3V0DA

Crystal structure of ciona intestinalis voltage sensor-containing phosphatase (ci-vsp), residues 241-576(c363s)
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
325
structure length
324
Chain Sequence
NKRRYRKDGFDLDLTYVTDHVIAMSFPSSGRQSLFRNPIGEVSRFFKTKHPDKFRIYNLCSERGYDETKFDNHVYRVMIDDHNVPTLVDLLKFIDDAKVWMTSDPDHVIAIHSKGGKGRTGTLVSSWLLEDGKFDTAKEALEYFGSRRTDFEVGDVFQGVTASQIRYVGYFEKIKKNYGGQLPPMKKLKVTGVTITAIQGVGRGNGSDLSMQIVSERQEVLLCKFAEGYNCALQYDATDDCVTCEVKNCPVLAGDIKVRFMSTSKSLPRGYDNCPFYFWFNTSLVEGDHVTLKREEIDNPHKKKTWKIYRDNFTVKLTFSDAED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Voltage-sensor containing phosphatase
publication title A glutamate switch controls voltage-sensitive phosphatase function.
pubmed doi rcsb
source organism Ciona intestinalis
molecule tags Hydrolase
total genus 113
structure length 324
sequence length 325
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00782 DSPc Dual specificity phosphatase, catalytic domain
A PF10409 PTEN_C2 C2 domain of PTEN tumour-suppressor protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1110 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3v0dA02
3.90.190.10 Alpha Beta Alpha-Beta Complex Protein-Tyrosine Phosphatase; Chain A Protein tyrosine phosphatase superfamily 3v0dA01
2J71A 3BRHA 3S4EA 2J16B 2I42A 1C86A 2MBCA 2H03A 4NYHA 1R6HA 3V0IA 2G59A 1RXDA 1I9TA 2HC1A 3CWEA 2J72A 2CM3A 2FJMA 1NL9A 3ZMQA 2PI7A 5J8RA 3ZM2A 2AHSA 2B49A 3QCEA 1I9SA 4YR8B 2CM7A 4GE2A 3U96A 4GRZA 2H02A 2VEVA 1C84A 1GWZA 2B07A 2FJNA 2HB1A 5K25A 1JLNA 4GFUA 3S3EA 2PSZA 2CFVA 1Q6SA 2F46A 3F9BA 1KAVA 1XBOA 3I7ZA 2A3KA 2BIJA 3S3HA 1NWLA 3V0DA 4GS0A 2NT7A 4BPCA 4ICZA 1FPRA 2YOCA 5KA0A 4QAHA 2I6PA 1Q6TA 4WU3A 2CNHA 5HDEA 3V0FA 4I8NA 3H2XA 2BGEA 3D44A 4JMKA 1BZHA 1OEOX 1ZC0A 4IKCA 2I6OA 5BX1A 4BJOA 1G7FA 1YTWA 1NO6A 5KA4A 2QDCA 2B3OA 2I6MA 3SR9A 4GWFA 2CJZA 2DXPA 2PQ5A 3B7OA 4S0GA 1YGUA 1KAKA 3A5JA 4ZRTA 2C7SA 5K23A 1VHRA 2QBPA 2HCMA 3QCHA 2AZRA 4NNDA 4Z6BA 1SUGA 1C87A 3D1QA 2NLKA 3RO1A 2HC2A 4RI5A 2PA5A 2J44A 1EEOA 1OEUA 5LXQB 1PTUA 3BM8A 1XXPA 1YZ4A 3OLRA 5IBSA 5IBMA 1G4US 2B4PA 3V0JA 3EMUA 2I4GA 2VEUA 3RZ2A 4QBWA 2NZ6A 3MMJA 3QCKA 4QUNA 1BZJA 1NWEA 3QCLA 2ZN7A 2F6ZA 2I75A 2F6VA 3CM3A 2WGPA 3S3FA 4Y14A 2FHCA 3I36A 3F81A 2VEWA 5KA8A 1PA9A 2P6XA 1P15A 2QDMA 1QZ0A 3V0GA 3MOZA 1L8GA 2CMCA 2F71A 1OHEA 2I5XA 2NV5A 3GXHA 1MKPA 4PVGA 3AWFA 4KI9A 2CNIA 1NNYA 2VEYA 1PXHA 2P4DA 2ZMMA 3QCBA 2QBSA 2QEPA 3S3KA 2I3UA 2F70A 5K22A 2IMGA 1FPZA 2VEXA 2H4VA 2J17A 1A5YA 3M4UA 1NZ7A 4NWGA 2HXPA 4YAAA 4NWFA 1ZCLA 2J43A 3QCCA 4WU2A 2B4SA 1OHCA 4R0TA 1U25A 5GTJA 1YTNA 4RHGA 4H1OA 5M43A 3QCJA 4GE5A 3QCIA 1ZCKA 3EU0A 1G1GA 2Y2FA 4JMJA 3QCMA 4B04A 1G1FA 2GP0A 2PT0A 2OUDA 2FHBA 1Q1MA 2PBNA 1YWFA 3BLTA 2BV5A 3EB1A 1D5RA 2M3VA 2R0BA 3OMHA 4D3PA 1T4JA 2ESBA 2GWOA 2YA1A 3QKPA 2YDUA 2GJTA 1XXVA 4ERCA 1FQ1A 5K9WA 2BGDA 2H04A 1WAXA 5BUGA 1Q6PA 2Q47A 1WRMA 2I1YA 4HJQA 3N0AA 3QCDA 1U26A 5K9VA 1OEVA 3D42A 2I6IA 5AWXA 3AWGA 4ZI4A 4OHIA 5EHPA 1C85A 2Q05A 1OEMX 1G4WR 1OETA 4OHHA 2OZ5A 4WTYA 1ZZWA 5KA1A 1M3GA 1PYNA 3V0EA 3ZM1A 3SMEA 4QBEA 3O4TA 1Q6JA 4GRYA 5KA9A 2QCJA 3V0HA 4D3QA 1C83A 3RGOA 3D9CA 3NMEA 2I6JA 4JNBA 4OHLA 1WCHA 2G6ZA 4KYRA 1I57A 5KACA 5BZXA 2H4GA 1V3AA 3O4SA 5KADA 4OHDA 2NT2A 2I4EA 4RI4A 1YGRA 3I80A 3BLUA 4J51A 3QKQA 1Q6NA 4JBCA 3AWEA 1BZCA 3A5KA 2CM2A 2I4HA 1ONYA 2RF6A 1T48A 2CM8A 2CNEA 2HNPA 1PTVA 4HJPA 4RDDA 4TVVA 4AZ1A 4GE6A 2CNGA 1YTSA 3S4OA 5K24A 1AAXA 2NTAA 3QCNA 3ZM3A 3ZV2A 3F41A 2E0TA 3O5XA 2QDPA 2QBRA 5I6VA 1LQFA 1Q6MA 2OOQA 2H4KA 1PA1A 1LYVA 2C46A 3ZM0A 1ONZA 3D1OA 4GFVA 4DGPA 1C88A 3MOWA 3D1HA 5KA2A 4QUMA 4HRFA 2SHPA 3QCGA 1LARA 2F6WA 4RKKA 5KA7A 3PS5A 4KYQA 3RGQA 5KA3A 4PYHA 5MMZB 1PH0A 1PTTA 2Y96A 1OESA 2HVLA 4RH5A 1YPTA 3EZZA 1JF7A 1G7GA 2FH7A 1G1HA 2A8BA 1XRIA 2I3RA 3GXGA 4ZN5A 2F6FA 3QCFA 4OHEA 2B4UA 3EAXA 2OC3A 1XM2A 1L8KA 1QXKA 2JJDA 2FHFA 3ZMPA 2HNQA 2CNFA 5BZZA 4H34A 3O4UA 1GFYA 2B4OA 5KABA 4WOHA 3F99A 3LJ8A 2J16A 4R30A 2F6TA 1X24A 2QCTA 4D3RA 1EENA 1RPMA 5KAAA 5EHRA 4QAPA 1T49A 4Y2EA 1YFOA 4NX8A 1OHDA 4R0SA 2BZLA 4MBBA 3F9AA 1PTYA 4DGXA 1ECVA 2F6YA 2J73A 1U24A 2CMAA 3O3LA 2HY3A 2QBQA 1YN9A 1J4XA 2CMBA 4RH9A
chains in the Genus database with same CATH superfamily
5D2NC 4KI5E 4U6XB 8FABB 3EFDL 3EJYD 4WY7H 2CDFB 4MHHG 1N3NA 4HC1H 3WUZA 4R0LB 1QG3A 3BQVA 3RZWA 3DRTA 1ZK5A 4KX9A 1FDLL 1UB6B 1QLEH 1NCHA 3NT0A 4EUPB 3V9EA 3HA0A 3D25B 1R6HA 4OJFH 3WN6A 3ULVD 5FB8A 3EZ8A 2EDMA 4MB3A 3AG2B 3FCBA 2OMYB 3V0IA 2FEEL 2J6EL 1FGNL 1T6VN 4YVUA 3LH2L 4NO3B 3RDTB 5TE7H 1ITBB 1N7MH 3VWJD 3RVVD 4AMKL 5IBLC 3GXDA 4HLEA 5C0FA 4LOFA 2YAOA 4WI7A 4NO2B 1KBPA 3WIHA 2XV2A 3VD9A 2A9MH 2UZYB 5KOVC 4ELMA 3OKLA 4MQ7A 4BSWB 4AQEB 2XKUA 3MNZA 1WAAF 4OJDH 2OULB 2FT7A 3FFCE 3FOLA 1FL6A 3BEVB 3PGFH 1FV1B 3EHBC 5L4IA 1GZQB 4ZAKB 2TSBA 1CTNA 4MLSA 5KANI 2KQNA 2O5YL 3LMJL 4NGHH 1A3LL 2PSZA 5IJBC 1J8SA 1DVFD 1S7QB 2C9RA 2D0HA 3MV7D 4Y16B 5DFVD 1K85A 1Y6KR 5ALBL 2GK0A 2FBJL 1LE5A 3PGCA 4KJQD 4Z7QE 3GGWB 5KSBB 4DGUA 4F2MA 2YWYA 1SUJA 2XYBA 2NYZA 4NQCE 5C07E 2A3KA 3QNYB 4ODUA 5I8KL 3S3HA 4B9GA 1R3JB 1ZA6A 2X1XR 3JSSA 2F53B 