2B4PA

Structure of the d223n mutant of selenomonas ruminantium ptp-like phytase
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
314
structure length
314
Chain Sequence
MTVTEPVGSYARAERPQDFEGFVWRLDNDGKEALPRNFRTSADALRAPEKKFHLDAAYVPSREGMDALHISGSSAFTPAQLKNVAAKLREKTAGPIYDVDLRQESHGYLDGIPVSWYGERDWANLGKSQHEALADERHRLHAALHKTVYIAPLGKHKLPEGGEVRRVQKVQTEQEVAEAAGMRYFRIAATNHVWPTPENIDRFLAFYRTLPQDAWLHFHCEAGVGRTTAFMVMTDMLKNPSVSLKDILYRQHEIGGFYYGEFPIKTKDKDSWKTKYYREKIVMIEQFYRYVQENRADGYQTPWSVWLKSHPAKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords myo-inositol hexaphosphate phosphohydrolase
publication title Kinetic and structural analysis of a bacterial protein tyrosine phosphatase-like myo-inositol polyphosphatase.
pubmed doi rcsb
source organism Selenomonas ruminantium
total genus 107
structure length 314
sequence length 314
chains with identical sequence B
ec nomenclature ec 3.1.3.72: 5-phytase.
pdb deposition date 2005-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14566 PTPlike_phytase Inositol hexakisphosphate
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1690 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2b4pA01
3.90.190.10 Alpha Beta Alpha-Beta Complex Protein-Tyrosine Phosphatase; Chain A Protein tyrosine phosphatase superfamily 2b4pA02
5AWXA 2GWOA 3QCNA 1AAXA 1YPTA 2CJZA 3EMUA 1BZCA 1PA9A 2C46A 3V0FA 4DGPA 1J4XA 2Y96A 2CFVA 2CMCA 5KABA 2CM7A 1XM2A 4OHIA 4GE5A 4H34A 1FQ1A 4Z6BA 1D5RA 1EEOA 2HNPA 3BM8A 4HJQA 4OHDA 3AWGA 1KAVA 4Y2EA 2H04A 2OOQA 1C88A 3F99A 2FH7A 2HNQA 3ZMQA 1OEVA 1QZ0A 4JBCA 2CM2A 3ZM0A 2FJNA 2CM8A 3O4UA 2I4GA 4TVVA 2I6IA 5IBMA 3BLTA 1V3AA 1YN9A 2PI7A 4WOHA 5KA2A 2F71A 5BZZA 5K22A 1Q6SA 2OZ5A 5I6VA 3U96A 1C87A 1NWLA 2I6OA 2YDUA 2I6JA 1Q6JA 3NMEA 3OMHA 4WTYA 1G7FA 3D1HA 1ECVA 2M3VA 1R6HA 2QEPA 3QCMA 3LJ8A 4PYHA 3QCFA 2F46A 4DGXA 5IBSA 1T49A 2PBNA 4KYRA 2B3OA 3GXGA 2HXPA 2VEWA 3S3KA 1I9SA 1Q6PA 5EHPA 1LARA 3RGQA 3O4TA 4JMKA 2QBPA 4ZI4A 3V0GA 5K9VA 3RZ2A 4NYHA 5BX1A 1PTYA 2QBRA 4GFVA 3EAXA 1GFYA 1YTNA 1Q6MA 3CWEA 1BZHA 5KA1A 4HRFA 1I9TA 2CMAA 2CNEA 5KA8A 4GE2A 4R0TA 5LXQB 2BZLA 4J51A 2I3UA 1OHDA 1ZCKA 2RF6A 3QCIA 2CM3A 1C86A 2CNFA 2Q47A 5J8RA 4JMJA 2QBQA 2DXPA 3O5XA 4D3PA 4ERCA 2F6TA 2B4PA 1G1GA 2NV5A 1YGUA 1WCHA 3S3HA 1M3GA 1Q1MA 2A8BA 2I6PA 3QKPA 1G7GA 3S4EA 4S0GA 5M43A 3SR9A 4H1OA 5HDEA 1NO6A 2GP0A 2QCTA 1C85A 1PXHA 1ZC0A 2G6ZA 2H02A 3I7ZA 3S3EA 2P4DA 4GFUA 2IMGA 2B07A 3RO1A 2B4UA 2HY3A 1MKPA 4D3QA 2NTAA 2GJTA 2F6ZA 4NX8A 4QAPA 3ZM1A 2H4GA 4R30A 3H2XA 3D42A 4RHGA 1WRMA 4JNBA 1EENA 1C83A 1XXPA 3RGOA 1YFOA 1X24A 5KADA 1XXVA 2CNGA 2PT0A 3BLUA 2SHPA 4QUMA 2CNHA 3A5KA 4YR8B 4ICZA 2FJMA 2B49A 4RH5A 2F6VA 1RXDA 1Q6TA 5K25A 4QBWA 3GXHA 3QCLA 1T48A 1FPRA 2B4OA 1ZCLA 4WU2A 3MMJA 2QDPA 1QXKA 2I75A 1A5YA 4D3RA 4YAAA 4GS0A 3M4UA 4NNDA 4RI5A 4MBBA 4I8NA 1OEUA 1ONZA 2F6FA 3EB1A 3EU0A 1JF7A 5K23A 2HB1A 3A5JA 3QCKA 1G1HA 4RDDA 3B7OA 2J16A 3N0AA 1YZ4A 3F9AA 4PVGA 3QCCA 3ZM3A 3V0EA 1OHCA 3F81A 1NL9A 1U26A 1P15A 2Y2FA 4BJOA 4QUNA 2A3KA 2I3RA 1ZZWA 2ZN7A 4WU3A 1PH0A 2G59A 2H03A 3QKQA 3MOZA 3AWEA 1YWFA 3ZM2A 3V0JA 2F6WA 1U24A 1PYNA 2P6XA 3I36A 2BV5A 3D9CA 5KA7A 5KA3A 2ZMMA 1PA1A 2I6MA 2J17A 3ZMPA 1U25A 2I4HA 3O4SA 2HC2A 1WAXA 4GE6A 1KAKA 1YGRA 2VEUA 2H4VA 3F41A 1NNYA 2I42A 3QCEA 4NWFA 5MMZB 4QBEA 2NT7A 1OHEA 1LQFA 2WGPA 2QBSA 5KAAA 1PTVA 4ZN5A 4ZRTA 3QCJA 1L8KA 1YTWA 1T4JA 2R0BA 4GRYA 5EHRA 5KA4A 2I4EA 4B04A 4GWFA 4AZ1A 2OC3A 2PQ5A 4BPCA 5BUGA 1RPMA 2PA5A 2HCMA 2HC1A 1C84A 2PSZA 4KYQA 3AWFA 1OETA 2F70A 3PS5A 4RH9A 3V0HA 5KACA 4OHEA 1OEOX 4RKKA 1PTTA 1I57A 4Y14A 2J16B 2E0TA 3QCGA 3BRHA 3SMEA 2VEYA 2F6YA 3V0IA 3O3LA 3MOWA 4NWGA 4QAHA 2HVLA 2I1YA 2MBCA 2NZ6A 1PTUA 2H4KA 4GRZA 4IKCA 3D1QA 1LYVA 1ONYA 5K9WA 2JJDA 3I80A 3F9BA 2QDCA 2B4SA 1XBOA 2BGDA 2BGEA 3QCBA 3D1OA 2OUDA 1OESA 2QCJA 5BZXA 1SUGA 2I5XA 1Q6NA 3V0DA 3S3FA 3CM3A 1NZ7A 3D44A 2VEVA 1G4WR 3OLRA 3QCHA 1JLNA 1YTSA 3QCDA 1G4US 1OEMX 1VHRA 2ESBA 4HJPA 1BZJA 1XRIA 5K24A 2NLKA 2QDMA 3EZZA 4R0SA 2C7SA 4OHHA 5KA0A 1L8GA 4KI9A 1G1FA 2Q05A 5GTJA 2NT2A 5KA9A 3ZV2A 1FPZA 1NWEA 2CMBA 3S4OA 1GWZA 2CNIA 2BIJA 2AHSA 4OHLA 2AZRA 4RI4A 2VEXA
chains in the Genus database with same CATH superfamily
2RT3A 4HKQA 1Q8BA 3VZIA 3PVXA 3CMES 2CPHA 4F3OA 5ETMA 3W8PA 2KHDA 1AZSA 4FF1A 4ZCLA 2PFDA 5F0WA 4C8OA 1NAQA 4HLBA 3ETMA 4OI4A 4BDPA 1FK9A 5KABA 2OLWA 3US5A 1JLBB 1NUEA 3EGNA 2CXEA 2PMZD 4F8RA 3O44A 4K5RA 2AQ4A 2HIYA 3TA0A 1IKXA 2BMBA 3QATA 3K8VA 2Z56B 1TL7A 1D3WA 2GGPB 4I69A 2CJXB 3LQVA 3W60A 1IVZA 2UUTA 4FS2A 3BGRA 2GIQA 2OPSB 3KK3A 2CM2A 2WZ1A 3KJFB 3OHAA 1K44A 2YQ1A 4P71A 1UVJA 5LM7E 1TAQA 4X4VA 5D4PA 3M8PB 2HHUA 2QSFA 3I9V9 1TMJA 5HROA 1WSRA 4Z2XA 3OMHA 2Y9HA 4NYZA 4CO5A 1FJGF 1TVRA 2AGPA 4WFNQ 1KONA 4QIEA 2KL8A 3QCFA 1DARA 5D0EA 3M30B 3RR8A 3DOKB 2V8PA 5K8MA 5IM0B 3C6TA 3O4TA 4C97A 4L76A 4U67Q 3UDVA 4HDHA 2D3UA 3ZM6A 3GIJA 1FDDA 3CWEA 4NLSA 4C8KA 3CT9A 2DXEA 3BN7A 3NP5A 2OSQA 2ZDOA 2M88A 3VAHA 3PW5A 2I3UA 1RU1A 3UNYA 1PBUA 3NXZA 1DAXA 5J8RA 4IDKB 4M8LA 5H9FK 2YKAA 4DL5A 2H9ZA 5F3ZA 2W4PA 1T94A 1VBKA 2RS8A 1QM9A 3I31A 2E5GA 3JS9A 5B0AA 4JI8F 1RYSA 5KFXA 4I4BA 1FWPA 3I82A 