3AWEA

Crystal structure of pten-like domain of ci-vsp (248-576)
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
316
structure length
305
Chain Sequence
KDGFDLDLTYVTDHVIAMSFPSSNPIGEVSRFFKTKHPDKFRIYNLCSERGYDETKFDNHVYRVMIDDHNVPTLVDLLKFIDDAKVWMTSDPDHVIAIHCKGGKGRTGTLVSSWLLEDGKFDTAKEALEYFGSRRTGDVFQGVETASQIRYVGYFEKIKKNYGGQLPPMKKLKVTGVTITAIQGVGRGNGSDLSMQIVSERQEVLLCKFAEGYNCALQYDATDDCVTCEVKNCPVLAGDIKVRFMSTSKSLPRGYDNCPFYFWFNTSLVEGDHVTLKREEIDNPHKKKTWKIYRDNFTVKLTFSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Voltage-sensor containing phosphatase
publication title Crystal structure of the cytoplasmic phosphatase and tensin homolog (PTEN)-like region of Ciona intestinalis voltage-sensing phosphatase provides insight into substrate specificity and redox regulation of the phosphoinositide phosphatase activity
pubmed doi rcsb
source organism Ciona intestinalis
molecule tags Hydrolase, membrane protein
total genus 101
structure length 305
sequence length 316
chains with identical sequence B, C
ec nomenclature ec 3.1.3.-:
pdb deposition date 2011-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00782 DSPc Dual specificity phosphatase, catalytic domain
A PF10409 PTEN_C2 C2 domain of PTEN tumour-suppressor protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1110 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3aweA02
3.90.190.10 Alpha Beta Alpha-Beta Complex Protein-Tyrosine Phosphatase; Chain A Protein tyrosine phosphatase superfamily 3aweA01
3CM3A 4GFUA 2F71A 1OESA 2NT7A 2J16B 1Q6NA 3S4OA 4MBBA 2I75A 1ZCLA 3A5KA 2CM7A 1PYNA 3H2XA 2FHFA 4RI5A 2HC2A 3V0DA 1KAVA 2CMBA 1ZCKA 4PVGA 3QCEA 1BZCA 1X24A 3QKPA 4ZN5A 1U24A 3RZ2A 1RXDA 1G4WR 3O3LA 1PH0A 2I3UA 3ZM0A 4RHGA 1I57A 2Y96A 2Y2FA 3ZMPA 1KAKA 1PA1A 4RH5A 4YAAA 1OHDA 2ZN7A 3ZV2A 5I6VA 2HY3A 2QCJA 1U26A 4OHLA 2I3RA 5KA0A 2HVLA 2SHPA 2NLKA 1FPRA 3V0GA 1FPZA 3V0IA 1T48A 4H1OA 4QUNA 1Q6MA 2R0BA 2CNIA 3QCFA 3OLRA 2I6IA 1XXPA 3EB1A 1PA9A 5LXQB 2H4KA 1A5YA 5EHRA 2PI7A 2BZLA 2B07A 3U96A 4HRFA 2CFVA 2HNQA 1NZ7A 2G59A 1OEOX 1OHCA 1G4US 2RF6A 2HB1A 2ESBA 3ZM3A 3EAXA 1G1GA 4WU3A 1I9TA 2CNEA 2YOCA 4GS0A 4WOHA 2BV5A 3I36A 4AZ1A 5KA4A 1LQFA 3GXHA 4QAHA 2AHSA 1EENA 4Y2EA 2QEPA 2HC1A 2FH7A 1YTNA 4OHIA 4QAPA 3MOZA 3V0EA 4GE6A 2F6ZA 5BUGA 3EMUA 5KAAA 3QCDA 5KA9A 2GJTA 5K9VA 1YPTA 2BGDA 2MBCA 2CNHA 2JJDA 1QZ0A 3ZM1A 4RH9A 1MKPA 2NZ6A 1NO6A 2CM3A 5K25A 4BPCA 3QCHA 4NWFA 5KA7A 4PYHA 1YTSA 3O4SA 2PBNA 3S4EA 4D3QA 3A5JA 4Y14A 4GRYA 2B4PA 1V3AA 4GFVA 1LARA 1YN9A 4QUMA 4ICZA 2H4GA 3S3EA 4BJOA 5M43A 4WU2A 2H4VA 2I6OA 1ONYA 4S0GA 5EHPA 3AWEA 3OMHA 1LYVA 5KA3A 5AWXA 2YA1A 1XBOA 2OUDA 1P15A 1PTYA 2P4DA 2J72A 2IMGA 2J17A 2F70A 2B49A 2QDCA 3O5XA 4QBEA 5J8RA 1PTUA 3S3HA 3RGOA 2OOQA 5BX1A 2CM8A 4H34A 4RKKA 3O4UA 1YGUA 1WAXA 4KYQA 2B4UA 4OHHA 1RPMA 1G7FA 1Q6PA 1WCHA 5KADA 4GRZA 3MOWA 2GP0A 2CMCA 3QCMA 1PTTA 1I9SA 2VEWA 3BLTA 5K9WA 3BRHA 3D1QA 2B4SA 4WTYA 1OETA 1YFOA 5K24A 2PA5A 1R6HA 1GWZA 2B4OA 1EEOA 1OEVA 1Q1MA 3S3FA 5KABA 2H03A 4R30A 1FQ1A 1AAXA 3CWEA 2F6YA 2CNFA 4HJPA 2NT2A 3QKQA 2I6JA 3I7ZA 2BGEA 2CNGA 1NNYA 1C88A 1JLNA 3AWFA 1ZZWA 2I42A 2FHBA 4YR8B 3QCJA 3D9CA 2FJNA 4KYRA 1YTWA 3V0HA 1XXVA 1T49A 3D1OA 2I1YA 5BZXA 2GWOA 1YGRA 2PQ5A 2OC3A 2C46A 5KA8A 4JMJA 1C85A 2J44A 2ZMMA 3S3KA 1ECVA 2I4HA 3QCBA 1SUGA 2I4EA 2YDUA 3SMEA 2C7SA 3D1HA 3F9BA 2HCMA 5KA2A 1L8GA 2J73A 1T4JA 3QCCA 1C86A 4I8NA 3F41A 2BIJA 1BZHA 4NWGA 3V0FA 2A3KA 4GE5A 4RDDA 2G6ZA 5KACA 1NWEA 2J43A 2PSZA 2VEYA 4DGPA 2I6PA 3NMEA 3F99A 3RGQA 1OEUA 1C83A 2F46A 4NYHA 5GTJA 3LJ8A 4OHEA 3ZM2A 4JMKA 1G1FA 2WGPA 1C84A 4ERCA 4DGXA 2Q47A 2PT0A 4ZRTA 2F6FA 2M3VA 3QCNA 1U25A 4GWFA 5K22A 1OEMX 4NNDA 2E0TA 1YWFA 2QDPA 2H04A 2I4GA 2I6MA 2P6XA 2QBPA 4IKCA 1NL9A 5K23A 2CMAA 4TVVA 4QBWA 1PTVA 2QCTA 2OZ5A 4D3RA 3SR9A 1G1HA 3D42A 2H02A 4B04A 4Z6BA 1OHEA 4NX8A 3QCKA 5BZZA 4JBCA 1L8KA 2QDMA 2A8BA 1D5RA 1QXKA 1ZC0A 3BM8A 2Q05A 1C87A 3EZZA 1JF7A 2VEUA 3EU0A 5KA1A 2HXPA 1Q6TA 3PS5A 2J16A 4HJQA 1GFYA 2B3OA 2CM2A 2F6WA 2QBSA 2I5XA 3AWGA 1Q6JA 4R0SA 1NWLA 3F81A 3GXGA 1ONZA 1YZ4A 2VEXA 2F6VA 1PXHA 5IBSA 1VHRA 1G7GA 4J51A 5IBMA 3BLUA 3N0AA 2DXPA 3D44A 3B7OA 1M3GA 2FHCA 2CJZA 2QBRA 1XRIA 3O4TA 1J4XA 2J71A 4ZI4A 3F9AA 2VEVA 3I80A 4KI9A 1BZJA 4GE2A 3V0JA 4R0TA 5HDEA 3MMJA 4D3PA 2NV5A 4OHDA 2NTAA 1WRMA 3M4UA 1Q6SA 2FJMA 3RO1A 2QBQA 1XM2A 2F6TA 3ZMQA 2HNPA 3QCLA 5MMZB 3QCGA 4RI4A 2AZRA 3QCIA 4JNBA
chains in the Genus database with same CATH superfamily
