2B4PA

Structure of the d223n mutant of selenomonas ruminantium ptp-like phytase
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
314
structure length
314
Chain Sequence
b'MTVTEPVGSYARAERPQDFEGFVWRLDNDGKEALPRNFRTSADALRAPEKKFHLDAAYVPSREGMDALHISGSSAFTPAQLKNVAAKLREKTAGPIYDVDLRQESHGYLDGIPVSWYGERDWANLGKSQHEALADERHRLHAALHKTVYIAPLGKHKLPEGGEVRRVQKVQTEQEVAEAAGMRYFRIAATNHVWPTPENIDRFLAFYRTLPQDAWLHFHCEAGVGRTTAFMVMTDMLKNPSVSLKDILYRQHEIGGFYYGEFPIKTKDKDSWKTKYYREKIVMIEQFYRYVQENRADGYQTPWSVWLKSHPAKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords myo-inositol hexaphosphate phosphohydrolase
publication title Kinetic and structural analysis of a bacterial protein tyrosine phosphatase-like myo-inositol polyphosphatase.
pubmed doi rcsb
source organism Selenomonas ruminantium
molecule tags Hydrolase
total genus 107
structure length 314
sequence length 314
chains with identical sequence B
ec nomenclature ec 3.1.3.72: 5-phytase.
pdb deposition date 2005-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14566 PTPlike_phytase Inositol hexakisphosphate
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1690 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2b4pA01
3.90.190.10 Alpha Beta Alpha-Beta Complex Protein-Tyrosine Phosphatase; Chain A Protein tyrosine phosphatase superfamily 2b4pA02
2VEYA 1C88A 3OMHA 1ZC0A 2PI7A 2HC1A 2I6OA 1MKPA 4HJPA 1JLNA 1PA1A 2CMBA 3I80A 1FPRA 1YZ4A 1WCHA 2QEPA 1Q6JA 2HY3A 4R0TA 1GFYA 4NWFA 3ZM3A 4WTYA 1RPMA 4ICZA 3O4UA 5K9WA 2HC2A 2BGEA 5KACA 2CM8A 3QCGA 4KYQA 3ZM1A 2B07A 2VEXA 3AWFA 2HCMA 4OHIA 2Q47A 3O4TA 2OC3A 1AAXA 4GRYA 2QBPA 5K22A 2NTAA 2VEWA 1LQFA 2NT2A 3S3KA 5EHPA 1I9SA 1NZ7A 1R6HA 1YGRA 2F6VA 3QCBA 4GE6A 4QUNA 1T49A 3OLRA 1G1HA 4WOHA 1C87A 3QCHA 2B4UA 1Q6TA 4TVVA 2QDMA 1YWFA 4JBCA 2OOQA 3F41A 1I57A 3AWEA 3GXHA 1J4XA 2NLKA 4RH5A 1L8GA 3MOWA 2CNEA 3V0HA 3I36A 3QCFA 1C84A 2HXPA 3A5KA 4MBBA 2HNQA 4AZ1A 4OHLA 2WGPA 5KA2A 5K24A 3D1HA 3QKPA 5BZZA 2QBSA 2QCTA 1M3GA 2B3OA 3V0FA 4NX8A 2H04A 1L8KA 5GTJA 1YPTA 1C83A 3F9BA 1EENA 1X24A 4Y2EA 3ZM2A 1A5YA 2F46A 2I3RA 4YR8B 3QCMA 5BX1A 5K25A 2H02A 1YGUA 2I3UA 3S4OA 1NWEA 4RKKA 1BZHA 5BZXA 1PA9A 3D9CA 4D3QA 4ZN5A 3EB1A 4DGPA 2Y96A 2IMGA 4H34A 3S3FA 2B4OA 2I1YA 2F6FA 5M43A 4GS0A 2I6JA 1G4US 2CJZA 3D42A 3ZV2A 1OEVA 2I6MA 1U25A 2NT7A 1SUGA 1YTSA 1ONZA 2CM2A 2AHSA 1YTNA 3F81A 5KADA 1VHRA 2I4HA 4WU2A 5KABA 2SHPA 3RGQA 2F6ZA 5KAAA 3O3LA 1PXHA 4OHHA 2PT0A 1D5RA 1Q6MA 3A5JA 1PH0A 2G59A 3QCKA 4QUMA 3BLTA 3CM3A 2CMCA 3EAXA 1WAXA 5KA9A 2I6IA 4OHDA 2F6WA 2DXPA 4GFVA 1BZJA 4OHEA 2P4DA 5LXQB 1YN9A 2R0BA 3SR9A 2VEVA 2ZMMA 1GWZA 1XBOA 2FH7A 4R0SA 1ECVA 5AWXA 1OETA 2H03A 4JMJA 3QCLA 3QCIA 2F6TA 4RI5A 4ERCA 3ZMPA 3AWGA 5I6VA 4ZRTA 2JJDA 1G1FA 4GWFA 2CNIA 3F99A 4QAHA 2Y2FA 1OEMX 2VEUA 3QKQA 4GE5A 1U24A 1OHEA 4GE2A 2J16A 1G7GA 4KYRA 2CFVA 3ZM0A 1C86A 4GRZA 1ZCKA 2NZ6A 2I75A 3CWEA 1OEUA 2F70A 1I9TA 2AZRA 1OHDA 1QZ0A 1XRIA 2MBCA 2G6ZA 4RH9A 5EHRA 3S3HA 2Q05A 1T4JA 4NYHA 3RGOA 2A8BA 1KAVA 3D44A 3BM8A 3V0DA 2M3VA 4BPCA 4DGXA 1PTUA 4JNBA 2QDPA 3V0EA 1ZZWA 2F6YA 3QCCA 1C85A 2QBRA 3BRHA 2PSZA 1JF7A 2HVLA 3S4EA 1FPZA 1Q6NA 3EMUA 3N0AA 2F71A 2CNGA 2YDUA 4PVGA 4RHGA 4QAPA 1PTVA 4HJQA 2CNFA 1YFOA 1G1GA 5HDEA 1G7FA 3V0JA 3V0GA 1G4WR 1WRMA 4NWGA 2I42A 1KAKA 2A3KA 2OUDA 2PA5A 3V0IA 5KA4A 4Z6BA 4PYHA 4KI9A 3QCEA 3O5XA 3U96A 2RF6A 2E0TA 1FQ1A 4BJOA 4GFUA 1PTYA 1QXKA 2H4GA 2BGDA 3RO1A 2GWOA 3S3EA 2P6XA 2QCJA 1NO6A 5KA1A 3QCDA 2J17A 1ONYA 1P15A 1LARA 2QDCA 1U26A 3M4UA 1BZCA 1Q6SA 1XXVA 1XXPA 3QCJA 5IBMA 5KA3A 2FJNA 2GJTA 1OESA 1ZCLA 3B7OA 4H1OA 5MMZB 3NMEA 1T48A 4R30A 5K9VA 3MOZA 2CMAA 2H4KA 2OZ5A 4QBEA 4D3PA 2B4SA 4RDDA 3EZZA 1NNYA 4Y14A 3D1QA 5IBSA 1Q6PA 5KA7A 4YAAA 4IKCA 1OEOX 4J51A 3ZMQA 2H4VA 2ESBA 3EU0A 5K23A 1RXDA 1Q1MA 2PQ5A 2BZLA 4B04A 2HNPA 2B49A 5BUGA 2I4EA 4QBWA 2PBNA 3I7ZA 5KA0A 3H2XA 1EEOA 5J8RA 2HB1A 1NL9A 2C46A 1V3AA 3PS5A 2NV5A 3F9AA 3O4SA 1LYVA 2CNHA 3GXGA 2I6PA 2C7SA 2I4GA 4NNDA 4ZI4A 1XM2A 4I8NA 2BIJA 4D3RA 1PYNA 1PTTA 2QBQA 2ZN7A 5KA8A 2I5XA 2CM7A 4JMKA 2CM3A 2BV5A 2B4PA 2J16B 3D1OA 4RI4A 4WU3A 1NWLA 4S0GA 3MMJA 2GP0A 1OHCA 2FJMA 3BLUA 3RZ2A 3LJ8A 1YTWA 4HRFA 3QCNA 3SMEA
chains in the Genus database with same CATH superfamily
3PHEA 5KT3A 2ZOMA 4IFVB 5KTQA 2G13A 3CJTA 2PO4A 2MKKA 2OH2A 1ZC0A 2BOAA 1VQPS 2XLIA 4ZLJA 1JLNA 1LWFA 2ZH9A 1CULB 1WELA 2Q1LA 1WCHA 4B3OA 3GYGA 1N4LA 5D77A 3ZZYA 1FE4A 1M5VC 3O4UA 1SH0A 2Z4PA 2IFXA 3L3CA 1TR0A 4F7VA 4NI2A 4B9TA 2YKNB 3H4BA 3DKDA 2EW9A 1X4GA 4QYZJ 2VPYB 1FHTA 1CEZA 4HACA 2YQ1A 2HZVA 2CNOB 3QT5A 4FVCA 1R31A 4WCEQ 2Y8YA 1R6HA 3BN4A 4A8XA 4IOCQ 4IFYB 8ATCB 2Z57B 3KMQA 4EMDA 3LP1B 3RUBL 3H4DA 2KXFA 2QDMA 5LL6d 1FEEA 5M2PA 4JBCA 4XDDA 1R8AA 3ZO7A 4S0MA 3FQLA 1I51B 3VQSA 2CJKA 4RZRA 4R0JA 3R2CJ 4BHQA 3ICLA 1R6YA 4OHLA 4YY3F 1QDUB 2H3EB 2NXEA 1IN0A 4C13A 1C83A 5KT6A 5DETA 5BX1A 3HHLD 3UW1A 2GS8A 4B3MJ 3NP5A 3CPWR 3WIUA 2AF6A 2YX1A 3PO5A 2L9NA 3AD7C 2XNQA 4NZ7A 2VHGA 2NS1B 3MEDB 2AYEA 4FYXB 3QT6A 4DLEA 3KUEA 2GO9A 4JI0F 2F6FA 4CO5A 1S1VB 4ZVFA 2CJZA 2W8KA 2GQ2A 3NS6A 1N34J 3FCVA 2GHWA 3Q2TC 5KADA 5KG2A 3DOKA 4WU2A 3H5SA 3BO3A 4FF2A 1D0EA 1S1UA 