2B4PA

Structure of the d223n mutant of selenomonas ruminantium ptp-like phytase
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
314
structure length
314
Chain Sequence
MTVTEPVGSYARAERPQDFEGFVWRLDNDGKEALPRNFRTSADALRAPEKKFHLDAAYVPSREGMDALHISGSSAFTPAQLKNVAAKLREKTAGPIYDVDLRQESHGYLDGIPVSWYGERDWANLGKSQHEALADERHRLHAALHKTVYIAPLGKHKLPEGGEVRRVQKVQTEQEVAEAAGMRYFRIAATNHVWPTPENIDRFLAFYRTLPQDAWLHFHCEAGVGRTTAFMVMTDMLKNPSVSLKDILYRQHEIGGFYYGEFPIKTKDKDSWKTKYYREKIVMIEQFYRYVQENRADGYQTPWSVWLKSHPAKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Kinetic and structural analysis of a bacterial protein tyrosine phosphatase-like myo-inositol polyphosphatase.
pubmed doi rcsb
source organism Selenomonas ruminantium
molecule tags Hydrolase
molecule keywords myo-inositol hexaphosphate phosphohydrolase
total genus 107
structure length 314
sequence length 314
chains with identical sequence B
ec nomenclature ec 3.1.3.72: 5-phytase.
pdb deposition date 2005-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14566 PTPlike_phytase Inositol hexakisphosphate
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1690 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2b4pA01
3.90.190.10 Alpha Beta Alpha-Beta Complex Protein-Tyrosine Phosphatase; Chain A Protein tyrosine phosphatase superfamily 2b4pA02
2E0TA 4ZRTA 2B4SA 2H02A 2B4UA 4JBCA 3ZM1A 1U26A 4R0SA 5BX1A 2B3OA 1C84A 3QCLA 4NYHA 1NL9A 2H4KA 2I3UA 3QCHA 4GE5A 3F99A 1FQ1A 2PT0A 4RH9A 2HXPA 2CM3A 4ICZA 2CM8A 1BZJA 2PA5A 5K9WA 2F46A 3BRHA 5I6VA 1LARA 2BIJA 3QCJA 4OHEA 4JMJA 3QCIA 4RDDA 3V0EA 2B07A 2I42A 2I6PA 1ZCKA 2CMAA 2RF6A 4S0GA 2MBCA 4IKCA 1I9SA 1YWFA 3EZZA 4YAAA 2NT7A 3O4UA 1YPTA 5K25A 1YTWA 5IBSA 1Q1MA 2Q47A 2JJDA 4RHGA 3I7ZA 3OLRA 2G59A 4PYHA 1L8GA 4MBBA 2HNPA 1AAXA 1G1HA 1WRMA 2PI7A 4NX8A 4D3PA 2YDUA 5BZXA 1BZCA 4QAPA 2PBNA 2CM7A 3ZMQA 2QEPA 2QBSA 1T48A 4RI4A 1XM2A 2NT2A 3I80A 4GRYA 1V3AA 2CMCA 2OZ5A 2F6YA 3EU0A 4QUMA 1OEMX 5KAAA 2F6FA 2QCJA 3GXHA 2NLKA 3O3LA 2VEXA 2BGEA 4R0TA 2QDMA 2ZN7A 2QCTA 3O5XA 1OEVA 4BPCA 2CM2A 1RXDA 4Y2EA 4ZI4A 2VEUA 3QCKA 4GWFA 3S3FA 1PTVA 3CM3A 4RI5A 1JLNA 1G1FA 1X24A 2Y2FA 2I5XA 1Q6SA 1RPMA 1Q6MA 2QDPA 3I36A 3ZM2A 2CNGA 2AHSA 3O4SA 2CNIA 2NZ6A 1BZHA 1G4WR 1XXPA 2A3KA 3AWFA 1QXKA 1U24A 2C46A 3F81A 1I57A 3RGQA 1NO6A 2H4GA 1M3GA 1EEOA 4NWGA 2NTAA 2CNEA 4HJQA 1G7GA 3QCDA 2QBPA 2I75A 1ONYA 3S3KA 2A8BA 1YN9A 2FJNA 3SMEA 2VEYA 2I6MA 2QDCA 2CMBA 4QUNA 1C87A 5HDEA 2CFVA 4KYQA 4Y14A 1C86A 4RH5A 4ZN5A 1ECVA 1GWZA 3BM8A 3F41A 4DGPA 3H2XA 2B4PA 2I4EA 1J4XA 3S3HA 1PTTA 1FPZA 3QKPA 2Q05A 4WU2A 2I6IA 1A5YA 2F6WA 1G7FA 3CWEA 3QCMA 1OHCA 2R0BA 1L8KA 4YR8B 1XRIA 3GXGA 3BLTA 3BLUA 1U25A 3QKQA 3EAXA 4R30A 3LJ8A 5M43A 1FPRA 1I9TA 1EENA 5K23A 5EHRA 4OHHA 3V0GA 4KYRA 2H03A 2B49A 2F71A 4ERCA 3V0JA 2HNQA 2HVLA 3QCNA 4DGXA 5IBMA 2SHPA 1PYNA 3D9CA 2WGPA 4PVGA 4BJOA 1G4US 1ONZA 3D44A 2VEWA 1Q6JA 4WTYA 2F70A 1R6HA 5KACA 1D5RA 2FH7A 4H34A 2I6OA 4QBEA 2F6ZA 1XBOA 4D3QA 1P15A 3V0IA 1OESA 4HJPA 3EMUA 3O4TA 3OMHA 1NZ7A 2BGDA 2BV5A 3QCGA 4WOHA 4JMKA 3F9AA 4GS0A 5EHPA 2GP0A 2HB1A 4GE6A 1PXHA 5KA9A 3ZM0A 2NV5A 4I8NA 2ESBA 3D1OA 3F9BA 3RZ2A 2AZRA 1LQFA 1C88A 1VHRA 5KA3A 3D42A 2I4GA 4NWFA 5GTJA 4H1OA 1WCHA 2H04A 4B04A 2HC2A 3V0FA 1KAKA 1XXVA 2B4OA 1PA1A 4D3RA 3A5JA 1NNYA 1ZC0A 1JF7A 3V0HA 3V0DA 4OHLA 5K22A 3D1HA 4J51A 5J8RA 4HRFA 2P4DA 5KA4A 2PQ5A 1LYVA 4GFVA 2C7SA 3RO1A 1T49A 2HY3A 1C83A 1YGRA 2QBRA 5KA0A 4QAHA 3S3EA 2Y96A 2J17A 3MOWA 2P6XA 5AWXA 1YFOA 2BZLA 2GJTA 3D1QA 2OC3A 4GFUA 4AZ1A 3AWEA 1NWEA 3S4OA 3N0AA 2M3VA 3U96A 2QBQA 2J16A 1C85A 1WAXA 4Z6BA 3EB1A 4TVVA 5BUGA 2H4VA 2I3RA 3A5KA 2I4HA 1OETA 3PS5A 4GRZA 5KA8A 3ZM3A 1OEUA 1NWLA 3ZV2A 3RGOA 2OUDA 1PTYA 3QCFA 3QCBA 3SR9A 2I1YA 4QBWA 3NMEA 1ZCLA 1YZ4A 2J16B 5MMZB 1T4JA 5KADA 4OHIA 4RKKA 4JNBA 2G6ZA 4OHDA 4WU3A 1YTSA 3QCEA 1MKPA 3M4UA 2DXPA 2CJZA 4NNDA 2HC1A 1PA9A 5BZZA 1OEOX 3MOZA 2F6VA 1OHDA 4KI9A 1Q6NA 3S4EA 1OHEA 5KA2A 1QZ0A 2PSZA 1YTNA 5KABA 2CNFA 5KA1A 1G1GA 1PTUA 2FJMA 2HCMA 5K24A 1KAVA 4GE2A 2GWOA 5K9VA 2F6TA 1GFYA 2OOQA 3ZMPA 1ZZWA 2VEVA 1Q6TA 1YGUA 1SUGA 2I6JA 3MMJA 2ZMMA 1PH0A 1Q6PA 3AWGA 5KA7A 3QCCA 2CNHA 3B7OA 2IMGA 5LXQB
chains in the Genus database with same CATH superfamily
4J9UE 2FLPA 2D7SA 3IMQJ 3PYFA 4L72B 3F44A 4DL3A 4BWMA 2PD1A 2RNEA 1U26A 1GMWA 3VALA 2AGOA 4PAAA 3W9IA 1YRXA 2KZZA 1C84A 3NCPA 1F9EB 2GVZA 1YX2A 1R8HA 3R27A 1D9FA 4JI7J 3K17A 4P75A 4DX8H 1Y4ZB 2FY1A 2NXEA 4RUCA 4XPCA 3QCHA 4ED4A 1DBDA 1GTHA 4QPTA 4J9LA 3I5BA 1IKWB 1RT1B 4DR1F 1Q8LA 1RTJA 2PT0A 1Q78A 2A0FB 2FTRA 2ZKTA 2HXPA 4RH9A 1NM2A 4MH8A 4ECYA 5DGAA 1C1BB 2EKYA 3ILJA 5KT4A 1SV5B 2AYBA 4UW2A 3BF4A 3MXHP 3BBCA 1CEZA 4DFPA 1Y11A 3NKYA 1CJKB 1WI6A 5I6VA 4QIVA 2Q43A 2XGPA 5KFJA 2DVIA 2HHHF 5J1PA 2BIJA 3QCJA 1M1HA 4OHEA 1GMWD 1F6TA 2E1MC 2XULA 4ED2A 3GTYX 3BPDA 3OR1A 5DZ7A 2I42A 1FKPB 1TZ0A 3ILIA 1LK7A 4H4MA 4PXEA 1TL5A 5M2RA 3RBEA 3K5PA 1D3WA 1CS4A 1RT4B 1YDLA 3BV8A 1WTBA 2JEIA 1FRLA 3I9V9 1S4FA 5CZVA 2XC9A 1N48A 2CM3A 1FESA 2NYIA 3DDIA 1J6UA 3CMQA 5DJBA 4DSIA 3JTOA 1Q86T 4I68A 4LF4J 5AJ3F 2IJRA 5D8HB 3F0NA 4DOZA 2HQIA 2DPIA 4K5SA 1ZCKA 4A8QA 2CA9A 4IFYA 2XYGB 