4GRYA

Crystal structure of shp1 catalytic domain with so4
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
283
structure length
271
Chain Sequence
GFWEEFESLQKQEVKNLHQRLEGQRPENKGKNRYKNILPFDHSRVILQGRDSNIPGSDYINANYIKNQLLNAKTYIASQGCLEATVNDFWQMAWQENSRVIVMTTREVPYWPEVGMQRAYGPYSVTNCGEHDTTEYKLRTLQVSPLDNGDLIREIWHYQYLSWPDHGVPSEPGGVLSFLDQINQRQESLPHAGPIIVHSSAGIGRTGTIIVIDMLMENISTKGLDCDIDIQKTIQMVRAQRSGMVQTEAQYKFIYVAIAQFIETTKKKLEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-guided studies of the SHP-1/JAK1 interaction provide new insights into phosphatase catalytic domain substrate recognition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Tyrosine-protein phosphatase non-receptor type 6
total genus 91
structure length 271
sequence length 283
ec nomenclature ec 3.1.3.48: Protein-tyrosine-phosphatase.
pdb deposition date 2012-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00102 Y_phosphatase Protein-tyrosine phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.190.10 Alpha Beta Alpha-Beta Complex Protein-Tyrosine Phosphatase; Chain A Protein tyrosine phosphatase superfamily 4gryA00
4H1OA 1WRMA 1YTNA 5KAAA 2HVLA 4DGPA 3BM8A 4ZI4A 2R0BA 2CNFA 1G1GA 4KI9A 2FJMA 1PA9A 2ESBA 1EEOA 3AWEA 3D42A 4ZRTA 2B07A 1BZCA 1JF7A 4OHEA 4RHGA 5EHRA 2I6OA 3MOZA 2H04A 4HJQA 1ONYA 1C86A 3QCFA 2VEXA 4NWGA 4AZ1A 4GS0A 4TVVA 1Q6TA 2B3OA 4HRFA 2H4VA 4OHHA 1YGRA 3BLTA 2CJZA 1VHRA 1OEVA 4GRYA 2QCTA 2CNGA 3NMEA 1Q6SA 2I42A 1WAXA 2G6ZA 4DGXA 4WU2A 3V0DA 1QZ0A 2F71A 2VEUA 4GFVA 2C7SA 5KA1A 2FJNA 4MBBA 1NWLA 1V3AA 3F9AA 1OHEA 4I8NA 5IBMA 1QXKA 1PTTA 4H34A 3QKPA 2PT0A 4BJOA 1SUGA 4ERCA 2J17A 2B4UA 1OETA 5KA4A 4Y14A 1YTSA 1Q6NA 3MMJA 1XBOA 2IMGA 3A5JA 4KYQA 2CM2A 2Y96A 3S3HA 3RO1A 2I6JA 4RKKA 1ONZA 4PYHA 4QAHA 3S3KA 2AHSA 1YN9A 3EB1A 3ZM2A 2F46A 2QDCA 1LYVA 3SR9A 2I75A 4GRZA 2C46A 3RGOA 2PI7A 2OZ5A 3QCJA 3LJ8A 3QCBA 1R6HA 4QUMA 1ZZWA 2F6ZA 5KABA 2QBRA 1T4JA 4GE5A 3OMHA 1FPZA 2M3VA 3SMEA 5GTJA 1FPRA 3O4TA 5I6VA 5K9VA 3V0GA 3CWEA 2JJDA 4BPCA 5KA9A 2I3UA 3S4OA 2QBSA 3QCDA 3I7ZA 5KA0A 2P4DA 4NWFA 2PSZA 1C84A 3ZM0A 3QCLA 1LQFA 2RF6A 5KA7A 2CM3A 4JNBA 5BZXA 5K9WA 4WU3A 3N0AA 3RGQA 1L8KA 1OHCA 5EHPA 3H2XA 1OEMX 3EZZA 3O5XA 2J16A 5HDEA 2CMCA 2CM7A 1WCHA 2NT2A 2YDUA 2I5XA 2QBQA 1X24A 3EMUA 5KACA 2NT7A 3F41A 3S3EA 2B4OA 3D1QA 1FQ1A 2F70A 3D44A 1PYNA 1G7FA 2A3KA 2B49A 2HCMA 2HNPA 4D3QA 4HJPA 1M3GA 2BGDA 4WOHA 1RPMA 5J8RA 1YWFA 3QCNA 2AZRA 2J16B 3F9BA 4RDDA 1Q6PA 1BZJA 4Z6BA 3U96A 1NO6A 5KADA 2VEWA 3ZMQA 1G4US 2F6TA 4D3PA 4NNDA 5K24A 1LARA 3ZM1A 3BLUA 2QBPA 1KAKA 1GFYA 2I4EA 4JMKA 4RI4A 3QKQA 2P6XA 3GXGA 2E0TA 2BIJA 1NWEA 1XXPA 1C87A 2CMBA 1G1HA 2HNQA 2CMAA 3QCMA 2MBCA 1RXDA 1XM2A 1NL9A 3QCGA 4R0SA 4QAPA 1KAVA 1NNYA 2CNIA 3CM3A 4NYHA 3O4UA 3B7OA 3A5KA 4RI5A 3V0IA 1PH0A 5KA8A 3O4SA 2QDMA 2I6PA 4PVGA 2WGPA 1OEOX 4GWFA 1G4WR 4S0GA 1ECVA 2I6MA 1Q1MA 2BGEA 5KA2A 3QCKA 1T48A 1G1FA 4JBCA 2NLKA 1MKPA 2CFVA 5MMZB 1EENA 