3GV5B 4AL6A 3LUYA 1SC4B 1S1TA 1C0UA 2GMLA 1T9WA 2VV5A 4FNIA 3WZ0A 2MSTA 1VHIA 2G2OA 3AJ2A 4F2RA 5AXKA 2VQFF 2QT7A 4GVBA 5HMXA 2DGOA 2RRNA 3K89A 3UDVA 2W2NP 2KG0A 2W2MP 1TK0A 3OR1B 2CJQA 4J9KA 3TAMB 2OKQA 2OTLS 3SCKE 1NDPA 2MPUA 1JJ2R 2ROPA 3RYLA 3ZZRA 3CNQP 4JYAF 3V4MA 3NGSA 4KAIA 4GE2A 2BM1A 2CFVA 4GRZA 2QSWA 3W5YA 2V4JA 2QRRA 1QZ0A 1YHQS 5CYMA 3FZ2A 3S3HA 5KT4A 2CPZA 2RH3A 1KONA 1FRMA 3DXBA 4KFBA 4NLDA 2LLZA 4RX6A 2DGTA 1OWXA 5T7LB 4CCHA 5C2GA 2F6YA 5F0WA 5C24A 2ASLA 3M32B 3KJFB 3ISNC 3OHAA 4DR3J 2LDIA 2KHDA 4BC7A 5D15A 3CO0P 4ELUA 3TEHB 4DEZA 3PEHA 4TQSA 2LEPA 3CW2C 5BYSA 3T19A 3L7UA 1Y0HA 3ZZ0A 2AGOA 2B0GA 2AZ3A 4ECXA 5LSRA 3MPDA 3V0JA 5CZVA 1RAGB 2GAGC 3K5PA 3VAKA 2XQCA 2G2YA 5F9NA 1NH7A 3I96A 3T9NA 3SSSA 1Y7PA 2BJ9A 1FESA 1QE1B 1Q86T 4WF9Q 4KHPJ 3C2PA 2X1AA 1XXVA 1H7XA 2GAHC 2GHVC 2FJNA 1TKTA 3DN9A 3IBCB 5MMZB 3OVAA 2CMAA 4JI7J 2GQCA 3BJYA 1DFDA 1RKIA 1S9EB 3IGNA 5KA7A 4A4JA 3T9ZA 4AL5A 1RT3B 1RT2A 3IO1A 3K58A 3FBBA 4XDCA 5K5MA 4QBWA 1K1SA 2BVZA 2Z2ZA 3SYZA 1YJUA 1N33J 1UP1A 5MLCV 2XGPA 3GWCA 2EI5A 2CNHA 4TNOA 1S76D 3QPIA 1Q0NA 4UUWA 1FRIA 4FKXA 4J5OA 1QJHA 5K14A 2DH9A 5J2QB 3MPWA 4I8NA 5ETRA 1NJYA 2B4PA 2OPPB 1N8RT 4FKYA 3SV4A 1NEEA 1F9EB 2ZD1B 5FLXY 1Z2LA 3M6VA 2B8PA 1YRTA 4O23A 4HRFA 3RW6A 3SCJE 4QWCA 1S5ZA 3SFUA 1RUSA 4ZLPA 1RBLA 2I6OA 2IVMA 3MEGB 4DV1J 4LBPA 1VQNS 4HV4A 1SPBP 1NDLA 2VQEJ 1RHRB 2LECA 1RT4B 3ZM3A 1RPMA 2HNYA 1GTEA 2UUTA 3DLLQ 5HBMB 1ZPVA 2G1HA 3NNCA 1F2GA 1LQFA 1FKOB 2Y1JA 1OJ4A 3MGJA 2NT2A 4OI0A 2IJRA 1CC8A 2V94A 4B3OB 4TLRA 2ZUAA 1NJXA 4RUHA 1U8WA 2Q6BA 2RRAA 3QCHA 5L46A 1Q6TA 4RPFA 2JJ4D 3MR7A 4DPUA 4LF7J 5E3CA 2HS3A 1F5CA 4EBDA 1ITPA 2JRSA 2VASA 3R5AA 2HSEB 1I57A 2ZOFA 1RWVB 1CJKB 4DWIA 3OVSA 4RUCA 4DV5J 3SDEA 2MKSA 3CDBA 4LF2A 3I4PA 1RWKB 1VI7A 3IR7B 1IM6A 4Y3CA 1WDDA 1N52B 1WJ9A 1SC3B 4DS5A 3QWUA 2MZSA 1O6XA 4C8LA 2CWKA 2BJDA 5LXRA 1KSPA 2H04A 1KD1T 1BXNA 2OAUA 3HVTA 5HJYA 4DCPB 3SIPB 3AAWB 1IBMJ 2KL8A 2OPRB 5F41A 4NA2A 3K8VA 1YVFA 2J9CA 1WHXA 5BZXA 2DISA 2BX6A 2LXIA 3UQSA 3I6PA 1LV5A 1T9UA 4XK8C 4K59A 1NPPA 3IWXA 3M1VA 3O6QA 5K8MA 3GE9A 4Q43A 1KEKA 4CLPA 2I6MA 1SUGA 5DLFA 3NOGA 1RTIA 3I32A 4B3RJ 4JI4F 1R6VA 2K2PA 3G8TA 3MR5A 4EI2A 5KABA 2SHPA 1U1PA 4J9MA 4OZ3A 4WJBA 3MMCA 5C5JA 1PXHA 4ZP7A 4ERDA 3E51A 4RO0A 3AD9C 5GMKa 4K8RA 4JI6J 4C8ZA 2WSCC 4JV0A 5KOXA 2VTDA 3AB2B 1RAEB 5E33A 5B08A 3DOKB 2E5LJ 5KFHA 1YN9A 2WCXA 1VC5A 5KFDA 1YBUA 4USVA 2OEKA 4DQPA 3EVWA 3LK7A 3K57A 2YNGB 3MVNA 1WTFA 4JMJA 4QWAA 5A8RA 1E6YA 3HI9A 2P2CB 3W2VB 3CCLS 4DR6J 3LGHA 2MKIA 2XBPA 1U2FA 1S12A 1YRXA 3F99A 4PR6A 2BZ2A 5L9XA 4X64J 4C12A 2RU3A 5I42B 4PWWA 3M05A 3ZM0A 1RT6A 3TNVA 2GIQA 2I75A 2Y1LB 1YRUA 5ETOA 1T9TA 2DHXA 3W64A 1RHJB 2UUOA 2ZJPQ 2BYCA 2IJFA 1CJTA 2RIJA 3RAMA 3I5CA 1VHFA 3SV3A 2FJDB 1J2VA 4DGXA 3CDWA 3R9LA 3J7Z5 5LMUJ 2MQ8A 1ZZWA 3QCCA 3OD2A 5AXNA 3VHQA 1EQMA 5H9FK 3CCSS 2V4JB 1FE0A 2APOA 2CFXA 2J8SA 1HPZA 3S4EA 4OI2A 2K3IA 1HLWA 1NK0A 2N82B 2YX4A 2QLJB 2YDUA 2HHQA 4RHGA 3Q22A 3CJ8A 2Q43A 4IQXA 3J81Y 4DV4F 4YS2A 2ASDA 3V6JA 4E8UA 1Q16B 4WIQA 4LRBA 2K7JA 1APSA 3U7JA 3M4XA 8AT1B 2E29A 1TZ0A 3QGHA 5A6PA 2Z58B 1MLAA 4KI9A 4FS1A 4BJOA 1PTYA 2XLKA 5BYQA 1NHKL 4Q0BA 1XMQF 4DR7J 2QCJA 2V63A 5C25B 1DZ5A 2VC0A 1RTZA 2F4VF 4HT7A 1UVLA 3GP9A 4KHRA 5KFYA 4DUTA 4Y6IA 2CPHA 2HMIB 5KFGA 4RW8A 1Q6PA 1HQEA 2MHNA 1HHTP 1FJEB 3DGPB 2G0JA 4JV2A 1NZAA 5LM7E 4WE1A 1Q82T 4DR1J 4HR2A 4LFCJ 2PBNA 3OVBA 4DV3F 1H98A 3KJQB 5EWGA 4A47A 4R8UA 2QL5B 4DU7A 3GXGA 3AXKA 4LUBA 3DCAA 3H2VE 3OXFA 1BQMA 4ZI4A 1RAHB 5ETNA 1FEHA 2QJ3A 4LF1A 1PAUB 3SI8A 3QT7A 3BGLA 3HO1A 4DXLA 2GJIA 3EZOA 3VGUA 3HSZA 2AWZA 1SUQB 2P8IA 1HNVA 1J6UA 1MW7A 2V50A 3M8RA 4RW4A 1H2VZ 2PN6A 1IWAA 2ACYA 3AQOA 5L38A 3RZ2A 3LJ8A 3QT8A 3QCNA 3PJWA 4PWDA 2BXJA 1X4CA 2VC1A 4TY8A 5E5NA 1PA1A 2CMBA 1H38A 2M70A 1FPRA 1HQUA 3DRRA 3RB6A 2HC2A 2BMBA 3MF5A 4U7UK 3C15A 2VBXA 3LPEA 4PG4A 1DTTA 3O4TA 4C0HA 4DFKA 3HD2A 3OUYA 2NXNA 2QBPA 3LPYA 3V6KA 2V4RA 5D3GA 5EHPA 2OMOA 3ENVA 1VBKA 3NWRA 2RAQA 5JVHQ 2RMLA 1C4CA 3CCUS 1QVGR 1PIEA 1LQ9A 2J7WA 3MM7B 3FNNA 2IVYA 2PIIA 4OYXA 4URQU 2BJ3A 5HVFA 1FERA 4ED2A 5EWEA 2P6SA 5ETVA 5E3QA 5B0BA 1RWPB 2B3OA 4BDPA 4DL2A 5KG3A 4IUFA 1S97A 1IKYA 3M8YA 5E3AA 1VQ4S 3ZM2A 3NY0A 3SDEB 3QCMA 4C3LA 5KFEA 4DR4F 4K4ZA 4I0WA 2DD8S 3EX7B 3EB1A 2OFHX 4MKVA 1HI8A 1R8BA 2WVCA 1S77D 4C2MA 2J0XA 2IA6A 2G0CA 2UXCJ 1HNWF 4V19X 4E98A 4USWA 1VS3A 1S0MA 3E2EA 2GMHA 2OPSB 3UWTA 2B3TB 2VUGA 1OQ6A 2OGUA 3FJ2A 3IG1A 3TJ8A 1JJCB 4P7TA 3HN7A 1IBLF 3UE2A 1NNDA 2ZC4A 3BPDA 4F0MA 4OHDA 1NH8A 4O3NA 4OHEA 2FJBB 1KHWA 2RRBA 1Q95G 1X0PA 3QGIA 4ED5A 3N6MA 2CWXA 1BQXA 1XBOA 2UV8A 1QTNB 4NYZA 1I94J 4C8MA 3TVZA 2WVDA 1F5AA 3NGKA 1OQ3A 5EWFA 2VORA 2WVFA 4I6AA 4QYRA 4R5PA 5T41A 4F02A 4YOEA 4NLXA 1UEVA 1JLCB 3F56A 4LMZA 5AJ3J 1JLAB 3H5YA 3VGSA 4LSZB 2DO4A 2ZBIA 3SZ2A 3UVJB 2E5GA 4C0OC 3CCZA 2BM0A 2EBGA 1Y5LB 4DG1A 1OHDA 2HHTA 1E6YB 2LQ9A 1KQFB 4CI0B 2XNRA 2G6ZA 4M5DA 3KHHA 1O5JA 1EQ0A 2BQUA 5KFMA 3QAEA 1XTZA 1PTUA 2O1PA 1TL3B 4CO2A 2H1YA 2H4YB 2DIVA 1QUVA 3VAHA 1NK8A 4FVMA 3I82A 2H51B 2D9OA 1NK7A 3BSNA 2ACMA 4GC6A 1XK8A 4B02A 4N41A 2V9KA 3G6YA 2VONA 3H2UB 5HDEA 1G7FA 5CZXA 2HS0A 4F3OA 1KRPA 3TZYA 