3QHFL 3TF7C 2JIXB 3FQRA 2BVQB 3X11A 3U30B 3EOTH 3MX0A 3X3GH 2FO4B 4FQQB 2QADC 3A6CL 2QSQA 3NYKA 3TGXA 4CJ0A 1XDTT 5AOLA 3H4HA 3QCTL 1NZRA 2WYTA 3C5JB 3V0FA 4I8NA 2E7CA 5E6YA 4HX1A 2VDOH 1G5AA 4NZTH 1TO4A 4PCTA 3E8UL 5GGTH 2O6PA 4JBSA 5F7AA 3AUVA 2ZIDA 4ATTA 1PU0A 2AEPH 3GRWL 1ID5I 2XSKA 5DYFA 2HRLA 2BIHA 2CR6A 2SEBA 5GSVB 1E9QB 2ATPA 3RZCB 1N19A 2OXGA 3GNMH 5A2BA 4XOCA 4U2YA 4GINA 4M3KB 3B7OA 2ITEA 4Q14A 4DKFH 1A6WL 4G6AC 2XTJB 1HNFA 4NZRL 4Y4FA 5I26A 1ED3A 5A6MA 3TBYA 2VXQL 4WK4B 3K6SA 4YDIH 3HS0B 2EYSB 1LP9E 4HU2A 1EEHA 1WBZA 5E8NB 4K0OA 4L8DB 5JHBA 4B95C 3IDGB 1JYXA 4URKA 2Y36L 5IOPA 1RPUA 1IGFH 5DHEA 1QWUA 1IE5A 4A2FA 1IM9A 1Q9LB 1RPKA 4Y4FC 1SEBB 3CQPA 4GEJA 3IRCA 2VDML 3C9NB 3V6ZB 5L88H 2BNQA 4HVBA 4KGLA 1Z5LB 3O3EB 4MJ5B 5LXQB 1CIUA 4OT1L 4NKIL 3F7YB 4JY5L 4OQ1A 3LS5L 2B4PA 3D39A 3GMLA 3MKKA 3EMUA 4HMDA 2AGJH 3FSZA 1W6LA 4FFZH 5DJAB 1RUAH 3WLWC 5K5YA 5EULV 3IJYB 2NY0C 4QCIB 1HXYB 1MVYA 4JFDB 4F15C 2RIKA 4J3OC 2AAVA 4Y4HB 3RI5F 1L9TA 3UIYA 2H2SC 3CM3A 2XPYA 5CU9A 5ERWA 3LNFA 3F81A 1KULA 1G9MH 2IV9A 5EZLA 5IQ7H 2ZYRA 2CGZA 4DVRH 1QRNA 3UTPD 1HKLH 1S7SA 4ALAL 3WV0A 1CE1H 2D31A 2DQEL 1ADWA 2OX5B 2G75A 4WAFA 3IRPX 2F7QA 5IWLA 3CV5A 3RAJL 3WFCH 5CUSH 4B96A 3BYYA 2XN9D 2CD0A 3CSYA 3CDZB 4OZIF 1PX4A 1YPZA 2PF6A 4TVPL 3UYRH 3IETA 5KYUA 1UTDA 1SMAA 1KC5H 1DANT 2Y06L 4PRBB 4C4KT 5B38A 2W0KA 2EZ0C 5IWLC 1TQCB 2AABL 1NM4A 2R2EB 1KENH 5EOQL 5BOJA 2VR7A 5FO9A 3P9MA 3WTVA 2QELA 3VXRD 1LO2L 4LVEA 4YDMA 5INCB 2VO5A 4GKNA 3BKJH 1TQWA 3F7RA 4L3CA 3FQTA 3CFTA 3HI5H 4JG0L 1KZQA 4H1LH 4GOSA 2L7QA 3TZVA 4CSSA 1FVDB 1FL3A 2MFNA 3SKNA 2I9TB 1N2RA 3VFWB 4D3CL 1E6OL 3ZMRA 1MCWW 5JA8B 4RCAA 4PP1C 3O0RL 3ZZ1A 3O6LL 4IBZA 4NCC1 5GZOA 5KAQG 1XBDA 3CFKB 1X5HA 2GC5A 2YKKA 4UIMB 4AITA 1NCDL 1N70A 1PX3A 1XH3B 4KQ4L 2J8HA 3TBTB 3WKQA 2CMRL 1RJZB 1SJHA 1GS6X 2BJMH 2YPLE 3FMGH 3KD4A 2CAKA 2Z1KA 3FCSA 4TTDC 1I9RH 4NQUA 3TZVC 4NM4L 3TO2B 4TVPD 4NQDD 1J5IA 5GZOC 5CJOL 5HYJA 3NTCH 1EAPA 3MGOA 5DI8B 2PWFA 4IMKA 4KFMA 5HSFA 5AVTB 4P9HL 1JMZA 5I15H 1EEYB 4QRAA 4DPRA 4YZWA 1E6JL 2IDCA 2QPEB 5DUJA 4Z7OB 1JPEA 3TN0D 3CFMA 4Q6IA 3THML 4K2UH 3BXNB 3GIVB 1BZDA 1AO7D 1D5MA 3KGSA 1DBJH 3WY4A 3PNWB 4JGMA 1YWFA 4Y7MA 1CXKA 1OAKL 4RAVB 5E6IA 3ROLA 3RB7A 2QQNH 1X5ZA 2BOCA 2Z31B 2BVUA 3HUJE 5BMFL 2FO1A 3PHOB 4IMKC 4PJIA 4RZCB 1HZHH 4X6CF 5EFIA 4FQPA 1QFWI 1BYPA 1R5IA 5EIVA 2K45A 3MHZA 4TULH 3SKJL 2WW8A 4RFOH 2Z3FA 4GAGH 1BBJB 2D3JA 4PLOB 3S8WA 4IKJA 4DN3L 3WAJA 1AYRA 1E5ZA 3IJHB 3DURA 3R8QA 1FF5A 1L6PA 3D4ZA 3KYKH 4R7XA 3FZUD 3AXLB 2WVUA 1A7QH 3VFNB 5DEZA 2IANB 3CVCA 4UM9D 4I3SL 4P57B 1AJ7H 3FU7B 4N2NA 3FTSA 2VRQA 3N0AA 3US9A 2HLFD 4NC0B 4OZIB 1HILB 1E5BA 4HOMA 1MCHA 5C3IA 3D42A 4I13B 4GB9A 1KPVB 4CDGC 1WQVT 3D50A 4HJJL 1N8ZA 1C85A 2OCJA 3AABA 3BWAB 4JKNA 3EFOA 4GAAA 2Q76A 3B3BA 2O93L 3DVNB 1C12A 1U8OA 4FXGB 4CILA 4RNRB 5MHSD 5FGSA 5BPPA 1BF5A 4XTRD 1MN4A 4PS3A 2YK1L 3P77B 4XWGL 3V4VA 1A47A 1YO4A 3KR3L 3T6XA 5KA9A 1TETL 4IGBC 4PB9H 4YDLC 1C83A 1H8NA 3H42L 1TSHA 3D09A 5IMLA 1YEEL 3QG7H 2YEVB 1PS3A 1A1OA 5CINH 4QUOA 3X3FL 2BLFA 4Z7VA 3BRDA 2YOAA 4XP5L 4KK5C 2NW3A 4XBGA 4AWJC 1GC1H 4W9GC 4PRHB 5FS5A 3LPPA 4FQ2H 3E2HB 3S3JA 12E8L 1J5HA 2BWIA 3IT8D 3VX1A 4B5EA 5DZNA 4M48H 2XQBH 4TL4A 4XBPB 3H6AA 1RMFH 2XG5B 2MRYA 2B1AH 1PSKH 4NQVB 1I1FB 3G6AB 4X8XA 1FLRL 3AWEA 1O75A 1MFCL 4TUOB 5DMKB 5F7UA 3P54A 3JVFC 1TFPA 1T7ZA 3RPIB 1VFMA 2BMKB 1HZKA 4JN2B 5F96H 2VDKB 2Z93A 4AEHL 3MV7E 1IAIM 5DK2A 3N1GC 2N56A 4HZ1A 5GGQH 3LKRB 1U3ZA 2G3XA 3ZYOA 3VXNB 4E41E 1QAWA 4D9LH 3QPKA 2CO4A 3JV6B 1MNUH 1KACB 3ZV2A 3GZOA 4X6CB 4E2OA 1IKFL 1MCOL 3T4YA 5F7BA 1FZOA 4K3EL 4G7RB 4HUCA 4K7PX 4F33B 3VM7A 5JIDA 4A2HA 3F7VB 5IREA 1KTDB 2OMUA 3NQIA 1UM4L 2VQ1B 4EVNB 3DK0A 4YSCA 5JHLH 1T1YA 2JCCE 5DJXA 3S35H 2F5AH 1YN6A 4N3UA 2XVLA 4CA4A 4F9LA 3OB0H 5IJVA 5JW5B 35C8L 4LVNB 4RQQB 2V0AA 2WIMA 3D4CA 5I1DA 4L3EB 3HLKA 3D08A 1LARA 3EJTA 4GSUA 3BKCH 4XI5D 4MAUL 2C1PB 4WFGD 4NN6C 3KPSA 3ARGB 4S1SH 5EHFA 4PBXA 4Z0XA 4BV1A 1WCQA 4F9LC 4W6XB 4GIPD 2FJGA 4I2XB 1JV5A 2NTSP 5E0FA 5AZ2L 3EGXB 2YRZA 2F7OA 4AZ8A 4KQ3L 5T1DL 1G7GA 3PWJA 3RUGB 3MVNA 2G2RA 5B4MC 2BHZA 2IWEA 4WKZB 5JW3L 3X13B 1FG9C 3QWOB 3VXQB 1CLOH 4OZHF 2X4OB 5DGRA 3L3KA 3UJJH 3G9VA 2E75C 1A4BA 3W5NA 3N1QC 4JCWA 2YBRB 3VB8A 4S1DD 1XGYH 1TJIL 4HSAC 4AQOA 1JBVA 4YR6A 3V5HB 4MD5A 2LU4A 4NHUB 4NYLA 4N2FA 4NQQA 1T7WA 4C83B 3WG7B 2FHFA 3HI1A 4PQXA 1XGRB 1E28A 4G8IA 2WTZA 2QDVA 3ZHKA 2XPGB 3HG1A 1K4CA 4P2QA 1JXDA 3F99A 3V52L 5D1ZA 1MI5B 1SUHA 3Q8FA 5FDWB 4MXWL 3S9DB 3T0AA 2H0EA 1QSFB 2B59B 3MRGB 2HT4C 4LSQH 4LHUB 1T7VA 5I2IB 4R30A 4H25B 5C7XH 1FNSL 4P9ML 5LGHH 4OZGE 4QTHB 2X0VA 3N55A 4TVUA 4WKXA 5E8EB 1MW0A 1NGZA 3R19A 1SHXA 4F7TB 3HI6H 3ULAB 5AZEH 4CADA 3BDYH 1JFHA 4XXCC 5J9PB 2DM2A 4Q4EA 5L2KA 4GSDL 1KTJA 4QO1B 1AGCA 3HG5A 3MUHL 2XN9E 1IEBB 3HMXH 3KYMB 2FQFA 5E1AA 5IB2A 4MMXB 1RPQA 1H8SA 2AEOA 3TBBA 1BWMA 1HKFA 3WE6A 4NN5B 2PW1B 4OGXH 4YMPA 2R83A 5C2BH 5LAXB 3SDYL 1WWBX 1RIUH 1IFHL 1JZIA 1RZ7H 5T5FA 4PVLA 1NM9A 2DIAA 1SN2A 3L7EB 1ECVA 2AP2A 1E9OA 3LQAC 5HDQH 4YC2C 2QBQA 1ONQB 2PW2B 3VXRE 1INEH 4G6FB 3S34L 3IPFA 1FO0A 3DX1A 3IN0A 3MJ7A 4GAYB 1SY6A 2ERJC 4U1NB 