1UZDA 2XZTB 2XTJP 3HULA 4QWCA 1NZ8A 1IKYB 4B3SF 4LR7A 4GKJJ 2F6ZA 4NX8A 4QAPA 5DM7Q 5I4MA 4G3IA 4NCBA 4ZP7A 5ETOA 2CNOB 4DS4A 1X24A 5J2QA 3WC0A 1SV5B 5H1SV 4JI5F 3TUIC 1VQ7S 3M2VA 2MZSA 2F3JA 4RLEA 4NLXA 5L8RC 1U48A 3QCLA 3L09A 4WU2A 2G2OA 5C25A 4MIWA 4YN3B 1IJEB 3HHLB 1HFEL 2DHGA 4KE5A 3J81Y 1VOMA 2WBMA 1JXVA 2ZM6J 4AYBD 1A0OB 3LGHA 3KYLA 3FUYA 3R7BB 3V81A 2BX6A 1G1HA 1NK6A 3BH6B 1FX2A 3QCCA 3ZM3A 3I56S 3O2IA 3HMJG 1S0NA 1NL9A 1IKWA 3KLGA 2ILYA 1PH0A 1HA1A 1OYEA 2FJEB 2XM3A 5L1KA 1MW7A 1KLMB 3AOCA 4RU9A 2HS4A 2DD8S 1VQ4S 2ZMMA 1U25A 2RRBA 1TL1B 3NRSA 3R2DJ 1RTZA 1KFSA 1TKDA 1ICEB 5J2NA 1S1UB 2DJWA 4JB8B 5KFMA 1RJJA 4HR2A 5RUBA 1KFDA 3H8YA 3OTEA 3W7BA 1IJFB 2GO8A 5EHRA 4ED8A 5BJRA 4H4KA 4NASA 3GG0A 3LPYA 1RGVA 1NHUA 3FEYB 2DHHA 1T3OA 5BR8F 1WHWA 2HCMA 2HC1A 3AAWB 2CVIA 4E8UA 4YY3F 3ZC4A 4OI2A 3DI6A 4RH9A 4JI4J 1FFGB 1MMNA 1A9NB 1RAIB 3QCGA 4FPRA 3QCZA 4UZCA 2V0NA 4DV1F 4F4XA 3EDRB 5KFAA 3MOWA 4NWGA 1URRA 1VQSA 2XZWA 2MBCA 1PTUA 5LSRA 1RAJA 1VQ9S 4NLVA 2DISA 1S99A 4EO6A 3P4UB 3NGKA 2BGEA 4USJC 1U0HB 2J6UA 1XMQJ 3IG1A 2IJNA 1LWFA 2M52A 3KK2B 5K8OA 3ZFVA 2VUGA 5KG0A 4F67A 4U8VA 4Y2IA 4V19J 2ALYB 4WKYA 1GK8A 1IN0A 1VJQA 2XLJA 1HD0A 4UOFA 2I5JA 2VORA 4EI2A 3IGVA 4KFBB 1Y0HA 3MPDA 3A13A 1JJCB 1HIYA 3DC2A 2B9EA 1FPZA 3NCPA 1KS2A 2OIHA 1PJ5A 4S0MA 3HN7A 2JH3A 3CTRA 1N5SA 3VAMA 4HH1A 4RI4A 4ZIYA 2NZCA 3GFHA 2KJWA 3PKMA 2GCAA 1NB7A 1DRZA 3HSDA 4LF2A 2PN6A 5FDLB 2XNQA 2L48A 2DIVA 4H34A 1LQ9A 2PGCA 3CD0A 2KYZA 4O44A 5AJ3F 2HQIA 3NBPB 3I9ZA 3W66A 4CLPA 2B4VA 4M5NA 4N8NA 2GA7A 4TY9A 1YK9A 3CJTA 2BJ8A 1B64A 2HZVA 1U02A 3IWXA 1R0AB 2FH7A 4CCHA 4LSLB 2YNGA 2WCXA 4I0WA 2ACYA 2NSBA 5KFHA 3BSOA 1ZBTA 1E6YB 3BDEA 3I0SB 3Q0AA 2PI7A 1X9MA 2BJEA 2OPRB 3WQPA 3LA0A 2OKQA 5HI7A 2GVDA 1JLQA 2HFZA 3OTBA 1HR0F 1Q6JA 3DU6A 4GKKJ 5F8MA 2HVDA 3OL6A 4YB7A 3BGLA 1SIWB 2VB6A 2XYGB 4R0JA 3VV2B 1RADB 4GVLA 3OUYB 2XQCA 3PY8A 5B7WA 1KHVA 4YOEA 2QBPA 3QSYB 5HQMA 2QBRA 5KFSA 2XYPB 4KIAA 4O4GA 2MZTA 3PCOB 5KA1A 3VZHA 1WI6A 2EG2A 4R0TA 1X4DA 3EGZA 4F4KA 2RF6A 1UW9A 1TL4A 3EGWB 3ITHA 2HHQA 3JTPA 3PEJA 1JLGA 2BKPA 1R7IA 4DL6A 1CJUB 3CJRA 2BXJA 5CA5A 3D6MB 2HG4A 1GFWB 3SR9A 1BXNA 1RWNB 3BH7B 2QCTA 5B09A 1YJ7A 4NLYA 1V6HA 4L72B 1HD1A 3RO1A 1AFIA 2B4UA 1QAYA 2VFUA 4D3QA 4KO0A 3SCLE 1VLOA 4NOHA 1FERA 3BSAA 2NTAA 2GMLA 2YNHA 4IKAA 5J2MA 3HFKA 4USVA 5A8RB 4LF7F 2RQ4A 4WFXA 3BQ0A 3OFEA 4ZP6A 5L39A 3UR0A 5A8KA 1GAOA 1SVDA 1Y11A 2FUG9 1EP4A 4U7UD 1DTQA 1WKKA 4DR2J 4OYAA 2H54B 2ZBPA 1FJCA 2B6AB 3CULA 1SCJB 1ZZNA 2GJ2A 4QUMA 1U6BA 3KHRA 2IJFA 3M2UA 3GONA 5C42B 4AUKA 4RW9B 2Y8YA 1W25A 2RIJA 1D8YA 1DLOA 1NPPA 4KPYA 2UVVA 3BR8A 3SZ2A 4WKRA 4ZIVA 2LLZA 4ZKAA 1R6VA 2MKKA 4HH0A 2HQDA 4LRDA 1UWBA 5CCLA 3T5LA 4O3SA 1DFDA 3PX6A 1X60A 4DL2A 1YZ4A 2IDLA 1TUGB 2GIRA 1RDRA 3UO0A 1U26A 4NLQA 4BWMA 1RHQB 2OPQA 4AT1B 1JLAB 4K2JA 1LNQA 4OJHA 2BRKA 2UUBJ 2G1DA 2QT7A 3GB0A 2R7VA 2E66A 4AXIA 2CQ0A 1S1XB 2VG5A 3VR1A 4RU2A 3W65A 2XNRA 4CH0S 1WAXA 2H4VA 3NRBA 3GU0A 4DL7A 2MHEA 4C3KA 1KBRA 3HVTB 1PTVA 3QIPB 4O3QA 4J9NA 4CO2A 4C7QA 4OJGA 2VHGA 4GWFA 3RRHA 3CE8A 1VISA 5CYJA 4EBEA 3I32A 2VONA 5LL6d 3PS5A 4Q0BA 3DRXA 1FJGJ 3J7A1 3MUMP 1C0TB 3BBFA 2IMWP 3EJMA 5GADU 2M8DB 3FCWA 1YZ6A 3Q83A 4QAHA 2E44A 3EXYA 1NH7A 2UXBJ 5I3UA 2CPYA 1Q95G 3PIOQ 2QFIA 2N7CA 2B3TB 3OR1A 4RKUC 3SV4A 3DOLA 1GQQA 3IBCB 3IMQJ 2YPZA 2EEYA 1R3NA 1I5OB 1NK0A 3BYPA 2IPOB 3ZTQA 4WYWA 3FBFA 3CCZA 3OLRA 4XK8C 4JI6F 2BJDA 3HJVA 1OEMX 4V19X 3PHEA 1BZJA 3OTOJ 2CQ2A 3CSKA 3D28A 4R0SA 4FBTA 4PABA 1U0SA 1RT2A 3T6BA 2V2QA 2WTZA 3MECB 1QAJA 3PR5B 3KNAA 3M9OB 3VALA 1GWZA 3BO3A 4NPOA 1PKUA 3MURP 1TP7A 4J7CA 3VQSA 4OV1A 4H4OA 1N5YB 5KFIA 1UEUA 2IMOA 2CQ3A 4ZPVR 4OZ0A 5HJYA 4B9UA 1IQZA 3U7JA 2J0SD 1JXEA 2K8GA 4I7FA 1JNZB 1XM2A 1RA6A 2L9WA 4DR4J 4JI5J 2J5AA 3OV7A 1B3TA 4Z6BA 3AD7C 2B8QA 3BSNA 2XHWA 3EUNA 2H1YA 2IVFB 6AT1B 3DRYA 2KVIA 3UVJA 4TKTA 3CD7A 2E1MC 1P8GA 2WW4A 3QO9A 5DGBA 4LVNP 3ZM0A 2UVUA 3C6UA 4LIRA 4ES1A 1GMUA 1XR5A 1H6KX 4M5DA 5GAHI 3O1LA 4ED6A 2YKNA 4F7VA 5A0YA 2K7KA 2VG6A 2YH1A 4CWBA 1HL6A 4ZVUB 3BGFA 1IBMF 1Q82T 2KT5A 1HQEB 3KG4A 2ATLA 4PCQA 3IRXA 2GHWA 2B9YA 4DX5A 3HXMA 2XSJA 3BQ1A 3RBXA 3RGQA 2VA3A 4TU7A 1REGX 4FZVA 1VRUB 1C0UB 3H4BA 1H2VZ 2CWXA 4DV0F 2CNEA 4I2PB 2VV5A 1YI2S 1ZYQA 4OX7A 2AD9A 4J51A 1OHDA 2OH2A 3QZ7A 3C2PA 2CM3A 1U45A 3MPWA 1WOSA 3PW7A 2NV5A 3S3HA 1KSPA 1S1VB 2YWHA 1OSDA 5GADI 2VOOA 4KSEB 4DN9A 2KI2A 3IBFB 4U96A 4CLKA 4DV7J 2P4DA 4URGA 1ZTWA 5HBMA 1UVIA 2A2CA 4HHJA 4DQSA 5F8GA 3K17A 1GT8A 4F25A 1KHWA 1LK7A 2WOMA 1LW0A 2RDIA 4QDIA 1VK3A 1RU2A 1CC7A 1B99A 1CQMA 2ZUGA 3MCOA 3UE2A 2OTLS 2VKRA 5IT0A 2VOSA 1KTQA 3RGOA 4ID8A 1FX4A 2LDIA 4ZVGA 4O3NA 1XXVA 2RQCA 1SL0A 1XNQJ 1UTAA 3UR3C 2F4VJ 1NMEB 1XBWA 2RHSB 3GIMA 3MAAB 5K25A 4AE5A 3Q8UA 4PR6A 3CUNA 3A12A 5CAAA 2PO4A 2R7UA 2NLWA 3KHGA 2RDDA 2MKSA 1PG5B 3AB2B 5K23A 5D4NA 4B9TA 3A5JA 1T9UA 1RKIA 1S0OA 2UXDJ 2G59A 3G71S 2BM0A 2N4CA 4I2QA 4RO0A 3Q8QB 4DSFA 3ENQA 5AJ3J 2Z2MA 2W2MP 3GIKA 2DNLA 2HLTA 4PYAA 4K7QA 1T0TV 3CIZA 1L3TA 4IUFA 4Y0FA 2A2DA 3UFCX 4JUZA 2ZC4A 6FDRA 3KLEB 3UW1A 3KXDA 1NNYA 1JX4A 3RBZA 4QBEA 2NT7A 2HIQA 1RWPB 4DX7A 1L8KA 2C28A 1N36F 4X4SA 1U6ZA 1X31C 4AZ1A 