 3EW3B 3GZKA 3QG6A 1IFHL 4JREC 1WISA 4ES8A 5KG9A 2A9MH 4KRMB 4K9EC 1FN4A 1G0DA 3QDMB 1J4XA 2J1YA 5BS0B 3OQRA 5K23A 1O6SB 2AFNA 2RFXA 1E5UI 2XG5A 1EDYA 3S5YA 1CFNB 3GRWA 5K9KB 4Y89A 4JKPL 4L4TB 1JZEA 1FGVH 1PA9A 2QHRH 2E7CA 4FXTA 1F11B 1E8ZA 3MACL 1MCPH 4AE1A 2D9QB 4N2KA 4ZW3A 2YBGA 3NPSC 4NRYB 2CO1A 2F0CA 4WEUD 5FUZH 5B1BB 5D7LD 1W78A 4ZO8A 5DRWA 5F6IB 3JUZA 1BG1A 3MV9E 5F9WC 2YGNA 4TLKA 1HZHL 1FH2A 2HKHL 4ELDA 1INDL 1YYMH 5EBGA 2ED8A 4DESA 1WA0X 2PTUA 1EERB 3ES6B 4PG2A 1NIEA 5ADPL 1QLEL 3ECWA 3W82A 3I6KA 1AKJD 1JFQL 5AWNL 4U1MB 4PY7A 4DVRL 1MI5B 4ONHB 3BT2L 1WFNA 3WBDA 5DJAA 5I66B 1BG9A 2W65B 4NKIL 4JFDD 5C09E 4AM0Q 5I1EH 3AXIA 3D3VD 1NC2D 1XF5A 2BINA 3LKSA 4R7DA 4L5FE 2IANB 1EO8H 3G7TA 1EZVX 5JOPD 3ZV2A 4K94L 1D5XB 4ZD3L 2H1LM 3WU1A 1XF2B 1QYGL 3S3BB 3MCG1 3O4OB 4WVRA 1I7RB 1NCIA 1FHNA 2Y5TA 3FB7A 5D7SL 5EZIH 3SD5A 4U4IA 4HFUL 4JGNA 1JNLH 4F80A 3WIAA 1JUFB 4ESKA 4UQAA 3ZOAA 2VXUH 1CPUA 3DUSB 5IV2B 3TBTA 5G4OA 2VR4A 4JFTA 2BS71 4DW2L 1FNSH 4QRQA 3REVA 4ZFZB 3U83A 3KHOA 4R4FL 5CGTA 4NQVB 2AZAA 3E6HB 1L7IL 1I3VA 4DCQA 4MNHA 3RVVD 4Z5RA 1SJMA 3K4DA 4M7JL 2CBPA 1EIBA 2JLPA 3T0DA 2GSGB 4HHWA 2XN1A 4X9GA 2YD2A 3K6SA 2CNGA 2YA0A 2J71A 3ABGA 3ZGHA 5D1ZC 5BZDB 4WV1B 3OTTA 1HL9A 3IFLH 1F6AB 3TTYA 2BHFA 2F53D 3R1GH 4HALA 1LO5A 3L3OA 2UUOA 3FT2A 3UTTD 3CVHH 3FT3B 4NO5A 1GZQA 4TV3A 4ABQA 3I2CL 1FFNA 1LMIA 5G4MA 4H34A 1P1ZA 3PU7A 3WHXB 4F9PA 4XAKE 2HJKB 4NWTH 4TF4A 4GIPD 4N8CL 1GC1L 1PY9A 1RUKH 4UDTA 4KRNA 1KBVA 2IALA 1YDPA 1MW2A 1QLRA 3RY4A 3ILEA 3SE3A 5MP6L 1YCSA 1P84J 1ZT7A 4XN1A 4JZJB 1HH9A 3MFGB 1XGQA 3GSXA 1ZT1A 3FH7A 4NP9A 2Y22A 2OULB 1AMXA 5IQLA 4BFRA 3UCQA 4KTYA 4IDJL 4NOBA 3T0WA 4AUYA 4GNKB 4IRSD 2VITB 4NKDB 5BXFB 4NAJA 3VI4E 4G6JL 2NTFB 4HCRA 3SMEA 3KYAA 4XRCA 5KYUB 4POZD 3QDAA 1CFQA 3HMWL 3WFDL 3WY3A 1JWMB 4Z3HA 5IB4B 2VRAA 4YWGH 1MW0A 4H88H 1OSPL 4PRBB 1HOCA 4YHZL 4YL9A 1JRHL 1ACZA 4HPYH 4OJDH 3MOAL 4KJWC 5HYEA 3FTGA 5CSZB 4F58L 4PGEB 3VFTB 3JV5A 2F58L 2LAGB 4YSSA 4W9KC 4QJ5B 3RVTD 5MERB 3SDCB 3KGTA 1DCEA 5ETUA 4MSWB 2EXWD 4QDGA 4AQZA 4FQLL 3RHWK 4JCWA 4Y7MA 5IHZB 4GI9A 2SEBB 1MELA 1ZLVH 4TQEH 4JPKL 2O5XL 2XI9A 3AADB 3KPPB 4LXFA 3MFFA 1ID2A 1EHAA 5I5IA 5IR1B 2L3BA 3VMPA 4L9LB 4CJ1A 1DN0A 2Q10A 4LLMB 2YOAA 4UOW0 4Z3TA 2IGFH 1VFMA 5E5MA 1P5VA 4YHOH 4QT5B 3B9EA 3EHBD 1DVZA 1E3XA 4OB5L 1NJ9A 4FQXD 1ZLVK 3ZZ1A 5CSGA 3EYQD 3VXUB 5A5EA 5EO0B 4ONHA 1EANA 4A7GA 1JD7A 5J3HD 2DQCH 3KPQA 5JYMA 5IESL 4PQXA 1BXXA 5D93C 3HR5B 5J57B 2QBWA 4QHMA 2HLAA 3U7AA 4JFOB 5SWZB 2RCSH 3DMMB 2XQ0A 3QZBA 4QYOB 2R0WL 4G3YH 3ZTNL 4DAGL 3HE7D 1UADC 3AWFA 1PIFA 2ATAA 3DUSA 1X5FA 3OJDB 5IV2A 3UAJD 4NKOB 5DTFA 3THMH 1MIMH 1KBGH 4WI2A 3U82B 3ZDZE 5C08A 1HHJB 2DWDA 4W70A 3D2TA 4AXWB 4JDVB 5DHVB 1I7TA 4PJHB 2ZWKA 2RIKA 1HNGA 3L3IA 1A1NA 5FUCE 1OGPA 2C3VA 4W9HC 4BZ2L 3VTTA 3QWQB 1T0NA 2YUZA 4WRLA 4IOSA 3IMRA 5FKPA 3ZDYE 2YMOA 1U3JA 3T2NH 2CNEA 1T7VA 3WFCL 5CCKL 2P7TB 5DC9B 3RBSA 1EZUA 1ZANH 2QPSA 2A38A 1A3ZA 4PJ8A 4QY8B 1SY6A 3MX0B 1AI1L 1M1SA 4K9JA 1A7PL 3OXSA 5AAWC 2IFFH 4AYFA 3OKNA 5E9DE 3PP3K 1H3GA 5KW9H 2C9QA 4YDIL 2X4NA 4MKTA 5G2NA 5C0IA 2Z35B 2X3BA 5JIPA 3T6ZA 1NFKA 1R17A 3AS3A 5CM1A 2EO7A 2VZ1A 2ZCKL 4HC1H 2WCPA 2E0TA 2EDXA 1ADQH 3ROOA 2VZUA 4XCFL 4M93C 4QR7A 4JFXB 3RURA 3D2UD 2DIJA 5CGYC 4Y88A 1SPDA 5K5YA 1KXHA 1O7VA 1HILB 2BNQD 2EYSB 2AVFA 2H9GA 3MV7B 1RPKA 4NZTL 1MFEL 5I30H 3AQXA 3I75B 2CRYA 3MUJA 2OAAA 3BDYH 2H0FA 3JBG7 4M5YL 4CRPA 4OT1L 1UFUA 3B56A 2VR5A 2NTAA 4FXGB 3KPSE 5IMMB 3DGCR 4LPVA 3IDYB 2VRKA 4L0YA 4RA0C 3G04A 1NL9A 4APQD 5IMOB 1BZ7B 5F8RC 3QJXA 4DCQB 1SMAA 1BQHG 3KYKL 3CHRA 4U6XB 3ZHNA 3DJZA 2J1XA 1S7WB 4BWWA 2PYFA 4UM8B 3ARVA 3VD1A 1U8KA 4G8IA 4K5PA 5GJTL 3ARFB 2YGVA 3K6FA 3D52A 1KUMA 5HD8D 2ICWB 2DIBA 1BQKA 2VLKB 4EMZA 