2LQJA 3H4DA 1TKTB 2I0XA 4WE1B 3OUYA 3OSPA 2CMAA 2L3MA 2HIQA 1M90T 2MBCA 4S0GA 2J0SD 1M3GA 2BZ2A 4ZP8A 1YWFA 1PJ6A 2XHWA 3IG1A 1C1CA 2J6UA 2BABA 4ZLPA 4PWDB 2B8PA 1PJ7A 3MMAB 1U47A 2NT7A 2HGLA 3DKDA 4LQ9A 3O4UA 2VBWA 1PSDA 4TU7A 3NMAA 1C1BA 1YQHA 5K25A 1KFDA 3MM7A 4GMKA 4MT1A 2W7OA 3NXZA 1YTWA 2Q47A 2ZNZA 3FNNA 3QCZA 3R5DA 3LP1B 4CLKA 2YQ1A 1B7YB 3GLJA 4G1QA 5MLCV 2JWNA 2AP6A 1ZTWA 1DHMA 2VOSA 3OLRA 3B4MA 2D74B 1GEHA 3ZTRA 1WHWA 3QT7A 2R8HA 2CFXA 2VQFF 2KG1A 4DV3F 2G59A 2BXJA 1FCAA 3QLHA 2KDOA 3UQSA 4TU9A 3PS5A 3T9ZA 2J9DE 2GMJA 2L08A 1L8GA 4PYHA 4YQWA 3HD1A 1FWLA 3ZTOA 2G0CA 3IS9A 2ATLA 4LRCA 1AAXA 3TP2A 3W2VB 3G6XA 1NWEA 2GQ2A 3BYRA 1YTYA 2AEFA 1E6VB 2FHKA 4YHHF 2GCFA 4ED3A 3JXOA 1D0EA 4YY3F 2LXFA 3BSCA 1S1WB 4FNIA 3ZMQA 3SFGA 1ZM4A 2QSFA 4WE1A 1S72S 1RACB 1KLMB 1TP7A 5I3UA 2NT2A 2QFIA 1Q79A 4K0KJ 1S6PA 1SKWA 2HBRB 2F6YA 4ETXA 1OWXA 1LFWA 3MEDB 4USWA 3R8YA 2RVJA 2LDYA 3RGIA 4PWDA 4WIIA 1OEMX 3KK2B 3UFCX 2J5AA 1RA6A 1BY9A 1VK3A 3ETMA 1EIYB 4K4UA 2KFZA 4OYAA 1UZDA 2F9DA 2MZTA 5KAAA 3ZXWA 1M5VC 2VODA 3RBZA 3O3LA 4EBEA 3LP0B 5D0EA 1DZ5A 3RB4A 2GHPA 1U49A 5DS7A 3TVKA 4O0IA 2DGUA 4BPCA 2VDHA 5D78A 3A1YG 2CM2A 1R27B 1EJ7L 5C25B 1EP4A 3GFYA 2ZD1B 1HWLA 4NYOA 4QU7A 2VU5A 1T9TA 1X9SA 1FRHA 2NREA 3M2VA 4RWXA 3SEOA 4BLGA 3BR9A 3MM8A 5J2PA 4GKKJ 4RI5A 2CNKB 5F3ZA 2HSEB 3BDEA 4PABA 3OTDA 3PV8A 4CLWA 3QT8A 4QBUA 1RPMA 4AL7A 3KUEA 1CBKA 1GMVA 2FJBB 2PGCA 9ATCB 1VQ4S 2AHSA 4G1PA 1X5SA 4CIOA 2H54B 2J76E 1UWAA 1FHTA 3FBEA 3BQ0A 3AD8C 1IQTA 2NZ6A 2D9PA 2A3KA 3N6NA 4TN2A 3AWFA 4LF1A 2UUBJ 1SQFA 2ZWOA 1AW0A 1YJUA 4C6AA 1OYDA 5K5MA 4F3MA 2VG6A 2B4SA 1KQGB 2C46A 2FGOA 3F81A 2C2ZB 5HMYA 1TU0B 1S9EA 2W25A 3K8WA 4AL6A 5IC4B 4R5PB 4DR6F 2HVZA 3PKYA 1I57A 3DM2A 3QYYA 5ETPA 4J9MA 3D68A 2CVEA 5KT7A 4IG3A 3MCMA 5HVFA 2D3OR 5HL7Q 2BV3A 3DLKA 4USHA 1HBUA 1SI9A 3RR8A 4B9VA 4I2QA 3SCJE 1NJZA 4JV2A 1Y5NB 3OFEA 2GHWA 3B78A 4AXJA 2XGQA 3CJQA 1IN0A 4FZVA 3C2PA 1YN9A 3IRWP 3M32B 3D6MB 1O51A 1VQNS 1U09A 3VAGA 4EZ6A 2I6MA 2QDCA 2PE8A 2WONA 1I6JA 2YKOA 1GK8A 1T95A 4LF2A 4B17A 2M8DB 3J7A1 5HDEA 2G0IA 2GO9A 3E51A 3NBPA 3OL8A 4RNHA 3CCUS 2P9GA 4DFKA 1C86A 4KYQA 4RH5A 2KT2A 1ECVA 3VAJA 3TR5A 4X64J 4ZN5A 3F41A 2VZ9A 2LU1A 4QU6A 5ETMA 2HAFA 3VGVA 2NZCA 3QWUA 2EK1A 2IMWP 2Z0GA 1U8WA 2RKIB 3PJWA 1DQ8A 3D3BJ 3BR8A 1HI1A 3CD0A 1HBMB 3CO9A 3HHEA 5HQ8A 4M63A 2R2TA 2BQ3A 3W7BA 1S10A 2AF6A 1BHNA 1RB0A 1PAUB 1RHKB 2K7JA 3M1VA 4QZVB 4RW6B 4DZDA 1EB0A 1S48A 2YKAA 4IFYB 1NK4A 4QOTA 5GAGU 4I64A 4ZIVA 4B3TJ 2LCWA 3UCZP 4F2RA 2VG6B 1RKIA 1T7PA 1G2EA 3QKPA 4TYBA 4WU2A 1FFWB 4RBVA 4Q7AA 2IM0A 4UOHA 2R7RA 5EN1A 1XR7A 1WDTA 2GCAA 4DUYF 2XSFA 2W01A 4PXCA 4AQYJ 3H2XA 4KC5A 2N4DA 3TZXA 2I6IA 2JOQA 5T7LA 2JJ4D 4F4WA 1VCTA 2P5VA 4JI2F 4DN9A 3HULA 4M8LA 3ZNUA 1U1NA 1OMSA 1REVB 2F1FA 2LEAA 3MMCB 3FMWA 4HL9A 3W9HA 2R0BA 1JLGA 2ZHBA 3DHWC 4QYZK 3DYAA 3CC4S 5L46A 2V9KA 3HHKA 5CABA 2ROEA 5K8PA 3CC7S 4UOFA 4JV1A 3BLTA 3H2LA 2YNFA 1UETA 4NLQA 2WONB 5T41A 4OX8A 3VCDA 5ETRA 4DG1B 1LW2B 3PACA 5KFDA 3HPOA 1SXLA 3MZIA 2XMUA 4I6WA 3KK1A 2W2PP 2VQEF 3AFGA 1CC7A 3TNVA 2IY5B 4FS2A 1VS3A 2FGCA 3DC2A 3ITHB 4HTIA 4RW9B 1CJUB 3LJ8A 5KT3A 1XNQF 3M8QB 3W2VA 2K3IA 3FEXB 4J90A 1TAQA 2DD8S 3VQSA 1VHFA 1FPRA 1RXOB 2K3KA 4CZCA 5KFRA 2N82B 3QRRA 4QR1A 4HHUA 5GVQA 2BOPA 4OHHA 3OSNA 3V0GA 4KYRA 1FWPA 1TKZA 3UI3A 2B9EA 5GMDA 2DT9A 2GS8A 1B70B 2DXDA 2Y3YA 2AYMA 3FQLA 5C24A 5KFCA 3KLEB 2QL7B 4CTAA 2R2SA 2NQPA 4ATNA 2SHPA 1ULRA 2MKHA 3MOJB 4BBYA 1TMMA 4LF9F 3WX8A 4HEA9 3ZM6A 2C42A 1T03A 5A2QY 3D9CA 4DSFA 3LK7A 4PVGA 4KV8A 2B7CB 3NS7B 3OVBA 3U1MA 3POTB 5E41A 1Q1KA 5D3GB 3F73A 1H2VZ 4UZBA 2MQ8A 5CYQB 4DF8A 4LUBA 3DYAB 2VEWA 4DGXA 4WTYA 2Y8WA 4LR9A 4I6YA 2JX2A 1BLUA 1VJQA 1X4HA 2VKRA 4UUXA 1DFDA 2F70A 5KACA 1FFSB 4H34A 2W2OP 3D2WA 2I6OA 3A5JA 1OY8A 2JNJA 1LW2A 2DR7A 2HBYB 2BKNA 4UOGA 4C0HA 3QGPA 4ICLB 2DISA 3CCES 2VIHA 3R1HA 2VG5B 2RHSB 5U47A 2GC6A 1RTZA 1WDDA 1FKOA 2N3LA 2V8HA 2WBRA 3PJXA 1P1TA 3TJ8A 8RUCA 1TTHB 4K0KF 2DGWA 2HS4A 1YJVA 2MSTA 4MYUA 5KFTA 3OMHA 3H40A 1P27B 1TV6A 3LANA 2H5JB 4RUAA 1A9NB 2G2YA 2XJAA 3QCGA 4DLGA 1W26A 2Z4PA 2YQ0A 5HVHA 2CZVC 4JYAJ 2X1GA 3CUNA 2CAJA 1VQOS 1T05A 3F9AA 3T41A 4J91A 2F8HA 1X9WA 2HB1A 3CIMA 2E5LF 1IBKF 3MF5A 1UA1A 2H03A 3RW6A 2GMHA 2CUYA 4PG6A 4I8NA 4K4YA 3RZ2A 3EM1A 4K5RA 2DH7A 3KJFB 1LQFA 2RJZA 2YWHA 3D67A 3ADAC 3LPEA 1RAAB 4FNHA 3QQCD 2V34A 4ZVEA 3VVUA 2PFFB 2CNOB 3BH6B 1RHJB 2FVCA 2MKYA 2KN4A 3D42A 4NOHA 4NWFA 4PUOB 5GTJA 3POTA 5D3GA 4R5PA 1FXDA 1YBTA 2HKEA 3M2RB 3OXLA 2JSXA 5ETTA 2QO3A 1PYTA 5B0AA 3Q0AA 4B04A 2HC2A 1MMDA 2JHEA 4WK1A 2VBZA 2YVSA 1UVMA 3NGUA 1SKRA 4CQ1A 4ED0A 4N77A 1ZYQA 3RB0A 1RWPB 4ZVUB 1HMVA 2I9SA 3OTOJ 1WTFA 1SJ4P 3M32A 4RL1A 5E3PA 1OS5A 1YITS 2KI2A 2F65A 4OZ1A 3QZ7A 3BYPA 1J4XA 2YY3A 1Q8KA 4NLXA 1HNZJ 4R8UB 1NNYA 4DV1F 1U6ZA 2G13A 2CJBA 3IGNA 3JQKA 4NCGB 2J0XA 1IKYB 1F3VA 2KVIA 1QE1B 3FEYB 1SKUB 4OFZA 5DDRC 2N7CA 4DLEA 2DHAA 2HQ3A 4O3QA 1PA1A 1RYRA 2HS3A 1Q0NA 3AJ2A 5DETA 3KNGA 1RWNB 3RU0A 4URQU 1CSJA 2EFOA 2PA3A 3ISNC 3GFZA 3D1HA 1NUEA 3TA2A 4J51A 1IJEB 2WB4A 4B3RJ 2VFSA 2J7WA 2XG8A 3M8RA 2VA2A 3BO2A 3R5GA 3M1VB 2B0GA 3AJDA 1MW7A 4X4UA 3PYDA 1LWXA 1RE1B 3BZQA 2IA0A 