3GSUA 1A8ZA 4PU2A 1ZXKA 2GIXA 3T0ED 3T2NL 2ZPKL 1LNUA 2X1WL 3HLAB 3TWYA 1ORQA 1L6XA 3WGVB 2JWYA 1TTBA 1JPTH 2EVGA 2V7HB 3S34H 3TWCH 2DIEA 2H03A 1AVAA 2H47C 1L9SA 3HRZA 3EFDH 3P2BA 3IXTA 3U79A 1NGXA 4OZHB 4YDVA 4YSPA 4A7VA 2GBAA 1M7DB 4M3JA 1JV2A 4JRYD 1FDLH 3SBPA 4Z77B 1RXDA 1MWAB 3O3DB 2D0GA 4TVPE 4NP4L 2CM3A 2XACC 3NJXA 4DVBA 3HRZC 4U4IA 2J6EH 4K94C 1FGNH 4GG8B 1H15B 2EEBA 2JQZA 3LH2H 1X5AA 1IM3A 3MBEB 4AMKH 1EHLL 3QE5A 4A6YL 2NLJA 3U96A 2HVKA 3UBXA 5FOBB 2ESVA 2X44D 5DVKA 3UGUA 1E42A 3ZDYF 3UG3A 1SJEB 3ESNA 1ID2A 4U1MA 4LSPH 5HVWA 5J57B 1JLNA 3QB7C 3CVHB 5BO0D 4TUUA 3OGCB 4BUCA 1S9WA 3NIFF 3FAWA 5E1IA 3EFFA 1NTDA 2O5YH 4WW1A 2ATKA 3LMJH 4Z3EA 1A3LH 1BIIA 3QZOA 2J8OA 2C26A 2WQVA 2XX1A 4GW5A 2F68X 5FWQA 5JYLA 5ALBH 5DVPA 2FBJH 3KLAB 3HE7A 5CR1A 2NT7A 5C86A 4BPCA 4YPJA 1FPRA 1TMQA 1N12A 5I8KH 2I6PA 5GJTL 3FONA 4UNTA 1GA2A 4PVNA 1P31A 1M2VA 5D1XD 2N4IA 3QHFH 5KVMC 3FN0L 5FYLL 2CNHA 2EDKA 1GGYA 3DYMA 3O3UN 4NQSA 4LBEB 3HE7C 5DRXA 3A6CH 1OEOX 3EH3B 1QASA 1ZC0A 2PMZA 4X6DE 1UT1A 2WXRA 3MNWA 4KKZA 3MRDA 1Q0EA 3EGDB 4QLWA 2AM1A 1A9BB 2CCLA 3DX3A 5MHSE 3WGUB 3E8UH 4XNUL 5E1GA 3MLYL 3GRWH 5E23A 5KA4A 4QHPA 4UQ9A 4AT6B 4M1GL 4ZMWA 2VYRE 5GGSB 4PJ8A 4EDXA 1MW3A 2G9KA 1R3IL 5BZDA 2O61A 2X4QB 2E74C 3KVPA 1A1NB 4QTIL 1FG2B 4Z6BA 3LVEA 4H26A 1MCKA 3VA2C 4NZRH 4LVOC 5E2JA 1TR7A 2VXQH 1WYJA 2RAMA 3Q2LA 2H8PA 3KNBB 4FCAA 4OGQC 2FIRT 3UG4A 5EBLA 4PJ8C 4AKQA 5DUBA 1NC2D 3LKQA 4PFEA 1M3JA 5FYLD 1IRAY 5IMKA 2ZUTA 2Y36H 5C0EA 3TM6A 3SKMB 4A2MA 2A9CA 1PTUA 4KAQL 3LRKA 2JLPA 1DVXA 5IBSA 1KB5L 2VDMH 5GGRB 3KCPA 3L3GA 4OT1H 3IDIA 4NAJA 4NKIH 4PW9A 5TTRA 3O6FD 1G7IA 4JY5H 3LS5H 1UT2A 1QR1A 5JR1L 2ZF8A 2WWKO 1MREL 4MZIA 3MLVL 5AVWB 3WTYA 4HQQL 2F6ZA 2GQHA 1NANH 2F6VA 1ETA1 3GPSA 2VNCA 4X5XB 3IMUA 1ZVHA 4B9PA 3G6JA 2OI9B 3BO8B 4P46D 1SJMA 2CO7A 2PO6A 1MDAA 3EYFB 4IU3A 2YUWA 3GEWB 5FK9A 3GSNB 3MRNB 2HKAA 2FR4B 5EORL 1THCA 4HKJA 3UP6A 1JN6A 1FFQA 1UJTA 5IM7A 1KOAA 4CAGA 3TFKC 2PPEA 4ALAH 1S9VA 3A4AA 4OCYL 2DQEH 3BIBX 2CNIA 2PO6C 3MNVA 4WFGE 1CLVA 3BP6A 3RAJH 5CU5A 3ZL2A 3FCGA 4BZ2A 1WICA 3QCBA 3CX5J 1YSOA 2FNBA 3HIZA 4JLRA 4KROC 3DYOA 5DHMC 2UZIL 4C59B 4TVPH 2AQ2A 1G7PA 2X2YA 1JGIA 3F7KA 2Y06H 4HIJA 1SZNA 4O2CA 3SDCA 2AABH 2DKUA 5ABAA 1C5BL 5EOQH 3ZT6A 4EXKA 5AVVB 3OXSA 1LO2H 2ID5A 3WDHA 3NSDA 4X7TB 1XF5A 5I1AA 3FT4A 4Y1AA 4WEUD 2P42B 2VABA 4JG0H 4K5LA 2ZT9C 3C8DA 4PW3A 1FRGL 3SDCC 3D1MC 3E9TA 4YAQB 4D3CH 1X5LA 1OHZA 5EF0A 1ND0A 2RACA 4R7NB 3HMWL 4X4YA 3O0RH 4NN7C 4ICWA 3O6LH 5EN3A 5HTSA 1WC7A 2WBKA 1HU8A 1FL5B 5E6ZA 1NCDH 5F7HA 4X9FA 4KQ4H 2CMRH 2AC0A 1CFVL 1U3YA 2B20A 5HI3C 3I9IA 2VLJA 3RKDC 2ILLA 4ENED 3EU0A 2A6JA 4NM4H 5ITFB 4H8WC 5CJOH 5E0QA 4HJTA 2DIBA 4APQA 4LKXB 5D5MA 3RVXD 1WFNA 3QBTB 1HJCA 3ECVA 3DROA 3JUYA 3E1ZA 2ZNXA 3EKCA 1E6JH 3OAZH 1LD9B 2FAUA 3F65A 1U93A 5TD4A 3ZTEA 4MCZA 5EZJB 3THMH 4F27A 1S9YA 4QBEA 2ZXGA 4AXWB 1I3RA 2OZNA 1GR7A 4ZS6C 3J07A 1OAKH 2ZWYA 2VQ4A 4H0HB 2XQ0A 2HP4A 4APQC 1H0DA 3BQUD 4XNXL 5SWSD 5BMFH 2VLRA 3BVUA 1HYSD 2GJ6B 4ERCA 1XGQA 2VDQL 2ZUUA 1UH2A 5MERA 2MMXA 1S3KL 3SKJH 4L0YA 3RU8L 4G5AA 1KTLA 1KXHA 2DAVA 4ZQKA 4JREC 1MCIA 1W0VB 2BNRA 3WOVA 1WFJA 3F5WB 4WQOA 5EC1B 4E9QA 2OCCB 3L9RB 5HJDA 4DN3H 4FXTA 1KJ2B 2CLRB 1OK8A 4GW1B 3D48R 1BQKA 1N0LA 1VENA 5C0CA 1EFXD 4DWHA 1QTPA 2OLDA 1WFUA 4I3SH 1J0HA 1J48A 2A73B 4NRXB 5AWXA 1E50A 1L6ZA 1OETA 5J6HB 1BIHA 3VFVA 3T0EE 3UC0L 5HP5A 4W9LC 4S2SB 4H20L 4HJJH 2AMUA 1ETZB 3QCUL 4CC1A 3VXTB 4MCYB 1AQDA 2FVNA 1KDIA 2GJZA 5DEJA 1B0GB 4BWWA 3O4TA 5JOPD 4CMHB 2XYCA 3WMSA 2IG2L 3ESMA 3ELAT 1DZBA 2ZNWA 2C7FA 5AW8B 4JMNA 2YK1H 1E67A 4XWGH 3KXFA 4M1CD 1QFWL 3KR3H 1JZFA 3FB7A 4JRYE 3L4WA 4QIRA 3U2IA 5KSUB 1XWVA 3G5ZA 4FABL 1E4XI 3H42H 1FNGB 1KBGL 1LTXA 1RXLA 1YEEH 3ASWA 1WISA 4WNSA 5DS1A 3VGAC 3X3FH 2Y2WA 5E7BA 4RH4A 1MFAH 3CFJB 4XP5H 3TVMB 4F5CE 3GFUA 3D87B 2HLEB 1CICD 2XBDA 5H35A 3NCYP 12E8H 4IRSA 4UQBA 5DEGB 1YAIA 3GMQA 4DGYL 3KLQA 3KYNA 2IBGA 4GE6A 4QRPD 5IQ9B 1FLRH 1MFCH 3BP4B 1C5DB 4N0CC 4HA1A 3EADA 3QJUB 4K4KA 2EIZA 1A4AA 4KJPD 2HPOA 5ACZB 1PY4A 3TBWA 1NWOA 2IMNA 4IRSC 2R29A 4WCYL 3U7AA 2H41A 1U2CA 1UB5A 4X4XB 3IEAA 3QAZC 1CD9B 4PRPD 5DJ6A 3VD7A 4DJMA 3IVKB 3QRBA 4D8OA 3G5WA 2CRIA 1ZV2A 2R0WL 4Y5XA 5BZWB 4AJVA 2QBRA 3BAIA 1DLHB 3HAEB 2BP0B 1Q9OA 4JRLA 3L9YA 3MA9H 1IKFH 1MCOH 3MCKB 2AQ3A 5D1XE 4UDTA 3GTTA 2YIHA 4K3EH 4P2CG 1ONZA 3JTBA 3FPYA 2BZ7A 5A16B 4BFIA 4Y5XC 3OJ2C 1IGTA 2XETA 4HRFA 4BJLA 3NFPB 1W9XA 2WZPA 4DN4L 4OFDA 3QCGA 3GJEB 1BZ7B 1GS7A 1GYCA 2OMBA 3ZDWA 2XWTB 4WEEA 1I1AD 4N3TA 35C8H 4N2MA 3BCDA 4U31A 2GY5A 2EC8A 4KMLB 4V2BA 1RJYA 4NZJA 3KWXA 4MAUH 3G08A 4LL1A 2YN3A 3MRLB 3VNZA 3MOBL 2AI0L 1J9QA 4I4WA 3DGDA 2WAHA 1Z6JT 1U95A 2EVHA 3FFOA 4MA1B 5AZ2H 2X2HA 5HHNA 3IPEA 4KQ3H 5DZAA 3LD8B 4JZOB 4L0PB 4M5SA 5T1DH 5JXAL 3MUGA 4NKOA 2FJUB 2P5WA 3IS0X 1A4KA 2X70B 3P4OB 2W65A 3BZFB 2QEJA 5JW3H 5FYLE 2WXGA 3ATDA 4WV1C 5HDBE 1MHCB 2XUWA 1WIOA 1ZD6A 4DAGL 5J13C 4FQIL 5JTWA 3CIAA 3L8QA 3QEQB 1XX9C 4MD4A 4BH8A 1F1DA 1TJIH 1NCIA 3OR7B 2X5PA 5I71C 1QNZL 3QIBA 2YEZA 4M03A 4TQIA 2AV1B 4R7DA 5EU6A 1OGSA 1S5HA 2H0JA 4HBCL 4F8OA 1I31A 5EBMA 4AGOA 1CFMA 5KSAB 4LSVH 4FJYA 4Z76B 3LJ8A 8FABA 