1I9SA 2GWOA 5BX1A 3I80A 1OEUA 4RH5A 1I57A 1YPTA 3OLRA 3V0EA 4GE6A 3ZV2A 1PTUA 2Y2FA 4NX8A 3M4UA 4OHIA 5K25A 2QDPA 3QCCA 2Q47A 2HXPA 1ZCKA 1GWZA 2F6WA 2I3RA 2HC2A 3F99A 3ZMPA 2CM8A 2A8BA 1PXHA 3MOWA 2OC3A 2I1YA 2GJTA 1AAXA 2HC1A 1BZHA 1Q6MA 3AWGA 2H03A 4WTYA 2PBNA 2F6FA 4GFUA 1T49A 2I6IA 1L8GA 2OUDA 4R0TA 1JLNA 2DXPA 4OHLA 1PA1A 1YGUA 1D5RA 1YZ4A 2I4GA 5K22A 3V0HA 3RZ2A 2H4KA 2QCJA 4B04A 5LXQB 1PTYA 1OHDA 3D1OA 5M43A 1PTVA 1P15A 4GE2A 3S3FA 3V0JA 3EAXA 4ZN5A 4ICZA 4R30A 3PS5A 5AWXA 1NZ7A 2HB1A 3AWFA 3D9CA 1I9TA 1A5YA 2G59A 3BRHA 1J4XA 5KA3A 2ZN7A 4YAAA 1U25A 1XRIA 4IKCA 2VEVA 1C88A 1ZC0A 2NZ6A 2F6VA 3EU0A 4YR8B 3O3LA 3ZM3A 1ZCLA 2I4HA 3GXHA 1C83A 2BV5A 2CNEA 2NTAA 4RH9A 2B4SA 4JMJA 2F6YA 2PQ5A 5BZZA 4QBWA 1OESA 1YTWA 5K23A 4QUNA 2NV5A 1C85A 2Q05A 2ZMMA 3QCHA 2H02A 3F81A 2VEYA 3QCIA 1YFOA 2B4PA 4D3RA 2H4GA 3D1HA 2FH7A 2BZLA 3S4EA 3I36A 1XXVA 2CNHA 2QEPA 4QBEA 1Q6JA 4J51A 4OHDA 5IBSA 5BUGA 2HY3A 1G7GA 4KYRA 2PA5A 1U24A 4Y2EA 1U26A 3QCEA 3V0FA 2SHPA 2OOQA 2GP0A
chains in the Genus database with same CATH superfamily
4H1OA 1WRMA 1YTNA 5KAAA 2HVLA 4DGPA 3BM8A 4QDIA 2R0BA 4ZI4A 2CNFA 1G1GA 4KI9A 2FJMA 1PA9A 2ESBA 4UAGA 1EEOA 3AWEA 3D42A 4ZRTA 2B07A 2UAGA 1GQQA 1BZCA 2VTEA 3QCZA 1JF7A 4OHEA 4RHGA 5EHRA 2I6OA 3MOZA 2H04A 4HJQA 1ONYA 1C86A 3QCFA 2VEXA 4NWGA 4AZ1A 4GS0A 4TVVA 1Q6TA 2B3OA 4HRFA 2H4VA 4OHHA 1YGRA 3BLTA 2CJZA 2X5OA 1VHRA 1OEVA 4GRYA 2QCTA 4C12A 2CNGA 3NMEA 1Q6SA 2I42A 1WAXA 2G6ZA 1O5ZA 4DGXA 4WU2A 3V0DA 1QZ0A 2F71A 2VEUA 4GFVA 2C7SA 5KA1A 2FJNA 4MBBA 1NWLA 1V3AA 3F9AA 1OHEA 1UAGA 4I8NA 2AM2A 5IBMA 1QXKA 1PTTA 4H34A 3QKPA 2PT0A 4BJOA 1SUGA 2Y66A 4ERCA 2J17A 3HN7A 2B4UA 1OETA 5KA4A 4Y14A 1YTSA 1Q6NA 3MMJA 1XBOA 2IMGA 3A5JA 4KYQA 2CM2A 2UUPA 2Y96A 3S3HA 3RO1A 2I6JA 4RKKA 1ONZA 3NRSA 4PYHA 4QAHA 3S3KA 2AHSA 3EB1A 1YN9A 3ZM2A 2F46A 2QDCA 1LYVA 3SR9A 2I75A 2F00A 4GRZA 2VORA 1W7KA 4ZIYA 2C46A 3RGOA 2PI7A 2OZ5A 3QCJA 2VOSA 3LJ8A 3QCBA 1R6HA 4QUMA 1ZZWA 2F6ZA 5KABA 2QBRA 1T4JA 4GE5A 3OMHA 1FPZA 2M3VA 3SMEA 5GTJA 1FPRA 3O4TA 5I6VA 5K9VA 3V0GA 3CWEA 2JJDA 4BPCA 5KA9A 2I3UA 3S4OA 2QBSA 3QCDA 3I7ZA 5KA0A 2P4DA 2GC6A 4NWFA 3PYZA 2PSZA 1C84A 3ZM0A 3QCLA 4C13A 3MVNA 1LQFA 2RF6A 1JBVA 2CM3A 5KA7A 4JNBA 2JFFA 5BZXA 4HV4A 5K9WA 4WU3A 3N0AA 3RGQA 1E0DA 1L8KA 2GC5A 1OHCA 5EHPA 3H2XA 1OEMX 1W78A 3EZZA 3O5XA 2J16A 5HDEA 2CMCA 2CM7A 1WCHA 2NT2A 2YDUA 2I5XA 2QBQA 1X24A 4CVLA 3EMUA 5KACA 2NT7A 2GCBA 3F41A 3S3EA 2B4OA 3D1QA 1FQ1A 2F70A 3D44A 1PYNA 1G7FA 2A3KA 2B49A 2HCMA 2HNPA 2WTZA 4D3QA 4HJPA 1M3GA 2BGDA 4WOHA 2XJAA 1RPMA 5J8RA 1YWFA 3QCNA 2AZRA 2J16B 3F9BA 4RDDA 1Q6PA 1BZJA 2Y68A 4Z6BA 3U96A 1NO6A 5KADA 2VEWA 3ZMQA 1G4US 2F6TA 4D3PA 4NNDA 5K24A 1LARA 3ZM1A 3BLUA 2QBPA 1KAKA 1GFYA 2I4EA 4JMKA 4RI4A 3QKQA 4BUCA 2P6XA 3GXGA 1GG4A 2E0TA 2BIJA 1NWEA 1XXPA 1C87A 2CMBA 1G1HA 2AM1A 2HNQA 2CMAA 3QCMA 2MBCA 1RXDA 1XM2A 1NL9A 3QCGA 4R0SA 4QAPA 1KAVA 1GQYA 1NNYA 2CNIA 3CM3A 4NYHA 3O4UA 3B7OA 3A5KA 4RI5A 