1LYVA 3RO1A 1NK7A 1HI8A 1S1XB 2XZTB 5D4PA 4N41A 1R6VA 1NMEB 1VQYA 1C83A 5KFMA 2ZBRA 2XNRA 4DX5A 3DI6A 5KT5A 5LM7E 4IH7A 4DR1J 3RBDA 2QBRA 3HZEA 2XS7A 2EFQA 1RT3A 3J81j 3TAPA 3W8GA 4X64F 3MPDA 3C66A 1B64A 4RU2A 4IFVA 3HJVA 1NB7A 1JLGB 2BVZA 4FXDA 3MOWA 3BN7A 5GAHU 3SBMA 2P6XA 2WHOA 3IM9A 1V5VA 2WBMA 4U8YA 2FHOB 2R3VA 3L7UA 5B0GA 4CLPA 2VQFJ 3D1QA 1H38A 2OC3A 2VORA 4C8NA 3ZTPA 4J37A 4KIAA 3LTOA 4RBTA 2YH0A 3AWEA 3S3HA 3S4OA 4YR0A 4UQTA 3V81A 2CQGA 1I1GA 2CWKA 3ILOA 4O23A 4A47A 2OPPB 1IKYA 3M05A 4QR2A 3Q8PB 1YBAA 3ITHA 3BSOA 2V68A 2J16A 2IFXA 5E33A 2OFHX 1LW0B 1FEEA 3MR7A 1RLDA 1WKJA 1RWWB 1Y5IB 3C15B 3N5BA 4WCEQ 2IM2A 3G8SA 1S1UB 3GU0A 1VDHA 1R8PA 2E5JA 2H4VA 2HVHA 1FJCA 3V6DA 2V5HG 5CYJA 1OETA 4H4KA 1OO0B 1RT7B 2QX0A 1H7WA 3QBCA 3W60A 3KLEA 1WG1A 2R7SA 1SV5A 3VGUA 4ZVOB 1U1MA 2E9ZA 3CCZA 3MECA 4KO0A 2LMIA 3A5KA 5HSPA 2ZH9A 3OFHA 1Z4UA 3MWBA 1FVSA 3DMJA 3DI6B 1Q5YA 4GO5X 1RHRB 1X7VA 2QLWA 2DHGA 1JQGA 2DNOA 4CLFA 3K57A 2FJWA 4RW8A 3TUZC 2P9EA 3DRRA 5K14B 4WF9Q 4ANEA 4NLYA 2HQGA 6AT1B 4IKCA 3PX0A 1V3RA 1WC0A 2QA2A 1SC6A 1BQXA 2VFVA 2F8EX 3PRBA 1V6HA 3LAKA 3W65A 4C0BA 1D09B 2VG7A 4OYPA 2DNLA 3IAS9 2DO0A 4U8VA 1N36J 2NXUA 1KKHA 4ELTA 1T02A 2ACYA 4HACA 4OQJA 1ZCLA 2F40A 5ETNA 4GO7X 1FKOB 2HWIA 2LA6A 2EBGA 2RF2B 2ZBQA 2ZBPA 2J0WA 4Q2MA 3H5UA 4UT4A 1TR0A 4UTGA 3TYTA 2VASA 2KO1A 5L38A 5KFQA 2JRSA 2DO4A 5KFBA 1K1SA 4NPOA 2Q6CA 3JYTA 4JNBA 4OHDA 1YTSA 1HQ2A 1CQNA 1SL0A 4X2BA 1REGX 4L3KA 4U96A 3A8IA 1RT7A 1X9MA 4LFBJ 2YKNB 4IO9Q 3LP1A 1B7FA 4P73A 3CJRA 1P1LA 3H59A 1W7KA 2PMHA 1RWVB 3HI9A 1M5KC 5KFWA 1KOOA 3VZIA 1SJ3P 3C8YA 4W90B 2CJZA 4DV0J 1OPZA 2YX4A 1NJYA 4YB5A 2EKNA 3R7SB 4LFAJ 4AE5A 1U1PA 5BZZA 1OEOX 3H90A 4RU9A 4KQZA 2BE2B 2HHPA 1JLQB 2ZOFA 3DCAA 3ENAA 2F6VA 5LMNJ 4HHJA 3WIUA 3S4EA 1Q6NA 4AL5A 4QWAA 1OHEA 2IYGA 4KHMA 5IWAF 1QZ0A 3NAHA 4QIGA 1FJEB 4Y14A 4DS4A 4F50A 2XI3A 2DGOA 1DQAA 1HMVB 3FZ2A 3HX9A 4L75A 5IM0B 4DUZF 1VRUB 2C2NA 3PXGa 2HHSA 5KA1A 3SFUA 3D9BA 3CEDA 3IWXA 3KKFA 3PO5A 3A3NB 3QJPA 2XBPA 4L73A 1DURA 1IBCB 4NCGA 1LQ9A 4RW4B 2DTJA 4KGXB 2F00A 2M70A 2UUWA 3BO3A 2CJKA 4HKQA 2HHUA 2J8SA 3RZAA 4DZ6A 1XK8A 4V19J 2DNGA 2GWOA 1H74A 4R25A 2GFFA 2YWWA 2YKNA 4C8KA 2LA4A 2HK3A 3OTEA 3I0SB 1Q6TA 4G1IA 5CYMA 3EYZA 2AZ3A 4OZJA 4Q0BB 1V3ZA 4EU0A 2BJ3A 5IT0A 5HMWA 4DV6F 1XMQJ 1R8BA 3D5MA 2DNNA 4HLBA 4UOCA 5CZXA 3OTOF 2W7PA 3BPSP 4RUBA 2VBXA 2AYGA 1NKCA 4EBDA 4C8OA 2JLEA 1APSA 2G0JA 4OYMA 4NEZA 1QM9A 3K5NA 2KRBA 1HWJA 4ZVGA 4AQYF 2UVUA 3CULA 3M2VB 3CDAA 2QMWA 2HLUA 2DNRA 2YX7A 1WKKA 2CPIA 2BQRA 1LWFA 1Q7YT 1ZPWX 4BDPA 1K1QA 1WUUA 2OI2A 2DR6A 4IFVB 3VWSA 1N5VA 2Y66A 2ZM6F 2O66A 3GIRA 5HN0A 5H9FK 1JB0C 3HVRA 1WORA 2DH9A 2ZITA 3CJTA 1FNOA 2B4UA 1ZM9A 5GAGI 5GMEA 1VQLS 3HK2A 3KJVB 4FYXB 3ZM1A 5BX1A 1FX2A 2YKMA 3Q8QB 1BQNB 1MNEA 5C5JA 5C2CA 3RAXA 1U1LA 2B3OA 1NL9A 1E6YA 3U27A 1B4SA 2IAJB 4BC7A 3PTWA 1XNQJ 4GE5A 1G3OA 3PEJA 4YN3B 3VV2B 1S0NA 2K1RA 3HFVA 1KWMA 1NCLA 3WX4A 4FBUA 1YHQS 3F99A 2W24A 4WP9A 1W2BR 3JQJA 2IRXA 4HVZA 4I56A 3OW2R 4A46A 2CJXB 5F41A 2CADA 3PW0A 1Y00A 4AZ1A 3BH7B 2O3DA 4ICZA 1HBUB 3THTA 4I2QB 4B9NA 4J9PA 1AB8A 4TVAB 3MM9B 3WC2A 1U6BA 2PA5A 1HNIA 2Y67A 4U7UK 1LEOA 1IR1A 2FYXA 2HFVA 4I7FB 4KO0B 4DS5A 3BRHA 4OI2A 3VF0B 4P6QA 5BR8J 4WFBQ 2AGPA 2ZC3A 1I51B 2MQNA 4KFBA 1RAEB 3UR0A 4JMJA 3QCIA 3NBPB 4L74A 1N5TA 3P45B 1VLYA 4O0NA 1KEKA 5KG2A 4YR2A 3M9MB 1N5YA 2YWEA 2EVZA 3DLGA 2CQBA 2FJDB 4ZHRB 2CG8A 4B3OB 3CTRA 1ZPVA 1C0UB 1ZZFA 2W2MP 2V50A 4RWWA 2YNHA 1U7LA 4CO1A 5HQLA 4X66F 2B07A 3AXKA 4JI5F 4Q8FA 2JC1A 1D9AA 2FZCB 3FRYA 2IDLA 1FD8A 2V6AA 5DLFA 3UN3A 1H2TZ 2VOPA 2FQQB 2RF6A 1PBAA 4F4KA 4J9KA 1I9SA 2E1PA 4LBPA 4MKAA 1D8YA 3NMRA 3DDKA 1O0PA 2K1RB 2RQKA 1YBUA 2VKZG 1GX5A 4NASA 1RT1A 3A8EA 4B08A 3JYTB 1QSSA 4WKRA 4YAAA 4C13A 1RJJA 4GC6A 1VOMA 3UCUP 2M2BA 4PWWA 4ECXA 2QMXA 3D3CJ 1X4DA 3GYGA 1HHQA 2QZ8A 1KLNA 5B0BA 3IC1A 1ZOTA 1ROFA 2IIHA 3MMBB 3IWLA 5FLXY 2C2MB 3KLGA 3MD3A 5J2QA 3MCSA 3WHIA 1WHXA 2GIFA 1SIWB 4PG8A 2FVSA 4J9OA 2X1AA 1BXNA 2XMAA 3CJ3A 4KFBB 1HNWF 2BJ8A 1N36F 2RRBA 1TKXB 2GJFA 3MEGA 3MAQA 1UVLA 1MMNA 2MY8A 4PR6A 2OEKA 4H4MB 3PJ9A 4D3HA 5B08A 3EZOA 4IH6A 3PDNA 5AE1A 4N7TA 1FA0A 3C6TB 3I56S 3ZTSA 1HYSA 2DGSA 5AXNA 4F3OA 4CP5A 1TL1A 1G1HA 1FRMA 1M5HA 2QL5B 2PI7A 4D3PA 4DQPA 3AAWB 3HVWA 3D54A 4ECSA 3PW7A 5L1IA 4LFBF 2MEWA 2W9CA 1GXLA 2JLGA 4RZRA 4QAPA 2C3PA 1R89A 2OSQA 5F8IA 3CMAS 3AY0A 3CVKA 1T48A 2QEPA 4RI4A 5HJXA 5IV4A 1HNZF 2E9RX 2G1DA 3OVSA 3MUMP 1X0PA 2DB1A 3GWCA 3GSDA 3H5YA 3DN9A 1T94A 4EO6A 4CLUA 3FEZA 3GMGA 1L5UA 1OHCA 2MXYA 4B02A 1YIJS 1TFWA 2AJ0A 2ZDOA 2NUHA 1SL1A 4PZVA 1UAWA 2QJ3A 4RX6A 1F0XA 2UV8G 5KTQA 4B9TA 3EVMA 4USKA 3F56A 1UPMB 3WBZA 2KXNB 2XZDB 3TX0A 2WOMB 3I9ZA 1HPZA 4RPFA 1VGYA 1DTTA 1S7IA 2SXLA 4JI6F 1WC5A 4EYIB 5ETOA 3DLLQ 4B3RF 1IBKJ 5KFZA 2BGEA 4NMLA 2VEXA 1CJTA 2HQCA 3ET6B 4V1Ak 1NK6A 4NXMJ 2B4VA 2QDMA 3K7RA 2KM8C 3BS9A 4U7CA 2QCTA 2ZN7A 3JAMY 4KT0C 3N01A 2CXEA 2V2VA 3VGSA 3KFWX 4KB7A 1TFYA 4Y2EA 1S57A 5L1KA 3OLBA 2D9OA 1PTVA 2UAGA 3CM3A 3A3OB 3PX6A 4YOEA 2HNDB 1JLNA 2YWFA 3Q8VA 2QSWA 1OQ6A 1X8DA 3B82A 3CDUA 3GIMA 1F5BA 2HZAA 2NXNA 1FX4A 3HKZD 3IXQA 4LFCF 4GKJJ 1X5TA 4OI0A 3O4SA 3BKFA 2YWKA 5HLFA 