3V52H 2EE9A 1T5XB 3H53A 3TX4A 3RFZA 4HJIA 2APSA 2CDFA 3KWWA 4MXWH 4FFWD 1F3RB 3APMA 1UB6A 4EUPA 4AKOA 3D25A 2GUOB 1RPMA 1FNSH 4P9MH 4UT6A 4G8FA 5KAAA 2OMYA 4JQVA 3E8VA 1DJHA 4NO3A 5SWZB 3RDTA 3X14B 3CLEL 2QFPA 3SY6A 1P7QB 2A3TA 5IHUL 3I6KB 1URIA 4GSDH 2DWSA 2BRQA 2UZYA 4F1SA 4GRLD 4BSWA 1DQTA 1NOFA 4JQVC 4NJ9L 5A2CA 4ZUUB 3BEVA 3P4NA 2XKNA 1FYTB 4ZAKA 3RDTC 3SGJC 1JERA 3BN9D 1MHPL 2OJEB 1VEPA 3T2PA 3QC5X 2X4TB 3SDYH 4APXB 4XNYL 1IFHH 1H8OA 1S7QA 1DZ0A 4MA8L 1JCVA 1ZWIB 4RMUA 3DHMA 4JRXA 4BSVB 5KSBA 3GGWA 1WCBB 1BXXA 5AW5B 3LXAA 3GLAA 4QDGA 1KYAA 1KJ3H 4AW7A 2VB5A 2FYYB 4LLWB 4ZAKC 3FTVA 1NC4D 3ZE0B 1HNGA 5BW7A 4LPWA 1JCKA 1R3JA 4HOWA 2ZPKH 2F53A 3D3VB 2ZP0T 2JIXA 5IV2A 1RSFA 2BVQA 3HFFA 1IC5L 4Y16C 3P0GB 4ZFOB 5EO1B 2H6OA 4GG6A 1BAFL 4FQQA 5E4EB 3U36A 3P2TA 4NLHA 3O81A 2E4TA 3MU3A 3C5JA 1KN4L 2NUPB 1FJ1B 5BW7C 1IIKA 1A6AB 4AMXA 4P2AA 1NL9A 4FMVA 2NXZD 4ZSOB 3U30C 4PLKD 2DY2A 4JFFD 4MNGE 1XGZA 1I9SA 4NO5A 1CFTA 4NP4H 4GO9A 1XB8A 3RZCA 4KH9A 3SYPA 3ULUL 3CSTA 4GMSL 4NUMA 4J1UB 3PWNB 3QZNA 4OFQA 1EHLH 4A6YH 2Y1OA 5AD0B 4NO0D 2CLZB 4UOW1 3ATAA 3C6SB 3QQ3B 4LOVA 3VWKB 2QSTA 5GXBB 3ZM5A 5DFWH 3HS0A 4ZNCD 2EYSA 1J1OL 2JSFA 1E2ZA 5E8NA 2H1PL 1F02I 4OM0L 3RZCC 4L8DA 3SCMB 5SWSE 2QTEA 5DURB 1TYJA 2QJDA 2R59A 2DMKA 1ZTXL 3IDGA 5HHMD 2B4SA 2CKNA 3CC1A 4P5KA 1E27A 1UD6A 2XTJC 4LPYA 1Q9LA 2DM3A 1U8HB 2XX0A 1SEBA 3HS0C 3C9NA 3RYMA 1JD7A 4WU3A 1Z5LA 4MJ5A 3VRJB 2Y7LA 4BKSC 4OVUA 3DX2A 4HUNB 5GJTH 3D44A 1WAAA 3UTSB 4UZGA 4RMWA 4OD3L 3FN0H 5FYLH 4ZRGA 5DJAA 4FNUA 4DK3A 2WLZA 3IJYA 1LMIA 1HXYA 4JFDA 4Y4HA 3E6HA 3P3RA 2EYTA 3MDJA 3LNIA 5FIEA 2EIKB 5I1KL 5JOPE 4YPGA 5I1HL 4MJIB 4YS4A 3D33A 4XNUH 3MLYH 4NUJB 3P69A 4M1GH 2ZXQA 2VN6A 4JGUA 2K8MA 1EO5A 1M57B 2ZAIA 3SE4A 1HHHB 3ARXA 4JKMA 3MV11 4Y4HC 2OX5A 1R3IH 4H0LC 4MSWB 4M3HA 2YPKB 1M9SA 3HHSB 5JIKA 4QTIH 1RURL 4BWTA 2FSDA 4UNUA 3HVNA 3GXUB 1YYLH 4XGZB 4RI5A 1YYML 2BOLA 1Z5HA 3BZ4A 4PRDB 4HS6B 4QHUB 3ZQWA 1OEUA 2APXA 3SE4C 2F54D 1REIA 1W0WA 3OLRA 2X05A 3U2SA 3OZKA 1U33A 2R2EA 1I7RB 2FLBT 4QRPE 3Q44A 1KPUA 2UZXA 3VXUB 2NDGA 3K46A 4QXTA 4DO5A 4J2QA 4MCNA 4OFYA 1X5KA 1KB5H 2NZ9D 5INCA 2CCWA 3FTYA 5ENWB 1SYSB 3O41B 4PJGE 4PRPE 2VW4A 1BZJA 1CXIA 4PMEA 1T03L 5ISZE 4ZPTA 3US1A 5DC2A 1CDHA 1TQCC 4TV3A 2FEDC 1FVDA 5JR1H 2NZIA 1MREH 4JUTA 3IMBA 3BFWA 5IVXF 5LXVA 4HQQH 2PCPB 4M29A 4PJFE 5KVDH 3CFKA 4UIMA 3B6SB 3PP3H 2VH5H 1QZ0A 2P24B 1XH3A 1UM6L 2NY6D 3VI3B 2CMCA 1RJZA 3K6FA 1FZMB 1X4ZA 3Q3GB 1J7VR 1XSKA 5DD6B 2BY2A 3B9AA 3FO0H 3GMMB 3TO2A 3PWVB 3GI9L 4LOUD 3SPIA 3L6FB 1XMWA 5EORH 2WBXA 1XCTB 2JFCA 2X7LB 2Z7WA 4R26L 1EEYA 3RGVA 4I9WD 1VB9A 4OCYH 3ZUNC 4CVLA 4PJCF 2BINA 4FZ8L 2KL6A 2I3UA 1RIHL 5K22A 3ZJAA 4ZMPA 1CT8B 2VEXA 2H4VA 3PNWA 4D9RD 3KLHD 4RAVA 3OHMB 4Y9GA 4UAHA 2Z31A 2UZIH 3PHOA 4RZCA 1NZ7A 3CJJA 5D7IE 3V9FA 3WFBL 3RGVC 4YBQC 3KPOB 4KXZH 1U6AL 3HHMA 1XT5A 3EOYG 1UUSA 1AMYA 1C5BH 3VQ1C 4JFPA 2Z31C 2YZ1A 4CNIB 1RUQL 3AXLA 2W91A 2IANA 5J12B 3LIZA 3QCJA 4JQIA 3HE6B 1MCFA 2A7BA 2FUQA 4G8GB 1GCYA 1UOVA 1WS8A 2L4OA 3GS0A 5HHOD 4DEUA 4OZIA 1FRGH 1HILA 4AKPA 1KPVA 5DZLA 2F19L 3HMWH 4L4VB 2LT9A 1HXMB 4PHXA 3TIDA 3BWAA 4JVPA 2VC2B 1T6WA 1E30A 1PG7W 3DVNA 4HT1L 3NPZB 4FXGA 5IW3A 2VRKA 4TYUA 4NAMA 1JZHA 1CFVH 3GSXB 2RBLA 2JFFA 1YC8A 2BV5A 1AZNA 2WQXA 1KLFA 1RUKL 5A6IA 1E8YA 5FXCH 1EPFA 3WIHL 3P3SA 1ZIBA 4WI8A 4FXGC 3HB3B 2EE0A 5IVXB 3IDNA 1H6EA 3ARVA 2YDUA 3LH8A 4JFEB 3MACL 2ZSVB 2GY7B 2WMPB 1FQ1A 4L37B 4G43B 1R24B 2R2BB 4V11A 2GG1A 4XNXH 5E56A 2DLFL 4Z8FH 5CP3H 2VDQH 4NQVA 4KKNA 5DHVB 1I1FA 1TZGH 1BJ1H 2W1NA 3G6AA 1S3KH 2NX5D 3P30L 3RU8H 1I9IL 4TUOA 5DMKA 5IBLD 2Z91A 1EXUB 1USQA 2WLKA 4AQAB 3RPIA 5EO9A 1ZT7B 2BMKA 5IF0A 1LO3L 4JN2A 2KDYA 3E2HC 4PJCB 5JUEL 1CGXA 3SKOA 5CZVL 3HCVB 3ZYJA 3X12A 1U21A 1OEMX 1I53A 1N59B 2CA4A 1PIGA 5HGAB 3VXNA 2WXIA 3QFGA 3VD3A 4J4PA 4YXKL 3BCFA 4X6CA 2AVFA 5FGCE 5CIPH 3UC0H 4H20H 2E56A 1DO5A 3QCUH 1VFUA 3TV8A 1XAKA 2D7NA 4HJ0D 3F7VA 1KTDA 1ECYA 5AVZB 4JFXB 2ZWKA 3FBQA 2VQ1A 1OO2A 4P2OB 4XX1E 2BDNL 2EDFA 2IG2H 1YECL 3CPLB 4J4PC 2ZWSA 3LK7A 4W1TA 1I82A 1DL7L 5C0GB 1QPPA 2APFA 1QFWH 2BVOB 3PAUA 4RQQA 4UTAA 3WSQL 5CJXA 4FABH 4L3EA 2NNRA 4PM1A 4J8RB 1KBGH 4JFFE 2VT0A 5D71L 2Y68A 1S7TB 3ARGA 5IIEA 2OM5A 1I7UB 2G5UA 2P48B 2E5EA 3PHQB 1BQUA 3DJTA 2Y7QA 4LVNC 4OM1L 3KPMA 5CJXC 2Q3AA 5B7MA 9CGTA 4ATWA 3OXRA 2R2HB 3EGXA 4AH2B 4F57L 2NY1B 1NUNB 1Z0MA 3QA3B 4DGYH 4OI9A 5FOJA 1M9WA 4QMEA 5CCHE 1KTRL 3ARGC 1J0ZA 1OTTD 3A47A 2NTAA 4LNRB 1QSEA 5HHME 3V0VA 4Q9RL 1NFDF 2XN2A 1SVBA 4NQDB 1QTSA 3DUUB 3QWOA 2JF1A 4EZJA 3N91A 3RWJB 2X4OA 4WCYH 4XX1G 3B1TA 2PNDA 1JZ2A 4MDIB 1OSYA 3BC9A 1H3UA 5JHMA 4P5TD 2Y6SC 2YBRA 2P26A 2R0WH 4PGDB 3RNKA 2V2XA 1QHQA 4AUUA 4WI9A 4C83A 4DEPB 3D1OA 1E4XL 3F84A 4Q0XH 1AO7B 2A74B 4ORGB 5HBBA 1BREA 1FNFA 1OARL 1ZE3H 4Y4FD 3EO0B 4FLSA 2B3RA 5H94A 3TEUA 4MKMA 4EQ2A 4YHZL 5LUMA 5KA2A 1KJMB 3FQYA 4MXQC 3CSBA 1J8HE 3ULUE 1S7VB 2FX8L 2G9HB 3MV9E 3EOAB 1JGLL 5FDWA 4TUKL 4ZZFA 2ZX6A 1PF3A 1AFVL 3GXTA 3UJTL 4KO9A 3GEFA 4DN4H 5IHHA 3SDXB 3MRGA 1QSFA 2B59A 2E86A 5TDPB 5KA3A 4CN1A 4LHUA 3QUZA 5I2IA 1WE5A 3WL9A 4ORZC 3TH3T 4H25A 3US0A 2EO9A 4XC1L 1JXGA 4RH5A 4QTHA 3RB5A 3WLWD 