1YN9A

Crystal structure of baculovirus rna 5'-phosphatase complexed with phosphate
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
168
structure length
168
Chain Sequence
MFPARWHNYLQCGQVIKDSNLICFKTPLRPELFAYVTSEEDVWTAEQIVKQNPSIGAIIDLTNTSKYYDGVHFLRAGLLYKKIQVPGQTLPPESIVQEFIDTVKEFTEKCPGMLVGVHCTHGINRTGYMVCRYLMHTLGIAPQEAIDRFEKARGHKIERQNYVQDLLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of baculovirus RNA triphosphatase complexed with phosphate
pubmed doi rcsb
source organism Autographa californica nucleopolyhedrovirus
molecule tags Hydrolase
molecule keywords polynucleotide 5'-phosphatase
total genus 59
structure length 168
sequence length 168
chains with identical sequence B, C
ec nomenclature ec 3.1.3.48: Protein-tyrosine-phosphatase.
pdb deposition date 2005-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00782 DSPc Dual specificity phosphatase, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.190.10 Alpha Beta Alpha-Beta Complex Protein-Tyrosine Phosphatase; Chain A Protein tyrosine phosphatase superfamily 1yn9A00
3D42A 1OEMX 3EB1A 3V0DA 2MBCA 2J16B 2BZLA 3MMJA 3V0HA 2NV5A 3RGOA 2M3VA 1G1FA 1P15A 2WGPA 4JMKA 1NL9A 5KA8A 5IBSA 4GFVA 2A3KA 2NTAA 4QBEA 2H04A 2RF6A 2PI7A 4JBCA 3QCKA 5AWXA 4RH9A 3QKPA 2CM8A 4ZN5A 1NNYA 3A5KA 4NWGA 1KAVA 1GWZA 1YTWA 2C46A 3GXHA 1RXDA 4GS0A 2NLKA 1RPMA 3EZZA 4ICZA 3ZM0A 1ECVA 2BIJA 2HNPA 1U25A 2B4UA 4NNDA 1GFYA 3V0IA 1T4JA 1J4XA 3V0JA 2I6OA 4IKCA 1G4WR 3QCHA 3V0FA 3QCBA 1PA9A 4J51A 1I9TA 3BM8A 5BZXA 1WRMA 3QCIA 4JMJA 2NT2A 2CNIA 2AHSA 4RI4A 4DGXA 1V3AA 1BZHA 2HXPA 3QCJA 1G7GA 1PTVA 5KA0A 2OOQA 4GE6A 1YN9A 1OHEA 1Q6TA 3F81A 5KA1A 1YGUA 3OMHA 4HJQA 1NWLA 1T48A 5KA7A 4OHLA 3M4UA 4OHHA 3S3EA 2CNHA 2GP0A 3ZMQA 4YR8B 3O4SA 5KA3A 3EMUA 1LQFA 2I4EA 2OC3A 2OUDA 2FJMA 1T49A 2HY3A 1C84A 3S3FA 2HC1A 2I3UA 2F46A 1BZJA 3BLTA 2F70A 2AZRA 2VEVA 1KAKA 1PA1A 2I6MA 1OEOX 3S3HA 1ONYA 3S4OA 3ZM2A 1ZCLA 4ERCA 5HDEA 2OZ5A 2CJZA 1XXPA 1LYVA 3RZ2A 4WOHA 5K24A 2VEYA 4D3RA 3O3LA 1D5RA 3RGQA 4I8NA 5EHPA 2G6ZA 2HB1A 3B7OA 2B3OA 2VEXA 4PYHA 1ZZWA 2FH7A 2P6XA 1MKPA 1YGRA 1NWEA 2H03A 1XRIA 1YFOA 2B4SA 3BLUA 3O5XA 2I75A 2NZ6A 2JJDA 1C83A 1WCHA 3MOZA 2PSZA 3OLRA 2H4VA 5KA9A 4OHEA 4QUNA 1M3GA 1XXVA 1L8GA 5IBMA 2B4PA 4B04A 4RH5A 2B49A 1I9SA 2F6WA 1L8KA 1Q6JA 3D9CA 1NZ7A 1FQ1A 3SR9A 3NMEA 2CM7A 4R0SA 5M43A 5K9WA 1BZCA 2QBPA 1Q1MA 3O4UA 3AWGA 2Q05A 3QCNA 2QCTA 1G1HA 2F6TA 2QBQA 1C88A 1C85A 3BRHA 3CM3A 4R0TA 2CM2A 2H02A 2I6PA 1U26A 4BPCA 4R30A 2Y96A 2QDMA 5K9VA 3QCMA 2P4DA 1EEOA 2CM3A 4KYQA 1Q6NA 5BZZA 3F9AA 2QDPA 2FJNA 3A5JA 4JNBA 2H4GA 4QAPA 2CNGA 2I6IA 3QCLA 2F71A 2Q47A 3U96A 3F99A 2BGEA 4WTYA 3QCDA 1ZC0A 2B4OA 2IMGA 3QKQA 2I6JA 1I57A 2ESBA 5I6VA 1G1GA 2HVLA 2I5XA 4YAAA 3MOWA 2A8BA 5BX1A 4GWFA 5MMZB 2CMBA 2B07A 4GFUA 1XBOA 2SHPA 1PTTA 5K25A 3F9BA 2F6FA 3CWEA 4HRFA 2I4HA 1LARA 4HJPA 4PVGA 3RO1A 2QBRA 1VHRA 1QXKA 5KA2A 2PQ5A 5GTJA 4BJOA 2GWOA 2G59A 4NYHA 