2ODHA 4U6VL 5AZ2L 4JFFB 1HZKA 1H3UA 4Y2NA 4UWQB 4JO5A 4OIFA 3LRGA 5T3XL 4WEUD 3NCBB 1XF1A 4N25A 5IW3A 4OM1H 3KLHC 5FA3A 2ODIA 3INUH 2E3VA 1CFTA 1KB5A 3GXMA 2MKLC 3VCLA 3QC6X 4FMFA 1X24A 1OCRB 2ZF8A 5E03A 2FYYB 1NC4A 2K70A 3QDMB 3MLUL 4OUOA 1RXDA 4MD4A 2X2HA 3HPLA 4GKOA 1PJWA 4M03A 1J11A 1RZ8A 4X6EA 5AVWB 5HVHB 3BMWA 4JL2A 3L4CA 4KMTL 5C07D 2NY0C 1CVRA 4JANA 5I6VA 2A9NL 2H32A 4ICXA 3D85D 5AOLA 3J7HA 3WFCL 5KWYC 2MIZA 3GKZA 3MLRL 2PF6A 2VN3A 4F7PB 4LQFL 1J12A 1HXYA 2H2PD 5J6GA 4JGNA 5AUMB 4MVBD 3R8BB 3DGDA 1KBGH 4JVUA 3KYOA 4P4RA 4I77H 5C08D 5C0BD 3K81A 4F9LC 2EAEA 2APVA 3VGAC 1VFBB 5ABZA 4NQQA 4XB7A 2A6DB 1X7QA 3V9EA 1AP2A 5TD4A 3ZSSA 3QUGA 3OKDA 1A9EA 2GUOA 2H4KA 3D18B 3TBSB 2EO9A 1EBPA 2FJHB 3UTTB 4E9TA 1L6ZA 2O6CA 1BLIA 3QG6B 2B07A 4OTXL 4JPKL 4GW5A 4R7DB 2WSKA 2PW2A 2QMKA 3QO1A 4XHQA 2VDLH 1U8QB 2HRPL 1AKJD 2QTEA 3L6FB 2Y5TB 1JV2B 3MZTA 4UU9A 5E6UB 3FAWA 3RIAF 2BSBA 2DQHL 3ARGC 4X6DA 2I5YL 5GXBB 1G7LA 1PNCA 1N6QL 1WBZA 3ZM3A 1KIRB 3EAXA 5D5MB 4ELMB 1UG9A 3F7QA 3LKQA 2B4CH 2WJ5A 4FQIL 5F9DC 1AI1L 5L2JB 3IRPX 5ITFB 5IFJA 4F7MA 3WIAA 3ULUC 3V4VA 1S7WA 4AZ1A 3WENA 4C8XA 4WJG3 3AU1A 1L7IH 2CU9A 3TNNB 5D1QE 1BYNA 1QSZA 3C5JB 2K9UA 3F64A 3IMUA 5KYWA 5H2BA 3ISWA 3FCBA 5FECB 1ZANH 3ESPA 3QCDA 5DJYB 4NNYB 4JY5L 4UOW0 3QDJA 2X3BA 5DVOA 3U0PB 1YNKH 1CCZA 3LPGA 2J20A 4RH9A 4HLJA 1S7RA 5AW5B 1OCWL 4JFZL 1AIZA 1NGZB 4R84A 3GTVA 3QWRA 1IM3A 5GS0C 1AGCB 1ZT4B 2CG9X 2IG2H 2XWZA 1R24B 3ARBD 3W11C 4BZ1H 2GIXA 3JVGA 3GDBA 3RGBA 4G3YL 1IGIH 5J56B 1LM8V 1P7BA 2VQUA 3F00A 2J4WH 3FF8A 2WYZA 4BQ6A 5JHMA 4OZIF 3S37H 3INOA 5C3TA 5E7FA 2X4RB 4X5XA 3K0WA 5FYKE 4LLQB 3SPJA 2FBRA 2AJYL 2H4GA 32C2A 3II1A 2MCPH 1BF5A 5JQIB 3Q9QA 1KNOB 3OAUL 1IT9H 4P59H 1IGYA 5E4EC 1QLFA 2XSKA 3PQYA 4LCUB 5EIIB 5EHPA 3BZ4A 3FOMA 3OMHA 3QDAA 5IM7A 1B90A 3C87A 4PY8I 4DP6X 1LEIB 2VIRB 1HTYA 2DQMA 3WXVL 2H4EA 4P23A 5JMOC 4KJPC 4NDMB 3K80A 5EOCH 3D4YA 3Q8BA 4N2IA 1IC1A 3O4LA 1T21A 2PR4L 1IFGA 4LLMA 4UILH 1MFDL 4W4OA 5J8OA 1IGCL 2LFEA 3M7FB 4PV8A 4YSUA 3VD2A 2BMKB 2NY1B 3EGSB 4IKNA 1Y18A 4JR9H 1HILA 1H3PH 4PI0A 4BXSV 2H2SC 4UTBL 2X4UA 3IETB 5G4MA 2IPKB 2EXYC 3WL9B 1VF5C 3JWNE 4KYQA 3EDKA 1Q94A 3O3BA 2GTZA 4L1HA 3B3IA 2QPEB 4NN5B 5IT2H 1KMGA 5GGVL 5DXWA 3MOWA 2PPDA 1JGEA 4L3EB 2Y68A 3GIVA 3B3BA 3W9DB 5T1MB 3GHEH 1PTTA 3IJ9A 1DSFL 1ET8A 1YMME 2YAEA 3FB8B 4OZIE 1AQMA 1EO7A 2RFXA 2QGDA 4D8PA 3MRKA 2RJMA 4AGMA 2GB2A 2WANA 3D0LB 4KKPA 4JGMA 3KJ6H 3UC2A 3QYCA 1A7QL 3OX8B 3PUUA 3VWKB 5KOVC 3VE0B 3LNDA 4G7VH 4PHXA 1SOSA 4Z8FL 4AV4A 2A6KA 4F2FA 3EYOB 5HHMB 3VMPA 1OCOB 3FCGA 3S3FA 5HI4C 5GJSL 1IZJA 4GS7C 3APMA 4KNSA 5HGAA 2EEXA 3WELA 2YMXH 4PJCE 2FX9H 4W9JC 5I8KH 3VX1A 2WAHA 1BX2A 2VR5A 1RZIB 1L5GB 3BZDA 4HKXB 2HJKB 2NY5C 4XCFH 2NT2A 2ERJB 4PJ8C 3WIHL 4ZFFA 1T5XA 4ZW3A 1RIHH 3OJVC 4HIXH 1RMFH 5HYEA 4FGMA 1I3GH 2VLLB 3ECQA 2JIXD 3CV5A 1MCNA 1ZTXE 1D7CA 1X5XA 1BJ1J 1IAIM 2CLZB 3D9CA 4QXGH 5AB9A 3L3JA 4PJGA 3TONA 1NINA 1L0PA 4Y5XA 1MFBH 3PYZA 5C09B 2XV3A 2X4TB 1YTWA 2CGZA 1OE2A 3KPRA 5CP3H 4DERA 1P84K 3TBCA 1YC8A 1ZHLA 2W80C 1G6RA 3DX8B 5JHLA 1KJVA 3QZLA 3SKJH 1VGKB 1IFHL 1UB5B 2MFNA 1HJBC 4PY7A 1F8TL 4UANA 5DUBB 3O6LH 5AW1B 2V2TB 3B6SA 4ZXBD 2NY2D 1BOGB 4KXBA 1BXXA 4BK4A 2R8SL 1T6WA 3JT0A 4LHJB 1KB3A 3QJHB 2IQ9L 1QBLL 3MRMB 4PJHB 3SMEA 4OKVB 1ILSA 2B77A 4IDLA 3HBQA 2ZCLL 3MNZA 3NH7L 3SDDA 1L4IA 5HD8D 1XFPA 3G6JE 5CNHA 3IDIB 4O58H 7FABL 3SE8L 3KLSA 4CVXA 1VCAA 5GJTH 4S1RH 2BK8A 3ULUL 2R0ZH 5CO1A 3V0FA 3I3DA 4HIJB 4UAOB 1MCOL 1R75A 4WNQA 2EKSA 2YN3A 3A67H 1CE6A 4X98A 1HH6A 3TJEH 3B2XA 1N8ZB 1MCQA 4ODHH 4IBWA 2WO4A 5AEAA 4P46D 4R8WL 1J8RA 4JFQA 3N40P 4LOEA 1PKOA 2ZWYA 2UY7A 4K7PH 4MD5A 4GO9A 3ZGIA 1TTGA 2FB4H 5I8OL 1INDL 3IRCA 3QFJE 4LCIH 4GUOA 2ENSA 2AQ1A 5SWZD 4NQDB 4YPJA 3WLWD 5EBLB 2WGPA 1C84A 1F41A 1P1ZA 2BP8B 1YYCA 4JO3L 5GS0L 2GY5A 4WV1A 4RBPH 2QHRL 3NT0A 4BZ2A 1ET5A 4F57L 1UM4H 5KJRL 2ADJB 4JZOB 2FL5B 1PD6A 1YQVL 5ANMA 4HPYH 4XVOA 3IDXH 4LASH 4EVNA 1HESA 5D5MF 2GABA 1IGFH 2D9QB 5A2FA 3KH3A 5CEZH 4IGBC 1V7ML 4XAKE 5D71H 3FO9B 1C12A 2JKTM 2FO4B 3W0WB 4CAGA 4HLZH 3M88A 2CKBA 2LTQC 5AAWC 4HPOH 1G1HA 1UURA 3QWQB 3F2LA 3NFSL 1QFPA 4YWGL 5IQLA 3MUGB 5AKTA 4Z6BA 1HCYA 1M57B 3HE6D 1J5IA 1P4IL 2DH3A 3QCKA 4MJID 2DYPA 2DN7A 3L3OA 1NIDA 2H6UA 4NFDA 4JFDE 4AENB 2C3VA 2WINA 4G6MH 5JOFB 4Q14A 2A74C 3VXSE 3KPPA 4XNAA 2HUEA 4XH2B 5DF0A 5FV2A 1M2OA 4B9YA 3MV7B 3MRHB 5DJAA 2WUCH 3VTAA 1OB1A 1CBVL 4X4XA 1G7QA 3QXDB 4PW4A 3HHSB 5DJZB 4FQPA 1BBJB 5E5UB 3BQUA 3ZT5A 1ZIAA 4AYSA 2ZOLB 3U0TB 1GTNA 5HGGS 4L48A 4JRYA 4M8RA 3HNSL 4RFNB 3LS5H 3T1WA 4OQTA 4WU5B 2PN5A 4ACPA 2J5LB 1N8OE 4PJ6A 1I7UB 2XOTA 4HEPA 5JIHA 4GKZB 5KSVA 2F1EA 5KS9F 2EE0A 1NBZA 1VFUA 2CGRH 3LXCA 4CVZB 5C0DA 3REWA 1ETJA 3ULSA 2ATPA 1RK1A 2YKKA 3FFDB 1FDLH 3MRRA 1I3RB 1N67A 4YE4H 3JYBA 3VFNA 3D50A 2K7PA 3SE9H 1CT8B 4YHOH 2EUVA 4BH8A 4CSTA 1T89C 3GSRB 2ED9A 3GI8L 4NOBA 4I3RH 4QRRE 4DGIH 3L3KB 4UZSA 4J3TA 3CVIH 4J28A 3AU0A 4DGYL 2HB0A 4MCYB 2EIZB 2TSAA 3RX8A 4ZX4A 4BH7A 2ICCA 3A22A 4OT1L 4JFUA 4MJ5B 4LRIC 3LRLA 4OR1A 4LMQE 4Y4FA 4YXKH 1XBDA 4KZEH 1NC2A 2NY5L 3MMJA 4MB3A 4JE0A 3CAFA 4JFHE 3VFRB 3Q9PA 5D7JC 3GO1H 4K8RD 1A5FH 1AHWC 4WW1A 3MRBA 4DTGL 3L2NA 2BNQE 3LQZA 2NOYA 5FDWB 4B5ZA 3G5YA 2LT9A 2FJMA 1I7RB 3BAYA 2QBQA 2RH0A 4EEEA 2OXHB 5EO9B 4QI3A 1L7TL 4XX1E 1WQVT 4D0CA 4OLWL 3QHZL 4PCTA 4RI4A 5FFGA 1CLZL 1A7OL 2O1AA 1GMIA 2FQGA 1E5ZA 3HJ0A 4CNIB 3EHBB 4NAMA 3UTOA 4BKLB 4WWKD 2QBWA 2XN0A 3IS1X 2VMFA 2YD8A 4U05A 1ZLWH 1BYPA 1IM9A 2C3WA 2X9ZA 5KS9E 2ZKMX 1NCNA 3QEQD 3A5KA 1XSIA 5C0CA 3US1A 3GXFA 4YHNA 2FHFA 4E68A 1RK7A 2Z1PA 2FGWH 5E8OB 3TN0A 1KB5H 1KFGA 2CDFB 1YUHB 1P84J 3GK8H 3MXVH 5HYSG 1E42A 1G1OA 4MAYA 1NLDL 1BA9A 1J8HE 4FL4B 1E30A 4OLYL 3IJYA 1HE7A 4KC3B 3ARTA 2I3UA 3N3EA 4OZFH 5DZNA 4G8GB 5IROC 3VXQA 3F5WA 4RRPA 4AYGA 3ESVF 4RVBA 2ZNXA 5CKGA 4OZFG 4JHVA 3W57A 3K74B 1SOKA 2QADC 2H32H 5C0AB 