5CEZD 2BNQD 4KJYB 3FT1A 2ADIB 2ENYA 1KBWA 1ZTXE 4J3OD 1SXBA 4F7TA 3IN2A 5SX5H 1EZSA 5J9PA 4IW4C 2H2SD 3MOBH 2DRUA 3FJTA 1KGYE 4CDHA 5A3IC 3D39D 2AI0H 4JJHA 3QUZC 3HPJA 2BWQA 1R5WB 2B4UA 3GJFH 5I6XB 3EAXA 4TTGA 1IEBA 3U46B 3KYMA 5JXAH 1NAKL 5HJ3B 2AANA 2GEEA 5MENB 4J2XA 1L4IA 1D3CA 2VKXA 2Y23A 3UH8A 2PW1A 2XWCA 5HGHA 3O2VL 4AK1A 2IPUG 2F54E 5LAXA 4Y9FA 1UOKA 2EDWA 4J3BA 4U6VL 1UEYA 3FRPG 3QSKB 4E5XG 5BZZA 3EO1B 3L7EA 4OSUL 4R84A 2OR7A 1HE8A 5A2LH 4DAGH 5CFHA 4FQIH 4J12A 4PWIA 2X6VA 2IGFL 3KPNB 3ESVF 3QPXL 3NG5A 4U6HB 1EUUA 1OE3A 4ZOAA 3BMWA 4NN5C 5F3HB 3UADA 1QNZH 2EZ0D 2P28B 1YMHA 1EJ8A 1FNEB 1DYZA 3CN0A 3HLAA 3VFGL 5JNYB 2F6TA 1MUJB 3ARBB 4HBCH 1CFSB 2V7HA 5FM5O 1NFDB 5ICUA 1HFUA 4OZHA 1A6VL 2HTLC 1EENA 1OGAD 5D6DA 1M7DA 3CHRA 3DTXB 4QAPA 3CQQA 4PWHA 3LPGA 4AGQA 4PP1D 5IMMB 4ZDHB 2Q6WA 4R97B 1B4RA 1XF4B 2Q9OA 4ZS7L 3SQRA 1KXQA 3LH9A 3QYNA 1H15A 3LXUX 3FSOA 3CLEH 4QPEA 3MBEA 3DX6B 4I9WE 5D6DC 4DFIA 2DIJA 3OR6B 5KJRL 5I8OL 5IHUH 3EBHA 5GZOD 1NQBA 4PGCB 4XVUC 1U2YA 1TOXA 1VZHA 2BS8A 4ZUVB 5ESAB 4NJ9H 4I5BB 3C5ZB 2XV6B 2F1EA 2WBJA 2Z4QB 3OGCA 4GKLA 4M6AA 3MBEC 4N6RA 4WFFD 1MHPH 3AS1A 3C2AL 1IUZA 1PQZA 2A9DA 2DLHA 3II2A 4MNQD 4XNYH 2I42A 3BUBA 4MA8H 4OIFA 1E40A 3KLAA 1JDDA 3DHJA 1Q9WB 3KPLB 5DK0B 3S3BB 2C9PA 4QRUB 3N5AA 3VACA 4MB1A 4NDMA 5AKRA 5HHOE 3KPRA 5IB4A 1IC5H 1T7YA 1P4UA 3ECBA 2ZTBA 3K81A 4NBZB 3TC9A 1X5IA 2XZQL 3S37L 2VSMB 1T1WB 4W4OA 3EGDA 4FRWA 3SYAA 1A9BA 1KN4H 2AHSA 1A7OH 2BP8B 1I8KA 3KEHA 3ARRA 4KTYA 1FI8C 4X5LA 3UTZA 1HQRB 4NX0A 4M6NL 1HX0A 4AT6A 4TNVF 4R5XA 3SJVA 1EZVY 4EI5B 5SWQB 2OYLA 4W4OC 1A5FL 2V5RA 1HH9B 2OYKA 4EMZA 3ULUH 4GMSH 1CFQA 3O9WB 2WLLB 5EO0B 2VL4A 1A1NA 1AYOA 1VCAA 3ABMB 3QJRB 1EWHA 1XBOA 1C8PA 3DXAB 4QYOB 2EIJB 5CJ8A 3KWUA 4YSUA 4IGBD 4AV4A 3EYQD 1J1OH 2XNAB 4C13A 5B39B 1SRDA 2H1PH 2KBGA 4Q6KA 2J5LB 3FS9A 1ZTXH 4KK5D 1KGWA 3LV3B 3ZE2F 1F4YL 2NX5E 3SKMA 3APFA 2B39A 4NHCL 2Q2EB 2VM9A 4HPYL 1JZ5A 3M6DA 4JMKA 1QMUA 2VW6A 5F7DA 5FM5M 3SPGA 4HISA 4P05A 5B7EA 4U1JB 3CSGA 4LP8A 2WNWA 3BGAA 3W9EB 1SOXA 1YY9C 4OD3H 4V1DD 4LSSL 1QNIA 4KMQA 5L8LB 3MJWA 3U82B 1CXLA 4JY4B 4PHZA 3LN4A 3MLTB 4X5XA 5DJ8B 2AQPA 2DXPA 2PQ5A 1JNNL 3QZWB 4N24A 4ELME 3LKNA 3LN5B 3DPBB 1O7DC 1OSPL 3UTOA 4FTVA 3QCHA 4B0MM 4CL7A 1LWJA 5I1HH 1Z9PA 3ZMNA 3GSNA 1A4JB 1NINA 2F8OA 3U9UA 3MRNA 5JIMA 2KI6A 3BW9A 2FR4A 4Q2ZB 4L1TA 5FV1L 3MMEB 3WJMA 3ZTDC 3BAJA 3MXVL 2OBGA 3RJQB 5AWNL 3RNQA 1XFPA 1IFGA 2CIKB 5IUSA 2AW2A 2NSQA 1CLZL 1MPAL 1RURH 1UXMA 3LNDA 4UANA 4K3DL 4FHKA 4FERA 1ADQA 4GSRA 4NC2B 1V3MA 2ARJB 3EJZC 1YYMH 5DWUL 1DHKA 5EIIB 1JI1A 3N40P 1NMCB 4GBXA 2A9AA 3IDXL 4XNQB 3V9CA 4KGJA 4U7MA 4H44C 3VGBA 5HDBF 1ZGLB 3QCLA 3MREA 4NIKB 1AHMA 2XWJA 2WXPA 3V5KB 4R4FL 4X7TA 4GBXC 4UUJB 1C8QA 4HK3N 2X3CA 5E6UB 2FHCA 2ZCHL 3KPSD 1ZAGA 1T03H 5KBNC 3UC2A 1FFOB 4JO4L 2W81C 4LEOB 3L7FB 4WSJA 4EIBA 1F6AA 3O4OC 4N0UE 1H3VA 4R7NA 2WKOF 1WZAA 4DZBB 4J5VA 2I5XA 3ZE2B 2NV5A 3GXHA 4JY6A 3L2MA 2W60B 2OYPA 1F3DJ 1XB6A 5EG6C 1UM6H 4RZKA 1QA9B 5JMOC 1OTSC 3M7FB 4YHYB 4HZLB 3K7UA 3UCQA 4ZMAT 4GAFB 1JXJA 3CMOH 1CGTA 3GI9H 4KTDL 4R4BB 4QHMB 1EK3A 2MOGA 4TLTA 4YBLB 5D7SL 4LKXA 2E6PA 1UD3A 1OPGL 2QQKL 4R26H 2UWEF 4L9DA 2BNQE 2CDGB 3AQYA 1YLBB 3OD3A 4FZ8H 2J17A 5DO8A 5BRZB 4ZFQA 2G0LA 5EZJA 2HXPA 2HT4D 2C4FU 2VLLB 3D39E 5T5FL 4PRIB 4WU2A 5F1SA 4P2QD 1B6DA 3WFBH 1NEUA 2IH9A 3ULSB 4UAOB 1TQSA 1U6AH 2DMHA 2EC9T 3UAAA 3E9UA 1ZV9A 4RHGA 3S5LB 1FO0L 5F72S 1SY6L 1W0VA 5DLLA 3GI8L 3F5WA 4JQXA 5EC1A 5MEQB 3L9RA 2IPUK 4GW1A 1RZ8A 4MA3A 3ZRSA 1QZ1A 5KN5A 2PN5A 4FG0A 1RUQH 1G7QB 3Q8CA 4I7ZC 4PG9B 3BWSA 1S9XB 3ARDA 4K94L 1AZRA 3NJJA 3OF6D 4JQXC 4JM4L 3BPLB 4LEBA 3BPCA 2EIDA 3IRZA 4S2SA 1M3IA 4X7DC 3DO7B 1JHTA 2F19H 3B7UX 4J3OG 3GM8A 3V7MA 5D93B 1ETZA 3VXTA 4MCYA 2FECI 4WENB 3MBXL 4HT1H 5CN2A 1YPZE 3ARDC 1B0GA 3QWRD 1ULVA 2JKRM 5HGGS 4KDTA 3W1ZA 4WUUA 2Y7SA 3D52A 4PD4K 4B9ZA 5I6OA 1OGAE 1MCQA 2EDYA 2CO2A 1IAKB 5KSUA 1T5WB 1RUKH 2BSCA 4OF7A 1FNGA 3VI4F 1GYVA 3WIHH 3QEGL 3IK2A 4L4TB 4EIUA 5K9WA 2WZ5A 3EJRA 3CFJA 3I9PA 4KDTC 4BSJA 4CMHC 3TVMA 4J8QA 5TK2A 1BVLB 3V7AE 2UX7A 3NK3A 4N28A 1T20A 1UADC 3MACH 1MCEA 3T8XB 5DEGA 3BH9A 4ZODA 3ZPDA 5KSVB 3O8XB 4E36A 2A38A 1M53A 3C08L 5EF1A 2DLFH 3GF8A 3FTUA 5IQ9A 3OKOB 3P30H 1B88A 1I9IH 1ITCA 2CHDA 3BP4A 4J3WA 4PWEA 5E8OB 5C08D 3TVMC 5BNXD 1G4WR 4WFFE 1CBVL 2UWEB 1OPOA 4WWKD 3VQLA 5ACZA 1LO3H 4GUOA 1XL6A 5JUEH 3IE4A 4MNQE 2Y7NA 1LO4L 1OGTA 4X4XA 3VA6A 5B38G 5CZVH 1RQ5A 1R0AH 3IVKA 4BBWA 1ZVSB 1WFTA 1U58A 5JO5B 1UEMA 5BZWA 4HFUL 4UILL 4N2IA 4C47A 1GJWA 2XKSA 1HCVA 2BP0A 3FCTB 3NSJA 4HIHB 4YXKH 2W9EL 2ESVD 3MCKA 5ETUB 2VE6B 2CRMA 2TRYA 3FFCA 3FW6A 3A5VA 2VJXA 2P80D 1JZ3A 4WUKL 1RAMA 3I3EA 5GZND 3TBSB 4PJIE 3VXOA 1VA9A 4RRPA 4PBVC 3NFPA 2BDNH 2ODIA 1YECH 3PYZA 3BVNB 4ODWB 3ZYIA 3GJEA 1BZ7A 1N26A 4J51A 3V95A 1DL7H 2XWTA 4YBHA 1GHFL 3ZR5A 4YDKL 2IWGA 2WINB 3WSQH 4TSBL 2WXNA 1CS6A 3HE7D 4ZUTA 1U8MB 1R6VA 5D71H 3OZLA 1BQHB 3QK0A 3LKOB 4HLZH 3MRLA 3GUTB 2CNGA 3DOIA 4ODSL 1HESA 1NIEA 3ZGHA 2XBTA 1AH1A 1TZAA 4OM1H 2DH2A 2ALAA 3C09B 1ZGLM 4F57H 3ZM3A 3V6FA 4JZOA 3RFRA 3F41A 2EDOA 2XXGA 1LQFA 2X70A 3P4OA 3NZSA 1UD8A 2WLMA 3C6LB 3T71A 3BZFA 4J3OH 4Q9RH 