1YWFA 2CMCA 2I4GA 1C86A 4OHDA 2I42A 1FPZA 1JLNA 4S0GA 2CFVA 4D3QA 2CMAA 4OHIA 2QDCA 4QAHA 1WAXA 2QCJA 2PA5A 2HCMA 5KABA 4DGPA 2I3RA 3V0GA 3I36A 3S3KA 3ZM3A 2J16A 2PT0A 4NWFA 1PTUA 2F6ZA 2YDUA 2VEUA 3N0AA 2Y2FA 4Z6BA 4Y2EA 3H2XA 1OEVA 5KA4A 4QBWA 2BGDA 4H34A 1OHCA 1Q6MA 3QCCA 3QCGA 4GRZA 1YTSA 2J17A 1NO6A 5BUGA 4RHGA 4Y14A 4RKKA 1G4US 3ZM1A 5KAAA 4TVVA 5KADA 2R0BA 1G7FA 4AZ1A 1C87A 2HNQA 3V0EA 4RDDA 5K23A 4H1OA 3ZMPA 4NX8A 2PBNA 2C7SA 2E0TA 3QCFA 1A5YA 1SUGA 1FPRA 1PTYA 4GE2A 3EAXA 3F41A 1U24A 1QZ0A 3LJ8A 2ZMMA 3O4TA 1ONZA 4QUMA 1YPTA 2CNFA 2H4KA 1Q6SA 2DXPA 4KYRA 3AWEA 5J8RA 4GRYA 2F6YA 2HC2A 3GXGA 3EU0A 1PYNA 4WU2A 4MBBA 5K22A 3SMEA 1EENA 3D1HA 4ZRTA 5KACA 3I7ZA 3PS5A 1JF7A 3S4EA 1PH0A 4ZI4A 2GJTA 2F6VA 5LXQB 2VEWA 3D1QA 1OHDA 4GE5A 4D3PA 1YZ4A 3QCEA 1PXHA 4KI9A 3AWFA 1OEUA 2CNEA 1AAXA 4RI5A 2I1YA 1Q6PA 1ZCKA 1OESA 3D44A 2QBSA 1X24A 2NT7A 5EHRA 2QEPA 4WU3A 1R6HA 2ZN7A 3D1OA 3ZV2A 1XM2A 3I80A 1YTNA 1OETA 2BV5A
chains in the Genus database with same CATH superfamily
1UAGA 3D42A 1OEMX 3EB1A 3V0DA 2MBCA 2J16B 2X5OA 2BZLA 3MMJA 3V0HA 2NV5A 2Y66A 3RGOA 2M3VA 1G1FA 1P15A 2WGPA 4JMKA 1NL9A 5KA8A 5IBSA 4GFVA 2A3KA 2NTAA 4QBEA 2H04A 3ZM6A 4ZIYA 2RF6A 2PI7A 4JBCA 3ZL8A 3QCKA 5AWXA 4RH9A 3QKPA 2CM8A 1JBVA 4ZN5A 1NNYA 3A5KA 4NWGA 1KAVA 1GWZA 1YTWA 2C46A 3GXHA 1RXDA 4GS0A 2F00A 2NLKA 4CVKA 1RPMA 3EZZA 4ICZA 3ZM0A 4BUBA 2GCAA 1ECVA 2BIJA 2HNPA 1U25A 2Y1OA 2B4UA 4NNDA 1GFYA 3V0IA 1T4JA 1J4XA 3V0JA 2I6OA 4IKCA 1G4WR 3NRSA 3QCHA 3V0FA 3QCBA 1PA9A 4J51A 1I9TA 3QCZA 3BM8A 5BZXA 2XJAA 1WRMA 3QCIA 4JMJA 2NT2A 2CNIA 2AHSA 4RI4A 4DGXA 1V3AA 1BZHA 2HXPA 3QCJA 1G7GA 1PTVA 5KA0A 2OOQA 4GE6A 1YN9A 1OHEA 1Q6TA 3F81A 5KA1A 1YGUA 1O5ZA 3OMHA 2WJPA 4HJQA 1NWLA 1T48A 2UAGA 5KA7A 2VORA 1GQQA 4OHLA 3M4UA 4OHHA 3S3EA 2CNHA 2GP0A 3ZMQA 4YR8B 3O4SA 5KA3A 2Y68A 3EMUA 1LQFA 2I4EA 2OC3A 2OUDA 2FJMA 1T49A 2HY3A 1C84A 3S3FA 2HC1A 2I3UA 2F46A 1BZJA 3BLTA 2F70A 5A5EA 2AZRA 2VEVA 1KAKA 1PA1A 1W7KA 2I6MA 1OEOX 3S3HA 1ONYA 2GC5A 3S4OA 3ZM2A 1ZCLA 4ERCA 5HDEA 2OZ5A 2CJZA 1XXPA 1FGSA 1LYVA 3RZ2A 4WOHA 5K24A 2VEYA 4D3RA 3O3LA 1D5RA 3RGQA 2WTZA 4I8NA 5EHPA 2G6ZA 2HB1A 3B7OA 2B3OA 2VEXA 4PYHA 1ZZWA 3LK7A 2FH7A 3UAGA 2P6XA 1MKPA 1YGRA 1NWEA 2H03A 1XRIA 1YFOA 2B4SA 3BLUA 3O5XA 2I75A 2NZ6A 2JJDA 1C83A 3MVNA 5A5FA 1WCHA 3MOZA 2PSZA 3OLRA 2H4VA 4UAGA 2VTEA 5KA9A 4OHEA 4QUNA 1M3GA 1XXVA 1L8GA 5IBMA 2B4PA 4B04A 4RH5A 2B49A 1I9SA 2F6WA 1L8KA 1Q6JA 3D9CA 1J6UA 1NZ7A 1FQ1A 3SR9A 3NMEA 2CM7A 4R0SA 5M43A 5K9WA 1BZCA 2QBPA 1Q1MA 3O4UA 3AWGA 2Q05A 3QCNA 2QCTA 1G1HA 2F6TA 2AM1A 2QBQA 3N2AA 1C88A 1C85A 3BRHA 3CM3A 4R0TA 2CM2A 2H02A 2I6PA 1U26A 4BPCA 4R30A 2Y96A 2QDMA 5K9VA 3QCMA 2P4DA 1EEOA 2CM3A 4KYQA 1Q6NA 5BZZA 3F9AA 2QDPA 4QF5A 1W78A 2FJNA 3A5JA 4JNBA 2H4GA 4QAPA 2CNGA 2I6IA 1JBWA 3QCLA 2F71A 2Q47A 3U96A 3F99A 2BGEA 4WTYA 3QCDA 1ZC0A 2B4OA 2IMGA 3QKQA 2JFHA 2I6JA 1I57A 2ESBA 5I6VA 1G1GA 2HVLA 2I5XA 4YAAA 3MOWA 2A8BA 2XPCA 5BX1A 