3AWEA

Crystal structure of pten-like domain of ci-vsp (248-576)
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
316
structure length
305
Chain Sequence
KDGFDLDLTYVTDHVIAMSFPSSNPIGEVSRFFKTKHPDKFRIYNLCSERGYDETKFDNHVYRVMIDDHNVPTLVDLLKFIDDAKVWMTSDPDHVIAIHCKGGKGRTGTLVSSWLLEDGKFDTAKEALEYFGSRRTGDVFQGVETASQIRYVGYFEKIKKNYGGQLPPMKKLKVTGVTITAIQGVGRGNGSDLSMQIVSERQEVLLCKFAEGYNCALQYDATDDCVTCEVKNCPVLAGDIKVRFMSTSKSLPRGYDNCPFYFWFNTSLVEGDHVTLKREEIDNPHKKKTWKIYRDNFTVKLTFSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the cytoplasmic phosphatase and tensin homolog (PTEN)-like region of Ciona intestinalis voltage-sensing phosphatase provides insight into substrate specificity and redox regulation of the phosphoinositide phosphatase activity
pubmed doi rcsb
source organism Ciona intestinalis
molecule tags Hydrolase, membrane protein
molecule keywords Voltage-sensor containing phosphatase
total genus 101
structure length 305
sequence length 316
chains with identical sequence B, C
ec nomenclature ec 3.1.3.-:
pdb deposition date 2011-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00782 DSPc Dual specificity phosphatase, catalytic domain
A PF10409 PTEN_C2 C2 domain of PTEN tumour-suppressor protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1110 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3aweA02
3.90.190.10 Alpha Beta Alpha-Beta Complex Protein-Tyrosine Phosphatase; Chain A Protein tyrosine phosphatase superfamily 3aweA01
1T48A 4OHHA 2CNHA 3BM8A 4JMJA 3QCCA 2F46A 4H1OA 1C84A 3O4TA 3ZM1A 2B4PA 2I4HA 2B4SA 2BGEA 3RGQA 3S4EA 3V0JA 2VEYA 4RKKA 4GFUA 3MOWA 5KABA 2F6YA 3OLRA 3RO1A 2G59A 1GFYA 1C86A 2I5XA 5K24A 4Z6BA 2I6JA 1J4XA 5J8RA 3V0GA 3EMUA 5K25A 1GWZA 2VEVA 1C87A 1NWLA 1XRIA 3N0AA 5K22A 2I75A 1L8KA 1JF7A 4DGPA 3D44A 5KAAA 2HB1A 3QCIA 2J16B 1YGUA 1D5RA 2B49A 3RGOA 2J16A 3A5JA 2OC3A 1ZCKA 4YR8B 3PS5A 2QBQA 2GJTA 5AWXA 3O5XA 3M4UA 1BZJA 2HNPA 2HC2A 2Y2FA 4D3QA 2P4DA 2H03A 4GRZA 4R0SA 1XM2A 2FHFA 1L8GA 2PT0A 1G1HA 1FQ1A 1BZHA 4BPCA 3V0HA 2RF6A 3QCGA 3QKQA 2F6ZA 5KA4A 3QCLA 4ERCA 1BZCA 2VEXA 4OHDA 1YFOA 3ZM0A 1Q6MA 1QXKA 2I6MA 3O4SA 2BV5A 3ZV2A 5BX1A 2J73A 3H2XA 1V3AA 2M3VA 1Q6SA 2HCMA 3V0FA 4WU3A 2I4EA 2OUDA 4GE2A 1PTVA 2PSZA 3D42A 3QCHA 3V0EA 3AWFA 4QUMA 2OOQA 3A5KA 1OHEA 1Q6TA 2FJMA 2SHPA 1ZZWA 1OESA 4GS0A 4KYRA 4I8NA 3I80A 4OHEA 1M3GA 1OETA 1U24A 2ZMMA 4GE6A 4Y2EA 1P15A 5BZZA 3EU0A 4GE5A 3CM3A 2AHSA 2DXPA 2H4KA 5MMZB 3U96A 2J44A 4WU2A 2I1YA 1YTNA 1A5YA 2NV5A 1KAKA 2HXPA 2HY3A 1Q1MA 1U26A 3MOZA 3QCMA 5KA7A 3QCNA 3O3LA 