2DIUA 3CXCR 2IC3B 1NSAA 1HPZB 1GTHA 5D4PA 2V4QA 7AT1B 3T1HF 2NLWA 4ZP8A 2MLZA 3S3EA 1ONYA 1P15A 4QW8A 1X7VA 2DXDA 3GIRA 4OYOA 5KA3A 3OTOJ 3PM9A 3EXCX 5AE2A 2GQQA 3LANA 4LF8F 3MCSA 3CB4A 4PPZA 4B3TJ 2RQMA 1F6TA 4CNZA 1FWKA 1OYDA 1R7IA 5KFSA 3OW2R 4Q2MA 4KR0B 1CC7A 3G2XA 3R7BB 2AM2A 2F40A 4WFAQ 3KHRA 2NYIA 1LYVA 3OPKA 4JYAJ 1B0VA 2BJ8A 2JVOA 1GMWA 2PC6A 5E41A 2CADA 3Q8QB 3H40A 2QMXA 1B70B 3MUVP 4KO0A 2BJEA 1A6LA 5F8NA 2JDJA 3BSAA 3BQ1A 4DFMA 4S0GA 3MEEA 2GP0A 1N5VA 4RNHA 1HNXF 4R8UB 3HZEA 3OFEA 4ZCKA 3BDEA 2CNNB 3SMEA 1Q79A 3M2UA 3MMBA 2ASJA 1C1BB 3VV2B 5DDOC 1IUJA 2MB0B 5KG1A 1YZ4A 1AA1B 2AEJA 4ZCIA 3EVMA 2XMVA 3EGVA 1PC4A 1TVRA 5F8JA 4OI1A 4RW4B 3SCIE 3ZM1A 2QFIA 2VEXA 3FC9A 4CO0A 3HF5A 4GC7A 2KRBA 5HMWA 2JNJA 4NLSA 2CPYA 2J5AA 1RK8A 1VRTA 3V6DA 4Z37A 1UJ6A 2YWGA 2ZC3A 1T05A 1UJ4A 5GAGU 1UFLA 5ETQA 4K4UA 1C87A 2VPXB 1ZBTA 4QOTA 1PKUA 1Q5VA 3DXSX 3CMQA 1KFSA 1U0SA 2NSCA 1DTTB 1SKUB 3DYAA 4DV6J 1J4XA 3OUYB 2H65B 1JLGB 3KYLA 3HFVA 3QFWA 1T03B 4F25A 1NK5A 4KC5A 5HQLA 2XLJA 4AZ1A 3V81B 4RBUA 2BRLA 5K24A 2PMZD 3TWZA 1SC1B 5HP1A 3D6FB 4NX8A 4GO5X 5GTJA 2X3GA 2HFOA 4ZLNA 4WFXA 2SXLA 4OYWA 4DN0A 2MSSA 4UY85 2I3UA 3DOLB 4C0BA 3FBCA 4NLRA 2MQMA 3PX6A 1IWGA 3HSGA 2QV6A 2HPUA 2RF2A 2EFVA 3PR4A 2IMGA 2VB6A 3ETMA 2J8AA 1YBAA 4QIEA 1UL3A 3D3BJ 1UWAA 4DUZJ 4G6VB 4QCLA 3BN7A 2YKOA 3MR3A 1PJ6A 3QYYA 4WKYA 5KFRA 2WAQD 2F8MA 2ZZMA 4CWBA 2C2OB 3D68A 3RB3A 1S1WB 5CD4A 5EUHA 2RQCA 3DLKA 3AOBA 2ZH2A 1EKRA 3B82A 2MGZA 4DOZA 2F6WA 4KH1B 1FKPA 3R1HA 3I31A 4PUOA 3PRBA 2R0BA 2ZBPA 3GSDA 2A10A 4NXNF 2MY7A 4IOBA 3ET6B 4QIGA 1HWIA 5KT2A 2HEKA 3RBZA 2B51A 1WD6A 1RHKB 2AEMA 4WYWA 3PJ9A 4NXMF 1X4HA 3C16A 4Q44A 1K8AT 5ETSA 4GE5A 2KFYA 5KFZA 3G6VA 1ZCKA 2W9AA 1QY7A 4R5PB 3EPGA 4C9DA 4PXBA 2FPHX 4EEYA 2HHUA 2XPCA 1T4JA 1N36F 2X1FA 2AIRB 3ZZPA 3MFIA 3OLBA 5HVHA 1RBAA 4JNBA 4EZ6A 2IAJB 2QZ8A 2J7UA 1PBAA 4FN5A 1C85A 3T5KA 2OJ3A 1SCJB 1JBVA 4F4AA 1WEYA 3SQOP 4DG1B 2PSZA 1K0VA 2BQRA 1JLQA 2RQKA 1F2HA 4AXJA 2GGPA 4I1TA 2CNGA 3HHEA 2LA6A 5DDRC 1UW4A 3X3UA 1FRJA 2E9TA 3QATA 1YWXA 3GJQB 4X4RA 1KDNA 3MDFA 2HFUA 3CJSA 5DQHA 1FNXH 1M90T 1FD2A 4OV6A 1FJGF 2DRDA 4KHMA 7FD1A 2W2PP 3CDUA 4KGXB 4GKJF 4FPRA 2ERRA 2FJVA 2N3LA 4GFUA 2H4GA 2AHOB 3RO1A 4ZN3A 2XGQA 2J9DA 2VG5A 3C19A 4WKRA 1LARA 3T6BA 2HFNA 1N5YA 1UVMA 1YSJA 4C8KA 4LF9J 4CH1A 2V34A 2HHVA 2M0GB 1A9NB 1OESA 1VQSA 2XS2A 3NMEA 3OFGA 3SEOA 1VRUA 3U1NA 3KLEB 3W5ZA 1IBKF 3LGMA 3HSJA 2Y1RI 2GX8A 2ESBA 2HKEA 3FMBA 2B9XA 4N8OA 1N5TA 3OV7A 2Y9HA 1I5OB 2K1RA 4FYYB 3NBPA 4FBTA 1HNIA 3BQ0A 1H72C 2I4GA 3TJ9A 3CGIA 3G82A 4UTGA 2DR8A 2Z30B 1K9MT 1FFSB 2BIJA 3TOQA 1PYNA 4RU9A 3HMJG 2VU5A 1S79A 4LF6F 2F63A 5HK4A 3U27A 1VOMA 1GMVA 3DDKA 1WEZA 5LSOA 2PEBA 2R2RA 3GFYA 2I6WA 1U1OA 2LQJA 2XMMA 2RUGA 4CLKA 4ZPDA 4O3QA 4B9LA 4YDDB 4Q7AA 4DSEA 4NLOA 1N6QB 1VQOS 2QSFA 5SZTA 2IMWP 2FY8A 2N7CA 1W2IA 5K9WA 5KACA 2BANA 4MYUA 3RGIA 2CJBA 2CPFA 4OHIA 2EC0A 2V68A 4FZVA 4X66F 1F60B 3NGDA 1KHVA 1QSSA 2FIUA 5DG9A 4B9SA 3Q8YA 1NKBA 2VOSA 4FYWB 3Q8VA 2W24A 2VDHA 4ATNA 1H6KX 2EFPA 5I4MA 1SIZA 2JX2A 5KT7A 2BE7D 3KLHB 4K4TA 3JB9k 2OIHA 1SIWB 4ECZA 3GXHA 2DITA 4M5NA 3T41A 1LFWA 2NLKA 1M5SA 1RZMA 4JP8A 1VRTB 3FRZA 2C2NA 3V6DB 4G65A 1VQ9S 5F9LA 2GW8A 2F4VJ 1UVJA 5DM6Q 1AROP 3N5FA 1VQMS 3RG6A 5IT9U 2FZGB 2Z56B 3D6TB 4P9SA 4OZLA 5A8WA 3ILJA 4NCGB 3HHLA 3F9BA 2B8QA 3DYAB 3VCDA 5J1EA 2AP6A 1SJ4P 3VQTA 4KQZA 2ROEA 2M8DB 2IRYA 2OEMA 2LXUA 2W25A 4A8FA 5IC4B 1JB0C 3E8OA 1U49A 1Q8IA 4ES3A 4KBIA 2HQCA 4A8YA 4K5RA 1OSCA 4B9UA 1YJTA 1FK9A 5IV3A 1O51A 3OFFA 3AB4B 4I6WA 5KFNA 2ZH3A 4JI5J 3GYXB 2CQGA 4YUDA 3NAIA 3P3DA 3L7PA 3E01A 1MROB 1D8YA 1JX4A 2LU1A 2RF2B 2DO0A 2MJNA 2XMKA 4WFNQ 3CCMS 1JKHB 5E2QA 2ZVIA 1XMBA 2CJ9A 3GJTB 3KK3B 4NLGA 4YP3A 4DV2J 2IRXA 3MCNA 3GIMA 1V6HA 1WAXA 2BV3A 5I3PA 1DAXA 1RU2A 5D6GA 4IH6A 1HL6A 2A6MA 2HNDB 3Q2SC 3B78A 4HVZA 1VC6A 2UUBF 1X31C 3I9V9 1RDRA 2E5HA 4A8OA 5CA5A 5E3PA 4CP5A 3IR6B 1NU4A 4F4WA 1X4EA 1X5PA 3JSRA 4I69A 4MYTA 1MG7A 3H0PA 1HI0P 2M5YA 2FHJD 3CT9A 3OL8A 4FF4A 4ZRTA 3CMES 3OXLA 2YY3A 4PUOB 3IA0A 4I6YA 1LFPA 1FDAA 5KFBA 4R25A 4HH0A 2GVDA 4F04B 2HZAA 3T1YF 3MAHA 2B6AB 2DKOB 2JFGA 1WOSA 4DV0F 3TP2A 2F3JA 4BWJA 2NR0A 4P71A 4RH9A 3VALA 4E0DA 1XJWB 2J0SD 3QLHB 2Z2YB 2FLLA 4URGA 3ZNUA 3LH2S 3CCQS 2CAJA 1MMLA 1XR7A 2QA2A 1AZSA 2CPIA 4OI3A 2QFJA 2RJZA 1IBCB 1TAQA 2DGUA 1XNQF 2W01A 2GVZB 5IM0A 4O0NA 4XPEA 1SV5A 5CABA 4NWGA 4DX6A 4X4QA 5LXYA 2N3OA 2WRMA 3KUGA 4J9RA 2A3JA 2YH1A 2GGPB 1LXJA 3CIMA 4ED6A 2J76E 3B6BA 4ZDNA 2HWHA 3CO9A 4ZPAA 2U1AA 5L9NA 1GXUA 1L3KA 5D8HB 1BZCA 4WFYA 3M30B 3LALA 3DOMA 2KJWA 1TL7B 2B4SA 1SQFA 4DSJA 3TW0A 4ZVQB 4FP9A 1J5OA 3DDNA 2U2FA 1HYSB 4B04A 1Y5IB 2VKRA 3LOUA 1IJEB 4FYDA 3DGVA 4WFBQ 2R7UA 1KTVA 5J8RA 1SKSA 1NL9A 4P7VA 2XY5A 4F0HA 3MI7X 2Y0BB 2BE9B 3F9AA 1RLCL 2J0QD 3BGOP 2KYZA 3RBXA 1U45A 1HBNA 4TLQA 1GEHA 1RE1B 2YKAA 3EGZA 3CC2S 2J7KA 5IWAJ 5K8NA 1HMVA 3LGNA 1YZ6A 1YITS 3CD6S 2UUAJ 2CQCA 5B0DA 2JFHA 1JLBB 2WONB 3A13A 2CQDA 4DV7F 1OMSA 2E44A 1AYEA 4OHXA 2RDIA 3UD4P 5H9EK 2FVSA 3KTQA 1MKPA 2CPJA 3DHWC 1H73A 2Y66A 4RNOA 2BE2B 5KFTA 1RTHA 3QIPA 4KYQA 3LAKA 2AJFE 1P1TA 4CYUA 3BSOA 5LSLA 1T95A 4ED3A 1EB0A 1IR1A 1PG5B 3HULA 