1QY7A 3T6JA 1F6TA 5EDWA 3PJXA 5BYRA 3VGVA 1M5VC 1FRLA 2WVCA 4BUCA 1HR0J 2F70A 3R5BA 3KDNA 2XWXA 3Q8VA 1R8CA 2AEFA 3FFIA 4KR0B 3SMEA 3W3SA 2XSFA 3QLHB 3KK1B 3SFGA 1X5SA 3TQ1A 4FPIA 4K8RA 4USWA 3JAMU 3I80A 1HQUA 5ADZA 1XBOA 2C3OA 1WEXA 2AU0A 2CFXA 4P74A 3RW7A 2I5XA 1YBAA 3HF5A 2RJZA 2W4DA 1QTMA 2HRUA 4JI1F 1RHJB 2R4FA 1JLFB 1S77D 4KJIA 3QCDA 3C8YA 3IP0A 3UWTA 2QZ8A 4J5OA 1BMQB 4CRJA 2JFKA 5KFLA 2QDMA 4RW7B 3EZZA 2FJBB 5ETRA 3U1NA 4YS2A 2OD6A 4USIA 1H2UX 1HBUA 5G4DA 4F2SA 1FGSA 4OHLA 1N6QB 3C16B 4J9LA 4LF7J 1FT8A 1R8PA 4OIXA 5CABA 2D3O1 2AKWB 2ADCA 3M2RB 1LWEA 2PMWA 5C2GA 1LV5A 2ZNYA 3TVYA 3HT3A 2YNIB 4CIOA 1SBRA 3L7UA 3TX8A 3CVKA 2C46A 2RUGA 3OJUA 2GVZA 3DM2B 5BXIA 1FNOA 4DV5J 1R0BG 1SH2A 2VQFF 4ZCMA 1ZOTA 4F4WA 2FHJD 2AW0A 5DQIA 1EEOA 1VRQC 2X1FA 3UPFA 3KLHA 4B9LA 2J7WA 2O5DA 4RW6B 1R43A 3P49B 5BYQA 2IY5B 5DDRC 1RTJB 2LA4A 1QZ0A 2DNHA 4IOBA 3LP2A 3VQTA 1VI7A 2LEBA 3BLTA 5KT3A 2ZJRQ 1V3AA 2E1AA 1X4FA 2JFFA 2RH3A 4UZBA 3PIPQ 1WF0A 2R7RA 4XPEA 4NWBA 2GAHC 3IR6B 3V6DB 1JLBA 2QC3A 3S8SA 1U8WA 4CTAB 2AJ0A 2LQJA 3QQCD 2VBXA 1RZMA 2AM2A 1REVB 4ECYA 1B4SA 1D0EA 2B5JB 4N76A 4DGXA 1R31A 2PBNA 2B8PA 2MJNA 2OPSA 2KM8B 5EHPA 1UMJA 1NDCA 5LJ3Y 4LREA 1T9XA 1BZHA 1I9TA 3M8PA 3HVWA 2APOA 3DYAA 2KTQA 4GE2A 1NJYA 4CLUA 2CNFA 2F7VA 2X5OA 4PWUA 2V69A 1G1GA 3DRSA 2VJVA 3GLJA 4LRAA 2QV6A 2WONA 3V4MA 2I6PA 1VQLS 3I5BA 4P52A 5M43A 4H1OA 2ZZTA 5IM0A 4DXLA 1YRUA 2IMGA 1QE1B 4DR5F 4PQAA 3K5MA 2FZCB 2KG0A 2ZH7A 4UQGA 5HVGA 4OHXA 2P6TA 1NSQA 4G1QB 4JNBA 4DV4F 3PRVA 4ED2A 2CNKB 3ZTOA 1ZZFA 1B7FA 2CQCA 4L3NA 1H72C 4RZRA 5HL7Q 1Q86T 2W01A 3VAIA 4KAIA 4EUVA 2RILA 2OELA 3QJLA 3CCWA 3MM8B 3W2WB 4ZVQB 4LR8A 2HQ3A 1ZCLA 3M32B 1A5YA 3KHLA 4LFCF 4DLEA 1HHTP 4ZP9A 3CCRS 2MGZA 3EU0A 1JF7A 3PRBA 5K5MA 1U7LA 1Y5IB 1F2GA 2DGUA 4LSNB 4HYKA 4ES3A 1Q53A 4OYIA 3FC9A 4TXSA 2RE1A 2GCFA 1CULB 1YWFA 2JLFA 3N2AA 2X1BA 5HLFB 4ZJOA 3D9CA 5KA3A 2KXFA 1YLXA 1WNEA 1XQIA 2I6MA 1GXTA 4OZLA 2EW9A 4RNHA 3M7VA 1YGRA 1JXLA 5C5JA 1FEHA 5IC4B 5MLCV 3QMQA 2W2OP 2MQPA 2OC3A 5EHHA 3T3FA 1DTTA 4FYXB 1T05B 3FQLA 1N56A 4LF9F 4B3OA 1U2CA 2PC6A 3TZZA 2VJUA 3AWFA 4J9QA 1IBMJ 1FJEB 5KACA 4IFVA 1KWMA 1PTTA 4QR1A 2VODA 2ZZNA 1CEZA 1TL1A 1TK8A 3Q22A 2DGOA 3V0IA 1S1UA 4P7TA 4GRZA 3ZO7A 3TEGA 4MYUA 1UEKA 1Q8LA 1NJIT 2OD4A 1ZETA 3NOCA 3PYZA 1WF2A 1N52B 2AEMA 1OS5A 3QCBA 3VF0B 2OUDA 4WWSA 4CQ1A 1PBAA 5IWAJ 5EWEA 1FVQA 4Q8EA 3CM3A 3C3LA 4ZPCA 1PYTA 1WDTA 2XMJA 3KLIA 5EUHA 5DZ6A 1SJFA 1HQ2A 1UVNA 2XMMA 2ESBA 3B6BA 1KVKA 5IQ6A 1LFWA 3MF5A 1S76D 2XEXA 1FTRA 4KI9A 1IQTA 4ZLLA 1XMOF 4BUBA 4C8YA 1XWLA 1U0HA 3CCJS 2BIJA 1S6UA 2BANB 2E5IA 8AT1B 1CJTB 3P3DA 3H7HB 3H59A 2OAUA 4CH7A 2LXIA 2Y96A 2PI5A 3HSZA 4K5SA 4OYWA 4ZVEA 3VVTA 3I55S 4ERDA 2C2EA 4OL8A 1T8EA 4GE5A 3DCAA 1DJ0A 5DETA 4KFBA 1NKBA 2PA3A 3O8WA 1T02A 3GJQB 1L3SA 3T1YF 5KG6A 4ECSA 1P1TA 2R8IA 5KFFA 2DHXA 4NLPA 3DDIA 1YG0A 1GMWD 2LP4A 1F0XA 3D7SB 1RAEB 1RT6B 2VQEF 1IBCB 4YB1P 2ZJPQ 3R5AA 1YRXA 1HWLA 2JC1A 3D4JA 3NNCA 1Q6SA 5I6VA 3IAS9 3KMSA 3FBBA 2I6OA 3GILA 1QTNB 3SDEA 2YXLA 4J9OA 4HHUA 3NBPA 2AJ1A 2XLKA 1S4FA 1H2TZ 1X4CA 4ZK7M 2FB0A 3IXQA 1R0AA 2EWHA 4DV3F 2HXPA 4PZVA 3A8KA 4I67A 2Y68A 5KG2A 4HV4A 2W9AA 5CD4H 3K58A 4YR0A 4ZCKA 2CNLB 3NGDA 1UCNA 4CYUA 2C1EB 2V4RA 3CJKB 3SSSA 4WE1A 2V9KA 1PAEX 2FYXA 5E3QA 1VCTA 4ZLJA 4WIQA 5KT2A 3GZ7A 3DMJB 1N0VC 2QL9B 1M5KC 2VC0A 4B3MF 3DOMA 4U7UK 1C85A 1IWAA 4OYPA 5B0DA 2GW8A 9RUBA 2ALZA 4CM0A 4MKYA 2HY3A 2ASDA 5CH7B 3D6TB 3PEHA 1KEKA 1TAUA 2B0GA 1YGYA 4NCGB 5B08A 2ACMA 4EBDA 2V4QA 1J5EF 1RAFB 1FRXA 2V4JB 3LP0B 3MXHP 4OI0A 4K4YA 4J90A 4AQYJ 1XXPA 1YFOA 2IJRA 1PILA 1UA1A 1Q81T 1FO1A 3ETOA 3PRDA 4TY8B 2BDPA 2ZE2B 1WEZA 2D1CA 3A3PB 4P2MA 2NCKL 5JUMA 4YR8B 5E7OB 1IKVB 2FJMA 5DG7A 2DBBA 2B49A 1N0UA 4R5PA 2QIFA 4DFKA 3K7RA 4N7TA 2V50A 5IS2A 4NLUA 1AA1B 3MAQA 1EAYC 4L73A 4OX9J 4TQRA 3GYGA 2YQ3A 1O6XA 5A8WB 1ITPA 1YVFA 2VD3A 5AE3A 3IA0A 2CVEA 1UL3A 1SKRA 2F1FA 3X3UA 2B6AA 3MM6B 5KT5A 3IS9A 1SXLA 1VFJA 4C11A 5C42A 2Y2FA 3ZTRA 4LIWA 2ZN7A 4ZP8A 2CJYB 4ILMA 2FLOA 2R7OA 3DLHA 2LCWA 5IT4A 4CLLA 3V2UC 2QLJB 2GS8A 4HI2A 2CDQA 3RZAA 2YTCA 2I4HA 2VH7A 3MEEA 4TQSA 4I56A 4X4QA 1Q8KA 2EBGA 1FDNA 3V4IB 2AIRB 2P9GA 4FXDA 5D3GA 1FNXH 2E1CA 1QJHA 2WTFA 3CCES 3OR2A 4FYVB 1HKAA 1RT3B 4DCJB 2MYFA 1JLAA 5IFMA 5LSOA 2QL7B 2PA5A 1WELA 4CH1A 1C84A 1XC9A 1Q5YA 3K5LA 1S1XA 2VZ9A 2CADA 4MK7A 4Y00A 3BRHA 5F3TA 4DOZA 4J9PA 4ZA1A 3T5HA 2HVLA 1SC1B 1CPZA 3HVTA 3NS6A 4C48A 4ED0A 2EFPA 2Q66A 1YBTA 3POTA 2IA0A 3QIPA 1CS4B 4GVBB 2ZEJA 2BR0A 1IWGA 2W24A 5E33A 5K14B 3F9BA 2O3DA 3T5KA 2VA2A 3Q89A 4NLOA 3HVAA 4BWJA 1VR6A 1AROP 1X0FA 1C0TA 2AJQA 4RW8B 3PYEA 4PPDA 1AXQA 1NJZA 4LQ3A 1Q7LB 2CNNB 5ETNA 4ZN1A 1WC0A 4X4UA 2J9EA 4IH7A 2FDNA 4FF2A 3TO8A 4KH1B 2XY5A 2DTJA 4RR5A 3BM7A 4X4RA 3BB5A 3QGPA 1KRPA 3EZUA 4B3TJ 3OVAA 5KT6A 2OJ3A 1UAWA 5A76A 2I8EA 4X62F 3QRPA 3MMBB 2HPUA 4QIGA 1KQFB 3HSJA 5GAEI 2XY7A 4RBVA 4A8WA 2G9OA 3MR6A 4NA2A 1WHVA 3MECA 3QT5A 1KLNA 3FK4A 3EX7B 2FY1A 1HYSB 4Y2EA 2H04A 5CYQB 2DNQA 3GPAA 1LOUA 4LFCJ 3JSYA 2FJNA 3KFWX 4PWDB 3WDOA 1ROFA 1NM2A 5CD4A 1TK0A 4JI0J 1CJKB 1YN9A 1FRKA 3B4MA 1H98A 4B17A 1VS3A 2XMKA 3J7ZT 4DV2J 4N8OA 3H2LA 1WC6A 3D5MA 2PI4A 2R2RA 