2B4PA

Structure of the d223n mutant of selenomonas ruminantium ptp-like phytase
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
314
structure length
314
Chain Sequence
MTVTEPVGSYARAERPQDFEGFVWRLDNDGKEALPRNFRTSADALRAPEKKFHLDAAYVPSREGMDALHISGSSAFTPAQLKNVAAKLREKTAGPIYDVDLRQESHGYLDGIPVSWYGERDWANLGKSQHEALADERHRLHAALHKTVYIAPLGKHKLPEGGEVRRVQKVQTEQEVAEAAGMRYFRIAATNHVWPTPENIDRFLAFYRTLPQDAWLHFHCEAGVGRTTAFMVMTDMLKNPSVSLKDILYRQHEIGGFYYGEFPIKTKDKDSWKTKYYREKIVMIEQFYRYVQENRADGYQTPWSVWLKSHPAKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Kinetic and structural analysis of a bacterial protein tyrosine phosphatase-like myo-inositol polyphosphatase.
pubmed doi rcsb
source organism Selenomonas ruminantium
molecule tags Hydrolase
molecule keywords myo-inositol hexaphosphate phosphohydrolase
total genus 107
structure length 314
sequence length 314
chains with identical sequence B
ec nomenclature ec 3.1.3.72: 5-phytase.
pdb deposition date 2005-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14566 PTPlike_phytase Inositol hexakisphosphate
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1690 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2b4pA01
3.90.190.10 Alpha Beta Alpha-Beta Complex Protein-Tyrosine Phosphatase; Chain A Protein tyrosine phosphatase superfamily 2b4pA02
2Q47A 3ZM2A 1GWZA 5GTJA 5KA3A 2BZLA 4HRFA 2A8BA 3SR9A 3QCLA 3QCNA 4OHIA 2QBQA 1I9TA 1G4WR 2H4VA 2F6TA 1WRMA 5IBSA 2ESBA 2H03A 2B4PA 2J17A 4JMJA 4PYHA 2HCMA 3QCJA 4S0GA 4JBCA 2CMAA 2F70A 3SMEA 2PA5A 3ZM0A 4KYQA 1KAKA 2NLKA 3BLUA 3H2XA 2OUDA 2HC1A 5KAAA 2I1YA 1ZC0A 2VEWA 2I4GA 1L8GA 3AWGA 3O5XA 4GFUA 1D5RA 1FQ1A 1G1HA 1PTVA 1YTNA 1EENA 3MOWA 3S3KA 3F9AA 2DXPA 2HNPA 4GFVA 4D3PA 4RDDA 1ZCKA 2NT7A 2SHPA 1XRIA 2HVLA 2Q05A 1OEVA 1P15A 1RPMA 1OEMX 2H4KA 2HXPA 2J16B 1WCHA 1U24A 3ZM3A 2B07A 2AHSA 3F9BA 4QUMA 2AZRA 1PA1A 1YZ4A 2P6XA 5KA9A 1C86A 4B04A 1JF7A 2A3KA 3O4UA 2F6VA 2C7SA 3ZMPA 4WTYA 4J51A 5KA7A 4GE5A 2B4OA 3OMHA 3MMJA 2QDPA 3RZ2A 2CNFA 1OEOX 2WGPA 1C85A 2I42A 2VEXA 2CM2A 4WU3A 3QCGA 3D9CA 1OETA 1U26A 2QBPA 2PSZA 3I36A 2H02A 4BPCA 2FJNA 1Q1MA 2I75A 4NX8A 3N0AA 4DGXA 4GS0A 1YGUA 2FJMA 4BJOA 1G1GA 2ZN7A 4GWFA 5AWXA 3QCIA 3QKPA 3ZMQA 4ZN5A 4MBBA 4H34A 3NMEA 4QBWA 4ICZA 3QCCA 3AWFA 2BV5A 3QCMA 3S3FA 1LYVA 5KA4A 2CJZA 1PXHA 1OHCA 3GXHA 2B4SA 2QBRA 2OZ5A 4JNBA 2Y96A 3ZM1A 3OLRA 1OESA 4D3RA 1T48A 1YN9A 3S4EA 1PYNA 1BZCA 3QCHA 5KACA 3V0HA 5J8RA 1SUGA 1NNYA 3I80A 2B3OA 1ECVA 3MOZA 4NWFA 2QEPA 2VEVA 1YPTA 1C87A 3QKQA 2F71A 2QBSA 2OOQA 3RGOA 1R6HA 1XXVA 2QDMA 3QCKA 2G59A 4JMKA 3B7OA 4R0TA 3V0JA 2Y2FA 4HJPA 2VEYA 3EU0A 1ONZA 2NT2A 2I3UA 1NO6A 2QDCA 4AZ1A 3V0GA 2NV5A 3I7ZA 1PTYA 4NWGA 5BZZA 2JJDA 4QAPA 5BX1A 3EAXA 2I5XA 4Y2EA 1YTSA 3D1OA 2CMBA 1QXKA 1I57A 1G7FA 2H04A 1I9SA 5KADA 2GWOA 4Z6BA 2CNGA 5KA1A 1JLNA 5KA8A 2CM3A 2F6WA 2YDUA 2G6ZA 4DGPA 3F99A 5K23A 2QCJA 1ZZWA 2HY3A 1Q6PA 2OC3A 3GXGA 2H4GA 1GFYA 2M3VA 4IKCA 1QZ0A 3M4UA 1NZ7A 3O4TA 5K9VA 4D3QA 3RGQA 1G4US 1ZCLA 2R0BA 4OHEA 3QCFA 2C46A 3D44A 5KA0A 1RXDA 4RHGA 4R30A 1XXPA 1OHEA 1T49A 2CM8A 5BUGA 2CFVA 3QCDA 2FH7A 1LQFA 4NNDA 4H1OA 3S4OA 2MBCA 4OHHA 3QCBA 1U25A 1OEUA 2VEUA 2I6MA 4TVVA 1Q6SA 1ONYA 1KAVA 3A5KA 2P4DA 2HNQA 1Q6MA 1LARA 2GJTA 3F41A 2F6ZA 4PVGA 4QUNA 5KA2A 1C83A 3AWEA 1BZHA 3CM3A 1WAXA 4RH5A 4WU2A 1T4JA 1Q6NA 1Q6JA 4RI4A 3D1QA 2I6JA 2E0TA 2I4EA 3O3LA 5K24A 1C84A 3O4SA 2CNIA 4GRYA 1PTTA 4GE2A 4GRZA 1YTWA 1OHDA 5I6VA 3QCEA 1PH0A 2F6YA 3EMUA 3U96A 1XBOA 2GP0A 2J16A 4KYRA 1FPZA 4NYHA 3ZV2A 1G1FA 3V0IA 3BLTA 5KABA 5M43A 1L8KA 2B49A 5HDEA 3PS5A 4GE6A 1PTUA 2I3RA 4ZRTA 1PA9A 1XM2A 2PI7A 3CWEA 1A5YA 4RI5A 2NTAA 2BGDA 3A5JA 4ERCA 3D42A 5K9WA 2IMGA 3EB1A 4YAAA 3S3EA 1G7GA 2ZMMA 1J4XA 1V3AA 4OHDA 5K25A 1AAXA 3LJ8A 2I6IA 5LXQB 1NWLA 2BIJA 1MKPA 3BRHA 1NWEA 4YR8B 1YWFA 2CMCA 4HJQA 2F46A 4Y14A 2QCTA 1Q6TA 2NZ6A 1C88A 5IBMA 2CNEA 3D1HA 2HC2A 5BZXA 2CM7A 4RKKA 3EZZA 4I8NA 5K22A 5EHRA 1YFOA 2PBNA 5MMZB 2RF6A 1YGRA 3V0EA 3BM8A 2I6OA 2PQ5A 2F6FA 3F81A 3S3HA 3V0FA 4RH9A 2HB1A 4ZI4A 4WOHA 4KI9A 4R0SA 1BZJA 1FPRA 2PT0A 2B4UA 1M3GA 5EHPA 3V0DA 1X24A 1NL9A 1VHRA 1EEOA 2BGEA 4OHLA 2I4HA 2I6PA 2CNHA 4QAHA 4QBEA 3RO1A
chains in the Genus database with same CATH superfamily
4F3QA 2R9LA 1SXLA 3BGUA 4X62F 4CYUA 4ZPCA 3ZZOA 3H8YA 4LUBA 4RNMA 1HNZJ 2J0XA 2XSFA 2ZOMA 2QC3A 3A8IA 1QE1A 1K0VA 2UP1A 5KA3A 2XMKA 3A12A 1VRUB 3QIPB 1RBAA 5KFOA 2ABYA 2HLUA 2A18A 4A8OA 3JB9k 2K3KA 3QNWB 2ASJA 1FWKA 2C22A 3GZ7A 4RH9A 2LEAA 1NDCA 1RT6A 1PJ5A 2FJVA 1SKRA 1F5BA 2EC0A 4LIWA 1M0SA 3BV8A 3CB4A 1WJ9A 4OHIA 1I9TA 5J2NA 2H4YB 2Z0GA 3MMCB 5HP1B 1WEYA 2FLLA 4ELTA 2Q66A 1TELA 2C42A 1WRMA 2CJQA 4XK8C 2IY5B 5CYQB 3UR3C 2R2SA 4M5IA 3T5LA 4B3SF 1IXKA 1EETB 1NJIT 2J17A 2OPRB 2CVIA 2M5YA 3H2VE 1YKWA 2BE9B 1UAGA 1X9MA 1ELOA 2RUSA 3BJYA 4EI2A 3UVJB 1V5VA 3CCSS 1WUUA 4OYOA 4JV0A 2KL8A 3BF4A 4QWBA 3TZWA 5LSRA 3DMJA 3KLFA 3ZTPA 2W7PA 3SFUA 4YR0A 2M0GB 3MM6A 4B9NA 4JI2J 2BJ8A 2YKNA 1OWXA 4J9UE 4QYRA 1MN7A 3SSRA 2W9BB 1R0AB 1C1BA 2F70A 4JB8B 3G6XA 2O1PA 3D4JA 3DLBA 2ZZNA 4WZMA 1YZ6A 2D3UA 4H54A 2JOQA 3OPKA 1KQGB 3K17A 3LANA 3PRBA 1JNZB 4HR2A 4WIQA 5BXIA 3VVTA 5DLGA 