1ZM3A 2V69A 1LWCB 2VJUA 1I9SA 1NZ7A 4C11A 2F6VA 2FTRA 5HQMA 1IKVB 2YKMA 2KFZA 3G87A 4UQTA 1FJ7A 2VH7A 4W90B 3WDOA 5DQIA 4YR0A 1RABB 3P5BP 2VIHA 1NKCA 2CNLB 1UWBA 5J2NA 3FEYB 4NL5A 3F73A 3U1LA 2JH3A 3W8PA 3V0HA 3BB5A 2B9EA 2QYCA 2V8VA 3HD1A 3NCQA 4ECVA 2UAGA 1XMOF 2KHCA 4DSFA 1VBXA 4IG3A 2QL7B 5J2MB 2BABA 2UZAA 3QKPA 2RUSA 1C1CA 1OSDA 1ZA2B 4F67A 2VD3A 4C6AA 3QRQA 3ZTPA 1J5EJ 2E1MC 1X24A 3IWLA 1M5KC 2WK4A 4QWBA 5CHCB 4HDGA 3GPAA 1Q81T 3K0JA 2D3ZA 1BZHA 2EWHA 2FGOA 3C3LA 1URRA 4U96A 4KH0B 3M8PA 5LT5A 1RB0A 4BUCA 1VJQA 1XNRF 2W7PA 4IRCA 3D42A 1FVSA 2EFOA 2CM2A 1G2EA 1HNXJ 2IM3A 2P9CA 4OYBA 3MM5B 1RAAB 1U2CA 3SXLA 1ZYQA 3NMRA 4QQBA 2AJ0A 4PQAA 5I3UA 3TUZC 2G59A 2B43A 4HTJA 4J9OA 1UVIA 5ETKA 1REVA 4CT8A 3U1MA 3HHNB 4XTTA 3VR1A 3EWGA 5K9FA 1MU2A 4MIWA 4QW9A 2VBYA 1BHNA 5GAHI 3CJKB 4PXCA 1GQQA 2VOPA 5JXSA 1GQYA 4YMEA 3OFHA 2AU0A 1IKWA 1S6QB 2AX1A 3DFEA 3DLJA 2Y8WA 5EHHA 4BWMA 1YJWS 3PW5A 4RKUC 1R0CB 5G0RB 2JHEA 3UDCA 2VG7A 1NBEB 2VFTA 2VZ9A 1XEZA 3W65A 4U95A 1FDBA 2JLFA 3CC4S 1UZDA 2F70A 1W26A 2FHKA 4YR3A 1K0TA 3GCWP 1FNOA 1AFJA 2VTEA 2GFFA 4IFVA 1U1QA 5D4NA 3BGFA 2V0NA 2GVDB 4PG5A 2O01C 5T14A 3JAMU 4TU7A 1NK4A 2OEJA 3A3PB 4DR2F 3TX8A 1JF7A 1EETB 4HT5A 5H9FJ 4X65J 3PYGA 4AQYJ 1MWQA 1T8EA 3PTWA 2YKNA 4UW2A 3KJVB 4IDKB 1P27B 4OFZA 4IG0A 2YX7A 4FXWA 4IFYA 1YK9A 2I42A 1VDHA 2HBZB 5K8PA 1FXRA 3LP1A 4PYHA 4K4SA 5A2QU 5LMNJ 1PILA 4MK9A 3U96A 1TV6B 1UPPA 1X5OA 5JUMA 3A1YG 4KPCA 4NE9C 1AT1B 1UCNA 1KR4A 4LSNB 2KU7A 3ILIA 3A3OB 5IM0B 3C6TA 2J17A 2Y1IA 2HLTA 1SV5B 1Q6SA 1Q8BA 1JNRB 3HPOA 3ZTQA 2MQPA 4Q45A 4H1OA 4NA3A 3JTOA 3A12A 5G4DA 1T3NA 2H4VA 2V8GA 3MWBA 4RL1A 1VQ7S 4DUYF 2I4EA 4LF4J 5HROB 2WBRA 3CSKA 1EEOA 1WG4A 1U1LA 1YI2S 1BC6A 3O4SA 2D9PA 5B7WA 4J9QA 3IP0A 3OBIA 3TZZA 1S1VA 2G9OA 1J5OB 3A8JA 3WC2A 3CCWA 1GFWB 2M3DA 3G6ES 1WEXA 2QC3A 2ZM6F 2XWXA 1OHCA 2KDOA 3PY8A 2FJMA 4I56A 3BLUA 1H2UX 5GADI 2DGXA 4H4MB 3UAGA 4D3HA 4HJPA 2MKCA 3FCHA 1YJ7A 5HJXA 3GQCA 2FLOA 1CJUB 3RAQA 5DGBA 4R0EA 4R0TA 2HY3A 3BREA 3P45B 3WC0A 2KH9A 3MM9B 3B54A 1Y10A 5IT9Y 2WTFA 4DLGA 5LJ5Y 4KTQA 3MMAB 1SL0A 3OR1A 2OC3A 3CWJA 1FXLA 1LNQA 3TAMA 3D0IE 2UVUA 4YQWA 1NDKA 1KQKA 1FJGJ 1Z1ZA 3Q83A 4FYVB 4GKJJ 4K2XA 2WSFC 4CO4A 4UOCA 1D8ZA 4NPOA 3Q89A 4CYUB 3M8WA 2XI3A 3VGTA 4AYBD 3RTVA 1A0OB 3PG9A 4HHHA 3PKYA 2NPFA 3QCFA 4C11B 3UDLA 5K20B 2EG1A 1RJJA 3AJ1A 4TU9A 4I67A 3IRXA 4WZQA 5BYRA 3SMZA 2CJXB 4PCQA 1FVQA 3M32A 1SJ3P 5J2NB 5MAOA 2LCWA 3N0VA 1UJ5A 2ZH6A 1UA0A 1AXQA 2DH8A 3TA1A 4RKKA 1LW2B 1JK9B 5DDPC 5EDWA 2LKZA 3ENWA 3C14B 5KFLA 3D0GE 3MPYA 3CJ4A 1KFDA 4EYIB 2HGMA 4LF6J 2QLXA 3KNGA 2WVBA 1U25A 2KT2A 1YTSA 2R7TA 3DRSB 2HG4A 3PIPQ 4CO3A 5HATA 1WOPA 5D0EA 1CQMA 4WTOB 1KKHA 5KAAA 2PT0A 1D5RA 3K2YA 1ELOA 3GYNA 1LWXA 2OPQB 3D7SB 4UOFA 4CRJA 3RJMB 1BZJA 1S9EA 4CIOA 5LXQB 1RT3A 4X66J 1RA6A 1H2TZ 1TK5A 3I0RB 5I3UB 2FVRA 4ILLA 2C42A 2AW0A 2PFFB 4RI5A 3V2UC 3M2VA 2CNIA 1EEHA 4WIIA 1GH8A 4KSEB 3PW2A 1G7GA 5GADU 4RW9B 3CWEA 2ZD1A 2VA3A 3PACA 1IKWB 2OMLA 1WC0A 5HANA 2MZRA 1XQIA 2F00A 2RKIB 1FJCA 3RGOA 2QN6B 2Z0GA 4C4WA 5CD4H 2DHHA 3MEGA 3VTIA 4C3KA 3PYDA 4CLYA 3FSIA 4DX5A 4K5SA 4DL4A 1RCOB 3MUMP 1JMTA 2G2ZA 2LVWA 4DR5F 3I56S 1RT4A 4DL7A 1B7FA 2M2BA 3L7OA 4GMKA 4OJGA 2FC9A 1FPZA 5HBMA 1UA1A 2F71A 3TZXA 2LFVA 2BKNA 4TKTA 1FKOA 5D0HA 4QR0A 2JLEA 3H5XA 1FD8A 1B0PA 4AD6A 1UFWA 1S10A 2C2RA 5FD1A 1FKAF 4O44B 3QCEA 1PYTA 1WC1A 2DGWA 3W5XA 2ZH5A 2R3VA 1FQ1A 1KP6A 4IR1A 2QMWA 1CJKA 1T9VA 1Y3JA 3NXZA 4IG0B 3TQEA 4P52A 2ZEJA 3PR5B 3DHXA 1DQ8A 2CQ2A 4QIVA 2N7YA 3EDRB 3IN5A 2D74B 2JFFA 3CJ0A 3LWLA 1S99A 1OEOX 2Z8QA 2DNRA 4KY3A 2OPRA 3KJNB 3A3NB 3C6TB 2R7SA 4RWXA 4EBEA 4F0KA 3TYTA 1WC5A 2EBEA 3UFCX 2NPIA 3NG8A 4CDIA 2N4DA 1AUSL 4QWEA 4J37A 4J9NA 4HYKA 3PCOB 1FO1A 4MK8A 4PKDB 3R27A 2I5XA 1HHSA 2K7KA 2W8LA 4Z2XA 4QU7A 2AYMA 1NMEB 1RQ0A 1U1RA 1YJVA 4CNYA 5EGYA 1U47A 2VG6B 2HQGA 1FTRA 3NAHA 2VEYA 4C97A 5BR8J 1S1XA 2E66A 3NCRA 4KJIA 2UUCF 4BUBA 4WBFA 5ETLA 4BBYA 2KT3A 4WK3A 4ICZA 4MFBA 3KLGB 3CJQA 1XNQJ 1OYEA 5DRKA 1S9GB 4YR2A 1SH3A 2YNGA 4NMLA 5KFJA 2YPYA 3DU5A 3FRYA 3PVXA 2AKWB 4C98A 3W2VA 1CS4A 1WWHA 3BSCA 1KVJA 3TQ1A 3OLRA 3GFZA 3EJMA 2B7CB 3ONQA 3PX4A 1YWFA 4AT1B 5I42A 4ZA1A 1RCXB 4CVMA 5HLFB 1FFWB 1HBUB 3CJRA 1VIOA 5KFAA 4GKKJ 4BC9A 3PYZA 1DLOB 2GC8A 4L3KA 1C84A 2YNFA 1R89A 3N4WA 5AE1A 2FVQA 1FNMA 4CLLA 4OYPA 2RT3A 4F4ZA 3DLGA 2UXDF 4UOHA 2QBSA 4H54A 2QCTA 1VQ5S 2R8JA 3I5AA 1EENA 2I8EA 4Y2EA 3FEXB 2I3RA 3S4OA 4LBIA 4PRFA 1N34F 2CDRB 2XO6A 2DNHA 2ZZTA 2V67A 1ZM4A 3GB0A 3IBWA 1MWYA 3R5GA 3IRXB 1WG1A 1W2BR 1FWLA 2V8PA 3C6UA 2B9WA 3BKUA 4I2QB 4MKBA 2OFGX 4ZVSB 1O5ZA 2BOPA 2NT7A 3M9NB 1ONZA 2DPIA 1YTNA 5KG0A 1JJ4A 1FWPA 1G6BA 3TARA 3BZQA 2GV1A 4LVOP 3VGVA 4OHHA 4LRDA 3MEKA 5C25A 3I4HX 3CCVS 3BLTA 1X4FA 2DK2A 2GJ2A 4N56A 4WPAA 2ZBRA 4U6PA 1F3FA 2VPWB 2CG8A 2W7OA 2DR9A 2Z2MA 2ZJRQ 2HMIA 1VJWA 3R5JB 2C2ZB 3AHPA 1LWEA 4ZPWR 4ID8A 3QJJA 4OV1A 4F26A 3DGPA 2E9RX 2VEVA 4ZIYA 2IJNA 3FK4A 1HR0F 2E1PA 4DPXA 2OELA 1BD6A 3GIJA 2OSQA 2GC5A 3O1LA 5FDLB 3D6MB 5L39A 5EX3A 3ZZZA 4ECWA 1SKWA 1Y4ZB 2V2ZA 1V3ZA 4NYOA 3RRKA 2AV5A 1BWEA 5JVGQ 2JEGA 2Y2FA 2W4PA 1X4BA 4OZ5A 1Y9OA 2YWWA 4L75A 2MXYA 4KKOB 4KYRA 3PW4A 2OTJS 2Q3PA 