3V0IA 1PH0A 2JFHA 5KA8A 3O4SA 2QDMA 2I6PA 4CVMA 4PVGA 2WGPA 1OEOX 4GWFA 1G4WR 4S0GA 1ECVA 2I6MA 3ZM6A 1Q1MA 2UUOA 2BGEA 5KA2A 1FGSA 3QCKA 1T48A 1G1FA 4JBCA 2NLKA 1MKPA 2CFVA 5MMZB 1EENA 1I9SA 2GWOA 5BX1A 4CVKA 3I80A 1OEUA 4RH5A 1I57A 1YPTA 3OLRA 3V0EA 4GE6A 3ZV2A 1PTUA 2Y2FA 3LK7A 4NX8A 3M4UA 4OHIA 5K25A 2QDPA 4QF5A 2Q47A 3QCCA 3UAGA 2HXPA 1ZCKA 1GWZA 2F6WA 2I3RA 2HC2A 3F99A 3ZMPA 2CM8A 2A8BA 1PXHA 3MOWA 2OC3A 2I1YA 2WJPA 2GJTA 1AAXA 2HC1A 3ZM5A 1BZHA 1Q6MA 3AWGA 2H03A 4WTYA 2PBNA 2F6FA 4GFUA 1T49A 2I6IA 1L8GA 2OUDA 2Y1OA 4R0TA 1JLNA 2DXPA 4OHLA 1PA1A 1YGUA 1D5RA 1YZ4A 2I4GA 5K22A 3V0HA 3RZ2A 2H4KA 2QCJA 4B04A 2XPCA 5LXQB 1PTYA 1OHDA 3D1OA 2VTDA 5M43A 1PTVA 1P15A 4GE2A 3S3FA 3V0JA 3EAXA 4ZN5A 4ICZA 4R30A 4BUBA 3PS5A 5AWXA 5A5EA 1NZ7A 2HB1A 3AWFA 3D9CA 2GCAA 1I9TA 1A5YA 2G59A 3BRHA 1J4XA 5KA3A 2ZN7A 4YAAA 1P31A 1U25A 1XRIA 4IKCA 2VEVA 1C88A 1ZC0A 2NZ6A 2F6VA 3EU0A 4YR8B 3O3LA 3ZM3A 1ZCLA 3N2AA 2I4HA 3GXHA 1C83A 2BV5A 2CNEA 2NTAA 4RH9A 2B4SA 2Y67A 4JMJA 2F6YA 3ZL8A 2PQ5A 5BZZA 1E8CA 4QBWA 1OESA 1J6UA 1YTWA 5K23A 4QUNA 2NV5A 1C85A 1EEHA 2Q05A 2ZMMA 3QCHA 2H02A 3F81A 2JFGA 2VEYA 3QCIA 1YFOA 2B4PA 4D3RA 2H4GA 3D1HA 2FH7A 2BZLA 3S4EA 3I36A 1P3DA 1XXVA 2CNHA 2QEPA 4QBEA 5A5FA 1Q6JA 4J51A 4OHDA 5IBSA 1JBWA 2HY3A 5BUGA 1G7GA 4KYRA 2PA5A 1U24A 4Y2EA 1U26A 3QCEA 3V0FA 2SHPA 2OOQA 2GP0A
chains in the Genus database with same CATH topology
4H1OA 1WRMA 1YTNA 5KAAA 2HVLA 4DGPA 3BM8A 4ZI4A 2R0BA 2CNFA 1G1GA 4KI9A 2FJMA 1PA9A 2ESBA 1EEOA 3AWEA 3D42A 4ZRTA 2B07A 1BZCA 1JF7A 4OHEA 4RHGA 5EHRA 2I6OA 3MOZA 2H04A 4HJQA 1ONYA 1C86A 3QCFA 2VEXA 4NWGA 4AZ1A 4GS0A 4TVVA 1Q6TA 2B3OA 4HRFA 2H4VA 4OHHA 1YGRA 3BLTA 2CJZA 1VHRA 1OEVA 4GRYA 2QCTA 2CNGA 3NMEA 1Q6SA 2I42A 1WAXA 2G6ZA 4DGXA 4WU2A 3V0DA 1QZ0A 2F71A 2VEUA 4GFVA 2C7SA 5KA1A 2FJNA 4MBBA 1NWLA 1V3AA 3F9AA 1OHEA 4I8NA 5IBMA 1QXKA 1PTTA 4H34A 3QKPA 2PT0A 4BJOA 1SUGA 4ERCA 2J17A 2B4UA 1OETA 5KA4A 4Y14A 1YTSA 1Q6NA 3MMJA 1XBOA 2IMGA 3A5JA 4KYQA 2CM2A 2Y96A 3S3HA 3RO1A 2I6JA 4RKKA 1ONZA 4PYHA 4QAHA 3S3KA 2AHSA 1YN9A 3EB1A 3ZM2A 2F46A 2QDCA 1LYVA 3SR9A 2I75A 4GRZA 2C46A 3RGOA 2PI7A 2OZ5A 3QCJA 3LJ8A 3QCBA 1R6HA 4QUMA 1ZZWA 2F6ZA 5KABA 2QBRA 1T4JA 4GE5A 3OMHA 1FPZA 2M3VA 3SMEA 5GTJA 1FPRA 3O4TA 5I6VA 5K9VA 3V0GA 3CWEA 2JJDA 4BPCA 5KA9A 2I3UA 3S4OA 2QBSA 3QCDA 3I7ZA 5KA0A 2P4DA 4NWFA 2PSZA 1C84A 3ZM0A 3QCLA 1LQFA 2RF6A 5KA7A 2CM3A 4JNBA 5BZXA 5K9WA 4WU3A 3N0AA 3RGQA 1L8KA 1OHCA 5EHPA 3H2XA 1OEMX 3EZZA 3O5XA 2J16A 5HDEA 2CMCA 2CM7A 1WCHA 2NT2A 2YDUA 2I5XA 2QBQA 1X24A 3EMUA 5KACA 2NT7A 3F41A 3S3EA 2B4OA 3D1QA 1FQ1A 2F70A 3D44A 1PYNA 1G7FA 2A3KA 2B49A 2HCMA 2HNPA 4D3QA 4HJPA 1M3GA 2BGDA 4WOHA 1RPMA 5J8RA 1YWFA 3QCNA 2AZRA 2J16B 3F9BA 4RDDA 1Q6PA 1BZJA 4Z6BA 3U96A 1NO6A 5KADA 2VEWA 3ZMQA 1G4US 2F6TA 4D3PA 4NNDA 5K24A 1LARA 3ZM1A 3BLUA 2QBPA 1KAKA 1GFYA 2I4EA 4JMKA 4RI4A 3QKQA 2P6XA 3GXGA 2E0TA 2BIJA 1NWEA 1XXPA 1C87A 2CMBA 1G1HA 2HNQA 2CMAA 3QCMA 2MBCA 1RXDA 