3QUXA 4AMXA 2QTVA 1HQ4B 4HBCL 1FO0A 4Y2DC 2O5YL 4MA8H 3W0WE 5KSVA 4LEBA 5KG9B 3D0VA 1JK9B 1A4CA 2ZOLB 1X5ZA 5EU4A 5BPPA 1DQML 4H5SB 1XCWA 2BY2A 2GBVA 4AVKA 2UX7A 4HISA 1SJEA 4IBUA 2BHUA 3WDJA 1KLUA 3M1CA 1KY6A 4DGVH 3W9EB 2ZUQB 3UG4A 3AG4B 1UJ3B 3EJYD 1A9BB 3B9KB 3CBKB 3H3PL 3VSQA 4PR5B 3GBLA 5K9OA 3D3VE 2E86A 3V8CA 5EEYA 4BA0A 4UOJA 1IFHH 4S1SL 1IEAA 1ZVHA 1WBXB 3IU3A 2B4CC 1FNGB 1GPOL 1CLYL 1S9YA 1WWWX 2P80D 2PWGA 4L4VE 1ACYL 3QWNA 5TDOB 4D2NA 1GYVA 3CDGA 1MCQA 1MG3C 3L3KB 4LSPH 4P4KD 3NJNA 5EU3A 3BVVA 4A39A 3DK0A 3N42F 1OHDA 4R7VA 1I9SA 3BP6B 1PDKA 2B4CH 5IMLB 2AXFB 3QEQE 2DTML 2DQDH 1O5DT 1OQXA 1ZVSB 4I3RL 4P2CG 1XSJA 1XEUA 4I7ZC 5CJ8A 3IMVA 4NZUL 5E2VH 4HC1A 2DWSA 3NIFE 1QFOA 3LZFL 2VAAA 3F6LA 5C9JA 1T22A 3MNZA 5HY9A 4HJPA 1DQQB 4FLRA 4XXCA 1RKRA 4WTZA 5LG6A 3TBCA 3MRKB 3KGSA 3HZKB 4YR8B 3UGUA 2RQEA 2KL6A 3TVMA 4CILA 5ADPH 4WO0A 4JVWA 3BUTA 5FDYA 3II3A 4J3OD 3A23A 1YUKB 2PCFA 2ITDA 2B59A 1AE6H 1IAIH 3L3IB 3CAFA 4YSOA 3VYOA 3ULVE 4B97A 3F12B 3FRPB 2ZAHA 4UDUA 4NKIH 3X1EA 3T2OA 4N2HA 3GMQB 2FEEL 3BLTA 1P7QA 1SN5A 1T21B 2Y68A 1XAUA 1E9QA 1YEGH 1LQFA 3CJJA 1D7BA 4KK9C 4G6FD 4E9XA 3ME0B 2DMCA 2BRQA 4GKNB 1FGNH 3ZKXC 3BP5B 2WLNA 3US9A 3MJ7A 5K1NA 3WLWC 5BUGA 4LO9A 1R34A 2FX9H 1A0QL 1U8NA 3P11L 2F1BA 3X2QB 1W2KT 4GSRA 2BV5A 1KPUB 5IG7A 2GKIA 3HR5A 5B8CB 3ULUD 4JG5A 5C0FB 4BZ1H 3ESVF 3CXDL 2V5SA 2VGLM 3F7VA 5E51A 4PGJA 4LK4A 4NNPL 4PRPB 4N24A 4WI0B 1R3HB 2ITCB 3S3HA 2ZCZA 1ZJAA 3CFJA 2DKSA 3GSQA 3TV3H 3FT4B 5F7BA 1ZLSH 2VDKL 5C09B 1HVXA 3NPSB 5JMRA 1TU2B 1I31A 1PSKL 1NLBH 4F7CA 3RZ2A 4NNDA 2R1YA 1EAPB 3IFLL 1JXGA 3C5ZC 5B1KA 5D4JA 4HS3A 5EF1A 4IBYA 5AVTB 4MJ2A 2GWOA 4WI6A 3FB6B 3GSVA 4ERCA 3MA9L 3VFRB 4EI5D 1JF7A 1LARA 1F00I 3ISYA 3F99A 4WNQB 1BJ1J 4JANA 3NSXA 2VDPL 4K0OA 3FNKA 1I7UA 4W4OA 2XFXB 1INQB 2Z7ZA 3HAEH 5KUKA 4JBSA 5KBLA 1PQZB 5KVEL 1ZDSA 2VUYA 4ZMQA 4OIAA 5DD1H 1RUKL 1X7QB 2X1QA 1EEOA 2MPVA 5IVXE 5I5MA 4PJGA 4Y4FC 5DS8B 3BX7C 3OB0K 1P4LA 4N9OB 1OE1A 1CXEA 1OF2B 2J6EA 3B2XA 4LZKA 3VWKC 3DOIA 5CHNB 3WXVL 2N59A 2PA5A 1U91B 5ESQA 5DTFB 3AW5A 2V2TB 4HH9B 3SY0B 5M7QA 5IZ7A 3JTBA 3CWEA 1XDTT 5F1SA 2YLHA 1NAMB 2BFGA 3LIZA 1AQ8A 3CHOA 5TDOA 5JZ7C 1K8DA 3P3YA 2R15A 4P3CH 2X4SA 4FC3E 4P9MH 4Z3GA 1KJ2B 4GQQA 2E76C 2Q3ZA 3WD5L 1BMZA 3BD3A 4A2EA 3C8KA 3RILA 3UBFA 4OTXH 1A6TA 2JKWA 1U58B 4QRPD 1JRHH 1QLEB 1IBFA 3BISA 1SF3A 4I3SH 2KBGA 3MOAH 5DLML 5JXED 3WNOA 3ZM2A 1RK0A 2WZPA 4OHDA 4FL4C 4ZFGH 3O2DH 4KDTC 3DO4A 5C0BB 3IJEB 2A77H 4DP6X 3U6RB 4K07A 4U0RB 4MNQB 2AHIA 1T03H 1DQJA 4NN7C 4YQXL 4CSSA 2FBRA 1SDDA 2FQGA 4IKJA 3ZT5A 5DYOA 1ES0B 1LE9B 5I0YA 5KS9A 5FIEA 2Y7SA 4LF3A 3QUZA 3SPCA 1QXKA 3VXNB 2AJUL 1JPGA 1VHRA 5D7IF 1NGWB 1TJGL 4JHBA 2OW6A 4JX0A 1R3IH 2CMRL 3LV3A 1FVCA 1XH1A 3AXLB 5CEXB 1U2HA 3D85D 3Q8CA 3ULVF 2B39A 5CUSH 4QOKE 2BS8A 3SN6N 3TONA 2BDNL 5KS9E 4OB5H 2EEBA 1UD2A 3E2HB 2PCFB 1WBYB 5GZOC 1KGXA 2QCTA 3K2UH 4WEMB 3VI3E 5LXQB 1BHGA 1RUQH 2Y36H 3MV8D 1IX2A 3ARGB 2EE9A 3EJTA 2BP8B 5IESH 4FKKA 5EEZA 3PQYB 4X6DF 5HDWA 1ITCA 2BVUA 2VLME 4AW4A 1PD6A 3PIQB 1J0KA 3JTTB 5GGRA 3ZYIA 5HVHC 2OXHA 5D2LB 1W0VA 2IXQA 3H55A 4GPVA 4DAGH 3L3DB 1IFRA 3NCWA 5T1KA 4BFBD 3V5KA 1DTUA 5E0QA 1T2XA 5DEZA 3S4EA 3OV6A 5BZXA 1QFWM 3GRBA 2D0GA 4BUHA 3FQUB 4BH7B 4Y2OB 3SPIA 2ZF8A 1YPZA 4GBXD 3D69B 1UXWA 5TDNA 1N5AA 1WD9A 4N28A 1MJUH 1IAOA 3ARBA 3LKQB 1Q0XH 1S78C 1A9VA 1BZQK 5EEXA 1QW8A 3IFOA 4N2MA 3M6DA 4Z7VB 1GIGL 1IC5L 2PTTA 1MCDA 3CVHA 5C8JA 1N10A 2MBCA 5HVHB 1UT1A 1YEDB 2NY7H 3QEQA 1NOLA 3FFDB 1JNHA 3FN3A 3MUUA 4JFPB 1W72H 2WLKA 3PHSA 4ZS7L 4GY4A 3IN0A 3LK7A 1V5JA 4RZKA 5IVOA 2EIZB 5KW9L 4NZRL 5TDPB 1GTFA 3RDTD 1JWSA 3TBYB 5FAAA 1U2CA 3I3BA 4C83A 3MMEB 1JVOA 3HUJE 4NGHL 4M1GL 2PW2B 4FYSA 5GGSY 1A3RL 3I6GB 1M7DA 5D7KD 1FFPA 3O8XA 