4UT4A 2IRYA 1NNDA 3I5AA 4EZ6A 1T49A 3GXGA 3SBMA 3S7RA 3HX9A 5DLGA 4B9NA 1RTDA 1JMTA 4KHRA 2AEJA 2W9CB 3R7SB 1IBLJ 1NU4A 1Q6MA 3HDSA 4AXJA 2PFFB 2MQLA 5CQGA 4E2FB 1IBKF 4B9SA 2OPPB 4OZ2A 1F2HA 2RF2B 3PW2A 4ED7A 4KRWA 3CJSA 3MM9A 1S7HA 2IBKA 4D3PA 4LF9J 2A6OA 1X4GA 5L1LA 2FGCA 2DEJA 1WORA 3CIMA 3HFVA 2HK2A 2DR9A 1SJQA 4FYDA 1VRUA 3CXCR 4LF6F 1MKPA 2ROGA 2GJTA 1FRHA 4ICLB 2KDOA 1M0SA 1RQ0A 3MPUB 2BJ7A 3OW2R 4K59A 4HL9A 3UI3A 2G0JA 1PC4A 1FTCA 1WRMA 1TU0B 1VC0A 2RRAA 5AXMA 1Y3KA 3D6HB 2Z0GA 2FJDB 1JLEA 1S72S 1Y3JA 3OFFA 1NHVA 3R5DA 1JBWA 1KVIA 3A5KA 1RWWB 2G0CA 2W9BA 4QW8A 3MCNA 2W2NP 4U9RA 2DNNA 1YX2A 2HAFA 3KTQA 3WX8A 2KT3A 2RAQA 1XMOJ 1TELA 4YAAA 3SQOP 3FCVA 4LSZB 3M4UA 2DH9A 2C3YA 1U2FA 4W92B 4C12A 2HB1A 3B7OA 3DNCA 2E7XA 3F9AA 4LFAJ 2O1PA 4QU7A 2J9DE 4IH6A 5E3PA 4FBUA 2RHQB 3GR0A 3LGNA 4C8MA 2BBEA 2DY1A 5A2QU 4P10A 1G1XA 2CWKA 2MLZA 3BBBA 3L4BC 1U24A 3UD5A 3RYLA 1RHUB 1WDDA 4UAGA 5KA7A 1T9TA 1BHNA 4P7VA 1YJUA 2E5LF 3T1HF 3J81j 3K57A 4HEA9 2DGWA 1ZAWA 1HNIB 2WSCC 3QCEA 4NWFA 1OHEA 1FESA 5L38A 2VQEJ 2AT1B 2HNYB 4XO0A 4GRYA 2DNKA 1N5VA 1X4EA 2I4EA 4C9DA 3C14A 2FHOB 4DQRA 2GMHA 5A6PA 1X4AA 3JXOA 4LBHA 4P72A 1QUPA 2NQPA 4RKKA 2IAJA 4RUBA 2OFHX 1PSDA 2COLA 4PXBA 1HWJA 4AD6A 4DV3J 8ATCB 2UZAA 2MHNA 3NAHA 4KV8B 2R8HA 1HI0P 4EZ9A 3PV8A 1IXKA 1UEVA 2XHCA 5GMKa 1LYVA 2DO0A 4PRFA 2NPIA 1HPZB 3E3XA 3VGUA 1NLKL 1SIZA 3OTDA 4WFAQ 4X4OA 4K4XA 1GX6A 1SKWA 4Y28C 2VICA 5EWFA 4A8MP 3GV5B 1J5OA 3MMCA 2GHPA 3NAIA 3ICLA 3U02A 4B3MJ 2NREA 1K0TA 4G1PA 3KK1A 2NLKA 8RUCA 5EWGA 1IR0A 2WSFC 4PXDA 1BY9A 5L9XA 4A8OA 2KHCA 1N88A 5CYMA 3GIRA 3E01B 3MZIA 4LF5J 4PKDB 2VEXA 4C0HA 4QPXA 1W78A 2Z2YB 3CPWR 2DR8A 3W9IA 3RW6A 1JLFA 4PUOB 1U47A 3QYYA 5G0RA 2ZKUA 5KFUA 4DS5A 2GX8A 5HANA 4EMDA 4RW7A 1Q5VA 2QN6B 2MY8A 3BKTA 3PYDA 1JJ4A 1VQPS 1JLCB 1KAVA 2HVHA 2NXEA 2OOQA 4PQUB 4Y34A 1C88A 2ERRA 1N6QA 4F36A 2HNQA 2AGOA 4P6QA 1RXOB 3HHEA 4RNNA 1C1BA 2CM8A 3O4UA 5GMEA 4FNHA 4DUZJ 1NXIA 1YHQS 1FFWB 4ALZA 2L08A 5IC6B 3SEOA 3NGRA 2F71A 5F41A 3U96A 2MEWA 1NWLA 2P9CA 2XB2D 4EEYA 1FKOA 1R8AA 3W61A 2DITA 2FIUA 4ECQA 1FDAA 2C2OB 2IDEA 2L41A 1SC6A 3F56A 4O3OA 1N5TA 2RUSA 1RTJA 1FK9B 1ZTTA 2PEHA 3M8WA 5KFYA 4YR3A 4DF4A 4PG4A 3EAXA 1G3OA 1GFYA 3DN9A 1GX5A 1JKHB 5KA8A 2IFXA 2OTJS 2DPIA 4WBFA 1E0DA 3QGGA 1R8HA 5KG3A 3THVA 2EPIA 3I0RB 3BGRB 1XEZA 1VQOS 3QT7A 1Q8IA 1UVKA 4DWIA 1UP1A 2ZOGA 3G8TA 5HVHA 2OMLA 3CDAA 3I6PA 5KAKA 5KG5A 4YHHF 3VAKA 1WACA 2OEKA 1FFSB 3FBEA 4RUHA 1W7WA 2LXUA 3V6HA 4CT9A 2CPXA 1SQEA 1TVRB 4ZPBA 2P5VA 4R30A 2IVYA 4QIWD 1WSVA 3D68A 3G6VA 1EENA 3V6KA 1N4LA 2ASLA 4M5GA 5DRKA 4ZVOB 4DPOA 3MAHA 2PT0A 1MMLA 2RU3A 4LVOP 1GTEA 4ECUA 1PYOB 3R1LA 4Q5VA 2CZVC 4RH5A 1QE1A 2V8DA 1ULRA 1RT1A 2FLNA 3B4DA 3K89A 2FJXA 3R97A 2A18A 1OYDA 3RB3A 2ADBA 4G1QA 4PWWA 5DS7A 5C7PA 3IM9A 1ONZA 3HHKA 1BE4A 4CO3A 2YWKA 2M70A 3UCUP 3CJ4A 2J16A 4QWAA 3J7YI 4RW4B 4JV5J 4PVGA 1CBKA 1EX8A 2RS2A 3AOAA 4F26A 4I6AA 2CQHA 4ZLPA 3W2WA 2UVWA 4G1IA 4K50A 4KQZA 2A10A 4PYDA 3M32A 2KB2A 3PNIA 1QVGR 5J2QB 9ATCB 3R9LA 3MEDB 2X51A 2RKIA 1NDPA 3HI9A 1TV6B 3L3CA 5KAAA 2QBSA 4CO0A 3FQKA 4WK3A 5HMWA 1FRJA 4OYOA 4F4YA 3EM1A 1T4JA 1HNZJ 2H51B 4Q2MA 4BPCA 3DFEA 2GQ2A 1UFWA 3DXSX 1NO8A 1FD8A 1M1GA 3VHQA 4RWWA 5HLFA 3MD3A 1OETA 2ZH1A 2KN4A 5HMZA 4WFBQ 3TJ9A 2E0TA 1TL3B 2HEKA 2F6YA 2WW8A 2HQGA 1WC4A 1VQ5S 1X8DA 3KLGB 2HS3A 4CP5A 3RJMB 4C4WA 4P73A 2R2UA 1JB0C 2DNMA 2ZBRA 1DQ9A 1ONYA 4OZ5A 3W62A 5MAOA 1KQGB 2DCLA 1T05A 4AL5A 2BQ3A 1MN7A 4WTOB 4WFZA 3D1OA 3KJVA 5AXLA 3IAM9 4U95A 5J2NB 2MY7A 3EVOA 3AD8C 3IBWA 4FYYB 4HHHA 2BV3A 1ZM4A 4BHQA 1VQ8S 4O3PA 5DM6Q 2F00A 1QDUB 2Q6CA 2VFSA 2WB1D 3KMQA 3ISNC 2FJWA 4C0BA 2H3EB 2CJAA 1L8GA 3FDSA 3DI6B 3C15A 1RWOB 1YDLA 2CMBA 4NRTA 1FWLA 4LJMA 3UAGA 3L7PA 4K4TA 3QCNA 5KFKA 3SXLA 5J1EB 3EMUA 2ZC3A 1NZAA 1YWXA 2RQMA 5I3QA 4F0HA 2U2FA 1YIJS 4DGPA 2JX2A 3L7OA 2UUAF 5E5NA 1RBAA 3NGTA 1SI9A 3DLKA 3OLBA 1V3SA 1FQ1A 3CDWA 2W8LA 3IG1B 2WSEC 1C4AA 2HWHA 1LWFB 2CJKA 1RAGB 2JLEA 2ZVIA 4OHDA 3BN4A 2VASA 2CZ4A 1UJ5A 3ENWA 4USMA 5HSPA 2NUUG 1FVSA 4O0IA 4O3RA 1BQMB 3F99A 2BANA 4OMFG 3S1TA 5IV3A 5KFGA 1HNXJ 1S79A 3KLFB 3A1YG 1RUSA 3WIUA 3DLGA 5KFEA 3IO1A 4DL4A 5KOWA 5BZZA 2KFZA 5JVHQ 2OZ5A 2FC8A 4NXNJ 2OHDA 2MKYA 4NCAA 3HP6A 1ZA2B 5SUHA 2QEPA 4J9UE 2ZWOA 3AXKA 2AJFE 2ZHOA 1HHSA 3KUHA 4I6YA 1EARA 4RBTA 2GIFA 2DHAA 3GWCA 4CLFA 4JMKA 1EZZB 5IT9U 2B51A 2DB1A 4B02A 3EPGA 3G6XA 3HFZB 4HRFA 1EEHA 2HHPA 1GMVA 2HZCA 4NMLA 2HSEB 5LXQB 1K1QA 1RAOA 1PYSB 2LA6A 3G82B 5KFBA 5FJ4A 2IM1A 1F3FA 1SQGA 4ZVHA 3QT6A 1NK5A 3VAFA 4ZN3A 3S4EA 5CXTA 4IG3B 3KJNB 1ZC0A 3TA1A 2J0XA 1VLYA 2Z8QA 1S4EA 2GVDB 1JLQB 4NMXA 3RBDA 2VOPA 4L75A 1PIEA 4O4RA 1RLDA 1DURA 2C2ZB 3IFEA 4NX9A 3SV3A 3ZM1A 2CKWA 5KFCA 3FEZA 4MFBA 5B0EA 1RE1B 1TKTB 1U1LA 2KVQE 3DMJA 4BLGA 1ZAXA 1NDLA 2M4MA 4LF4F 2XCAA 1CQNA 4O4GB 2ZH9A 3PFEA 3HT0A 4BBYA 3LAMA 5KFZA 4KGKA 3ITHB 1KR4A 3GV7B 4ZOSA 4NCGA 4B9MA 2IRUA 2KZMA 2VDHA 4D3RA 2DNOA 2V4JA 4HTJA 3LP0A 3TAMB 2UXCF 4TYBA 4NLRA 1BWEA 2LVWA 2R2SA 2FHMA 5GAGI 1HLWA 4I1TA 1UPPA 1HNWF 1SUQA 3N0AA 2XS2A 3ILIA 4PG7A 1TKZA 2ZE2A 3CGIA 4QIVA 2YNHB 3HKZD 5J2MB 4ED5A 3D6FB 4ZLNA 3R2CJ 4QR2A 2R7QA 2MSSA 2YQ0A 5T7LB 2DYAA 