3X1LB 3H2XA 3CJQA 2OI2A 4ANDA 3C16A 2HRUA 3EGVA 3CDUA 3DLEA 4LFAJ 1U1QA 1T7PA 4DL6A 5F9NA 5D0RA 2V2QA 3EVMA 2PEHA 2Z2YB 2Y9HA 2M7SA 3D6FB 4OZLA 4J9SA 2YXLA 1D5RA 2MQLA 4MYUA 4A8XA 2KI2A 1UVMA 1PTVA 2CIMA 4TU8A 2JFHA 4ID5B 2DXPA 4ZOSA 1AW0A 2SXLA 1Y3KA 3JSBA 3G9CA 1F3VA 2LQJA 2W1BA 4NE9C 4C6AA 2V4JA 4A8YA 3BSCA 4UOGA 4JI0F 2XB2D 5FLXU 2WZ1A 1NHVA 1X4AA 4KBIA 1XRIA 2ALZA 4KHPJ 2J16B 1X4EA 2VG5A 4UY85 3K7RA 5F8IA 4NRTA 5AE3A 2MQPA 4A8FA 1B0VA 4CM2A 2DO0A 2OGUA 3QMQA 3AFGA 5FLXY 1RPMA 4DHVA 1X7VA 3AOBA 4RX6A 4WP3A 3BO3A 3DOKA 3N5FA 2QA4G 1QLNA 2H4KA 1R89A 4HT7A 4MFBB 4C48A 1U24A 4M5NA 5FJ4A 2DH8A 3UWTA 1WCHA 4AL6A 2B07A 5I3PA 2AKWB 5KFJA 3NS7B 5KFVA 5IQQA 1PA1A 2WTZA 2JLGA 3VCDA 3IAS9 1CVJA 1FF2A 3MM8A 3HHLD 3DRSB 4ES2A 2GJ2A 2ADCA 3BQ1A 2UVWA 1MKPA 1FE0A 2FVCA 3KJQB 5F8NA 1C86A 2R2UA 1JF7A 2CFXA 3UR0A 5IT9U 2A3KA 3PW7A 4OJGA 1XMQJ 4QU6A 1TKTA 1RT3A 1HNIA 2DTJA 2F1FA 2IAJB 4LSLA 3VGTA 2DNOA 3W65A 5MLCV 5LMUJ 5B0DA 1MMLA 2DGUA 2ERRA 5C42A 5DZ7A 4C11B 5CABA 3ZM5A 4QIFA 4TY8A 2CQCA 4WFAQ 2A1BA 5T7LB 3EMTA 3B78A 4DR5J 2GIQA 3KNGA 3W8GA 2B7CB 4M63A 4D3GA 3AA9A 3RGIA 4DX6A 1RTDB 1AUDA 2MQ8A 4UUXA 2HRYA 4NCGA 3OXFA 3BGFA 4E2FB 5LJ3Y 2CDRB 4U67Q 2A3JA 2ZHAA 2VEXA 2GX8A 3MCSA 3RJMB 4PG8A 3TZZA 4KPYA 5DG8A 3D9CA 3QCGA 1JLEB 1SIZA 2RS8A 4M5KA 2PSZA 2ZM6F 2DBBA 4LFBJ 2KZZA 3I36A 2BJEA 1KVIA 1RAJA 3DN9A 2H02A 4OYZA 2VKRA 2MZ1A 3N0AA 2JLEA 2YNIB 5LSOA 3DYAB 3GJRB 1AUSL 3MEGB 4P71A 3CUNA 2UVRA 2Z2MA 1BQNB 1X4CA 2XZDB 1SQGA 2KXFA 5KG7A 4XIUA 2DR7A 5KFFA 1G1GA 2ZN7A 4WP9A 2IM3A 1M5PC 1MMNA 1X4DA 2C2KB 3TAMA 2VF3A 3MDFA 1SC1B 2IYIA 4GWFA 4ZN5A 1WI6A 2MSTA 1VJWA 1SL0A 4I7FB 3EX7B 1UW4A 3N5BA 3CJTA 4RJVA 3FEZA 4EGLA 2AEFA 1BXNA 2GQ2A 3ZTQA 3PEHA 2DRBA 2RF2B 1BMQB 5IFMA 3QCCA 4FPRA 1N8RT 1IR2A 1N34J 3AQPA 2XULA 1WELA 4KR0B 2D3O1 1QTNB 1IBKF 2DPJA 3MM5A 1TUGB 1YZ7A 4ENOA 3GXHA 2ASDA 2V50A 3GFZA 3CMQA 1DLOB 3FZ2A 3MPUB 2QBRA 3EXCX 4RW7B 1EJ7L 1K1SA 1WOSA 3H42A 3MM9B 2BACA 3KLIB 3NOCA 2GMHA 2P8IA 1QTMA 3ZM1A 1VQ5S 2DY1A 2V0NA 4D3RA 1T48A 3MEDA 4K4XA 1X9WA 2F8EX 4DBQA 1R0BG 3Q8QB 1WC3A 1TVRA 4OLOA 3V0HA 3PFEA 4GKKJ 5J8RA 3SCJE 1NNDA 2CQDA 2HQIA 1RWMB 2JC1A 3BH7B 3M2RB 3NWRA 3CSKA 3K8VA 3TUPA 1RE1B 3U02A 2YNGB 3W5XA 4HKQA 1HW9A 4QCLA 1YPTA 2KYZA 2VEVA 5GAEI 2DNPA 1RWPB 2ZH4A 4FS2A 4KTQA 3E8OA 2Y8YA 2HFZA 1P31A 4WJBA 2F71A 2QBSA 2P9CA 3HFZB 1YJUA 3GQCA 5CD4A 2CPYA 1GX6A 4QJVA 8AT1B 4A8SA 2VUGA 2P9EA 3RGOA 3U1NA 1MROB 2Q1LA 5DZ6A 4J5OA 1R6HA 5ETSA 2ZKUA 1HYSA 5HJYA 2R7RA 2MKYA 1GT8A 4JMKA 4HTIA 1VRUA 3Q2SC 1DJ0A 4G1QB 4OZ2A 3AD7C 3CO9A 2PFFB 5ETLA 2VC0A 1RT5A 3KFWX 4MIBA 4YHHJ 4JV5J 1REVA 2WONA 3LP1B 4ZPAA 2IC3B 3TEHB 2VQEF 4GE5A 1RQ0A 1VCTA 3EXYA 4NPOA 3EU0A 1WSVA 2BM0A 2YNHA 4N77A 4DPUA 4ZLJA 4KO0B 5CYJA 2X51A 1TL5A 3HSZA 1ZAVA 4AZ1A 1L3VA 1XR5A 2KFZA 1MWZA 4CO0A 3A8JA 3J7AN 3G8TA 1XMQF 1U2FA 9ATCB 1YDLA 5CYQA 3J81Y 2HWTA 3FFIB 4QW9A 2V8GA 2NV5A 3I7ZA 2Z2LA 3KG1A 3PTWA 5KOXA 4JI6J 1IJFB 1KRPA 1E0DA 1NPRA 4ECZA 1FGSA 2PMWA 1TL1A 2WVBA 3OR2A 1RACB 3BB5A 4K0KF 3KLFB 2VBWA 4RW6B 2HHSA 2BKOA 2E5HA 3G87A 2WOMA 4XTTA 3UFCX 3DFEA 3KMQA 2KT3A 1EP4B 2XGQA 2XG8A 3V6HA 2VKZG 3G8QA 4ES3A 2PDAA 1WTFA 1SI9A 4TNOA 1FJEB 1S6QA 3D1OA 1CULB 3ITHA 2J0WA 4FPIA 3J7YU 1I94J 1HR0J 1G7FA 3M9OB 2ILZA 4HI2A 3C16B 4NASA 2AGOA 2NXNA 1W2IA 3BR9A 2OO4A 1U6ZA 2CA9A 4OYWA 4W98A 2OAUA 3R5JB 3QT6A 5JJBA 2RSQA 2OD4A 5HI7A 1L5UA 4PG4A 1JX4A 2OJ3A 4TQRA 4DV2F 3QRPA 1JLNA 2CM3A 4HHHA 3PDNA 5LMNF 2CJBA 1S1XA 2IA6A 1KVJA 1FRLA 3WIUA 2MY8A 4IG3B 5IC4B 1LW2B 3GV5B 1BE4A 1Q82T 2G6ZA 2YDUA 3PYZA 2MTLA 3F99A 4BDPA 5K23A 4C8NA 1RUSA 2QGFB 3TA2A 1U1RA 3W64A 4NCAA 2FVQA 2ZH6A 2ZOGA 2F4FA 4USJC 3OTBA 3MAQA 1WHXA 5RUBA 1TAQA 3W2WA 4X4OA 1B3TA 2MLXA 1OY8A 1Q7LB 2QL7B 2BJ9A 1YBAA 4R0EA 4EYIB 3RB4A 1UAWA 3AHPA 2HVHA 1S48A 3G6VA 3ETMA 3UPFA 1W2BR 1KNZA 4YB7A 1R8CA 1T3NA 1S72S 1M5KC 1JWWA 1JLBA 1S10A 5HANA 2ZEJA 5KFXA 4K4YA 2DB1A 1HHSA 3DOKB 1RBLA 5DM7Q 4K4WA 3N01A 1S49A 3IA0A 2PEBA 1SCJB 3KK3B 4NEZA 3T1AA 2IVFB 2R7UA 2LXFA 1UWAA 1UZHA 3LAMA 1T94A 2AM2A 2W8KA 2VJVA 4G1PA 2F8MA 2ASYA 4KH1B 4YOEA 4UAGA 3OUYA 3M4XA 4RWXA 4OYXA 1Q0NA 3DRSA 4FXVA 2AJ0A 1FDBA 1XR6A 4YQWA 4QYZJ 3D44A 5BYSA 1RXDA 3ZXWA 5F8GA 4R30A 3OFFA 2CQ4A 2ZVSA 1T49A 2XS7A 1AZSA 3HCXA 4OZ5A 3QCDA 1ZAWA 1LK5A 1YRXA 2RU9A 3GR0A 2YKMB 2D74B 1LQFA 3TX0A 5C42B 3BQ0A 2XI3A 2W8LA 3ETOA 4CWBA 3PKYA 4TY8B 1N5YA 2DVIA 1VBYA 1S1UA 4KGXB 2QMXA 4ILRA 4IDKA 4EBDA 2GCAA 2MBCA 2VTDA 1S97A 3KHRA 3OTOJ 4G6VB 3OVAA 4ZVPB 1OEUA 3I4PA 4DR4F 5DJBA 4L74A 4CDIA 4I2PA 3TX8A 2DGSA 4OJ3A 3C46A 4FP9A 2MKKA 2FZGB 2G1HA 3G6ES 1FFWB 1RAHB 1Z1ZA 2ZJPQ 1NLKL 2HBRB 1GEHA 4KHRA 4OFZA 4OJ1A 4CH0S 1VOMA 1JLEA 2HS4A 3OD2A 3MR5A 2FVSA 3GU0A 2WBRA 4TLQA 1TTHB 4C9DA 2P4DA 3FQLA 2CJYB 3R6LB 1OPIA 5K8OA 3DRRB 2C2NA 3I5AA 2FLNA 4GKKF 3NRSA 1D9AA 2Z57B 2GJTA 1HBUB 3C14A 2M88A 1H73A 5ETMA 5BJRA 2UV8A 3KOAA 2WW4A 1IBCB 2IPOB 5L1LA 2HNYA 2HHVA 3ZC4A 3QRQA 1UMJA 2XMVA 3TAMB 4CLKA 1HPZA 4EUVA 3ONQA 1C83A 1OYEA 2XWYA 1OHCA 5KA2A 2MZRA 3PZPA 2F7VA 2L48A 3R7SB 4DDFA 3JAMU 1DTTA 2Y3YA 4WU2A 4LF5J 2MZJA 1N33J 1LWXA 4USMA 3CT9A 2AYEA 1EZZB 1RYSA 1U2RA 4DR3F 2ZD1A 3PHEA 2BW7A 2QSFA 3CJSA 4Q8EA 3PR5B 