1FJ1B 4FG4A 1CGTA 4G42B 3VXQB 4Z7OF 4XNQB 3NCMA 4AGLA 4DN4H 5DHYA 3KH4A 4U6XA 1YYLH 5I30L 2FGWL 3Q8FA 2WBXA 3AU0A 2A74C 2BVOA 1IGTB 2IQ9L 5DK0B 5HBBA 3GSXB 2Z3FA 4JHWL 1GKOA 4YPGA 3QJFB 5AW3B 1YYCA 1PS3A 1RJYA 2IBGA 3GMOB 3BH8A 4RSVA 4MS8D 5HI3C 3KL5A 3MXVH 1TETH 3IRZA 3DMMA 4Q9RH 1OT1A 1PTVA 1KTLA 2XTJC 2CCVA 1C1EL 5F0JB 1BM3H 2HSIA 3UXFA 2CGRL 2J8UA 5BNXD 2J12B 1A8JH 5DQJB 2AQTA 1OZUA 3KR3H 4UOW1 1U8QA 4PR5A 2DD8H 2YOCA 1PZUB 4CVWA 5KYXA 1NCHA 1R3KB 3WFEH 3F5WB 4JFEE 2Y2YA 4OLYL 5E2TH 3K6IA 5F7KC 1IE5A 5JUEL 3M1OA 1YY8A 4I77L 4PV9B 3LKRA 1IBBA 1NL0H 3GRGA 1QP1A 4HIXH 1JP5A 1LNUA 3VJ6A 4K4KA 1EV2E 2BOCA 4MNGE 5DMIL 4GRLC 3T0AA 1N2RB 5FM8A 1BPVA 3M17B 2XT1B 2Y7QA 4ZXBC 4DP7X 2MQCA 2Q47A 3M7OA 3Q13A 2COVD 4FFWC 2CLRB 3SKJL 1CLYH 4M8VA 1VFUA 3CFEB 4WHYG 1ACYH 3P54A 5F8QC 4C4UA 4TNWF 1Q94A 4MXQC 3SIKA 3V55A 1CBJA 5L2KB 4N5ED 4PRDB 3G5ZA 3UAEA 1ZS8A 3D6GA 1DHKA 2ZPKL 1D5ZA 3M45A 4CGTA 4YEFA 1HHHB 2AJVH 4IBWA 3TWCL 4S0HA 4UUJA 3MLZL 1EENA 1W6LA 1KCKA 3QNZA 4PJAF 1QEXA 4ZMNA 1IUZA 3WGUB 3LZPA 5LBVA 4B5EA 4ODBD 1MHPH 1SYSA 3IWVA 1CC3A 2X4TA 3S4SA 2R83A 4ZFFB 4ODXA 3KPNB 2K4AA 4C12A 3WLWD 2Z93B 4B7IA 1DQJB 4RMSA 4ZXBA 1UH2A 4RQQA 4PLNC 5MI0C 2VSMB 2NW2A 3T4AB 4CSPA 1XSOA 4FA6A 4LVNB 4PHZA 1Q90A 3PXLA 3TYGL 2GT9A 2AHSA 2ATPA 1XTMA 4OR1A 5DD6A 1SHMA 2APTA 5E2WH 5D71L 3SE4A 4MA1B 2OTUA 5DJXA 3LRHA 3BPLC 3ALWA 3H3KA 3FCGA 3TA3B 5JIIA 4XMTA 2CJTA 2NSQA 3DBXA 1UXLA 3P30H 1E3FA 1IBGL 3QARA 5IFHL 2X42A 3G5WA 5FF6A 3MOBL 1OAXH 1KJ3H 3E80A 2PBNA 2OTWA 1U3YA 2J44A 3WTYA 4CW1A 1UWYA 3ASWA 4J8QA 4AGNA 3P11H 5IVNA 4CKVX 1EH9A 1M3IA 5BVPL 1UUSA 2J2ZA 5DUBA 2Y07L 1RIHH 3O11B 4BUGA 1MHHA 1BEYL 1L9PA 1EHNA 2X1WL 1E5CA 4R30A 3RVXC 2GUOA 1NC4B 5I19L 1RI8A 1GH7A 3IS1X 2GYSA 3ROLB 1MEXH 3DV6B 3Q1EA 3ULVH 3A6CH 2QBRA 3HB3D 2D7NA 1PSKH 2DI9A 3I6LD 2QPEB 3GIVA 5CKGA 4KTEH 4D3PA 4DQAA 1ONZA 3WFHB 2W59A 3CQFA 3EYQC 5IJBC 4TVVA 1R4XA 3BESR 3STZB 4B5ZA 2HRGA 4ERSH 5CCJA 4XOCA 3N06B 3DX6A 3FYIB 2VZVA 4DP8X 1TQUA 1YG9A 2CXGA 4IJTA 3SYAA 1JZDC 2BIQA 3FTWA 3IGFA 3L54A 4OIIH 3NFPA 4APQB 3FCBA 4PG9A 1HESA 3KWWA 2BX5A 2EIJB 4QKTA 2DQHL 2WLMA 1G1OA 4V11A 4I5BA 2A9NL 4M61A 3BKYL 4JPVH 1TENA 2VRQA 3NT0A 4RFEA 5D7IA 3VH8A 3T3PB 5IROA 3C2AL 1AXSA 5FHAH 5I15H 3FF8A 3I9PA 4O02B 4LLUB 1I8IA 1FH5H 2UY6A 1MFDL 4PJXE 5GIRB 2BVPB 3APNA 3O9WD 4LCCB 3Q44A 2G0KA 1R0AH 4AEIL 3MZTA 2WLHA 5A3ID 1MLCB 2FX7L 4GRWE 1Z66A 5FO2A 3VFMB 1LGVA 5B8CC 4CKQA 1FYTD 1KV3A 3NFNB 2QLYA 1GKEA 2PYEE 2OSLB 1E9QB 3EH4B 1F3DJ 5DC0A 4UT7H 4NUPA 4PRDA 2A8BA 5GRJH 4GE2A 3CZFB 2BSSA 5KYYA 4YO0B 3F84A 1BVKB 2VQ4A 4U1HB 4ZUSB 2D3JA 5CN3A 1DVFC 1FVCB 3K6DA 4M6NH 5A6LA 4X6DA 3EFDH 2OMUA 2X5PA 4JFFA 4DTGH 3T1FA 1DFBH 3O2DL 4XP4L 3OKEA 3HUJF 1VCAA 5CFHA 1WAPA 1C83A 1C16B 9PCYA 4YQXH 5A2KH 2OX5B 3S0PA 4JVPA 1VZIA 2MWCA 4KVPA 3QQDB 2NX5E 2AJUH 3KPLA 5GGQH 4X50A 1TJGH 1AXIB 3MCYA 1ECVA 3ZDYF 4UQEA 2J56A 3FO1A 3FZUD 5I75B 1DEDA 1XGYH 2X6BA 1HHIA 2F5BL 2ZXCA 4GBXA 1KYFA 4YGVA 1KCLA 1AY1H 3ZZLA 5JHMA 1W8NA 3LN9A 4M8UA 1AR2A 5GRVK 3RAJH 3HE7B 3O4LE 4O58H 4AG4H 4BUBA 1CQYA 2OQJB 4LNRB 4N3UA 4PAZA 3LHAA 4HH8A 4QXWA 1WZAA 2PNDA 15C8L 1U41A 4K3DL 3VB8A 1V8HA 4NQCA 3RG1C 3ATBA 1ETJA 1VB9A 4ANKA 4L1BA 4PWHA 1F6AA 2H0EA 1RJYB 3F7QA 3OJ2C 2YPVH 2C3XA 5E6IC 1MCNA 2G75B 3VXUD 5L7XH 3RY5A 1CL7H 2NR6A 2B1AL 5JO5B 1AHWA 1WS8A 5KA4A 4M7KH 2PW1A 3EHBB 3BIKB 3PF2A 3ABMB 4Z7IA 4O2FB 1Z2KA 2BVQA 5CLTA 2W60A 5D7JA 4UTAL 4G82A 4TNGA 1IL1A 2NZ6A 1VF5C 4Y1AA 2PXYA 1ZA3B 3FS9A 4KH2A 5AUMA 5FA3A 1MJUL 1HQ4A 1MREH 5IROD 3L95A 4QI3A 1Q0XL 5KABA 4C83B 2EDWA 3TO4C 2UWEA 3OG4B 4L8SA 3A47A 2E7DA 4M4RA 3LRGA 4F2FA 1A4BA 3WL9A 3WDIA 3ZZQA 3N9GL 2NY7L 1UATA 1PNDA 4JPIA 4EN3C 4Y4FA 2ETWA 4X0NA 3CLWA 5C92A 2VXTH 3U25A 4O4YL 5LN8A 3L4XA 