4D3PA 4WOHA 4JNBA 4RI5A 2B4OA 2E0TA 4ZI4A 4OHIA 4OHLA 1NNYA 2HNQA 3QCBA 1C83A 4RHGA 2WGPA 1RPMA 4WTYA 3F81A 1G1GA 4KI9A 1ONZA 1G7GA 2H4GA 1U25A 2QDPA 1XXVA 1PA9A 1VHRA 1EENA 2FH7A 2VEWA 1LYVA 1T49A 1I9SA 2BGDA 1OEMX 1YTWA 5K23A 4NYHA 1YTSA 2IMGA 4HJPA 1PXHA 4QAHA 3D1QA 4QUNA 4ZRTA 5IBMA 3S3KA 3S3HA 4J51A 2I42A 2OZ5A 2F6WA 1ECVA 3F9AA 4QAPA 1OEVA 4B04A 2J43A 2AZRA 5EHPA 1OEUA 2QDMA 2F70A 1I57A 1PA1A 2B07A 4RDDA 4NWFA 2C46A 4HRFA 2BIJA 2F6FA 4R30A 4BJOA 2J71A 3I36A 1WAXA 2HC1A 2A3KA 2I4GA 2NT7A 2CMAA 3S4OA 4AZ1A 3F41A 3AWGA 1NZ7A 2YDUA 1JLNA 2FJNA 2I6PA 3QCDA 1OHDA 1Q6PA 5KA9A 4QBWA 2B4UA 2CM7A 1Q6NA 4RI4A 3ZMPA 5KA0A 1PTYA 1LARA 4Y14A 1WRMA 1PTTA 2F6TA 2CNIA 4H34A 3BLTA 1ONYA 3B7OA 3BLUA 1G1FA 2PBNA 4ICZA 5BZXA 3MMJA 1NO6A 2NLKA 5IBSA 2QCJA 2G6ZA 4TVVA 3RZ2A 3D9CA 1YWFA 3LJ8A 1EEOA 2I6OA 5I6VA 3V0DA 2I3UA 2QEPA 1Q6JA 5KADA 2YA1A 1NWEA 1ZCLA 1G4US 1MKPA 1PTUA 2Y96A 3EZZA 3OMHA 5KA2A 1G7FA 5LXQB 1T4JA 3GXHA 3QCJA 5K9VA 2F6VA 4YAAA 2VEUA 1YN9A 2F71A 2NZ6A 1G4WR 4JMKA 5BUGA 1XBOA 5M43A 3QKPA 1OEOX 2Q05A 5GTJA 4GFVA 2ESBA 3AWEA 2CMBA 4R0TA 1C88A 1FPZA 2P6XA 2FHBA 3O4UA 1AAXA 5HDEA 2GWOA 2H02A 5EHRA 4JBCA 2CNFA 5KACA 2FHCA 2B3OA 1ZC0A 3D1OA 2CM2A 4DGXA 2PQ5A 4ZN5A 2J17A 4NX8A 2CM8A 2QCTA 4S0GA 2CM3A 2I3RA 4GRYA 4IKCA 3EB1A 2YOCA 2CNEA 3F9BA 3CWEA 2J72A 4MBBA 4RH9A 3S3FA 2CJZA 2QBRA 2JJDA 4PVGA 4RH5A 4QBEA 3S3EA 2PI7A 3NMEA 1OHCA 1YZ4A 2NT2A 4PYHA 2A8BA 4GWFA 3ZM3A 2I6IA 1PYNA 3ZM2A 1RXDA 1QZ0A 3GXGA 2GP0A 3ZMQA 1PH0A 1YPTA 3SR9A 2C7SA 3EAXA 2ZN7A 1KAVA 3V0IA 1XXPA 3QCKA 3D1HA 2QDCA 4NNDA 5KA1A 2QBSA 1SUGA 2CMCA 4HJQA 3SMEA 2CNGA 5KA8A 5K9WA 1C85A 3QCFA 1I9TA 2Q47A 3F99A 2PA5A 2H04A 1R6HA 3QCEA 2QBPA 1NL9A 2R0BA 3I7ZA 4KYQA 2H4VA 2CFVA 5KA3A 1YGRA 2MBCA 4NWGA 2HVLA 2BZLA 1X24A 3BRHA 4D3RA 1LQFA 1FPRA 2NTAA 1WCHA
chains in the Genus database with same CATH superfamily
5L4JA 2Y7MA 4W93A 2CBOA 4Y9EA 3BM8A 1QFWI 4PJAE 5L4MA 4PLKC 4W9LC 2VXQL 3QP3A 4LLUA 3HBGA 2ICWA 2CO7A 3LZFH 2A6DA 5FYLH 4XO9A 4XP9H 1BQLH 3BSZL 4PS4H 1QFUH 4BDVB 3NZHH 2GFBB 4LPUA 4I13B 4YBLC 5FKAA 5L2KE 2EUVA 3T0AA 4U31A 1NC2B 1QEWA 1QKZL 1U8KB 1W8NA 2WUCL 4MXWL 5E2WH 4UQBA 3QQ4B 4MA3A 3KE0A 4MA1C 3SCMD 3RLSA 4EZKA 3MRLA 3BGMA 3VWKA 5J6HB 4H40A 4HT1L 5FOJA 2D2OA 1ITCA 2QADD 2VJXA 2YPVA 1ORSA 1G7LA 1XRIA 4MA8L 1DN0B 2VXUH 5KW9H 1VGKB 2VDQB 3QFDA 1H3WM 4FYQA 2X38A 5CILH 4KAQH 4H8UA 3RWGA 1ZANL 1CI5A 1G6RL 3M46A 4Y5YC 5IBLC 3HLAA 1AS8A 3CDZA 3WKML 2GEEA 1D5RA 4HISA 4JHBA 1YQVH 4Y4FA 4QXTA 4XPTH 3ALXA 1INDL 1KB9J 3KBPA 5C2BH 4UWQB 1UXWA 3ZVVA 1UCTA 3ISWA 5BQ7A 1BG9A 2CZNA 5C0BE 