1A8ZA 4LNRB 4W70A 3BKML 3II2A 1M6OB 2NLKA 1ZHBA 2K3HA 4FQXD 1D5BA 1PTZA 5LAPA 5K9QG 1U8CA 3VG9C 4H1OA 1YC7A 1WICA 5I1CH 2NY0B 1WFNA 2JJWA 3QPQC 2EE9A 3U46A 4BSJA 1YJDH 5CINL 4JM2C 4L29A 1JERA 5DJ8B 3VH8G 1EAPB 2D73A 4PJ7E 3IDYB 1XXPA 2PWDA 1QWHA 2MPAH 3KVPA 1ADQH 1S78C 1GS7A 4BINA 2A2QT 4BGLA 2ATAA 3ZKSD 3FT3B 4TUOB 3T08A 3RILA 3VGAB 4EDWL 2GCYB 1IBYA 2BFVL 4PJHF 2BP0A 3Q1SH 5DD3L 3VFPB 4RNRB 3D07A 3JTTA 5CM1A 1OPOA 2MQ3A 3FUHA 1A4JA 5BV7C 3CBKB 4L1BA 3CXDL 2QR0A 3H9YA 3S34L 2RF6A 1P7QD 2I7OA 3BIKA 4M3JA 1JSYA 1FH2A 1U2YA 4HEMA 4I0CC 1U91B 1X5AA 4IEFB 3QPKA 1VADB 2YOCA 5CCKH 5J1TC 1DDHB 5DC4B 4G8IB 4PB9H 3TV3L 4E42B 3GRWL 4UYPA 4NQCE 2Y1VA 3CD4A 5EN2A 1WS7A 4XHJC 2VQTA 5INDB 1JNJA 3ARGB 4AQEA 1QD0A 2BVPB 2G9KA 2HT3C 2VXSH 4F24A 4GYBA 1MCIA 5E5LA 1LO0L 3NDYE 3DHUA 3UTSE 3H9SB 2FECL 3HS0C 4D7PA 2EYTB 4OHIA 4BDVA 1FAIH 2JB5H 3GJFA 1NDGB 1XO8A 1D5XB 3FTUA 5C0IB 3KLQA 3S7GA 1FPTL 3GMLA 2VZVA 4DKEL 2D03H 2X2UA 2KBGA 3GSXB 4NO5A 3NFPA 1R3KA 4QAMB 1I1FA 3IJHA 3BAEH 1NO6A 3H6AA 1OAUH 2EQDA 4E41D 4NWFA 4FTVA 2NYZA 5TQ0L 5KA7A 2AK4B 4AVHA 1SXNA 4BKTC 4JFFD 3MX0A 2H1PH 1JPSL 1N64H 4CJ1A 1NIFA 4Y14A 1WZ1L 1FG2B 5C6PB 1CZ8H 3RAJL 5D8JL 2YD0A 4Q4IA 1LVEA 3MLVH 3GQFA 3RZWA 4LRNL 4TSAH 1UFGA 4OGXH 4QUMA 4TYUA 1EEUA 3M8OH 4M93C 2GC7C 5GZNA 4PJDB 3DNKA 2XN9B 4ZDHA 3ROOB 4XVTL 3NJXA 4C55A 2P43B 5MEPB 3SKOA 1X5LA 3ZKND 2ZXCA 2OAAA 5J13C 3QDMD 1JZ5A 1EUUA 3MGTB 1RKRA 4Z78B 4U31A 4M56A 3OHXA 2VR9A 5SWQA 2YPLB 3ECUA 5JO5B 3WMPA 5F0LB 2DQCH 2Q7AA 3KS0J 1U93B 2O4EA 1AD0B 1CXEA 1WE5A 2R2BB 5E4EB 2BWQA 5D6CA 4CA4A 3ARWA 5B8CC 5EU6D 3AS0A 3QDGA 4NPJA 2Y4SA 4HS8L 4QYOA 4U4IA 3S2AA 3VXRB 3U2SB 5J8RA 2DW5A 5E2TH 4EZJA 3UO1L 1PLCA 5IB2A 5JHAA 4NUQA 3BUYA 1TVHB 3BAXA 5E6YA 3BKYL 1NCHA 4BQ8A 4NFBA 5EWIH 2OZ4L 5AD0A 1KTJA 4N5UA 2OMWA 3FN0H 5JXAH 3BEWA 3ABMB 4W68A 4RGOH 3K5RA 2CMCA 4F3FA 2YAOA 1OPGH 4XTRD 2O61B 1T7ZA 4PJIE 5AYUH 2DH2A 1Y1DA 3PJNA 4W9KC 4GXVH 4EPSA 2F8XC 2YD4A 4FXLA 2QQNH 1TENA 2D8KA 2GHWB 2JJVA 2WSPA 4EDXA 4FXKA 5LDSA 3CVHB 1E8CA 2XY2A 3OKOB 4Y2OA 3NSYA 1N59B 4GBXA 1N0LA 4YMPA 3EYUH 3NCYS 3SCMD 3SDCC 3V0VA 2YBRB 3QIUD 2HPOA 5L2KA 2Z0BA 3IKCA 1I1AB 4NZJA 3MAWA 1C08B 2WBJD 4YL4A 1OALA 5CS7A 5E6IA 4C57C 5EF2A 3QKQA 2O93L 3SPVB 5C9JA 1HNGA 3O2DL 4PV9B 4GS7B 1KIQB 1UD4A 2APSA 4LPCA 2IDQA 5KVFE 4ZG1A 5CLTA 1RJLA 3F7VB 3GPSA 4IIQC 1DEDA 4OCMC 2WKOF 1OQOA 1TQTA 1OGAB 2OP4L 4P06A 5DMGC 4DEPC 3GMRB 4H13C 1XCTB 1NDTA 1DZBA 1I1RA 3QEHA 5GRUL 2AJVL 2BH0A 1LP9A 2NUPA 3CHPA 2L8AA 4J3XA 3C8KA 4ZUTB 4OM0L 3WJJA 3IF1A 5A2CA 3QISA 1QTSA 3KLAA 2BSRA 4N86A 5JHLH 1HAUA 2DQDL 3GB7A 3WXWL 4LVNB 1SDDA 2Y7MA 3HE7A 4XZUB 3CDGB 1ZA6A 2OC3A 4D9LH 4X42A 3RUGB 2Q2EB 1CL7H 3KLKA 3QQ3A 4YOKA 5JQ6H 3FN3A 3COOA 3JXAA 3EJJX 1MJUH 4PJ9B 4KKLC 2P5WA 4YVUA 5BV7L 2YEZA 4NHUA 4KKZA 3VI3A 1TJHL 3FOLA 3VFUA 3MRGB 1TVBB 3QBTB 4KHXL 3S3KA 4H2AA 5ESQB 2I4EA 3D1HA 5DC2A 2PYEE 5C07A 3SYAA 3GXPA 1KGJA 3VSQA 5JIKA 4E9XA 2EZ0C 1UH4A 5MERB 2Y06H 3QNXB 1L8GA 3UH8A 5HI5C 3IRZA 5KVDH 1A9BB 1Y6MR 5E9DE 4HFWA 2F5AH 4YDLC 4CL7A 4U4BA 1JTTA 3ZTCC 2VITB 2BIHA 1NWEA 4B5EA 1HKLL 5GSVB 1OCCB 2CCVA 1GMEA 2V5RA 5C08A 2Y6TE 5C0BA 3DVGB 1A4BA 2DIEA 1BEYL 2VMCA 3UTPD 4QRSA 5DJXA 1EEZB 3QJSB 2NNAA 4QT5A 5FYKL 3STZA 1PMYA 2BRRL 3TO4D 2GJJA 1F4XL 2OA9A 1UATA 5D4HA 4N2CA 1G7IB 2NY1D 3K2UH 3EJYC 1AGBA 5CMAB 4BQCA 2CUMA 3SY0B 1UA3A 4LBEA 3S5YA 3DJZA 1BMZA 3WE1A 2IFFH 1AD9B 2Z7WA 3VRIB 1FL6B 1F13A 4M48L 4IBVA 5IQNA 5J1AB 4BZ2H 1AKJA 3CSPA 3NJFA 2YXFA 5B4MD 1S7SB 2IADB 1NFIB 2WZ5A 5DUPL 3X3GL 2OMTB 1EIBA 3B2VH 4YHKL 1DR9A 4L3ED 3OMNB 1KYUA 1Q9WA 4KTDH 3P1VA 4FKHA 5I8CA 5E70A 4XE5B 2ZOTA 4UIKL 4AWJC 5KUKA 1BMGA 4E9LA 4HBCL 4UNVA 5K23A 3IXTA 3U9UB 2CKBH 4TQEL 3W56A 5I1GH 1QAWA 4OAWB 3WNJA 2QCTA 2X2YA 4AQAA 3MLTB 3SPGA 3PAUA 4IDJL 2OW6A 3U7WH 4Y89A 4IGBB 3S9DB 3OL2A 4PJAB 3H42L 2YSSA 1HS6A 4OZHB 1ES0A 1YSOA 1U2CA 4JK0D 4TF4A 1FYTB 1H9DA 3LQAH 4YXLL 1RI8A 1UH2A 3GUTA 3LEYL 4QJ5B 2N7SA 5LQBH 3B4NA 1AKPA 5DT1L 2CHDA 4F1ZA 3MCLH 4YQXH 2WB1A 5MHSE 3EZZA 2KQNA 4DVBA 5AZEL 2X0UA 1JHLL 2RGSA 3VGDA 3ULVC 3ARBA 4IRJC 2D7PA 3QS2A 3U2JA 1MPAH 5DQJB 5I76B 3JV4A 1UA7A 5C0GB 3IFLH 1T1WB 2WMPB 4OQTH 4APQC 3FFOA 5C09D 3O11B 2B0SL 4TUJB 2X4PA 2OYMA 3E8UH 4NZUL 1JDAA 5AW3B 4DP2X 1BVLA 4NJ9H 2XVGA 3DUSA 3NCXA 3CSYB 1T04B 4Y5YC 4U6XB 2VDOL 5KG9A 1SEQH 3BWAB 3OZ9L 4FNLH 5I1KL 1FC1A 3TZVA 1NBQA 1BZ9A 1ZTXL 3IDMA 4RDBA 2CK0H 5BZDA 4XP5H 1ZHKA 5KUMA 2FJGA 5ILTL 3WNLA 3BLUA 1T7YA 5T3XD 4TKWA 5F71A 1Z9OA 5HGBB 4F58L 2D3JA 2IAMA 3KXFD 1D5ZA 2HH0L 1YY9C 5CGYC 2QBRA 1CQKA 2OL3L 2UWEF 1FVDB 5DRZA 2V3DA 3ZZQA 4R7VA 3UPCA 1YLBB 4FG2A 1PZ2A 3CIQA 3C5ZA 2NT1A 2OTWB 1J10A 2VXUL 1MFNA 4ZS7H 4R90L 4KI9A 1UENA 3K6OA 4GE2A 4AW4A 2FR4B 3UBXI 5AOJA 4EI0A 3RWGB 3VU2A 3HI5H 2WVTA 2CHZA 4LSSH 1W2KT 5F7YC 4B7IA 3HZVA 3L9YA 3OGOE 3P9MB 3ZYJA 4KFMA 1Q6SA 5AENA 4HK3J 3RO1A 2Y23A 5IEKB 2Y67A 3E1ZA 2CPUA 3EO0B 4TNVF 2HX9A 5CJXA 5HVFB 3V6FB 1LO3H 1XSJA 1W0WB 5D7JB 4OIIL 3P2DA 1MCJA 2D7TH 3HFFA 4JFED 4A1RA 1AHWB 1DO5A 5ESVB 2XPCA 4ZJ9A 1NGQL 5IJKA 4NQDD 1QFUL 5DLML 2JLLA 2CR3A 2JB6B 4JN1L 3ECBA 5C6TL 4U6HB 5DEFB 3GHPA 5JPMA 1Q6NA 3CLEL 2OSLA 3N43F 5IB4A 1FBIH 1PYWB 4NKDA 2VE6A 3FB7B 4Y4HC 