4OLEA 3GDBA 1X9LA 1GWZA 4XOEA 3R18A 3V0AC 4JN2A 1MHEB 1TSRA 2V2WB 5KS9B 3QUMB 4EN2A 1M2VB 2EIMB 4BYHA 3VXRD 2PP9A 4HZ1A 3L4CA 1GJIA 2R29H 4IRSB 3NCYS 2H2SC 3AREA 3C5ZA 3BUYA 3RO1A 1EA9C 1KTBA 4FQXA 3OKOA 5CJOH 3RUGA 3D39E 3TYFB 3UACA 4Z7WB 3KW7A 2BP0B 3QZOA 1CICC 4H4NA 1UFGA 5DJYB 2FGWH 2P44B 3QHFH 3KYMA 1NFAA 1WG3A 3FUKA 5C0EB 2TSAA 4E0RA 3HHRB 4XPGH 3OR6A 4F33A 1G7HA 3FQYA 1MRFL 5L2KD 3ZHKA 4N2CA 4HZAA 2WYZA 5D1QB 5HDOA 3NJMA 5E8NB 1S9WB 5E6ZA 1A7OL 4Z76A 1KGIA 4UV7L 2G9KA 5JW5B 3QJVB 1MNNA 3NIFF 4HAFA 3LS5L 4XOAA 4M1CD 4M3KB 1KJMB 3SDAD 4PCSA 1J6UA 1WTGT 1NFDF 4OZHE 4YSAA 5F7HA 3OKEB 4Y16D 3GIVB 1C1EH 3KPOB 5C0CD 3ECVA 5M43A 4HUMB 3H9SA 1FNHA 2F53B 4Y2LA 3HZ3A 2PYED 5GGUB 2IPKB 1WA1X 2F54A 2JF1A 3B2VH 1MWAH 2YC1B 3B2PA 2LV4A 3EYVB 1TZHB 3GRWL 5CIPB 4UDUB 4X2UA 2FWUA 1ZOXA 5JW3L 4XMXA 3PWUA 4KKLC 1N4XH 4IRZL 4ZQKA 3T3MB 2JFHA 1N7ML 4RMWA 2XZQL 4FQCH 4JM2A 2ESVB 4WKZB 1JGUH 4HIXL 3TO4A 5GHWH 2F7QA 4NQEA 2F54E 1LE9A 2ICWJ 1JNNH 4JFHD 5IMKA 3X13A 3IDMA 3T9WA 2PXYC 1I8KB 2OQJA 3QCBA 1G6VK 3GXHA 1GOGA 2NY5H 2CKBA 2FJNA 4QRAA 1G1GA 2OK0L 3ORJA 3GSQB 5AB1A 1A5FL 3GM8A 1E7UA 1TCRA 1AQKL 2WXNA 1Q72L 5E95B 1GJWA 2OKMA 1PX3A 4BUQA 3OKNB 2HH0H 4L4TE 2AXHA 5ITBH 1JZ8A 2IO5A 5E6IA 4EOWH 1OE2A 1ECZA 3OAZK 5DRNB 4JFQB 1K9TA 4KNSA 3JT0A 2DDQH 2GJ6B 4MDJA 3SBRA 2BGEA 3MLZH 2C4FT 3BAIA 2EE2A 5MEPA 3G9AB 2HKAA 4HUWA 4I2XE 2JJSC 2X0UA 5AOKA 3CZGA 3SOBL 2GI0A 4KC3B 3SJVD 2BZDA 1YO4A 1MRDL 5HYFA 1CDJA 2FEJA 2D31A 2PXYB 3INOA 5AUMB 4KNQA 3UBGA 4OQTL 3FQ2A 1NMAL 2WLLB 4L1HA 4KQ4L 4OBSA 4F2MB 5I1GL 4OZIA 2CDFB 2CBTA 3OJVC 3LEXB 3RJQB 1X7QA 2DLFH 3IB4A 4GSXA 2EVJA 3NEOA 3KPLB 2I5YL 2OMZA 3RQ3A 3WFBL 1FPZA 2JJDA 3CZKA 1DUZB 5TQ2L 4GQRA 4G9FD 3T6WA 1U8IB 2XETA 3GI9H 1HSBA 2Z31C 3K46A 2A3KA 5EU6E 2P5WE 3IK2A 2AEIT 2G2PA 4HIEA 4BE6A 3P30L 4GS7B 4E9SA 3HN3A 1RHHA 2WLJA 5FKAB 5FECA 2HJLB 4RNRB 5J56B 4G7YH 1FWXA 3P4OA 2Z9TA 1KCBA 2VAAB 3BN3B 4HX1B 5KJ4A 3QGVA 4JKLA 4QHPA 3QCHA 2Q7YA 3OWEA 2FEDC 1YY8B 3NZSA 3Q8EA 3BLBA 2Y07H 1TQVA 3CFJB 2D3LA 3K2IA 2BWIA 2G5BB 4G6ML 4OZHB 4QD2E 5EHRA 4XGZB 2B1HL 2ADFH 5FYJL 3TO2A 1BEYH 4LAJH 1KLUB 2FTAA 5HDRA 3F85A 4J4PD 4TVPH 5H35A 3GSRB 1FZKA 3BKCL 5M95B 4OM1L 5LB1A 5ICYA 1N12A 2IMGA 2VEUA 2Y6TE 3UC0H 4PH8A 3QNYB 5J6GB 4KOBA 2O1AA 3NJHA 5BZWB 5HHOA 3ZGIA 3PL6D 2I32A 2VQTA 5AQ0A 2Y06H 1P6WA 4QAWA 1CDBA 2OMTB 4CU6A 1PYWA 4MHHI 5AVRB 3S5LA 1HHHA 1T2QL 1GRWA 1ZHNB 3B3BA 4FQQA 4HKJA 4ZO7A 3LRMA 3T4AC 2WZ0A 2W0LA 5IWLA 3MNMA 1NEPA 2ERJB 2OMVA 1CFTB 4GKSA 1S7TA 4M3JA 1FV1B 1EEZB 2BOBA 2Q8AL 2OW7A 4A7GF 4JK0D 1JXJA 1SXNA 4PW9A 5C0AB 4G7VL 1UM4L 3PYZA 3MFFB 4OZFG 2J43A 3P1VA 3EOAA 4WU5B 3QORA 3VXSA 1J5IA 2GSMB 4KWUA 3QNFA 5DT1H 2VUOA 4E9TA 5FLUA 1JCKA 3NJXA 4QXUL 4NOFA 1CDUA 3SCMB 1OVZA 2WM0A 4XZUB 4U1NA 3GSOB 3BCFA 1E28B 4QRPB 1WA2X 4PJEB 4NP4L 4UTBA 1A6UH 2CIIA 3T4YA 5KVEE 3EGSA 3ETBF 5G55A 4H8UA 3FO2B 3SO3C 2EYSA 1KJ2L 3MV7A 2I60H 1K72A 4PS4L 4XC1H 4XO8A 2X4RB 1LDPH 4Z78B 3EFDL 3QIUC 1V54B 5BOZG 1A2YB 2MOQA 1XXVA 4LHUG 5FW8A 3FBQA 1N5AB 4BFGA 4G80A 3S96B 1UWXH 5FHBL 3QCEA 3WEOA 2AABH 1ZT7B 1QFUL 4HD5A 4N0UA 4PJFB 4GRMA 3S36L 4RH9A 1SXSA 1KPVA 4XHJC 1NLDL 2X12A 3HI1A 4UDTB 3NRSA 3QAQA 2N01B 2VR3A 4NAQA 1Y6KR 5E4EB 5E8DH 4D9RE 3CK0H 1XGYL 2HFEA 2XKSA 3II2A 1W16A 3KGRA 1H3XA 4P3WA 1OAJA 2PP8A 5A40E 2FD6H 4PSRA 3GXTA 3SKMB 3RX5A 3FKUS 1KTDB 1NGPL 1U36A 1MQKL 3I6GA 3WY1A 2FJGB 2R0BA 4OF3A 1CCZA 4A67A 3TBVB 3HHSA 1ZS2A 2UVFA 4HMEA 3U1SH 2DQEL 3HMXA 5HDQH 3U4EA 1BECA 3UZVB 2JVUA 3CFBB 4FOMA 3RZCA 1NDMB 2P48B 3JZ7A 2IPTH 5J8OA 2XTJE 5GZNC 4BHUI 1PCXA 4LVOC 1ZGLP 2A6DB 2JQMA 4WGWB 3KWXA 2DL9A 5GQBA 4FXLA 3W1ZA 2ZN7A 3CXFA 3GXUB 3GXNA 5DJDB 2EIEA 4NM4L 2PYEB 5FX3A 3HC0B 1HEJC 4M9OA 4Z7VE 1RP8A 4KJPC 1HILA 5C0CB 1ADQA 