3WNNA 3FBKA 1MHCA 1P2CB 2UY7B 3QHTC 4JKKA 4MA1C 1FN4B 2V9QA 1NBYA 3MA7B 3L3IB 4P49A 3V4PB 3QEQA 4Q74A 3OR7A 1U8PB 4IU2B 4AOFA 4XBEL 5C0JB 5K93A 1MW1A 3R06B 1E4XH 2PXYB 1EZLA 2AV1A 1OARH 4GI8A 1EA9C 2Q8BL 4YHZH 5KSAA 3QPQC 3CTTA 5ILTL 2YQ2A 4Z76A 3D05A 1SBBA 1PH0A 4PGJA 2FX8H 2Y72A 2IAMA 3HNTL 1JGLH 1SDDB 4L29A 4PJ7E 1ASQA 3CVIL 1AFVH 4TUKH 3QZLA 3UJTH 4U1KB 5HYQA 2FH7A 2A6IA 3AROA 3WKML 2EXYC 2WO3B 1EFXB 3DX7B 4XC1H 3DBSA 5KSAC 4PSPA 1AR1B 5GS1B 1F58L 3FUDA 3BUIA 2IAMC 4Z7WE 3PQYB 4WHCA 5SWZA 2IH3B 1AXIB 4DP2X 1P7QA 3WIFB 2AQ1A 1LQBC 2BZDA 5IB3A 3I6KA 3VM5A 5I5IA 3TF4A 4XP6L 3KH3A 3DKHA 5FW6A 3L95B 3MV8B 3UBGA 1E4KA 2DWDB 1NAKH 4RGND 4EI6B 5FGRA 2PO6D 2P7TA 3O2VH 4Z3TA 5EA0H 2HT2D 5FF6A 3QEUB 3QNZB 2B4OA 3B7SA 1OCRB 2GITB 4JPKL 4U6VH 1OAJA 3VFRA 1UD4A 1A66A 4OSUH 4MX7B 1ZWIA 1KCUL 4QRQB 1LVEA 1NCUA 5E4OA 4AYFA 4G6ML 1J10A 1WCBA 3CFIC 1E4KC 2H6UA 2GJTA 4H8WL 5KBKA 2Q20A 2IGFH 3QPXH 1GOGA 2EXWC 2FYYA 2P4AB 2NY5C 2QCTA 5JLZB 3AQDA 1MG3C 1CICB 3KPSE 2NQ3A 2VQTA 4PPTA 4X2UA 5C0NC 1ET7A 3VFGH 5BS0D 5L9DH 4X4ZA 1X9RA 3ULVF 1AOZA 5D4HA 4CVUA 1N68A 2R1WB 5EO1A 4X99B 5KW9L 1S3RA 4X6BB 4YHIB 2KS0A 5E2WL 4OZ4B 4MMZB 3FOMA 2NR6D 4YN3A 2MQCA 1A6VH 1FJ1A 2W38A 4G9DB 2C1OB 1EAQA 2WQ8A 3FU3A 3H6JA 4S1QL 3SDCD 1A6AA 1DSYA 2H1LM 3QUXB 4FAAB 4W9EC 3FT0A 3WIIL 4ZSOA 1YDPA 3N1MC 5EF3A 2BZLA 3QUKB 4POZC 4HUWA 5E4EC 2F7RA 5ALCH 4C4KO 3D0VB 1W80A 4ZS7H 5T3XL 5KVFL 4Y1AD 2FT8A 3FQWB 3IJ8A 3PWNA 2DWYA 3BI9X 5HI3D 1E8CA 2HY3A 3FN9A 2CLZA 2WSKA 5KJRH 3PDGA 5I8OH 3CN4A 1TEFA 5JOFB 3QQ3A 1L3NA 3MUUA 4OCLC 3ZTNL 3E80A 2YPLA 4HXBL 2JFHA 3HG1E 2K1MA 5C9JB 4P2QE 4A1RA 4PJBB 4JANB 1A9EA 5DC0A 3S8GB 4R4NC 1GAFL 5HPMB 3C2AH 3P4MB 4GO6B 3K1KC 3PDDA 4QXVA 3ZSTA 4YLCA 5DTFB 1AY1L 4W9HC 4GP5B 1U8HA 4ZS6D 3HBQA 5K1NA 4FHBD 4F8TA 4APQD 3K1DA 1ZT4B 2OMNA 2ADJB 4C56B 3QEHB 4HKXB 3U7YL 3VRJA 5FC9A 1VPOL 2F6AA 1B90A 4ZMVA 3UTSA 4UV7L 3ZX1A 4HG4K 5E2UH 4NKDA 5L2KE 5T3XD 3V4VH 2XZQH 3S37H 2JE8A 3A6OA 1V3LA 1TCRA 2F18A 2VDLB 4GKZA 5CHNB 4GUQA 1RU9L 2YD8A 2BNRD 3QR2A 4NI6A 3IAPA 1SXZA 5I6PA 4MJIA 3WEBA 1SM3L 4JZNA 1PLGL 4X50A 1BFSA 4M6NH 4A7SA 2YO3A 1PNDA 4JFOB 4JHAL 1A5FH 2VWEE 2W9LA 4L2LA 4HJGA 4OLYL 3TCXA 2BIJA 4MSWA 5HGDB 4UMGA 4HEPA 2Z4TA 1FZJA 3HHSA 2G60L 3GMRB 3PU7A 1AQ8A 3EBIA 3VH8A 3I3DA 4JFYB 4HS6A 5IP4A 2R29L 4KX7A 3Q2VA 3OGOE 1M6OB 1WP6A 4J3UA 4MA7L 4W6WB 4XO8A 5HD8C 4MVBC 4FQHB 1I7RA 1F4YH 4UU9A 3P0VL 1W6WA 3WEAA 3KXFD 4NHCH 1V54B 5C08E 4CGTA 1NCWL 4YQXL 4GMTL 4HPYH 4JR9L 3U0TB 3FUFA 3MGTB 1JUFA 3O41A 3OKMB 4WFHD 3L4ZA 4EPSA 1KV3A 1AZVA 4FG6C 1JXFA 3FO1B 5I1IL 3QXAA 2AXJA 4A2DA 5CF3A 1P1ZB 5F8QC 4S0GA 4BH7B 2VXTL 5E03A 4EOWL 1FC2D 4LSSH 2ESVE 4E9LA 5JORB 3DHPA 2DPKA 2R9HD 4NBYB 2EXSA 2PCPA 3CN1A 2F0CA 4CVXB 1K8DB 5C71A 4WWPA 1JNNH 4OU3A 4CJ1A 3IMWA 2LLLA 2DQDL 2NLKA 4PJ9B 1FZMA 2RD0A 3Q3GA 3O4LB 5DD6A 5FW8A 1KXTB 1IX2A 3VRLE 3GMMA 4Z7UF 3VVWA 3PWVA 3D85B 3L6FA 3OV6A 4O02A 1WIPA 1YEDB 3QJSB 2EJ1A 4KRNA 4NB7A 1CF8L 1XCTA 2X7LA 2VLME 3NJIA 3KEDA 2R23B 4AV5A 4PN6A 3MXVH 2AEQH 4RAUB 2NTFB 5AWNH 1P5UB 4R2GD 1OAQL 4YZFF 4UF7C 2EACA 1CLZH 1MPAH 2ZP9A 1CT8A 2EE3A 3HG2A 3MSPA 4K3DH 4KJQC 3F58L 4U3XA 2VLKB 5G4MA 3HC0B 4ONGL 5DWUH 5C09D 1IE4A 2A1WL 1R17A 4ZX4A 3UBXG 3MLUL 5J1SC 3LJ3A 5IQNA 3IDXH 1GGUA 2WZPD 2LVCA 1CYGA 4I1RA 1UURA 1I8IB 2KZ1B 1E8ZA 2DD8L 4N1HB 1J86A 4ZTPL 4CNIA 5I17B 3WJLA 1PLBA 4R4FH 4OGZA 1ACZA 2ZCHH 2ODHA 3P3UA 3HE6A 3L4XA 5CP7B 4G8GA 2J8UF 3I6SA 1QSZA 5K9QI 4X0KB 3DETD 4JO4H 1WS7A 4KKBC 1IAMA 1BFTA 3IJ7A 1BHGA 5AZUA 5IBUG 5EBWB 2YC1A 4L4VA 3WUWA 1HXMA 4F7KA 1PXHA 4LP4A 3WJLC 1WK0A 2OMVB 5J12C 2BSRA 1T89A 2P5WD 5HVHB 3HE6C 3UTTB 1JRHI 1HHGB 2K4WA 1XL4A 5EF2A 3GSXA 2R7EB 4GUPB 4TQ8A 1VRSA 3Q2CA 1M05B 4X9BA 4XCCL 5EZIL 4KTDH 3N43F 3AQZA 3BMVA 2QTVA 5ACMA 5D7SH 1D2PA 1OPGH 4L8BB 4OFVA 1T89C 5IVXA 4GSQA 3LQAH 3D2UD 5T3ZL 3CFEB 4Q52A 5HYSG 5EDXA 2WMPA 1XR9B 1QBML 3OKDA 4G43A 4L37A 4OD2A 1R24A 5T5FH 4DKEL 4YSAA 2R2BA 4CU8A 4RDQG 4Z7UB 1UKTA 3B9KB 1A6UL 3HB3C 2H0FA 5DHVA 3DUHA 2P8MB 3G6JE 1FO0H 4AQAA 1SY6H 3UTQB 3K4DA 1ZT7A 3GI8H 3PS6A 4BQ6A 4A2EA 4KO7A 4PJCA 1SDYA 3QCIA 2M83A 3HCVA 1KYDA 4XO5A 5LQBL 1KCWA 1BVOA 2EE2A 4Z7IA 5DMJB 5GRVL 2WCPA 4OLVL 1N59A 3RDTD 3BVWA 3WXWL 4K94H 1C16A 3J27A 5DD1L 1MW2A 4JM4H 3H54A 4NNPL 3MLXL 3G6DL 3CFDA 3T3ME 5BS0E 3W5MA 1MJUL 4YO0B 4AENA 3NDZE 4I0PB 1KIPB 4O4YL 3MBXH 4ANXA 4K5PA 2D2OA 4X4MA 1EHKB 3GSOB 4ZAKD 3KJ4C 1KT2B 3M1CA 3CPLA 2XIBA 3PCYA 2ZOUA 4O9HL 4KKQA 4WF7A 2BSTB 3UYPB 4OJEH 2ITCA 2BVOA 2OTWB 4Y16D 4U0RB 2J8UB 3GB7B 2JKSA 2CLVB 1P7BA 3ETTA 3QEGH 3FRUB 4P8QA 4JAMB 1KGIA 2Y5TB 1E3XA 1S7TA 1Z9NA 1R5VB 1YEHL 1BQRA 2A0LC 4Y1AE 3F12B 5DRNB 2Z7UA 4AEEA 2JIXD 1DCEA 3PHQA 4PTUB 1E4JA 4LSUL 3GINA 3H8NA 4LU5L 5EHPA 1AR2A 2R2HA 1S7UB 4AH2A 4Q89A 3C08H 1AGEB 3OMAB 3QA3A 4HKZB 1PD1A 1HEJC 4WDIA 3IBEA 3LRSB 1K2DB 4NSKB 5FO2A 4ZD3L 3HN3A 3KBHE 3T6VA 3WAKA 2OQJB 1M3GA 2GC7C 2NW2A 4NQDA 2FECL 3L2LA 4XT1C 3DUUA 1CBVH 1ZLVK 1A21A 1YJDC 1LO4H 3ISWA 3U0PB 2NY1C 1D6VL 4MRCA 4AW4A 4AUYA 4BM7A 3RZCD 3DIDA 4EJ1C 5D5ME 3QJTB 4XCEB 1NKOA 3GZPA 4PGDA 4FG4A 4HFUH 1E9PA 4UILH 1MHHB 3TT3L 1AS8A 1XSIA 1AO7A 3B4NA 3LXBA 4ORGA 2JELL 4QXGL 