2IFXA 1H6KX 1O6XA 2I6JA 2C3MA 4DPWA 2DNLA 4DX7A 1HBNB 4QIWD 2C2MB 4WFZA 1C1CA 2UZAA 2GVZB 3DU6A 3GV7B 3BSNA 5EWFA 2R2RA 1UW9A 3MEDB 2CNIA 1TUVA 4CH1A 4WCEQ 4PG5A 1P9QC 1TR0A 3TJ9A 3M8RA 1UTAA 3R1LA 3OXLA 3ZTOA 3K2YA 3QFWA 1DZ5A 4DUZF 2VU5A 2AGQA 1PBUA 2CPXA 1T05B 3G96A 1VGYA 5ETQA 4ERDA 4DI6A 4M94A 3FDSA 4Y34A 4GC7A 4ZP6A 3D9BA 5DRKA 5IM0B 1T3OA 5F9LA 1DQ9A 3MWBA 2EFVA 3H98A 3IG1A 1QAJA 1JBWA 5E2QA 8ATCB 1X9SA 2MPUA 3QGPA 2I6MA 3PO5A 4B3RF 4KYRA 1WC0A 3W9IA 4JYAJ 1MROA 2LLZA 1FPZA 2FGCA 4GKJF 2R8KA 4KV8B 3IP0A 2RU3A 1N6QB 3ZV2A 2FPHX 3V0IA 3FJ2A 3T6JA 3OHBA 3MCMA 4ZP7A 3NGRA 1S0MA 4L76A 3AOAA 4G1QA 4O3RA 3K0JA 5M43A 2XZWA 1L8KA 4OZNA 3PX0A 4N56A 1Q8BA 2EFNA 4CT8A 5LMUF 2FY1A 1X60A 1REVB 2AEMA 1WSRA 2WONB 3LP1A 6AT1B 1XNQF 5DDOC 1R43A 1RLDA 1REGX 2CQ0A 4A4JA 2NQPA 2PMHA 2I3RA 2CZVC 3IBWA 2IHR1 4M95A 3MPVA 4CM0A 3R5AA 4OX9F 3VAIA 2HHUA 1I1GA 3QZ7A 4RI5A 1N54B 2K7JA 2BGDA 3QAUA 4UOCA 2VODA 3A5JA 1HBOB 1CJTB 4I0WA 3LK7A 5K9WA 4HTJA 3H5YA 3QPIA 4QPTA 5I4MA 3GIRA 2UXBF 1LWCB 5KFDA 2KHCA 4PXEA 3S3EA 2FHKA 3ZTSA 2BZ2A 4RW6A 2CQPA 1S9FA 1SV5A 1XERA 1XN9A 2YH0A 3DGPA 3GWCA 1B70B 3PY8A 4DWIA 2OFGX 3W3SA 5KFSA 3KJFB 2J76E 4GVBA 4QIEA 1U6FA 2V67A 5K25A 1AAXA 4NX9A 2CKWA 1FCAA 5L1KA 4XAKA 1F9FA 3IC1A 3M6UA 1QVFR 4NA1A 2L41A 2DD8S 3CCMS 4C4WA 2V2KA 5A76A 4YP3A 1RSCA 2O66A 4KC5A 4LRDA 1J5OB 2E9RX 1NWEA 3ISZA 1T02A 4WKYA 3WDOA 5BR8F 2VHGA 2LECA 1M1KT 2HMIA 2Z58B 2UXDJ 1E8CA 2CMCA 3BKFA 4CLLA 2F46A 2B9WA 3RBZA 4DXLA 1HNVB 1YWXA 2LXIA 2KG0A 1UEKA 3GJQB 4RW4B 3E51A 2R7WA 3BYRA 4WYLA 4DR7F 1KDNA 2PC6A 2NZ6A 1YJ9S 2RNEA 3T9ZA 4LQ3A 1HW8A 2CNEA 2B7BB 1NHKL 2UUCJ 5BZXA 4CVKA 2VL1A 2YQ0A 3IWLA 3L95X 2FDNA 2ZZMA 3FVYA 3EGWB 4JI4F 4I8NA 2FHJD 2XSJA 1X8DA 4DS5A 2V6AA 5K22A 2YWEA 2WSCC 1DQAA 3RR7A 1GMUA 2DK2A 4NL5A 1QVGR 4RU2A 3ILOA 3C19A 2AJ2A 5G4DA 2IM1A 3LW5C 4YEAA 4EFAC 5KFQA 4Z7CA 4DV0J 4DLGA 2C2EA 1YJ7A 2KVQE 3ENAA 2MQOA 5A2QU 1GXLA 2F6FA 2JFDA 1OQ3A 1RHKB 3QGHA 3CDAA 4NCBA 3DRPB 4HDGA 2XO7A 3CWJA 3B4MA 2IJFA 2HB1A 1W78A 4OLPA 4K2XA 5K5MA 3MTKA 1GX5A 3DLKB 4DF4A 5IWAJ 3PRVA 3VAMA 4XDDA 2DISA 3CGIA 4DCJB 1BZJA 2IRYA 1MU2A 5AE2A 5EHPA 1IM6A 5D4LA 4FN5A 2F4VJ 2ZKTA 1LXJA 3BREA 4IOCQ 1IM4A 1UZDA 3M8PB 1ZTTA 4LIRA 2RDIA 3OUYB 4FF3A 2QYGA 1EEOA 2HIYA 2YX1A 5D8HB 7FDRA 1PJ6A 3OR1A 3CMAS 2FJWA 2I4HA 4DV0F 2CNHA 3CIMA 4LQ9A 3WC2A 1LEOA 3D2WA 2Q47A 2N7CA 2C2ZB 1ROFA 4PPDA 5B08A 1GWZA 2RQKA 3B4DA 3OHAA 4WBFA 4LSZB 1GXTA 1VQ4S 4DFPA 2GW8A 5GTJA 5A5EA 3DM2A 2W9AA 1JJ4A 3Q24A 2KRRA 2VG7A 1JB0C 3AH6A 1UFWA 3TRGA 1RWOB 3ZZUA 4MMOA 2MJNA 2WVEA 2QA1A 2H65B 3IR7B 3DGVA 4KGVB 1EKSA 1FERA 1PKUA 1S1UB 2Y1RI 4KY3A 5ADZA 4IDKB 2V4RA 3VGVA 1QUPA 4DV6F 4DU7A 1TFWA 3POTA 1MNEA 3DXBA 3WC0A 2XO6A 2CQ3A 1U1OA 3FRYA 1EX8A 3G82A 1LQ9A 4I6YA 4X84A 4L72B 1S0VA 4C2MA 1VQPS 4Y2AA 3UN5A 2E9ZA 1ZOTA 3S1TA 2FJBB 2Y1IA 5ETRA 4DL3A 4P2MA 3CDWA 2GQQA 3W66A 4Q2LA 1LWEB 1S57A 1G6BA 1RAOA 3N6LA 4DZ6A 3M6WA 1ZETA 3JAMY 1KC8T 4PRFA 2ESBA 2ZBPA 3UN3A 5IZHA 1J4XA 3DRRA 2EKYA 3I5BA 3PHTA 3ZZTA 4F4AA 1CPZA 4JMJA 2AHOB 1VRTA 3LALA 4PYHA 1X5PA 2A10A 1DURA 2X1GA 4ZVRB 2YBVA 2MKJA 2HCMA 3QCJA 3FCWA 2ZC3A 1HQ2A 2QN6B 2R3VA 3HFKA 2CMAA 2O67A 3ULHA 2CRLA 4FF2A 1S6PA 4O3QA 1HQEA 2JDJA 4RO0A 3QRRA 4KYQA 2B5JA 4PAAA 5EN1A 1Q5VA 2ZE2B 3BLUA 1SH3A 4XPCA 1HMVA 1NM2A 2F9DA 2Q6CA 2Z30B 3KUGA 3QLHB 4B3RJ 2GC5A 2XBPA 2H54B 1QY7A 1R6YA 3T6BA 2HC1A 3F44A 4Y2MA 1HNWF 4DV1J 1L8GA 3SCKE 4ZHRB 1P9YA 4PWWA 2GIFA 1UA1A 1U4BA 2DITA 2HKEA 1FQ1A 4NLRA 1Z2LA 3W8PA 2VFSA 3Q8PB 4C8KA 2GVZA 1XNQJ 4Y6IA 1YTNA 3MVNA 3F9AA 5D15A 1PJ7A 2N4DA 2RT3A 2UVUA 3V6JA 1C0TB 2HNPA 1YG0A 4GFVA 2HHHF 4D3PA 1FX4A 1NMEB 2CNLB 1DHMA 1SQFA 4RPFA 1T05A 1RDRA 2Q6BA 3P8BB 2GMJA 4DCPB 2BW2A 2VD3A 4DV5J 3NNAA 2HVLA 5K14A 3WQPA 1SJRA 5IM0A 2OIHA 1IJEB 1P15A 4O0NA 1KD1T 4DFMA 2HHTA 2FZCB 3MMAB 4PWUA 1PBAA 1NZAA 2DJWA 4Y2CA 2NZ4A 4BLGA 2PI4A 3N9UC 4RBTA 5L39A 1YITS 1TL3B 3GFXA 3QSIA 2RDJA 3ZM3A 2V5HG 3PG9A 3VWSA 1RT1A 2QZ8A 1KHVA 1UP1A 1KQKA 1G2EA 3KJVA 4QUMA 4MKVA 3AT1B 3M6XA 1YZ4A 3LAKA 4M8LA 2OFHX 2YKOA 4N8OA 1KHWA 1RWXB 1QD1A 1Q81T 2CPIA 2GNKA 4RKUC 2R7TA 4JI8F 5KA9A 1UEVA 3S01A 2KU7A 2KZMA 1RCOB 1VC0A 4WYWA 3WHIA 1HLWA 4DPTA 1NPPA 1NSAA 2BM1A 2BRKA 2CJXB 3QZ8A 5CYMB 1VYAA 3JXOA 4YY3F 4TXSA 1EB0A 1N5SA 2QLJB 4KKOA 4FXDA 4U6PA 3BGRA 5ETPA 3EZZA 1X4BA 2CPFA 3MECA 5KFYA 2P9GA 3HDSA 4URSA 4ZCKA 3ZZPA 2HS3A 3HVRA 1BD6A 4XDCA 3Q8SB 2GCBA 1GQEA 3D54A 3Q8VA 2V2VA 4WFBQ 3OLAA 1H7WA 1IKYB 2B4OA 3TAQA 1H98A 2R7XA 1S7HA 4DU8A 1RTHA 4ZIVA 1FNXH 2HNZB 2LQ9A 2CNFA 1DAXA 1HWLA 2LYVA 2WGPA 3C66A 1GG4A 2E7WA 3T1HF 2LA6A 3BSAA 1S1WB 2MKCA 1U0SA 5CH7B 4H4KC 2DIUA 1HWJA 1TK0A 1M5OC 4DL5A 4B9TA 3OW2R 2X3GA 1JKHB 1QDUB 4BPCA 2I75A 3FCHA 3K58A 4Q45A 4F02A 3EZ5A 1I6JA 3ILLA 1HHQA 1RJJA 4PYDA 4ZLPA 1J5OA 3C2PA 4LF4J 1VQKS 4IOAQ 1YGUA 5HK4A 2WJPA 3TI0A 3BZQA 2HMIB 3IRXB 2UUBF 5T41A 3EVWA 6FD1A 1DFDA 5KFKA 4LFBF 1HNVA 1RK8A 2G2OA 2C2DA 1Q6JA 5AWXA 3X3UA 2HHWA 3AJ1A 2CZ9A 1J6UA 2CQIA 3BKTA 4OX7A 3CF5Q 4MBBA 4GO5X 2ZBQA 2EXUA 4H34A 1H2UX 1ZH5A 1WI8A 3PM9A 5CHCB 4ICZA 1XR7A 1Q8LA 4MK7A 2V34A 4DSJA 3SFGA 5EGYA 1YSJA 2AD9A 3P96A 4NLGA 2XSJB 1LOUA 3A8EA 2ZJQQ 4LF6J 4LBPA 3EGZA 3IWNC 