1XM2A 1NL9A 3QCGA 4R0SA 4QAPA 1KAVA 1NNYA 2CNIA 3CM3A 4NYHA 3O4UA 3B7OA 3A5KA 4RI5A 3V0IA 1PH0A 5KA8A 3O4SA 2QDMA 2I6PA 4PVGA 2WGPA 1OEOX 4GWFA 1G4WR 4S0GA 1ECVA 2I6MA 1Q1MA 2BGEA 5KA2A 3QCKA 1T48A 1G1FA 4JBCA 2NLKA 1MKPA 2CFVA 5MMZB 1EENA 1I9SA 2GWOA 5BX1A 3I80A 1OEUA 4RH5A 1I57A 1YPTA 3OLRA 3V0EA 4GE6A 3ZV2A 1PTUA 2Y2FA 4NX8A 3M4UA 4OHIA 5K25A 2QDPA 3QCCA 2Q47A 2HXPA 1ZCKA 1GWZA 2F6WA 2I3RA 2HC2A 3F99A 3ZMPA 2CM8A 2A8BA 1PXHA 3MOWA 2OC3A 2I1YA 2GJTA 1AAXA 2HC1A 1BZHA 1Q6MA 3AWGA 2H03A 4WTYA 2PBNA 2F6FA 4GFUA 1T49A 2I6IA 1L8GA 2OUDA 4R0TA 1JLNA 2DXPA 4OHLA 1PA1A 1YGUA 1D5RA 1YZ4A 2I4GA 5K22A 3V0HA 3RZ2A 2H4KA 2QCJA 4B04A 5LXQB 1PTYA 1OHDA 3D1OA 5M43A 1PTVA 1P15A 4GE2A 3S3FA 3V0JA 3EAXA 4ZN5A 4ICZA 4R30A 3PS5A 5AWXA 1NZ7A 2HB1A 3AWFA 3D9CA 1I9TA 1A5YA 2G59A 3BRHA 1J4XA 5KA3A 2ZN7A 4YAAA 1U25A 1XRIA 4IKCA 2VEVA 1C88A 1ZC0A 2NZ6A 2F6VA 3EU0A 4YR8B 3O3LA 3ZM3A 1ZCLA 2I4HA 3GXHA 1C83A 2BV5A 2CNEA 2NTAA 4RH9A 2B4SA 4JMJA 2F6YA 2PQ5A 5BZZA 4QBWA 1OESA 1YTWA 5K23A 4QUNA 2NV5A 1C85A 2Q05A 2ZMMA 3QCHA 2H02A 3F81A 2VEYA 3QCIA 1YFOA 2B4PA 4D3RA 2H4GA 3D1HA 2FH7A 2BZLA 3S4EA 3I36A 1XXVA 2CNHA 2QEPA 4QBEA 1Q6JA 4J51A 4OHDA 5IBSA 5BUGA 2HY3A 1G7GA 4KYRA 2PA5A 1U24A 4Y2EA 1U26A 3QCEA 3V0FA 2SHPA 2OOQA 2GP0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H1O A;  1WRM A;  1YTN A;  5KAA A;  2HVL A;  4DGP A;  3BM8 A;  4ZI4 A;  2R0B A;  2CNF A;  1G1G A;  4KI9 A;  2FJM A;  1PA9 A;  2ESB A;  1EEO A;  3AWE A;  3D42 A;  4ZRT A;  2B07 A;  1BZC A;  1JF7 A;  4OHE A;  4RHG A;  5EHR A;  2I6O A;  3MOZ A;  2H04 A;  4HJQ A;  1ONY A;  1C86 A;  3QCF A;  2VEX A;  4NWG A;  4AZ1 A;  4GS0 A;  4TVV A;  1Q6T A;  2B3O A;  4HRF A;  2H4V A;  4OHH A;  1YGR A;  3BLT A;  2CJZ A;  1VHR A;  1OEV A;  4GRY A;  2QCT A;  2CNG A;  3NME A;  1Q6S A;  2I42 A;  1WAX A;  2G6Z A;  4DGX A;  4WU2 A;  3V0D A;  1QZ0 A;  2F71 A;  2VEU A;  4GFV A;  2C7S A;  5KA1 A;  2FJN A;  4MBB A;  1NWL A;  1V3A A;  3F9A A;  1OHE A;  4I8N A;  5IBM A;  1QXK A;  1PTT A;  4H34 A;  3QKP A;  2PT0 A;  4BJO A;  1SUG A;  4ERC A;  2J17 A;  2B4U A;  1OET A;  5KA4 A;  4Y14 A;  1YTS A;  1Q6N A;  3MMJ A;  1XBO A;  2IMG A;  3A5J A;  4KYQ A;  2CM2 A;  2Y96 A;  3S3H A;  3RO1 A;  2I6J A;  4RKK A;  1ONZ A;  4PYH A;  4QAH A;  3S3K A;  2AHS A;  1YN9 A;  3EB1 A;  3ZM2 A;  2F46 A;  2QDC A;  1LYV A;  3SR9 A;  2I75 A;  4GRZ A;  2C46 A;  3RGO A;  2PI7 A;  2OZ5 A;  3QCJ A;  3LJ8 A;  3QCB A;  1R6H A;  4QUM A;  1ZZW A;  2F6Z A;  5KAB A;  2QBR A;  1T4J A;  4GE5 A;  3OMH A;  1FPZ A;  2M3V A;  3SME A;  5GTJ A;  1FPR A;  3O4T A;  5I6V A;  5K9V A;  3V0G A;  3CWE A;  2JJD A;  4BPC A;  5KA9 A;  2I3U A;  3S4O A;  2QBS A;  3QCD A;  3I7Z A;  5KA0 A;  2P4D A;  4NWF A;  2PSZ A;  1C84 A;  3ZM0 A;  3QCL A;  1LQF A;  2RF6 A;  5KA7 A;  2CM3 A;  4JNB A;  5BZX A;  5K9W A;  4WU3 A;  3N0A A;  3RGQ A;  1L8K A;  1OHC A;  5EHP A;  3H2X A;  1OEM X;  3EZZ A;  3O5X A;  2J16 A;  5HDE A;  2CMC A;  2CM7 