3U36B 5DURB 3WN6A 1SY6H 1WE5A 2LU7A 2BW5A 1CBVL 4ZFOB 1DTUA 2WWKO 3EO1B 4HSCX 1K85A 5F7FA 3F7KA 1P6FA 5F7NC 5HHVL 1G7QB 4FQ2H 1XCTA 2YAOA 3J2PA 3S0PA 1SYVA 4BCXA 5ABZA 4KPHH 2CCLA 1BZHA 3WKNA 3V5KA 3S35H 2X2YA 2JF1A 1Z2KA 2XQBH 3E3QE 4B0MM 3O9WA 2EKSB 3N1GC 1GMIA 4XMUA 3CLFH 1OF0A 4AG4L 2KKQA 3TBTB 1JVLA 3ZDYE 4TPRH 1BZCA 2GJZA 4F33A 3JTSB 3H7BB 3GXDA 3GS7A 2FLBT 4JFPB 3E1ZA 4MQXD 2JV6A 4Q9BA 1CFMA 3U7WH 2YWZA 2AJUL 3NP3A 3US1A 1PNCA 4U1NA 4PJBF 2DQHL 1H3GA 2ZE0A 3BAIA 3CNKA 3LKSB 3DRQB 5IEHB 1MW3A 1MFEL 3G5XA 4YXLL 3G5WA 4PREB 2CHNA 3GPSA 2BVEA 3FULA 3T3MF 4TSAL 1MFVA 1WFIA 4KKCD 2H9GB 4M03A 4NUMA 5C0DA 3V8OA 5HDRA 1L4IA 3T3MB 2OMNA 3X14B 1QSFD 4ZX3A 5JOFB 4C58B 1I7RA 2BY2A 5JO5B 2DQFA 1BPVA 1M2VB 4KXZH 4KFMA 1VZHA 1NEZA 2V5SA 3DTXA 4M7LL 1SHMA 4X98A 5I2IA 4XBEL 5KVFL 5EOCJ 1OT1A 2WGNB 4HETA 4D9RE 4QWWC 2BVPB 4AM0B 4Q7DA 3LHAA 3MR9A 5I24A 4Y19A 4I5BA 4UTBA 5ID1B 1XGRA 4PJ8B 5F7EL 5I0WA 5CMAA 4IRZA 1DL7L 1NUNB 4N85A 2FJMA 2R2EA 5CSGA 2FO8A 3QZWB 3DA0A 4GMTL 3SE9L 4KYRA 2E6QA 3MRCB 3PS6A 4LCIL 5ESAA 4AX3A 3A6BH 2J1WA 4X6CE 1FL3A 2R1YA 3S88H 2WCSA 4J2XA 4Y2EA 1B0RA 1ZLWK 3ESPA 2G5RA 1P15A 4IK7A 5BVPL 4JM4L 3LIZA 2UXTA 4UTAA 2X05A 3CZGA 4MDIA 4MAYA 1G84A 1JZ7A 3V79C 1LHZA 4KRLB 2VUYA 3WGUB 3H1ZA 5DWUL 3ZDXE 1YTNA 3QWOA 4OJFL 5FHAH 1R5WA 1LE9B 3FQXA 5EU6D 4A37A 5IFJB 1BFOA 1EUUA 1JUFA 1WA2X 2P5EA 2RCSH 5GIRB 5FGBA 4M6OH 5E2TH 5T3ZH 3TBVA 5GGSA 5F3BB 1Q1MA 2H7WA 2XBDA 3W9DB 1O7VA 3BH4A 1CLYL 1FORH 3BP6B 5EFIA 2W91A 4JFDB 3SYOA 1MFAL 4I1RA 5L0QB 4YGVB 5C07E 3MGTB 3C60D 4HKZA 1MAJA 2NYZA 3NN8A 1FAIL 2W92A 1XV8A 1NLDL 4R7DA 5I19L 4Y2DC 1T5XA 4DP5X 1S46A 3X14A 3FS9A 1Q9WB 1OE3A 5HHNA 3MYJA 5FYJH 1ETB1 1WP6A 2AEQL 4HAGA 1C16B 2XHNA 1SBSL 3CZSA 3D85A 3BXNB 4RHGA 5LNEA 1MIEH 2D7QA 5GRJH 2YUZA 4GQRA 1E42A 4KI9A 3SGJA 1ODUA 5HGAA 1QQDB 5B39G 3R8QA 2YGNA 2ODHA 3QWNA 3ML8A 2ENYA 4HUWB 3SPIA 4JFTA 2EILB 4J1UA 3W82A 1WZ1H 2FH7A 2YAPA 3IE9A 1SQMA 2ZX7A 2MCAA 2EKJA 2VZSA 4OZ4A 2OSWA 1RK0B 3LD8B 1TQUA 1Y07A 3S34L 1B4JL 4KXAA 2IMGA 2A1WL 2AJYH 3CVHL 5D7IB 3A6CL 4CU7A 5AUMA 4GXUM 4UQ3B 4X80H 1UD2A 5I16A 2VLLA 2ZCLL 3V5KB 5KUKA 2WTPA 3S3HA 5FFGA 5TGBB 3GMNB 1HL5A 1MJ8H 3TZVA 4MGXA 4HK0A 4KVPA 4H20H 4Y4FC 4RISL 3KYOA 4A7TA 3PWJA 4ZG1A 3TEZA 4NO3A 4EMZA 1NGYB 4JFHE 2XWZA 3QFJE 4QRRB 1OEVA 5E03A 1BZOA 5DZPA 1ADQL 3VFOB 4AWJC 3L7EB 2BY3A 5F7HA 4XVSL 1INQB 2EICA 1ZS8B 4HLEA 1FWXA 3ABZA 1J0JA 3WFCL 2YK1H 1T20B 3GS4A 4XHJD 1HHKB 2BIJA 2F1BA 1DBJL 2ORBH 1DJXA 2HWZL 4BBWA 4LSPH 1KPUA 1J6UA 4V2BA 1EO8L 1JGDA 2VAAA 5I0DA 2UV3A 1WGVA 2I4GA 2VLJD 3Q2WA 1J9CT 