5KG0A 4JI1F 1C4AA 1XNRJ 1J2VA 1TK0A 1N54B 4PQUB 3E8OA 4OV6A 1G4WR 1XXPA 4OZLA 2YKMB 5KFKA 3CCRS 4DV6J 2L9WA 3MEEA 4KGVB 1HI0P 2CQPA 4B3SF 5A2QU 3R6LB 3PW5A 4DL0C 3NGRA 2FLLA 3G86A 3TX8A 3QGIA 3J7YU 4DV5F 3TAMA 1KSPA 2FJEB 3C16B 2HK2A 3G96A 5LMUF 3KNAA 2H4GA 3T5KA 5F8LA 4A4JA 3PKMA 4FF4A 1EEOA 1HR0F 4NRTA 3PO4A 2KVQE 4RW7B 1YG0A 2Y1LB 2J9EA 4USIA 1JBWA 4A8SA 5L1JA 3PFEA 1WJ9A 2CPEA 4JI0J 1ONYA 2CKWA 3KHHA 2DGQA 1F5AA 1VIOA 3GIKA 2A8BA 1QTNB 1TUVA 1OYEA 3SMEA 1DAXA 1FTRA 2Y1RI 5KFAA 4A8XA 1N88A 1SB6A 2CMBA 2N4CA 2I6JA 3G2XA 5EX3A 3GJRB 1KP6A 1BUXA 2XI2A 1R0BG 2UU9J 4M94A 2VEVA 2KYZA 4ED1A 1VQ5S 4OHYA 1EKRA 4X4PA 2D3O1 1RTDB 1TUGB 3O8WA 2X3DA 1GXTA 4QF5A 2F5GA 3MDFA 4DR7J 1BWVA 4DR3F 3IR6B 4QJVA 1DTQA 2EFVA 5L39A 3VAKA 4DX7A 3CD5A 3IP0A 2B4PA 3CO0P 5KFXA 1FDAA 1Q16B 2OIHA 3J81U 4B3MJ 1DY3A 1RQ0A 5IQQA 4KPYA 1SPBP 1FPZA 1FO1A 1PTTA 1RHUB 1KOHA 4PXBA 3H8YA 4C8YA 4IOBA 4TQSA 1BQMA 4DV7J 2E7VA 4FYVB 4GVLA 1VQ7S 3C16A 4D3GA 1NHVA 2XY5A 2WW8A 2IRUA 1RWXB 4L6V3 1K73T 1SH2A 2ACMA 3D6FB 3LA0A 3NWGA 4NLPA 2ZWPA 4CNYA 2RDJA 4A8YA 3Q2SC 4IOAQ 1VQ9S 1E0DA 1A6LA 2CPZA 3QWPA 2ZZMA 5J2QB 2NXCA 2QGFB 4X66J 4ANCA 3ZNJ1 4H54A 4LT6A 4NEYA 1AZSB 1OSCA 2GO8A 2HMIB 1U2CA 2GIQA 3EVWA 5DLGA 2WTZA 3SQOP 3BQ2A 3GE9A 1IM4A 5H9EJ 1QAIA 1X4AA 2OMOA 4U6PA 1JLCB 2V8VA 3B4DA 3GIIA 1FJGJ 3ILLA 3ENWA 2OTJS 4KPCA 3T1YJ 2VONA 5M43A 3LH2S 2CPXA 3H25A 3QGHA 4IG0A 3PZPA 3Q8YA 5EHRA 2HHXA 1RHMB 4NCAA 1F5CA 4O44A 4QWCA 1JBVA 3QGGA 1HNXF 1RU1A 1QTMA 2HBQB 4DR2J 4JV5J 1DTQB 2EW9A 1QAXA 2APOA 2BM1A 2OPQA 1F9FA 3DU6A 5BYRA 4DUZJ 2PI4A 4OYIA 1PJ5A 3JTNA 3KLHB 1UVNA 3O6QA 2UUPA 5IBMA 3GB0A 4IQMA 2MPUA 2WVFA 1URRA 5B09A 1Q82T 2E5IA 2OKQA 2XEXA 4Y65A 2HBZB 2RQMA 4A8FA 4A48A 1UFLA 3BEGB 3VTIA 1HNWJ 2IVFB 1EX8A 1PYNA 3MAAA 1QAJA 3UDVA 2WGPA 1WF1A 1N5SA 1R8CA 2XO6A 5F9LA 2D3ZA 3QFHA 1FKAF 3MMCA 1VMBA 2G4BA 1KTVA 4WYLA 4F04B 3AJ1A 4NXNF 4HHHA 1PYOB 1NK8A 1HLWA 1FWKA 2R7TA 4Z37A 4FDFA 4M5GA 1UL3A 2P6SA 4X65J 2QLBB 2B56A 1M5SA 2W4DA 3HHLA 1LWEB 4RNNA 3CCMS 1BE4A 2VA3A 1EZZB 2BW7A 4TYAA 4OI1A 3C19A 1SC1B 2F6ZA 4DUTA 3DM2B 1CULB 2X1FA 1QLNA 2EFGA 1GFYA 3Q8UA 2C2DA 1G1XA 1OESA 1NU4A 3J7YI 2HNDA 3LGNA 2POKA 3US5A 3FC9A 1UJ4A 4G1QB 2OPSB 5JJBA 4YFUA 3TQ1A 2VJVA 1U48A 1N34J 1NZ7A 4M5DB 2D41A 4LF7F 2BGDA 1RBLA 2IVMA 3K2YA 2ZM6J 5IWAJ 2RRAA 2B9XA 3BBFA 3L7PA 3AH6A 2BRKA 3D0HE 4M5LA 4Q43A 3QLHB 4FPIA 2LEBA 5FD1A 5EHPA 5AXKA 1FE4A 4ZVFA 2GP0A 2OO4A 3ZM0A 1ZAWA 3QJLA 4YR3A 2NV5A 3TQEA 5CQGA 2KB2A 1EARA 3F9BA 4ZI4A 2J9DA 3L4BC 4O3OA 3V4IB 2E9TA 3OL6A 1EETA 3ZFVA 2WVEA 3MTKA 3KMSA 1T03B 4LF5F 2FD2A 1AUSL 4E8UA 2GGPA 1VHRA 1U0SA 3CNQP 3LW5C 1V5IB 2HQDA 6FDRA 1RA7A 1S77D 1S1WA 4RW6A 1NSQA 1EHWA 2CJ9A 5KFUA 4ZJQA 1NPKA 2ASDA 1KONA 1RISA 2D1CA 1CLFA 4C3MA 5J2MA 2H04A 3OR2B 5DO2A 2UVRA 5A6PA 1XERA 3T5HA 5J1NA 5L1LA 1XXVA 4ZN1A 2PC6A 2N3OA 2RDIA 3MEDA 5A8WA 2AJFE 2P8IA 2VFUA 2B4OA 1VBZA 1RTJB 1ELOA 1T3OA 1VRUA 3GFHA 1FK9A 2DNPA 2QYGA 3CD7A 1JNZB 3P5BP 4I2PA 2VG5A 1TQLA 1ZBTA 4OYZA 4QR0A 5LXYA 3M9NB 1ZC0A 2V8GA 3NCQA 3J7ZT 3BSAA 4E2FB 4DSJA 3EZ5A 5KOXA 3DGVA 3R5JB 2MLZA 3H4BA 3V0HA 3L09A 3M2UA 1U1RA 2ZE2B 5LSLA 3GSIA 3G87A 4PG5A 2YNFB 5KT6A 2BBEA 5JVHQ 1RTDA 4OHLA 1RAGB 5JVGQ 5K22A 4P10A 2HW3A 2B51A 2XMWA 2YNIB 2FHJA 3CW2C 3Q89A 4ED5A 4G6VB 1Y0HA 1JNRB 4X4SA 1HARA 2VV5A 3W62A 3BO4A 4P2XA 1CJUA 5G4DA 2NCKL 4ES3A 2WSCC 4IQXA 5J8RA 2V94A 1WG4A 4ANDA 1RGVA 5IOLA 5A0YA 4JI0F 2GJIA 4YB7A 2CQIA 1EETB 3V4MA 1TVRB 2Y0SD 4C97A 5JXSA 4XO0A 3RAQA 5HMXA 2DR8A 1B0PA 4MK7A 3G6YA 3O4TA 3FGVA 3MFHA 2ZH4A 4WFNQ 1YWXA 3GV7B 4F4ZA 4WYWA 5C24B 5KA0A 4TY9A 2U2FA 2G9OA 1O6XA 5MAOA 4OYOA 3HSDA 5M2UA 5F8MA 3PM9A 2Y96A 2J17A 2B6AA 3M8PA 5IT9Y 1NDPA 3V6HA 4ZMMA 2H1YA 3HSZA 3SCKE 4H4OB 3WQPA 4B9UA 2BZLA 1NJWA 4U95A 2F4FA 4RKKA 5HANA 4DV3J 5IV3A 3S8SA 4N56A 3MPUB 2R8IA 4LFCJ 3QATA 4OYXA 4MK9A 4G3IA 1S9EB 2OPRA 3G82B 3R7NB 4R8UA 2O01C 2V8PA 3GFXA 3N0AA 3SQGA 4ES1A 4KAIA 1ZA1B 5CYQA 2C3UA 3K59A 1OIAA 4B3MF 4C11A 5L9XA 1IBLJ 4KGMA 1YRTA 4BWJA 1VJWA 2IAJA 3MPWA 2CDQA 3ENQA 5E7OB 5DQGA 3G71S 1C85A 3UDLA 3EB1A 4NLDA 3SMZA 4AYBD 4TVVA 1MWYA 2PN6A 1NZ8A 6FD1A 5HVGA 2JLFA 4KY3A 2XY6A 1TL3A 2WAQD 3D66A 1S12A 2DXFA 1K9MT 1W78A 4K4SA 4ZPDA 2HFSA 5HI7A 3ZO7A 1HHTP 4M5MA 1TL7A 2C3OA 1R43A 4K7QA 1P31A 4FKYA 2X5OA 1LWCA 2DHHA 2HGNA 5E3CA 3OXGA 5IFMA 2DRBA 2OLWA 3R2DJ 1NWLA 4EMDA 5KFNA 1RLCL 1AXQA 2VB6A 1KS2A 4M5IA 1LKZA 5EWEA 2V67A 1M5OC 2K06A 1OY9A 3T1YF 1FJ7A 2XSJA 1YJ9S 2DBBA 3ZZ0A 1N4LA 3UN5A 4FF2A 2W9AA 4LR8A 1QVFR 3QCBA 2XO7A 4XDDA 1UEKA 2A3JA 3DDNA 2DITA 4JV5F 4K4TA 4GRSA 3I6PA 2VFRA 4ZPAA 1GXUA 3V81B 3VZHA 3TAQA 4DQSA 2XM3A 1XR6A 2NSCA 4C11B 5KFHA 3IO1A 3DHXA 2J16B 3I4PA 4DR4J 4QIWD 4GKKF 5M2PA 1ZETA 3CJ5A 1N0VC 4WBFA 3DLJA 1FDBA 2G6ZA 2BEFA 1B3TA 2NXJA 4DR5J 3PFOA 3B6BA 3CJ4A 3Q86A 5C25A 4P7VA 5CD4A 2L41A 4C12A 3EGWB 3EWGA 1N6QA 4YUDA 1TL3B 3MURP 3E2EA 3P49B 2JVRA 1UZHA 3DOMA 1WNEA 3IAM9 2X1BA 5IXUA 3M4UA 1R3NA 1LK5A 5B0FA 5IZHA 2UUBF 5D0HA 1LWCB 3CGIA 5KG1A 1H3DA 2GAGC 3I96A 5I4MA 2IHR1 3P3DA 4F36A 2AX1A 2V2ZA 4ZS6A 4BC9A 4NNDA 4Y0FA 1VR6A 2GGPB 3K89A 1JJ4A 4JI3F 2AYEA 2ABYA 3UD5A 1S7HA 3LGHA 3NG8A 3MOZA 4TY8B 5DM6Q 4JI6J 4HI1A 5GAEI 