3REVB 1BVKA 1KPVA 2AJZB 1JNLH 1PYNA 3NJNA 4G6JL 4KNTA 1P7HL 5D1ZC 2EH8L 3DX4A 1SN2A 1ZCRA 5FGCE 3VXME 4XAWL 2BNRB 4L1TA 4P5MB 3W0WD 5I0WA 4X99A 3E6FA 4AH2A 4PP2B 2F7PA 5DA0B 2UWEE 4ZTPL 3S5LB 5CJOH 2C26A 1DN0B 1ZKAA 4UM9B 3EOAB 5KVEE 2PTTB 3SOBL 2ID5A 4QLWA 1AO7E 3FU0A 3BZ5A 4YIQA 2VQ1A 5HJGA 1PA1A 4XO9A 1SUHA 5FYLE 2QV2A 1S5HB 1LNUA 2HY3A 4HFUL 3T0BA 4XI5D 4YH6A 3K2KA 3SDXA 1EAQA 1OANA 2IC2A 3C8DA 1E5UI 4Q9RH 4ESKA 1BQHG 3CMOL 4ZO9A 5HDBB 1T48A 2VW4A 2QADB 3O6FC 3C09C 4XC1H 4WUUE 4NGHH 3CFJA 3TH2T 4M7ZC 1G6VK 2A38A 4WEBH 3W9EA 4ODBD 5SV4A 1EHKB 2N1KA 1PA9A 3RUGF 3D3VD 3VG9B 4TL5A 4HA1A 1KLUB 2ZUWA 4JPQA 1G7MA 1VRSA 4JM2B 5I1DB 1TF4A 4XP6H 5KJ7E 3F65A 1VGEL 4F8NA 4AE0A 5B1BB 1HK6A 3QG7L 2HWZL 3EDEA 4P2QD 2J3SA 4W9HC 1UB6B 3IS0X 3P2TA 4H8VA 2R0LL 3BFOA 4RZCB 1H3GA 1JXDA 1OEOX 2WXKA 4QRQB 1WZAA 1U42A 4AK1A 2JI2A 3I75A 3K1DA 2WKGA 4GP8B 4WI2A 1PZSA 3D39B 4PJ5E 3I74A 3T4AA 4NI6A 1KCUL 2DZEA 4NIKB 4M61A 2WVVB 4ODWA 5BV7B 3RJDA 3ZHKA 1U8HA 4ZSOB 4OD2A 5IBTL 1AZBA 4O5LL 4P46A 3NA9H 1AQDB 1N9PA 4Y5VA 3LAFA 2R29H 3E6HA 5BRZA 1QKZL 1SRDA 4PB0H 2ZYSA 4KO5A 3ZDWA 5DWPA 2WLMA 3FTYA 3QUZC 3S5ZA 1MDAA 5EZIH 2VLKD 5JIDA 4UAGA 4NC1E 1K8IB 3OXRA 1FNSH 1XCQA 3DTXA 3PWUB 4QHNB 5A2AA 1B9KA 5CKAA 3RPBA 3VFVA 3OJDA 1SMAA 2IFGA 4MQ7A 2HFGH 2GUYA 4S1DD 1X4ZA 5SWZA 3TURA 4O2CA 1BMWA 4N2GA 5GS1C 3BJLA 1RUMH 2JJDA 1S46A 3HS0B 2CR0A 5DEGB 1L0XA 2GQHA 4P57A 3ARVA 2X5PA 1KLFB 1NFKA 3OR6B 2VLRE 3DX7B 3ZUNC 3KPMA 4KRPC 4M1DH 2VDPB 1EFXD 3UIZA 4C12A 4GKLA 5I6NA 4LF3B 3UGUA 3IGAB 3O4SA 4GKSA 3EHBD 4NYLA 2VR4A 3E1F1 3VRLF 1CLYL 2C4FT 1K5NB 4D3QA 1ASPA 2AJ3A 3K4DA 3S3DB 4H88H 2XWTB 1F58H 2ZOOA 1WD8A 2CIIA 4U1GC 4G9FE 4FAAB 2IPUG 1FFOA 3MLSL 4X8JA 2A6JA 3KG5A 4WY7L 1DLFH 3HE6A 2NUTA 4MJIA 4WEMB 2PCFA 4KKRA 5GGRA 1JZ8A 12E8H 2N56A 4MA8L 1E4HA 3ROLA 4AKQA 3CZNA 3S4SB 2FBJH 3B83A 3KPNB 4NLHA 3ZL8A 3GSUA 3KLHD 3KPSB 2OMNA 4D7BA 4GG6B 1YEKH 3WKQA 2NX5B 1OK8A 2YA1A 1YEIH 2IWFA 3BSHA 3SJVA 5IW1A 4M93B 3STLA 5KYUB 1CXHA 5TDPB 2HKHH 3W37A 1X5JA 4IS6B 3AT9A 1QSEE 3KZ8A 1Z5HA 3CZFA 1CR9L 1LMIA 4MBRA 2AS5M 1I8AA 5C0AD 4GI9A 4NQEE 5E00B 3S35H 3KYKH 1ND0B 1ZSHA 4R0LC 5D93B 5GHWL 5GRXG 5T5NG 5CFAA 3DXAE 3ESMA 3MGAA 3DV6A 5TE4H 3T2OA 3DX6A 1WIUA 3UYPA 1MVUA 1R47A 1YY8A 5FKPA 1FO0A 4MJ6A 5IB5A 2NY0D 3L95A 2BHFA 3BZEA 3T8VA 5B8CB 2XZCL 43CAA 5IIEA 4HKBB 5F9JA 1WAXA 1B88A 4KQ4L 5FB8A 1I7ZA 3G6DL 2KERA 4N8UA 4XNYL 3QH3A 2ZKYA 4O2FA 1UT9A 5I17B 3KW7A 2J6EL 4BBWA 4YBQC 5C0FB 1Y07A 3SQBB 4UAHA 4NQSA 4DPAX 3D69A 2DWEB 4MDJA 1BZ7A 5K59F 1I9SA 2MEJB 1PG7H 1C8PA 3BLPX 1NGXA 2UYLA 5DSCA 3U36B 3L1OH 3WBDA 4BELD 4RMRA 4NP4L 5JXEC 1TTFA 5CP7B 3UBHA 1H8OA 4HJ0C 2CAKA 1D6VL 3QCVH 2BCMA 4WWPA 2W38A 4K94H 1JPEA 4B0MB 5HHVL 1NFDB 2EIJB 3D12B 2F7IA 1NBCA 3ARGD 1J1XH 5AW9B 5HHOA 4C56E 3EGDB 5GGQH 4FFZL 1OZTG 2OL3B 1AG0A 4I0PC 4K3JH 3SDCB 4ZMAT 5KBNC 2DMKA 1LQSR 3HG1E 1G7JA 3H9SD 4GLRH 4PJXB 2BGEA 2ZWSA 3ULUD 1MH5A 3V6BR 5MENB 3H54A 5C2BH 1PS3A 4OFDA 1TCMA 4XPHL 1M7DA 4ZMYA 1IGTA 1W6LA 3PABB 5BJTA 4QHPA 4MKTA 5H94B 3R06A 1UD2A 5BCAA 2Y36H 3ZKMC 1ZEAL 4QOKB 4Q0XL 4I87A 1IILE 4OCXL 3V0HA 4TS6A 4IIQB 2EACA 3UG3A 4YHLL 3CGTA 3QEQA 1BWMA 4UTAL 1KGWA 2UVEA 3SDAA 3D1OA 3CDZA 1LK2B 2I9LB 4JFOB 1SY6L 2NXYD 3T0EE 2Y7QA 4JDEB 2GFBA 3VDBA 3ERXA 1USZA 3BPOC 5K59E 1NPUA 4KNUA 1U33A 5KA8A 3LDBC 1MQKL 4TNVK 5GS0D 1I7TB 3QFDA 3FAXA 3W11D 7PAZA 5C7XL 2XBTA 3CSTA 2XN1A 2QGEA 3ARDC 1PCSA 2R1XB 3VSUA 3TPUA 2XN9D 5CXPA 4NM8L 2CUHA 5F9WC 1PVHA 1IZKA 1LEGB 2I07B 4XCEB 4LDCA 5F7WC 4LLWB 4MNQA 4H8QA 3HW7A 3FT4A 3WV0A 4NAQA 1S9WA 3CHSA 5LN8A 3FRPB 4FF9A 1MWAB 4M7JH 4FQXA 2FLRT 1B6UA 4ENZA 5CWSA 3FT0A 2FCBA 3WUWG 5KACA 3HBZA 3WFDL 5HDBF 2J43A 1MREL 3HC0A 1FLRL 4O02H 4N90D 2W0KA 1G7PA 4X5RA 1UC6A 1O5ZA 1KBBA 4HISA 5CJQL 1YECL 4KZDL 2Y3NA 4WFHD 2I6PA 4JQIL 5ID1B 4YDLB 4FN0A 3TYGH 4Z6AT 1R1CA 2D3NA 4QRPE 2NY7H 2XVKA 1C83A 4KJPD 4KX9A 4QGYA 3BAIA 4XO5A 2VLJA 1HOCA 5EO1B 1OP5K 3UGEA 1BXVA 4JZNB 3RRQA 4RETB 1H19A 1NAMA 4HWUA 5A2KH 1NKRA 4HH9A 2J8UA 4WW2F 3D06A 2P8LB 3LKRB 2UXGA 3HR5A 5TF1L 5ISZD 2H2SD 1P7QA 5MEOB 1E7UA 1FJ1A 1ZPUA 5DZLA 1HXKA 3PWPD 4GMSH 1KGYE 2V2WB 2EXYD 5IHUL 4L4JA 5D7LB 1OP9A 4D9QE 4XP1H 3W39B 1DVSA 1R9FA 3POHA 1F4WL 4HOWA 1WISA 1QBMH 2AMUA 3GGWA 2QTVA 3MJ9A 1GZQB 1E2WA 5I5IA 4LAQH 4LSVH 2IXQA 4IBZA 1IAOB 1OSPH 2DI8A 4DP5X 1AS6A 4JN2A 1CFNB 3QCTH 3F3HA 3D42A 2PKDA 3EO1B 1KXQE 4B04A 4JPVH 1TZIA 1TZAA 2F5BH 1KN4L 1TYEB 3TEYA 4NKMA 1S7VA 1MFEH 3DVNB 1H15A 3PP4L 3GPEA 4ANKA 3BZFB 2K7QA 2ZWLT 3DV4B 3MBXL 4DP0X 2WXNA 2XPGB 3IFNL 3MROB 4A6YB 3MJ7A 2DEXX 2HJLA 3IAGC 1QYGH 4WU7A 1EEYB 4HHGA 1A3QA 4M62H 4MTMA 2WYIA 3QIBC 1R0AH 5F88A 3QZWB 4YO0A 4PRPB 1OW0A 1ZOXA 4NXSA 4XOCA 2Z93B 5HI4D 3CC5B 3AITA 4RSVA 2ZP0T 3ZMNA 1NQBA 2CJSA 1Z9MA 5EUKA 4JFFA 4PJ8D 1GFYA 4MB1A 3AB0B 5FKAB 4NWUH 3DHMA 4YSDA 3RQ3A 2IH3B 1JV5B 2M26A 4IRJB 4R0SA 5J6HB 2QQLH 3TT1H 2NCMA 2Y0SA 3FB5B 1H5BC 4HWEH 3IFPB 2EVFA 1V3KA 2OTUB 3TPKA 5ANHA 3ZDYE 3RP1A 3UMTA 4UZUA 2VEXA 3WUZA 4FG6C 3NACL 1PZAA 4H8PA 3UEQA 2FYYA 4AQOA 4RFOH 3QDMA 3MCKB 1BAGA 3ZE2B 5IBMA 3L4TA 5F9AC 4UINL 3CFBB 1U6AL 4FRWA 2DL9A 1QUPA 3N85L 4JL1A 1DBBH 5FW7A 1SBSL 2J71A 4XNDA 1C5DB 4ATTA 4PVNA 2AANA 