1AXSB 3SGEI 3T0EB 2WAQA 4KK6C 1H3TA 3SDAB 4IK7A 1MCEA 1P1ZB 2PLTA 3BYTA 2WGPA 3S34H 3O4TA 3KPPA 1NM4A 4UCFA 1MREL 5DZJA 1F5WA 3EH1A 3U0PB 4F91B 4RWHA 1QWUA 4A7QA 5T3ZD 5H35B 4JMNA 3ZM0A 4ETQA 2ARJA 4AMKL 2YUVA 1G5GA 2VW6A 2DQFA 4MB1A 4QMEA 1TTFA 1MZYA 3RDTA 4UV4H 2CDEB 3SYQA 1KIPB 5IEKB 1FDLL 1QUNA 3EO0B 1E8WA 1UEMA 1U92A 2YMXH 5F2FA 1RULL 1GYCA 5HJ3A 2VXTL 4K3EL 2X4SB 4MVBC 4WY7H 1NFDA 3TCLB 3K72A 1C16A 1OP4A 2CO2A 4JVUA 3EO1A 1R5IB 4M29A 5K39A 4HK0A 1E50A 1TZGL 2IH3B 4JZOA 4G1EA 1NWEA 3QIUA 4YVNA 3ULUF 5F1NB 1I9JH 1SHSA 4KVCL 2A73B 5E5RB 1OTTD 1N2RA 3FUNA 2F6ZA 2Y24A 3KLKA 1T4KB 5LNGA 4W9JC 2PWFA 2DMGA 4HJJL 1CU4H 1CVSC 1NGXA 1OLLA 3H0TA 3GBEA 1QUNB 4PTTA 4KI5C 4R4NC 4XO5A 1NNYA 5G4NA 5GS2H 4FQ2L 1G9NC 1MCRA 1WT5A 1JGLH 3PABB 1YEDA 3QEQB 1NGWA 4OJAA 2GTWB 4TYUA 1DBJL 1Z9SA 3BPCA 3Q8AA 1OGTB 2EKJA 2KLSA 4FQIL 4I0PB 4DH2A 5ALBH 4ODTL 1TUPA 2A99A 4NO2B 5LNDA 1RLBA 1I7RA 1MI5E 3FB7B 2WYHA 3ZE1B 1RJLA 4C59B 4YK4B 4GP4B 3L5WB 2P52A 5CP7B 4LSUL 1CO1A 1TU2A 1IEBB 3RX8A 3B9KD 3RWHB 1FIEA 1T48A 2EE0A 3KLDA 1MWAL 2JWYA 3BP7B 3GRWH 1FL6B 4HIJB 2G0LA 4AYBA 5DCCA 4AK1A 3WKYA 4BKLB 3JWNH 1KNOA 2V8MA 3BO8B 4BINA 1V7ML 3QXDB 3PDGA 4OAWB 3UPRB 1N7MH 1CFMA 3L3DA 4U2YA 1JZJA 3DROB 4HX1A 1JHKH 3PGCA 2JFCA 5HPMB 3QA3A 4Q4EA 3NP3A 4PD4K 3D69A 3WNKA 3NTCL 2ESVE 5AD0A 3U0WH 1DLHB 4JG1H 5EU6D 2OR8A 2QFPA 5BOJA 4Y5YC 3R4RA 4ZS6D 2V9TA 1HS6A 1QFWI 2BP3A 1KBBA 4TQ8A 5DRZA 3TC9A 4ZMWA 2H3NA 1T3FA 4Z95H 4QRTB 4YX2H 4XPTL 3QEGL 4GRWF 4U4BA 1XXFC 4QRSB 2VAJA 2OK0H 1YEKL 4WZ9A 2XWEA 5EOTA 2FO1A 4FNRA 1XSKA 1N6VA 2A6KA 1ILSA 2FB4L 4HCFA 1PG7X 2Q8BL 5IQ7H 1XGUA 4EOWL 2Q0ZX 2Z4QB 3N1GC 3O3UN 4LHUA 4P5TB 2P26A 2X4PB 1OEMX 4RFOH 1YEFL 2F6TA 2APFA 3MMEA 3FO9A 4LL1A 2F8IA 2V6HA 4Z78A 4PJ7F 2JXMB 2EIZA 7TAAA 5DJ2B 3ZKND 5IB3A 1MRDH 3BVNA 5E9NA 4WU2A 1Z9LA 5I1EL 2CIKA 2GJJA 3NZ8B 3D9AL 3K8KA 4Y19B 1ZLEA 4UANA 3OKLA 4IM8A 1BZ9B 2DLFL 3PWLB 3U0PA 2NZIA 1MI5A 3ZIYA 1WGVA 4AENA 2LU4A 4ICZA 1BBJB 1RZKC 3IFPB 1UQSA 2Y1YA 3H2QA 1S5HB 3QIBC 5F0PB 1KCSL 4UILL 1VGEH 3VXTA 3CGTA 3T3PF 4ELMF 4UT9H 4JZNB 2OZ4A 3N6YA 3B6SB 4Z7AA 3RTQC 4EI5A 1N59A 2EVHA 5IW6A 2E6QA 2R56L 3WIFB 3KBFA 4DW2H 4U1GB 5L9DL 2BFVL 4G6AD 4N25A 3V79C 2J25A 3NZHL 4G9DA 4GWFA 3MROA 1E6JL 4TSBL 5FYJE 1TLMA 3LNGA 2LU5A 2H2SD 2PCYA 4DZ8B 2NY6B 1UACH 3WKQA 3MRJA 5DVNA 4OJCA 2R0KH 4QRQB 3REVB 1J5HA 1ZLDA 3VACA 1J9TA 4UTBL 5JW4R 1F02I 3HLAA 3BEVB 4NHCL 1G7PB 4QXGL 2JJSA 1HDMA 3QJZA 2DOCA 3TBBA 3QQNA 1Z3GL 1G84A 4IKLA 2BOCB 2GQHA 3FCTB 3MRGA 4X7FC 5DO2D 2QQNH 3VX1A 2IH1A 3CFKB 2P3YA 4FNTA 4JFWA 4LPUA 3TIDA 3HFFA 1HZKA 2R0ZH 2X28A 2VQ1B 4G5ZL 1GZPA 1KEMH 1XH0A 2DICA 4TTDC 3LXAA 3PFQA 1HH6A 1ZHLA 2D7TL 3P2BA 4S1DD 1G7GA 1T49A 3RKPA 5EZLA 2VR9A 1QKZH 1PF3A 1UWGH 1ZAGA 3HZVB 1U8MB 4NRXA 4UU9A 1IGYA 4XO4A 7FABH 5AG9A 1PJ9A 1N5YL 4UNTA 2XIDA 3HZYB 2JKNA 4K3GA 1ORQB 3OGCA 3WMPA 1R1CA 3HFMH 4MB5A 2P1YA 5A7BA 4UQ3B 3GJFH 4R7LA 2QEJA 5CBEA 3M1BB 1CK0L 3D85A 3LKPA 2QGEA 1DZ0A 2GK0B 4YHZH 2B1OA 3IJHB 3S3PA 4HPYL 2VQ1A 2ADIA 4HJUA 4R26H 2HRLA 3IM1A 4EUPH 1JV5B 4YDJB 4F8NA 1J1XH 1MCOL 1S5IL 2B9BA 4JFSA 5CR8A 2EQDA 3LNDA 1YPZF 2HFFA 5I17A 1AS7A 4KKRA 3S3JA 3VI3F 2VTDA 1RHHB 3QUYA 1JRHI 4Z3FA 5D2NB 2R7EA 4A2GA 1B2WH 3QR1A 3M46A 4JUTA 3CSBA 4XC1L 4XWOD 1BBDH 5C6TL 1T2JA 1BLIA 1G7IA 1B0WA 1XGTB 3EJZC 5F3HA 3DSNA 1RFDL 2KUTA 4I88A 4A7TA 5LXGL 1RZ7L 4AK2A 2FBOJ 5FHBH 3WEAA 1PQZA 5DEJA 1TQWA 5IMOA 1NA8A 4Y9EA 2YEZB 3NQKA 2AEPH 2XY1A 3WENA 4EI6A 1B6DA 1PIGA 3K6NA 4NERA 4RISH 2XRAL 1E4WH 2F2HA 3STLB 4KI9A 4Z7VA 4ZNCD 1AGBB 5DD0L 2K3TA 3OF6D 4HCRH 4TTGA 1T1YB 2MRYA 5AYTA 3ZKQD 2RQ8A 3SDDB 4YFEA 4L2LA 2ZZUT 2ZNWA 3IXAA 1KCUL 5IQ9A 3W38A 2EZ0C 4DEPC 1NGPH 2XFGB 2WB7A 2R2HB 2GIMA 2YD6A 3GJEA 4G3YL 4D7BA 3BP4B 4WFGD 3MLRL 3PPEA 