5LSRA 1B99A 1LV5A 2CPJA 2HAIA 4CM2A 3DLEA 2XQCA 1SUQA 1ZS6A 1N8RT 3QSYB 2PSZA 1U1OA 3GP9A 2ASYA 1YTNA 2QV6A 2GHVC 1HIYA 1VYAA 3SV4A 2MB0B 4LMZA 1NDCA 2CPDA 1X4CA 2BANB 3PG9A 5KG7A 2B9WA 1PTUA 3QIPA 5JUMA 8ATCB 3CCLS 3MEKA 5K24A 2CQCA 2G1HA 3I55S 3J7Z5 2P6TA 4LF5J 5DQIA 4LF6J 5C7PA 2ZJPQ 3THPA 2RB7A 3M6VA 5CD4H 1SKSA 1K47A 4EO8A 4GKJF 5K9VA 1R0AA 2X51A 3DXSX 4NLUA 4ZCKA 4ES2A 8AT1B 1AFIA 2VBYA 3AA9A 3GYNA 5D77A 2ILZA 2X3GA 1F2HA 5E5NA 4F26A 2VL1A 5G0RB 3IS9B 4CWBA 2V4QA 2NSBA 1RXDA 2NPFA 2XCPA 4EK2A 1YGUA 4B3TF 4EBCA 3J81Y 2W8KA 2OTLS 4E0DA 2DRAA 1SUGA 3BM7A 4QW8A 4KGZB 4C48A 2RSQA 2BA9A 3CJSA 3V6DB 2VDIA 3GR1A 3FVYA 4DV5J 1PH0A 1T05B 1Q6PA 5ETQA 3RB6A 3OFFA 3EDRB 4JI2J 1R6YA 2IDEA 1H2UX 2V2QA 3HVTA 5KA7A 3WZ0A 2NUUG 1NO6A 4RR5A 2B6AB 3M8PB 2RS8A 1CG2A 3CF5Q 4CDIA 3BB5A 3T1HF 5D6GA 3PIOQ 5LXQB 3JSRA 2YDUA 1KVIA 3MTJA 2B5JA 4B9SA 2E0TA 3KK2A 3KDOA 5HLFB 2BDPA 2A6OA 2H02A 3R5BA 2OUGA 1FI4A 3BGFA 3GPAA 2IMOA 3DXBA 4JBCA 4LRFA 2I6WA 4OLPA 2W1BA 3QIPB 2E29A 4IKAA 3G9CA 3E3XA 3FQKA 2ZHOA 3LP0A 4NYHA 1MLAA 1MN9A 2MHEA 4RNFA 1QJHA 1SC4B 2QLJB 2MQMA 2UU9F 2H4KA 5FDLA 2JFGA 2BRLA 2DJWA 2I3UA 3AOCA 2MSSA 4F8RA 4DG1A 4LSZB 3PEHA 3HLUA 5BYQA 3T5LA 3EGZA 5A8RB 3KG4A 4HACB 2VC1A 5ADZA 3M8WA 1I94J 4DR3J 4Y28C 1BD6A 2CWXA 4TXSA 1RBAA 4LSLB 4ALZA 1SQGA 3W2WA 2CM8A 3CJKA 2H4YB 4NYZA 5LJ5Y 2PIIA 1T9UA 4MKBA 3LOUA 3RB3A 5K9WA 2F9JA 3TA1A 2ZH5A 1BMQB 4LF9J 2UUAF 2ZVIA 3FMBA 3KLIA 1WACA 1HHSA 3VAIA 1LARA 5LL6d 4WPAA 2R7OA 4MAKA 1T4JA 4O3PA 2V9WA 3UVJB 4RDDA 3TWZA 3FKBA 2AU0A 3NNHA 5BXIA 4CNZA 5KFEA 3KOAA 4QYZJ 4DI6A 4QPXA 4N5SA 3PY8A 1S4EA 3N4WA 4MIAA 4QWDA 1OPIA 3E01A 3OJUA 1NPRA 4LRDA 5DDPC 3J80U 4MIBA 4Q2LA 4X65F 3MPYA 3BGLA 4OZ0A 5I42A 4LIRA 4USMA 3R5AA 2LECA 1FD2A 5H9FJ 4RKUC 4Y3CA 3KJVA 3K58A 3SIPB 4DEZA 1JLQA 3TEGA 1YI2S 2XMTA 4KR0B 4NLTA 5K8NA 1E6YB 2RHQB 4KYZA 3JAMU 2ZBIA 5B7WA 5F0UA 1KQSR 4UY8T 4RO0A 2MQQA 3ELHA 2M8HA 2MKKA 1TK5A 1GQQA 1NO8A 3DLBA 5D15A 4RNOA 3NGDA 1S99A 5F3TA 1YPTA 4WFXA 1JLEA 1VK8A 4ZVTB 2B43A 4J9VA 4YDDB 3QT6A 1RK8A 3DOMB 2VPXB 3DGPA 4MFBA 2OD4A 1T9XA 2DH8A 4DCOB 3KYLA 9RUBA 4RHGA 2DNZA 3ZL8A 1TV6B 4XTTA 1TK8A 3CDWA 2EC2A 4NLRA 3TZWA 4B9MA 3TJAA 1YJNS 1KNZA 5EGYA 2DCUB 4ED7A 5F8NA 2RIJA 3G8QA 2MKIA 5H1SV 3LGMA 3NRBA 3GIJA 4BUCA 2W4CA 2HNPA 1YJTA 3LO3A 3QMQA 1H72C 2DNYA 2R7QA 3ONQA 4EI2A 1N32F 4UQGA 4HTJA 2JFHA 1D8ZA 1Y3JA 3MECB 3FBCA 4ELVA 2RU9A 5AXLA 3RRHA 1WRMA 4OYBA 3TUJC 3DLEB 1OY6A 3FDSA 1NRKA 4NA1A 2OEMA 4ZCMA 1GTEA 2GZOA 2AX0A 4C2MA 4PUOA 2ROPA 2XB2D 2PBNA 4DDFA 3C6UA 2BJ1A 4IDKB 3KWMA 4ECUA 2QBSA 3V6KA 2R7VA 2BANA 1XM2A 1LWFB 1VI7A 2BE9B 5LXRA 4OX7A 3P4UB 1WC6A 5KFLA 3UE2A 3GCXP 5AE3A 5A8KB 1X0FA 4C8LA 2CMCA 2OZ5A 3J80Y 2K2PA 3SCLE 2LQ9A 1NLKL 4ZPBA 2RU3A 2CJQA 4X84A 3HMJG 5A5EA 4Y2IA 4CO3A 4UY85 1VQ6S 2Y1JA 1RT6A 1UWBB 4WXWA 1X60A 4HI2A 5L8RC 3UW1A 2F6FA 2QCJA 3GJSB 2VTDA 3NGTA 1IWAA 4K8RA 4PKDB 3R97A 1BQNA 2NLKA 3LPYA 4F7VA 3TO8A 3KLGB 4PQAA 4R0TA 2WZ1A 4OLOA 3L7OA 1VQ8S 2FY8A 1FRIA 1HWKA 1OEVA 3C3LA 3CCWA 4EYHB 3AHPA 3QO9A 4OHXA 5K9FA 2W2NP 2V4RA 4KKOB 3SV3A 2M52A 1DLOA 1NKBA 2F4VF 3ULHA 2M4MA 3W5YA 3UR3C 4F0MA 2VHGA 3P5TL 1TAUA 4GWFA 3S3FA 2ZDPA 1DRZA 3AD7C 2HQFA 3I82A 1RTHB 3ZZOA 2BACA 4NE9C 4JI8F 2U1AA 1C2PA 3MM9A 4K2XA 5SZTA 2OPSA 5GADU 3KLFB 1FF2A 1TL1B 1G1FA 2I5XA 3HJFA 2H4WB 2PO4A 3BQ1A 3R2CJ 1Q6SA 1KR4A 3OPKA 4CLTA 5HMZA 3EPGA 5ETSA 2QDPA 1NBEB 4TKTA 3C46A 2B5JB 1B0VA 2E44A 4ZLJA 2OELA 4FYWB 2CNIA 2V69A 5E3AA 5GAHI 2CQ3A 4OHWA 1BZHA 1CJVA 4OJ1A 3DLGB 4AXIA 4LQ3A 3QFWA 4ZHRA 2BE2A 5DM7Q 1CS4B 1RT4A 2J9CA 4JI4F 3EUNA 4DPXA 4K4VA 4QQBA 3MM5B 4F25A 3MI7X 3OVAA 3B8HA 2W8LA 1RAJA 2FJXA 1ZAVA 1Q95G 3U7JA 2OGUA 3CE8A 1GG4A 2R2UA 3HHNB 2E1CA 1UAGA 2XS5A 1XN9A 3ZZZA 4NWBA 3DRSA 3RGQA 1FERA 1F60B 1FTCA 3S7RA 1U1KA 1ACMB 3HT0A 2KH9A 5DG7A 2HMIA 1XWLA 4M1KA 4YMEA 3OV7A 3NCRA 4FF1A 1RAOA 2CNEA 2V4JB 4HJQA 2J7UA 2BUNA 3DOLB 4DF4A 2I75A 3PYZA 3S3KA 3C15A 3LP2A 4OV1A 5H9EK 3JB9k 2CZ4A 2R9LA 2EXUA 3MMAA 2R2RA 2E7WA 2Q1LA 1UFWA 2V0NA 3AQOA 3D0IE 2HZVA 2VEYA 7FD1A 2QA4S 2AT1B 3N2AA 1RI7A 2YKPA 3W8PA 4QUNA 1C87A 3M8SA 3MM6A 4OL8A 2CFVA 3I0RB 3O1LA 2CDRB 2IJFA 4WFAQ 1GWZA 3R5CA 4KSEB 4KBIA 1YGYA 2F7VA 2NYHA 4C98A 1NHKL 4AT1B 1S1VB 4Y34A 4DGPA 4DFJA 2BKOA 3HCXA 4PPZA 1TKXA 3PHEA 1UP1A 1T11A 2LYVA 2RT3A 1RCOB 3TUPA 2RUSA 2W9BB 1CJVB 1XQIA 3PHTA 2MZQA 3C6TA 4F67A 1IM6A 1QSLA 4BHQA 1PAEX 2I3RA 3EJMA 2NZ4A 4NLSA 1IBLF 4QW9A 2Q05A 3OJSA 3VAMA 2I5JB 1IKXA 4P9SA 3LALA 5LOQA 4DR5F 4ED8A 3DLHA 1MWZA 4M5KA 4DL5A 4X4RA 3I5AA 3PIPQ 2F6WA 1MWQA 2E5HA 1G7FA 4DN0A 3AQPA 3QCMA 1KHVA 4OJ3A 2FC8A 2UV8A 4K59A 5DRKA 5BJRA 1S6PB 3PR4A 2MQOA 2DGVA 2XZWA 2LU2A 3VGTA 3LWMA 3DOLA 3HKWA 1KRPA 3MR2A 1S5ZA 2PMZD 3HM9A 1NZAA 1U8SA 1XRIA 1HWIA 2AV5A 3NWRA 5EUHA 1OJ4A 2DK2A 2YBVA 3DRXA 3IGVA 4LRAA 4URSA 1JKHB 2KL8A 4QWEA 1T3NA 2H51B 3K0JA 1HPZB 4YP3A 5HATA 4KH1B 1C88A 1UVKA 1HWUA 2HHTA 4LFAF 4ELUA 1N52B 4R30A 2MKJA 1L3TA 3I87A 4X4NA 5LMNF 3A4TA 4NLGA 1EENA 1VRTB 4CVKA 2FZGB 3H0PA 1PYSB 2DNMA 3H5SA 2WVCA 5KFGA 2AJ4A 4DL2A 2IBKA 2LEPA 4Z2XA 1JLBB 3A12A 3LF0A 1DARA 4JV0A 1M5PC 3QRQA 4JOUA 1UVIA 1ITPA 3W1YC 4IDKA 2H9ZA 1FRXA 1N5QA 3AD9C 4DBQA 1J5EF 2LKZA 