4F7PA 5LCVL 4X6CE 3AQYA 3QJQB 3I80A 3FULA 3FUIA 3F05A 3LZFL 5AUMA 3B8YA 2WQSA 2R4RH 35C8L 2AEIT 3ISRA 4R7XA 5BO1L 3NJMA 1VFBA 3K4AA 4MMYB 2NV5A 4AIEA 4Y88A 3CFIC 2A6DA 2X28A 4BFRA 3ATFA 2XZAL 1I9JH 4N5EC 3WSQH 3FQXB 1AXSB 4AMKL 4RESB 1E4KC 2Y2YA 1RK0B 3D18A 3TBSA 4DAGL 2FJHA 3AS1A 3UTTA 4H4NA 3TWCH 1JYXA 5AW6B 1B4RA 4WSGA 3Q2CA 2F53B 4TOYH 3SKUD 5B38G 5BOPA 3QG6A 3VD5A 1KELH 4HSCX 3UAGA 4R7DA 2IOMA 2GEQA 4BHUI 1PGRB 1MOEA 2HLFC 5E95B 4B6ZA 2Z4QB 3MUJA 1U8QA 1QNZH 1IX2A 1OT4A 5KW9L 2F71A 5CR8A 3L6FA 1TJMA 1JV2A 2Y5TA 4HK0B 4JHAL 5HYJD 4NQVB 3CLFH 2F0CA 4NUJB 4WI5A 1TTAA 1VFMA 1YG9A 3GIZH 4GY4A 1KIRA 1ZCLA 3RIFF 5D5MA 2Z8SA 1HZHL 4ELMA 4Z7WB 3OSVA 2VDLB 5L2JA 4NX0A 3UMNA 3MRIB 3S6CA 5ITFA 2WLHA 4QY8B 4XO8A 5A3IC 5TE7L 1FHGA 1GY1A 1IAMA 1ZCKA 1BFVH 3HLKA 1N6VA 2AXJA 3ZHLA 1UWXK 4XMUA 1ZD6A 4B0MM 4ZQTA 2JFFA 4LSQL 3TNNA 1PW3A 4Y4HB 3C5JA 2GBAA 1CGYA 2VN4A 5D1ZB 1SF5A 4FFYA 4IGBD 2C4XA 3ZVVA 3L4YA 4EIUA 5FECA 2BVYA 1FYTD 3QK0A 4DEPB 5DJYA 3UJTL 4NNYA 4PSPA 1I8UA 3QRGL 4IBLT 3QXTA 3U0PA 2F6AA 1A3RL 2XACC 1PZUB 2RAMA 3QRLA 5LVEA 4Z7AA 3L13A 2WVSA 4OV6F 5FUCC 3WLBB 1NGZA 2WTZA 1V3MA 4FEIA 3IAPA 1NIAA 3DOSB 1AGCA 1OAXH 1ZT4A 5DJ0B 1R24A 1NIBA 3D6GA 5FYJU 3HUJE 1J6UA 5DUMH 4FABH 1MF2H 1PLAA 4Q9QL 2OK0H 1I82A 1G1CA 1GRWA 2ZP9A 2AZAA 2O5XH 5LXQB 1P6WA 2GIYA 2CMRH 5JHBA 2D4FA 3P30H 3O6FB 4EXPX 3C09B 5GRZA 3HG2A 2DD8L 3EUDA 2X4RA 3IVKB 4M7ZB 4LLQA 2V8LA 1RLWA 1BP3B 4ONHB 1KNOA 2VM9A 3WNNA 2ZG3A 5FO2A 1E4WH 2YO3A 4LCUA 5EIIA 2BW5A 1ODAA 2C3XA 4W6XB 3SIKA 1F1GA 2J6WA 3VFGH 2HB1A 1PZ3A 1WFIA 3ECWA 2ZQKA 1AANA 3MVSA 5CN1A 1LEIA 1AGEB 2VIRA 1IEAB 3PHOB 5L88H 1G1GA 3MLWH 4RCAA 5JIIA 5ADOL 1I9TA 4NDMA 3N1GC 2MOQA 2J12B 1AY1H 4KI5F 5KAQF 3NBNA 4DO4A 5KA4A 2B15A 4KI1A 2JTDA 3HZYA 1ED3B 2BMKA 1ZT7B 4BQ9A 3ECVA 3EGSA 3GDCA 5DVLA 2ZOKB 3IETA 2BPBA 3V0EA 4CC4C 4GE6A 1PZ5B 2IPKA 3T71A 2V5MA 5BUGA 1PFOA 3WL9A 3BKCL 5KAAA 4IW4C 3WJLA 2YUXA 2IOOA 2CRIA 3D7PA 4LO9A 4MNGE 5ALCL 3QUZB 2JELL 2MSPA 2N7BA 3I85A 4HC1L 2YR3A 1YN7B 2W9EH 5DZVA 4P9HH 1T7VA 3AREC 1C1EH 4KKBC 3TVMC 1ZXKA 2VDRL 5D7JD 2PABA 4L3EA 3OAWA 5KVGE 3W9DA 5T1MA 4F92B 5AZUA 4YDJB 1YTSA 1IBDA 3FB8A 4N0RA 5GRJL 5GS1B 3F7PC 4MD0B 4XVJH 3ZT7A 1BFOB 4X80L 3JWDH 5TDNB 4L8SC 3D0LA 4EI5C 5I73C 2IGFL 3OX8A 3VGHA 4FQCH 4OCWH 3VWKA 3VE0A 1BF8A 2XUWA 1YN9A 1IV8A 2ZX9A 1E6OH 3EYOA 4GRWH 1JGVL 4FNPA 4ICZA 1AR2A 2V8MA 4BWUA 2W91A 1TOXA 3Q6GH 4U1GB 2CLRB 1G84A 1RZIA 1L5GA 2NTSP 4YZFF 4S0GA 2HJKA 4OJFH 1JF1B 4XMVA 5H35B 3VDAA 2PPCA 3QS3A 4UM9D 4IMLB 2OUDA 3D34A 3WCYA 3H9HB 4LL4A 5IHWA 2FD6L 2VLLA 2COVD 5DR5H 2ZJSH 2J17A 1FGVL 5I23A 2B49A 4X5LA 2CLZA 2X38A 3CUPB 3ABLB 4KRMB 4QBEA 3I02B 4YNYB 3RIKA 3S3HA 1QEWB 2HVKB 5ELIA 1PDKB 5IROD 5C09A 2X4TA 2B1HL 4NCDA 3PPSA 1Q4NX 2DLFH 3UTZB 4ABVA 1EGJH 2QADD 4A2LA 4K2UH 1GGCH 3ULVF 3DX8A 1BVZA 3QUML 4WO4C 1DQDH 4BSWB 1B9ZA 4AYDC 4CC0A 3QSKB 2EEAA 2XX0A 2KQMA 4W9IC 3TU6A 3FCSB 5KVEL 1EHNA 1VGKA 1RJCA 1UB5A 3QUYC 2YARA 3KWWB 4FG4A 3VA6A 5KBDA 5DUBA 3DHJA 3DIDA 2YAHA 2V2TA 3QPQD 1NA8A 5FYLL 1BOGA 4WZ9A 5KZCB 3HFMH 4JM2D 4ZI8A 1IQWL 1CDGA 2XV2A 4OSUL 4PJHA 3QJHA 1CDBA 3MRMA 5IBLC 4WK4B 3KXFA 4AY0A 4DZBB 1JVKA 2BY3A 4J1UB 4OKVA 4RMWA 2VDKH 2VEWA 1S78D 4LT7A 5K9WA 4PJBE 3S36H 1L9PA 3CX5K 3EDFA 4RZKA 3IDIA 3WKML 4YHYB 3J8F7 2PP9A 3UJJL 4EQ3A 2B4SA 4ZW6A 1S2EA 4CMHC 3QZPA 5J12B 5JZ7C 2OJ1A 3D39D 3FB6B 3GT6A 4HIJA 3W5MA 2DDQH 4KPHH 1JMXA 2RA1A 3EJRA 5I6XC 4M6OH 4K8RH 1N8ZA 2X6AA 1XF3B 4ZT1A 1H3TA 4XZ4A 3T0EC 4NQUA 4DCQB 4DH2A 4OF5A 1ZA3B 3LH9A 3LRKA 3S8WA 4DHLA 1M7UA 3C60C 1PLBA 4UQBA 2P46B 2H0FA 2VISB 2CZNA 4GQ9H 5HI3C 2FIRT 1SEBB 4XMZA 4DO6A 2DQTH 1RPQA 1Z3RA 1MSPA 2LLGA 2CNGA 4L05A 4XHJD 1FL5B 1F0LA 2VM4A 3FU7B 4JPSA 1S9XB 4Z3FA 1GAFH 2HT3D 2X6VA 1KJ2L 4NQDA 3SO3C 4XNXH 2DQJL 3Q5TA 4I0PB 2E76C 5EBLA 2CRYA 1XTLA 1TNNA 2BP8A 3BSGA 4MHHI 4PH8A 2VDNH 3L2MA 5I19L 3TESA 4XMKL 3LB6C 2ADJA 4JZOA 5FYKD 2FL5A 1DVQA 4QXUH 2VTDA 1B0GB 1EAJA 4EOWL 1RZ7H 1KENH 5DYOB 1WWAX 4B41A 4Z7WF 4NQXB 5DJ2B 2EC8A 4NJAL 3PGFL 3FO9A 2FGZA 3MODH 3RLSA 2FO4A 3L54A 3W0WA 2N0KA 1XAKA 5IHLB 1YEEL 4NWTH 5ABDE 2AJXH 3DGGB 4KUCF 1DJXA 4P0DA 1NJ9B 3FONB 3MUGA 1UCBL 4JKWA 4Y19B 1H3VA 5LAXB 2CA4A 2HG0A 2GTQA 5I1JH 4AENA 1NMBH 3F9BA 4ZNCD 1Q72L 4NKOB 4RGNC 3TT3L 5JOFA 2LU5A 4BK5A 5EEXA 3LDBB 3QNZB 2XTJC 2J73A 1ORSB 4XH2A 1CICD 1QG3A 3MV7A 2V5SA 3VG0L 3MRHA 1AS8A 3F41A 1QI4A 1F1AA 2NX5D 5ICYB 1PFCA 3BE1L 1UT1A 2V7HB 1U8OA 1ZV5A 1DVFC 3TA3C 1WEJL 5K1VA 4YDIH 3BGAA 4J6IA 2I25N 3QXDA 1KGUA 3HHSA 5DJZA 4YX2H 3GKWH 4QTIH 1BBJA 1L9QA 3PS6A 2JNZA 4U7SA 1TETL 2ZOLA 1T66C 2XQYK 3A21A 3GNMH 1XGZA 1TDQA 3U0TA 3BOVA 5JR1H 5DD5H 3RGQA 1YMHB 2VMEA 2DLIA 2AK1H 3LZPA 5FCUL 5HDWA 4JHZA 4UT7H 4WU5A 4FADA 4CRPA 1MCWM 3BSZL 1NAMH 4TQHA 4X8XA 1I7UA 1Q9LB 3ILQC 4YVNA 1UM5H 3OLDA 4FNUA 2F54B 4ZTEA 2VLMD 4HS6B 4GKZA 2DWXA 4ZOBA 4ZW7A 3WS6A 5E8DL 4CVZA 5FWRA 3V7MA 2NNRA 3NABH 2YSTA 1JPFB 3FFDA 1U25A 2NSMA 1I3RA 1QRNE 3OKMB 1NM4A 1Z6JT 1CT8A 5AVVB 2ZUXA 5IMOB 4R97B 4BV1A 2JJSC 3MJ9H 3GSRA 2I6MA 4Y1AE 4IKCA 3AAZB 2B1OA 2PP8A 4JAMB 2B59B 3L3KA 4JQVA 4KVNL 3GBML 2G2RB 2VR8A 4MCYA 4BUGA 2EIZA 3ZQXA 1LK3L 1MRDH 4JPIB 1ZLVH 2V4LA 1HE8A 3QNFA 4MJ5A 2O6EA 1B6DA 