4JLRA 1OZTG 1OM9A 3RLSA 4MXVE 4EN3A 4I18C 1JJUA 3UJJL 2BP0A 1UA3A 2ZTBA 3WFZA 4FTVE 2WWMC 5FO8B 2NR6C 3AWEA 3Q9PA 4PRNB 2LU7A 4KJQC 1ERNA 3K3QA 4PWKA 4B9KC 4HG4K 5I1LA 4MB3A 3H7LA 2FHCA 3ETTA 3SB3A 1C5DB 3RGQA 2DLHA 4GW1B 1OCOB 4HQQH 1FG2B 4KHTH 4AI7A 4N8UA 3GSWA 3GS7A 3CVIL 4B9IA 4PP1C 4TULH 2DY2A 5FA3B 1RXDA 4J3OF 4BQ8A 4HS8L 2Z4QA 4FFTA 4GAAA 1ETZB 1AGDA 1SEBA 3BMVA 5J11C 4PMFA 3IVKA 3QFDA 4P3DB 5BO0D 2MQGA 3QZPA 5ETUB 2OR9L 3GHBH 3WUWA 3QUGA 4S1DC 1DJHA 5D6DC 3V0JA 3ZDZB 4QHLB 3TN0C 4HXAH 3C6EA 2MHAB 4AMKH 2VDMB 3ZE0F 1NC2B 2IGTA 4P2AA 2UAGA 3EU0A 1DO5A 5IF0B 1GCYA 2VQUA 2XA8H 1YSOA 3CPLB 1SN2A 4X80H 3WHE1 3B5HA 5E99L 1NIFA 2YMXL 3N04A 5A5FA 3CSGA 3H2XA 4K3EH 4WY7L 4R84A 4XCFH 1FG2A 2IDUA 2AJYL 4WFFD 4AKPA 4NYHA 1CTMA 4X6DB 5KSBB 4Y5VB 1SBBA 3C9NB 4Q6YA 1HIMH 1QTPA 3D50A 4Z7NB 3AG3B 2ZP9A 4JM0A 4NZTH 3WOVA 2W80C 4ONGL 3ROOB 3EGXB 2YAHA 1IGJB 3QUML 5FPIA 2P42B 2VDNL 3GMLB 4PRIB 1NKRA 3LCYA 1I75A 3TIEA 4UQ3A 4PJAA 4XN8A 2F61A 2Z65C 3CC5B 4M5ZL 4WWPA 3CVCA 5E56A 4UBDC 4F8QA 1DVXA 2R2EB 4XTRD 5AVQB 4BFOA 4I48B 3DTDA 3QUYB 1KB3A 2XDHA 4NQCE 5A43C 4FQPA 4U7SA 2XV3A 3RNQA 5DJCA 3VM5A 4LEXL 4J4PC 1KGCE 2VR8A 4GBXB 4RAVA 1JGIA 2B08A 1E5YA 4H0LC 3IAPA 3OBAA 5CD3B 1DQMH 1IRAY 1Y07A 3IPEA 4BFNA 2Y1OA 4GUPA 5K59F 4LSUH 2IOOA 3RFZC 1Q9OA 4DGVL 1KG0A 3JV4B 1JERA 4PP2B 4DP9X 8FABA 2YXMA 3DVGA 3FFCE 4BZ2A 2IDTA 4HKZA 3TV8A 2AQRA 5DZNA 4BCZA 3EYFB 3G6JF 2J1KA 3RIAF 2VIRA 5D2LF 1CFQB 4HZLB 1YNLL 4HFWA 4K5NA 5BW7C 4OZ4B 3FRPG 3OLEA 1GPOH 3MV8B 2VMJA 4ABVA 3W0WA 3WO4B 3P9MA 1T7XA 3NSJA 3VA6A 1Q9LA 3LZOA 1PY4A 4LMQI 1WT5C 3X17A 1JDAA 3HJ0A 1XR9B 3NPZB 4HLZH 3OSVA 5C9KA 1E2ZA 5GS0H 1DBKH 5A6IA 4LESA 3BPOB 5EH1A 3D85B 1DQKA 3LKPB 3LKSB 5E2VL 3UTSA 4KDVA 3T65A 1YEKH 3QIBD 3LZFH 4IKCA 2AMGA 2H4EA 4HG4J 4JRXB 1WAXA 3QCKA 3MYJB 5F6IC 1S3KL 3LPFA 5IQ7L 3LDBC 4MAZA 1AJ7H 4JHVA 2V2WA 3ZKSD 4Q56A 2J6EL 4AENB 4PV8A 3FO0L 4PLKD 5H94B 1VADB 2NNCA 3D39A 1E0OB 1ZHLB 2CR3A 1CUOA 1AE6L 1IAIL 1ZSDB 3MR9B 2XPCA 4B3VA 1FL5A 4AYMC 1P5VB 3L4ZA 4TL4A 4YHNB 3VXPA 3RDTC 2MSPA 2R4RH 4KKAD 2XBTA 4ZFOL 3WIFA 4BGDA 3QRBA 3FUJA 1RZKL 1A65A 1D9KB 5B7MA 1QATA 1JK9A 3DI3B 1BGXH 2WSPA 3MBEB 2OX5A 3GINA 4ORGB 3D25A 4PHXA 3LKNB 1A6WH 4QJ3B 4YHLL 5ISZD 3F58L 2WQSA 5FWRA 4PRIE 1ACCA 3DA0A 5DJZA 4FTDA 4P2OB 1A0QH 4IW4C 3N40P 3FU8A 1VEOA 1CTOA 2GJ6D 1NCCH 3X1GA 2HT2C 1TR7A 3T3ME 3C87A 5GRUH 4AXWA 1J11A 1Q8MA 4R0LC 4NNPH 2BSRA 1K2DB 5D5MF 3SY6A 4XP9H 4BKLA 3UJTL 1U92B 2IVFC 1H8OA 3TV3L 3VGDA 1NCUA 2PO6B 4NUQA 1CIDA 3L3HA 3K1DA 1G6RB 1ZLSL 5HI5C 2G6ZA 1I1AD 2ZXGA 5E5LA 4WTZG 1Y6NR 4DEWA 5E2JA 1S7RA 5IB5A 1DN0B 2GABA 4PJEE 3KCWA 3MHZA 2O61A 4NKDA 5H37A 3PNRB 4U7MA 2F15A 2BNRB 2ESVD 2GBUA 3CN0A 1HYRC 4GMTL 4FADA 4MHHG 4N0FB 4UM9D 4UQCA 1LM8V 1OHZA 1S46A 2MFNA 2Z35A 4YVUA 4QRSA 3OLRA 2H26B 1P1VA 5C09D 5KVEH 3A6BH 2GJRA 1M7IA 4KQ3H 3ZM1A 2DV6A 2G3XA 1CICD 4XMVA 3QJTB 4AYFB 5J5EA 1WIOA 3KPTA 4V33A 4GKLA 4HYTB 3MRBB 4Z5RB 4MD4A 2IEPA 4CA4A 4G5ZH 2R51A 2PN5A 3S8FB 1MWAA 2LE9A 1U95A 4GT0A 4GRZA 3RIFF 5D7KE 2OLDA 5E1IA 5B38G 1FC2D 1FGVL 4PI2A 1DBBL 4BCYA 1IIKA 2CLRA 1LO5B 1THAA 3HOGA 5DVOA 1N5YH 1YN9A 4P5KB 3SOTA 2FIKB 1THCA 3MACH 5K1JA 4N26A 4Q2ZA 5J9PA 4G6FB 1RUPH 5D1QD 4JPQA 1C5CL 3VFVA 3VXMD 2NXYC 5FUZL 3OHXC 1HNFA 4QYAA 4JW3A 3GS0A 4I1PA 3T04D 4R0TA 2IQAB 2XXGA 5DUBB 2DBLH 5TE7L 3O2VL 1PG7W 5ISZA 3QCMA 4L18A 4BD4A 3UBXI 5IB2A 1T80A 3Q48A 5I1AB 5KVMC 1L8GA 1J1XL 1MCOH 3C60D 4R7NB 4NEHB 3MPCA 4J2XA 2A77L 2Z91B 2BWQA 4URTB 1FQ1A 1MRCL 3DXAE 1NCBL 3RWGA 3VFWA 4W9ZA 2ZCHH 3QHTC 2QQQA 1B2WL 2WLIB 3KEDA 1ZT4B 3DRTB 2KH2B 4LCCC 2HT3D 2CRIA 5C6TH 1MCHA 3RL2B 3FFCD 4RKKA 3OAUL 4RA3A 5ABAA 1TO4A 4X4ME 5IM7A 4L3FA 5TF1H 4FN0A 1D3CA 5JPNB 3WAKA 2DM2A 1YMMD 1RZ7H 2E8YA 5IWLC 4O2EA 