4GWFA 5MMZB 2CMBA 2B07A 4GFUA 1XBOA 2SHPA 1PTTA 5K25A 3F9BA 2F6FA 1E8CA 3CWEA 4CVLA 4HRFA 2I4HA 1LARA 4HJPA 4PVGA 3PYZA 3RO1A 2QBRA 1VHRA 1QXKA 5KA2A 2PQ5A 5GTJA 4BJOA 2JFGA 2GWOA 2G59A 4NYHA 1E0DA 1YWFA 2CMCA 2I4GA 1C86A 2AM2A 4OHDA 2I42A 1FPZA 1JLNA 4S0GA 2CFVA 4D3QA 2CMAA 1GQYA 4OHIA 2QDCA 3HN7A 4QAHA 1WAXA 2QCJA 2PA5A 2VTDA 2HCMA 5KABA 4DGPA 2I3RA 3V0GA 3I36A 3S3KA 2UUOA 3ZM3A 2J16A 2PT0A 4NWFA 1PTUA 2F6ZA 2VOSA 3N0AA 2YDUA 2VEUA 2Y2FA 4Z6BA 4Y2EA 3H2XA 1OEVA 5KA4A 4QBWA 2BGDA 4H34A 2JFFA 1OHCA 4C12A 1Q6MA 3QCCA 3QCGA 4GRZA 1YTSA 2J17A 1NO6A 5BUGA 4RHGA 4Y14A 1P31A 4RKKA 1G4US 2GCBA 3ZM1A 5KAAA 4TVVA 5KADA 2R0BA 1G7FA 4AZ1A 1C87A 2HNQA 3V0EA 4CVMA 4RDDA 5K23A 4H1OA 3ZMPA 4NX8A 2PBNA 4BUCA 2C7SA 2E0TA 3QCFA 1A5YA 1SUGA 1FPRA 1PTYA 4GE2A 3EAXA 3F41A 1U24A 1QZ0A 3LJ8A 2ZMMA 3O4TA 1ONZA 2UUPA 4QUMA 1YPTA 2CNFA 2H4KA 1Q6SA 2DXPA 4KYRA 3AWEA 5J8RA 4GRYA 2F6YA 2HC2A 3GXGA 3EU0A 1PYNA 4WU2A 4MBBA 5K22A 3SMEA 1EENA 3D1HA 4ZRTA 4QDIA 5KACA 3I7ZA 3PS5A 1JF7A 3S4EA 1EEHA 1PH0A 4ZI4A 2GJTA 2F6VA 5LXQB 2VEWA 3D1QA 1OHDA 4GE5A 4C13A 4D3PA 4HV4A 1YZ4A 3QCEA 1PXHA 4KI9A 3AWFA 1GG4A 1OEUA 2CNEA 1AAXA 4RI5A 2I1YA 1Q6PA 1ZCKA 1OESA 3D44A 3ZM5A 2QBSA 1X24A 2NT7A 5EHRA 2QEPA 4WU3A 1R6HA 2ZN7A 2GC6A 3D1OA 2Y67A 1P3DA 3ZV2A 1XM2A 3I80A 1YTNA 1OETA 2BV5A
chains in the Genus database with same CATH topology
3D42A 1OEMX 3EB1A 3V0DA 2MBCA 2J16B 2BZLA 3MMJA 3V0HA 2NV5A 3RGOA 2M3VA 1G1FA 1P15A 2WGPA 4JMKA 1NL9A 5KA8A 5IBSA 4GFVA 2A3KA 2NTAA 4QBEA 2H04A 2RF6A 2PI7A 4JBCA 3QCKA 5AWXA 4RH9A 3QKPA 2CM8A 4ZN5A 1NNYA 3A5KA 4NWGA 1KAVA 1GWZA 1YTWA 2C46A 3GXHA 1RXDA 4GS0A 2NLKA 1RPMA 3EZZA 4ICZA 3ZM0A 1ECVA 2BIJA 2HNPA 1U25A 2B4UA 4NNDA 1GFYA 3V0IA 1T4JA 1J4XA 3V0JA 2I6OA 4IKCA 1G4WR 3QCHA 3V0FA 3QCBA 1PA9A 4J51A 1I9TA 3BM8A 5BZXA 1WRMA 3QCIA 4JMJA 2NT2A 2CNIA 2AHSA 4RI4A 4DGXA 1V3AA 1BZHA 2HXPA 3QCJA 1G7GA 1PTVA 5KA0A 2OOQA 4GE6A 1YN9A 1OHEA 1Q6TA 3F81A 5KA1A 1YGUA 3OMHA 4HJQA 1NWLA 1T48A 5KA7A 4OHLA 3M4UA 4OHHA 3S3EA 2CNHA 2GP0A 3ZMQA 4YR8B 3O4SA 5KA3A 3EMUA 1LQFA 2I4EA 2OC3A 2OUDA 2FJMA 1T49A 2HY3A 1C84A 3S3FA 2HC1A 2I3UA 2F46A 1BZJA 3BLTA 2F70A 2AZRA 2VEVA 1KAKA 1PA1A 2I6MA 1OEOX 3S3HA 1ONYA 3S4OA 3ZM2A 1ZCLA 4ERCA 5HDEA 2OZ5A 2CJZA 1XXPA 1LYVA 3RZ2A 4WOHA 5K24A 2VEYA 4D3RA 3O3LA 1D5RA 3RGQA 4I8NA 5EHPA 2G6ZA 2HB1A 3B7OA 2B3OA 2VEXA 4PYHA 1ZZWA 2FH7A 2P6XA 1MKPA 1YGRA 1NWEA 2H03A 1XRIA 1YFOA 2B4SA 3BLUA 3O5XA 2I75A 2NZ6A 2JJDA 1C83A 1WCHA 3MOZA 2PSZA 3OLRA 2H4VA 5KA9A 4OHEA 4QUNA 1M3GA 1XXVA 1L8GA 5IBMA 2B4PA 4B04A 4RH5A 2B49A 1I9SA 2F6WA 1L8KA 1Q6JA 3D9CA 1NZ7A 1FQ1A 3SR9A 3NMEA 2CM7A 4R0SA 5M43A 5K9WA 1BZCA 2QBPA 1Q1MA 3O4UA 3AWGA 2Q05A 3QCNA 2QCTA 1G1HA 2F6TA 2QBQA 1C88A 1C85A 3BRHA 3CM3A 4R0TA 2CM2A 2H02A 2I6PA 1U26A 4BPCA 4R30A 2Y96A 2QDMA 5K9VA 3QCMA 2P4DA 1EEOA 2CM3A 4KYQA 1Q6NA 5BZZA 3F9AA 2QDPA 2FJNA 3A5JA 4JNBA 2H4GA 4QAPA 2CNGA 2I6IA 3QCLA 2F71A 2Q47A 3U96A 3F99A 2BGEA 4WTYA 3QCDA 1ZC0A 