4BIKA 3NZ8B 1GZHA 1KTCA 1TYJA 3VFRA 3H4HA 3R1GH 4HWNA 4XB3A 5F6HI 1J0KA 2X9YA 5FDWA 2Q86B 4A7GA 1I7RA 3U4BH 3SDCD 4L23A 2OXHA 5EO9A 1LO4H 4PJFB 2PR9A 2Q05A 1C87A 2VEUA 2X4SB 3LZQA 1DANT 2W88A 5BQ7B 4CNIA 3MV9B 5CF3A 4BKLA 3R0NA 2D3VA 1AC6A 4XXCC 3QIBB 2VDQL 2WUBL 3US9A 1GGBH 1M3IA 2CM2A 1RURH 1ZLDA 1M7IB 3NIDB 5CLYA 4M1GL 3EF7A 2W60B 1EHXA 5DMGD 2JQZA 1F97A 1L9MA 3Q8AA 3X1BA 1AJ7H 1CFVL 5E8OA 3SYOA 2VDRB 2CDFA 2RTTA 1YUHA 1Z2KA 2W94A 2E0PA 1PXHA 3HNVH 3E3QE 3Q2LA 3D2UD 2ZXAA 2EDBA 1JGUH 5HYSB 1JMZA 2XETA 4G8GA 1IC4H 5AKSA 5E99H 3VSVA 1M3GA 2DOCA 4G7YH 1KCLA 5C0AA 3GZQA 1AFVH 3MJ6A 4KKLD 1RZKC 2QQKL 2W1NA 4X6EB 4J2QA 4LNRA 3C2AL 1QSFE 4OZFB 3GSOB 4GRLB 5FM5O 1M6OA 3CX5J 1QFWH 1KPRB 1BZQK 4QHKJ 2FYVA 4AL8C 1USQA 2O5YH 3ETTA 4H8HA 5D96B 5E2JA 1J0IA 1Z9LA 5KYXB 3IGLA 1Z0NA 4NZRL 4ZNEE 3WIHA 3MOAL 1I8MB 5DJ8A 5HI5D 4LEOB 4P9MH 1W15A 1U8KB 1EAPA 1T3FB 3E9TA 5G5DB 2XBZA 3NJKA 3QQXA 3E9UA 4AT6B 3LHPH 1MHCB 4JB9L 3VH8B 4KGJA 4GMTH 1CB4A 4GFTB 2A7BA 4WUKL 3A6BH 4KV5F 3PIQB 4MASA 3FT3A 4F9LA 4TUOA 4AE1A 2XQ0A 3A6OA 4XAKD 4AEIL 1FZKB 2W95A 2GCYA 3D9AL 5JOPE 3BQVA 3VFPA 2RCSL 3MKKA 4RNRA 1UWGL 2X9WA 1Y0LB 1UZ6F 2GITB 1O5DT 5HJBA 3NRSA 4KITB 3EJYD 4CKQA 4HJSA 4B9PA 1J5HA 2VMDA 4LCWE 1S3RA 3PL6C 1U91A 2HVBA 2OR7A 4IEFA 4YBLC 4JFDD 1KT2B 2RR3A 5CU9A 1VADA 3EYSL 2KC0A 2BFGA 1ACCA 4HLEA 1X7SA 3TBBA 1DDHA 4G8IA 1ZS8A 3TCLB 4E42A 1JVLA 4J23A 5FC9A 2HKFL 1FFNB 1XH2A 4L5FH 4QTFA 3FQTB 5INDA 4F1SA 3ARGA 5FAAA 2BVPA 5LXGH 3KNBB 4XNZC 1U24A 1M2VB 1G4WR 3H9SA 3GBDA 1Z5YD 2FWLB 2EYTA 2EDYA 5DA4A 2XC8A 1TJGH 4RHGA 1XGQB 4K7FB 2Y2FA 2Y69B 4N8CL 1NDGA 1KAKA 4UQAA 1D5XA 3A6CL 5C0IA 2ZN7A 2VR6A 3JWOH 3AGWA 3FSAA 3GSXA 3OAZK 2QCJA 1DEEB 2M2DA 4TNEA 2GJZB 5KA0A 1N26A 5LNDA 1W72H 3MQIA 5LNEA 4XBEL 1S6NA 3BT2H 4PRPD 3HLAB 4AMWA 3V0IA 1C9SA 2CBMA 4KY1L 2YAQA 1MHHB 4G7QB 4HF5H 3G7TA 4HZ1A 4N4YB 2AK4A 1U8PB 1INQB 1J9RA 3MNMA 4XC3L 2Q2LA 3VRJB 1MCPH 4FQ1H 5E4OA 3EB1A 4G5ZH 4MZ3A 5E4IA 5MI0C 1KJ2B 1FG2A 2OR8A 3CN2A 4ZTOH 1UZ6E 5DHDA 2AQRA 1CU4L 4FMKA 4WNSA 5A16B 4QRRD 2XI9A 1UA6H 4JS7A 4IRJD 4WI7A 1OAKH 3OHMB 4OFYD 3ZO9A 2BCKB 1C5CL 4YAQB 3TXAA 3P3RA 4PJDA 1DQML 1BVNP 2XN9A 2B5IC 5ENWB 3ROOA 4NN6C 1MCKA 4APQD 5I30L 4Z7VE 4YXHL 5MEPA 1IRAY 1DJIA 1G4RA 3WNIA 1CD0A 3UIYA 3MGTA 4DW2H 2ZUQC 4Z78A 3GI9L 4JFHD 4J2XA 5IFAH 2YPLA 5JO5A 2R69L 2XJKA 4ODUB 5DK2B 3BRFA 2FNBA 3PJSB 2F18A 2BNQD 5IVOA 1YYMH 1U93A 1AD0A 2CDGB 2R2BA 3T3PE 1X4XA 4HMCA 5AVTB 4P2OD 2V17L 1WPCA 3NIGB 1HIML 3P11H 1SLXA 2EYRB 2AJUL 3NK4A 3OD3A 3GXUB 4FQ2L 4PG2A 1WS8A 3SSGA 3U2SA 3QULB 3CFQA 3HCVB 5AB2A 1YY9D 5CGYD 5LBVA 1YTNA 4M7LH 3O2WL 4HXAL 1TVHA 1MCDA 4Z0BL 1ICTA 2MQCA 3CSFA 3RGHA 1IL1B 4YK4C 4YSOA 5IR1B 4PBWD 2JCCE 3S88H 1PEZA 2IH9A 3CDCA 4G9FB 5JHDB 1QZ0A 3TYFB 3BVXA 3DDGA 1INEH 1BQRA 3RNQB 1J5CA 1MKPA 2Z8RA 3Q8CA 1EO8H 4UB0L 4AQ8C 2F53D 1EZLA 2J1YA 4BPCA 3GJEB 1EZUA 3LMJL 2XG4B 3SQOH 4M5YH 2O61A 1KFAL 4OCRH 3N5AA 1E5CA 1J8HD 2DMHA 5CEZE 3A5JA 3GIVB 4XNMB 4HXBH 2ESVE 3CVHA 4DN4H 3OKOA 1N59A 5JOEA 2B4PA 3IU4H 4X7SL 2YBRA 2UVFA 4V11A 4HS3B 1SYSB 4K94C 1F6AB 4ONGH 5DD0L 3X17A 1I1AA 2A1WL 1GY2A 3MACL 4GIOA 1C08A 5EU4B 4JKNA 2HMID 4EI5B 3G04B 2P5EE 5I73B 3OGCB 2P9RA 4JG1L 4E9SA 3LYRA 4TM9A 2YFNA 3ZXAC 4Y4HD 4PS4L 5I15H 5E1AB 2WLYA 1MFUA 2NSXA 3SPVA 3TH4T 4MYPA 5D1ZD 3NCJH 3QJOA 4PJFF 4S1QL 1RZKL 3QUXC 1XBOA 4PV9A 3U1SL 1KIQA 1PTYA 5LDUA 3TO2B 3F7VA 2X87A 3KBEA 4AL8L 1QP1A 3EOTH 4ONFH 1OGAA 5B3SB 3NPSB 3GMRA 3FMGH 1XCTA 5TK2A 4OZGA 2F70A 4RMUA 1XT5A 4MS6A 4I85A 4P2RE 3RTQC 5D7SH 5CSZB 2GW5A 4ZUTA 3SD2A 2H3XC 3NIDF 1HINH 3X11B 2CO7B 4YN3A 2Q8BH 1IC7L 4XZUA 3CDGA 1QHPA 5D6DC 1J9CT 2IJ0C 4U6VH 5AZ2H 3RUGA 2PO6B 2D9CA 2P44B 5T3XH 3O6FD 1MKFA 2N01B 3R7RA 4WO4B 4NQCD 4OF0A 3MRGA 1TVBA 5E1GA 4ANXA 1VEMA 3CQPA 4B95C 5ESQA 5KSBE 3ABGA 1A6TB 3QUYB 4G80B 3DKHA 1F6LL 4PIRF 3UTSD 3QNXA 5BUPA 3QZNA 3T2QA 5MERA 1A9BA 3ARSA 1TG8A 3N41B 5FGSA 4PWHA 1GGTA 3VDCA 2CBTA 2X53A 4PM1A 3ARFC 5K24A 3MLUH 5JTWA 4ZODA 3HN5A 1UZGA 4JKPL 5GSVA 2FEDC 4TQIA 5IY5B 3IMRA 3DVGA 3DYPA 1JXFA 2IAAC 4R30A 1EEZA 2ZE0A 4KMTH 2PTVA 1IE4A 4CMHB 2CNFA 3LH8A 4GSDL 3NCYP 2A9NH 4M9OA 1B0IA 1G7IA 5I6XB 3WFCH 2GJRA 1L0QA 3MLRH 4NZDA 5CMAA 4Z7NB 3VI4B 3SY0A 4LQFH 1BZOA 5D2NE 4LPTA 1AD9A 4UYQA 5EH1A 1FL6A 3VRIA 5IV2B 1EXGA 2CO3A 3C60B 3BUPA 1JLNA 2W0FB 3DBXB 5J1AA 1AYRA 5ID0B 2XVLA 1P4LB 3QUZD 3V0WL 1RAMA 2VABB 1S7SA 2IADA 1NFIA 2FJNA 4KHTL 3MTXA 3P3UA 2OMTA 1P5VB 3JV5A 2L7QA 3BLBA 5TDOB 5F1OB 5CN2A 4FMVA 3SO3B 4ZFOL 2BP3A 4V1DB 4OTXH 3MLZL 4JPKH 4PP1C 1ZLEA 5J6SA 3GBNL 3U9UA 5EEYA 2J1KA 4Q6IC 3C2SA 2VZTA 4HD5A 4OAWA 2HRPH 3MLTA 3MRJB 1JHKL 1QBBA 3O41B 5DS8B 5TPWL 3AM8C 2DQHH 4KRPD 4LCCC 2I5YH 3NEOA 1N6QH 3UP6A 4IGBA 3N06B 2AAAA 4MDIA 3V55A 2CKBB 4W81A 4K55A 4PJAA 4OZHA 3R4DA 4FQIH 1AI1H 5EU7C 1ID5I 1FYTA 3SZKC 5AAWA 5KVGL 4QAWA 2FJSA 3KD4A 1PY9A 3M1BB 5D2LB 5KA2A 2UV3A 2CHXA 1BZHA 2ZT9C 4GE5A 3I50L 4RGNB 5A5EA 2WXHA 5K33A 3H2QA 3ES6B 3T4YB 2XTJB 5C6WH 5E56A 3HAEH 1F3JB 1OB1B 4OGZA 5DQJA 5I76A 1JI1A 4JY5H 3QEUB 5C0GA 2BSTB 1T1WA 2WMPA 1FNEB 1NUFA 2VJXA 3HAEG 3O11A 1DBJL 1E5BA 4N26A 3L3DB 4TUJA 4X4YB 4URTB 2F7QA 4JFZH 3PFQA 2P47B 2AC0A 5AQ0A 3CSYA 1T04A 1M53A 4R7LA 