4FNRA 1JHKL 4H88L 5F7AA 5G4OA 1QHPA 4OT1L 2WWNA 1DQQA 1UGKA 1KIRB 4Y2NA 5EPMB 3RWHA 4PRHA 2YWYA 3LNDA 4HHAB 5EEXA 4B9KC 4XMTA 4RGNC 3D85D 2YD4A 4AUJA 2VMEA 1PMYA 1UWEH 1CTOA 4U1HA 4JVPA 4PJXF 4RGOL 3T4AC 4D0BA 4PJ8D 3CU1A 5I66A 3PREA 2NW3B 4NPYB 4G8GE 2ZOKA 3PLYA 2DKMA 4LIQE 4P2AA 3C5JA 3PHQA 4YHOL 2DI8A 2WKGA 3NTCL 3PP4L 1FIGH 2W0LA 4AY0A 2B3IA 2V9RA 1IIKA 3CH8A 5K59E 2BWQA 2IH3B 5D2NA 3QULB 5HD8D 2OZNA 5F8RC 1B3IA 3LXUX 4K0OA 2ZX8A 3VTTA 1MCCA 3U1SL 4YL9A 5D6DA 1U21A 2VB5A 1LO5B 3RVUD 3ILQC 4G5ZH 4HXBH 4A38A 4B9JA 1Y6NR 4G9FA 3UOAB 2FO4B 1HAUA 1ZAGA 3QBTB 1J8HB 4FA7B 1UHVA 4MBOA 2ZKHH 3SGJC 5A2IH 3V0DA 4S0TD 4ZFFA 2DLFL 4NBZB 1R3LA 4OI7A 1SBSH 1CLZL 1GTFA 1R0AL 3UTOA 3WEAA 1WAAF 1VENA 1X7TA 4HUVB 4P59H 1XFPA 4F15B 5TQ2L 5IREA 3T65B 2Y96A 4YGVA 4XXWC 3LNIA 3IU4L 2P4AB 1PZUB 5DZVA 2ZP8A 4DERA 2PO6A 2QPEB 2DQCL 4N0UE 3DC0A 4TLTA 2CR0A 2ZKMX 2OPCA 3KHQA 4F57L 5KBPA 1G4WR 5C8JB 4MX7A 3D2UB 2UVFA 2C9SA 3S3CB 3FUHA 5TDOA 4WK0B 1A3QA 3WEXA 1AO7D 1XMEB 2UZXA 4M6OL 2IQ9L 3WLWD 5KJRH 4J23A 3VG9B 4JHWH 5DVMA 2ZWSA 2P8LB 4ZPVB 4R0TA 1DANT 2VC2B 2OJZH 3WJJA 2OR8A 3QWRD 4CSSA 1LEKA 3QRBA 3JV4A 1DSFL 1ZGLA 4PRBA 5GGQL 2YGOA 1KEML 4HD9A 3G08A 4G8GB 3DO4A 4YEFA 3II2A 4ODTH 3MJ9H 4YIQB 3OZ9H 3VQ1C 4CDHA 4X6EA 3G5ZB 3QHFL 1PAMA 3JWOL 4N4YB 3VFUB 1CXFA 3TLRA 3VRIB 2PXYB 5KUMA 5HYFA 2CALA 4WUUE 3EB1A 4WHTA 2YSSA 3ZL1A 4R2GD 1KV7A 3GM0A 5F7EH 1KIQB 1S4IA 3DTUB 3T8MA 5EA0H 1YY9D 3FT3B 3IE4A 4JX0A 5MI0B 4QRRA 4LKCA 3PF2A 4W9CC 2GVYA 2FDBP 2ZKYA 4WNSA 5C0BB 4I4WA 1I9IH 4L8BB 4AMKL 4F7PB 3RB5A 2PWEA 2Y7LA 4ZUUB 1X5HA 2AF2A 3TTYA 2EH8H 2XU9A 4ACPA 5E9DA 3ZRCC 4CVMA 2CO6A 4C56B 1CIUA 5AAWC 1U3JA 1GYUA 3GDCA 4M1DL 1OLZA 3ZYIA 1G4MA 3PL6C 1EHAA 4FNLL 1P4UA 1WHPA 3ABMB 3LZQA 3KYNB 2DDQL 4APQC 1MEXH 4LSVL 3EH2A 5CIPH 2DQHH 5KOMC 2WUBH 4D9LH 1BVNP 3NJGA 4NNDA 5E9DE 2HP4A 3OGCB 2F58L 2FEEI 4KKRA 2B5IC 2BRRL 2OTUA 4UZUA 1PEZA 3ZDYB 4FL4C 4ZZFA 4ATTA 4OAWA 2VXTL 1FBIL 5D1QE 3ZDYF 5D1XB 5ECGA 1EX0A 5BV7L 1WYJA 2GITA 2V2XA 3B3BA 4AG4H 1KGYE 3BGAA 4GQ9H 2Z31B 3CLFL 1MI5A 2NY5H 4OIAA 4QO1B 4J27A 5AVZB 4NAJA 4ZO8A 2AM2A 2E7LA 1VFBB 4TMPA 5JA9A 3ZUNC 1MIMH 4Z7NF 2F7IA 3S35L 4C56D 2TRYA 3PHQB 3QCEA 3PWLA 4W1TA 4PJBE 4Z7NB 3P0VH 4C54A 4LPYA 3EFDH 5ICXA 4GAYA 1OAZH 2QSTA 2VOTA 3N06B 1J5IA 3T3ME 1DEEB 4K5MA 4UQAA 1FPRA 3FOLB 3TWCH 2VDQH 1UZ6E 2ERJB 1MWOA 5C6TL 1QPKA 3H9SA 4Z7QB 2JIXA 4APXA 2DQMA 4LQFL 1TT6A 1T2QL 1RFDH 2ADFH 4LCWD 4QTHB 4PRNB 1BM3H 3IDIA 4N5EC 5GQBA 2COVD 4NRXA 2G3NA 3TEYA 4GRWB 4NKMA 3OAYH 2CHDA 3ARGD 2OYLA 2EZ0D 4B50A 4HCGA 5TD4A 4GFUA 3MOWA 3BUTA 3C5SA 