4J9LA 1TMJA 2AM1A 4NX8A 1PXHA 1HD0A 4P7TA 2XMMA 4NWBA 3VQTA 4JI8J 2XNRA 2GAHC 1I3OB 2NUUG 2RDDA 2OHDA 1RT6B 2Y0BB 3BPDA 4L3NA 3OL7A 4H4OB 3V2UC 1PIEA 4URQU 4USKA 3WX8A 3GYNA 1D3WA 2V8HA 2GA7A 3GG1A 3TEGA 2HHPA 2C3PA 1Q4RA 3M32A 3PYDA 1F60B 5J2NB 4AT1B 5KAKA 3KYLA 2J6UA 2D9OA 1YN9A 3S4EA 5KACA 3CJ5A 2J9EA 3DRPA 2CNOB 2HWHA 1RP5A 1UPMB 2GMLA 4K8RA 4USIA 5HJXA 3V81B 4UT4A 5IOLA 4B9UA 1NNYA 4ZVTB 4UZCA 1TV6B 1T9VA 3IR5B 2Y67A 4PPZA 2B3OA 3TWZA 1XNRJ 2ROGA 3UVJA 3MOZA 2G9OA 1TMMA 5EHHA 1ECVA 4NWFA 3DMJB 2OEMA 2VDHA 3DI6A 4IYQA 4OYBA 3J80Y 3EPIA 3CJ8A 2OTLS 1M5SA 1WKJA 3GCWP 1T9YA 1CJKA 1EKRA 3OR1B 1APSA 1C1BB 1Q53A 4LRBA 4MYTA 4X65F 2DHSA 1VIOA 2HGLA 2DEJA 4QW8A 3UD4P 2UUAJ 3FRZA 4WFYA 3NGTA 1KN6A 2ZH5A 2GCFA 1RTIB 2EC2A 5HL7Q 2EPIA 4OL8A 2KXHA 3DM2B 2H51B 1D1UA 1ZZFA 2VG6A 4DSIA 2MXYA 5LOQA 3HHDA 3CO0P 4ZI4A 1D8ZA 2AZ3A 2XMJA 4HHUA 4R25A 4ZJOA 4K0KJ 5EUHA 3VTIA 1CJUA 3AQOA 4HJPA 4FNIA 3V6KA 4CNZA 1FT8A 2XM3A 4UQGA 1ONZA 1DARA 2OP5A 4Q44A 1PCAA 2YWKA 3T5KA 1DY3A 1R8PA 2I3UA 3R5GA 2QDCA 3UDVA 2DNKA 2WRMA 2NR0A 2HFOA 3CJ0A 5KFAA 3K57A 2G0IA 1L3SA 3V0GA 1LWEA 2ZZTA 3OSPA 2MKSA 3ISND 3VVUA 2MQMA 2VBYA 2RB7A 1H0HB 1J5EJ 3I4HX 3S8SA 4LF7F 2VONA 1PTYA 3IXQA 2HIQA 2DNGA 3SZ2A 3BO4A 4OHXA 2X5OA 1ZM4A 4BS2A 2AF6A 2HGNA 5GAEU 3PW5A 4JI7J 3KLHB 1RTZA 2KKHA 5CZXA 2HPUA 5LL6d 5IS2A 1VQOS 4JYAF 2K3IA 5A8RB 1EQ0A 1GQYA 3PW2A 1XMBA 3QYYA 3N4WA 3MD3A 4H4MA 1F5CA 1SH0A 4FBUA 1ZA2B 1YTSA 2EFOA 1B4SA 1KP6A 4DX8H 2B5JB 3EZUA 2E66A 2ZE2A 4Y2IA 2H04A 3QBCA 3FSXA 3J80U 1JLCB 2VPWB 3TA1A 3AOCA 4IFYA 4M5MA 3L7PA 4OZ3A 2KN4A 2ILYA 2GWOA 1ZYQA 2Y0SD 4LSNA 4Y00A 5HMXA 4ECYA 2RMLA 4DV3J 4NOHA 1I5OB 3A3PB 3GJTB 5JXSA 2HZCA 5SZTA 5L46A 3JQJA 1HI0P 3DLLQ 1VBKA 4X4QA 2F6WA 1RT3B 1OO0B 2R4FA 2V2ZA 2IAJA 4LSLB 3TR5A 3NGSA 1VQ7S 4HHJA 3CVKA 4AYBD 5FDLB 4DGPA 1RHRB 1YBTA 2LU2A 5AT1B 5KA4A 2H5JB 3NOGA 1QJHA 1IR1A 2DR9A 1XJWB 3R27A 4WF9Q 5KA7A 2GV1A 2QLWA 2D7SA 4KPCA 4LMZA 4TVAB 1KOOA 2W24A 3L7UA 1SQEA 4V1Ak 1T03A 2GFFA 3E3XA 4NCGB 1VC6A 2YH1A 1VQ9S 3GXGA 1FNOA 2VJUA 2DHGA 5D4PA 3CTRA 1E6VA 3DDIA 4IKAA 2BQUA 1G4CA 1YRTA 3GPAA 3PIPQ 1NDLA 4J9NA 4Q0BA 3Q23A 1GFYA 5GVQA 3N79A 2M3VA 3M7VA 1SC6A 2ALYB 2L3MA 2PO4A 4RZRA 4ZIYA 1IQZA 1F9EB 3FEXB 3MCNA 1UJ4A 3DYAA 3MHYA 3CULA 3W1YC 3O4TA 2E1AA 3MEGA 4X4SA 3ZM6A 3RGQA 3MAHA 5KG5A 1RA6A 2KFYA 3KJVB 1BQNA 1VK8A 3NKYA 4GO7X 1U09A 2IJRA 2DR8A 1KLMB 4I4BA 2HSEB 4A8WA 2XHCA 1SKSA 1S12A 4OHEA 3DLGA 3NBPB 3P4UB 2KVIA 3BGOP 1VHIA 2Q3PA 3HI9A 4OYIA 2XYHB 4I7FA 4LBHA 2DGOA 4O4RA 2C46A 3ZNUA 1XXPA 1OHEA 2CM8A 2J8SA 2C2OB 2EFQA 5E3QA 2MB0B 1R8AA 2AP6A 3UNYA 5CYMA 3KLGB 3N6NA 3MMBB 1CSJA 1JNRB 4DR4J 2BJ1A 2F40A 3BGRB 4KHMA 1NHUA 1EAYC 4QPXA 4H1OA 4P74A 3BH6B 3QT7A 4O3SA 1YVFA 2DO4A 3H4DA 5D4NA 3ZZ0A 1DLOA 1FXDA 1RT2A 5KFRA 4XPEA 2H48B 2ZHBA 1N5TA 4RW7A 3QCBA 2CPEA 3H20A 2D3ZA 1LFPA 3MM9A 3TZYA 2BQRA 1GMWD 1YBUA 5LMNJ 1QSYA 1FA0A 3RRGA 4LF9F 4DV2J 4DF8A 4G3IA 2HNZA 3P49B 5HO4A 1N56A 1KWMA 2GO8A 3CEDA 1IWAA 3IM9A 4RNHA 1LFWA 4KIAA 1Q8KA 1KS2A 1FJGF 2JVOA 3EDQB 4OI6A 4B02A 1PO6A 5F8JA 1WDDA 1RWKB 1S1TA 2ZH1A 1NDPA 1JKHA 2LEPA 3H0PA 4DUYJ 1U2CA 3ZZYA 1RWNB 1HR0F 2IRUA 1G7CB 2WCXA 5GADI 4ETZA 3HPOA 3JYTA 3C6TB 4ZP8A 4E0DA 4PUOB 2P2CB 3PJWA 2NXUA 2UXBJ 5A8KA 5D6GA 3H40A 3W7BA 4FKXA 2E5LJ 4PVGA 4HV4A 1UKUA 3IRXA 4QUNA 2BQ3A 1NZ7A 3MAAB 1KR4A 3A8KA 3I9V9 4BWJA 4F7VA 3R1HA 5D78A 4CLWA 1J2VA 1T9TA 1U02A 4YS2A 1T8EA 5HVHA 3CM3A 3KWMA 3NCRA 3P45B 5HMWA 4PWDA 3K89A 1HYSB 3KLVA 4U7CA 2Z56B 2EK1A 2W25A 3AB2B 2H1YA 3MFIA 1H7XA 2OKQA 2OPQA 1T11A 3I9ZA 4E98A 5GMEA 4JI3J 1W7WA 4J37A 1NKBA 1WG5A 1JLAA 1PC5A 4IO9Q 5BYQA 2B4VA 1F3FA 2NXCA 1KONA 2IC3A 3EJMA 4LF2A 4RLEA 5ETKA 3SSQA 3ILIA 1TK8A 4MJKA 1FHTA 4QWCA 1Y5IB 3O3LA 2MLZA 2FLPA 4CO1A 2VQEJ 1AB8A 3UCZP 4JI0J 2J0QD 4YHHF 4MAKA 3LP2A 4I1TA 2ZUAA 4AL5A 2P5VA 2WVCA 1RWVB 2LQ8A 4CLZA 4ATNA 4ZN1A 4F50A 1NK4A 1VK3A 2KRBA 3H2LA 1WTBA 1TAUA 2HFVA 2ZBCA 2VICA 4ZPDA 2CJAA 3TUZC 3D3CJ 4KGMA 4ZCIA 1EIYB 4C12A 2BBEA 2RQ4A 3R6GB 4GE2A 4N76A 2AYGA 2BUNA 2ATLA 1ZM2A 4NXNF 1TL1B 4UF4A 1CLFA 1YTWA 2DGXA 1OHDA 2G1DA 4UUWA 2UUTA 3QCEA 2C3YA 2F6YA 1V9OA 3KDNA 3MGJA 3Q83A 3KHHA 2LVWA 4F8RA 1HD1A 4RUCA 1UCNA 1FK9A 2XLIA 4LBIA 2QL9B 1VQLS 1CULA 1VHFA 3ITHB 5F0WA 5KG6A 2BOAA 4ECQA 3SMZA 1WACA 4EWTA 2JZ5A 1LK7A 3W5ZA 2CUYA 1Q8IA 2DCLA 2X3DA 4PQUB 1NH8A 3M6VA 1U8SA 3MPYA 4TN2A 4Q5VA 3H5XA 2OLWA 3M8QB 4Z7YA 3V6DA 4K4SA 5HDEA 3PS5A 5A6PA 3M2UA 3CJKB 2DR6A 3H5SA 4WZQA 3PYEA 1S1XB 2B6AA 4NLSA 4AL7A 4NLQA 4DR3J 2WW8A 2NZCA 1EEHA 2Y1LB 2M4MA 1LW2A 5LJ5Y 4FYVB 1T9XA 1FRKA 1XM2A 5AXMA 4LFAF 2QEXS 2QL5B 5DGAA 1QSLA 1A5YA 3P5BP 3J7YI 1RB0A 3WZ0A 5DS7A 4OYPA 4C3KA 4ZVQB 3D42A 4QF5A 3EB1A 1T9WA 2CNNB 2MDAA 2YVSA 3T41A 5KFCA 2WK4A 1HBMA 4XO0A 1O5JA 4C0HA 2JHEA 1S1VA 3TANA 1JLBB 1KQFB 2DGQA 4RL1A 3U1LA 4ETXA 2W4DA 2ZMMA 3NP5A 4AQYJ 4ECRA 3NWGA 3IS9B 3PFOA 3RW7A 4K59A 3LP0A 3QFHA 3WBZA 2MGZB 2VV5A 2V4QA 2AQ4A 1NJWA 2BKNA 4FVMA 2KXNB 2CPHA 4O44A 3LO3A 1VC5A 1NWLA 2I6IA 5LXQB 2N3LA 3NCPA 2BIJA 2JL9A 4DOZA 1X4GA 3BRHA 3EUNA 2HFNA 4IFYB 4YR8B 3C3LA 1HWUA 2DHAA 3ZZRA 1BGXT 3CC2S 4ZS6A 1N0VC 4LSNB 4HJQA 4F04B 2JFGA 3NEKA 2FHMA 4RNOA 4DV5F 5KT4A 4WKRA 2HG4A 