2ZC4A 4BCAA 4DR4F 1H6KX 3OQ2A 1UFKA 3GZ7A 2HWTA 3PRDA 4WJBA 3CIZA 3OLAA 3G6ES 3EXCX 4HT7A 2HHHJ 3VHQA 3QJJA 2YNHB 4IRCA 2RE1A 5IT4A 1WOSA 1XEZA 4RUHA 4J9RA 4PQUA 1RT6B 1UWBA 4W98A 4DU8A 4DSKA 1YZ7A 2OMLA 1G4US 1ONZA 1A7GE 1JJHA 2DY1A 3KG0A 2IPOB 1JLFB 3GR0A 1VBKA 2ZKUA 4NI2B 3TZYA 3MR3A 2ZZNA 1TMJA 5BUGA 2CPHA 3M4XA 5J1EB 1Q6JA 2FIUA 1VQMS 2OJ3A 2M5YA 2DHSA 4IRDA 1LW0A 4WTOB 2CJYB 1XMBA 2I38A 2GJ2A 3SDEB 4ER8A 4AUKA 3DFEA 2PMWA 1DLOB 4UAGA 2MZ1A 4NZ7A 5GMKa 1TELA 1JLCA 1IKVA 4IG3B 3R9LA 3PR5B 4I67A 4ZVRB 4P52A 2LQ5A 5CYMB 4HJPA 3EMUA 4ZA1A 2CNGA 3RR7A 2ATCB 1C4CA 2MHNA 2FUG9 2BV5A 1HFEL 5F8GA 4Q44A 4IR1A 1RP5A 1F3FA 4IR9A 3QPIA 2FVQA 4JMKA 2BMBA 4CO4A 2D69A 4OZ2A 2HS0A 4GE6A 2HVDA 2O1PA 2AWZA 3TJ9A 3PVXA 2J0QD 2WB1D 1GQYA 4FVMA 4ZP7A 2W7AA 2VH7A 4RJVA 4ZITA 5D4LA 5K14A 5K8MA 2HNZA 2ERRA 3C14A 2YH1A 3O44A 1S0OA 1JMTA 1T9YA 2FHMA 4OHIA 1TUWA 3MM5A 2C28A 4X4QA 1GNKA 2JVOA 3JS9A 3MAAB 3IR5B 1WSRA 4M5JA 2M3VA 5KFYA 2I4GA 1JX4A 2GNKA 3IM8A 4LVNP 1F2GA 1WOOA 2M9KA 4MMOA 1KN6A 3DRSB 2UXBJ 4JI8J 1WCHA 1KHWA 2FHJD 2PFDA 4ZP9A 3S01A 4HYKA 4XIUA 3KHGA 5J1EA 1VC0A 4CVLA 3IA0A 4I4BA 3EMTA 2R42A 5F0WA 1H0HB 4JB8B 2MTLA 2Y0BB 2UUOA 1KAKA 4TQRA 3HF5A 3V0FA 2CJAA 1ZZNA 1ZAXA 5B0EA 1ICEB 1SC3B 3SDEA 2FDNA 3NP5A 4ETZA 5BZXA 1WF2A 2H65B 1RT2B 1Y3KA 1FEHA 1L3SA 2JH3A 4S0MA 5BR8F 2MMYA 1NJIT 4ZIYA 2DR5A 2ZBCA 3Q23A 2C2KB 4ZOSA 1KQFB 4JI4J 1N56A 5LT5A 3S6EA 4WP8A 3SXLA 2BJ7A 1UEUA 1ZA2B 2C2EA 1CJTB 2ZJRQ 5KFVA 1CJKA 2GX8A 2DRDA 1JXVA 3HN7A 1NDKA 1WI8A 3EGNA 4Y2AA 4DXLA 3GV5B 3D4JA 1J5OA 2R8JA 3T1HJ 2GC8A 3IBFB 1FVQA 4ZVPB 2IJNA 2ZH3A 3RJMB 4CT9A 4PXDA 1NB2A 1RTIB 2B9YA 4EWTA 5CA5A 4X62J 4Z7YA 3RYLA 5AT1B 3SSQA 3HZGA 1N5YB 3GG1A 2MDAA 3M8QA 5KG4A 2NR0A 3M7VA 2KFNA 4HRFA 2KHCA 4FP9A 4ID5A 3TW0A 4X4OA 2PQ5A 4GFVA 1UMJA 2A2DA 4I6AA 4LJMA 3RBXA 1T49A 3CCQS 1MG7A 2I5JA 2RAQA 1AUDA 4Y6IA 4M5NA 2ALYB 2XMJA 4X4VA 2HY3A 7FDRA 3SSRA 4IRKA 5F8JA 3MCOA 3T3FA 2AW0A 5KG5A 2Y68A 1Z1ZA 1YRUA 3CDEA 5IM0A 1JJ2R 4CTAB 2EI5A 4NMXA 1I94F 4QAHA 2AHOB 4I69A 4DL4A 5HBMA 2YQ3A 1XIQA 3EPIA 2W4PA 1UEVA 2XYPB 1TKDA 1S0MA 1YJWS 1XBOA 2KT3A 4KHPJ 1YFOA 5AWXA 4DMZA 2AEMA 4GFUA 3KK3A 1U4BA 3RUBL 3TAMB 3MM7B 1RCXB 1PGZA 1RHQB 4PWUA 4RLEA 2HFOA 2XHCA 2MQPA 1YLXA 5HP1A 3QAUA 1XR5A 1NPPA 3U96A 2CVIA 3JTPA 5DG8A 2QBQA 3BBBA 2HLTA 3PYEA 2FPHX 4Q0BA 1JXEA 2YPZA 1N32J 2V2KA 5KFFA 1LWEA 3NOCA 3ISZA 4ECRA 2EC0A 2ZEJA 2J8AA 2GW8A 4ERDA 3JSBA 5A8RA 2MQLA 5KAKA 1VBXA 1FT8A 1HNVA 3SYZA 1RAIB 2A10A 2BJ9A 4AFFA 4DHVA 5HROB 2L48A 3NNAA 2UXCF 1FXLA 1OSDA 3CB4A 1GX6A 1JLAA 2WVBA 3NRSA 4GRZA 4CYUB 2GMLA 2KFYA 1G6BA 2LFVA 4LIWA 2XPCA 2DIUA 1L3VA 1WC4A 1OEUA 2DEJA 3BGRB 3OHAA 3AODA 2RKIA 2YNGB 3TUIC 2XY7A 2EWHA 2AD9A 1XMOF 3ZV2A 1S6OA 2X7IA 3RGOA 2DNKA 1NSPA 4WZMA 2MKCA 1G4CA 5I3UB 1MU2B 1J27A 3ISND 5J2NB 3CD6S 1PTYA 3I4HX 1IVZA 1P8GA 4LBHA 5A6WA 3NNCA 3AA8A 4FXWA 4NXMF 3FCHA 3OTCA 1VLOA 4O4GA 2EG2A 1FRKA 5ETLA 3U1NA 5I42B 1FE0A 1U6FA 2B7BB 3IRXA 3KUGA 4OHVA 4USVA 4ZN3A 1T9WA 3KK3B 2AJ2A 4KH0B 3SR9A 1WOPA 5C42B 4PCQA 2UZAA 3UNGC 1VC6A 3VAHA 3NMEA 3UD4P 3OHBA 2ZH8A 2MKSA 2B3TB 4HT5A 2Z2LA 4DU7A 4C8MA 5F9NA 1YZ4A 3ET6A 3RRKA 1FFGB 2VFTA 5MMZB 1NDLA 1PKUA 2FZKB 1RKJA 2QYCA 4ILLA 3H2UB 1RADB 5L9NA 1AA1B 1CQMA 4OZ3A 4DUYJ 4ECZA 2HFZA 1U2RA 2Z56B 4I2PB 5D4OA 4F2SA 2JDJA 3CJ0A 4PG7A 2CNNB 1JIHA 5HROA 1U45A 3MD1A 1JXLA 4CCHA 2BJDA 3H5XA 3KG1A 1Y10A 3NAIA 4MFBB 1LNQA 3HHLC 1HD0A 1QE1A 1S49A 4NZ0A 4DCPB 1YJ7A 1TL7B 4RW9A 3VAFA 3BJYA 2VOOA 4TLRA 1Q4RA 3PCOB 2OD6A 1D9DA 1VQKS 5ETVA 3CCTA 4LBIA 4URGA 1KD1T 1RZMA 1C0UA 4IG0B 4ILRA 1WSVA 1GAOA 3B54A 4WFYA 4B3SJ 3RW7A 3KUHA 4USUA 1OQ3A 3HSGA 2QTWA 3NY0A 2IM3A 3I32A 3IWNC 1PA9A 1KBRA 1F1BB 1MMLA 2QE5A 3BGUA 3QT5A 3JSMA 4PEOA 3GJTB 5E3RA 3G4SS 3GYXB 1FXRA 3Q24A 5LMUJ 4NRUA 1HD1A 1NKEA 1HR0J 2E5GA 2FVRA 1OHDA 1Z2LA 5KA2A 3CMES 5EWFA 1HA1A 5C42A 2ZH2A 2OH2A 2QLXA 4ZVQB 2XYHB 2KM8B 2ZH6A 4ECWA 2O5DA 3M6WA 2CNFA 2C3MA 1A0OB 3HFZB 2IA6A 1R0CB 3AOAA 2Q3PA 4RW7A 1EQ0A 1G1GA 2ZFHA 4Q45A 2FJMA 3FZBA 2JEFA 1PG5B 4OMFG 2EPIA 1WD6A 2VD3A 4OHZA 2WVDA 2XTJP 5A5FA 5KOWA 3V0JA 3HHLB 4FVCA 4KGKA 1IKWA 2KYXA 4YEAA 2KU7A 4TLQA 4NLWA 3M9OB 3SQGB 1AT1B 2P2CB 2OOQA 1NNDA 1NHUA 4C3LA 3KTQA 4P2SA 5ETKA 4DV4F 1ZZWA 2HIYA 1SIZA 5CXTA 2PEHA 2W2QP 4PG4A 2XCAA 3UO0A 3V0IA 2JEGA 5KFPA 1P6TA 2L9NA 3D7SB 1WKLA 1B0TA 1E6VA 4ZPCA 3UDEA 1Q5VA 1CC8A 1QY7A 1TL4A 2AMCB 2P9CA 1DQ9A 3D6TB 3JSMB 1VQSA 1RTHA 1IBMF 2HHQA 2KXFA 2UXDF 2XNQA 1FKPA 3N6LA 3AWGA 1KLMA 3WDOA 1NAQA 1QVGR 2CNHA 3B7OA 4NZ6A 2IMGA 3KJNB 3N28A 1D1UA 2WK4A 4NXNJ 2N7YA 2O67A 2QFJA 5F8HA 4ZRTA 1H73A 4L3NA 2Z58B 4X62F 2BYCA 3OTBA 2H5EA 4QDIA 4OZ5A 2E1AA 4ZDNA 4RW8B 3S1TA 3UN2A 3WIVA 4IH5A 1REVA 4CH7A 4F3QA 2HG4A 4R0SA 3BREA 4YB1P 3IBCB 4NX9A 4FYYB 3QCLA 4R0EA 4JP8A 5J2MB 3OR2A 2ADCA 1RAHB 2OAUA 3FK4A 3DNCA 2PEBA 2ZOMA 5E3QA 3UPFA 1R0AB 3NGKA 1FQ1A 5I3QA 1T8EA 2PDAA 2ZOGA 4I1TA 4XK8C 2ZD1A 5I3PA 4DPTA 1IQZA 4HR2A 5DG9A 1JJCB 4CO5A 1G7CB 1PC4A 4U67Q 4NLOA 1HNXJ 4C9DA 5G0RA 4ED6A 2R4FA 3RG6A 1BZJA 4TNOA 3K5OA 3MM8B 2HFUA 5J2PB 2A6MA 1NSAA 2G2OA 2CQ1A 3QAEA 4ZVHA 2Q66A 2PA8D 4I0WA 3DU5A 2ZH1A 2F46A 3JSYA 2UVWA 4J7CA 1RWOB 3HDSA 2ZZTA 3KHRA 1TKZB 