A;  1WCH A;  2NT2 A;  2YDU A;  2I5X A;  2QBQ A;  1X24 A;  3EMU A;  5KAC A;  2NT7 A;  3F41 A;  3S3E A;  2B4O A;  3D1Q A;  1FQ1 A;  2F70 A;  3D44 A;  1PYN A;  1G7F A;  2A3K A;  2B49 A;  2HCM A;  2HNP A;  4D3Q A;  4HJP A;  1M3G A;  2BGD A;  4WOH A;  1RPM A;  5J8R A;  1YWF A;  3QCN A;  2AZR A;  2J16 B;  3F9B A;  4RDD A;  1Q6P A;  1BZJ A;  4Z6B A;  3U96 A;  1NO6 A;  5KAD A;  2VEW A;  3ZMQ A;  1G4U S;  2F6T A;  4D3P A;  4NND A;  5K24 A;  1LAR A;  3ZM1 A;  3BLU A;  2QBP A;  1KAK A;  1GFY A;  2I4E A;  4JMK A;  4RI4 A;  3QKQ A;  2P6X A;  3GXG A;  2E0T A;  2BIJ A;  1NWE A;  1XXP A;  1C87 A;  2CMB A;  1G1H A;  2HNQ A;  2CMA A;  3QCM A;  2MBC A;  1RXD A;  1XM2 A;  1NL9 A;  3QCG A;  4R0S A;  4QAP A;  1KAV A;  1NNY A;  2CNI A;  3CM3 A;  4NYH A;  3O4U A;  3B7O A;  3A5K A;  4RI5 A;  3V0I A;  1PH0 A;  5KA8 A;  3O4S A;  2QDM A;  2I6P A;  4PVG A;  2WGP A;  1OEO X;  4GWF A;  1G4W R;  4S0G A;  1ECV A;  2I6M A;  1Q1M A;  2BGE A;  5KA2 A;  3QCK A;  1T48 A;  1G1F A;  4JBC A;  2NLK A;  1MKP A;  2CFV A;  5MMZ B;  1EEN A;  1I9S A;  2GWO A;  5BX1 A;  3I80 A;  1OEU A;  4RH5 A;  1I57 A;  1YPT A;  3OLR A;  3V0E A;  4GE6 A;  3ZV2 A;  1PTU A;  2Y2F A;  4NX8 A;  3M4U A;  4OHI A;  5K25 A;  2QDP A;  3QCC A;  2Q47 A;  2HXP A;  1ZCK A;  1GWZ A;  2F6W A;  2I3R A;  2HC2 A;  3F99 A;  3ZMP A;  2CM8 A;  2A8B A;  1PXH A;  3MOW A;  2OC3 A;  2I1Y A;  2GJT A;  1AAX A;  2HC1 A;  1BZH A;  1Q6M A;  3AWG A;  2H03 A;  4WTY A;  2PBN A;  2F6F A;  4GFU A;  1T49 A;  2I6I A;  1L8G A;  2OUD A;  4R0T A;  1JLN A;  2DXP A;  4OHL A;  1PA1 A;  1YGU A;  1D5R A;  1YZ4 A;  2I4G A;  5K22 A;  3V0H A;  3RZ2 A;  2H4K A;  2QCJ A;  4B04 A;  5LXQ B;  1PTY A;  1OHD A;  3D1O A;  5M43 A;  1PTV A;  1P15 A;  4GE2 A;  3S3F A;  3V0J A;  3EAX A;  4ZN5 A;  4ICZ A;  4R30 A;  3PS5 A;  5AWX A;  1NZ7 A;  2HB1 A;  3AWF A;  3D9C A;  1I9T A;  1A5Y A;  2G59 A;  3BRH A;  1J4X A;  5KA3 A;  2ZN7 A;  4YAA A;  1U25 A;  1XRI A;  4IKC A;  2VEV A;  1C88 A;  1ZC0 A;  2NZ6 A;  2F6V A;  3EU0 A;  4YR8 B;  3O3L A;  3ZM3 A;  1ZCL A;  2I4H A;  3GXH A;  1C83 A;  2BV5 A;  2CNE A;  2NTA A;  4RH9 A;  2B4S A;  4JMJ A;  2F6Y A;  2PQ5 A;  5BZZ A;  4QBW A;  1OES A;  1YTW A;  5K23 A;  4QUN A;  2NV5 A;  1C85 A;  2Q05 A;  2ZMM A;  3QCH A;  2H02 A;  3F81 A;  2VEY A;  3QCI A;  1YFO A;  2B4P A;  4D3R A;  2H4G A;  3D1H A;  2FH7 A;  2BZL A;  3S4E A;  3I36 A;  1XXV A;  2CNH A;  2QEP A;  4QBE A;  1Q6J A;  4J51 A;  4OHD A;  5IBS A;  5BUG A;  2HY3 A;  1G7G A;  4KYR A;  2PA5 A;  1U24 A;  4Y2E A;  1U26 A;  3QCE A;  3V0F A;  2SHP A;  2OOQ A;  2GP0 A; 
#chains in the Genus database with same CATH topology