1CLOH 3TONA 2EEAA 4Z6BA 1F2QA 2LABA 1EANA 3O4OC 4XBGA 3V8CA 4PRAB 5AW8B 3U6RA 5JORA 3EJZD 3L48A 3A0OA 4OJAA 2CJUL 3LN4B 5CD3B 4TRPL 3EFFB 2W1NA 3QJSB 5H35A 5F9OL 3ZDXB 3IRZA 5LGKA 3QJUB 3H53A 4N2NA 2ZCHH 4ZSOB 4BRJA 3DSNB 4Y9GA 1W0WB 1FLRH 1Z9LA 1A4KA 4NB7A 2W38A 1H5BA 2CPUA 3QJHB 3CN1A 3DV6B 3X1BA 4FHBD 2QT6A 1ZCKA 1I7UA 5ECJE 4DAGH 1U4EA 3AY4A 4PVLA 4GG6E 3U25A 5LUMA 4EN3D 4XXWA 1SUHA 1J1XL 2AQTA 3VXUE 1IQWL 2VT0A 4Q9RH 1HILB 3QIBD 2CU9A 1FNHA 4OCYH 5KVEL 3TYGL 3VRIA 2ADJB 3OR7A 1FV1A 1L8GA 2RGSA 3JZ7A 2V3DA 5IB5B 4LPTA 5KSAA 5HGHA 3QCGA 1JV5B 4L4TB 3ZDZF 4RSYA 5BZDA 2Q10A 1ILUA 1A3LL 3JUYA 2D03L 2WMPA 2EH7L 3GI8H 2A6JB 4LOEA 3GQFA 4FLOA 1E3XA 4DUWA 1YNTB 2OMVA 4GAJL 1NCDL 3U0TA 3AABA 3CVCA 2E9JA 4QF5A 2VIRB 4JRXA 4KK5D 4DZ8A 1AMXA 1Z9SB 5E00A 5E1AA 3ZLQC 4LEBA 4AENA 3MBEB 1NCDH 1OTUC 3UBFA 2I6MA 1NCCH 4WI9A 3GI8L 4LSSH 4XNUL 5HYQA 3L08A 3T5WA 4XR8C 1FA4A 4GKOA 1CFVH 1ZT4A 3U82B 3AJ7A 4D8OA 3GLDA 2XWEA 3HOGA 1L9OA 4O2EB 5GISL 2Y07H 4NRYB 3HA0A 4PJEF 2ICEC 3TWYA 4BSJA 1I75A 3O4LA 3KJ4C 4PJ7E 1Q6SA 3QDGE 3QNYB 2XIDA 1NFAA 2YC1A 1RZIA 3FQTA 4Y89A 5D1XD 2GITB 2HX8A 3IGAA 4GE2A 1IQWH 4UU9A 5A6MA 4L8SA 4Q9RL 4C47A 4J3OG 3QJHA 1P31A 4YFLF 3ARBB 1U58A 3C5ZA 4IM8A 4QUMA 1FP5A 3QXUA 4PWFA 2H26A 4TTDC 2ZOOA 4R7VA 4XRCA 5DRNA 4V1DA 3MLPA 3WS3B 5D96C 1L6PA 2AEIT 3F7QA 4GSQA 35C8L 4Y5VB 4N24A 3I80A 3ABGA 4A6YL 1CF1A 4H5SB 4BZ2L 3ZL4H 1IKFH 4ZUTA 4K3GA 5B3SB 3EJUA 2ZP0T 1G43A 4GSDH 4Z18A 3QIBA 3QA3A 2FK9A 3T2PA 1KUMA 1J1OH 4F57H 1WAPA 3RWFA 3BFWA 3QVAA 1SFDA 1AMYA 4BCZA 1V3MA 5DVNA 2E9IA 3T6VA 2X0WA 2ICWB 3HI1A 3OXRA 4KO5A 4LIQH 4Y16D 1CDYA 1R3HB 4PB9H 5FYLE 4WU2A 1A0QH 4MA7L 4O2CA 3P69A 3HUJA 2H47C 3PWUB 1XXFC 1BECA 3RDTB 3CZEA 1U8QB 2X1QA 5C92A 3OMZA 3BJLA 3ARUA 1O6TA 5D6CB 3W2DL 2XKSA 2PNDA 4PJGE 1NCAL 4PJBB 2NY2C 3FUKA 3SGKC 3T0ED 2MOGA 2PYED 1ULVA 4AV5A 5C0JA 2PWHA 1T2QH 5JHLH 1D7DA 1JBVA 3GBDA 2E0TA 3QH3A 2NY3B 3APMA 3S37H 5E7FA 4ZI4A 1G9NL 2EE6A 5DUJA 1OAUH 1BFVH 2VDQL 2V2TA 2OTWB 2H3XC 1TNNA 1UA7A 3TZVD 1CICC 2EXWD 4WK4B 2I6JA 2PCYA 4KY1L 1GS6X 2ZOTA 2R0LH 3O0RH 4G8IA 5H37H 3FQTB 4LOUD 5CP3H 3FTZA 3UO1L 2H0FA 3HNTH 1AQMA 2X6BA 4KTYA 5K9JL 4XCFL 1U8PA 1YYLL 2YA2A 2NXYC 3RTQB 4WWPA 4JB9H 2H4GA 2ZWNA 4G1EA 4JM2C 1PLGL 2EDHA 3ZBMA 1KTDB 4KKZA 5B1KA 3CBRA 1SM3L 3VI3F 2XG5A 1JF1B 1R3KA 3UC0H 2UXGA 4WHYH 2WKLA 1OM3L 3SDDC 2EE9A 3V52H 5F1SA 1I8IA 1Q0YL 1DEDA 3KWWA 3D1QA 3WTXA 5HHXL 1GS8A 3JWDH 3W0WB 3CCHB 4GQZA 3UYRH 3BPLC 3T71A 2VLKE 3GXNA 5E6SB 3PUCA 4HJJL 3N91A 4ZW7A 1CD9B 3HW7A 3P3RA 3OPZL 3ATBA 2R69L 3HG3A 4HUNB 4DZBA 4K3DL 4GXVH 4JUSA 