3CJ8A 2XMMA 3DOKB 3UNYA 1P9YA 1L3KA 2KT5A 2OPQB 5IQ6A 3BGOP 4DV1J 1MSWD 3CDBA 4GVBB 4ZPTR 2VPYB 3GQCA 2VPWB 3V6JA 2R8KA 1FDNA 1NK9A 1SVDA 4W4MA 3V0EA 4B9LA 1UVJA 2HEKA 3DRYA 5SUHA 5A0YB 2DHXA 1I5OB 2RILA 3QNWB 4N76A 4F4XA 2I6PA 3W5ZA 2DKOB 3BSNA 1UJ5A 3O2IA 2VUGA 2WSFC 5DQHA 4Q8EA 2DIVA 1Q8IA 2RD5C 2ASLA 1NEEA 2NS1B 2ZUGA 3KJQB 4TY8A 3HO1A 2UXCJ 2HHVA 1FGSA 3AB4B 4QBWA 1RABB 2AM1A 3IFEA 2E1RA 1IUJA 1R8AA 4P72A 4MIWA 2VJUA 1ZTTA 4LVOP 3EZZA 3A3PB 1SUQB 1UPPA 4U9RA 2A2CA 1L3UA 5HAOA 2MY7A 1N34F 4H4OA 4GC7A 1Q81T 2KRRA 4FXVA 4LF7J 1K8AT 1WHVA 2JFFA 5GAEU 1X4GA 1YVFA 3TOQA 3FFIB 4OJGA 5LJ3Y 3IN5A 2QEXS 2OPRB 3G82A 4LSLA 4EUVA 3FUYA 2C2RA 3M8YA 3W2WB 2PI5A 3BN4A 3EGVA 1Q1MA 2JJDA 2YX1A 1J5EJ 1URNA 2XMVA 3AB2B 1JK9B 1PILA 5EWGA 4M5DA 3I7ZA 1YJRA 4WWSA 4HDHA 3DOKA 4LSNA 2CPFA 5KG6A 4CT8A 4MBBA 1QUVA 1MN7A 1WELA 3H20A 4IO1A 2GQQA 5EX0A 3UVJA 4CH1A 3G6VA 4CVMA 2UXBF 3UWTA 4E98A 2F3JA 1RAFB 3V4IA 1JWWA 5KT2A 2FJVA 1LXNA 2Z30B 4H4KC 4MKYA 4NX8A 5HK4A 4K2JA 5GADI 1WHYA 1CPZA 1BZCA 3QZ8A 3Q2TC 4QWBA 2XMKA 1QAYA 3AXMA 2CM7A 5T7LB 3Q22A 1LXJA 3HVTB 1WWHA 3FCWA 1YSJA 3I80A 4GRYA 2HPUA 1X5PA 3N6MA 4CI0B 3EU0A 4QUMA 1IXKA 3CJ2A 4WKYA 1SJFA 3HSJA 1EAYC 1AYEA 4G65A 5IBSA 1PBUA 2AZ1A 4QIEA 4PRFA 1AZSA 3P96A 4ITSA 3ICLA 4MTPA 2AKWB 4DFMA 3PX4A 1GT8A 3GONA 3NL0A 4WIQA 2VG7B 5CAAA 3MVNA 1HQUB 3KK1B 2JEJA 4DQIA 1JLFA 2CQ0A 2BX6A 2H48B 3OXFA 3IR7B 4NI2A 4P7TA 1M0SA 5DGBA 3DLKB 3M2UB 1RT5A 4OI4A 1P3DA 3O5XA 5CH7B 3TEHB 1LFPA 3A8JA 4LSNB 3PW2A 3ZM5A 2GQCA 2A18A 3OT9A 2AIRB 3FBFA 1H7XA 3H2VE 2VEUA 3QCKA 1IKVB 1H98A 4TU8A 2GIRA 2GVDB 3R1LA 1N33J 3CJKB 2HVEA 2FC9A 4KJIA 1RDRA 3VR1A 1X24A 2Y2FA 4J9SA 1TVRA 1FDDA 4FBTA 3KXDA 3M6UA 5CCMA 3OFGA 2CNLB 2M3DA 1Y7PA 3P8BB 3RRGA 4N47A 1Q6MA 3ZM2A 1X31C 1M1GA 3SSSA 4KHPF 4P74A 1UKUA 2CPYA 4FS1A 2JZ5A 3HXMA 4UF4A 1HW9A 3CSKA 4KV8B 4USTA 3K5MA 1BWEA 2MYFA 4DPOA 4DV4J 1LOUA 1W2IA 2IYIA 4DV2J 2UUCJ 1QXKA 3BKUA 3EX7B 4LF8F 1ZM3A 1U24A 2GVZB 1HKAA 2AQ4A 4DV0F 4M5HA 4NL5A 2Z2MA 3GV8B 4RBUA 4KRWA 3HT3A 1WC3A 4QYRA 4WZQA 1HQUA 3WC0A 1IBMJ 2Y8YA 3N5FA 4P2FA 4C7QA 4ENOA 4ZPWR 4W92B 2UXDJ 5CHCB 1FRJA 4NWGA 2R7XA 1K44A 1RU2A 2NTAA 5IT9U 3OL9A 4CLZA 2CQ4A 3HVAA 1T0TV 1RT5B 3VVTA 2KZMA 1WF0A 1G7GA 3QCDA 2QBPA 3HD2A 3ZC4A 2JC0A 4K4XA 4ZJOA 3T6BA 2OHDA 1V3AA 2FJNA 4HV4A 2LVWA 2QIFA 4KE5A 1O5JA 5E0OA 3CC2S 2BKPA 2RS2A 4ZP6A 1NH8A 2BW2A 1BC6A 2KTQA 2HGMA 2HRYA 3OD2A 2QLFB 3MMBA 3OR1B 3J7AN 2EK6A 2CQDA 3FSXA 2WSEC 2D3UA 2UUTA 3I0SA 1S79A 4Z7CA 5CCLA 2HYIB 2B8QA 4JI7F 2CYYA 3N0VA 4LR7A 4ILMA 3BM8A 1J5OB 2V8DA 2ZNYA 4DPWA 1P9QC 2QN6B 2G2ZA 3LWLA 2OFGX 3QSIA 1UJ6A 1GMUA 1CVJA 1N0UA 1RTIA 5KG3A 4ECTA 2R8GA 4ZCLA 4CRJA 3ETOA 3DRRB 2WRMA 4CO0A 4CO2A 4DQQA 2I4EA 3OUYB 1XMQF 3LAMA 3R6GB 5B0CA 2C3YA 2YWGA 2FLOA 3MR6A 2V63A 5A8WB 1WG5A 3D28A 1XJWB 2RH3A 5KFOA 2HNQA 1QSYA 1SH3A 2HWHA 3W9JA 1A5YA 4RNMA 1YK9A 3FFIA 3V5RA 3NLCA 2YTCA 3CWEA 3UCGA 3MFIA 2HVLA 5B0DA 1M1KT 4WFZA 2DEIA 5THWA 4ZCIA 1L8KA 4YR8B 1F9HA 3LP2B 2QL9B 2RRNA 3ZZYA 3KLVA 4DWIA 2LLZA 3GXGA 5D4NA 2ZE2A 4P2MA 2EFNA 4C0OC 3TARA 1HQEB 1NH7A 1S1TA 3MCNA 1NJXA 3SI8A 2H5IB 1ZH5A 1N6QB 3BLUA 4PYDA 3EXYA 1XMOJ 3FRZA 2Q6BA 2YNIA 1U25A 1SQEA 2QG9B 3QKQA 1VBYA 4JI3J 3EAXA 5KABA 5IS2A 2NPIA 3GXHA 3FJ2A 2YPYA 4BS2A 1I9TA 2EEYA 2LXUA 1S1VA 1VISA 1O5ZA 1HBOA 1MROB 2COLA 5K23A 4BJOA 4MKVA 3THVA 4IUFA 4OX6A 4DCJB 3KLIB 2FVPA 2XLKA 3MHYA 2Y9HA 2WJPA 3GCWP 1Q7LB 2W9BA 2B49A 2YKQA 3EE3A 4XPEA 2F71A 4ERCA 3PW4A 1Y5LB 3W61A 4Q5VA 4Y2KA 1FNXH 1X4BA 1U0HA 2DXEA 3A13A 2AJQA 4DL6A 3UAGA 4OX9J 3P6YC 5E2QA 3FCVA 3L9ZA 1GFWB 2MLYA 2GAHC 3K8VA 1AFJA 2GV1A 4XAKA 4LF6F 2YNGA 1U02A 4Y00A 4NA2A 4A8MP 1PC5A 2E66A 3SCIE 4EGLA 1S0VA 4DSLA 4JUZA 5J2NA 3FSIA 4OI6A 3MEEB 2OPPA 4L76A 3D44A 4PPDA 1Z2ZA 1UW4A 3HFKA 4RW4A 3ZZTA 1YKWA 2QRRA 4DQRA 2ALZA 4NLVA 1KVJA 3CT9A 2IBOA 1VQPS 3IRXB 2XWYA 3KHLA 1D5RA 1R6HA 4JI5J 2R7UA 3HHDA 2FH7A 4LF4F 2L9DA 4ZVSB 2LXIA 3R3TA 4F0KA 5T14A 1SL2A 2DR9A 3MAHA 2FLNA 2ZHAA 3EVOA 1Y9OA 4QBEA 2EG1A 1X4FA 1IWGA 4OIXA 4WXOA 1JLEB 4F4AA 3X1LB 2MZSA 2K7KA 5D0GA 1P15A 4D3QA 4J5OA 4O4RA 1WC1A 5AXMA 3W66A 2E7XA 3T1AA 5KFSA 3MUVP 3I36A 2V4JA 2XLIA 2NLWA 1KC8T 4YB6A 2UP1A 1EEHA 2KG0A 1HL6A 4UZCA 5AE2A 1SJ1A 2MGZB 2XS2A 4FYDA 4WOHA 2BE7D 2CIMA 1JLBA 4GS0A 1S97A 1EKSA 3MGJA 1NK0A 2F63A 3MM6B 4ZJLA 4YDXA 3UD3P 1U0HB 1RSCA 1PXHA 5RUBA 1V9OA 3RAMA 2ZJQQ 2Y1IA 2LQBA 4ID8A 2ESBA 2XSJB 3D1OA 2AZRA 3SZ2A 5C2GA 1HYSB 1EQMA 3EDQB 3T6JA 3CWJA 4EZ9A 7AT1B 1S1XA 4J9NA 1RWMB 1QD1A 5KA3A 3RTVA 1S6QA 2J6TA 4H1OA 2OSRA 2FJAB 2M0GB 3PYGA 1N33F 4MYTA 5HJYA 4ZLNA 5D0RA 1RT3B 1HBNB 3KDNA 1KTQA 1R31A 1UTAA 1YZ6A 2IC3A 2RF2A 4PYAA 2VF3A 5FDLB 5A8KA 5FLXU 1IKXB 4F02A 3TRGA 4YHHJ 2I2YA 4ECVA 5DDOC 1NK5A 2A1BA 3D6HB 3T5JA 3R7BB 3GJQB 2UUAJ 4D3RA 3AOBA 1U1QA 3U02A 3ZZRA 1UCNA 1T9VA 4FF3A 3VQTA 4DV2F 4CH0S 2WOMA 2IVYA 2KKHA 2UUCF 4U7UD 1JF7A 3T9NA 3MPVA 4NCBA 1S9GB 1PCAA 3K5LA 2RQCA 3QRPA 1HNIB 3PRVA 4ZKAA 4ECQA 3N79A 4I7FA 1S76D 3V0DA 2LQ8A 2MGZA 2DNQA 1W25A 3GG0A 3NS6A 4USJC 2WTFA 1U2FA 1VC5A 3QO9B 4FKXA 4M95A 1S1UA 4DR6J 3L3CA 3TANA 2K8GA 2RUGA 3EZUA 1HBMA 4DJBA 2HVIA 4O3SA 2VPZB 3AT1B 1SCJB 1RUSA 2HNZB 2HURA 4DSEA 2P4DA 3V2UC 