4NI2A 4X66F 3QKQA 3RB0A 3MOZA 3AWEA 3FBCA 1DTQB 2BV5A 2H5EA 2XI2A 1VBYA 4A8KA 1Q0NA 2QSWA 3ZMPA 2E9ZA 4DUTA 3M2UB 1QSSA 2G4BA 3P45B 1FKPB 2W2PP 2JOQA 2FVQA 2VTDA 3RR7A 2BQRA 4ZPDA 1VIXA 2GJFA 3HHDA 2QO3A 4ZS6A 2AYGA 2Z30B 4DMZA 4KYQA 2CZ9A 2D3OR 4KBIA 2UV8A 1CJVB 2VG7A 1UWBB 2W7OA 2GC5A 3ZZYA 1I1GA 1HHQA 4DG1A 2XYHB 3Q23A 3KHHA 1PGZA 1AW0A 4EWTA 3BZQA 1S9EB 1PCAA 4ED4A 1VBXA 4K4WA 4WF9Q 2HNDB 1I94J 2EC2A 3AQOA 4A8FA 4OHZA 1RT3A 1FEEA 3MR5A 1F3VA 4KGZB 1OO0B 1NSKL 5BZXA 3JSMB 1F5AA 1Q6NA 3ZZZA 2AX0A 3JSBA 3MEKA 2WJPA 2HBZB 3EE3A 3OSPA 1G4US 3LP1A 3HHLC 1VK8A 1HNVA 4ZVSB 1H74A 4KB7A 1CS4A 5KA0A 4GVBA 4YHHJ 4M5LA 1UVLA 3CJ5A 3M9MB 5K14A 3A8JA 5KA9A 3AJDA 2LEAA 1P9YA 4MTPA 4EYHB 3BGOP 3WBZA 2CPDA 1AAXA 1WC5A 1EJ7L 4KHPF 2HMIB 2CJZA 5CZXA 1M5HA 2CQPA 5ETQA 4IFYB 1V5IB 5I3UB 2JVRA 1U2RA 5KFNA 4W90B 4FDFA 5K9FA 3VTIA 4HVZA 3OR1B 1MU2B 4XAKA 1VQYA 4DR1F 2KZZA 3RUBL 3VGSA 2G2YA 2A1BA 3NWRA 2XMVA 2I1RA 3Q8RB 1T9WA 5KFJA 4DL3A 3EVMA 3D0IE 3KNGA 1H7WA 2UP1A 3UDEA 1RT2B 2C2NA 5DO2A 2J76E 4WOHA 1WKJA 1SJ3P 2HHXA 4UY85 2DNZA 1SB6A 3GYXB 3W9HA 3G86A 1AFJA 3MWBA 4QWEA 1RT4B 1E6VA 1HYSA 3UDCA 2EFOA 1V3RA 1UA0A 5CYQA 4I6WA 3F44A 4IO9Q 3BKFA 2JC0A 4ETXA 2VEWA 4I7FB 1I9SA 3JYTB 2DGQA 2LDYA 2ZJQQ 1UFLA 5D15A 4X84A 3GMGA 2B56A 2CPJA 4OJ3A 3AJ2A 4J91A 3H42A 1UW4A 2HWTA 5GAHU 2M0GB 1Z1ZA 2ZM6F 5E0OA 4QPTA 4C98A 4X64F 3UVJB 1S6QB 1C1CA 4KY3A 2ABYA 1XIQA 1M1HA 2N7YA 3C6UB 3KDOA 2E7VA 1Q1MA 3QKPA 3PKYA 3CF5Q 4FYWB 3MM7A 5A0YB 1NO6A 2GP0A 1RWMB 1S5ZA 4QWDA 3SMZA 3FSXA 2M7SA 4M5IA 4CLYA 1FXDA 2R8KA 1FDBA 2OPPA 3IRXB 4E98A 2RF2A 3T41A 1WD6A 2XSJB 2PMHA 3PO5A 1NK9A 2WVBA 2EC0A 4DV6F 5DZ7A 4DL0C 2CNGA 3NCQA 1MNEA 3A8EA 1RWXB 3JQKA 1TK5A 2HWIA 1RBOB 3ZNUA 4RJVA 2I0XA 2HVEA 1EHWA 2F6VA 4C8LA 3TUZC 4B9VA 3PJWA 4JI4F 4CLZA 2YKOA 1FI4A 3MMJA 4ICLA 2QDPA 1TUVA 4HT5A 2BJ9A 2DRDA 1WJ9A 1AUDA 1T03A 4I8NA 3FGVA 2MB0B 1RWKB 4YDXA 1ACMB 2UV8G 3HKWA 3QCKA 4DQQA 2V2ZA 3THPA 2BE9B 3GE9A 4X4PA 3AJ1A 1FHTA 3F81A 2DR6A 2UUAJ 4JI8J 1RCOB 2I2YA 2QG9B 4M1KA 2QMXA 3PM9A 2GC6A 1UKUA 2RMLA 3KG0A 3N4WA 2F6WA 3TUPA 2HNZA 3P6YC 3J7AN 3CNQP 2CPFA 4B3SJ 4ANCA 3Q8SB 4A8QA 2ZITA 2A6MA 4QQBA 1CLFA 2HC2A 3RAXA 1RCXB 4GE6A 4A47A 2NYHA 4YMEA 1NCLA 3FEXB 2RU9A 4WYLA 3T19A 1XN9A 1GH8A 2ZHBA 3LK7A 2YH0A 3PDNA 3WHIA 1S97A 4LBIA 2MQQA 2PQ5A 2F4FA 2DNGA 2EVZA 5F9NA 5BUGA 3M6XA 4ZHRB 1RP5A 3NL0A 5J1NA 4M5MA 5A6WA 2GQQA 4DHVA 3DRPB 4FKYA 2EKNA 3W5XA 2G0IA 1HNIA 2XG8A 2HHHF 2I1YA 1VHFA 4A4JA 2R3VA 2NSCA 4KGVB 1V3ZA 4I2QB 2GC8A 4CVMA 4OZJA 2HNYA 5ITHA 1B0PA 2VTEA 4I68A 5CHCB 2BGDA 3I4HX 3X1LB 1K73T 4LBPA 1GG4A 5KFWA 2WVEA 3QJPA 3V0DA 2YKQA 4RWXA 3JSRA 3N79A 1VHRA 3RB4A 1TKXB 2V94A 2M2BA 4GKKF 3UN3A 3M05A 1D1UA 4KV8A 3N5BA 1KTVA 1AUSL 3MTJA 3OXGA 1UVMA 1NWEA 3N6MA 1N54B 1GQYA 3FFIB 2MZJA 1FXRA 2CNIA 3ISZA 3UN5A 2CDRB 5L1JA 2J0QD 4PPZA 5A5EA 5BR8J 4PG5A 1L5UA 2XMAA 3CJ0A 3EDQB 4OHVA 2BM1A 4YR2A 4YY3J 1PA9A 3AD9C 4NEZA 1J4XA 1RYRA 2Y0SD 1P9QC 3MMAA 4DV1J 2VFTA 2PD1A 3TOQA 2RQKA 2AYBA 3BV8A 4MH8A 1SQFA 2GJIA 3OBIA 3AWGA 2QA4S 3U1MA 1RA7A 1HBMB 2SXLA 4QOTA 3E01A 5IZHA 3T5JA 3BKUA 2J6SA 4K4ZA 3CW2C 4WZQA 4TVVA 2M8HA 2P9EA 2GO9A 2LMIA 3VAJA 3SSQA 1SPBP 2Z58B 4PUOA 3HK2A 2DH7A 1X9WA 4ID5A 5T41A 2AZ1A 3G2XA 2HURA 1E8CA 2DR7A 4EK2A 3H98A 4I64A 4DZDA 3GCXP 1KVJA 3LPEA 1R6YA 1JLCA 3TUJC 5HP1A 2F5GA 4PQUA 4IR9A 4ES2A 2Z2LA 4DR7F 5M2PA 2GVZB 4FXVA 3SYZA 2V8VA 3I87A 3RZ2A 1TQLA 2ZVSA 1W26A 1W2IA 1OQ6A 3J81U 3K0JA 4OZ1A 3HO1A 4M63A 4BS2A 3ILLA 2YKMA 1U09A 1U6FA 4K2XA 2VFRA 4JMJA 3O5XA 1YITS 2V8HA 2M5YA 3LP2B 3L9ZA 3SCKE 2OMOA 3FMWA 2A8BA 4GMKA 2DR5A 1U1PA 4UOGA 1ELOA 2YWWA 4OLPA 4LF8F 2H02A 5HO4A 3I7ZA 2OSRA 2OFGX 4JV1A 5CCMA 2JDJA 2B07A 4WP3A 2UUBF 3L95X 2MTLA 1S9GA 1JKHA 4QF5A 2YY3A 2ZWPA 4ECXA 2BE2B 3BO2A 3EICA 1NBEB 2YNFA 2LU1A 3RB6A 3I0RA 4JV2A 3WX4A 4R8UB 4DR6F 3PW4A 1C83A 1J6UA 2D41A 4KT0C 4YUDA 3S6EA 4IR1A 2R42A 2ZBCA 1AT1B 4KTQA 2SHPA 3DYAB 1RTHA 3KOAA 3MEGA 2IRXA 3J80Y 2OEMA 2JHEA 1K0VA 1T48A 4Q45A 3DRSB 3G8QA 2WONB 1Y5NB 3H2UB 2OGUA 3M1VA 4ELVA 2Y0BB 2UXBF 3R27A 2MLXA 3DGPB 2F6FA 1S57A 2CJ9A 4KHPJ 4J9MA 2IM3A 6FD1A 2QJ3A 4QUNA 4WU3A 1SKUB 2HLUA 2VPWB 1WHXA 5EX3A 4LFBF 3ZM2A 2MZQA 4NL5A 5J2PA 4DR1J 5D0GA 1RTIB 4ECTA 3OTOF 3MCMA 5KG7A 2YBVA 2ZZMA 1LQFA 2WGPA 2XZDB 1YRTA 4RW4A 1YTWA 2R0BA 4DDFA 1LW2A 3N6LA 3HHLD 3PACA 1X4HA 1U1NA 5D8HB 1RPMA 1GXLA 3PHTA 3P96A 4W4MA 2MGZB 4IG0A 2R7XA 3QAEA 5F9LA 2W7PA 3PZPA 1FNMA 5F0UA 3KUGA 3R1HA 3W2VA 4DR4F 4OYBA 3SSRA 3MEDA 4LT6A 4DR3F 2IYGA 1VIOA 3ZL8A 1TV6A 2D9PA 3OVSA 1TMMA 2H4KA 3GR1A 3D1QA 4Y2KA 1DZ5A 1N34F 3D2WA 3KUEA 5FLXY 2I6WA 3EZOA 3VGTA 1WKLA 2AYEA 4G6VB 4X64J 1OESA 1OJ4A 3PO4A 2XS7A 3K5OA 2JLGA 2GGPA 1TL3A 2CQBA 2DH8A 4MT1A 1RHRB 2I9SA 1VRTB 2ZFHA 2GQCA 1LWXA 5K24A 4EFAC 1DTTB 4NZ0A 4B3OB 2JEIA 3IRWP 2ZH4A 1Y4ZB 2YWFA 3D66A 1K47A 1HBOB 2DIUA 1JNRB 4IFVB 1TFWA 4XDDA 4OYZA 4CNZA 4O0NA 2AHSA 2NZ4A 5AWXA 2O66A 1D9FA 3M8YA 2VU5A 4TLRA 3EMTA 4Q8FA 1L3VA 3CWJA 1TTHB 2MKJA 3LOUA 2PE8A 3DLJA 3M30A 3DOKA 1P1LA 4DV6J 2K06A 4IQXA 4O23A 2HKEA 4OHIA 2YKPA 1H73A 3Q24A 3MCSA 5KFQA 3LUYA 2HNPA 3BM8A 4HJQA 2W4CA 3GFZA 5DLFA 5F8LA 2C3UA 3K5PA 3KLIB 1Z4UA 1G4CA 4C2MA 4DV7F 