3W2DH 1GZHA 4N2GA 1ODUA 5AL0A 3GKWH 5JOEA 1TNMA 1LO4L 2VXUL 1WC7A 4F8LA 1ZS8B 2NY3C 4TVSa 5J0BA 2AEPL 9CGTA 5IBMA 4RISL 3BRDA 2X89A 3REWB 1R3LB 2I6MA 1E4WL 1R5IA 1B2YA 1EJOH 1U21A 2Y36L 3JVGA 2ZUWA 3CC1A 1KCWA 4HCRL 2Y1VA 5K93A 1OY3B 4K7PY 1KBWA 3AACA 4DOHE 3IFNH 2VW7A 1K4CB 5I73C 3D25B 5T5NF 5KVFL 5MENA 3OKKB 1EXUB 4PVBA 4AE0A 1F1DA 5L0QB 1G7MA 4QOKD 3T5WA 2V0AA 4D9RD 3S5LB 1J18A 1RU9H 3ULSB 4KY2A 3CM3A 4R8WL 3WUWB 3D4YA 4M8RA 5DVPA 5SV4A 2P5WA 5FGRA 3VI3A 4HLJA 2VMEA 5CBAA 4OCRL 3MNWA 1X4XA 5SWZA 2FJFB 2V7HA 2XIBA 3FB5B 2FX8H 3NEEA 1X7TA 3BVTA 4I4WB 2VLKD 4FG6D 3BOVA 4CC1A 4GAJL 4W6XB 4WO4D 1BVNP 3QI9D 1DQLH 5MP6H 1KG0B 3DI2B 3ZM6A 3WTXA 3OG6B 3S4OA 1D5IH 4PREB 2P28B 5I6MA 3A4FA 4DNLA 3V6FB 2OR9H 2DQFB 3ZSTA 4HV8A 4IDJH 1IU1A 2RA1A 3VFPA 3JWNC 4HWBL 2IDQA 1UZ8A 4ZS7H 3GSOA 1DVFB 5I82A 2I3RA 3EGXA 4JM2F 2EECA 2QKIA 4M1DL 4LLDB 5A1AA 3HJEA 3HS0B 4JB9H 2WZPD 5I8OH 3MV7D 5T5FL 3HMWH 1HI6B 3VGBA 3FCSB 2QADC 1XV8A 1SYSB 1JWUB 2FSDA 2W9DH 2E27L 4WO4A 2YJLA 5ACZB 3F7RA 1HJBC 3AJ7A 5F89A 1XRIA 1OXYA 1MQ8A 5IW1A 4IOFD 4BSVA 4DN4L 1XQ4A 1CFSB 1BX2B 5JIQA 2HWZL 3LIZL 1X6NA 5EC2A 1S9VB 1OAYH 2C7FA 3C6LD 3DX8B 3PWNB 4B53A 1FYTB 2L7JA 2X4QA 3MDJA 4DSYA 5HYQB 4NPYB 1QZ0A 4RNRA 2DQIL 3O9WB 1OB1B 2ENYA 1ODAA 3L6FB 2VLMD 4RMRA 3D39B 4RAVB 1YZ4A 2EDFA 4Q9RL 1P6AB 3EOTH 4Z77A 2CHNA 1VA9A 1AIZA 2P5ED 3WNJA 5AW7B 4HKZB 2CRZA 5E24E 1HL4A 4LSSH 1D6VH 3U9WA 3W5MA 1URZA 3MUZ1 4HIIA 4PJGB 4LEXH 3QQ3B 4IHOB 3UBXG 1JZ4A 3B4NA 1UCBL 4FNPA 2QBQA 5EEWA 3HIZA 3E8VA 4ZNEE 2EC9T 1T04A 3VGAB 5B4MC 5BQDA 4M62H 5BUPA 1ZVSA 1YHPA 2G59A 5JUEH 5LLIC 1TJXA 1GFYA 4Y16C 1NL0L 3SZ6A 1CB4A 2V33A 5B38A 4F92B 3O4LD 4AY0A 2AKRB 2WWKO 1JTOA 3S5ZA 4J4PA 4FG2A 4Z7QB 3GT6A 2LGNA 4D0CA 3FQNB 4GXVH 3THML 4PJBB 4AOFA 4R96B 3NIDB 3QEHA 2NXZB 3R4DA 4EXPX 3K0WA 1YEEL 2YWYA 3IETB 1JTTA 3MI6A 4HUUB 1JXFA 1AQDA 1RIVL 2FT8A 5CLXA 3UC2A 1S7TB 3V0DA 2ICEA 4QAPA 3I80A 3B7TA 4Q7DA 3GUTB 4ELMB 1MCKA 3CFQA 1A6PA 1CICA 4HK3J 4NT6B 3EBGA 4F9LA 5GS0L 2WXQA 1NH6A 4NBYB 4W4OC 1J8HB 4PSPA 3QXTA 1NFDE 1OT2A 3NJIA 4B7LA 5FECB 1OCWL 4HXBL 1LK3L 2VDOH 4KAQH 1XR8B 2HVJA 3WFCH 3V6OE 4G9FA 3DJ9A 4N2IA 3KPSB 2QR0A 2X9ZA 4X5XB 3N50A 4GKNA 2CM8A 2EIBA 2KDYA 3FC8A 4IRSC 3BAEL 3MBEA 2P4DA 2K1MA 4YXLH 3MGTB 4XNBA 4D3RA 4RMUA 2EDLA 3WIIH 5FFOA 1SYVA 1IAMA 3H53A 3N44B 4DHLA 4PRAA 4LIQL 3LSOB 5HI4C 3MRPA 1G7LA 5KYNA 3MRFB 1XO8A 1CXFA 5TE4L 1E9PB 2R4RL 1DQTA 2A6JA 3GBDA 5C1MB 3KLHD 2PWEA 1YAIA 2WZAA 2DMHA 1MH5A 1N64L 1KT2A 3V0WH 1K8DB 3TVMC 4BZYA 3O3BB 1CE1H 1G6RA 1EAPA 2WXLA 3MOWA 4J3TA 4OT1H 5J1TC 2DKMA 1TEGA 3QSKB 2OUDA 4Z7UA 2WK2A 1T7WA 1FUNA 4CVMA 1KGCD 2PCPA 3W9DB 4DFIA 5JA9A 3KYKH 2EDMA 5DJYA 3H9YA 1SJVA 3GSNA 5GRUL 3WI9A 2CO3A 1KIQB 3ILQD 2JIXD 3NJVA 4MDIB 1B0RA 3DXAD 4C58B 1ZMYA 3BPOC 2ZG1A 4I18A 3SBWC 2Z92B 3TO4D 2JCWA 3A6CL 4XWGH 3UCRA 2CNFA 5TE6L 3K8LA 1GY1A 1CR9L 1ZWIB 5EU7E 4CNIB 1FIGL 3ROLA 2GCYB 1M71A 1Z0NA 2F54D 2WXPA 1Z0MA 5F7DA 3H3PH 1PY0A 1BD2E 3N41B 3IGLA 2W0FA 5I74B 2BC4B 1UAGA 5JO5A 1ZHBB 5MMZB 3IE9A 4HKXA 5ICZA 3OKYA 1W8OA 1KCVL 3AY4A 1DE4B 3LZQA 1G9EA 1QHPA 3K7UA 5EIQA 4ZAKC 1KXQE 2VNCA 3BKYH 3FB6A 4I48A 3ZHFA 4LCUA 4PVLA 2WQUA 3WKML 4XNZB 3U46B 2B4CL 2R1YB 3C2AH 5FHAL 5I15L 1DBBH 5M94B 3GBNH 1FH5L 4I3RH 3LKOA 1AG6A 2E74C 4R2GB 1WAEA 2KS0A 5GS0D 1N3NB 3QXWA 2F5AH 2JI1A 4BM7A 3OAWA 1IC4L 3U9UA 3BN9C 3NN8B 2V2XA 4NQEE 4FLSA 2H02A 3GGWB 3ARDB 1OE3A 4MBRA 3LAFA 5J12B 5C0DA 2F53A 2ZOWA 3BP6A 3E3QC 3I75A 3IETA 4CN6A 2C9UA 4ZZFA 1KLFB 4UQ2A 3FOLB 1P5UB 1A7QL 2I24N 4CJ0A 3QDJA 1MI5D 4PP1D 3CU1A 1L5GA 3AFLA 3G6AA 1ZEAL 1E0DA 2NNFA 2NQ3A 3QZNA 2B0SL 2CK0L 4WW2F 4UBDD 3TTSA 1U91A 1NBCA 1MRCH 2JJTC 1TQTA 2QR0B 1JXDA 5E1QA 1KWKA 1BZ9A 4WENB 1J0JA 1GCFA 1DP0A 1NGYB 5F7MC 4FYRA 3VH8G 