3PAZA 1XO8A 2EH8L 3TF7C 2R1XB 4YNYB 2B07A 3QUKA 3ZL2A 4RGMB 4B60A 3O6LL 2YUXA 4NCC2 5EMYA 4X9YA 3PGCB 4ZIYA 3BRGC 2C46A 4IIZA 4JJHA 3QC5X 2JNZA 4KQ3L 2HUHA 2UZYB 1USZA 2OR9L 2DWXA 1F0LA 5I5JA 2IPTL 2YARA 4BWTA 4PM1A 4OGXH 5EA0L 2DWSA 3IF1A 4ZK8A 2WP3O 2WXGA 4RCAA 4KO6A 3IXTB 1EK3A 1L6ZA 1MRDH 3TO4B 2QKIC 1N68A 4ODTL 2K7QA 3S5LG 4A2GA 5KA9A 1EEUA 1EV2E 1LLAA 3N3EA 1XVSA 3MRIA 4WUUD 1QWHA 2BNQA 2R2EB 1HXYB 1MCOH 1K72A 4OVVA 1BVNT 2CLVB 1P6WA 2A77H 1P7HL 1JWMB 1Z0MA 1AZCA 4HDIA 5DT1L 2PO6C 2UUPA 2XBTA 1H0DB 4FQXA 2NUPB 4ZXBA 5IQOA 2DQJL 1FN4B 4BKSC 3A4AA 5AW3B 1IMHC 5T1KB 3TU6A 1W0YT 2XG4A 5E6IA 3QS3A 4X5XA 3TFKC 1D5MA 3MCLL 1SYSA 2D4FA 3P4OA 2IADB 4WU5B 1JVOA 3P77A 4CMMB 3MLRL 3D9AL 3ZTJG 3TFKD 5JHDE 4ES8A 1Z5LA 2YZ1A 3DK2A 4WNQA 2BZDA 3C5ZC 4IEFA 4XMWA 3UEQA 5AL0A 4QKXB 3CPLA 1HI6B 1KB9K 1DJZA 1HNFA 5IQLA 3KPMB 1UJ3C 5FUOH 1Q6JA 3FU0A 2JCWA 1EIBA 3PQYD 4ELKA 4K3JH 1MFDH 4NO5A 2H2SD 3ETTA 3ZE0B 1ZCLA 1JYNA 1D5IH 2YBRA 1PTUA 1E27B 2IALA 3ILPB 3TPKA 3IVKA 3LQAC 5AG9A 5A5EA 1RHFA 5ICUA 3QCJA 4R5TA 4GRMB 4WV1B 2YAQA 3NCBB 1IX2A 1TF4A 2Z7YA 2F7OA 4RMWA 4M6AA 4MD4A 2FJGB 2I32A 2XPGB 4OAWB 3MKKA 4FQHB 3VTAA 4EXPX 2Q05A 1DCEA 1PCSA 4P3CH 2X70A 1X5IA 3DX7A 4XVJH 5E5RB 1J5OL 2PO6D 3CSPA 2VERA 3KBHE 4GRWE 3VXNA 3D8MA 3FBQA 4ADIA 1JG9A 3OKOB 3L4YA 5DJDB 1IBHA 3I6KA 1ZHBA 4LLDB 4LMQI 3MLTA 3SBRA 1PY4A 2FIRT 3FSZA 3ARVA 2FHCA 4YXKL 1V10A 2PN5A 3LNHA 1J05B 1YY9C 2VW6A 3ET9F 2WVUA 4R0LB 3BI9X 1N7MH 2HRPL 3EDKA 5T1KA 3EJQA 3WO3B 4NLHA 4LE8A 2VN3A 1K8IA 2ZKXA 1TEFA 4WU5A 3HHMA 5ICZA 1JHKH 1U92A 3HJEA 1HHHB 3VXRB 4KTGA 3C6LD 5K1VA 4LKCB 5IHUH 3QFGA 4PRHB 3WUWB 5KVGL 2EVFA 4AL8H 4FYTA 4KUZH 3TJHD 1LWRA 1HFUA 1KB5L 1KY7A 3E8UL 2R83A 1CI3M 3IMWA 2WTRA 1X9RA 3WCYA 4DPCX 1TCRB 5IJKC 4M3HA 4Y0GA 4C56A 1TOXA 3C5JB 4ZPTB 4ZAKA 1YZ4A 5T3ZD 2A8BA 2YBRB 5D4HA 5MENE 3GUTB 3LS4H 3MV01 3CDGB 4DSYA 2VUKA 3CSGA 4GJTB 1JHLH 3WUWG 4FQQB 3DYMA 5LB1A 1MNNA 4WI0B 1YPTA 3L45A 5ITBL 3Q5TA 3H56A 4S10A 3QORA 5MEND 2Y3NA 1PDKB 2CMRH 3GSQB 5FK9B 5G4MA 5GRWA 5DMYA 1J86A 3D2UD 2OXHA 5EO0B 4QD2E 5GSRB 1MCJA 3U2SB 3CFIC 1B0IA 2A1WH 4LNVA 4AJ0A 5IGXL 1B4JH 4HC1H 4PRPE 3O81A 4WAFA 1RZ7L 2KC0A 1N4XL 4M6NL 3HB3B 1I7TA 4WCYL 3QO0A 1RULH 3A4DA 4M7JH 3K4ZA 3UBHA 4HVBA 1HQRA 3F99A 1JHTB 1WZ1L 4B27A 5CINL 2GEQA 3HBQA 5DI8B 3MODH 3IMSA 3QULA 4DUVA 2Z7WA 5AUMB 5TFSH 2YAMA 4F37K 4UT9L 5JTWA 4HSQA 3NG5A 1CDJA 3BVNB 3QG6A 4UV4L 5KYWB 4AITA 4B9CA 3F6LA 5FYJL 1GKOA 1KFAH 3PWJB 2HJFB 3Q9QA 4QRQA 5EU3A 3O11B 5I19H 2YKKA 4MZ3A 3WEXB 1GSMA 1T48A 3DRTA 1FAIH 5BNXD 1UZ6F 3HMXA 2BVOB 5D7JD 3G6DL 