3KLFB 3PRDA 4KGZB 3MAAB 3BS9A 1SUQA 5KG5A 1OEUA 2AZRA 2YNHA 3X1LB 2Q79A 2W7AA 1D09B 4I2PB 1IJFB 4DR3F 2Q05A 4FS2A 3M2VB 3VF0B 4U9RA 1JLFA 2CDQA 1PYOB 1R8CA 1G7CB 5HVGA 3W1YC 1N32J 4I4BA 3GV8B 1IQTA 3KG4A 1N54B 2IA0A 1OS5A 1M0SA 1KOHA 4ZJLA 4P10A 2IIHA 1TU0B 4PG8A 1XNRJ 2WTZA 5IS2A 1SBRA 3V4IB 4NLYA 5IOLA 3UI3A 2UUWA 3QQCD 3HT3A 1KAKA 4G1QA 2A3KA 2PA5A 4KHPF 2XWYA 1QD1A 1XR5A 4F4YA 3EM1A 3UO0A 3EZUA 4JI7F 1LOUA 3TZWA 1KVIA 5EX0A 3MM7A 1R3NA 1H0HB 2GWOA 2DPJA 4A8SA 4DL0C 1U26A 2D3OR 2A18A 4RJVA 3QCJA 1L3VA 4LVNP 4DBQA 4KE5A 3LWMA 3W3SA 1RHUB 3DRPA 4J51A 4NLWA 1NK6A 1IR0A 4CVLA 4O3SA 1FRHA 1U8SA 2BJ7A 3VVTA 1TFYA 3H2XA 2AJ1A 3HZGA 5F3ZA 1D9DA 2YVSA 4ECUA 1RT7A 3PS5A 2AX0A 1SXLA 1NSPA 4V1Ak 3RRHA 1AFIA 1QAYA 2JWNA 2IYIA 2DRBA 4J9PA 3JYTB 4KT0C 4J9LA 1WUUA 1F9HA 1TELA 5GMDA 4DV1F 1C4AA 1F1BB 1U7LA 2OPSA 3ZZOA 2ZH8A 3QZ7A 5A8KB 2VQEF 2E7XA 1P9YA 2R42A 2XSJB 1CG2A 4OI6A 5KFUA 1F3VA 2FVPA 1UVNA 2D41A 2HQDA 3UNGC 4OLPA 2D1CA 2H9ZA 2MZTA 2UVVA 2PI7A 5F8HA 2HC1A 3MM6B 1QSYA 3ZXWA 1Q6JA 2KZZA 1T9YA 3ENQA 1CLFA 4K4XA 4WTYA 2BGEA 4OZNA 1FXDA 3H90A 3ADAC 4LF7F 4OYIA 4GRYA 2MDAA 1MN7A 1RT1B 2W2OP 2VFVA 1S1XB 4FF3A 1PGZA 3VAMA 2HFZA 4DV5F 2RHQB 1JLCA 1GXTA 4MFBB 1JLAA 4TVVA 5IQQA 4LF5J 3CD0A 4ZVGA 4MKAA 2CQ4A 3UVJA 2OOQA 4LRCA 1SJFA 2BBEA 3HT0A 1Z2ZA 1CSJA 1KLNA 2R4FA 1D9AA 1VBZA 1R8PA 1VQKS 1CS4B 1IBMF 1EARA 1B64A 4O4RA 5KA2A 5CQGA 3HX9A 3OR2B 1F0XA 2KXNB 1TL3A 2DYAA 3EMTA 1S6PA 1YJRA 1N5QA 2GZOA 2PD1A 5D0GA 3R5DA 1VLOA 3K59A 3MECB 5K25A 2YNFB 4IR9A 2ZJQQ 4WZMA 4GVLA 7FDRA 3EGNA 2QEXS 4ZVHA 3DLGB 3A8KA 4ICLB 2Y96A 4DSLA 3NRBA 2B4OA 4LSLB 3HVRA 1E6VB 2I6JA 3HHLC 2ZHBA 3AA9A 3OHBA 3R5CA 1HBMB 2C3PA 4K4WA 2YWFA 3GR1A 4JI6F 4UY8T 2ZNYA 2IC3A 4NMXA 2DNLA 2ZUGA 3HKWA 2OI2A 3OTEA 5KFIA 4C8NA 2E5LF 2H5JB 1Q6MA 2DT9A 1PH0A 1UPMB 3C6UB 2XZTB 2CA9A 1WC3A 4WP3A 3O2IA 3I55S 3GTYX 1SL2A 1RISA 5KFWA 3QO9A 3TA0A 2E1AA 2EPIA 1UAWA 3M8ZA 4DR6F 1L3UA 3IWNC 2E9ZA 3OT9A 4V19J 2CYYA 1YLXA 4PQUA 4X64F 1WC4A 2FHJA 3EPIA 3QCLA 2XMUA 4M5HA 4B9MA 4RW6A 2JJDA 3DM2B 3F44A 1LWEB 1HW8A 3KLIB 5DG7A 3N6NA 1U24A 1F9FA 4E2FB 3B8HA 2C28A 3GCXP 1FFGB 2OLWA 4OMFG 3OL6A 2CPDA 4JUZA 4J9VA 4OX6A 2H48B 4DF8A 1MNEA 4YB1P 4IO1A 3BDPA 3R1LA 4NYHA 4JI1F 1QLNA 2VICA 1NDCA 1U09A 4M5JA 1U1NA 2O67A 1D3WA 3M2RB 3PNIA 4ILMA 3C8YA 4A8QA 1HARA 2ZH7A 3NGRA 2NUHA 5CYJA 1C1BA 3BRHA 2PMWA 2YNHB 2D7SA 1RI7A 1RYSA 1X9SA 2XJAA 1Q6NA 3MR2A 3MD1A 2WOMA 3UR3C 4RNNA 5C42A 1E0DA 1JLFB 1URNA 1G1GA 4MK7A 4JB8B 2GCBA 2HK2A 1R43A 2QYGA 1K44A 4DR7F 4X84A 2AJ2A 1VR6A 5J1NA 1FCAA 1Q8KA 1ZA1B 2XMTA 1GQEA 3W2WB 1CJVA 1JLGA 2V5HG 4ED8A 4IRKA 4X4TA 1WI6A 3QCDA 3EDQB 2WZ1A 3PDNA 1T03A 4B9NA 2JLGA 1HIYA 2JEIA 4DR1F 4OQJA 4G1QB 3V81A 4U8YA 1EIYB 1NJZA 3K17A 2XS5A 1BWVA 1U0HB 4J9UE 4Y34A 4UF4A 2J9DE 4W98A 4IKCA 3EU0A 4ID5B 3POTB 1S4EA 3V5RA 4H4KA 3I7ZA 2HQFA 3DOLA 1EHWA 2L9WA 1C0TB 3QNWB 2XYPB 1RAOA 3M8QA 2C2DA 3H2LA 5GMEA 5HSPA 4F2SA 1KLMB 1TKZB 4MAKA 3H42A 1VISA 2FD2A 1S7HA 4DL5A 3DRPB 4KGVB 1UKUA 1KS2A 1RXOB 2BV5A 4RBTA 2J16B 3D1OA 4WU3A 3LAMA 1WHVA 5KFFA 3IS9B 3NS5A 1RT7B 5SUHA 4HI1A 1P3DA 2HFSA 1S1WA 1P1LA 4ZK7M 4DR5J 3CCES 3CMAS 3K5MA 3DMJB 5H9EJ 1VIXA 3JS9A 2HHHJ 3IM8A 2NXUA 4BS2A 4NWFA 2CKWA 3N28A 4IOAQ 1T7PA 1VFJA 1WSVA 4ED7A 3ET6A 2Q47A 4USKA 3QZ8A 4B3SF 2MKYA 2DR7A 5A0YB 3NRSA 2DRAA 1EZZB 2RSQA 1YGRA 2DXEA 2XHCA 4PYDA 1EP4B 1FF2A 4ZCLA 4DX7A 3HVAA 2EK1A 2IBOA 1NB2A 3H7HB 4ZS6A 5HL7Q 1DTQB 2MLXA 3UPFA 1YJNS 4RH5A 2QA1A 1RU1A 1DARA 3EYZA 2WW4A 1NLKL 4MBBA 4M8LA 1ZPWX 2CQ0A 5GAEI 2MQOA 5B0AA 4DF4A 3THPA 5BZZA 2IAJA 4LT6A 4QWDA 1OPIA 1KQSR 1K1QA 2HVHA 3UNYA 2ZOGA 2F46A 2HVIA 3TUIC 3DI6B 4YY3J 1UFKA 1QAXA 2UXCF 2IY5B 1NHUA 3BBCA 1NHVA 3MTJA 4ELVA 2YKQA 2POKA 4ZN5A 4DGPA 3BKFA 2IRUA 2JC0A 1S6PB 3IAS9 4GS0A 3HFKA 4NLQA 4AUKA 3QMQA 4QF5A 3T1AA 1WSRA 3NWGA 2AHSA 3S8SA 2JSXA 3D6HB 1RAFB 2LXFA 3SQGA 2I4HA 3HK2A 1R0BG 1DRZA 2F6ZA 4JI0J 2C2EA 2O3DA 4FNHA 2F9JA 1VQLS 5E3RA 1R0AB 2UU9F 2CMCA 2HYIB 2UUCJ 1I94F 1ZOTA 3DDIA 4FXDA 5CYQB 3HLUA 3KLEA 2JOQA 3FZBA 2RE1A 1H7WA 4Y2CA 3LA0A 2ZMMA 2FLNA 1FTCA 3PO4A 5AJ3F 2LQ5A 2FH7A 3ULHA 2IM0A 3T6JA 4CQ1A 4ITSA 2AJQA 2VQFJ 3PYFA 3MZIA 4ED0A 3BBFA 1B0TA 4PG6A 3H25A 2HIQA 1ZM9A 4Y0FA 3QO9B 4F8RA 2N4CA 3Q86A 1RBOB 2VEUA 4WWSA 2OP5A 3W62A 2X5OA 4QU6A 2X7IA 3GU0A 4ZIVA 4PQUB 2LA4A 1YDLA 4RWWA 3UCUP 1FA0A 1BGXT 1I9TA 4MKYA 2UXDJ 4RW6B 4CO1A 3RB0A 2HIYA 4U7CA 3BYPA 2LQBA 2LEAA 2B5JA 1KAVA 3D44A 3D5MA 5KFPA 3QRRA 2M3VA 3PHTA 3CCRS 2CZ4A 5FIIA 2XSFA 3W7BA 4P73A 1N6QA 1SKRA 4WXWA 3MOJB 3FMWA 2IDEA 1UETA 3VAJA 2HNZB 2H4WB 5IC6B 3TUPA 2C22A 3GSIA 3EMUA 3UDEA 3N0AA 1LK7A 4KGMA 3PJXA 5CAAA 2YWHA 3J7AN 4IYQA 1TUWA 2MEWA 4JI8F 2KYXA 3WX8A 3KFWX 1WRMA 4WK1A 4DCOB 2EK6A 9RUBA 2OUDA 3V0IA 5A6WA 3MM8B 4TYBA 3KDNA 2UV8G 5CCMA 2MKHA 1YJ9S 3KLHA 3OTOF 3IC1A 3CE8A 2RF6A 2WOMB 4DSKA 5C42B 5GAEU 1HWKA 4B3TF 2CUYA 1IR2A 5B09A 2EC2A 4XAKA 1NPKA 5K9VA 4D3PA 4HKQA 1QAJA 4Y14A 5IBSA 4NCGA 3HCXA 1TL1A 3VWSA 2FZKB 1HR0J 2M4MA 1CJVB 4PXEA 5K23A 4N47A 4ANDA 1G1XA 4KRWA 4DFJA 1ZAWA 4X62F 1SJRA 5KA0A 2J9EA 2GIFA 2HB1A 5L1LA 4AXIA 4NZ6A 3I87A 5ADZA 2JEFA 1RWWB 1WC6A 5KA8A 4X4VA 2CM3A 4L76A 3CVKA 1T94A 2I9SA 4ZCMA 1M1GA 