2GJFA 4QR1A 1LYVA 1RT4A 2J8AA 3MCOA 2QJ3A 4HT5A 4C8YA 1AZSB 5IBMA 4KT0C 4Y2KA 3RAXA 1NXIA 2HHHJ 2H4GA 3HN7A 5FDLA 5F3ZA 3CJ2A 1RKJA 2QFJA 1VQYA 2V9WA 3J7ZT 4CNYA 4LF7J 1N5YB 1HNZF 4WE1B 2BABA 1NK0A 2DHXA 2B8PA 3DDNA 3BQ2A 3OQ2A 3SQGA 3DU5A 3UI3A 2JSXA 2XCAA 3QWPA 4YDXA 4GC6A 1UVLA 4YY3J 2RF6A 5MMZB 1T03B 4I2PB 1Q95G 4J91A 4DQRA 2M52A 1YGRA 2XZTB 3AODA 2I6OA 3V0EA 2OEJA 4DV1F 1E6VB 4O4GA 3S3HA 1NB2A 5A2QY 1ICEB 4CO3A 1CQMA 4EMDA 1PAEX 4ICLB 2BE2B 4PXDA 2B56A 1RHJB 2QMUB 2VDIA 4AXIA 3QATA 3CCUS 2HGMA 4JOUA 4USWA 4WOHA 1FXRA 1MW7A 1FPRA 1AXQA 1S5ZA 1H3DA 2KJWA 2PT0A 3RRKA 2DYAA 2VOSA 3SQOP 1RTJA 3U27A 3LWMA 1X24A 3V0DA 2AT1B 1HBUA 3C14B 2EI5A 5AJ3F 2K8GA 2W4PA 2WAQD 1UJ5A 3TYTA 1KLMA 1SKWA 2XYPB 4LF8F 2HNYB 2XMUA 5KFTA 3LOUA 3DLGB 3NBPA 4A8QA 2XYGB 3DRYA 3NXZA 4QBEA 3RO1A 3O8WA 3ZM2A 2E5GA 4B17A 4C97A 5DDRC 2UVVA 3N6MA 2YKQA 3Q0AA 4ITSA 3V4IB 2DGWA 2OPSB 3HM9A 2PA3A 4ZJLA 4NLTA 2QA2A 5KG3A 3VHQA 5JVGQ 3DDKA 2VH7A 1Z4UA 2GS8A 2RHQB 2ZD1B 3G8SA 3THTA 2O01C 3ISNC 3I56S 1YRUA 1I51B 1FNMA 2YQ1A 1WORA 3NGKA 4OHVA 3W60A 4BHQA 2CWKA 2LQBA 4DCOB 1BQMB 9RUBA 1HBNA 4I6AA 2R2TA 4JI5F 2M70A 1ZM3A 1FJCA 3SR9A 1C1CB 2AWZA 4LRCA 3AY0A 3O2IA 4DUZJ 3M9NB 2V69A 4KFBB 1SJ3P 1MSWD 3Q2TC 1LKZA 3HHLC 2FUG9 2ZDOA 3NMAA 5H1SV 1NJZA 1LW0A 3A4TA 4F2SA 4JV2A 1G4WR 5KFIA 4X64F 4ED5A 4LREA 4DX5A 5IBSA 3L09A 4QYZK 1U7LA 2GVDA 4P9SA 3SXLA 3HVTA 2R42A 4Y0FA 5H9EJ 1S6UA 2KDOA 2E5JA 3IGVA 3QO9B 4RBUA 1G1XA 4IR1A 1N5VA 3C6TA 2V63A 4MK9A 1ONYA 1JLQB 1FFGB 2FB0A 4KRWA 5K9FA 4QOTA 3IR6B 5A8KB 3HT0A 3VR1A 1TK5A 2BEFA 2WHOA 3DOLB 1W25A 1NJYA 4DQIA 2CDQA 4IQMA 5IXUA 1CJVA 2F8HA 2V8VA 4FXWA 3EPGA 4DQPA 4LF5F 5KFMA 1N33F 3SMEA 1Q5YA 2B43A 2KH9A 3UCUP 4PWDB 1KAKA 4LF1A 4IO1A 5KT5A 5IWAF 1N6QA 2NLKA 3KK2A 1VISA 2IJNA 2RQMA 3VALA 2Z4PA 3BKUA 4MK8A 1S9GA 2ZH7A 4QWEA 1NKCA 5KOWA 4DFJA 4KB7A 2AYMA 1X4HA 2RD5C 2R7VA 2NS1B 3NCQA 2I1YA 2VEWA 4WWSA 4UQTA 5E33A 2I4GA 2AX1A 1SKUB 5KFNA 2CJKA 2OPPB 1X0PA 1GMWA 2WSFC 4OZJA 2CQGA 1TZ0A 1YGYA 4OI3A 1FKOA 5H9FJ 1WC4A 2RJZA 2FD2A 3OBIA 4GVLA 4K5SA 4OJHA 4CLSA 4U7UK 2M8DB 3MOWA 3LP2B 4MIAA 1NSPA 5HQLA 1O51A 3G4SS 4NLPA 3S3KA 1KFDA 1HBOA 1CJTA 2X1AA 2GC8A 1URNA 2UUCF 3R3TA 2I5JB 2LMIA 1WOOA 1Y0HA 3IAM9 4NYZA 4ZVUB 4ZVSB 1LWCA 1Q16B 1WC6A 5B0AA 2VFVA 2E44A 3D5MA 1TL7B 1NDKA 2KJVA 5DDQC 2SHPA 4DV4J 2XLJA 3BR8A 3DGPB 5J1PA 4CTAB 1VBZA 1HA1A 1A9NB 3DHWC 2RE1A 4RNFA 3LUYA 4YMEA 4GVBB 4EZ9A 3EYZA 5H9FK 4MTPA 3FUYA 4ZCMA 5F8HA 4F2RA 4R5PA 2LXUA 4F4KA 1FK9B 2HYIB 1FVQA 1Y4ZB 1OEMX 1JXEA 4Y28C 4X4RA 1XTZA 5HN0A 1NB7A 3PX4A 2AHSA 3CIZA 2IDLA 4KAIA 5KG1A 1FXLA 3MTJA 5LXYA 2CAJA 4KQZA 1RT7A 2XI2A 2IM0A 2HVEA 1S9EA 4DR2F 2P6XA 3M8QA 1C4CA 3V6DB 4RW4A 4BUBA 4CT9A 5DLFA 1N0UA 2W9CA 3AD8C 3M2UB 3MR7A 3CJKA 3R97A 4A8KA 2B6AB 1PYSB 4ZVFA 2QX0A 5M2PA 3QGIA 2OD6A 2W7OA 1G3OA 2A2DA 2RH3A 2C7SA 4IFVB 3ZMPA 2GC6A 2HQDA 4WTYA 2IMWP 3IBFB 1NBEB 1V3ZA 4NLUA 3TOQA 4MKYA 2UUWA 3Q86A 1HL6A 2XWXA 3O44A 1YIJS 2LQ5A 2MZSA 3A1YG 4N8NA 2MHNA 2AJFE 4DL0C 2MKIA 3BO2A 3K8WA 3OTEA 2XQCA 5C5JA 1QAIA 3FBBA 2BANB 4G1IA 4DS4A 2YNFA 3KK1A 4B3MJ 2J9DE 3OJSA 1OEOX 3AXKA 3C8YA 1C85A 2I42A 2BA9A 5HROB 2JEIA 1VI7A 4WP8A 2D9PA 2DH7A 4PG6A 3LP0B 3PYFA 1D09B 1SBRA 5BR8J 3LTOA 4FDFA 1VQSA 3PJ9A 4ZPBA 3KNAA 2FIUA 4GKJJ 1HNWJ 2FJNA 4BBYA 1RZMA 5IT4A 4CVMA 4DGXA 3GYXB 1IKWA 5K8NA 5KFEA 2G2YA 1AA1B 3GONA 2PD1A 4FYXB 3K5OA 3D6TB 1UL3A 4G65A 4J7CA 1EHWA 4ZLNA 1ZPWX 4JI7F 2C2RA 3D0GE 5CA5A 1BY9A 4R8UB 3PVXA 3PV8A 2RRBA 3GYGA 2DNHA 4CH7A 1YJTA 4UOFA 4LR7A 5G0RB 3GG0A 3J81U 3LGHA 1TKXA 3UAGA 3BSOA 4OI1A 4NI2B 4U8VA 3M1VB 1KKHA 1SL2A 1FKAF 1Y9OA 4O0IA 5B0GA 2AGPA 4J9RA 3KLEA 2BV5A 1D9FA 2CJZA 5B0FA 4X4TA 3QAEA 4IH5A 5HQ8A 4ZVEA 4Y65A 3T1YJ 3POTB 4NYPA 2JFFA 4JNBA 1F6TA 1Y00A 3GJSB 3KG4A 1VJQA 4LFCJ 1IR0A 3GV8B 4BCAA 1CG2A 1SL1A 1B64A 1N48A 3OLRA 1OESA 1MMDA 3THPA 3UCGA 3UDLA 4O4GB 3VGUA 1BWVA 3EICA 2HURA 1VQNS 1BZCA 2I1RA 2V9KA 4K7QA 4K50A 2BE2A 5IT9Y 1P6TA 2E29A 1JK9B 1UFLA 3PYGA 3R5BA 1SUGA 4Q43A 4CCHA 4ED0A 5IV4A 1AROP 5GMDA 1VFJA 3B54A 1RTJB 2LFVA 2K1RB 2QEPA 3AA8A 4CRJA 1C87A 2JVRA 1WG4A 4PYAA 4RW9B 4NMLA 2JEJA 4K5RA 4PEOA 5F3TA 5GAGI 1EARA 1Q86T 5DQGA 4B08A 1P27B 5B0EA 4KHPF 5E3CA 3NGUA 1CQNA 4NA3A 2D1CA 1HQEB 2XY7A 3AJ2A 3HHLA 1U1MA 5I42B 2OOQA 4FF4A 1FRJA 4U95A 3UW1A 3V4IA 1AT1B 2KYXA 1HMVB 2N7YA 2W2PP 1XXVA 1WWHA 5GAGU 1IN0A 3QCKA 2VQFF 5T14A 5HMYA 1SB6A 4B3MF 4TYBA 4R0TA 3CCTA 4NLXA 4USTA 3EE3A 4RU9A 3MM7A 5KG0A 2HZAA 3EGNA 3HVWA 1HI8A 1VBXA 1PYTA 3C15B 3D0HE 2HQGA 3DC2A 3ENWA 5DG9A 4IRKA 4USHA 3EWGA 2ZHOA 1OJ4A 2XY6A 2VEYA 3AD9C 1FEEA 2A6MA 2FJEB 3R9LA 4ILMA 1Y7PA 4CVLA 4U7UD 3OVSA 3LA0A 1N32J 5L1IA 2ASLA 3S7RA 3SV4A 2VORA 3HLUA 3F56A 3I32A 2MYFA 1BUXA 2GVDB 3C6UA 4ZCLA 4DQQA 3HSDA 5D3GA 2WVFA 4X4PA 3MOJB 1BC6A 5J1EA 5C2CA 2UUPA 3L7OA 1VLYA 2HVDA 2KG1A 2EWHA 2UXCJ 1KOHA 1YQHA 2NCKL 3U7JA 4JI4J 1ZTWA 1OPZA 2FY8A 2UU9F 2QFIA 4DR2J 2JJDA 3Q8YA 3OL8A 2R8JA 4QAPA 4F4XA 1FDNA 5BX1A 3NNCA 3DOLA 3EVOA 2BV3A 4P6QA 1JLGA 1W7KA 1F9HA 1VMBA 3MMAA 4Y2EA 1CJVB 1E6YB 1FTCA 2DNZA 5IV3A 5DM6Q 3ENVA 1NCLA 3A13A 2RS2A 4DL4A 1IQTA 1TL3A 3HFVA 4YR3A 2G4BA 1HIYA 2E1CA 3F73A 2CMBA 4W92B 1OSDA 5IQ6A 5JUMA 1PC4A 