1YUHA 1S2EA 3EO0A 2YD0A 3OVUB 1AD9B 4WUKH 1UGKA 3UG5A 5KVFE 5T3XE 2DQFA 4C12A 3UYOD 2VDPB 2G9HA 1QI5A 1U2HA 4Y19B 5HYIA 4IJ3B 2PYEB 4DEPC 5EIQA 2A74C 5TDPA 2QPDB 5LGYA 2CNEA 4RDDA 3TNMB 5J6SA 3KZ8A 1GHFH 2AJSH 2BNRE 4YDKH 3TBCA 5A2JH 5F97E 4TSBH 1HL9A 4KJYA 1I4FB 1F2XK 1G6RB 3CFNA 4NQXA 1HEZA 4ZO9A 4BFEA 4ODSH 2O26U 5F3FA 2E0TA 3EOBB 1KSRA 1AI1L 1R5WA 1ZOXA 2AK4B 2WLNA 4XNMB 3LEVL 2WANA 3LKPA 4JFDD 3U46A 2WKGA 5HJ3A 4MDJB 2Y1AA 3D18B 4Y4HD 1DQLL 3IGKA 3FB5B 3ZZQA 4UQDA 2FRGP 3UZEA 5J0BA 2Q10A 5IQMA 2HX7A 4P9HC 3QIUB 5D7LB 4PJEF 3UACA 3KXFE 5I6XC 3VMOA 2CHNA 4QRBA 2F6WA 4U6HA 4XTRC 5F3HA 4XBEH 3Q48A 4WSKA 4WFHE 3JVGA 1DDHA 1MRDL 2ADGB 1H6FA 5LVEA 5JNYA 1MUJA 3DX4A 2Q8BH 1CFSA 1NFDA 5ILTH 2PUQT 1G1HA 3HNTH 5EPMB 3OSKA 3CVIH 3DTXA 4N8CL 2FEDD 3B83A 3JVGC 5KZCB 3DIVA 3W9DB 4UT9A 1UM5L 2UUOA 2C4XA 4U1LB 3WKMH 4B7IA 1F3JA 4F7EA 4OFYD 5IMMA 1F58H 3I6LD 3Q7JA 3CHPA 1QI3A 1RHHA 4LQFL 4ONFH 3O45B 1XCQB 5FA4B 1ZHNB 3DX6A 4MASA 3I75A 1DQDH 2HJLB 3DC0A 3FTGB 2XQYK 4ONHA 3NCMA 4V2CB 5L6YL 2DMBA 4RMRA 2WXKA 4PGCA 4E42A 4XP6H 3B1UA 4R97C 2ZAGA 3P73B 3TA3B 1S8DB 4CU7A 4LHJB 4I5BA 2VMDA 3C5ZA 5C09E 4HZAA 4PJ5B 2VJ0A 4KKLC 1U3JA 3AGWA 3LIZL 4P2RB 2ZUQB 4FP8L 1JGDB 4JPKH 3OC8A 2NUTA 2WXHA 4HYTB 1BZ8A 1KCUH 3OG4B 3Q01A 3KPLA 4G6MH 5DK0A 3FO2A 4H8WH 3C5ZC 4QRUA 2DQIL 1ZGLP 1A8JH 4R7LA 1RUPL 1SXAA 2A83B 1RK1B 4JPIA 5J11B 5D7JB 3AGVA 2ICWJ 4XOBA 5I8EB 4QWWC 2M26A 2Y2TA 1XGPB 4OD1L 4Y2EA 2Z31D 2KERA 4K55A 5KW9H 5E2WH 2ZUWA 5J1AB 4PJEB 4YHNB 5CMAB 2QGDA 2BCMA 2P5WE 4S1QH 2EXTA 2PKDA 1J87A 1UCTA 1FZKB 2M1KA 3PNRB 2DEYX 2Y7OA 3WIIH 1HQRA 4OIAA 1SMOA 4LLQB 1H8LA 4UZUA 1AC6A 5E94B 2CMAA 4QEGA 4AGLA 3QDGB 5SWQA 5DRZA 5INDA 5T3XH 5G2NA 3S35X 5KVFH 2GTQA 4X5PA 5AYQA 1AZUA 4LMQI 4XZUB 4B5ZA 2N59A 2CMBA 2FIKB 2WLLA 1A22B 4K71B 2MCG1 3D30A 1CGVA 2J71A 3HKZA 3KDPB 3W3BA 3GSWB 3HR6A 3DXAA 3DX8B 4QYOA 4NRYB 3GS7A 3QARA 4OBRA 3DX0A 1SYVB 5EU6E 5EC2B 3UGXA 4S1DC 2XNAA 3EJPA 3ZTNH 2VDKL 2PWHA 4HXBH 5J06A 1YNKL 5DYOB 2F8VA 5DMGC 2PCYA 5CLTA 4NYHA 3RQ3A 1U8JB 4GJTB 5IROA 1GAFH 3GXMA 3LV3A 2YRPA 5I16B 4AM0B 5CD5C 2WJ5A 4URTB 4LF3B 1Z9OA 1JWSB 1F90H 1PEZA 5IW1A 3FH5A 1AY1H 4I48B 2OS7A 3QUMB 1FGSA 2BW5A 3L54A 1WIUA 2Z65C 3CCHB 3JV4B 1E8XA 2V7NA 3MRHB 1P4LB 3S2AA 3PGDA 3U7YH 2J5LC 4U1JA 5DD3L 2FGWL 3C8KB 3H9SB 5IROC 3QCEA 1A02N 3QULA 2J5WA 4PRHD 3W9EA 4UV7H 4JUSA 4LCYB 4HS3B 1Z3GL 4RX4A 4Y2NA 1QFOA 4GRZA 1MOEA 1NCAL 1X4XA 4LCCB 3WNOA 5C1MB 1CXEA 3MLTA 4UTAL 1G4MA 1V5JA 1MLCA 3MRKB 3QAQA 3QZWA 4G6KL 4UQEA 3U6RB 3V0AC 3LN5A 2VDNL 3DPBA 1Q6SA 4NZ8A 1KB3A 1RU9H 4IIQB 4TMPA 1A4JA 1SM3H 1PLGH 1U9KA 3CHQA 1ANUA 3VX0A 4Y2LA 4M7JL 1RIVL 4ZW5A 1DE4B 5KSBE 1EO8L 1EGJA 3K5RA 4JHAH 3N42F 4OLYH 4QAHA 4MRBA 4JHVA 3N2JA 1QQDB 2K6ZA 1B6UA 4EUPG 4J4PD 5DXWA 5DD5L 2G60H 1O5DT 1T1ZB 3RGBA 3MR9B 3U4BL 1GYAA 2A4CA 3RY6A 2F53E 5FO8B 2JK5B 3MLSL 4UQIM 4H8VA 5EIIA 1OALA 1LGVA 4QAMB 5TQ2L 2R29H 2I6OA 2VM3A 3AAZB 3KYAA 2PABA 4XNQA 4MA7H 5DDHB 4TRPL 1O0VA 4N2CA 3QR1A 4E9XA 3P0VH 1NO6A 1UXWB 1U8LB 2XG4B 3RY6C 4NUPA 4AYID 2HG5B 1NCWH 1OB1B 4GMTH 4LT7A 5E9AA 2QDCA 3ZLQC 4CW1A 4JR9H 3EG9B 4GWFA 1K5WA 3OLEA 2ENJA 3V5KA 4BKTC 1R47A 1NMCC 3MRJB 1M4KA 4NM8L 4F5CA 3VGFA 2Y67A 3AU1B 4UBDC 3NCEB 4HUXB 1A1MA 1BW8A 5I1IH 1XXFC 3GSVB 2R1XA 4P99A 4LEOA 4NNDA 2XN0A 3RIKA 4JGNA 2DQTL 2Q87A 1P4IL 3T0XA 3AT9A 2VXTH 3STLB 2B5IB 4EOWH 2NXYD 2XTJE 3FKUS 1IQWL 3LNEA 3ZSSA 1JF1B 2W60A 4JFSA 4JZJB 4M6OL 1FVEB 2C9SA 4GFTB 4K8RC 5D2LB 1TG8A 4FKKA 1QA9A 3FUNA 2DQDH 3JYBA 3BUYB 4PJ7F 1NWPA 4M9PA 5AKVA 1ZTMA 4RISL 4QGTA 3QT2A 4QHMA 4FI6A 5IESL 5IBMA 4MXQD 1CF8H 3A0OA 4PTTA 1CU4L 4XOEA 5DEFB 1CZ8L 2VZ1A 2CDGA 3HC2A 2QQQA 1JYVA 2MHAB 4HFWB 4Z7WF 2QKIB 3MFFB 3S3CB 1OAQH 4G3YL 3G04B 2VLLA 1IEAB 3CN3A 3CH1B 1R1CA 3W11D 2FWUA 4PRIA 1J05B 1Z9SA 1Z0NA 3F58H 4YBLC 4ONGH 4HOXA 4A6YA 2A1WH 1F8TH 1MI5D 2IOIA 3ULSA 4Y14A 1XZ0B 3MLUH 3C60B 4JFDE 3CD4A 4WW2F 4ZO6A 1RFDL 1DP0A 3PXLA 4P4RA 1TQBB 4R6UA 2ZJSL 1KCRL 4F8PA 4LHUD 5MEQA 1OM3L 2WIIB 3N42B 3SIKA 4ZFFA 2DD8H 3QUYB 2F71A 2X2IA 3Q6FA 4GI9A 1U4FA 1ML0A 5AQ0A 3WKNA 5AVSB 1MH5A 1S9XA 1GOFA 2QFRA 4UAOC 3FQNB 2N1TE 1IILE 1KTKE 1OM9A 5ECGA 4FQXB 4JM0A 4X6EB 1LYQA 3TS8A 1QYGL 3DO7A 2CJ3A 2X4NB 4DW2L 3GPEA 1MWAL 4EUPH 1YN7B 5D70L 3KW7A 2D7TL 2G0KA 1NC2A 2AMGA 3KCWA 1FPZA 2H32B 5E2VL 1A4CA 4BE6A 4U3SB 1SGKA 2L7JA 4OH2A 3M4UA 5DJ0B 5H2BA 3KLDA 3BESR 3BPLC 4UYQA 4AQZA 1G0XA 3APDA 3DDFA 4XCCH 1JNLL 5EZIH 5A5FA 1MFEL 1IAKA 1T5WA 5D93C 5F1NB 2QDWA 2B7DT 4N2OA 3NEOA 4L4TA 3VXSD 4G6FD 2WKOA 3I6LE 3O6FA 5T3ZH 3CVHL 1IVTA 4NXSA 1BVLA 1HVXA 4V1DB 3MLZH 4X8JB 1G0YR 4NNYB 3T8XA 1QBMH 4EN3B 1M71B 4DKEH 1BAWA 1PZ3A 1BJ1J 3O8XA 1QUNA 2MCMA 3ASNB 4R8WL 4P46A 2CBOA 1A6UH 1DSWA 2YPVA 3QJHB 3O6FC 2OCFD 3OKOA 1MIEL 1HAUA 4XCYB 4KRPB 5E8OA 1GY1A 5JYMA 1GGBL 1EVTC 2FLMA 2ZKYA 2UWEA 3B2UD 3Q1EA 2BRRL 5FUCE 4ZMZA 2GIYA 2Y2FA 4XVUD 2ZKWA 5JQ6L 3OM3B 1JRHL 3O8XC 1OW0A 5LQBH 3CDGB 1VFBA 4ESKA 3ZU8A 4P46C 1ZVSA 2HJFB 2FHBA 2YAHA 4OLVH 1EERB 2EIEA 2Z8VC 1TJGL 4DF9A 3EB1A 1BXAA 4I77L 3MBED 1D5XA 3RJOA 1VKXB 4HIHA 3WXWH 4FKHA 3CX5K 3HZYB 1G7JB 5DD1H 4NNPH 3SODB 3MLXH 5ETUA 4WW2B 3MBWA 1CC3A 1OCWL 3G6DH 3WDIA 1MJUH 