4ERCA 4U6XA 4G3YH 2PW1B 3BWAA 3P4OB 1A6WL 2NQ3A 1FGNL 3BO8B 4ZRTA 5T5FL 4LEBA 1GW0A 4Q9CA 4X6DE 1N2RB 5FV1L 4QJ4B 3QORC 5KZCD 4BFGA 5E23A 2IANB 5HGBA 3W81A 2YEVB 3DBSA 1A3LL 3U4KA 1G87A 2G30A 2AJYH 1FVDA 3V7AE 4YS4A 2X5OA 1L3WA 1MIML 3P54A 3HS9A 1I3VA 4LGRB 4RBPK 1CN4A 5CEYB 1H6UA 4YBQD 3NIGF 5CGTA 1H6EA 2OTWA 1AGDB 1NWPA 2UZPA 3IJ7A 1T89A 3DI3B 2CM6A 2YD7A 4RQQB 2FR4A 3WXVH 2X4NB 3OKNB 2R27A 3RWGA 1GYUA 5LG6A 4GLRI 2GC6A 5JXED 4U2ZA 3R0MA 1DHKA 1YEDB 1YEFL 2PR4H 3P9MA 1MFDH 2YQGA 4HJ0D 4J27A 1PAZA 2QDMA 1IGCH 3EFOB 5IEKA 1OD9A 4LLAA 3DROB 4LRIA 2OYKA 4APXB 3EO0A 1CDIA 3D4GA 2BOLA 3RGVC 3V6FA 1W0WA 3CG8A 5D7JA 1MIEL 2TRHA 3EU0A 4AYEC 1AHWA 2Z7UA 4UTBH 4P3CL 4HHAB 5ESVA 5JW4M 5IMLB 4I0PD 2JB6A 1HXMB 1T22B 4U6HA 5DEFA 2R1WB 1OM9A 1DFBL 4FJYA 3OMZA 3BAKA 1LWHA 3H4FA 3AMLA 1PYWA 2PYED 4ES9A 3FB7A 3QI9C 3REVA 2AJZA 4OCYL 1TSHA 1NCDL 1QQDB 3MRQB 4CMMB 2GBVA 4PMEA 5SWSB 5GGTA 1DSFH 3F81A 2BNRA 3FKUS 5EOCJ 3EYVB 4P5MA 1GOFA 4M43L 2IV8A 4A38A 4PP2A 3PQYE 3BAWA 2FO8A 3S5LA 1XGRA 2KMWA 4HCRL 3SPHA 4Y19D 1A7QH 1DN0A 3T3MB 3ZW3A 2MMXA 4UM9A 3EOAA 5IWLC 2PTTA 5LBSL 4AV5A 3BP6B 1TQVA 2WXFA 4Z8FH 4NNXB 1KCWA 3RDTD 2VKWA 2EDLA 2KPNA 4FQQB 3O4LE 5AL8A 5GJSH 1UGNA 3KGRA 4DK3A 1S5HA 4ZUWB 4TSCL 1JCVA 2IDFA 2IGTA 1QZ1A 2OJZL 4ZMNA 2X6BA 1RERA 2ZX8A 3FSOA 3F9AA 4QGTA 5IROA 4EN3C 3ARDD 3C5SB 3WIHH 4ZFGL 4DKAA 4AEFA 1AZZC 2EDXA 2YBGA 5H4YA 3IJ8A 4PJGF 1BQHB 2ZUVA 5DC0A 5KJ4A 1U8CB 4QNPE 2Y5QA 1T2JA 5CBAB 1KLUA 4TULL 4JM2A 5I1DA 1E50A 4ZK8A 4IBUA 5FO9B 3DDFA 3R19A 5CEXB 4N2KA 2J21A 1UB6A 4RZCA 3T0XA 4OFKA 2VO8A 1RLBA 4K73A 4GG8B 4UT6L 1IFHH 3U25A 4QRQA 4PREB 2ETWA 5GQBA 1F8TH 3VWJB 3N41F 2H1LM 4FQLL 3UBFA 5L0QC 1EA9C 3D39A 1F00I 3KH4A 4MAZA 4R7NB 4U3CA 3D0VB 4LVOC 3S48A 2WVVA 2XVBA 1DQLL 2R8SH 2Q7YA 3PRZA 2IQ9H 1QBLH 3L3HB 1DANU 4H44C 2FH6A 4YUEL 2JTYA 2APWA 4ZSOA 3A24A 3AACA 3V0DA 1AZNA 4OJAA 3B43A 3MCG1 1QABA 3NH7H 3V8CA 1AQDA 1ZLWK 3PL6B 4YBLB 3H7LA 1W0YT 7FABH 2VZOA 2D3LA 3SE8H 1GKEA 3VYOA 4FA8A 3B2UC 4W6YB 4AC4A 1VCBC 3ULUH 4UV4L 3QO0B 4LOFA 1K8IA 4Q74A 5BMFL 3ZM0A 5LWYL 1MCOH 3PWUA 4PD4K 3VI4F 1I57A 1WD9A 3N42B 3QUKB 5G4NA 1JZGA 2B9BA 4YAAA 1XSOA 2M83A 2AQSA 3PREA 3HS0A 5DEGA 4R8WH 1U26A 1L0YA 4L9LC 1BIIB 4PJGE 4PLJC 5FGBC 4HX1B 1KLFA 4G7SB 1NGPL 1T0MB 2F74B 3OR6A 2B16A 3KPRE 4MXVF 2Z65C 2F61A 5I8OH 4LF3A 1INDH 3MV9D 3QCUL 2WLKA 1QA9B 1K5NA 2AV1B 2FWSA 3QIBD 5J5EA 1D9KC 1E8XA 4B9JA 4N9GB 2XWTA 4JO3H 5GS0H 2A5UA 5CZRA 2QHRH 4JO8A 4F57H 5KJRH 1X5ZA 3ZZ1A 4LOVA 1YQVH 3EXLA 3DPBB 4ACTA 4MAUL 4YGVB 3RVXC 1A22B 1LWRA 1TPXC 4U1MB 3MBEC 5MI0B 1R4XA 2DIBA 4ZFOB 1V7MH 1TQBB 1YO4A 5D2LF 3S4SA 3KPNA 1JDCA 5FGRA 1MDTA 3KPSA 5E8PB 3SOTA 5KVDE 1MNNA 4GG6A 2NX5A 2IG2L 3NFSH 4YWGH 4MLIA 1II4E 3LH2L 5TDPA 5F72S 4V33A 2B5IB 1MCWW 1FCCA 4IS6A 3AFLA 5AW8B 1P4IH 3HMWL 1BEXA 1F4YL 1OOWA 4FG6D 2ZXEB 4GXUM 1KEML 2Z6FA 1AIFB 5E00A 1ND0A 5DK0B 1P6FA 1F3DH 2ZUQB 1UTDA 1EO5A 4XMLL 1IBGL 3HZ3A 2C9XA 2YRBA 2MCPL 4YLQT 3CZEA 2C1OB 4N3UA 1WGOA 3H3PL 1CTNA 1QUNB 1JXGA 4OD3L 4UIMB 5B8CA 4HKBA 5EF3A 4DPBX 1QFOA 3ALPA 3T0WA 1CBVH 1HYSC 1JAEA 4JX0A 2X1PA 4OF6A 5L4JA 4MXVE 2ICEC 1RVFL 2GJTA 3AY4C 4OU3A 2PWEA 5CCJA 4PLKC 2IF7A 2WCPA 5IMMB 5IOPB 2BOBB 1JYVA 5I17A 3L3GB 3CN1A 3HNSH 3MYJB 4WGWB 3SQBA 3RE0A 5C0FA 3NCCB 5ANME 3VXMD 4DGWC 2DWEA 2OMUB 4WWID 4YK4B 4HT1L 1AGFB 4ZX3A 4N5ED 1SOQA 4HVBA 4JO1L 3U36A 3NTCL 1TITA 2GSGB 4K9JA 1AHKA 4WI4A 5FUZL 1JS4A 5EBGA 3HG3A 3UZQB 1R34A 5CP7A 2PPFA 3FDWA 1UQSB 2OMZB 4Y16C 1I31A 2QVTA 1K2DB 1VFAB 2HLFD 1G9ML 2V0AA 4CU8A 5FYLD 1K5WA 4N2EA 1A7NL 1JTPA 3QZMA 1NFDA 4WRLA 1YEJL 3GI8H 2OSXA 4A2FA 1TLKA 2XQYA 7PCYA 3EGDA 2WWMC 2YD5A 3EFDL 3T9WA 1SJEA 1SVCP 2OL3A 2ZUUA 1ONYA 3SDCA 4DGYH 5EZJB 4I18C 5IP4A 4PJXA 4JZJB 3OKYA 4KDWA 5A3ID 4OT1H 3MBWB 2ZSWB 1O7DC 5MENA 2NY5H 2W65B 4HV8B 3VGGA 1A3ZA 3BIAX 4A7QA 1CYGA 3LTVA 1XXFC 1PSKL 2YUWA 1IFRA 1J0ZA 3PABA 5H94A 4H8WC 2N59A 2EIBA 1MJ8L 1JG9A 4QDIA 4JRYE 4QOKA 3O3UN 5IJVB 4IIQA 1T03H 1L7TH 4FJZA 3L4WA 2ZYHA 2Z8VC 5I6PA 4OLWH 2CLVB 3QHZH 1LK2A 2I9LA 3G6JA 4JFOA 4LP5A 1CI5A 2R59A 1A7OH 1CLZH 4Y7MA 1NL0L 1U8JA 3NCMA 4JDEA 2GVYA 4L4VB 3UPRB 4G8FB 4N8VG 1R5WB 4XNQB 1L6XA 4ADIA 1WBXB 4XPGL 4RMQA 1WCHA 1I7TA 4GAGL 2ZX5A 1NMAH 1E5YA 4B50A 2CM5A 2OX5B 3T3MF 43C9B 2G2NA 3LZOA 2YPKB 2XKUA 2H41A 4D2NA 2R1XA 4N6RB 4B97A 3VFUB 4XCEA 1LEGA 2I07A 3RPKA 4LLWA 2AVFA 5IOKA 1NEPA 2P7TB 1ZJAA 1BVNT 4PEEA 1NLDH 3FRPA 4ISVA 1YFOA 1ZV2A 3B9KD 1MWAA 1SHMA 3PXJA 4OLYH 3TF7C 1N18A 4PWIA 5L8LB 4X7EC 3D85B 1O6SB 2H03A 2XJAA 3X2QB 4P8QA 3WUWB 5ID1A 1QR4A 3W3BA 2ADGB 3ARFB 1T5WB 2P52A 5F7FA 3BKMH 3RVWC 1JF6A 4O02B 5AOMA 3I7ZA 3EYFB 5EO1A 3B1UA 1HDMB 1NEZG 3GRBA 1M71B 5F1KC 1L9OA 1JXKA 4JZNA 3WTXA 2BS9A 3RKPA 1R3LB 2ENJA 5CINH 4PD4J 3C5XA 4G9FD 4AKOA 2P8LA 1EQWA 3LKRA 1IKNC 2EP6A 5MEOA 4QRFA 2EIMB 2V2WA 4UTCA 5D7LA 5C0CE 3W39A 4MMZB 3DO4A 2BFVH 3WKNA 5DD3H 1Q0YL 1GZQA 5EOQL 4J3SA 3U1QA 1A7RL 3ZE1B 2WO2B 1RV6X 1IAOA 3ARED 4KKBD 4AK2A 3TVMD 3CXDH 1KJ3L 1CE1L 1XD1A 1YEGL 3EO1A 3K8KA 3PDGA 1MXDA 4M02A 3S34H 1NWOA 2XKNB 3TNMB 1S3KL 4K3DL 1U8MB 3DVNA 4NQED 2I4HA 1HNFA 3BZFA 4Q6IB 4TNFA 3DXAD 4ZS6C 3DV4A 3PAVA 1ITBB 2XPGA 1C5BL 3PV6B 3TV3H 4EI5D 3MROA 5D70L 4A6YA 