3MTRA 5D7LB 3HI6H 1X5MA 1UXSB 1ZLWH 5HYJD 4YAQB 5TF1L 1CDHA 3T6XA 3QFDB 2ITDB 3C5ZB 5EU4B 1CXLA 4EXKA 4EIGB 5ES4B 4GSQA 2B8OT 2EC8A 2FX9L 4V1DB 3SJVA 1SUHA 1TQCB 4UIKL 3M1BA 4CSTA 3GKWL 3FTSA 1JWMA 3E2HC 4FULA 4A1RA 4A2HA 3UBHA 1K6QL 4F7MB 1L0PA 3G6AB 3NSCA 4AG4L 1AKPA 4OCSH 1UB6A 4MGXA 2ENQA 4YIQB 2DBJA 3K91A 2BIPA 4MAUH 1V10A 3H56A 3CX5J 1GYAA 2NSXA 4LRNL 4J51A 3UAJA 2V5RA 1S7UB 1H8SA 1KNOB 3BO8A 3VFNA 5HGBA 1L4IA 3ZMPA 3AMLA 4PCYA 2F8OA 5GRVL 3X3GH 3QDME 4JG0L 1IVLA 2GW5A 3UEZA 3H9HA 4IGBB 1KY7A 4IDLA 5FO7B 4ZX4A 3IJ7A 3EYOA 5ADOL 1QR4A 4IEFA 2CBOA 4TUKH 2DM7A 4M3HA 4YGAB 2WY3B 2UY6B 5IJDC 1BZCA 1MAMH 3VQMA 1TEFA 3VD0A 5AAMA 1RU9L 3CVBA 3T71A 1TQCC 2BNQE 2H1XA 4KMLB 4JDEA 4F24A 2D2CC 4BPCA 1RH8A 4OGAD 4UI2A 4BA8A 2YWZA 4UTAH 3H6JA 4AL8H 4NNYB 1M05B 4OIFA 2G3MA 1BOYA 1RZPA 4O2CA 3B1UA 4BQCA 3AC0A 2NLJB 3BGFC 2QPDB 2ICES 3VG9B 2I42A 1MFUA 4Y9FA 5KBMA 4F5CA 1OHQA 2IDCA 2DH2A 4LCWE 3BKJL 2CALA 3DIDA 3QPQD 2XJKA 5T1LD 5GPRA 3QYNA 3NAAL 5C3IA 3ETBJ 2X9YA 2I6JA 1IM3D 3EF7A 5DZOA 3IYLW 4GKZA 1KELL 4FJYA 4OI8A 3VD4A 3P77B 3DV4A 1NUFA 2BIOA 1IZJA 3LNEA 4DF9A 2D7OA 2ZF9A 3SDAC 1RZGA 5I71C 2BM3A 3VD7A 3GTVA 5AZEH 1QBMH 1JPFA 3MA7A 3LQZA 3CU7A 5HHOD 4PJ5A 1HKLL 5I23A 1YEHH 4JDVA 4NT6A 4OTXL 1ICTA 1UVQB 4I3SL 3SJVE 3VI4A 1FPRA 1OV8A 4HUXA 5GJSL 3OPZH 3D08A 4LCWD 4HIIB 3FFDA 4DVBB 4XPGL 1T03L 2HY3A 3UG5A 4X6CE 3UBXA 4PV1C 1VFAB 5C2BH 2J5LB 4MYPA 1KFAL 1IT9H 4DGWC 3DPBB 4OGYL 2DQIH 1CXKA 3BGAA 2OYLA 1M3JA 2YD3A 4QTIH 2FECI 2ZX7A 4PRAB 4MWFA 2XNAA 1T0MB 4G6KL 3JT2A 5CUSL 3S2AA 4WWNA 5ITFB 2NQDA 2GT9B 3QCIA 2BDNH 2BIHA 1PA1A 2JNZA 3PDDA 3TNNA 2A6KB 2LABA 2XX0A 4M48L 5KTEH 4H8WL 5I1DB 2BK8A 3N85H 5FGBA 4NKMA 1FAKT 4S11A 4BDVB 1JVKA 2WWKT 2JKTM 3SE3C 4NN5B 3KYOB 7CGTA 1RUQL 1X5GA 2NW3B 4PJ9C 4HWUA 1WRFA 4P23C 1EFXA 4P59L 4YHPB 5EIIB 3SCMA 3WS3A 3LQAL 2KI6A 3FCTA 3MRGB 2ZXWB 4O02A 4F8TA 3FQ4A 5DUMH 3ISWA 2VTFA 3MUGA 5D1XC 1NBVL 3HI5H 4MMXB 4R3SA 1F6FB 2A0LD 5DJZB 1WIPA 4HP5A 5IOPB 1CXIA 5KA9A 1OGAA 5K39B 5KS9F 2QELA 1GHFL 1Z5LA 4PJCB 4YZFE 4U6HA 3ZM3A 5HGHB 1RIVH 2H6UA 2P43B 1T4WA 2IDSA 1L0YA 3CHSA 5ENWB 5EO0A 4OGXH 4HWZA 1FCCA 2Y69B 4OLZH 4DKFL 1AZZC 3BPNB 5FM4A 4PRPD 1R3KA 2DLEA 3C08H 1L9QA 3QWRA 2FZ3B 3SBPA 5EO1A 1MJ7H 3H4HA 4QYOA 1IGML 3MLUH 5CILL 1I3UA 2DJMA 1UD4A 1LK3H 2UXFA 2VDOL 3AS0A 4KAQL 2W91A 4Z7UF 3SOBH 1QA9B 3L3OC 4N0CD 2FCBA 3TJEH 4KKCD 4JUSA 4F3FB 3HG5A 4JL2A 1RVFH 4HOWA 5TDNB 2EILB 2J72A 3PDOB 1VJSA 1LK2A 1FPTH 3QAZB 2Q6WB 4KH9A 4AX3A 4Y4KD 4YXLL 2A9CA 1ZE3C 3WIIL 4NZRH 5I1GH 1J05B 4ZK8A 2WANA 2DQ6A 5CP7A 4YDLC 5DJAB 4IU3B 1CGYA 1ED3A 1M2OA 1HDMB 3UTOA 4KZEL 5FS5A 1YRKA 1F42A 5TE4H 4D0BA 3IJ9A 5DXWA 3GI9L 4OFYA 2X4TB 4LNVA 3S4SB 5BO1H 2E0PA 4BKTC 4JDTH 3DVFA 3K71A 3QH3A 3VSTA 3Q5TA 1DANU 1S4IA 3HC0A 4KJQD 1RZGB 3DJTA 1OWWA 1CE1L 2YPLB 1LD9A 5E8PA 3A6OA 1KYUA 4XNAA 1QSFB 3NGBC 5H8DA 3BRHA 2YUXA 3MRRB 3MYZA 5HYSG 5HHNA 2QQKH 4HIHB 1CBVH 4GYBA 1P7QD 3K74B 2MH4A 3GM0A 1DBAL 3TNMB 4E5XA 3HC3H 2H3NB 4NQVA 3GXDA 2EC9U 4JE0A 4PJDE 2MPAL 2LT9A 4L37B 5EOCL 2H3XC 4Y4FD 1FC1A 1PFCA 3SGJA 3VWJB 3GMMA 2ZXBA 3F3HA 2SHPA 2CGRH 3GPEA 1OM3L 4TVPL 3GQFA 3V9EA 4P4KB 4AIXA 4OLVL 3HLKA 4GSUA 1HK6A 2JJUA 3CG8A 4OM1H 4LPYA 3UZQA 1FBIL 2N56A 5DO8A 4MQTB 4KITB 4M6OL 1AR1B 2ENSA 2O61B 4DVBA 1T66C 5B21A 3WFEL 3O2DA 4MS6A 4D9QD 1UXWB 3DOHA 1KB5A 2VDLH 1KC5H 4RGMB 4PRNA 3ZQXA 2MQ3A 2FNWA 1D7DA 2BCKA 1F3JB 1T7YA 4YNYA 2P8LA 2HTKC 5J7CC 2NT7A 3KGUA 1IVTA 1UKSA 4F8OA 1F90H 5F7WC 3FTUA 4AKQA 3POHA 2VEVA 1Q9LB 1KCVH 1UM4H 2HX7A 3SSGA 3SKJH 2JFGA 5BJTA 3IS0X 4OF0A 1HEZB 4XNDA 1AO7E 1UM5L 4IJ3B 1YN6B 3CZNA 4ELKB 3NMEA 1BXAA 4NQCD 4KRPB 3KVQA 1KXTA 2VORA 5DRWB 1P7HL 2I25N 5DT1L 4TTDD 2D4DA 5I76A 4X6EA 3CDFA 1U6AH 5IVZB 3X1BA 3E6FB 5IF0A 3FUHA <