4NLDA 1XMBA 4UQTA 4IDKA 3JAMY 1OEVA 3A3OB 5J1EA 4JBCA 3R5GA 2Q6BA 2I4GA 3RRKA 4TLQA 3EYZA 3AA8A 3SQGB 2UAGA 1PJ7A 2ZD1B 3SIPB 3ULHA 5K22A 3ET6B 4DU8A 3C66A 4DPWA 3V5RA 4ECWA 2J9CA 4JI6J 2XPCA 2GFFA 3TVZA 3RU0A 4NEYA 2DXDA 2XY6A 1IKYA 1M5OC 4TVAB 2LQ9A 1R6HA 2HAIA 1XNQF 2G1HA 3GJRB 4P2XA 1BQMA 2FHKA 4F4AA 2F4VF 3QAUA 2WK4A 2QEXS 5HJXA 2VPXB 1LARA 1WOPA 2J7KA 3KLFA 1SJRA 3RG6A 4TU9A 3W5YA 2ZHAA 1SV5A 3UDLA 3ZZRA 2HQFA 1UPMB 4DSEA 1A6LA 3ZTPA 2CQDA 4ELTA 2QBQA 2FVSA 4IRCA 3HHNB 3HHLA 2UXDF 1J2VA 2BACA 2LFVA 2QMUB 3MGJA 1Y10A 4ZVRB 3TZWA 4LRFA 3DXBA 3PX0A 1N48A 3SDEB 1WI8A 2HHHJ 1SJ4P 4WFYA 1M90T 2HFSA 4Z7CA 2K3IA 3EWGA 3MD1A 2H4GA 2FLPA 1BQNB 1QVFR 2J0WA 4P75A 5D4LA 3G82A 1NPKA 2X3GA 3ZXWA 4CM2A 1KLMA 3ZZ0A 4Y65A 2FLLA 2IIHA 2YX1A 3AHPA 4OLOA 4ED1A 4IG3A 3ZZOA 4CYUB 2BKOA 4ICZA 3PG9A 4WE1B 4RPFA 3H0PA 3BDPA 4IYQA 3EZ5A 4NXMF 5IV4A 2DRBA 4ANEA 4DV0J 4OX8A 3DOMB 5D77A 4M95A 3K59A 4NNDA 1TKTA 1OEUA 3G6YA 2KFYA 2EXUA 2MZ1A 2XJAA 2V6AA 3GQCA 4Q43A 3E2EA 4HTIA 1JWWA 4YEAA 4LRCA 2FJAB 2LECA 3BO4A 2IA6A 3OTCA 1PJ6A 1VJWA 4ZPTR 1UWAA 4F50A 2KM8C 2C42A 1MSWD 3OVBA 4CI0B 3V0JA 4ER8A 4U6PA 3TARA 4ATNA 3TAMA 3KK2A 4N47A 3DHXA 2I42A 4FP9A 2J8AA 4WPAA 2F8HA 3VVUA 4OV6A 4R5PB 4ZN5A 4ZRTA 3GSIA 4CZCA 3CDEA 3MR3A 1K9MT 2P6SA 4CVLA 5T7LA 3MHYA 3ONQA 3PJ9A 1R27B 4ILRA 3DU5A 1HMVB 4OHEA 1OEOX 2KYXA 3SFUA 4JOUA 4DV5F 1WC1A 3R6GB 3AT1B 3IS9B 4C11B 3E51A 1OQ3A 4DR7J 5I42B 1FKPA 4DZ6A 2V67A 1T3NA 2KH9A 2MXYA 4N41A 4OYXA 4KGXB 5KG4A 2WRMA 5FDLA 4OZ3A 3CJ2A 1MMDA 3D0HE 1OIAA 4AFFA 3PXGa 3MEEB 2QCJA 1S48A 4MK8A 2O01C 1CJVA 3WZ0A 3DHWC 5D3GB 2VEVA 1NPRA 2NXJA 5AXNA 4LSLA 3OR2B 1S9EA 4FKXA 1E6YA 1C4CA 4LF8J 5HATA 1RT7B 1N33F 2HNDA 1U8SA 3I0SA 3TJAA 3W8GA 2OPRA 1N36J 4DF8A 3DLEB 2HFNA 1FCAA 3G87A 1MROB 3JSMA 2XO6A 2CQ4A 1C2PA 2RVJA 4LQ9A 2CQGA 4DR6J 2Z57B 3POTB 4WJBA 2C2KB 2Q79A 4MKBA 3OUYA 2UUWA 2XMWA 3TW0A 3M8ZA 4KPCA 4L3KA 1VMBA 3R8YA 1RLCL 4U7CA 1D9DA 3OXLA 4E0DA 1WC3A 2C2RA 1LEOA 2WVDA 2QRRA 2AZ3A 2EFGA 5DDQC 3FJ2A 2EFVA 4EO8A 2UVRA 5F8IA 1JK9B 1RT5B 3HSGA 4ZCIA 3ZMQA 1IM4A 2EKYA 2HMIA 2VBYA 1CJUA 2FTRA 4IFYA 4XPCA 4RNMA 4Y2CA 2GNKA 2NPFA 4JI1J 1NB2A 1C87A 1MU2A 2MKIA 1R89A 2JJ4D 2ZNZA 3LWLA 4DX6A 4DLGA 5GAEU 1NRKA 1S1TB 1S6OA 1X0PA 3TR5A 1J27A 4LFBJ 5D6GA 5A8RA 1APSA 2KJVA 2JFGA 3GCWP 2XWYA 4DSKA 1FE0A 4C8ZA 3BS9A 1FXLA 1UZHA 4ZI4A 3V0GA 1YZ7A 1IR1A 1H0HB 1JJHA 3OHBA 3CCLS 2CMAA 2B7BB 1Y00A 3TYTA 3MFIA 4NE9C 4A48A 4RW9A 2YX7A 3P5TL 3OQ2A 1VQMS 1RT4A 4JV0A 4MAKA 4K4UA 2V2KA 2XLIA 4F3MA 2VQFJ 1VQKS 4IOCQ 2DXFA 2E29A 3H25A 4FF4A 1OMSA 2ZDPA 4RUCA 1NK7A 2XS5A 4C8NA 3JYTA 2AX1A 3S3EA 4DR3J 2JFDA 4GFUA 4DSIA 1BD6A 3CD6S 2BUNA 3FNNA 1Q4RA 2KO1A 4WZMA 4ZITA 4BCAA 3BF4A 3HPOA 1D09B 4ENOA 4Z7YA 1N34J 2BRLA 1NK4A 3BQ2A 1QSYA 3D42A 1S6QA 2XMTA 2Y1LB 1U1MA 3FRZA 1N5QA 4ZVTB 1RTDB 2XO7A 2LXFA 2U1AA 4YFUA 4UUWA 2Y1JA 1N32F 1XNRF 4CT8A 3FRYA 2QMWA 3M6WA 4NLWA 1FD2A 2HRYA 3ZTSA 2D3ZA 4ECZA 2JRSA 4F4ZA 5J1PA 3UQSA 1RXDA 4W98A 3MM9B 5HMXA 1X5TA 3TA2A 2GZOA 2VDIA 3J80U 1PO6A 2OP5A 4WXOA 2Y1RI 1FF2A 3NKYA 1RAAB 4MBBA 4NLTA 1DY3A 4P9SA 4QYZJ 2N3LA 1EETB 4DU7A 3V0EA 5F8JA 4J9SA 1GXUA 4WIIA 4BJOA 2BE7D 2KRBA 1O0PA 5IWAF 2V2VA 1TR0A 1S6PB 1XK8A 1R8BA 5T14A 4NA1A 2QL5B 2MKCA 3MR7A 3I36A 4DR5J 2YWGA 5HVFA 1JLEB 1S7IA 1LXJA 2R2TA 2C3PA 3AODA 3PX4A 2IBOA 1ZPWX 3ZZPA 3IWNC 5DG8A 3LANA 2W9BB 3QGHA 5AE2A 4DV4J 2RSQA 1XTZA 2EFNA 4WP8A 1YJNS 2L9NA 5GVQA 4JP8A 4NLGA 4J9VA 1M1KT 4B3RF 2JL9A 3DRRB 2PSZA 2FD2A 2N3OA 4ED3A 3V0HA 3AH6A 4OJ1A 3IM8A 2MPUA 1BGXT 5LOQA 2D74B 1KN6A 3N9UC 3FCHA 1S1WB 1N5YA 2FY8A 1B0VA 3TJ8A 2XMUA 2F8MA 1HW9A 5K9WA 2LQ8A 3QRQA 3TANA 2DKOB 4ZHRA 4USTA 3NCRA 5H9EJ 4HDGA 1X5PA 5FLXU 2H5JB 2ZH5A 2DNYA 3DRPA 4XIUA 5KT4A 3BPSP 3E8OA 4D3GA 2F9DA 3NLCA 2WB4A 1RI7A 2MKHA 3C14B 4UTGA 4L6V3 1XRIA 5LSLA 2A0FB 3QWPA 5GMDA 4URSA 3GJTB 2IM2A 5LT5A 3CCSS 3G9CA 3ZV2A 1K1SA 2FVPA 3EGVA 1WG4A 2KT2A 1P6TA 2IAJB 3M8QB 3TRGA 3MM5B 2LKZA 1S9FA 2GWOA 3DDKA 2F65A 2F40A 1HQEA 2BW2A 2OUGA 4AL7A 2HQCA 3V0FA 1VHIA 2CPIA 3MUTP 2CFVA 1TKXA 2CM7A 2UUCF 2A3JA 3ZZUA 4F04B 1I6JA 2I38A 1C0UA 3TNVA 3B78A 3U1LA 5L1IA 2DEIA 2H4WB 1X4BA 2HK3A 3MDFA 4I2PA 5ETKA 4JI3F 1J5OB 4NXMJ 1RBLA 2KRRA 3MMCB 1CC8A 3WC2A 4XDCA 3QIDA 5IBMA 4H54A 4G65A 1S1VA 5I3PA 1Q79A 2AGQA 4A8XA 5KA2A 4JI7F 4ETZA 4FXWA 5CYMB 2MSTA 5KFDA 2YDUA 4AQYF 4JI2F 3UCGA 4DSLA 3FZBA 4WTYA 2QLFB 1Z2ZA 1F60B 4C13A 2G2ZA 1HBMA 3NS7B 1JBVA 3KWMA 3OLAA 4RBUA 5G0RB 3TWZA 2POKA 1S12A 2J6TA 1TZ0A 1R0CB 1O51A 4NYHA 1NK8A 2FC9A 3HLUA 2VPZB 2K7JA 1NSPA 4H4MB 3R5JB 2Q43A 3THTA 3QSIA 3U27A 4OX9F 3W5ZA 5B0CA 2DPJA 4Y3CA 3MAAA 2HBRB 2LYVA 2K2PA 2B4PA 1C1BB 3ADAC 1W7KA 3QFHA 3T1YJ 3NEKA 4FVMA 4F0KA 1WF1A 3BGUA 5C24B 2CUYA 5B0FA 4ECVA 3O6QA 2ZKTA 4D3HA 1FKOB 4KKOB 3LWMA 2AJ2A 3B8HA 2V5HG 2GMJA 1WG1A 1SC4B 2CRLA 4DQIA 4TN2A 5L46A 2E9RX 1MWZA 2FPHX 2HHWA 5SZTA 2R7SA 3MOJB 3H2VE 4OI6A 3D3BJ 4GO7X 5KFPA 4MIBA 3KLEA 2CNHA 1IUJA 1NH8A 1XR6A 2HFOA 1SC3B 1LKZA 4ITSA 1F9EB 4KGMA 5DG9A 3MPVA 3BSCA 1HW8A 1RAHB 4N5SA 1N33J 5LMNF 1TUWA 1SL1A 2BE2A 3ENAA 2I75A 4M5KA 1B0TA 1D9AA 3W64A 2P2CB 2K1RB 4R8UA 3S01A 4N56A 5IQQA 4DPTA 2MJUA 3P8BB 2JWNA 3CDUA 3EB1A 4HACB 2VKZG 5KOXA 