1OW0C 3LKSA 1MJJA 4O4YH 1PKQB 2EEXA 3EXJA 5FA3A 1T80A 1V7NH 3DOHA 4DUVA 1WAXA 2ZYHA 4O9HH 5DWPA 3BVNA 5AW0B 4EIZC 3AQXA 1JTPA 3AREB 1KBKA 4HHAB 5GIRB 5T1MB 4ANUA 3UABA 1NCOA 3FPXA 3WNMA 2WINA 5CWSB 1LE9B 1BMWA 3TOPA 2VGLM 3P1VA 2VRAA 2BIPA 1Q90A 1U8MA 4BA8A 2I6IA 2IANE 4OHIA 3LKOA 1YEHH 3GUTA 4ZUWB 3SD5A 2Q05A 4N2AA 1KGUA 2OZ5A 4AYGA 4WTYA 4OZIE 3S3SA 1PGRB 4HIIA 1YVLA 5KBMA 4LSUH 1CGSL 4LU5H 5DLML 1UVQA 3C2SA 2NCEA 1X5MA 3ILDA 2PWDA 2H3XC 4B7LA 1G84A 1PJ9A 3ARTA 4YNYB 3B34A 1G7HB 4ZD3H 1EAOA 1NA8A 3C6LA 4XRCB 4Y2DB 3VI4A 5H37A 2XVBA 4CVZB 1P2CA 2UY7A 4JO2H 4XPGL 5F70A 3T1WA 3C09C 1FN4A 1I57A 3MA7A 2RA1A 1D6VH 2P8LB 3L3IA 4P3DB 2CRZA 2HFFB 3U83A 1U8PA 4IU2A 5C0JA 5KADA 4L3AA 3DMMB 2X10A 1X7SA 3C6LC 3TT3H 5EOCL 2PXYA 1A2YB 1EDHA 2JELH 4QXGH 4FMFA 4NPYB 5FCUL 3TL5A 3BQUA 5SWSA 3WO4B 3IF1B 3GSNL 2I4HA 2XZCL 1PTVA 3RJDA 3ISYA 3P9WB 3GIZL 4EZLA 4LLVB 4U1KA 2PXYC 1YY9D 1RULH 4HJEA 3VQ2C 1IARB 1I9JL 1ZLSL 1DQML 2F7IA 4BUQA 3DX7A 3VRLF 1EFXA 3BQUC 3DVFA 2IFFL 1PFOA 2ED8A 3OX8B 3CXDH 2K6WA 4FOMA 3R7QA 1ADQL 1HQ4A 2D7OA 4H2CA 4FQ1L 1JPGB 5J1TC 1XEDA 3PQYA 2YA0A 2GBTA 2IH3A 5JMRA 3H7BB 5LGJB 3WIFA 3QQNA 3X1FA 1EXHA 2G4GA 2GIMA 4X6CE 3B9DA 1AI1H 4ILDA 4D0BA 1HIML 2A6DB 4GYBA 1AR1C 3LEVH 2ZCLL 3L95A 4XMPL 3MOWA 4QTFA 2DWDA 2ZSWB 4OQTA 1T4KA 3BFQG 3LZLA 4HKBB 1DQLH 2DZEA 2ZUVA 4I3GA 3M17A 3QI9B 3QEUA 2J88L 2WWNA 3QNZA 1KBBA 1T83A 4XN7A 4JG1L 5AFAA 3X2QB 2CM6A 2DICA 3LEYL 3CZSA 4HIEB 5K9OB 1TT6A 2H3NB 3EJZD 4QRQA 1NMBH 4L3EE 2WLIB 1NBZA 5F88B 2AXHA 3FNKA 3PAZA 4BZ1A 3QJZA 1BG1A 1R3HB 1ODUA 5JLZA 1CICA 5KYXB 1MRDH 1RLBA 1T83C 2ADYA 3KG5A 5AB1A 4MMYB 1JGUH 2Z92A 1NFIB 2WQSA 2R1WA 1H5BB 4H0GA 5AUMB 4I2XE 1XF2A 4YHIA 1R3KA 2E7LC 4OZ4A 5K1JA 4JM2B 4QRPA 4Y9EA 3QCFA 4F8LA 4R96B 4E9TA 3RUGE 1Q4NX 2C1OA 4WHYG 1BD2B 1CICC 3QUXA 4H5SA 4N8CH 5G4OA 3TONA 4GEIA 5IHWA 1UM5H 4OUOA 2OSYA 3QO1A 4PRPA 2KPNA 3SPHA 5IJKA 3QUKA 5CKAA 43C9B 4ZG1A 1RZQA 3ZMPA 3D0VA 3RWFB 1BVKB 2HNQA 2X89D 3LYRA 4KZDL 3UDWC 4KUCD 4H34A 4LQFH 4QOKB 1PLAA 1OTSD 4KJPC 5MEPB 1GFYA 1NEZB 3LPOA 1T22B 3QUXC 4PJXF 2J1KA 2UUDK 5JOFA 5L6YH 2NSMA 1FSKB 2R56L 3DECA 2HPTA 5IJKC 4PJAF 1JZ4A 1M1SA 4KY2A 3VTTA 1DO6A 2FBRA 5C9JA 2MOVA 1B4TA 1MI5E 3DVIA 4YHPB 3P4MA 4HPOL 3LIZH 3MRCB 4FP8H 3SYOA 4F58L 1PG7L 1QSFE 1JDAA 4QHNB 4R3SA 1TQUA 2X9XA 2ADJA 4RMSA 4CVWA 2E8ZA 3QEHA 4HKXA 4HHGA 2DQIH 3ERXA 1TTGA 1QHPA 4LPCA 5DQDL 2I07A 1RUPH 1R3LB 1CD8A 4FYSA 3I9AA 4OD1H 4WZ9A 5F3BB 1HTYA 2WP3T 3T3MF 4JN1L 2UUPA 2GJ6D 3U7WL 3SGDH 1Q0XL 4ZOBA 2ETWA 3VXSB 4Y2OA 5CHNA 2ADFH 1FORL 1BCIA 3GXPA 4IBTA 4A7QA 43CAB 3IKKA 3D07A 3KGTA 2P5EB 5B22A 4RH9A 3C8HA 2LU3A 2W07B 5GRYA 3SDDD 4LHUG 3VXSE 3CZFB 5HGDA 3GMRA 4MD0A 4G82A 2LV4A 4WLCA 2QGBA 1MEXL 1D5IL 3T6WA 5AL0A 4JFYA 1AXSA 3M88A 4ZW3A 2KKQA 2VDKH 2X6UA 1YNKH 4UCFA 3VFSB 3ULVC 1I9TA 4KKAC 1M6OA 2J72A 1ROCA 4OZHE 3GJFA 4UWQB 5A2IH 4FQHA 1BV8A 4AGMA 4LDEB 2Z35B 4I3RL 5DMIL 1ECZA 2LR4A 4PRAB 2NY2B 3PLYA 3U0TA 4PJXB 4WNQA 3MGTA 2DWXA 4ISVB 3TO4B 2VOTA 3SO3B 1SOKA 1KXQE 1JFQL 5DD3H 2FGWH 5EWIL 5D6CB 2B15A 2ZWNA 3TVMD 3MI6A 4D8PB 2UXTA 4BH7A 1Z3GH 1Y18A 4LESA 1NCAH 5JORA 3POHA 3MYJB 4I87A 4CVXA 4RGNB 4HIPA 4UTAH 4G6KH 1URLA 2ZOLB 3NDYE 4OJYA 2VDNH 3ZO9A 2JMRA 2YD3A 4PJ9A 3GBNL 5IOKA 5GS0L 1KXTA 4FJZA 1MZYA 1OCZB 3D85A 3SBRA 1NCCL 1NIFA 1YEDA 1A0QL 2GC4C 4M7JH 4OV5A 1RIVH 1U8IB 1UD2A 3OWEA 4LLYB 5GRUL 2Q3XA 2C34A 1NC4A 1EO8H 2BOBB 4PW4A 2R23A 3HZKB 4PJ9C 4RAUA 3T2OA 1P5UA 3HJ0A 5DD5H 7TAAA 4G70B 2M8XA 3U4BH 5KJ7E 4RLDA 3NZHL 3FK3A 4TM9A 4UQ3A 2VLKA 3KYOA 3HC0A 3MLSH 3W0WB 4AC4A 5TQ2H 1X4YA 2WV3A 3CC5A 4TRPH 1SVZA 4XB3A 1P5UC 3CXHK 1I8IA 3QO0B 1D6EA 4F37K 1CD1A 1NCBH 1S7RB 2AJXL 1I7TA 3ABGA 4K9EC 3F7QA 1T7XA 5I17A 2BHFA 4NM8H 5GISL 1U3HB 5GS0D 4O00A 5CP7A 1C87A 2IFGA 5I1LB 1VCBC 1ZS8A 5ANHA 3JTSB 1AQMA 1ROWA 1UASA 4TNEA 2CDEB 3M1BB 5AVYB 2DQTH 2DL2A 1HDMB 3IDMA 4PLKC 4KTGA 3K71A 4KI1A 4NWUL 4GY4A 3GTNA 1IQWH 4Q97A 4M6OH 4HF5L 2DLGA 4E9VA 1EHNA 2R7EA 1YEGL 4GUPA 3RL2A 1EIBA 2DM4A 3QQDB 4GRWF 4RISH 3WS3B 4ETYA 5IESH 4WJG3 3VVVA 3H4FA 3ZQXA 2WNKA 3G3LA 1BJ8A 3QEQD 1CU4H 2K6YA 4L8BA 4HOZA 1CZ8H 1IB5A 4IBSA 2N7BA 1UHVA 2HLAB 3CFEA 3NCBB 4JDVA 1QACA 5AOJA 2I75A 4QRSB 1S7XA 1HI6B 3N41B 1C1EL 1O7DE 2XBZA 2NY5L 1U8CB 3FTZA 4G3YH 1NEPA 4Z1PA 1XR9A 4OW6A 2V8LA 5B3JF 3NEEA 3N3EA 3WN5B 4Z78B 2D7PA 3CZLA 3DI3B 4Z7UA 3B9KA 4WGVB 4W81A 5GS3A 2P8MA 3ARUA 1RFDH 1AIZA 2Z1PA 3LAFA 1OHEA 4N2HA 4XNZB 4X6FB 2ZJSH 3MRFB 1KCRH 2P49B 2WSPA 4YK4B 3UTQA 1DFBL 3MRMB 4WU5B 5CXPA 1OM3H 5HXMA 2HMIC 5I66B 2AXWA 5DJDB 4HHWA 4G42B 4ZFOL 3B9KC 5L2JB 4FI7A 5SWZD 3BSZA 4PH8A 3S3KA 3BZDA 3L5WB 1P7QD 3ZL4L 1SN5A 1IBFA 2X3BA 2F70A 3BH8B 2VR5A 1GIGL 1DJIA 3KL0A 3PG2A 4DH2A 2FL5B 3ABKB 1QYGH 4YO0A 1OP3H 2VN5A 5TQ0H 3OQRA 4DW2H 1ILSA 1MWAH 3ME0B 2F54A 5KS9F 5D70H 2D7TH 1FYTD 3GSOA 4IDLA 1KT2A 2VR8A 5E2VH 2AQSA 2BSTA 1DCLA 2YMXH 1AP2B 4YSSA 2Y07H 3ETBF 2CPCA 4J6RH 2DTML 1WD8A 1JNLH 2OTWA 2YKLL 4BK4A 1MFEH 2J8UA 3GB7A 4ZK8A 1JPSL 2CLVA 4I0PC 2DBLL 4KVPA 4M61A 2R15A 4F92B 1A7PL 2HYMA 3FRUA 4XE5B 4JAMA 2Y5TA 1R5VA 3GSQB 3CVHH 3F12A 3ZR6A 3W39B 3D3VD 4V33A 3JV0A 5K59F 1BM3L 1FNHA 2ARJQ 2HX9A 4LLDA 2GJPA 2NZ9C