3DLEA 1MROA 3M8QB 1B7YB 2E5JA 2J0WA 2XY6A 3A4TA 2KM8B 3FBFA 2R8GA 1VYAA 4ECYA 3TAQA 1JKHA 2QL9B 2D3UA 4B08A 3HVWA 3KK3A 2A2CA 1ZZFA 1DY3A 1JLEA 2Q6CA 2F7VA 5DG8A 3IGVA 2HNDA 2L08A 3R5BA 2MKJA 3DLBA 1LW0B 3D54A 3KUHA 1MWZA 3P6YC 3AWFA 4M94A 4YHHF 1HA1A 3AODA 1T9XA 5K22A 2B9YA 2UXBF 4DV6F 1D1UA 4LQ9A 4P72A 2R7RA 4OZ2A 1VQ8S 1U6ZA 4EO8A 3M9MB 3S1TA 2NREA 1WF0A 1T02A 2E7VA 2MY8A 4ZHRB 1RWOB 1TTHB 3ZTSA 2W2QP 4WFZA 3I0SB 4OZJA 4TU8A 2DCUB 2B6AA 4YFUA 2DHGA 3BQ2A 2DXFA 3MOWA 3PEJA 3VAGA 4OYAA 2CNEA 2KB2A 4N76A 2HHSA 3LP0B 3A5KA 4DX8H 3UCZP 3D66A 3R7NB 1U4BA 2OSRA 4QR2A 3QLHA 4H4OB 4RNMA 4IKAA 2FZCB 1RTDB 3V0FA 2FJWA 2AQ4A 4L74A 1TQLA 1UTAA 4JI3F 2BUNA 1A5YA 3D2WA 1Q4RA 4O0IA 4WYLA 4RNFA 4ZMMA 2H02A 1BQNB 4ALZA 5KFXA 1NWEA 4DUZF 2A0FB 1ZH5A 1HBOB 2C2MB 3JSMA 5IFMA 2GVZA 1YKWA 2YWKA 1V5IB 3HHDA 2LU2A 3ZV2A 4B9VA 2QMUB 1WKKA 2GA7A 3R6GB 5J2PB 3F81A 3DNCA 2IPOB 4UUXA 3IBFB 4F3MA 3R6LB 2D69A 5L8RC 2JVRA 3BM7A 4OX8A 3G6XA 4M63A 4A8KA 2KFNA 1NZ8A 1LXNA 4JI4J 4FBUA 3M30A 2I6IA 1LWFB 1TL7A 4OIXA 3L9ZA 3SQGB 2L3MA 1SC6A 3C66A 1HYSA 4NI2B 2GJFA 1P9QC 1QVFR 4LRFA 2V8HA 2FY1A 4HACB 5B0GA 2QLFB 4EUVA 4PPDA 4ER8A 3QKQA 5E7OB 3CTRA 2OO4A 5F8MA 1OHEA 2JFDA 2FYXA 2V6AA 3GV7B 1I3OB 4NOHA 1REGX 1XRIA 1RWMB 2IDLA 2ADCA 1JLBA 2WONA 3DRYA 9ATCB 1NK9A 3FBEA 2WJPA 4L6V3 1N0UA 2QDPA 3V0EA 3K5NA 2WB4A 2MYFA 3ZL8A 4Q8EA 2BE2A 3GIKA 4CH7A 3H98A 2MZQA 2Y1OA 4USMA 2B5JB 4DZ6A 3AOAA 1HNZF 3OJUA 3MCMA 2HRTA 1RP5A 6FDRA 1LWCA 4F50A 4Y2AA 2F8EX 3NMAA 2XG8A 4PAAA 1IKVA 2F65A 2AZ1A 3ZTRA 4LF9F 1KTQA 4LBHA 1N48A 1YIJS 4O3PA 3TJAA 2XEXA 4DV4J 2DHSA 3M8SA 5DZ7A 1T3OA 1S1UB 4L3NA 5B0FA 2QDCA 4GRSA 2YH0A 1S1TB 1MMDA 3OTCA 3IRWP 1C0UB 5J2MA 1XN9A 2CXEA 1XWLA 4QBEA 4GVBB 1G3OA 3EGWB 5KT5A 1KVKA 1XMQJ 3KG0A 2L41A 3JQJA 2X1BA 2ZHOA 3A8EA 2HNPA 4RR5A 2HZCA 3T5JA 3AD8C 5RUBA 3RR7A 4L72B 2QG9B 3EZ5A 4TVAB 3RR8A 3Q8SB 4O4GA 5H1SV 5K8OA 5BXIA 2YTCA 3MHYA 2COLA 4CLZA 3DLHA 2GCAA 2CQ3A 1TL1B 1FI4A 4TY9A 5DS7A 4HHUA 1N56A 4DV3J 3UD3P 4QPXA 2CM7A 2WBMA 2XO7A 2GHPA 3MM5A 1GX5A 2WW8A 5CYMB 1JNZB 4JI1J 4ETZA 5LOQA 3AH6A 1WF1A 3KK2A 3BO4A 4ZPTR 1DHMA 1NAQA 4KFBB 4DJBA 5C24B 1NXIA 2DNGA 3DLEB 4A46A 4UZCA 2GNKA 4EYHB 2JL9A 4O3RA 2B07A 3PYEA 3CJKA 3ISZA 2VDIA 1JLEB 2NTAA 4OYZA 1S6QA 1CBKA 3BPSP 5KOWA 5LJ3Y 4NRUA 1B4SA 2AJ4A 3H8YA 2EFNA 2A1BA 2CZVC 2E5IA 5G0RA 6AT1B 1M1HA 4C8OA 3GZ7A 3GLJA 5BJRA 1YTYA 3F41A 3BR8A 3AWEA 1J27A 2I5JA 3RB4A 1L8GA 1Q8LA 1Q53A 5KFQA 4DHVA 3I36A 1HW9A 1PO6A 2HXPA 2HNQA 3CJ3A 2P6TA 5KG6A 2CRLA 2QIFA 1TKTB 4ZVEA 3CUNA 3D1HA 3KLVA 3T3FA 3THTA 3I9ZA 3CJ5A 1NKEA 1TKDA 2DEJA 4X4PA 1V9OA 1RT2B 3TR5A 1R8HA 4YR8B 1EETA 3GFXA 1S48A 2KJVA 2PA8D 1YGUA 2K3KA 3US5A 2VOOA 4CH0S 3DU6A 1NO8A 4JI5F 3N79A 3KJVA 4IDKA 4D3QA 3Q24A 2L9DA 2NZ4A 4N7TA 2PI5A 2CQPA 1U48A 4ECRA 5K14B 4IO9Q 5ETMA 1IM4A 2JEJA 4DR4J 4CT9A 2C1EB 4FPIA 4DV2F 2ZE2A 2JZ5A 4EZ9A 2QGFB 4DCJB 2ABYA 4I68A 1TV6A 2V2KA 1GK8A 2CJAA 2XI2A 4X4OA 3M6WA 2O66A 1IKXA 3JSMB 1ZZNA 4LSNA 1X8DA 4L73A 5KFVA 1HNWJ 1ZAXA 1Y5NB 1EX8A 1NSQA 5HQ8A 5CXTA 5AT1B 4ZN1A 2RILA 2QLWA 2BKOA 2YXLA 1ZTTA 3L09A 3JSBA 2HNYB 3SR9A 3BBBA 4B3SJ 3BKTA 3W63A 1IBLJ 3T5HA 4PXDA 5HROA 3NNHA 3FFIA 2R9LA 2W9BA 4NZ0A 4ES1A 3P96A 4QR1A 3ZMPA 3AWGA 1HWUA 1NM2A 3UD5A 1L5UA 2F5GA 2H5IB 3QGGA 4UOGA 1V5VA 4MMOA 2QE5A 3K8WA 3ZZUA 3TUJC 5M2UA 2CG4A 2P5VA 1HQ2A 2MBCA 5A76A 4LR8A 2Q66A 4H4MA 3RRGA 4QIWD 4ECSA 3LO3A 1I1GA 2QTWA 2EFGA 1EAYC 2BDPA 3HVTB 1CJUA 5J1PA 1VMBA 3KHLA 4OJ1A 2EKYA 1SJQA 3MM9A 2ASYA 4C3MA 2ZBQA 2IBKA 4LR9A 1RHQB 1FDNA 4CLFA 4EU0A 4UAGA 1N5SA 3MMAA 2HHWA 1DQAA 4LFAF 2MMYA 1PTVA 2XB2D 4YB5A 3WX4A 1U1MA 4TQRA 3M1VB 4LJMA 1UW9A 1HWLA 2FJAB 2DNOA 1C2PA 2CQIA 1RTIB 2GO8A 1FRLA 3HFZB 3ELHA 3JXOA 2E0TA 1QXKA 3QBCA 5CCLA 2BGDA 3JTNA 3MMCB 2UU9J 4NASA 2FHMA 2AM1A 1U02A 5HN0A 1S4FA 3NKYA 3WHIA 3CCTA 1MSWD 1OPZA 4ZPVR 1X60A 1B99A 3UN2A 1ZCLA 5D4OA 3T1HJ 3MOZA 2H4KA 2HVZA 2DGVA 3D1QA 1SL1A 4NEYA 1S72S 3RBEA 3W60A 2CIMA 3OQ2A 1LKZA 8RUCA 1JXLA 2PQ5A 3ZNJ1 3K5OA 5GAGI 4YN3B 4ECTA 4DDFA 1MN9A 2QLBB 3WQPA 2XMJA 4LF8J 1LW2A 2VFRA 3BGRA 3HKZD 5IWAF 3TX0A 5A8RB 2NV5A 3V6HA 3C14A 2EXUA 2UUAF 4CLSA 3Q23A 2ILYA 1PTTA 2XCAA 4RUAA 1RT6B 3DRSA 4ETXA 1S0OA 3JSYA 1Q7LB 3OTDA 1ZM2A 1HFEL 4O4GB 4OX7A 5THWA 1WACA 5CH7B 1CJTB 2PEHA 1GMUA 2R8HA 1RWXB 2OPQA 4X4SA 3SFGA 2DB1A 3I80A 2VFUA 1YX2A 2NYHA 6FD1A 2V9WA 2QEPA 2GCFA 1PC5A 1Q1KA 1BMQB 2EKNA 1H74A 2IM1A 2KVIA 2CM8A 3QCGA 3GJRB 2MJUA 2R7VA 4QYZK 3KK2B 2LMIA 3I0RA 2NCKL 4F4XA 4PG7A 5IQ6A 4JI8J 1ZAVA 2OHDA 2VPZB 1S7IA 1ACMB 3Q8PB 2CQHA 3P4UB 2ZKTA 2DH7A 4F4KA 4YB7A 1T49A 2PMHA 2AYBA 2DNQA 4WOHA 2C3MA 3KK1A 1TKXA 4LREA 3TRGA 4P6QA 4RW9A 1JXEA 2YBVA 2UP1A 3HM9A 4Q0BB 3EE3A 1J5EF 3PRVA 4YB6A 1DQ9A 3O44A 4K7QA 2RKIA 2R7OA 2OD6A 2WGPA 2CNKB 3CD5A 1WDTA 1N0VC 2MQNA 1NUEA 4RW8B 3GIIA 2ROGA 1HQEB 5A5FA 1XERA 2BW7A 4ES2A 4X62J 2I5JB 4WE1B 4OL8A 4RW7A 2HQIA 3ZFVA 4OHYA 3W61A 2AGPA 2QA4G 1QSLA 4X4NA 4TXSA 4QIFA 3FVYA 3HSDA 3DC2A 4FDFA 3IM9A 1IXKA 3D9CA 4HL9A 2PI4A 2NQPA 4NLVA 4ZVTB 1S6UA 2V2VA 2YPZA 3HJVA 2FHOB 3S3FA 1V3SA 2VBZA 3GJSB 2I1YA 4IH5A 1BQMB 2WHOA 3IAM9 4BCAA 4LRAA 2V8DA 1FRXA 4G1IA 1KBRA 4O44A 3GILA 2R2TA 1HNVB 3O3LA 4KGKA 3AT1B 