2B4OA 2IMGA 3QKQA 2I6JA 1I57A 2ESBA 5I6VA 1G1GA 2HVLA 2I5XA 4YAAA 3MOWA 2A8BA 5BX1A 4GWFA 5MMZB 2CMBA 2B07A 4GFUA 1XBOA 2SHPA 1PTTA 5K25A 3F9BA 2F6FA 3CWEA 4HRFA 2I4HA 1LARA 4HJPA 4PVGA 3RO1A 2QBRA 1VHRA 1QXKA 5KA2A 2PQ5A 5GTJA 4BJOA 2GWOA 2G59A 4NYHA 1YWFA 2CMCA 2I4GA 1C86A 4OHDA 2I42A 1FPZA 1JLNA 4S0GA 2CFVA 4D3QA 2CMAA 4OHIA 2QDCA 4QAHA 1WAXA 2QCJA 2PA5A 2HCMA 5KABA 4DGPA 2I3RA 3V0GA 3I36A 3S3KA 3ZM3A 2J16A 2PT0A 4NWFA 1PTUA 2F6ZA 2YDUA 2VEUA 3N0AA 2Y2FA 4Z6BA 4Y2EA 3H2XA 1OEVA 5KA4A 4QBWA 2BGDA 4H34A 1OHCA 1Q6MA 3QCCA 3QCGA 4GRZA 1YTSA 2J17A 1NO6A 5BUGA 4RHGA 4Y14A 4RKKA 1G4US 3ZM1A 5KAAA 4TVVA 5KADA 2R0BA 1G7FA 4AZ1A 1C87A 2HNQA 3V0EA 4RDDA 5K23A 4H1OA 3ZMPA 4NX8A 2PBNA 2C7SA 2E0TA 3QCFA 1A5YA 1SUGA 1FPRA 1PTYA 4GE2A 3EAXA 3F41A 1U24A 1QZ0A 3LJ8A 2ZMMA 3O4TA 1ONZA 4QUMA 1YPTA 2CNFA 2H4KA 1Q6SA 2DXPA 4KYRA 3AWEA 5J8RA 4GRYA 2F6YA 2HC2A 3GXGA 3EU0A 1PYNA 4WU2A 4MBBA 5K22A 3SMEA 1EENA 3D1HA 4ZRTA 5KACA 3I7ZA 3PS5A 1JF7A 3S4EA 1PH0A 4ZI4A 2GJTA 2F6VA 5LXQB 2VEWA 3D1QA 1OHDA 4GE5A 4D3PA 1YZ4A 3QCEA 1PXHA 4KI9A 3AWFA 1OEUA 2CNEA 1AAXA 4RI5A 2I1YA 1Q6PA 1ZCKA 1OESA 3D44A 2QBSA 1X24A 2NT7A 5EHRA 2QEPA 4WU3A 1R6HA 2ZN7A 3D1OA 3ZV2A 1XM2A 3I80A 1YTNA 1OETA 2BV5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D42 A;  1OEM X;  3EB1 A;  3V0D A;  2MBC A;  2J16 B;  2BZL A;  3MMJ A;  3V0H A;  2NV5 A;  3RGO A;  2M3V A;  1G1F A;  1P15 A;  2WGP A;  4JMK A;  1NL9 A;  5KA8 A;  5IBS A;  4GFV A;  2A3K A;  2NTA A;  4QBE A;  2H04 A;  2RF6 A;  2PI7 A;  4JBC A;  3QCK A;  5AWX A;  4RH9 A;  3QKP A;  2CM8 A;  4ZN5 A;  1NNY A;  3A5K A;  4NWG A;  1KAV A;  1GWZ A;  1YTW A;  2C46 A;  3GXH A;  1RXD A;  4GS0 A;  2NLK A;  1RPM A;  3EZZ A;  4ICZ A;  3ZM0 A;  1ECV A;  2BIJ A;  2HNP A;  1U25 A;  2B4U A;  4NND A;  1GFY A;  3V0I A;  1T4J A;  1J4X A;  3V0J A;  2I6O A;  4IKC A;  1G4W R;  3QCH A;  3V0F A;  3QCB A;  1PA9 A;  4J51 A;  1I9T A;  3BM8 A;  5BZX A;  1WRM A;  3QCI A;  4JMJ A;  2NT2 A;  2CNI A;  2AHS A;  4RI4 A;  4DGX A;  1V3A A;  1BZH A;  2HXP A;  3QCJ A;  1G7G A;  1PTV A;  5KA0 A;  2OOQ A;  4GE6 A;  1YN9 A;  1OHE A;  1Q6T A;  3F81 A;  5KA1 A;  1YGU A;  3OMH A;  4HJQ A;  1NWL A;  1T48 A;  5KA7 A;  4OHL A;  3M4U A;  4OHH A;  3S3E A;  2CNH A;  2GP0 A;  3ZMQ A;  4YR8 B;  3O4S A;  5KA3 A;  3EMU A;  1LQF A;  2I4E A;  2OC3 A;  2OUD A;  2FJM A;  1T49 A;  2HY3 A;  1C84 A;  3S3F A;  2HC1 A;  2I3U A;  2F46 A;  1BZJ A;  3BLT A;  2F70 A;  2AZR A;  2VEV A;  1KAK A;  1PA1 A;  2I6M A;  1OEO X;  3S3H A;  1ONY A;  3S4O A;  3ZM2 A;  1ZCL A;  4ERC A;  5HDE A;  2OZ5 A;  2CJZ A;  1XXP A;  1LYV A;  3RZ2 A;  4WOH A;  5K24 A;  2VEY A;  4D3R A;  3O3L A;  1D5R A;  3RGQ A;  4I8N A;  5EHP A;  2G6Z A;  2HB1 A;  3B7O A;  2B3O A;  2VEX A;  4PYH A;  1ZZW A;  2FH7 A;  2P6X A;  1MKP A;  1YGR A;  1NWE A;  2H03 A;  1XRI A;  1YFO A;  2B4S A;  3BLU A;  3O5X A;  2I75 A;  2NZ6 A;  2JJD A;  1C83 A;  1WCH A;  3MOZ A;  2PSZ A;  3OLR A;  