4ZMMA 1S0VA 2HHTA 2IC3B 2P8IA 3IR5B 1GEHA 1M5SA 3UD3P 2CYYA 3QLHA 1VBZA 4J9RA 1MWQA 2DNPA 1NKEA 3M4XA 1EQMA 5FIIA 1PYNA 2P6XA 2BVZA 1F5BA 1FE4A 2QTWA 3EPIA 1LK5A 1PA1A 2NS1B 1J5EJ 3BREA 2H4YB 2VEUA 3DGPA 5MMZB 1WHYA 3D3CJ 2J8SA 1SJ1A 2IYIA 5M2RA 3NMRA 1RT1B 3UNGC 4X65F 3J7YU 2ZBQA 4B3TF 4B04A 1LWCB 2DT9A 4K0KF 2AHOB 2ROPA 4Q44A 4OI3A 2V8GA 3M6UA 2HS0A 3QT8A 2Q3PA 4ZVPB 3A4TA 3I5CA 1I57A 4Y14A 2J16B 1RTIA 3C16A 3O3LA 4Y2AA 3N28A 3M2RA 3EVWA 2NZ6A 3I4PA 2YNIA 3UN2A 4IKCA 2X1GA 2DRAA 1UAGA 3Q8PB 3DM2A 1HBNB 2B4SA 4NYOA 2HGMA 2KXHA 4DN0A 1KD1T 4R25A 2BABA 4KH0B 1SUGA 2RKIB 2UU9F 3LGMA 1NSAA 2V63A 4JI0F 2CQIA 1XERA 4WK1A 3QZ8A 1AZSB 1NZ7A 4C3MA 4RW6A 3D9BA 2ASJA 3NWGA 5A2QY 1YTSA 2VIHA 3TEHB 1OWXA 4DV2F 1AYEA 1CG2A 3Q8YA 1BC6A 2E5JA 4OHHA 4HT7A 4XTTA 3B82A 5GTJA 3CB4A 3R6LB 4UUXA 1IKXB 2VFVA 3V6DA 1TL7B 4UW2A 4USUA 3CO0P 4CTAA 2FHJA 3OT9A 2FZGB 1REVA 3KK3B 2L9DA 1IBLF 1BZCA 2Y8WA 3G6ES 2B5JA 5IXUA 2M9KA 1Q1KA 4YB6A 2EBEA 3BJYA 4IRKA 1N32J 2L3MA 1VRTA 3KJQB 1XNRJ 1AB8A 5HROB 3QBCA 2CIMA 2LEPA 2W1BA 3H5XA 3KKFA 1RISA 4F02A 1D5RA 2FVCA 3KJVB 5A5FA 3NS5A 2R8GA 2V68A 3PFOA 2EI5A 1HBOA 3DKDA 2XI3A 2ROEA 5IOLA 2IVMA 4J37A 4OZNA 3CMAS 2CG4A 1NEEA 3C6TB 2XBPA 4Z37A 4QZVB 2W7AA 2I6IA 4IH5A 2NYIA 2KXNB 2D7SA 3NGSA 3GP9A 4CNYA 4B08A 3GV8B 3C15B 5KT7A 4FS1A 2OEJA 1YJWS 4X2BA 3ELHA 4CDIA 4K4VA 3ILJA 3NMEA 2BKNA 1G7FA 1YSJA 2QLWA 3GTYX 2M3VA 1UETA 2DGTA 1NHKL 3BYRA 3CCMS 4KYRA 3LAKA 3Q2TC 2Y3YA 2B3OA 2GCBA 2BJ1A 2CAJA 1H38A 3JTNA 4DX8H 3NY0A 3IN5A 3GJSB 1S0MA 3DLKB 2C22A 2H65B 2WHOA 5BX1A 5E3AA 1PTYA 3SQGA 1UJ4A 4ZVFA 1FRIA 2ZD1A 4X62J 3VCDA 3ET6A 2AF6A 3GG1A 3TZXA 4CLTA 1ZCKA 3MM8A 1F9HA 2RDJA 4DEZA 4ZDNA 2KU7A 2DXPA 3JQJA 3OPKA 2B43A 4B3RJ 1OY9A 1T9VA 2Y1OA 2F9JA 1MLAA 4Q7AA 3JB9k 4JYAF 4LFAF 4EU0A 1ZM3A 3DLGB 3FVYA 2BOAA 4S0GA 1MG7A 3D0GE 1PAUB 4DPYA 3OL7A 3QRRA 3M2VB 4X4NA 2G6ZA 1HARA 1QD1A 5JJBA 2WAQD 3PYGA 3GFYA 4LSNA 5D0HA 4YDDB 1ZS6A 5C25B 1W2BR 2ZH3A 1CULA 2R8JA 2R7TA 3M8RA 2J9DA 4ZJQA 3MUVP 5LXYA 1RK8A 3H5SA 3V81B 5H9FJ 2D69A 4MK9A 2DY9A 2HHVA 1WWHA 1U49A 3V6JA 3VAGA 2RB7A 3UCZP 4OI1A 1FKAF 3RAQA 1IKWB 3HCXA 4ZJLA 1S49A 1Q6TA 3GXHA 1FPRA 2VPYB 1QXKA 1BQNA 3OL9A 2Y66A 2DK2A 1YTYA 2QA1A 1IBKJ 4A46A 4RI5A 3TAQA 4FNIA 2X7IA 2HRTA 2ZH2A 2OO4A 3SCIE 2V34A 4Y2MA 2JVOA 4ANDA 1F9FA 2EK6A 2CPZA 3QFWA 2I3RA 4DPXA 5F8HA 4YQWA 4MFBB 2UUCJ 1FRMA 4EBCA 3ZM5A 4PEOA 4ELUA 4LF6J 1OY8A 5HAOA 1L3UA 3QWUA 2QA2A 1JQGA 1YJ9S 1Q16B 2QX0A 4PAAA 3GYNA 4YB5A 2J17A 3O4SA 4JI3J 4MMOA 4ILLA 3TX0A 5EGYA 3DLLQ 4CO4A 2FGOA 4HI1A 2BZ2A 3CC7S 5GAGU 1K8AT 3OXFA 3CJ3A 3P5BP 3KG1A 5E3RA 1VQ6S 1VC6A 4LF5F 4DUYF 2DNRA 4WP9A 3R7NB 4DFMA 4KHMA 2AP6A 4JI7J 4JI2J 3HZEA 2VC1A 5F8NA 5ETLA 1YKWA 3MVNA 3NNHA 1SUQB 4NRUA 1U1OA 4AL6A 1TKZB 2E9TA 2JZ5A 2I5JB 3AB4B 1Y9OA 7FD1A 1CJTA 4M5HA 5AT1B 1RSCA 4NI2B 5LMUF 2BJ3A 2DHSA 3CDBA 4OQJA 2ZBIA 5E2QA 2MLYA 5D78A 1DQ8A 5ETSA 1H3DA 3FMBA 4DFPA 4DUZF 1HMVA 1DBDA 3S3FA 1YJVA 5THWA 1S59A 2HBYB 3QCHA 1JLNA 1PC5A 4NZ7A 2F8EX 4QIFA 1ZH5A 5I42A 1O5ZA 2E5LJ 2XGPA 3T1HJ 4HJPA 1NJWA 2DO4A 1RT6A 2HGNA 3OFHA 3OL8A 4O44B 4F2RA 1G1FA 3T9NA 2Q05A 4FVCA 4UY8T 5B0GA 2VG7B 3S4OA 1RKJA 2NUHA 5K8NA 4DG1B 3D54A 4LUBA 2YNGB 4X4TA 1WTBA 3K8WA 1YPTA 4GC7A 4CLSA 3NOGA 4CVKA 1U1RA 2QYGA 5E3CA 4USKA 1GMWA 2PIIA 2CMCA 1SKSA 1SL2A 3O5TB 1G6BA 3CMQA 3TI0A 1RT7A 2M3DA 2ZUAA 5JVGQ 2BEFA 1B7YB 3DLEA 3CD5A 4LMZA 2E7WA 3CJKA 2GV1A 1V5VA 5LMNJ 2C2MB 2HVZA 1XR7A 5HN0A 1MROA 2R7WA 2MQNA 1U1QA 3DDNA 2CQ1A 3LP1B 4DPUA 2FJVA 3B54A 1HNVB 5HK4A 3W9JA 2EK1A 2C3MA 5ETTA 1HWIA 4RL1A 2BOPA 2PA8D 3Q2SC 5BYSA 1Q78A 3MI7X 1FJ7A 1JLGB 3D1HA 1ECVA 3I96A 2VBWA 4TU8A 3QCMA 3LJ8A 4DJBA 4PYHA 2FZKB 1EQ0A 2CA9A 3F73A 1RT5A 3HVRA 2MZRA 4UOHA 1GNKA 3CCTA 2DVIA 4ECRA 1Q6PA 4GRSA 3IR7B 2HYIB 1NKCA 5K9VA 1EKRA 4KC5A 4TY8A 4TYAA 2HGLA 5EX0A 2YX4A 4KO0B 5K8PA 2BZLA 4X65J 2EFQA 4FF3A 1IKVA 1UFKA 3Q86A 5KFTA 4H4KC 4MKAA 5HQ8A 5A8KB 1T7PA 1S1TA 2FVRA 2H48B 4K0KJ 1BWVA 1EP4B 4JV5F 3RTVA 1WCHA 1P3DA 1VYAA 2CPEA 4DCOB 4P2FA 1F5CA 3BEGB 2G13A 4KYZA 5A8WA 1KNZA 1NDKA 1ZM2A 3PW0A 3WIVA 1WUUA 1DLOB 3MM6A 3H5UA 1E6VB 4OFZA 1S10A 5DJBA 1RHMB 1NJXA 4K4SA 1QAXA 4QYZK 1I3OB 1BQXA 4RHGA 4F3QA 4DSJA 2HZAA 3NG8A 1HNZF 3DGVA 2UU9J 2D9OA 2NR0A 5ETVA 2HHSA 2LU2A 3BLUA 1GQEA 2DGSA 4RNOA 4OYMA 2GHVC 2QGFB 2RRNA 2GAGC 3TP2A 2OPQB 3V4IA 1U4BA 2W8KA 2RD5C 3N01A 4ZPWR 1URNA 1C1CB 2JFHA 4QBWA 2J7UA 2VF3A 5KFOA 3BPDA 5IT9Y 1CVJA 2QLBB 3CJ8A 2E5HA 2VG5B 3MM7B 4LRBA 5JMNA 7FDRA 1O5JA 3D67A 3QGIA 4A8SA 1RABB 4QJVA 2LQBA 4Y6IA 2QE5A 2FQQB 1P15A 3GFXA 2MQMA 1HWKA 1KDNA 3MTKA 2XCPA 1ZZWA 1XJWB 4MKVA 2HBQB 1HI8A 3LW5C 3OJSA 3N0VA 4LF1A 4IRDA 1KQKA 2N82B 2B9XA 4Q0BB 3BBCA 3H20A 3QJJA 3LALA 4LR9A 4IOAQ 1EIYB 1JJ2R 3AOBA 2XGQA 3CC4S 2F63A 5KFVA 3F41A 4BC9A 3RRGA 4ZPAA 2YWEA 4QYRA 5HQLA 2W25A 3KLVA 2YPYA 5EN1A 1EETA 1VC5A 2WBRA 3QCJA 4RW8A 2H5IB 4J9KA 2UUOA 3LTOA 3OSNA 5H9EK 5AE1A 2AWZA 3DOLB 1QUVA 1T03B 1S6PA 4PXCA 4F0MA 2KFNA 4DQPA 2KG1A 4DI6A 3CO9A 2JEGA 3RBEA 2VEYA 1P31A 5KFRA 3W63A 4PXEA 2CJQA 3AQPA 1Z2LA 2O67A 2R9LA 2JEJA 4GKJF 2AV5A 3MMBA 3C19A 2JJDA 2HNZB 3HJFA 5K20B 2QDCA 1RACB 1RHKB 5CZVA 1TFYA 4IQMA 1X5OA 1HNXF 3DRRA 3IGNA 