4NLPA 2BEFA 3A5JA 4PWDB 4Z7YA 1PYSB 4QUMA 4ECQA 2DNNA 2G4BA 4TY8B 4EK2A 2K8GA 5HAOA 2BRKA 4PYAA 3RU0A 4ZKAA 1HQUB 2ZE2B 4GFVA 2P4DA 4JI2F 2QO3A 3DRRB 4YHHJ 4K0KF 3LP2A 3TANA 2DHAA 1IKXB 3C15B 1GWZA 2AEFA 3SCLE 3C46A 2UXBJ 1UEKA 4P2XA 2XZWA 3LQVA 5F8LA 1TFWA 1DJ0A 3QCIA 5D3GB 1TL4A 1KQGB 5DO2A 5I6VA 1G1FA 4ANEA 4NXNJ 5DLGA 3B4MA 5DZ6A 4JV5F 4NCBA 2W4DA 2IVFB 1SH2A 1A7GE 2BR0A 1YZ7A 1WF2A 1EKSA 4OX9F 1D9FA 1C86A 2R7WA 3OTBA 1TUGB 3FFIB 4NXMJ 3BH6B 2W9BB 3QSYB 2VG6A 2CVEA 2LEBA 4X65F 2GMJA 2J6UA 3BM8A 4YDXA 4AQYF 2CPEA 4U7UD 3J80U 4JI3J 2HK3A 4ENOA 4CM2A 1IKYB 1VQ6S 3G86A 2QBRA 2M8HA 3MURP 2R2SA 2M88A 1N36J 3KLGA 4RUBA 1JIHA 1JXVA 3M9OB 5DM7Q 3VZIA 1S9GA 3AOCA 2XMAA 5LMNF 2HAIA 2X3DA 1SI9A 3GG0A 3BH7B 3CDEA 3LW5C 5GAHU 5L1KA 3IR5B 4NLUA 1Y3KA 5L1IA 1SJ1A 1RLDA 2PGCA 4Z6BA 2ZNZA 3K5LA 4QPTA 3FUYA 1DURA 3OL7A 3Q0AA 3CIZA 3MFHA 5HLFA 2HGNA 2KO1A 2ALYB 1X9MA 1RACB 1HBUA 2DNZA 1NSKL 3S7RA 5HMZA 1DLOA 1NO6A 3IG1B 1VK3A 5KA1A 3GR0A 1P6TA 4ZJQA 1RGVA 4LF4F 1L3TA 2GJTA 4R30A 3I5BA 2OZ5A 3EZZA 1NNYA 2ZH4A 5F8GA 4DS4A 3GFHA 3ZMQA 4HH1A 1RXDA 5B0CA 2BZLA 2B49A 5BUGA 3AJDA 1OY6A 3U02A 1IBKJ 1FT8A 4CTAA 3J7YI 4P74A 1CVJA 2FJEB 1PSDA 2CPXA 4NLTA 4I2QA 5EN1A 2ZN7A 2FGCA 4CLTA 5AXLA 2DNKA 4H4KC 2DY1A 2G0IA 3UN3A 1W78A 1KOOA 3ITHA 3BGRB 5KFCA 2XM3A 2KM8C 5F8IA 4M95A 3FQKA 4M5DB 4P75A 1X4AA 2RS2A 1Q7YT 2E1RA 1PBUA 3TVKA 4JOUA 2FC8A 3MPVA 1NRKA 1GFYA 2PFDA 1EJ7L 1U6FA 2HBYB 2KZMA 1HNZJ 4DL6A 2MLYA 5B0EA 1AAXA 5FDLA 3P49B 4DPWA 1VLYA 4AFFA 3EICA 2RQ4A 3KKFA 2LDYA 4J7CA 1AW0A 2E7WA 2W4CA 3P8BB 2DR5A 1UVKA 4KKOA 2C2KB 3TI0A 3NS7B 3KLFA 3MAAA 3N01A 2ZDPA 2WB1D 3ILOA 4I2PA 3PXGa 2MZ1A 1PCAA 1X5SA 4G3IA 4LIRA 4JV1A 4DZDA 3KK1B 1TKXB 4Q2LA 1GG4A 1PJ7A 2ZKUA 3MR6A 5DDQC 4KIAA 2Y3YA 4Y2KA 4M5LA 1BUXA 2NZCA 4DFPA 1W7WA 2KVQE 3AFGA 3R7SB 3QCZA 4H34A 1ZS6A 2BACA 3V4IA 1SVDA 5DGAA 1RHMB 1G4US 4M1KA 4ZP6A 1OEVA 4KO0B 4LFBF 4RW7B 4EFAC 3SBMA 1VHRA 2MQLA 1I6JA 3MEEB 3RW7A 1SB6A 3RGQA 2ZHAA 3J7ZT 2H5EA 1SQEA 2YNIA 3O8WA 4Q5VA 3O5TB 3NL0A 3QCKA 2DNMA 3M2UB 3WIVA 4P2MA 3MMBB 4NYPA 1OY9A 4EGLA 4ZITA 2DY9A 2HVDA 2R7XA 2M52A 2DXPA 4QBUA 4DN9A 4O3OA 1TVRB 2CZ9A 4QDIA 2YQ3A 1Y00A 3TEGA 2ATLA 4OJ3A 3J7YU 2XMWA 2XTJP 3ENAA 1S0NA 4OZ0A 2XZDB 4X4UA 1M5HA 1T05B 4ERCA 2UUBJ 4OHWA 2ZZNA 4GWFA 1B3TA 3Q8RB 4QAHA 1OEMX 4DPYA 2AYGA 3LP2B 3QWPA 4KB7A 3JYTA 5IT0A 3ZM5A 3FSYA 4M5IA 3ILLA 2MQQA 4G1PA 4C8YA 2HWIA 3AXMA 4A8WA 4M5KA 4OZ1A 1RWUA 4HI2A 5A8KA 4ZPCA 2XSJA 5EHRA 1DBDA 3BF4A 2LQ8A 3AA8A 3E3XA 2ILZA 2A8BA 3T1YJ 3V0DA 1UEUA 4BPCA 4ANCA 5HP1B 4DV0J 2KT5A 2IYGA 3D67A 3MM6A 5JMNA 2WVEA 2AMCB 4NA1A 2FVCA 2I38A 3J81j 2HHPA 1NCLA 3TA2A 4IH7A 1RTJA 1Q5YA 2DNPA 1PJ5A 1RT1A 2C3UA 2RU9A 3W9IA 4HJQA 2CNFA 1O8BA 4K2JA 3V0GA 1L3SA 3TAPA 2KI2A 3S01A 3O5XA 3HDSA 3UR0A 2LYVA 4UZBA 2ZBCA 3VAIA 2VODA 4U67Q 4QZVB 3R2DJ 1RAJA 3GG1A 4NX9A 1AB8A 2HGLA 4A8MP 4IRDA 3M4UA 2IHR1 5D0RA 2BQ3A 5KG7A 2HRUA 3DLKB 4KYZA 4P2SA 5DJBA 1BY9A 3NLCA 2HFVA 2MGZB 1U2RA 3OR2A 2ADBA 4RDDA 2J6SA 4DL3A 1FKPB 2W1BA 2W9CA 4YAAA 2KG1A 4WP9A 4PABA 3JQKA 4EWTA 3MECA 2KRRA 1S57A 4N77A 1GAOA 1ULRA 3G9CA 3NGTA 2EFQA 4B3MF 4ICLA 2I6PA 5I3QA 3C16B 4C7QA 1YGYA 4LSLA 1E6VA 3OXGA 4NRTA 2Y67A 1X0FA 5HMYA 4CVKA 1RYRA 1HBMA 2QBQA 5HI7A 1K73T 4I7FA 4OHZA 2R8IA 1NWLA 1JBWA 2BJ1A 5BR8F 4TN2A 3NNAA 4CTAB 1CPZA 1YTWA 4ED1A 4MTPA 3CULA 1C88A 2B56A 3OMHA 5M2RA 1RT5A 1VBYA 1JWWA 1FRKA 4MIBA 3EVOA 1QUPA 4OJHA 4DV7J 3D4JA 1JLQB 3ITHB 4KV8A 4LFAJ 5IZHA 3RBDA 4ZJOA 3R3TA 3BEGB 2AT1B 2F4FA 5KFKA 4EO6A 1RKJA 3S3KA 1JQGA 3HP6A 1XR6A 4OHVA 4ED4A 3FEZA 4GKKF 3H20A 3DM2A 3FCWA 4GE6A 2XS7A 4QUNA 2PA3A 2VJVA 4NEZA 3KLIA 1G1HA 2DJWA 2P9GA 4DQIA 1BLUA 2B4UA 4F36A 2QA4S 1T11A 1KWMA 3QJPA 1ROFA 1W25A 3L4BC 3JAMY 3W8GA 2P9EA 3KWMA 2VG5B 4ZVUB 1WHYA 2HHXA 1N5YB 1TK8A 3D9BA 3JTPA 2A6OA 2VBWA 1VQYA 3M2RA 1VRUB 3VZHA 2PDAA 4YEAA 1M3GA 1WKJA 1GX6A 4HDHA 1L8KA 2DGQA 4ELTA 2YQ0A 1XMOJ 3L95X 3MUTP 3CCJS 5A2QY 4DI6A 1PA9A 2K1RB 4J91A 4Q8FA 4ZP9A 3NBPB 2FUG9 1XIQA 4Y00A 1HNIB 4XIUA 4URSA 3G71S 2ZDOA 3G82B 4ZVRB 2HURA 1NJWA 2MHEA 2QX0A 1HI1A 3M6UA 4N5SA 2I2YA 1VGYA 3W2WA 2AD9A 1UMJA 2M9KA 3SSRA 2B7BB 4MIAA 4ZPBA 1WHWA 3N5BA 2RS8A 2YWEA 3CM3A 1LK5A 1KC8T 1RAIB 1UZHA 2ZWOA 1NB7A 3LF0A 4K4YA 5KA9A 1R27B 1KN6A 2XCPA 2CJYB 4XO0A 3JQMA 3RZAA 1U0HA 3EUNA 2HQ3A 4HTIA 4U8VA 4LIWA 5A5EA 2BANB 4ID5A 4USHA 3QRPA 3POTA 2EEYA 2VF3A 2FLPA 2YNIB 3J80Y 2CVIA 4R0SA 2XC9A 4X2BA 1ECVA 5AWXA 3UCGA 1OETA 2KKHA 1C0TA 3MPUB 2H03A 1QAIA 2Z2LA 1CQNA 1X4DA 1KLMA 2I1RA 1TKZA 4M5MA 3CD7A 1IVZA 3AY0A 2K06A 1N33F 5F3TA 3G96A 5AE3A 1HHQA 2J16A 3N9UC 3LTOA 4GO7X 4USUA 5ETTA 3S6EA 3IS9A 2FQQB 3FGVA 1N32F 1FGSA 1TAUA 1NPRA 4USTA 4Y2IA 3IMQJ 4ZVPB 1F5BA 2NXCA 5A8WB 4MJKA 5U47A 2RNEA 3DMJA 3HHLB 2PE8A 1U1KA 4I64A 5J1EB 3OSPA 3N6LA 2HVEA 3FSXA 2HVLA 2X1GA 2G1DA 2RDDA 3CDAA 3G8QA 2ZFHA 4N8NA 1ICEB 5A0YA 4QAPA 1YFOA 2KN4A 4DR2J 5FJ4A 4XPCA 1FK9B 5KG4A 1G4WR 3M6XA 1EP4A 4PZVA 4W92B 4NCAA 3NEKA 1QM9A 3TVYA 2DCLA 3E01B 1DTQA 1RTJB 1OY8A 2DTJA 3TO8A 3KHGA 2P6XA 3F0NA 3KG1A 4OI4A 2ZH1A 1TUVA 1X9WA 4DU8A 2OUGA 1FX4A 2R8KA 5IBMA 1VC0A 3AQPA 3QFHA 3B7OA 2HBRB 2YKPA 3R8YA 4JI2J 5ITHA 3K7RA 2B4VA 4K0KJ 2EG2A 5D4LA 3HHKA 