3KK2B 1I57A 1QXKA 4M1KA 4IRCA 3NY0A 1I9SA 2PFDA 5D0HA 5D0EA 5FD1A 3CCQS 3PX6A 4IH6A 3WIVA 5KADA 4Z6BA 4ZA1A 1VLOA 3RYLA 3W2VB 1UVIA 2PI5A 3QJLA 1SUQB 3ADAC 2CNKB 4X2BA 5KA8A 3BGLA 2BMBA 3ZZZA 4YR2A 2OMLA 3OTDA 3QQCD 2CPJA 1JXLA 2I2YA 2JX2A 1V6HA 3M8SA 3LPEA 1K44A 3I6PA 4KKOB 3BYPA 4RWWA 3VF0B 4D3HA 4NXNJ 1FESA 1C0UB 2GZOA 3H4BA 4ECXA 4ZKAA 4K2JA 2QCJA 3GIMA 4ECSA 2EG1A 1ZZWA 3LGMA 4WPAA 1Q1KA 1FVSA 1Q6PA 2E9TA 1OS5A 2IA0A 4OMFG 5CZVA 1H2TZ 1FD2A 4AUKA 2CQHA 2OC3A 2C1EB 3PRDA 4FBTA 1HI1A 1RTHB 2ZWOA 3FNNA 3W62A 4OX9J 3B6BA 5SUHA 3BDEA 4B3TJ 1R3NA 4C7QA 3R2DJ 1S1WA 2HBZB 4F0MA 1XMOF 4DG1A 3BM7A 2OEKA 2QA4S 3SYZA 4CLTA 4X4UA 4W4MA 2DIVA 3FMWA 3GIIA 1OIAA 4L6V3 2UU9J 1R7IA 5E41A 2YWHA 1F5AA 5K9VA 2XC9A 2AW0A 1U1PA 3CC4S 4D3QA 3HXMA 3D68A 1G4US 1VS3A 1ITPA 3I0RA 1UETA 2DNYA 4M5DA 1ZCLA 3A3OB 1DRZA 1XQIA 2FGOA 4LRAA 2FC8A 4LJMA 3GIJA 1S9EB 1TKDA 2B8QA 3D3BJ 4TU7A 1M1GA 2W9CB 4DV7F 1UVKA 1U48A 5KA0A 2QE5A 4RHGA 2CJ9A 4X64J 1R31A 4TKTA 4ZPVR 1VQ8S 3M2VB 5BUGA 1H72C 3MURP 4MIWA 1FRIA 2BE7D 1RAFB 3RB6A 2FH7A 4FS1A 4NNDA 1JJ2R 2VQFJ 3GB0A 4RUAA 2DNNA 2M3DA 2EFPA 4H4OA 1FJGJ 3FBFA 3FBCA 3Q8UA 1JMTA 4OZ1A 2CADA 5CQGA 2MMYA 3D0IE 2H3EB 2VB6A 3CD5A 2YNFB 3M32B 2H9ZA 5DG7A 4JV5F 2J7UA 1QUVA 3I0SA 4Q7AA 4C98A 5DQIA 3K59A 2X1FA 4EEYA 3SIPB 4HACA 1AYEA 3D66A 3V81A 4YB6A 2NUHA 3GIKA 2JWNA 1DQ8A 1TV6A 4ZVHA 3DOMB 4HRFA 1ZA1B 2HNQA 1Q6MA 3TNVA 2RRAA 1LWFA 2AYBA 3I82A 3KHGA 3ET6B 5A8WA 5B09A 1RISA 1FKPB 1IKWB 3DI6B 3QGGA 1S79A 1T95A 3A3NB 3HSJA 3SV3A 2M2BA 3OFHA 3SEOA 2HQFA 1CJKB 3HHKA 2F5GA 1GK8A 2VPYB 2JEFA 2VASA 4UY8T 1WHWA 3BS9A 5HATA 4DUTA 3AWEA 3HD1A 4WIIA 1RTIA 3P5TL 1KVKA 2EK6A 2DH9A 1WAXA 4X66J 1SPBP 2YPYA 2GAGC 1T0TV 2QTWA 3HKWA 4NI2A 3W63A 5AXNA 4EBCA 3FZBA 3TVZA 2KT2A 2VG6B 1QE1B 4RI4A 2NYHA 3D1QA 4QR0A 2F00A 3S3FA 3HK2A 4ZP9A 3FK4A 2JH3A 3QIPA 2N82B 2D41A 3VZIA 4ZMMA 3MUTP 1CJUB 2QLXA 4ED4A 1U1NA 1JLFB 1X5SA 2ZBRA 3RB3A 2I4EA 4B3SJ 3DNCA 3BBBA 4DV6J 1B7FA 2UV8G 4GRSA 2ZH2A 5K24A 2YKPA 3E01B 4I64A 3D28A 2FYXA 3MXHP 4O3OA 3OTOF 4O3PA 1N34F 2FJXA 4RUBA 4PQAA 5HBMB 2ZVIA 2POKA 3QT5A 5ETNA 1BQXA 2VOOA 2R8HA 2MZTA 2YY3A 1EETA 4WTOB 2OPRA 4ANCA 3MR2A 2G0JA 2W2QP 2K1RA 3HX9A 2JEGA 2O5DA 3JTOA 2HBYB 2HVZA 2V94A 4QQBA 3KLHA 2DRAA 3K5LA 1MLAA 1HWIA 5KFUA 3NLCA 5A8RA 4DR6J 2YWFA 4F0KA 3EMUA 2CPZA 3JTNA 4J9QA 3U96A 1R8BA 4DSEA 1IBLF 1R0AA 2YKNB 4P52A 3HD2A 4H4MB 1Y5NB 3HO1A 1EQMA 4DV3F 3RBDA 1JBVA 2WBMA 2ACYA 3GILA 2KTQA 2YTCA 4J9PA 4AD6A 2FLOA 5A5FA 4NYHA 4OI0A 2FJDB 4ZHRA 3ZL8A 1JLCA 2F9JA 2K7KA 1SC3B 4HI1A 1PILA 4ANEA 2IBKA 1NZ8A 5K8PA 4AE5A 3BLTA 1TKZA 1FDDA 1NO8A 2CQ2A 2K2PA 3MM7B 4M5GA 4O3NA 3DLJA 1RI7A 1RABB 4ZIWA 3PCOB 5I3UB 3D6MB 5KFBA 3MFHA 4A46A 2WB4A 3L3CA 1ZPVA 2JRSA 1YHQS 1PTUA 2FHOB 1FWLA 3K5PA 3NRBA 1KSPA 2FQQB 1WHYA 1WF0A 2QIFA 1PA9A 3J7A1 3V5RA 2PI7A 1FD8A 2B9EA 1O5ZA 3CWEA 1J5EF 2D3OR 4CZCA 1FFSB 4QWAA 5E7OB 5D3GB 4HVZA 4C0OC 4RKKA 4ECWA 4ERCA 4F4ZA 1SJFA 2F3JA 5J1EB 3EDRB 3KTQA 2IYGA 1B99A 5HAOA 2V8DA 2EVZA 5F8MA 1R6VA 1S0OA 2IMGA 3OFEA 3D6HB 3SSSA 4YAAA 2XY5A 3PNIA 2Z2ZA 4NZ7A 3Q8RB 5J2QB 1HNXJ 4Q0BB 2VG5B 1SJQA 1G7GA 4RH5A 2QG9B 2A0FB 1B7YB 1FX2A 2LDYA 5E3RA 2W7AA 3RU0A 4CLFA 1E6YA 3K5NA 4IQXA 1HQUB 1P1TA 3KUEA 3LGNA 2MZQA 2MLYA 3DCAA 3SCLE 1U1LA 4I67A 1A6LA 3LJ8A 3UO0A 5HQMA 4MFBA 3Q89A 2VFRA 2L9DA 2VPXB 1O8BA 1HKAA 5CCLA 3V0FA 1OY9A 4ZVOB 2ACMA 4BC7A 3THVA 3M05A 1NAQA 2C3UA 2J7WA 1GQQA 1YWFA 3LWLA 2P6SA 1I94F 3HF5A 3PJXA 1WF1A 1S0NA 3BBCA 3OT9A 3W2VA 2KT5A 2NXJA 3AAWB 3H59A 1Q6TA 3DKDA 4ELUA 1C88A 3NNHA 3CNQP 4FYWB 2L9WA 3KLGA 3NAHA 3D1HA 1HNIB 1NRKA 3MMBA 4V19X 1BLUA 1X5TA 4ZDNA 3TVYA 4ZK7M 2HQCA 4IOBA 3OL9A 2LP4A 4NZ0A 2I38A 1N5QA 2EKNA 3FSIA 1XEZA 2HK3A 4HL9A 4C11A 1RT2B 1Z2ZA 3HJFA 5EHRA 1D9DA 2FVPA 3OXGA 3MPDA 2HLTA 2DHHA 4OV6A 2R7OA 4DZDA 4JI3F 5F0UA 4OHYA 4P73A 1TL4A 2JFKA 1QAYA 3IRWP 1H38A 1RTDA 5C7PA 3FC9A 2OH2A 2B51A 2PQ5A 3BM8A 1IWGA 2CNGA 1SH2A 1Y3JA 2V68A 3R7NB 2FHJA 1NK6A 3F81A 2BRLA 2WVDA 2ZNZA 2PA8D 2DXFA 4U8YA 4DG1B 1S1TB 2BJ7A 4ECTA 1BHNA 2Y96A 5L8RC 1FRXA 1NU4A 2KO1A 3PO4A 1GAOA 2IMOA 2FVRA 3JYTB 4PUOA 4R0SA 3MZIA 1RHMB 4YB5A 3UE2A 2B4UA 1M3GA 1P8GA 2E5LF 3CD6S 1YK9A 2NT7A 3I0RB 1TQLA 2B0GA 2CPDA 4RBVA 5EX3A 5L1JA 4JI6F 1M5VC 1NL9A 1VHRA 1IUJA 4F3MA 2BJDA 3MAAA 2NREA 4QAHA 2E5IA 2I6PA 4DUYF 3E2EA 1Y5LB 1UJ6A 1MWYA 1XMOJ 2QLFB 1RU2A 2KM8B 4MH8A 1U6BA 4USUA 2W2OP 3H90A 4ZN3A 5M2UA 2P6TA 2OPQB 3EZOA 3OSNA 2RF2A 3SDEB 1PG5B 5ETTA 1RA7A 1JLAB 2RAQA 1FRMA 4PXCA 5F41A 3MUMP 3TARA 1MN9A 2BZLA 3RBXA 3NGDA 3TZXA 1HNXF 2A8BA 4M5LA 1ZBTA 3CJ4A 3MM5B 3QCLA 1ZS6A 1PGZA 1N52B 2GQCA 2DT9A 2JLFA 2NXEA 3TP2A 5B7WA 2R7SA 1RAIB 2ZH8A 3QCNA 4F4YA 3HZGA 3OTCA 2ATCB 3IFEA 4KYZA 4J9VA 5AXLA 4CO4A 4WK3A 4F4WA 2QBQA 1YX2A 2LU1A 3VQSA 5KT6A 1U45A 4B9SA 4HACB 2CG4A 2W01A 2H4VA 2W2MP 2F6TA 1K9MT 3L4BC 5EX0A 2E7XA 1YTYA 4ED2A 1L3TA 2DR5A 2I8EA 4KH0B 3DOMA 2NLWA 1NH7A 4RNNA 4EO6A 2B4PA 2M9KA 1K8AT 2H03A 5B0BA 3CCWA 2R7QA 1LWFB 3D67A 3GP9A 3M2RA 3ET6A 4F26A 5A8WB 4WK1A 5J1NA 4J90A 4FYDA 3EM1A 2W2NP 2AV5A 3R8YA 3MPWA 4JBCA 4IRDA 4NXMJ 4K4TA 2YWWA 5E3PA 4M5HA 2PA5A 2Y68A 2FZKB 3ZM0A 1FJ7A 3SI8A 4PQUA 2EW9A 1RKIA 4NA2A 5H9EK 3PACA 2OUDA 