5KA4A 4C4WA 1HW8A 2OEJA 2Q79A 2C7SA 4O44B 2DYAA 2Z57B 4ZPVR 2IM1A 4O3RA 3CPWR 3FBBA 1YGRA 3DMJB 2WCXA 2C2OB 3H7HB 2MZJA 4O3NA 4IYQA 5LSOA 3KLHA 2QC3A 3ZTQA 5EDWA 1IJFB 2JFKA 3S3EA 4LRBA 1W7WA 2HZCA 1NSKL 1XTZA 4OJHA 5IC6B 4CM0A 3ZZPA 3NOGA 2HRUA 4NA3A 5HQMA 2UVVA 5FJ4A 4C8ZA 4OYWA 2DGTA 2GJTA 2AJ1A 1PIEA 1HQEA 1S1TB 2MJUA 4WP3A 4JI1J 3CCSS 1XNRF 3NEKA 1IR2A 2QT7A 3ENVA 1K0TA 2ASJA 3ZZUA 4ZIWA 4DPYA 1S9GA 5FIIA 2HNYA 1VIXA 3CCVS 4XDCA 1WAXA 4Z6BA 4CLSA 1R7IA 2HRTA 3G8TA 3GILA 1HBOB 1FNMA 1MROA 4WK3A 1RWUA 3TI0A 1S6UA 4AD6A 4MJKA 1CULA 3TVYA 3TVZA 4DPUA 1GH8A 5HO4A 2I8EA 5AJ3J 4QCLA 2AM2A 5K20B 3MR5A 4Y2MA 3OBIA 2JL9A 2I4HA 3M6XA 1QUPA 2HFNA 3I0RA 4ID5B 1S9FA 1GQEA 2AGQA 4K50A 2Z2YB 1RWKB 2M88A 3N9UC 2EBEA 1WEYA 5KA8A 3ZM3A 2CZ9A 1VFJA 5ITHA 2W9CB 5A76A 2BOAA 2QA1A 3IBWA 4J9QA 4X4TA 3W5XA 4GVBA 5BYSA 2OUDA 2BR0A 3W3SA 4ZLLA 2Z8QA 2QA4G 4K4ZA 1Q53A 1KQKA 3QCFA 2ILYA 2BQUA 1WEZA 2F8MA 4DL7A 2ROGA 4DR7F 1KVKA 2DNHA 4HH1A 3TZZA 4YS2A 4HDGA 5DZ6A 2F4VJ 2I1YA 1DTTB 1DJ0A 2KHDA 2M7SA 3LUYA 1TKTA 1UW9A 2CG4A 2DGXA 3H98A 4ICLA 4NYPA 4OX9F 4IOCQ 2HNYB 2RQ4A 3H42A 4K4WA 3OL7A 1RBOB 2DY9A 5K8OA 3IG1B 2ADBA 3A8KA 1C1CB 1XBWA 4CLLA 2BJEA 4WU3A 4DV7F 4KKOA 5KA9A 3D0GE 1IR0A 1RT2A 3HP6A 1FK9B 4A8KA 2GC5A 1JKHA 1HNVB 2GA7A 4YY3J 2Y1OA 2J7KA 2DCLA 3M30A 3BDPA 1MKPA 3TA0A 3QCEA 1SBRA 2HC1A 1O8BA 2LDIA 4UUWA 3KLFA 1JLAB 2DXPA 5KFIA 3CCJS 1VRQC 2JFDA 1UA0A 1K0VA 2ZH7A 1E8CA 4LF8J 2VTEA 4N8OA 4KTQA 4B3OA 2RMLA 1AROP 3O5TB 4Y2CA 4V19X 3E01B 1VRTA 3W63A 3BGRA 1SH0A 2CRLA 3PNIA 4P71A 3W64A 1XC9A 2ZUAA 3M8ZA 1PO6A 2J6SA 2VQEJ 3CXCR 1S6QB 2XLJA 2ZVSA 1C0TB 1MU2A 4FPRA 1FJGF 5EHHA 2VICA 3M2RA 4C3KA 3QCNA 1HBNA 2MZRA 4BUBA 4O4GB 4KI9A 3KMQA 2IC3B 2VC0A 3Q8SB 2GCBA 2H3EB 3EICA 4R0JA 1WEXA 2FB0A 4EEYA 1KFSA 3DRPA 3MUTP 2XWXA 2Z2ZA 4DR2F 1I3OB 2OP5A 2E5LJ 4A8WA 4LREA 4F0HA 3NGSA 4ZK7M 2KJWA 2KJVA 4N8NA 1X4EA 1BGXT 3DGPB 4QIFA 5HBMB 2HCMA 1X5OA 4OI3A 4FN5A 1KAVA 3UDCA 3X3UA 2AEJA 4A8OA 4GE2A 2R7WA 2I1RA 4CLYA 3M30B 4KHRA 2F6TA 5KADA 3MEGB 5HP1B 3U1LA 2DPJA 2WW4A 5JMNA 2CQHA 3LQVA 3ZMPA 3QIDA 3I5CA 2LP4A 3T19A 4HH0A 2QMUB 2RDDA 4OZNA 2MLXA 2HHWA 5DDQC 1EP4B 3L95X 2C22A 3JQMA 2CQ2A 3HHLD 1SJRA 3MMJA 2ZMMA 1C0TA 3I31A 2BM0A 1QDUB 2MJNA 1KDNA 1S59A 2GVDA 3C6UB 4DX6A 1RYSA 2YXLA 3BKTA 1VHIA 1SJQA 2EFPA 4MK8A 2C1EB 2IRYA 4EFAC 3QCCA 3Q8RB 1NXIA 1V3SA 2KXHA 4CYUA 4F4YA 3C14B 3Q83A 3FSYA 1ZM2A 1BQMB 4JYAF 3NS5A 3DRPB 1Q8BA
chains in the Genus database with same CATH topology
2FLPA 2D7SA 4L72B 3F44A 4DL3A 4BWMA 2PD1A 2RNEA 1U26A 2AGOA 3VALA 1YRXA 2KZZA 1C84A 3NCPA 1R8HA 3R27A 1D9FA 4DX8H 2FY1A 1Y4ZB 3QCHA 4XPCA 4RUCA 1DBDA 1GTHA 4QPTA 3I5BA 1IKWB 1RT1B 4DR1F 1Q8LA 1RTJA 2PT0A 1Q78A 2FTRA 2ZKTA 4RH9A 2HXPA 5DGAA 4MH8A 4ECYA 1C1BB 2EKYA 5KT4A 1SV5B 2AYBA 4UW2A 3BF4A 1CEZA 4DFPA 3NKYA 1WI6A 5I6VA 4QIVA 2Q43A 2XGPA 5KFJA 2DVIA 2HHHF 5J1PA 2BIJA 3QCJA 4OHEA 2E1MC 2XULA 4ED2A 3OR1A 1FKPB 1TZ0A 4H4MA 1LK7A 4PXEA 5M2RA 1TL5A 3RBEA 3K5PA 1D3WA 1RT4B 1WTBA 2JEIA 1FRLA 3I9V9 1S4FA 5CZVA 2XC9A 1N48A 2I42A 1FESA 2NYIA 5DJBA 4DSIA 3JTOA 1Q86T 4I68A 5D8HB 5AJ3F 4DOZA 2DPIA 2HQIA 4K5SA 1ZCKA 4A8QA 4IFYA 2LQJA 3H4DA 1TKTB 2I0XA 4WE1B 3OUYA 3OSPA 2CMAA 2L3MA 2HIQA 1M90T 2MBCA 4S0GA 2J0SD 2BZ2A 4ZP8A 1YWFA 2XHWA 3IG1A 1C1CA 2J6UA 2BABA 4ZLPA 4PWDB 2NT7A 3MMAB 3O4UA 1U47A 2HGLA 4LQ9A 2VBWA 1PSDA 4TU7A 3NMAA 1C1BA 1YQHA 5K25A 1KFDA 3MM7A 4GMKA 2W7OA 1YTWA 2Q47A 2ZNZA 3FNNA 3R5DA 3LP1B 4G1QA 5MLCV 2JWNA 2AP6A 1ZTWA 1DHMA 3OLRA 3B4MA 2D74B 2R8HA 2VQFF 1WHWA 4DV3F 2G59A 2CFXA 2KG1A 2BXJA 1FCAA 3QLHA 2KDOA 3UQSA 4TU9A 4PYHA 3T9ZA 2J9DE 2GMJA 2L08A 1L8GA 4YQWA 2G0CA 3IS9A 2ATLA 1AAXA 3TP2A 3W2VB 3G6XA 2GQ2A 1YTYA 1E6VB 2FHKA 4YHHF 2GCFA 4ED3A 1D0EA 4YY3F 2LXFA 3BSCA 1S1WB 4FNIA 3ZMQA 3SFGA 1ZM4A 2QSFA 4WE1A 1S72S 1KLMB 1TP7A 5I3UA 2NT2A 1Q79A 1S6PA 1SKWA 2F6YA 4ETXA 1OWXA 1LFWA 3MEDB 2RVJA 2LDYA 4PWDA 4WIIA 1OEMX 3KK2B 3UFCX 2J5AA 1RA6A 1BY9A 1VK3A 2KFZA 4K4UA 2MZTA 2F9DA 5KAAA 1M5VC 2VODA 3O3LA 4EBEA 3LP0B 1DZ5A 3RB4A 2GHPA 1U49A 5DS7A 3TVKA 4O0IA 2DGUA 4BPCA 5D78A 2CM2A 3A1YG 1R27B 5C25B 1EP4A 3GFYA 2ZD1B 1HWLA 4NYOA 4QU7A 1X9SA 1FRHA 2NREA 3M2VA 4RWXA 3SEOA 4RI5A 3BR9A 3MM8A 5J2PA 5F3ZA 3BDEA 3PV8A 3OTDA 4QBUA 1RPMA 4AL7A 3I36A 2FJBB 2PGCA 1VQ4S 2CNGA 2AHSA 4G1PA 1X5SA 4CIOA 1FHTA 2J76E 3BQ0A 1IQTA 2NZ6A 2D9PA 2A3KA 3N6NA 4TN2A 3AWFA 1AW0A 1YJUA 5K5MA 4F3MA 2VG6A 1KQGB 2C46A 2FGOA 3F81A 5HMYA 1S9EA 2W25A 3K8WA 4AL6A 4R5PB 1I57A 4DR6F 2HVZA 3PKYA 1M3GA 3DM2A 3QYYA 1NO6A 4J9MA 5KT7A 2CVEA 4IG3A 2D3OR 5HL7Q 2BV3A 3DLKA 4USHA 1HBUA 1SI9A 3RR8A 4B9VA 4I2QA 3SCJE 1NJZA 4JV2A 1Y5NB 3OFEA 2GHWA 3B78A 4AXJA 2XGQA 1IN0A 4FZVA 3C2PA 1YN9A 3IRWP 3M32B 1O51A 1U09A 3VAGA 4EZ6A 2I6MA 2QDCA 2PE8A 2WONA 1I6JA 2YKOA 4B17A 1T95A 2M8DB 5HDEA 2GO9A 3E51A 3NBPA 3OL8A 4RNHA 3CCUS 2P9GA 4DFKA 1C86A 4KYQA 4RH5A 2KT2A 1ECVA 3VAJA 3TR5A 4ZN5A 3F41A 2VZ9A 2LU1A 4QU6A 3QWUA 2EK1A 2IMWP 2Z0GA 2RKIB 3PJWA 1DQ8A 3HHEA 3BR8A 1HI1A 3CD0A 1HBMB 3CO9A 5HQ8A 2BQ3A 4M63A 2R2TA 3W7BA 1S10A 2AF6A 2K7JA 3M1VA 4QZVB 4RW6B 2YKAA 1S48A 4IFYB 1NK4A 4QOTA 5GAGU 4I64A 4F2RA 2LCWA 3UCZP 1G2EA 2VG6B 1RKIA 1T7PA 3QKPA 4TYBA 4WU2A 4RBVA