2H4V A;  5KA9 A;  4OHE A;  4QUN A;  1M3G A;  1XXV A;  1L8G A;  5IBM A;  2B4P A;  4B04 A;  4RH5 A;  2B49 A;  1I9S A;  2F6W A;  1L8K A;  1Q6J A;  3D9C A;  1NZ7 A;  1FQ1 A;  3SR9 A;  3NME A;  2CM7 A;  4R0S A;  5M43 A;  5K9W A;  1BZC A;  2QBP A;  1Q1M A;  3O4U A;  3AWG A;  2Q05 A;  3QCN A;  2QCT A;  1G1H A;  2F6T A;  2QBQ A;  1C88 A;  1C85 A;  3BRH A;  3CM3 A;  4R0T A;  2CM2 A;  2H02 A;  2I6P A;  1U26 A;  4BPC A;  4R30 A;  2Y96 A;  2QDM A;  5K9V A;  3QCM A;  2P4D A;  1EEO A;  2CM3 A;  4KYQ A;  1Q6N A;  5BZZ A;  3F9A A;  2QDP A;  2FJN A;  3A5J A;  4JNB A;  2H4G A;  4QAP A;  2CNG A;  2I6I A;  3QCL A;  2F71 A;  2Q47 A;  3U96 A;  3F99 A;  2BGE A;  4WTY A;  3QCD A;  1ZC0 A;  2B4O A;  2IMG A;  3QKQ A;  2I6J A;  1I57 A;  2ESB A;  5I6V A;  1G1G A;  2HVL A;  2I5X A;  4YAA A;  3MOW A;  2A8B A;  5BX1 A;  4GWF A;  5MMZ B;  2CMB A;  2B07 A;  4GFU A;  1XBO A;  2SHP A;  1PTT A;  5K25 A;  3F9B A;  2F6F A;  3CWE A;  4HRF A;  2I4H A;  1LAR A;  4HJP A;  4PVG A;  3RO1 A;  2QBR A;  1VHR A;  1QXK A;  5KA2 A;  2PQ5 A;  5GTJ A;  4BJO A;  2GWO A;  2G59 A;  4NYH A;  1YWF A;  2CMC A;  2I4G A;  1C86 A;  4OHD A;  2I42 A;  1FPZ A;  1JLN A;  4S0G A;  2CFV A;  4D3Q A;  2CMA A;  4OHI A;  2QDC A;  4QAH A;  1WAX A;  2QCJ A;  2PA5 A;  2HCM A;  5KAB A;  4DGP A;  2I3R A;  3V0G A;  3I36 A;  3S3K A;  3ZM3 A;  2J16 A;  2PT0 A;  4NWF A;  1PTU A;  2F6Z A;  2YDU A;  2VEU A;  3N0A A;  2Y2F A;  4Z6B A;  4Y2E A;  3H2X A;  1OEV A;  5KA4 A;  4QBW A;  2BGD A;  4H34 A;  1OHC A;  1Q6M A;  3QCC A;  3QCG A;  4GRZ A;  1YTS A;  2J17 A;  1NO6 A;  5BUG A;  4RHG A;  4Y14 A;  4RKK A;  1G4U S;  3ZM1 A;  5KAA A;  4TVV A;  5KAD A;  2R0B A;  1G7F A;  4AZ1 A;  1C87 A;  2HNQ A;  3V0E A;  4RDD A;  5K23 A;  4H1O A;  3ZMP A;  4NX8 A;  2PBN A;  2C7S A;  2E0T A;  3QCF A;  1A5Y A;  1SUG A;  1FPR A;  1PTY A;  4GE2 A;  3EAX A;  3F41 A;  1U24 A;  1QZ0 A;  3LJ8 A;  2ZMM A;  3O4T A;  1ONZ A;  4QUM A;  1YPT A;  2CNF A;  2H4K A;  1Q6S A;  2DXP A;  4KYR A;  3AWE A;  5J8R A;  4GRY A;  2F6Y A;  2HC2 A;  3GXG A;  3EU0 A;  1PYN A;  4WU2 A;  4MBB A;  5K22 A;  3SME A;  1EEN A;  3D1H A;  4ZRT A;  5KAC A;  3I7Z A;  3PS5 A;  1JF7 A;  3S4E A;  1PH0 A;  4ZI4 A;  2GJT A;  2F6V A;  5LXQ B;  2VEW A;  3D1Q A;  1OHD A;  4GE5 A;  4D3P A;  1YZ4 A;  3QCE A;  1PXH A;  4KI9 A;  3AWF A;  1OEU A;  2CNE A;  1AAX A;  4RI5 A;  2I1Y A;  1Q6P A;  1ZCK A;  1OES A;  3D44 A;  2QBS A;  1X24 A;  2NT7 A;  5EHR A;  2QEP A;  4WU3 A;  1R6H A;  2ZN7 A;  3D1O A;  3ZV2 A;  1XM2 A;  3I80 A;  1YTN A;  1OET A;  2BV5 A; 
#chains in the Genus database with same CATH topology