2H5EA 5KT7A 5KAAA 1ZC0A 3TVKA 2V8PA 5GADU 1M5HA 4DL2A 4J9KA 1IKVA 1RHQB 2HVIA 3AWGA 3O5XA 4GFUA 1WF2A 1RT5B 1WHVA 7FD1A 3RTVA 5JVHQ 1WDTA 1JLFA 2LCWA 3IM8A 4ECVA 3VAGA 1G1HA 1N32F 5DQHA 3H2UB 3DLHA 4F36A 1K0TA 1EENA 2YNHB 2EEYA 4HH1A 1FI4A 4HLBA 3E01A 4KO0A 5C25B 2HAFA 2VTEA 2LDIA 3IO1A 3CE8A 2KM8C 1PSDA 3PEJA 1IVZA 2D69A 3JS9A 5HBMA 4RDDA 4BJOA 3FFIA 2ZWPA 1A0OB 4Y3CA 5ETOA 2AJQA 2ROPA 1K73T 1ZCKA 4V19J 2CM2A 1HBMB 3KJNB 5KG4A 1JIHA 1S1VB 1IBLJ 3OR2B 1A7GE 1SJ4P 5K20B 4AQYF 2RRNA 4F25A 2J9CA 2APOA 2Y1JA 4P7VA 3RUBL 2Q05A 1RWWB 2WOMB 3IS9A 5E0OA 3I96A 2MGZA 1JQGA 3OLBA 2QYCA 3CC7S 1EP4A 2OSQA 1O0PA 3B82A 2XJAA 2HXPA 4CQ1A 2B9YA 4C13A 4O44B 2HWIA 1SC4B 2RVJA 3ENQA 4OYAA 4DMZA 3KUHA 2NPFA 4OI4A 4C3LA 1S6QB 4ED3A 4FNHA 3F9BA 1CC7A 2HNDA 2HQ3A 3AJDA 1M90T 2AZRA 1UEUA 2AZ1A 4JI1F 2Y8WA 1RGVA 2G13A 2HRTA 1TKZB 2I6WA 4DQSA 5B0CA 1CC8A 5I3UA 2BR0A 1NK5A 4C8OA 1UVNA 3AWFA 2DPIA 1RT4B 4NYOA 1R27B 4OX8A 1XK8A 5LM7E 3T5HA 1Q7YT 4C3MA 4NLYA 3O4UA 4FZVA 4NLDA 4CLPA 3NMRA 2F6VA 3FKBA 2N3OA 1V5IB 2MJUA 3HSGA 4IG3A 3RZAA 3W61A 4QIGA 5AXKA 3HMJG 4KSEB 5KFGA 3G2XA 4N41A 4WE1A 2BJ3A 3O1LA 4J51A 1FDAA 2MSSA 3DHXA 3SQGB 3ZFVA 4X66F 3CCJS 3PW4A 1DTQA 3I31A 3QT8A 4GMKA 2C28A 2U2FA 3W2WB 3U1MA 3RAQA 3OMHA 2G2ZA 3MMJA 3T3FA 2E7VA 2QDPA 5LXRA 2QRRA 5J2QA 3RZ2A 3QCZA 3WX4A 2ZNYA 3NG8A 3NAIA 4EU0A 2ADBA 3KDOA 1UA0A 1NJXA 2VFTA 3JSRA 4ICLA 4WU3A 2J7KA 4KGZB 5KFLA 3UD5A 1VQMS 1V3RA 1OETA 1U26A 4ZJQA 1HQUA 2UUAF 2DKOB 3G86A 2QBPA 4K4ZA 8RUCA 4L73A 2UUOA 3QCMA 1Q1MA 4DR1F 2IM2A 2MQQA 4QR2A 4F0HA 3KK3A 1UFKA 2GGPA 3M8YA 1V3SA 7AT1B 4GS0A 2FJMA 2J0SD 1XNRF 4O23A 3MR3A 2XNQA 4HDHA 4B3OA 3QCIA 3QKPA 4QDIA 3BN7A 3ZMQA 4EZ6A 1N88A 4OX6A 2OPSA 4ED8A 1RWUA 4TQSA 2J6TA 4B9VA 3R5CA 4JI2F 4K4VA 5JMNA 5CXTA 4WFXA 3PKMA 1F0XA 4X65J 3NMEA 4QBWA 4U96A 3VAKA 1N36F 1GMVA 2A2CA 4OHZA 3SBMA 4I69A 2YKMA 1S77D 1KFSA 5J2MB 1HWKA 1RHUB 3CCZA 3CXCR 1D8YA 2R0BA 1BQMA 3BEGB 1X4FA 3D7SB 4RR5A 1UWBA 4DEZA 4ES1A 3QWUA 4DLEA 5U47A 4B3TF 5GAHU 2B4SA 2KFNA 2OZ5A 4WXOA 2RIJA 2L9NA 3MR6A 3W9JA 4KFBA 4JI1J 4P2SA 2YX4A 5CAAA 4QWDA 3VAJA 2HFUA 2R8GA 1S76D 2VBXA 3JTPA 4AFFA 1LW0B 4LF6F 2Y1OA 2DEIA 1ZZNA 4DSLA 1PYNA 3KMSA 3QCHA 5F8LA 3R7BB 2DNQA 3FCVA 5KT2A 2IIHA 1K47A 1MWQA 1Y11A 1ZM9A 3HVTB 1RYRA 3M8WA 3QO9A 4LR9A 5D0GA 4ELVA 2HBQB 2NYIA 3TJ8A 4C0BA 1JLQA 3W9HA 2JJ4D 1F1BB 2XMAA 4LVNP 4I2QB 2UUBJ 2AEJA 3JSMB 2H5IB 3LPYA 3S6EA 1U47A 2ZOFA 1CS4B 3MI7X 4RW8A 4P2FA 3UN2A 1S6OA 2ZC4A 3QKQA 4DR7J 2C3OA 3JQMA 3N28A 4X62J 1IKXB 4F3OA 1JJCB 3NS6A 3KHLA 3KXDA 2CYYA 3HVAA 2UXCF 1HPZB 3UDEA 1XBWA 3W5YA 1J27A 3UNGC 2XMWA 3J7Z5 1WKKA 3T1HJ 5GAHI 1S9GB 4P72A 1DTTB 4ILLA 2QDMA 5HLFB 3HHEA 4A48A 4X4VA 5BYRA 2G59A 2ZH9A 2BKPA 2QT7A 2RILA 3SDEA 3CDBA 1S59A 3N0VA 2XLKA 3B7OA 1XIQA 2N4CA 2ZUGA 3V0JA 3TQEA 3OVBA 4Z37A 2ZBIA 1R8HA 4QBUA 1P1LA 2OPPA 2Y2FA 1FKOB 2MHEA 3CD0A 3J81j 2J5AA 2PN6A 3CMES 2NT2A 1IBKJ 1S7IA 1NO6A 1B0PA 1FEHA 4CO5A 4BC9A 5ETVA 5KFPA 2XPCA 3CJRA 1TP7A 2IRXA 2DNMA 1URRA 2I5JA 2QLBB 1OMSA 2XHWA 4TYAA 2HC2A 3O6QA 1OY6A 3NS5A 1TL7A 4NWGA 3GTYX 4CP5A 4PR6A 1N4LA 3ZO7A 2HEKA 5BZZA 4CTAA 2QV6A 3S4OA 4P2XA 3RR8A 4KE5A 1ULRA 2I5XA 2OELA 4OI2A 3TUIC 2E1RA 4R5PB 2AMCB 2WSEC 3IG1B 4FF1A 2E1PA 5CCMA 3TQ1A 4N7TA 2OTJS 4IG0B 4DPXA 1NK9A 4DR6F 3GR1A 2GIRA 5A0YB 3KG0A 3F0NA 4NLVA 3HP6A 4DN0A 2G0CA 2YX7A 2M8HA 4KV8A 1U0HB 2CZ4A 2Z8QA 3GE9A 2CWXA 1X5OA 1RT7B 3FSYA 4TY9A 4BUCA 1OQ6A 2COLA 3TA0A 3P6YC 2GHPA 2ZITA 4Q2MA 1C2PA 4YB1P 1T9UA 3H25A 1IKVB 2OUGA 1S4FA 2EBEA 2UAGA 2ROEA 5KA1A 1QAXA 3CW2C 2AX0A 2X7IA 4DR5F 3UD3P 5EDWA 2IVYA 1WOPA 2BDPA 4Q8FA 2RUGA 1LXNA 2H4WB 2MKHA 3FBEA 4IFVA 4J9OA 2QSWA 3HZEA 4S0MA 1FTRA 5C25A 1QM9A 4OHWA 3BBFA 1RADB 2NSCA 1IBMF 3M30B 4B9MA 2HK2A 3MUVP 5D77A 4S0GA 2HY3A 3ZTRA 1H74A 1RCXB 3GSIA 4JI5J 1OSCA 2VFUA 4JUZA 4IR9A 5A6WA 2GHWA 3NL0A 4OV1A 2KB2A 2CQBA 2BANA 1M1HA 3KK1B 2JC0A 3KKFA 1OEVA 4DV7J 5HROA 1WC1A 1HARA 1DBDA 3MEKA 3VGSA 3VV2B 4EYHB 3M9MB 1SV5B 3T1YF 4B9LA 4IUFA 4A8MP 3VAFA 1ZAXA 1QZ0A 4IKCA 3M4UA 5DETA 1L3UA 3ELHA 1JJHA 2VOPA 5KFHA 2BYCA 2EBGA 1WC5A 1F2GA 2LKZA 5C24A 1NEEA 4LF8J 1F2HA 4CO2A 5LSLA 5J2PA 4E8UA 2HHQA 2RKIA 1NSKL 5KFWA 2HNDB 3T5JA 3MEEB 2K06A 1X31C 1TUWA 1RAEB 2E1MC 4P75A 4I6WA 4QIVA 4DN9A 4YUDA 3IMQJ 4PZVA 4CI0B 3PR4A 3OV7A 4ED1A 2IDEA 2HS0A 4R8UA 4RUHA 4CIOA 1B0TA 4ZITA 1BWEA 3CPWR 3UDCA 5EWEA 3PW0A 1CEZA 3QCFA 4LFCF 2RHSB 3BDPA 5DGBA 1LV5A 4MT1A 5G0RA 4NEYA 1U1KA 1TKXB 4JV1A 3CDEA 6FDRA 3MF5A 4CYUB 2VA3A 2W4CA 3M1VA 3ILJA 2CFVA 2XTJP 4B04A 5IC6B 3KLEB 3VAHA 4DSFA 3GLJA 3GCXP 1WNEA 3R5DA 3GMGA 5E5NA 2DRDA 2IBOA 1DTQB 5ITHA 1U25A 1KLNA 4MKAA 3T9NA 2AJ4A 3ZNJ1 1GTEA 2MEWA 1VRQC 5I3QA 5IT0A 4C8ZA 2DGTA 2VBZA 5KT3A 2L08A 3FEYB 2YKAA 1AFJA 2VEUA 1S99A 2XEXA 4TVVA 3HULA 1Q6SA 3BN4A 3MMCA 4MKBA 5HP1A 1P3DA 3P3DA 1KAVA 3FQKA 4U9RA 3A5KA 4HH0A 5LT5A 5L9XA 2DCUB 2CVEA 4URGA 1NK7A 3DLKA 1WEXA 5L38A 2GGPB 4RW9A 1MU2B 4PKDB 5HMZA 1LARA 3CCES 1FWPA 1RU1A 3JSYA 2YPZA 1KTQA 3BPSP 3F41A 5L9NA 4N5SA 3M8PA 2MQNA 2F6ZA 2IVMA 3MM6B 3QJJA 3R2CJ 3O5TB 2A6OA 2J9DA 2VPZB 4UOHA 4ZPTR 3V4MA 3I55S 2W9BA 4B3OB 3HHLB 1GTHA 2NPIA 2BVZA 5I42A 2B3TB 2ZFHA 1BZHA 2HFSA 2YQ3A 2CG8A 2I0XA 2BOPA 