 4H1O A;  1WRM A;  1YTN A;  5KAA A;  2HVL A;  4DGP A;  3BM8 A;  4QDI A;  2R0B A;  4ZI4 A;  2CNF A;  1G1G A;  4KI9 A;  2FJM A;  1PA9 A;  2ESB A;  4UAG A;  1EEO A;  3AWE A;  3D42 A;  4ZRT A;  2B07 A;  2UAG A;  1GQQ A;  1BZC A;  2VTE A;  3QCZ A;  1JF7 A;  4OHE A;  4RHG A;  5EHR A;  2I6O A;  3MOZ A;  2H04 A;  4HJQ A;  1ONY A;  1C86 A;  3QCF A;  2VEX A;  4NWG A;  4AZ1 A;  4GS0 A;  4TVV A;  1Q6T A;  2B3O A;  4HRF A;  2H4V A;  4OHH A;  1YGR A;  3BLT A;  2CJZ A;  2X5O A;  1VHR A;  1OEV A;  4GRY A;  2QCT A;  4C12 A;  2CNG A;  3NME A;  1Q6S A;  2I42 A;  1WAX A;  2G6Z A;  1O5Z A;  4DGX A;  4WU2 A;  3V0D A;  1QZ0 A;  2F71 A;  2VEU A;  4GFV A;  2C7S A;  5KA1 A;  2FJN A;  4MBB A;  1NWL A;  1V3A A;  3F9A A;  1OHE A;  1UAG A;  4I8N A;  2AM2 A;  5IBM A;  1QXK A;  1PTT A;  4H34 A;  3QKP A;  2PT0 A;  4BJO A;  1SUG A;  2Y66 A;  4ERC A;  2J17 A;  3HN7 A;  2B4U A;  1OET A;  5KA4 A;  4Y14 A;  1YTS A;  1Q6N A;  3MMJ A;  1XBO A;  2IMG A;  3A5J A;  4KYQ A;  2CM2 A;  2UUP A;  2Y96 A;  3S3H A;  3RO1 A;  2I6J A;  4RKK A;  1ONZ A;  3NRS A;  4PYH A;  4QAH A;  3S3K A;  2AHS A;  3EB1 A;  1YN9 A;  3ZM2 A;  2F46 A;  2QDC A;  1LYV A;  3SR9 A;  2I75 A;  2F00 A;  4GRZ A;  2VOR A;  1W7K A;  4ZIY A;  2C46 A;  3RGO A;  2PI7 A;  2OZ5 A;  3QCJ A;  2VOS A;  3LJ8 A;  3QCB A;  1R6H A;  4QUM A;  1ZZW A;  2F6Z A;  5KAB A;  2QBR A;  1T4J A;  4GE5 A;  3OMH A;  1FPZ A;  2M3V A;  3SME A;  5GTJ A;  1FPR A;  3O4T A;  5I6V A;  5K9V A;  3V0G A;  3CWE A;  2JJD A;  4BPC A;  5KA9 A;  2I3U A;  3S4O A;  2QBS A;  3QCD A;  3I7Z A;  5KA0 A;  2P4D A;  2GC6 A;  4NWF A;  3PYZ A;  2PSZ A;  1C84 A;  3ZM0 A;  3QCL A;  4C13 A;  3MVN A;  1LQF A;  2RF6 A;  1JBV A;  2CM3 A;  5KA7 A;  4JNB A;  2JFF A;  5BZX A;  4HV4 A;  5K9W A;  4WU3 A;  3N0A A;  3RGQ A;  1E0D A;  1L8K A;  2GC5 A;  1OHC A;  5EHP A;  3H2X A;  1OEM X;  1W78 A;  3EZZ A;  3O5X A;  2J16 A;  5HDE A;  2CMC A;  2CM7 A;  1WCH A;  2NT2 A;  2YDU A;  2I5X A;  2QBQ A;  1X24 A;  4CVL A;  3EMU A;  5KAC A;  2NT7 A;  2GCB A;  3F41 A;  3S3E A;  2B4O A;  3D1Q A;  1FQ1 A;  2F70 A;  3D44 A;  1PYN A;  1G7F A;  2A3K A;  2B49 A;  2HCM A;  2HNP A;  2WTZ A;  4D3Q A;  4HJP A;  1M3G A;  2BGD A;  4WOH A;  2XJA A;  1RPM A;  5J8R A;  1YWF A;  3QCN A;  2AZR A;  2J16 B;  3F9B A;  4RDD A;  1Q6P A;  1BZJ A;  2Y68 A;  4Z6B A;  3U96 A;  1NO6 A;  5KAD A;  2VEW A;  3ZMQ A;  1G4U S;  2F6T A;  4D3P A;  4NND A;  5K24 A;  1LAR A;  3ZM1 A;  3BLU A;  2QBP A;  1KAK A;  1GFY A;  2I4E A;  4JMK A;  4RI4 A;  3QKQ A;  4BUC A;  2P6X A;  3GXG A;  1GG4 A;  2E0T A;  2BIJ A;  1NWE A;  1XXP A;  1C87 A;  2CMB A;  1G1H A;  2AM1 A;  2HNQ A;  2CMA A;  3QCM A;  2MBC A;  1RXD A;  1XM2 A;  1NL9 A;  3QCG A;  4R0S A;  4QAP A;  1KAV A;  1GQY A;  1NNY A;  2CNI A;  3CM3 A;  4NYH A;  3O4U A;  3B7O A;  3A5K A;  4RI5 A;  3V0I A;  1PH0 A;  2JFH A;  5KA8 A;  3O4S A;  2QDM A;  2I6P A;  4CVM A;  4PVG A;  2WGP A;  1OEO X;  4GWF A;  1G4W R;  4S0G A;  1ECV A;  2I6M A;  3ZM6 A;  1Q1M A;  2UUO A;  2BGE A;  5KA2 A;  1FGS A;  3QCK A;  1T48 A;  1G1F A;  4JBC A;  2NLK A;  1MKP A;  2CFV A;  5MMZ B;  1EEN A;  1I9S A;  2GWO A;  5BX1 A;  4CVK A;  3I80 A;  1OEU A;  4RH5 A;  1I57 A;  1YPT A;  3OLR A;  3V0E A;  4GE6 A;  3ZV2 A;  1PTU A;  2Y2F A;  3LK7 A;  4NX8 A;  