4Q0XL 4X6CF 1V05A 3QUHA 3HJ0A 4WUUA 5DMGC 3TFBA 2VIRA 1OGTB 5HVHB 1Y0LA 5JPMB 1HSBB 3IMVA 3UXFA 1TQBB 4MSWB 3HE6D 3V0JA 2WIIA 5E2TL 3WKYA 3FN0L 2B1HH 4HBQA 5D5MA 2JK5B 3WKPA 4WKZA 3RY6C 1ZKAA 2QZ5A 3VTMA 2F6YA 1KYAA 5C0AA 4GIOA 4LCCA 3U6RB 4W9EC 1YYCA 3GSNB 1M71B 3T0WA 5DQDL 3B7UX 1A4JA 5LG1A 5CCKH 4PD4K 2WM0A 1YMHA 2Z93B 1BYNA 3RWGB 4RMUA 5TE7H 4URKA 5JMOC 2G2NA 4CL7A 3UPRB 5PAZA 5IJDC 3MA7A 1BMZA 2O61A 7FABH 2P8LA 4X8JB 3CXDL 4XCEA 1TXKA 5FO7B 5I1JH 5A3IC 5JDSB 2QELA 1TZHB 3GLZA 3FU6A 2Q7NA 3ARTA 4FCAA 5DZOA 1Z9NA 1BQKA 2C1OB 3CQPA 4HGWA 3RL2A 1WZLA 3KPRA 4CNIB 4L4VA 5T1LA 5CLTA 4JZNA 4F7PA 1FRGH 4WO4B 4R4FL 2FX9L 4FFZH 2FJHA 1OGAA 3B9KC 4TOYH 3ZTCC 4QT5B 3QC6X 1AOZA 2X4QA 1MQKL 3DPBB 2Y5EA 2DYPD 4BA0A 2FIKA 2DZEA 2F0CA 1IC5L 2YSSB 3PAVA 3QNXB 3TV8A 3WTUA 4GNKB 3RWFB 4R0SA 3X1FA 5DJZB 3DX0A 1U93B 3OMAB 5BRPA 3S8WA 3LS5H 1N26A 1JV5A 4QTFA 2KPNA 4Z7QF 1MCQA 4JANA 2EEDA 1BZ9A 1X7QB 3IMUA 4QXGH 3RWIB 1LE5A 1XDTT 1QI3A 3FTWA 2NDFA 2VITB 3F12B 5BXFB 1DSYA 2VEXA 1CK0H 2ZXBA 1P1ZA 4JRYB 1V3JA 2R23A 4B9GA 3T8VA 4N2BA 3L9BA 2H32A 3MBXL 1OWRM 4JFEE 4QHMB 3BKYH 4WWKD 1HCVA 2VLMD 2IFGA 2DBLL 2XN9A 3O41B 5DK2A 2IDUA 3DJ9A 2YSTA 2Y69B 1LTXA 3IFOA 2A6KA 3W0WE 4A7GA 3VFWB 4LGRB 1TYRA 3BAJA 4OFIA 1HEJC 3BE1H 3HE7B 4KH9A 3BEVB 5DYOB 5GGUA 4EI5A 4AZUA 1FFRA 3LCYA 3ULVF 3S96B 2Q76B 2NW2B 1QTPA 4NCC1 1BWMA 1F42A 2P80A 2A4CA 4J12A 1XGTA 4HFWB 4TQEL 4PRDA 3E38A 5K39A 5IR1A 2J8OA 1JVKA 2LLGA 1KLFA 3O4LD 2DIBA 4X2UA 3NESA 3BC9A 5JXED 3MRMB 1AACA 2VM9A 4IKJA 4XN4A 5D7JB 5M7QA 4NAMA 3VXOA 2I27N 4ZRGA 5L8JB 1AY1H 5IMOA 3T2NL 5EEWA 3NJIA 5DI8A 2Y3AA 4DGYL 4XAKE 2SHPA 1INDH 3HS0C 4FMFA 5J9PB 3AFLA 3RVTD 4CW1A 1GPOH 1MY5A 1DLHB 2IFFL 1KYOK 2WO3B 4NDMA 4PJ5E 4XO5A 3OF6D 1ZANH 2XV0A 4MJ4A 1B2WL 5FM5M 4GE6A 2UZIH 3I3EA 1CVRA 1TVHB 4N90E 4PGJA 2CUAA 4K2UL 1QPXA 3EGXB 3FQXB 4JY5L 1FSKB 1P6AB 2M83A 4MA8H 1CD0A 3ARRA 4LCUA 4YDKH 4FA6A 1KBGL 3ZDZB 4N86A 4AEIL 1KC5H 3P9LB 2WBJB 4ZFGH 1WUNT 4L3CA 1A4KB 2YEVB 1CYXA 4N2IA 3OHXB 4Z0XA 3TGXA 4HXAL 4IRJA 4JZJC 2VDLH 4FI6A 3S48A 1JZ8A 3ZMRA 2BH0A 3BISA 5D7EA 1UVQB 3B9DA 2JKRM 4BCYA 4DKEL 1M7UA 2M2DA 4GRLB 5HSFA 2Q8AL 2JSFA 3IDMA 3NIDE 3OMNB 3WN5C 2VXQH 5KS9B 5FV2A 3CZLA 5KEZA 3BH8A 1RPQA 3MGOA 2G9HA 3LN9A 4GO9A 5BMFL 2AW2A 1E5AA 2DD8H 4W9IC 4HFUH 4FJ6A 4OHIA 2R39A 3T0EC 3KYAA 2F53E 3DGGA 5H4ZA 2XT1B 4IMKC 4OCXH 4OF8A 4UAOB 1K8DB 1CC3A 5B1CA 1AQDA 4I0CC 3HZVB 4QRUB 4CADB 2GSIB 3FTGB 4YSCA 1LP9B 1MCNA 3DIVA 3BT2H 2IG2L 1CCZA 1JDCA 2P47B 1GSKA 3C5XA 4I2XA 4OGYL 4FZ8L 4P46A 3OKKB 5IM7B 3U6XA 1XXVA 5EU4B 4APQA 1A6ZB 4QJ5B 4Y16C 