4OYMA 3HT3A 3OJUA 1UVJA 4ZVGA 1SIWB 3FMBA 1T4JA 4C8MA 4YDDB 1YJNS 1RAGB 1Q6NA 1LNQA 1OYDA 1NPKA 1YLXA 3LF0A 4ED6A 3ICLA 1GNKA 4F67A 4NXMF 2EG2A 1WEZA 3DLEB 2VG7B 4YN3B 5J2MA 4LRFA 2ZM6J 2CQ1A 1YJVA 4Z2XA 3C15A 3RRHA 1UWBB 2E0TA 1ACMB 2DY9A 4NRUA 1X0FA 2XS2A 4L75A 4DSKA 4NMXA 2ZH3A 4M5JA 4JP8A 1D0EA 4OHHA 4WXWA 2VIHA 3PXGa 1VR6A 3G82B 1C84A 3O4SA 4ED7A 4GRYA 4ID5A 1RAAB 4J9MA 2NSBA 2HW3A 5HSPA 4QU7A 2WB1D 3C6UB 4LF4F 2F63A 1JXVA 2PIIA 3AXMA 2HAIA 3HJVA 3LH2S 1R0CB 1S4EA 2PGCA 2V4JB 3CJ3A 3OFGA 4LVOP 4USVA 3CCLS 4PG7A 1PTTA 4GRZA 1SVDA 1U49A 2I9SA 4ID8A 3UQSA 4I2QA 1RLCL 5I6VA 1CBKA 3JSMA 2ZJRQ 5M2RA 3TUJC 2UXDF 2AU0A 1CS4A 1FRHA 3N2AA 4RW8B 3TO8A 1VRTB 1VQ6S 1JLGB 4LT6A 1PH0A 3QJPA 2Y66A 1NKEA 2MY7A 2DXEA 5D4OA 4ALZA 4DV4F 1IKXA 4ECUA 1YI2S 2PE8A 1XBOA 1Y10A 2GP0A 1C4AA 2LA4A 3G71S 2J16A 5FIIA 1AFIA 4QZVB 1S6PB 2FC9A 1FO1A 4R0JA 1H2VZ 1KEKA 1RXOB 4UTGA 2X1BA 3PIOQ 2XCPA 3TAPA 4CLUA 5HLFA 4FYYB 1G1FA 2RQCA 1U8WA 3QLHA 5K8MA 2QMWA 5GMKa 4ER8A 2DGVA 1YJRA 1NK8A 1GXUA 2Q43A 5KABA 3MM8B 2WTFA 1SUQA 1WD6A 3DXSX 1W26A 4I56A 4EO8A 3CCRS 1XWLA 4UW2A 5KFZA 2B49A 4PXBA 3H5UA 2R8IA 4DL7A 3US5A 4ZLLA 2XGPA 4GE6A 3L9ZA 3QSYB 1L3KA 1SJ1A 1TKTB 2U1AA 2KHDA 4ZRTA 5HVGA 2OMOA 1C0UA 3DRXA 4OZ0A 2YWGA 1TFYA 3QIDA 1GH8A 2GHVC 2OSRA 4EBEA 4KJIA 2NTAA 2PMZD 4A47A 1C0TA 1K1QA 4IH7A 3Q22A 2VC1A 3RW6A 1VDHA 5T7LA 3B8HA 3M8ZA 4H4KA 4LR8A 3RAMA 3TW0A 1N36J 3T19A 1HHTP 4OIXA 1QSSA 3G6YA 4YFUA 2BX6A 3IBCB 5K14B 3HHNB 4OHDA 2JNJA 4TU9A 1V3AA 5THWA 3IWXA 4TLRA 2HHXA 3LQVA 4NLOA 3OL6A 4IG0A 2BXJA 3GFHA 3I5CA 3IGNA 2O3DA 2YNIA 3TJAA 5HVFA 5A0YA 4M5DB 3JQKA 1RT1B 2B9XA 1U0HA 2CXEA 3GSDA 5E3AA 1NSQA 3IN5A 2HZVA 1WG1A 4DR1J 2Q79A 3I80A 4HEA9 4Y14A 4I68A 1PAUB 1NUEA 2GO9A 5AJ3J 4HYKA 1IBMJ 2QCTA 1FE4A 3EAXA 1XC9A 4C8LA 3M2VA 2FJAB 1RBOB 1Q78A 2LEBA 3CD7A 4LF9J 5AE1A 4NLWA 3RG6A 5KTQA 2CM7A 3K5MA 1HFEL 3M30A 4DFKA 3GFYA 4OQJA 3MECB 5CD4H 4FVCA 4CLYA 3VZHA 2F65A 4ZPWR 1UPPA 2DNRA 2XMTA 3RB0A 2AIRB 1YFOA 5DDPC 2VA2A 2PBNA 2GJIA 1IKYA 2AJ1A 1KQSR 3KLIA 1KBRA 3I0SB 4EK2A 4P10A 4WFNQ 2QO3A 5MAOA 3CCVS 1Q79A 2FTRA 4DPYA 3RBEA 2F4VF 2J6SA 4FKYA 1TVRB 4X4NA 3I87A 3FGVA 2DXDA 1PYOB 3HKZD 2XS5A 5KG2A 3SCIE 4NZ6A 3MD1A 1TU0B 5C24B 4KI9A 4W90B 3AB4B 2VZ9A 5J2PB 2EFGA 1FKPA 3H7HB 2RKIB 4PCQA 2YNGA 4UZBA 3MEEA 4N47A 4DPOA 5EWGA 1KTVA 4KGKA 1YJWS 4PABA 2ZDPA 5DO2A 4BWMA 4DJBA 5C2GA 2BGEA 4AXJA 4L3KA 4OHLA 4K4UA 1WKLA 1GFWB 1VIXA 1MG7A
chains in the Genus database with same CATH topology
4F3QA 2R9LA 1SXLA 3BGUA 4X62F 4ZPCA 3ZZOA 3H8YA 4LUBA 4RNMA 2J0XA 2XSFA 2ZOMA 1K0VA 1QE1A 5KA3A 2UP1A 2XMKA 1VRUB 3QIPB 5KFOA 3JB9k 2ABYA 2HLUA 2A18A 4A8OA 2K3KA 2ASJA 2C22A 3GZ7A 2LEAA 1RT6A 2FJVA 1SKRA 1F5BA 2EC0A 4LIWA 1M0SA 3CB4A 4OHIA 1I9TA 5J2NA 2Z0GA 3MMCB 5HP1B 1WEYA 2FLLA 4ELTA 2Q66A 1WRMA 2C42A 2CJQA 4XK8C 5CYQB 3UR3C 2R2SA 3T5LA 4B3SF 1IXKA 1EETB 1NJIT 2J17A 2OPRB 2CVIA 2M5YA 3H2VE 1X9MA 1ELOA 3BJYA 4ED7A 3VAHA 3CCSS 4JV0A 5LSRA 3BF4A 4QWBA 3KLFA 2W7PA 3DMJA 3SFUA 4YR0A 2M0GB 3MM6A 4B9NA 4S0GA 1R0AB 2YKNA 1OWXA 4QYRA 3SSRA 2W9BB 1C1BA 2F70A 3G6XA 2O1PA 2ZZNA 3DLBA 2D3UA 4H54A 2JOQA 3OPKA 1KQGB 3LANA 4ZHRB 3PRBA 1JNZB 5DLGA 3H2XA 3X1LB 2HRUA 3CDUA 3DLEA 1U1QA 1T7PA 4DL6A 5F9NA 2PEHA 2M7SA 4OZLA 4J9SA 1D5RA 2MQLA 4MYUA 4A8XA 2KI2A 1UVMA 1PTVA 2CIMA 4TU8A 4ID5B 2DXPA 4ZOSA 1AW0A 2SXLA 1Y3KA 3JSBA 3G9CA 2LQJA 4A8YA 2V4JA 3BSCA 4JI0F 2XB2D 1NHVA 1X4AA 4KBIA 1XRIA 2ALZA 1X4EA 2VG5A 4UY85 3K7RA 5F8IA 4NRTA 5AE3A 2MQPA 4A8FA 1B0VA 2DO0A 3QMQA 5FLXY 1RPMA 4DHVA 1X7VA 4RX6A 3BO3A 1QLNA 3DOKA 3N5FA 2QA4G 2H4KA 2J16B 1R89A 4HT7A 4MFBB 1WCHA 1U24A 5FJ4A 2DH8A 3UWTA 4AL6A 2B07A 5I3PA 5KFJA 1PA1A 5KFVA 5IQQA 3VCDA 3IAS9 1CVJA 1FF2A 3MM8A 3HHLD 3DRSB 4ES2A 2GJ2A 2ADCA 3BQ1A 2UVWA 1FE0A 2FVCA 1C86A 5F8NA 1JF7A 2R2UA 2CFXA 3UR0A 2A3KA 3PW7A 4OJGA 4QU6A 1TKTA 1RT3A 1HNIA 2DTJA 2F1FA 2IAJB 4LSLA 2DNOA 5MLCV 5B0DA 1MMLA 2DGUA 2ERRA 5C42A 4C11B 4QIFA 4TY8A 2CQCA 4WFAQ 2A1BA 5T7LB 3B78A 2GIQA 3KNGA 2B7CB 4M63A 4D3GA 3AA9A 1RTDB 1AUDA 4UUXA 2HRYA 4NCGA 3OXFA 3BGFA 5LJ3Y 4U67Q 2ZHAA 2VEXA 2A3JA 2GX8A 3MCSA 4PG8A 4KPYA 3D9CA 3QCGA 5DG8A 1JLEB 1SIZA 2RS8A 2ZM6F 2PSZA 2DBBA 2KZZA 3I36A 2BJEA 1KVIA 1RAJA 3DN9A 2H02A 2VKRA 2MZ1A 3N0AA 2JLEA 2YNIB 5LSOA 3DYAB 3MEGB 3CUNA 2UVRA 2Z2MA 1BQNB 1X4CA 5KG7A 2DR7A 2KXFA 4XIUA 1G1GA 2ZN7A 5KFFA 2IM3A 1M5PC 1MMNA 1X4DA 3TAMA 4GWFA 3MDFA 2IYIA 4ZN5A 1WI6A 2MSTA 1VJWA 1SL0A 4I7FB 3EX7B 1UW4A 3N5BA 4EGLA 3HJFA 3FEZA 2GQ2A 3PEHA 2DRBA 2RF2B 5IFMA 3QCCA 4FPRA 1N8RT 3AQPA 2XULA 1WELA 4KR0B 1IBKF 2DPJA 3MM5A 3GXHA 2ASDA 2QBRA 3GFZA 3FZ2A 1DLOB 3EXCX 4RW7B 1K1SA 3MM9B 1QTMA 2Y96A 2BACA 3KLIB 2GMHA 3ZM1A 1VQ5S 2V0NA 4D3RA 1T48A 3MEDA 2F8EX 4DBQA 3Q8QB 1TVRA 4OLOA 3V0HA 3PFEA 5J8RA 3SCJE 1NNDA 2CQDA 2HQIA 3M2RB 2JC1A 3CSKA 3K8VA 3U02A 2YNGB 2VEVA 4HKQA 1HW9A 4QCLA 1YPTA 2KYZA 5GAEI 2DNPA 2ZH4A 4FS2A 4KTQA 3E8OA 2HFZA 4WJBA 2F71A 2QBSA 2P9CA 1YJUA 3GQCA 2CPYA 1GX6A 4QJVA 4A8SA 2VUGA 2P9EA 3RGOA 3U1NA 1MROB 2Q1LA 1R6HA 4J5OA 2ZKUA 1HYSA 2R7RA 1GT8A 4JMKA 4HTIA 1VRUA 3Q2SC 1DJ0A 4G1QB 3CO9A 2PFFB 2VC0A 1RT5A 3KFWX 4MIBA 1REVA 2WONA 3LP1B 4ZPAA 2IC3B 2VQEF 1RQ0A 3EXYA 4NPOA 3EU0A 2BM0A