2I0XA 3BYRA 4HEA9 1Q1MA 3W9HA 3DI6A 3W9JA 3PW0A 2F1FA 3R97A 1S6OA 4A48A 3KMSA 1XC9A 5DQGA 1W7KA 1T0TV 4USIA 1V3AA 2OD4A 2BW2A 3PKMA 1RWNB 3MD3A 2KTQA 4JV5J 1TP7A 4NNDA 2W9CB 3QGPA 1WTBA 3BGUA 4RU2A 4DUYJ 1XM2A 4OX9J 1GMWD 3J7A1 1CULA 5AXMA 4RI4A 3MMJA 4PEOA 4Y65A 1Z4UA 4B3RF 5HO4A 2XYHB 1TL5A 1MMNA 3MTKA 3ZM6A 3PFEA 1R0AA 1P8GA 2DR6A 5C7PA 3PFOA 5GVQA 1QTMA 2UVWA 2ZM6J 3CF5Q 4I7FB 5CYQA 1WOOA 2AGQA 2HBQB 1AZSB 4F3QA 1OO0B 3QIDA 4B17A 1M5OC 1FDDA 1LEOA 4Y28C 4Y2MA 1TMJA 4HLBA 1PAEX 2HCMA 3BO2A 4LF5F 5E0OA 2BKPA 2VEWA 1V3RA 4ZIWA 1S0VA 4DMZA 3FKBA 1RT5B 3QCBA 3OJSA 5FLXU 4FF1A 2F8HA 4PWUA 4KV8B 3VVUA 1ZTWA 2R7QA 1H3DA 1TMMA 3CJ2A 2HW3A 1S59A 3W66A 3BV8A 2R2UA 2ZWPA 2IMOA 3SSQA 4RBVA 3D3CJ 4J9SA 1WI8A 3MCOA 3DOMB 3QJLA 3MEDA 1YPTA 2H54B 1S49A 2FDNA 5LMUF 3OSNA 4BLGA 2HNZA 5IXUA 2HRYA 3NGUA 2HAFA 3ISND 3P5TL 3ETOA 5C2CA 2ATCB 2XYGB 4CM0A 3KNAA 2CQBA 4DPOA 2GIRA 1SQGA 5M43A 4ILRA 2NUUG 1AUDA 3N2AA 3VAFA 2KXHA 4DQSA 1HBNB 2ZITA 3MM8A 1VRQC 2O5DA 4DQRA 2D3O1 4M5GA 1GNKA 4C48A 1HMVB 1HD1A 2DNYA 5IT4A 4J90A 2RHSB 4OLOA 2XULA 4WXOA 4USJC 3EAXA 2NSBA 4QJVA 3OL9A 1WKLA 2RD5C 3GONA 2RVJA 2X51A 4MT1A 3ZZTA 4CLUA 1X5TA 4MH8A 1RTHB 3KXDA 1Y11A 3QIPB 3M7VA 3NCPA 4HHJA 3IXQA 2DGSA 3MAQA 5L1JA 2M7SA 2FJXA 3ZC4A 2HLUA 1GT8A 4LFCF 2F6TA 4ZLLA 1OIAA 1M1KT 4LR7A 3THVA 2YKMB 5F0UA 2C3OA 5T7LA 2F9DA 2GC6A 2VA2A 2FB0A 2VKZG 2LP4A 2CQ1A 2NZ6A 1K47A 1UWBB 3PZPA 1RSCA 2V2QA 3WBZA 4UQGA 2Y0SD 3NOCA 4OYMA 3UN5A 1VCTA 2Y68A 2XHWA 4RLEA 5D78A 4IG3B 1G4CA 1P31A 1BE4A 5KFOA 1UAGA 1C1CB 4DQQA 2ZVSA 3H5UA 1KNZA 2RDJA 3GMGA 1JJHA 2VFSA 1YQHA 4EBCA 3G4SS 3D0HE 1WORA 4AE5A 2XY7A 4CLWA 1LW0A 2DEIA 3CC7S 3B4DA 2VL1A 1U6BA 5JJBA 2J6TA 1GXLA 2JFKA 1M5PC 4PVGA 1HWJA 1QE1A 3M8PB 4CZCA 1HD0A 3DRXA 2C3YA 1YG0A 4LFBJ 4ZVOB 1YBTA 5ETPA 3KDOA 2UVRA 3PW7A 1S9FA 4ZHRA 2HS4A 3OLAA 3QAUA 5KA4A 3MXHP 3KOAA 2WSEC 2UUPA 1E8CA 4IQMA 3I0SA 3PV8A 2RB7A 4WP8A 4K4VA 2IM2A 2ALZA 2L48A 4UT4A 4D3GA 1RA7A 3LP0A 3RAXA 1XXPA 2DBBA 2E1CA 4H4OA 1T48A 1RTDA 3HXMA 4KPYA 1ZETA 3PIOQ 1IQZA 1REVB 1HKAA 3G8SA 5J2QA 2BA9A 4K50A 2JC1A 4DSIA 1NJIT 3Q8UA 3QSIA 1RADB 1MU2B 3J81U 4DPTA 2OPPA 1BQNA 2A2DA 4Z7CA 5IV4A 2NXJA 2C46A 1HBOA 2MZJA 2DVIA 4NWBA 1O0PA 3D28A 2C7SA 1WNEA 1XBWA 3H59A 3EXYA 1VK8A 5KAKA 1Q78A 3HJFA 4D3RA 3CEDA 2VG7B 3A8IA 3T5LA 4ZOSA 3ZTOA 1N88A 3BR9A 4JMKA 3IFEA 5J2PA 2EVZA 2MTLA 4TYAA 4AL7A 4W4MA 4P2FA 3PX0A 2HHHF 2HWTA 4FXVA 4LQ3A 1FX2A 1WG5A 3FDSA
chains in the Genus database with same CATH topology
3PHEA 5KT3A 2RUGA 2ZOMA 2R8HA 4IFVB 5KTQA 2G13A 4OLPA 2PO4A 2MKKA 2D1CA 2H9ZA 2MZTA 2OH2A 4ZPDA 2UVVA 2OPQA 1ZC0A 4O3QA 4B9LA 1VQPS 2XLIA 2PI7A 4YDDB 5F8HA 4X4SA 4Q7AA 2HC1A 4DSEA 4NLOA 1JLNA 3MM6B 2DB1A 3SFGA 3I80A 1QSYA 1LWFA 2VFUA 6FD1A 2ZH9A 1N6QB 1VQOS 1WELA 2QSFA 5SZTA 2Q1LA 2IMWP 2V9WA 1WCHA 2QEPA 1Q6JA 2GCFA 4B3OA 1PC5A 2KZZA 3ENQA 1N4LA 5D77A 1CLFA 3ZZYA 2N7CA 1Q1KA 4K4XA 1FE4A 4WTYA 1W2IA 1M5VC 3O4UA 5K9WA 1SH0A 2Z4PA 2IFXA 3L3CA 1TR0A 2IM1A 2BGEA 2KVIA 2CM8A 2BANA 3QCGA 5KACA 2MJUA 4MYUA 2R7VA 4B9TA 4OZNA 3KK2B 2LMIA 3I0RA 1FXDA 2YKNB 3H4BA 4F4XA 2CJBA 2EW9A 2CPFA 1X4GA 4OHIA 4PG7A 2VPYB 5IQ6A 2EC0A 4FZVA 4QYZJ 1FHTA 4LF7F 4X66F 1F60B 1CEZA 1ZAVA 4GRYA 3NGDA 2MDAA 1KHVA 2VPZB 1QSSA 1RT1B 2VFVA 2FIUA 5DG9A 4B9SA 1NKBA 4FVCA 1R31A 1S1XB 4FF3A 4WCEQ 1R6HA 2W24A 3Q8PB 3BN4A 4A8XA 2CQHA 4ATNA 4IFYB 4IOCQ 1PGZA 1H6KX 3VAMA 2HFZA 2ZKTA 4DV5F 2DH7A 2EFPA 4F4KA 1JLCA 1GXTA 5I4MA 4YB7A 1T49A 2PMHA 3KMQA 2AYBA 2DNQA 4WOHA 1SIZA 2JX2A 5KT7A 3LP1B 4MFBB 1JLAA 2C3MA 3H4DA 4TVVA 3KK1A 5IQQA 1TKXA 3CD0A 4ZVGA 2KXFA 4MKAA 2QDMA 5LL6d 1FEEA 2CQ4A 5M2PA 4JBCA 3TRGA 4P6QA 3KLHB 4K4TA 4XDDA 1R8AA 2OOQA 3JB9k 1SJFA 2OIHA 1SIWB 4ECZA 4RW9A 3GXHA 2DITA 2NLKA 1LFWA 1JXEA 1M5SA 2BBEA 3FQLA 2UP1A 3HM9A 1VRTB 3FRZA 4Q0BB 3VQSA 3V6DB 1VQ9S 1Z2ZA 1CSJA 4RZRA 2CJKA 1KLNA 1J5EF 4R0JA 2R4FA 1D9AA 1VBZA 5F9LA 1R8PA 2GW8A 4YB6A 4BHQA 1VQKS 1DQ9A 1UVJA 3ICLA 3O44A 5DM6Q 1IBMF 1AROP 3N5FA 1R6YA 2RKIA 4OHLA 1B64A 2R7OA 4O4RA 4YY3F 2OD6A 2WGPA 5KA2A 1VQMS 5CQGA 3CD5A 3HX9A 3OR2B 4OZLA 1N0VC 5A8WA 2MQNA 1F0XA 2KXNB 1TL3A 1S6PA 4NCGB 1IN0A 1YJRA 4RW8B 3GIIA 2ROGA 1HQEB 1N5QA 1XERA 3HHLA 4ES2A 1C83A 3F9BA 3DYAB 5KT6A 2I5JB 2PD1A 3R5DA 3VCDA 3K59A 5J1EA 2AP6A 3MECB 1SJ4P 4WE1B 3VQTA 5DETA 4KQZA 2ROEA 4OL8A 2M8DB 5BX1A 2IRYA 3HHLD 4RW7A 2HQIA 3ZFVA 5K25A 4OHYA 3UW1A 2LXUA 2YNFB 3NP5A 2AGPA 2W25A 3CPWR 4A8FA 2QA4G 4IR9A 1QSLA 4X4NA 4TXSA 4QIFA 1C87A 1JB0C 3E8OA 2ZJQQ 3FVYA 2AF6A 1U49A 4WZMA 2YX1A 3DC2A 3PO5A 2L9NA 7FDRA 1Q8IA 3EGNA 4ES3A 2QEXS 2XNQA 1IXKA 3DLGB 4ZVHA 4KBIA 4HL9A 3D9CA 4NZ7A 4ICLB 2PI4A 2NQPA 4NLVA 4A8YA 1S6UA 2NS1B 3MEDB 2AYEA 2Y96A 4DSLA 4K5RA 1OSCA 2FHOB 4B9UA 3NRBA 3S3FA 1YJTA 2B4OA 4LSLB 1FK9A 3HVRA 4DLEA 2GO9A 4JI0F 1V3SA 2VBZA 2F6FA 2I1YA 4IH5A 1BQMB 1E6VB 2I6JA 4CO5A 3HHLC 2ZHBA 1O51A 1S1VB 4ZVFA 2WHOA 3AA9A 3OFFA 3OHBA 2W8KA 2CJZA 2GQ2A 3R5CA 3IAM9 1HBMB 2C3PA 4BCAA 4K4WA 2YWFA 3AB4B 3GR1A 3NS6A 4I6WA 4JI6F 5KFNA 4UY8T 2V8DA 2ZH3A 3GYXB 2ZNYA 2IC3A 2GHWA 2CQGA 3Q2TC 1FRXA 4G1IA 4O44A 4YUDA 3GILA 5KG2A 5KADA 3DOKA 2R2TA 3NAIA 3P3DA 2DNLA 2ZUGA 3E01A 3HKWA 3L7PA 4WU2A 1MROB 1HNVB 1D8YA 3H5SA 1JX4A