 1UAG A;  3D42 A;  1OEM X;  3EB1 A;  3V0D A;  2MBC A;  2J16 B;  2X5O A;  2BZL A;  3MMJ A;  3V0H A;  2NV5 A;  2Y66 A;  3RGO A;  2M3V A;  1G1F A;  1P15 A;  2WGP A;  4JMK A;  1NL9 A;  5KA8 A;  5IBS A;  4GFV A;  2A3K A;  2NTA A;  4QBE A;  2H04 A;  3ZM6 A;  4ZIY A;  2RF6 A;  2PI7 A;  4JBC A;  3ZL8 A;  3QCK A;  5AWX A;  4RH9 A;  3QKP A;  2CM8 A;  1JBV A;  4ZN5 A;  1NNY A;  3A5K A;  4NWG A;  1KAV A;  1GWZ A;  1YTW A;  2C46 A;  3GXH A;  1RXD A;  4GS0 A;  2F00 A;  2NLK A;  4CVK A;  1RPM A;  3EZZ A;  4ICZ A;  3ZM0 A;  4BUB A;  2GCA A;  1ECV A;  2BIJ A;  2HNP A;  1U25 A;  2Y1O A;  2B4U A;  4NND A;  1GFY A;  3V0I A;  1T4J A;  1J4X A;  3V0J A;  2I6O A;  4IKC A;  1G4W R;  3NRS A;  3QCH A;  3V0F A;  3QCB A;  1PA9 A;  4J51 A;  1I9T A;  3QCZ A;  3BM8 A;  5BZX A;  2XJA A;  1WRM A;  3QCI A;  4JMJ A;  2NT2 A;  2CNI A;  2AHS A;  4RI4 A;  4DGX A;  1V3A A;  1BZH A;  2HXP A;  3QCJ A;  1G7G A;  1PTV A;  5KA0 A;  2OOQ A;  4GE6 A;  1YN9 A;  1OHE A;  1Q6T A;  3F81 A;  5KA1 A;  1YGU A;  1O5Z A;  3OMH A;  2WJP A;  4HJQ A;  1NWL A;  1T48 A;  2UAG A;  5KA7 A;  2VOR A;  1GQQ A;  4OHL A;  3M4U A;  4OHH A;  3S3E A;  2CNH A;  2GP0 A;  3ZMQ A;  4YR8 B;  3O4S A;  5KA3 A;  2Y68 A;  3EMU A;  1LQF A;  2I4E A;  2OC3 A;  2OUD A;  2FJM A;  1T49 A;  2HY3 A;  1C84 A;  3S3F A;  2HC1 A;  2I3U A;  2F46 A;  1BZJ A;  3BLT A;  2F70 A;  5A5E A;  2AZR A;  2VEV A;  1KAK A;  1PA1 A;  1W7K A;  2I6M A;  1OEO X;  3S3H A;  1ONY A;  2GC5 A;  3S4O A;  3ZM2 A;  1ZCL A;  4ERC A;  5HDE A;  2OZ5 A;  2CJZ A;  1XXP A;  1FGS A;  1LYV A;  3RZ2 A;  4WOH A;  5K24 A;  2VEY A;  4D3R A;  3O3L A;  1D5R A;  3RGQ A;  2WTZ A;  4I8N A;  5EHP A;  2G6Z A;  2HB1 A;  3B7O A;  2B3O A;  2VEX A;  4PYH A;  1ZZW A;  3LK7 A;  2FH7 A;  3UAG A;  2P6X A;  1MKP A;  1YGR A;  1NWE A;  2H03 A;  1XRI A;  1YFO A;  2B4S A;  3BLU A;  3O5X A;  2I75 A;  2NZ6 A;  2JJD A;  1C83 A;  3MVN A;  5A5F A;  1WCH A;  3MOZ A;  2PSZ A;  3OLR A;  2H4V A;  4UAG A;  2VTE A;  5KA9 A;  4OHE A;  4QUN A;  1M3G A;  1XXV A;  1L8G A;  5IBM A;  2B4P A;  4B04 A;  4RH5 A;  2B49 A;  1I9S A;  2F6W A;  1L8K A;  1Q6J A;  3D9C A;  1J6U A;  1NZ7 A;  1FQ1 A;  3SR9 A;  3NME A;  2CM7 A;  4R0S A;  5M43 A;  5K9W A;  1BZC A;  2QBP A;  1Q1M A;  3O4U A;  3AWG A;  2Q05 A;  3QCN A;  2QCT A;  1G1H A;  2F6T A;  2AM1 A;  2QBQ A;  3N2A A;  1C88 A;  1C85 A;  3BRH A;  3CM3 A;  4R0T A;  2CM2 A;  2H02 A;  2I6P A;  1U26 A;  4BPC A;  4R30 A;  2Y96 A;  2QDM A;  5K9V A;  3QCM A;  2P4D A;  1EEO A;  2CM3 A;  4KYQ A;  1Q6N A;  5BZZ A;  3F9A A;  2QDP A;  4QF5 A;  1W78 A;  2FJN A;  3A5J A;  4JNB A;  2H4G A;  4QAP A;  2CNG A;  2I6I A;  1JBW A;  3QCL A;  2F71 A;  2Q47 A;  3U96 A;  3F99 A;  2BGE A;  4WTY A;  3QCD A;  1ZC0 A;  2B4O A;  2IMG A;  3QKQ A;  2JFH A;  2I6J A;  1I57 A;  2ESB A;  5I6V A;  1G1G A;  2HVL A;  2I5X A;  4YAA A;  3MOW A;  2A8B A;  2XPC A;  5BX1 A;  4GWF A;  5MMZ B;  2CMB A;  2B07 A;  4GFU A;  1XBO A;  2SHP A;  1PTT A;  5K25 A;  3F9B A;  2F6F A;  1E8C A;  3CWE A;  4CVL A;  4HRF A;  2I4H A;  1LAR A;  4HJP A;  4PVG A;  3PYZ A;  3RO1 A;  2QBR A;  1VHR A;  1QXK A;  5KA2 A;  2PQ5 A;  5GTJ A;  4BJO A;  2JFG A;  2GWO A;  2G59 A;  4NYH A;  1E0D A;  1YWF A;  2CMC A;  2I4G A;  1C86 A;  2AM2 A;  4OHD A;  2I42 A;  1FPZ A;  1JLN A;  4S0G