1FA0A 4H4OB 3LH2S 1G7CB 1FWKA 1ZM9A 4R0EA 3SI8A 2W2QP 3ZNJ1 1G4WR 3QNWB 2HW3A 4NXNF 4JYAJ 3FKBA 4DCPB 1S1WA 2YVSA 1KQSR 4PWDA 2MDAA 4MYTA 1CJKA 4C6AA 1IR2A 4TNOA 3RAMA 1ZAVA 1YJRA 3M8SA 2HVIA 3QPIA 1G2EA 3F0NA 4U8YA 3LF0A 3QO9B 3H4DA 2Z4PA 2V9WA 2AJ4A 4L74A 3FSIA 5AXKA 4M5DB 2YKNB 1LXNA 3IC1A 1T9YA 3HD2A 3TZYA 4DFJA 2VG6B 1WEYA 3OFGA 1SH0A 2LQ5A 2W9CA 1OSCA 2VBZA 1A7GE 4USHA 2MMYA 1KC8T 3GIIA 3H40A 2JSXA 2XC9A 3CCQS 3M8QA 1VQNS 2X3DA 3MM5A 1QSLA 2ZOFA 4WXWA 1MWYA 4QW9A 3JTOA 3DLBA 1TL5A 2HFVA 3RGIA 1P27B 3BR9A 1KKHA 1WTFA 1QAIA 3M6VA 4OHWA 3UD4P 2JEFA 2MQ8A 4OHYA 1RB0A 3OD2A 1YQHA 1WOOA 3TAPA 3PYFA 4EGLA 2I6JA 1YJTA 2BYCA 3CCUS 4V1Ak 3LO3A 2CG8A 1D8ZA 1WG5A 4WCEQ 2RNEA 2JNJA 2E1PA 2F46A 4DBQA 2C2DA 5IBSA 1VDHA 1JIHA 3S3KA 1HI1A 1X9SA 3AA9A 5KTQA 2NXNA 5FD1A 1DQAA 3N5FA 3MMAB 1MN9A 2B9WA 5HBMB 4GFVA 1KP6A 3AXMA 3CJQA 1YTNA 5B0BA 2ZH6A 3G4SS 2AM1A 2WOMB 1LW0B 4MJKA 1XMQF 5KG1A 2WVFA 1EKSA 3QCIA 1C86A 2Q47A 2AMCB 4DUYJ 2PEBA 1OY6A 2Y67A 3IWLA 4ERCA 4CLWA 2F6TA 2NXUA 4QBUA 1YGUA 5DQHA 3K5NA 1M3GA 2DCUB 2OI2A 1EB0A 4UF4A 2QYCA 5D4OA 1G7GA 1CSJA 3PTWA 3A3NB 5HDEA 5U47A 3HM9A 4ID5B 3M9NB 2BQUA 1PXHA 1U1KA 1V9OA 4P2SA 2QFJA 3J7Z5 1YBUA 3EXCX 1N8RT 4PG6A 2QLXA 4H4MA 5LMUJ 5HP1B 1H7XA 5DQGA 3H2XA 4GO5X 3ISND 4NYPA 2XULA 2PDAA 3GSDA 4FN5A 4GC6A 1KOHA 5KADA 1IM6A 4ZIWA 1OPIA 4QWBA 3TVKA 2HFUA 5C24A 3G8SA 2NXCA 3NGUA 2MQOA 3JQMA 2ILZA 2ZOMA 4CO1A 3VWSA 3AFGA 3SCJE 2YKMB 4KKOA 1UJ6A 2BA9A 4N77A 3TQEA 3G96A 2B4OA 3R3TA 4BC7A 4OX6A 2Y1IA 2KKHA 3MPYA 1I51B 4GS0A 5LXRA 3ILOA 3ZZTA 3H5YA 3NMAA 3MR2A 4M94A 1I94F 5C2CA 1KOOA 3R5CA 4RDDA 5DGAA 1RWUA 4EYIB 2CJBA 2K3KA 1S9GB 4QU6A 1OHCA 1ZA1B 5JXSA 1VGYA 2A3KA 3H90A 3HD1A 1SH3A 2H03A 2YNFB 1O8BA 5DDOC 4QCLA 1L3KA 1HPZA 2ASYA 2K1RA 2EG1A 1BLUA 1RTHB 1KAKA 1F1BB 4M5JA 3MEGB 4HACA 4YP3A 4UOCA 3CEDA 1Q7YT 3T1AA 7AT1B 2IC3A 2VL1A 3K2YA 4LF4J 5M2UA 5KA4A 1HQUB 3AY0A 2DGXA 1Y7PA 3FSYA 4A8YA 2Z2ZA 3M1VB 2IHR1 2UUPA 4IO1A 4C0OC 5DDPC 5L9NA 1M5PC 1Y5LB 5E41A 3PR4A 4QR0A 3W1YC 4URQU 1GTHA 2B7CB 1OPZA 2E1RA 2UXCJ 3A8IA 1BUXA 1T11A 2IM0A 2BW7A 1QLNA 5D0RA 5J2PB 2DGVA 3T9ZA 1HNWJ 1LWCA 1HBUB 1X7VA 4NA3A 5ETPA 1DHMA 1RWVB 3C46A 4DR2F 1T95A 5LJ5Y 4X66J 1LWEB 4RX6A 4RNFA 2QA4G 1LFPA 1ZPVA 3D44A 2Q1LA 2ATCB 3FZ2A 3CCVS 1LW2B 2AYMA 2ZH8A 4RUAA 2N4DA 3MFHA 3N6NA 3NNAA 4NZ6A 4Q2LA 2C7SA 4MIAA 1B70B 4IG0B 2NT2A 3KLHB 4PG8A 3HZGA 5HMYA 1HBNA 4C3LA 2X1AA 3CC2S 3W2VB 3ENVA 1HWUA 2AZRA
chains in the Genus database with same CATH topology
1S6UA 2GWOA 3WBZA 2BANB 2CPDA 3DDKA 2E5IA 1AAXA 2RT3A 4HKQA 2F40A 1Q8BA 3VZIA 3PVXA 1HQEA 3CMES 2CPHA 4KHPF 4F3OA 3P3DA 2HMIB 2BW2A 2CJZA 5CZXA 1M5HA 2CQPA 2KHDA 4FF1A 4ZCLA 4IFYB 5F0WA 4C8OA 1NAQA 4HLBA 5I3UB 2JVRA 4AL7A 1U2RA 3H59A 4OI4A 5KFNA 4BDPA 2OAUA 4CH7A 2LXIA 3V0FA 2CPIA 1FK9A 3MUTP 2CFVA 2Y96A 2PI5A 5KABA 4K5SA 1TKXA 2OLWA 4ZVEA 4W90B 4ERDA 3I55S 2CM7A 5K9FA 3US5A 3VTIA 2C2EA 4HVZA 3OR1B 2UUCF 2A3JA 3ZZUA 1JLBB 1MU2B 3EGNA 3DCAA 1DJ0A 5DETA 4KFBA 1T8EA 2PMZD 1NKBA 1I6JA 4F8RA 2I38A 1C0UA 3O44A 4XAKA 1VQYA 2PA3A 3O8WA 1T02A 4K5RA 3TNVA 3B78A 3U1LA 5L1IA 4DR1F 2AQ4A 2W8LA 1L3SA 3T1YF 5KG6A 4ECSA 3TA0A 1P1TA 1IKXA 1X4BA 3MDFA 2R8IA 2KZZA 3K8VA 4I2PA 5KFFA 2DHXA 4NLPA 1D3WA 2A1BA 2GGPB 4I69A 1YG0A 2XMVA 2I1RA 3Q8RB 3LQVA 4JI3F 1J5OB 2KRRA 3MMCB 1CC8A 3WC2A 5KFJA 4XDCA 2UUTA 4FS2A 1F0XA 3BGRA 2GIQA 2I6IA 2OPSB 3KK3A 2CM2A 4DL3A 1RT6B 3D0IE 3KNGA 1H7WA 3QIDA 2VQEF 3OHAA 5IBMA 2UP1A 4H54A 4YB1P 1S1VA 5I3PA 2ZJPQ 3R5AA 1RT2B 1YRXA 1Q79A 2AGQA 5DO2A 1UVJA 2J76E 1HWLA 1TAQA 2JC1A 4A8XA 5D4PA 4X4VA 3M8PB 4WOHA 1SJ3P 2HHXA 5KA2A 2HHUA 3NNCA 2QSFA 3I9V9 4JI7F 4ETZA 4UY85 5HROA 1Q6SA 5I6VA 3IAS9 2DNZA 4FXWA 1SB6A 3KMSA 5CYMB 3GYXB 2MSTA 2I6OA 4Z2XA 5KFDA 2YDUA 3G86A 3GILA 4AQYF 4JI2F 3SDEA 3MWBA 4QWEA 1AFJA 3UCGA 4DSLA 1RT4B 4J9OA 3OMHA 3FZBA 4WTYA 3NBPA 4NYZA 4CO5A 2AJ1A 1E6VA 1HYSA 2XLKA 1Z2ZA 1FJGF 1TVRA 2AGPA 1S4FA 3UDCA 1F60B 2EFOA 1H2TZ 4WFNQ 1X4CA 1KONA 1HBMA 1V3RA 1UA0A 5CYQA 4I6WA 4QIEA 3F44A 4ZK7M 3QCFA 1DARA 2FB0A 3KWMA 4IO9Q 3OLAA 3IXQA 3M30B 1R0AA 4RBUA 2EWHA 3RR8A 5G0RB 4DV3F 3DOKB 2JC0A 4ETXA 2HXPA 2VEWA 2POKA 4I7FB 1I9SA 3JYTB 2DGQA 5K8MA 5IM0B 3C6TA 2LDYA 2ZJQQ 2J6TA 3O4TA 1UFLA 4C97A 4U67Q 4I67A 4HDHA 3GMGA 2B56A 1TZ0A 2D3UA 4X84A 2CPJA 4OJ3A 1O51A 4NYHA 5KG2A 1NK8A 2FC9A 3GIJA 1FDDA 3AJ2A 3HLUA 2W9AA 2VPZB 2K7JA 5CD4H 3CWEA 4NLSA 1UW4A 3K58A 4YR0A 3CT9A 4ZCKA 4C8KA 2HWTA 4H4MB 5GAHU 2Q43A 3BN7A 3NP5A 3NGDA 2M0GB 3THTA 2OSQA 2ZDOA 1Z1ZA 2M88A 2V4RA 3CJKB 3VAHA 3U27A 4OX9F 2ZM6F 5B0CA 5E0OA 3SSSA 3PW5A 2DPJA 2I3UA 4QPTA 4C98A 4X64F 4WE1A 2V9KA 1DAXA 4Y3CA 1S6QB 5J8RA 1C1CA 2ABYA 4IDKB 4M8LA 2LYVA 2K2PA 2B4PA 2N7YA 2YKAA 1C1BB 5E3QA 4DL5A 2H9ZA 3C6UB 5KT2A 3GZ7A 3DMJB 5F3ZA 2W4PA 1T94A 1N0VC 1Q1MA 4FVMA 3QKPA 1WF1A 2RS8A 3BGUA 3PKYA 1QM9A 3CF5Q 1M5KC 3I31A 5C24B 2E5GA 2VC0A 4B3MF 3DOMA 5B0FA 4ECVA 3O6QA 3MM7A 5A0YB 5B0AA 1NO6A 2GP0A 4JI8F 4U7UK 5KFXA 1RYSA 4I4BA 1C85A 2ZKTA 5B0DA 2GW8A 4D3HA 3I82A 4QWDA 2ALZA 1FKOB 4MKYA 4KKOB 2HY3A 3SMZA 2ASDA 3FSXA 4QWCA 5CH7B 1IKYB 3LWMA 2M7SA 3PEHA 1KEKA 4B3SF 2B0GA 1TAUA 3B8HA 2V5HG 1FXDA 2GMJA 1YGYA 4NCGB 5B08A 2F6ZA 4NX8A 2R8KA 4QAPA