3M4U A;  4OHI A;  5K25 A;  2QDP A;  4QF5 A;  2Q47 A;  3QCC A;  3UAG A;  2HXP A;  1ZCK A;  1GWZ A;  2F6W A;  2I3R A;  2HC2 A;  3F99 A;  3ZMP A;  2CM8 A;  2A8B A;  1PXH A;  3MOW A;  2OC3 A;  2I1Y A;  2WJP A;  2GJT A;  1AAX A;  2HC1 A;  3ZM5 A;  1BZH A;  1Q6M A;  3AWG A;  2H03 A;  4WTY A;  2PBN A;  2F6F A;  4GFU A;  1T49 A;  2I6I A;  1L8G A;  2OUD A;  2Y1O A;  4R0T A;  1JLN A;  2DXP A;  4OHL A;  1PA1 A;  1YGU A;  1D5R A;  1YZ4 A;  2I4G A;  5K22 A;  3V0H A;  3RZ2 A;  2H4K A;  2QCJ A;  4B04 A;  2XPC A;  5LXQ B;  1PTY A;  1OHD A;  3D1O A;  2VTD A;  5M43 A;  1PTV A;  1P15 A;  4GE2 A;  3S3F A;  3V0J A;  3EAX A;  4ZN5 A;  4ICZ A;  4R30 A;  4BUB A;  3PS5 A;  5AWX A;  5A5E A;  1NZ7 A;  2HB1 A;  3AWF A;  3D9C A;  2GCA A;  1I9T A;  1A5Y A;  2G59 A;  3BRH A;  1J4X A;  5KA3 A;  2ZN7 A;  4YAA A;  1P31 A;  1U25 A;  1XRI A;  4IKC A;  2VEV A;  1C88 A;  1ZC0 A;  2NZ6 A;  2F6V A;  3EU0 A;  4YR8 B;  3O3L A;  3ZM3 A;  1ZCL A;  3N2A A;  2I4H A;  3GXH A;  1C83 A;  2BV5 A;  2CNE A;  2NTA A;  4RH9 A;  2B4S A;  2Y67 A;  4JMJ A;  2F6Y A;  3ZL8 A;  2PQ5 A;  5BZZ A;  1E8C A;  4QBW A;  1OES A;  1J6U A;  1YTW A;  5K23 A;  4QUN A;  2NV5 A;  1C85 A;  1EEH A;  2Q05 A;  2ZMM A;  3QCH A;  2H02 A;  3F81 A;  2JFG A;  2VEY A;  3QCI A;  1YFO A;  2B4P A;  4D3R A;  2H4G A;  3D1H A;  2FH7 A;  2BZL A;  3S4E A;  3I36 A;  1P3D A;  1XXV A;  2CNH A;  2QEP A;  4QBE A;  5A5F A;  1Q6J A;  4J51 A;  4OHD A;  5IBS A;  1JBW A;  2HY3 A;  5BUG A;  1G7G A;  4KYR A;  2PA5 A;  1U24 A;  4Y2E A;  1U26 A;  3QCE A;  3V0F A;  2SHP A;  2OOQ A;  2GP0 A; 
#chains in the Genus database with same CATH homology
 4H1O A;  1WRM A;  1YTN A;  5KAA A;  2HVL A;  4DGP A;  3BM8 A;  4ZI4 A;  2R0B A;  2CNF A;  1G1G A;  4KI9 A;  2FJM A;  1PA9 A;  2ESB A;  1EEO A;  3AWE A;  3D42 A;  4ZRT A;  2B07 A;  1BZC A;  1JF7 A;  4OHE A;  4RHG A;  5EHR A;  2I6O A;  3MOZ A;  2H04 A;  4HJQ A;  1ONY A;  1C86 A;  3QCF A;  2VEX A;  4NWG A;  4AZ1 A;  4GS0 A;  4TVV A;  1Q6T A;  2B3O A;  4HRF A;  2H4V A;  4OHH A;  1YGR A;  3BLT A;  2CJZ A;  1VHR A;  1OEV A;  4GRY A;  2QCT A;  2CNG A;  3NME A;  1Q6S A;  2I42 A;  1WAX A;  2G6Z A;  4DGX A;  4WU2 A;  3V0D A;  1QZ0 A;  2F71 A;  2VEU A;  4GFV A;  2C7S A;  5KA1 A;  2FJN A;  4MBB A;  1NWL A;  1V3A A;  3F9A A;  1OHE A;  4I8N A;  5IBM A;  1QXK A;  1PTT A;  4H34 A;  3QKP A;  2PT0 A;  4BJO A;  1SUG A;  4ERC A;  2J17 A;  2B4U A;  1OET A;  5KA4 A;  4Y14 A;  1YTS A;  1Q6N A;  3MMJ A;  1XBO A;  2IMG A;  3A5J A;  4KYQ A;  2CM2 A;  2Y96 A;  3S3H A;  3RO1 A;  2I6J A;  4RKK A;  1ONZ A;  4PYH A;  4QAH A;  3S3K A;  2AHS A;  1YN9 A;  3EB1 A;  3ZM2 A;  2F46 A;  2QDC A;  1LYV A;  3SR9 A;  2I75 A;  4GRZ A;  2C46 A;  3RGO A;  2PI7 A;  2OZ5 A;  3QCJ A;  3LJ8 A;  3QCB A;  1R6H A;  4QUM A;  1ZZW A;  2F6Z A;  5KAB A;  2QBR A;  1T4J A;  4GE5 A;  3OMH A;  1FPZ A;  2M3V A;  3SME A;  5GTJ A;  1FPR A;  3O4T A;  5I6V A;  5K9V A;  3V0G A;  3CWE A;  2JJD A;  4BPC A;  