A;  2CFV A;  4D3Q A;  2CMA A;  1GQY A;  4OHI A;  2QDC A;  3HN7 A;  4QAH A;  1WAX A;  2QCJ A;  2PA5 A;  2VTD A;  2HCM A;  5KAB A;  4DGP A;  2I3R A;  3V0G A;  3I36 A;  3S3K A;  2UUO A;  3ZM3 A;  2J16 A;  2PT0 A;  4NWF A;  1PTU A;  2F6Z A;  2VOS A;  3N0A A;  2YDU A;  2VEU A;  2Y2F A;  4Z6B A;  4Y2E A;  3H2X A;  1OEV A;  5KA4 A;  4QBW A;  2BGD A;  4H34 A;  2JFF A;  1OHC A;  4C12 A;  1Q6M A;  3QCC A;  3QCG A;  4GRZ A;  1YTS A;  2J17 A;  1NO6 A;  5BUG A;  4RHG A;  4Y14 A;  1P31 A;  4RKK A;  1G4U S;  2GCB A;  3ZM1 A;  5KAA A;  4TVV A;  5KAD A;  2R0B A;  1G7F A;  4AZ1 A;  1C87 A;  2HNQ A;  3V0E A;  4CVM A;  4RDD A;  5K23 A;  4H1O A;  3ZMP A;  4NX8 A;  2PBN A;  4BUC A;  2C7S A;  2E0T A;  3QCF A;  1A5Y A;  1SUG A;  1FPR A;  1PTY A;  4GE2 A;  3EAX A;  3F41 A;  1U24 A;  1QZ0 A;  3LJ8 A;  2ZMM A;  3O4T A;  1ONZ A;  2UUP A;  4QUM A;  1YPT A;  2CNF A;  2H4K A;  1Q6S A;  2DXP A;  4KYR A;  3AWE A;  5J8R A;  4GRY A;  2F6Y A;  2HC2 A;  3GXG A;  3EU0 A;  1PYN A;  4WU2 A;  4MBB A;  5K22 A;  3SME A;  1EEN A;  3D1H A;  4ZRT A;  4QDI A;  5KAC A;  3I7Z A;  3PS5 A;  1JF7 A;  3S4E A;  1EEH A;  1PH0 A;  4ZI4 A;  2GJT A;  2F6V A;  5LXQ B;  2VEW A;  3D1Q A;  1OHD A;  4GE5 A;  4C13 A;  4D3P A;  4HV4 A;  1YZ4 A;  3QCE A;  1PXH A;  4KI9 A;  3AWF A;  1GG4 A;  1OEU A;  2CNE A;  1AAX A;  4RI5 A;  2I1Y A;  1Q6P A;  1ZCK A;  1OES A;  3D44 A;  3ZM5 A;  2QBS A;  1X24 A;  2NT7 A;  5EHR A;  2QEP A;  4WU3 A;  1R6H A;  2ZN7 A;  2GC6 A;  3D1O A;  2Y67 A;  1P3D A;  3ZV2 A;  1XM2 A;  3I80 A;  1YTN A;  1OET A;  2BV5 A; 
#chains in the Genus database with same CATH homology
 3D42 A;  1OEM X;  3EB1 A;  3V0D A;  2MBC A;  2J16 B;  2BZL A;  3MMJ A;  3V0H A;  2NV5 A;  3RGO A;  2M3V A;  1G1F A;  1P15 A;  2WGP A;  4JMK A;  1NL9 A;  5KA8 A;  5IBS A;  4GFV A;  2A3K A;  2NTA A;  4QBE A;  2H04 A;  2RF6 A;  2PI7 A;  4JBC A;  3QCK A;  5AWX A;  4RH9 A;  3QKP A;  2CM8 A;  4ZN5 A;  1NNY A;  3A5K A;  4NWG A;  1KAV A;  1GWZ A;  1YTW A;  2C46 A;  3GXH A;  1RXD A;  4GS0 A;  2NLK A;  1RPM A;  3EZZ A;  4ICZ A;  3ZM0 A;  1ECV A;  2BIJ A;  2HNP A;  1U25 A;  2B4U A;  4NND A;  1GFY A;  3V0I A;  1T4J A;  1J4X A;  3V0J A;  2I6O A;  4IKC A;  1G4W R;  3QCH A;  3V0F A;  3QCB A;  1PA9 A;  4J51 A;  1I9T A;  3BM8 A;  5BZX A;  1WRM A;  3QCI A;  4JMJ A;  2NT2 A;  2CNI A;  2AHS A;  4RI4 A;  4DGX A;  1V3A A;  1BZH A;  2HXP A;  3QCJ A;  1G7G A;  1PTV A;  5KA0 A;  2OOQ A;  4GE6 A;  1YN9 A;  1OHE A;  1Q6T A;  3F81 A;  5KA1 A;  1YGU A;  3OMH A;  4HJQ A;  1NWL A;  1T48 A;  5KA7 A;  4OHL A;  3M4U A;  4OHH A;  3S3E A;  2CNH A;  2GP0 A;  3ZMQ A;  4YR8 B;  3O4S A;  5KA3 A;  3EMU A;  1LQF A;  2I4E A;  2OC3 A;  2OUD A;  2FJM A;  1T49 A;  2HY3 A;  1C84 A;  3S3F A;  2HC1 A;  2I3U A;  2F46 A;  1BZJ A;  3BLT A;  2F70 A;  2AZR A;  2VEV A;  1KAK A;  1PA1 A;  2I6M A;  1OEO X;  3S3H A;  1ONY A;  3S4O A;  3ZM2 A;  1ZCL A;  4ERC A;  5HDE A;  2OZ5 A;  2CJZ A;  1XXP A;  1LYV