1T5KA 5TQ2L 3BESR 4AYFB 3I6GB 3EBAA 3MV8B 1EEYA 4LCCB 3FTWA 1YPZB 2E5EA 4Y4KC 1UXSB 4PRDB 4U1HB 3QZWA 1LO0H 2BIJA 4PRPA 1DQTA 1BQSA 3BD3A 3CC5A 4DPCX 2X89D 4LE8A 2QKIC 3BGFB 3X1EA 4GFXA 4OGAC 2GAZB 5L7XL 1JE6A 3NG5A 1FPTH 3NIFB 3DJ9A 1MJ7L 4FQJL 1T6VN 5FKAA 3HI1B 5AW0B 3RVVD 4DKEH 1R3HB 1GKOA 1F5WA 3PP3K 2IH3A 5GTJA 5FYJL 1JV5A 4IRJA 5J6HA 1F02I 2Y22A 3FB5A 5TQ0H 3B2MA 3U4EB 1BZDA 3IFPA 4ALAC 5F7BA 1HL8A 2OTUA 3BPCB 4JMKA 4E9WA 3HB3C 2X4PB 1YNTB 4KMQA 6FABL 1JPSH 3GZKA 1B0RB 4A7SA 1WZ1H 3MCKA 1URLA 5E5MB 4HEME 3RAJH 5D8JH 4WO4D 4U3XA 1OEMX 1NGYB 1MVFA 2QDPA 1YWFA 1GGIL 5B22A 2OM5A 3CFBA 4LRNH 3K72B 5DYFA 3G5WA 3QUYD 2GT9B 1E3FA 4XMPL 1NCUA 3C8HA 1MAKA 2P6XA 3JVGC 4D0BB 1BZ8A 3FO0L 3QORB 4XVTH 4D3RA 1C5DA 1D5ZB 2FUQA 2GG1A 5IBLD 1RIVL 1KXVC 3FTZA 3FU3A 4JEGB 1NLBL 2HXAA 3ZIMA 2R23B 3ZM5A 1SZNA 4Z9KB 3QJVB 4MMYA 2V3EA 5B3JE 4ZO8A 1OSYA 5JZ7D 1CDHA 3J07A 3FQXA 1AXSA 2FWOB 4F27A 4HS8H 4PRIB 1RK0A 4HQQL 3IKKA 2VR3A 2YRPA 3T0ED 3UO1H 2F53A 1X5KA 4H8WL 4KO9A 4RDQF 3EW3B 3PWLB 4YSEA 1FI8C 3BM8A 4NIYE 1OAYL 4FTVE 3C60D 3UYOD 3V4PL 4X4ZA 2Z4QA 2J25A 3BKYH 2JKXA 2WQWA 4Z95L 2E4TA 2GY7B 1M05B 2F1AA 5HI3D 3I2CL 2LLLA 4HK0A 2KLRA 5IG7B 3QB7C 3UFIA 3RGVB 2OZ4H 2YGOA 4NQVA 3E0GA 4NUJA 4JY4B 3IFOB 1Z3GL 3T5WA 1FIGL 2Z91A 4R5TA 4Z7WA 3WN5B 3OWEA 4BXVA 4PTTB 3MRIA 4V1DD 2WBJC 4QY8A 4RLDA 3LB6D 2KT6A 4JFYB 3MVNA 5F0PB 2IGLA 1LO2L 4B27A 2DEWX 3EJCA 4YSQA 5EEUA 4EF3A 3QI9B 4Y4HA 4TVPE 4OLUL 1G7GA 5D1ZA 5DFVC 3CSBA 4PS3A 1WHPA 3KGUA 4OQ1A 2XKSA 1P2CB 2DWYA 2CJZA 4GAJL 1HI6B 3QRBA 3T0AA 2EEBA 1YEHL 4JKKA 2PTUA 3QDGE 1KCVL 2DWDB 3WDIA 1M6UA 3GC3A 3ZDZB 2MPVA 4Z0XB 3QQ4B 2JIXB 2VJ8A 3AUWB 3WLBA 3N1QC 3O2DH 1EX0A 1GL4B 2OYLA 4ZW5A 4RGND 3DOSA 3B8SA 4B9CA 1RY7B 2GBUA 4YHPB 5DJ0A 5DVKA 5LB1A 2VDML 4ZD3L 5I6MA 2XTJD 3EOBB 3EBGA 3D0AA 1LP9F 1MJJB 2BDNL 2OP4H 1WZMA 4GQQA 4EN3B 3V6OA 2XWJB 3CFNA 5GRUH 1FVEB 1QI3A 1DVFD 1R6VA 2AJVH 3TA3D 5EF1A 2RD0A 1FIEA 1P1VA 3O6FA 3FUMA 4M8UA 4MMXC 1HC1A 3IVKA 3B5HA 4BZ1A 4PVBA 4GAYB 4OM0H 3MRFB 1RPKA 3T2LA 3ATAA 1KEGL 4JNBA 1E4JA 1T66D 2DQDH 2A77L 4ONHA 1ORQB 4UTAA 2NY2B 4ZXBB 3WXWH 3K7UA 1Z9SB 3DTUB 3VI3F 1SY6A 3BX7C 4D9RE 5F1NB 2FQEA 1TO5A 2JI1A 2YJLA 2DLEA 2FT6A 3BHBB 5JPNC 1AGEA 5BV7H 1IEAA 2G5UA 2V3FA 3BN9C 3PHOA 1QR1B 1TJHH 2DLGA 3ILQD 1C16B 1X9LA 1L3NA 4KHXH 2MPAL 4LSUL 4XXWC 5F1SA 5L2KE 4RI5A 2HC2A 4DQOL 4JJOA 2VSKB 4YDVB 1TZ8A 1HWWA 4JBSA 5EU5B 1ED3A 1ZT7A 1UVQB 1E2VA 4TV3A 4LVOB 3CU1A 3K71B 5JA8B 4K71C 2ZOKA 5ESAB 1WH0A 3AY2A 1KC5L 4PJEB 4PWGA 1E4XI 2EH7L 3PXLA 2VN6A 2AP2A 2D0GA 2K0RA 2Y96A 3OAYH 1PZ5A 1W6WA 1HKLH 3LKSB 3X13B 3SDDC 2KL6A 1BEYH 1IAII 2GHZA 3D51A 2WN2A 5D1XC 3QUZA 3FH5A 5FYKH 2K6YA 2BRRH 1E9PB 1F4XH 5CD5C 2HFTA 1YN7A 3PWNB 1PKQB 1RXLA 4JQIA 3V4VL 4IK7A 2X1WL 3KWXA 4YDJA 4LNVA 5GS1A 4MD0A 1V27A 1D5IL 4M48H 4N2DA 2CK2A 4A04A 4L9LB 5IFHL 5J1SC 5JIQA 2WLIB 3Q43A 5TDNA 3ZE1F 4ABUA 2CUAA 2R51A 2FWUA 5ICXB 4KTGA 4PLNC 4ALAL 2P5WE 1WWWX 5DUPH 4LPVA 3X3GH 3VI3E 4G70B 2EIDA 2PI7A 3FZUC 4N0UB 1SXSA 1JPTL 4YHKH 3DJTA 4JG0L 3PWJB 2FEEI 5SWSD 5BRPA 4UIKH 1S7QB 1D9KB 2ZOWA 3M45A 1QTYT 4HBCH 5C07E 5HY9B 3DECA 3A47A 1EANA 2CLRA 3CFCL 4TQEH 3VFWB 4WV1C 1BV8A 1JF1A 4Y9GA 3S96B 5H35A 4J8QA 3JWNH 4U0RC 1UJTA 3B7SA 3CHRA 5IESL 4IMLA 4IDJH 3FSVA 3H9HA 3GS4A 4M1CC 3JWNG 3FHAA 1IGML 5C0BE 1QATA 1NCBL 1XL6A 3H42H 1U95B 4ERSL 4OD1L 1LTXA 1KCKA 3CUPA 3DUUB 4TUKL 4YXLH 5DZAA 3WTYA 3FRUB 3I02A 3LEYH 3P77B 3QVAA 4KXDA 1QEWA 2HVKA 2P5PA 1PDKA 4YNYA 5FR3A 3UO8B 1A4AA 5HHQB 4M7KL 4KK8C 1WYJA 4PJIA 5DT1H 4AJYV 3UTZA 2DQFB 4FX5A 4AGNA 4QAPA 2ZWNA 4BSWA 2EUXA 4XCNB 1OLLA 4PBDA 5AZEH 4MA1B 1JHLH 1JK9B 1PD0A 3FCSA 5DDHB 1PZDA 3HC2A 5KA9A 3KWWA 3MFGB 3GS0A 3L5XL 1MEXL 1YNTF 5EOTB 1YRKA 4HKJA 3IDJB 4A39A 2AZUA 3LPFA 2FZ3A 4DP4X 5BZWB 4E5XG 2CM3A 2B0SH 4X7FC 4MCNA 4DQAA 5IUCA 3QIWC 4FERA 4DZBA 4J1UA 2ICEB 4YSTA 5F1IB 4NZUH 4I4WB 4LFHG 3KYNB 3BQUC 1BCIA 4H0HB 2O72A 2VDOH 2BZCA 3P0VL 2CIKB 4ZMOA 2Q1EA 2HT4C 3OZ9H 3FB6A 5I1KH 1J5OL 1CXIA 1ZTXH 3PWVB 5ILTH 1LARA 1J87A 4OLXL 2ZCHL 1TTBA 2IBZX 2NSQA 4UMGA 4DCQA 1FF5A 1XF3A 1YZZA 4F58H 2HH0H 3ZY7A 2JH2A 2XXGA 1ZA3A 2CCWA 2IPUK 2OL3H 5I2IB 3PL6D 5M43A 2H4VA 4Y16B 2VISA 4W93A 4HUNB 5GRWA 1SEBA 4M6ML 2YC1B 2VXUH 4H8UA 5L9DL 1UYWL 2C9SA 2JCWA 4R90H 1FL5A 1PZCA 1P15A 3FU7A 5LCVA 1S9XA 1U30A 1KACB 4LU5L 2P4DA 2E27L 4Q9BA 3LNGA 2V5YA 2OCJA 2PXYC 1NEUA 1XEDA 4I0PA 4CBPA 5EHFA 4CKVX 1OSEA 4I18B 1X5MA 4HALA 2C1PB 3KGSA 4Y1TA 3WFHB 1B0GA 5FO7A 4WWKB 4Y4FC 5DYOA 2CJ3A 4IOFC 4OIIH 3RHWF 3ZKQD 2CM8A 2E7LC 4TTDC 5HHNB 3O4UA 2FJFB 4NQXA 5DJ2A 2VDNB 1YGUA 1V8HA 4DKDC 1NGQH 1H3WM 5T3ZE 1QFUH 2GCBA 2OYPA 5DLMH 2R0KL 4JN1H 4XNUL 5C6TH 1HOEA 2EILB 2QLYA 4Y2DC 1HHGB 2JK5B 4RFEB 3DGGA 5CGBA 4PVMA 1NJ9A 3FONA 4CVUA 3CLEH 4Y19A 1A21A 1N70A 4PGCB 2GP0A 5LAXA 2NPLX 4FNTA 4R5XA 2XRAL 3P02A 9CGTA 4G6JH 3RWEB 1XB3A 2F58L 4NKOA 2EH8H 1SN5A 4XAWH 3QNZA 1G6RL 1ORSA 2F15A 4N28A 4V2CB 3ZRFC 3OLEA 4P3DB 5ICYA 4NSKB 4IU2B 5EZOL 4ZTPH 4W9FC 3ARDA 1T7XA 1A6AB 2V7HA 3OLGA 3SGDH 1B2WL 4HU2A 1S7XB 2CALA 4QEGA 4AVJA 4G2AA 1UGKA 4WIQA 3SOBH 2QSCL 5D7IB 1W16A 5A6MA 2F6YA 2QLVB 3ALXA 4HJPA 4HFUH 1YMHA 4KDTC 1KDIA 1G4MA 1XSKA 1TT6A 3FU9A 4LPUA 4ZQKB