5KA9 A;  2I3U A;  3S4O A;  2QBS A;  3QCD A;  3I7Z A;  5KA0 A;  2P4D A;  4NWF A;  2PSZ A;  1C84 A;  3ZM0 A;  3QCL A;  1LQF A;  2RF6 A;  5KA7 A;  2CM3 A;  4JNB A;  5BZX A;  5K9W A;  4WU3 A;  3N0A A;  3RGQ A;  1L8K A;  1OHC A;  5EHP A;  3H2X A;  1OEM X;  3EZZ A;  3O5X A;  2J16 A;  5HDE A;  2CMC A;  2CM7 A;  1WCH A;  2NT2 A;  2YDU A;  2I5X A;  2QBQ A;  1X24 A;  3EMU A;  5KAC A;  2NT7 A;  3F41 A;  3S3E A;  2B4O A;  3D1Q A;  1FQ1 A;  2F70 A;  3D44 A;  1PYN A;  1G7F A;  2A3K A;  2B49 A;  2HCM A;  2HNP A;  4D3Q A;  4HJP A;  1M3G A;  2BGD A;  4WOH A;  1RPM A;  5J8R A;  1YWF A;  3QCN A;  2AZR A;  2J16 B;  3F9B A;  4RDD A;  1Q6P A;  1BZJ A;  4Z6B A;  3U96 A;  1NO6 A;  5KAD A;  2VEW A;  3ZMQ A;  1G4U S;  2F6T A;  4D3P A;  4NND A;  5K24 A;  1LAR A;  3ZM1 A;  3BLU A;  2QBP A;  1KAK A;  1GFY A;  2I4E A;  4JMK A;  4RI4 A;  3QKQ A;  2P6X A;  3GXG A;  2E0T A;  2BIJ A;  1NWE A;  1XXP A;  1C87 A;  2CMB A;  1G1H A;  2HNQ A;  2CMA A;  3QCM A;  2MBC A;  1RXD A;  1XM2 A;  1NL9 A;  3QCG A;  4R0S A;  4QAP A;  1KAV A;  1NNY A;  2CNI A;  3CM3 A;  4NYH A;  3O4U A;  3B7O A;  3A5K A;  4RI5 A;  3V0I A;  1PH0 A;  5KA8 A;  3O4S A;  2QDM A;  2I6P A;  4PVG A;  2WGP A;  1OEO X;  4GWF A;  1G4W R;  4S0G A;  1ECV A;  2I6M A;  1Q1M A;  2BGE A;  5KA2 A;  3QCK A;  1T48 A;  1G1F A;  4JBC A;  2NLK A;  1MKP A;  2CFV A;  5MMZ B;  1EEN A;  1I9S A;  2GWO A;  5BX1 A;  3I80 A;  1OEU A;  4RH5 A;  1I57 A;  1YPT A;  3OLR A;  3V0E A;  4GE6 A;  3ZV2 A;  1PTU A;  2Y2F A;  4NX8 A;  3M4U A;  4OHI A;  5K25 A;  2QDP A;  3QCC A;  2Q47 A;  2HXP A;  1ZCK A;  1GWZ A;  2F6W A;  2I3R A;  2HC2 A;  3F99 A;  3ZMP A;  2CM8 A;  2A8B A;  1PXH A;  3MOW A;  2OC3 A;  2I1Y A;  2GJT A;  1AAX A;  2HC1 A;  1BZH A;  1Q6M A;  3AWG A;  2H03 A;  4WTY A;  2PBN A;  2F6F A;  4GFU A;  1T49 A;  2I6I A;  1L8G A;  2OUD A;  4R0T A;  1JLN A;  2DXP A;  4OHL A;  1PA1 A;  1YGU A;  1D5R A;  1YZ4 A;  2I4G A;  5K22 A;  3V0H A;  3RZ2 A;  2H4K A;  2QCJ A;  4B04 A;  5LXQ B;  1PTY A;  1OHD A;  3D1O A;  5M43 A;  1PTV A;  1P15 A;  4GE2 A;  3S3F A;  3V0J A;  3EAX A;  4ZN5 A;  4ICZ A;  4R30 A;  3PS5 A;  5AWX A;  1NZ7 A;  2HB1 A;  3AWF A;  3D9C A;  1I9T A;  1A5Y A;  2G59 A;  3BRH A;  1J4X A;  5KA3 A;  2ZN7 A;  4YAA A;  1U25 A;  1XRI A;  4IKC A;  2VEV A;  1C88 A;  1ZC0 A;  2NZ6 A;  2F6V A;  3EU0 A;  4YR8 B;  3O3L A;  3ZM3 A;  1ZCL A;  2I4H A;  3GXH A;  1C83 A;  2BV5 A;  2CNE A;  2NTA A;  4RH9 A;  2B4S A;  4JMJ A;  2F6Y A;  2PQ5 A;  5BZZ A;  4QBW A;  1OES A;  1YTW A;  5K23 A;  4QUN A;  2NV5 A;  1C85 A;  2Q05 A;  2ZMM A;  3QCH A;  2H02 A;  3F81 A;  2VEY A;  3QCI A;  1YFO A;  2B4P A;  4D3R A;  2H4G A;  3D1H A;  2FH7 A;  2BZL A;  3S4E A;  3I36 A;  1XXV A;  2CNH A;  2QEP A;  4QBE A;  1Q6J A;  4J51 A;  4OHD A;  5IBS A;  5BUG A;  2HY3 A;  1G7G A;  4KYR A;  2PA5 A;  1U24 A;  4Y2E A;  1U26 A;  3QCE A;  3V0F A;  2SHP A;  2OOQ A;  2GP0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...