A;  3RZ2 A;  4WOH A;  5K24 A;  2VEY A;  4D3R A;  3O3L A;  1D5R A;  3RGQ A;  4I8N A;  5EHP A;  2G6Z A;  2HB1 A;  3B7O A;  2B3O A;  2VEX A;  4PYH A;  1ZZW A;  2FH7 A;  2P6X A;  1MKP A;  1YGR A;  1NWE A;  2H03 A;  1XRI A;  1YFO A;  2B4S A;  3BLU A;  3O5X A;  2I75 A;  2NZ6 A;  2JJD A;  1C83 A;  1WCH A;  3MOZ A;  2PSZ A;  3OLR A;  2H4V A;  5KA9 A;  4OHE A;  4QUN A;  1M3G A;  1XXV A;  1L8G A;  5IBM A;  2B4P A;  4B04 A;  4RH5 A;  2B49 A;  1I9S A;  2F6W A;  1L8K A;  1Q6J A;  3D9C A;  1NZ7 A;  1FQ1 A;  3SR9 A;  3NME A;  2CM7 A;  4R0S A;  5M43 A;  5K9W A;  1BZC A;  2QBP A;  1Q1M A;  3O4U A;  3AWG A;  2Q05 A;  3QCN A;  2QCT A;  1G1H A;  2F6T A;  2QBQ A;  1C88 A;  1C85 A;  3BRH A;  3CM3 A;  4R0T A;  2CM2 A;  2H02 A;  2I6P A;  1U26 A;  4BPC A;  4R30 A;  2Y96 A;  2QDM A;  5K9V A;  3QCM A;  2P4D A;  1EEO A;  2CM3 A;  4KYQ A;  1Q6N A;  5BZZ A;  3F9A A;  2QDP A;  2FJN A;  3A5J A;  4JNB A;  2H4G A;  4QAP A;  2CNG A;  2I6I A;  3QCL A;  2F71 A;  2Q47 A;  3U96 A;  3F99 A;  2BGE A;  4WTY A;  3QCD A;  1ZC0 A;  2B4O A;  2IMG A;  3QKQ A;  2I6J A;  1I57 A;  2ESB A;  5I6V A;  1G1G A;  2HVL A;  2I5X A;  4YAA A;  3MOW A;  2A8B A;  5BX1 A;  4GWF A;  5MMZ B;  2CMB A;  2B07 A;  4GFU A;  1XBO A;  2SHP A;  1PTT A;  5K25 A;  3F9B A;  2F6F A;  3CWE A;  4HRF A;  2I4H A;  1LAR A;  4HJP A;  4PVG A;  3RO1 A;  2QBR A;  1VHR A;  1QXK A;  5KA2 A;  2PQ5 A;  5GTJ A;  4BJO A;  2GWO A;  2G59 A;  4NYH A;  1YWF A;  2CMC A;  2I4G A;  1C86 A;  4OHD A;  2I42 A;  1FPZ A;  1JLN A;  4S0G A;  2CFV A;  4D3Q A;  2CMA A;  4OHI A;  2QDC A;  4QAH A;  1WAX A;  2QCJ A;  2PA5 A;  2HCM A;  5KAB A;  4DGP A;  2I3R A;  3V0G A;  3I36 A;  3S3K A;  3ZM3 A;  2J16 A;  2PT0 A;  4NWF A;  1PTU A;  2F6Z A;  2YDU A;  2VEU A;  3N0A A;  2Y2F A;  4Z6B A;  4Y2E A;  3H2X A;  1OEV A;  5KA4 A;  4QBW A;  2BGD A;  4H34 A;  1OHC A;  1Q6M A;  3QCC A;  3QCG A;  4GRZ A;  1YTS A;  2J17 A;  1NO6 A;  5BUG A;  4RHG A;  4Y14 A;  4RKK A;  1G4U S;  3ZM1 A;  5KAA A;  4TVV A;  5KAD A;  2R0B A;  1G7F A;  4AZ1 A;  1C87 A;  2HNQ A;  3V0E A;  4RDD A;  5K23 A;  4H1O A;  3ZMP A;  4NX8 A;  2PBN A;  2C7S A;  2E0T A;  3QCF A;  1A5Y A;  1SUG A;  1FPR A;  1PTY A;  4GE2 A;  3EAX A;  3F41 A;  1U24 A;  1QZ0 A;  3LJ8 A;  2ZMM A;  3O4T A;  1ONZ A;  4QUM A;  1YPT A;  2CNF A;  2H4K A;  1Q6S A;  2DXP A;  4KYR A;  3AWE A;  5J8R A;  4GRY A;  2F6Y A;  2HC2 A;  3GXG A;  3EU0 A;  1PYN A;  4WU2 A;  4MBB A;  5K22 A;  3SME A;  1EEN A;  3D1H A;  4ZRT A;  5KAC A;  3I7Z A;  3PS5 A;  1JF7 A;  3S4E A;  1PH0 A;  4ZI4 A;  2GJT A;  2F6V A;  5LXQ B;  2VEW A;  3D1Q A;  1OHD A;  4GE5 A;  4D3P A;  1YZ4 A;  3QCE A;  1PXH A;  4KI9 A;  3AWF A;  1OEU A;  2CNE A;  1AAX A;  4RI5 A;  2I1Y A;  1Q6P A;  1ZCK A;  1OES A;  3D44 A;  2QBS A;  1X24 A;  2NT7 A;  5EHR A;  2QEP A;  4WU3 A;  1R6H A;  2ZN7 A;  3D1O A;  3ZV2 A;  1XM2 A;  3I80 A;  1YTN A;  1OET A;  2BV5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...