1A02N 4FFVD 1WWBX 2B77A 3H3PL 3QARA 3QDAA 4QT5A 3VD1A 1OQOA 3QRFM 1LYVA 1DQJA 3FQUA 3K72A 4UB0L 3ATEA 4XGZA 3RI5F 4MCYB 2F7RA 2X3CA 2WJ5A 3HNSH 1QYGL 3S8GB 1AQHA 5B8CB 3H6AA 4L37B 3X13A 2YGPA 3ISYA 1PLBA 4NO3B 1QBMH 2R56L 1J48A 5GS0L 4J51A 4G1MB 1HHIA 2H1LM 1KCSL 3DROA 3LOWA 3RX9A 1LO4H 4G80B 1WRFA 2MJWA 2VRQA 3NACH 2XWBA 1BJ8A 3QQDB 4MNQA 1TNMA 2AZRA 3AM8A 1UACL 2PYEB 1OEUA 2F7PA 5JZ7D 1EEYB 4LB8A 5GJTH 1HHJA 3OGOE 3GJFA 1OGAD 1BOYA 3LYRA 1OOAA 1EZVY 2IAMB 2ZNXA 4G6JH 4WFFE 3VYOA 5DO2D 4H1LB 1ROWA 4MMZC 4G7VL 5H35B 3BH8B 4NFDA 4MRBA 4Z7AA 1MCEA 2A3KA 1C7TA 2JKLA 4LCYB 4MHHG 3CZKA 4I77L 4XXCA 4YHZH 1NDGB 5KVDH 2GIXA 2XJLA 2I60L 4O02H 2KBGA 1XSIA 4U1SA 2OTPA 4N2EA 5I1LA 1NCJA 3S6CA 3DV4A 1EEZA 1I8LC 2I6PA 3FUDA 2EIJB 4DVRL 4EEEA 3MACH 1LNUA 5HGDA 5ITFB 1JRHH 3X11A 2APBA 2Z4TA 1NBVL 2B59A 3PQYA 1PTTA 4B7LA 2DYRB 2ENSA 1B88A 4PJBA 4AT6A 4X8XA 1J05A 2EE0A 1IGMH 3I50H 1GOGA 2DMBA 5KYXA 3B7OA 1FZJB 4MDJA 3T1FB 5JW5B 3SIKA 5GGRY 4BE5A 5IB3B 1U8HB 2WHVA 3ASNB 1Q1JH 1KTBA 3BFQG 5I8KL 2C3VA 3X13B 1YMME 4BELD 5ICZB 5IWLC 1TVHA 5EULV 3VFRA 5T3ZE 1XH3A 2WPGA 4HF5L 1J1PL 1PKQE 2DMCA 2WWMC 1KJ2A 4JKPH 4XCCL 4YHLL 1AQKH 4HEMA 5A7BA 4X6BA 2BIOA 3NJHA 3UYPA 4DP1X 3JTBA 2F7QA 3WDHA 2N0MA 5JW4R 3FB7B 3FO0L 3MRLB 1MNUL 3QRGL 4L2LA 1NUGA 4QTIL 4GXUN 1YY8B 3SCMC 3FAWA 1ET7A 3A23A 4IU3A 2WLJA 3SE8H 4KK5C 4ODHL 2VDMB 4J8RB 1ZVSA 5FO9B 1G0YR 3JTTA 4N0YL 1GGTA 2DOCA 2JKTM 3F65A 3P4NA 3BP4B 3O3UN 1BD2E 4YC2B 1AGFA 3NSJA 15C8H 5JA8B 2J3SA 1Q9KB 3BAKA 2CKBA 3EGSB 3Q8BA 2AQ2A 4LU5H 2APXA 5IJKA 4AVIA 1N6UA 2GSIA 1FDLH 4OZIE 5IFAL 3QXTA 4OZHA 1BQHB 3FKUS 4UIKL 3SBWA 4B5ZA 2NXZC 1JXJA 2VMCA 4WI5A 3QEHA 1I9RL 3KWVA 4S0HA 5FCUH 3FO2B 1COBA 5JR1H 4CJ1A 2VERN 4KJPC 5KYXB 1HINL 3L1EA 1JZHA 5TK2A 4P0DA 4HX1A 2DWEA 4L48A 5EN2B 3O9WB 4DGIH 4I3SH 2PQ5A 5IB3A 4DGXA 1OAKL 4YFEA 2CM8A 3MYJB 4TKWA 1HH9B 2QCTA 2XRAH 4LARH 5E4OA 3M1OA 1A9EA 3RKDD 3LEXA 3NFSL 4K8RL 4C59B 1F97A 5E95B 4I0PB 5F88A 2O30A 3U4BH 3IXTA 5AB2A 1F3JB 1CGSH 4BK8A 3G6JF 3CX2A 2X28A 2VDOH 4KKPA 3G6JB 4NYLB 2ESVA 1RHHA 3CZUB 4FYRA 1MJ7H 2L8AA 3BWUC 3HFMH 4KKAC 3SKNA 5JHDD 1T1XA 3V4PB 4NNYB 4PV1C 3VH8G 5LWYH 3U0PB 1TTUA 3LEYH 1S9VA 2QGEA 3KEHA 3QDMB 1AFVL 2CLVA 3DRQA 3PGCA 2JK5A 3IJYB 3L5IA 4WEUD 3QZLA 2ZG1A 1HOEA 2I9LB 3K80A 4P5KA 1KNOB 2IDTA 4E9YA 2RALA 1PYNA 2O5ZH 2Z91A 4H1LA 2VN5A 5DDHB 4U1MA 3DVGB 4AUYA 4JJ5B 1S2EA 3QG7L 5HYSB 1ZVSB 3D2UA 2Z93A 1MHCB 1QSFB 3GFUA 1WHOA 2KQNA 3KGSA 1S7RB 5HHMD 5I2IB 5ETUB 4HWBL 2FX7L 2IF7A 1KAVA 2KLTA 3V0IA 1KCRH 2GBVA 5IB2B 1VCAA 5G2NA 3GSOB 4HJQA 2DQTL 1ZV5A 1TO5A 4LSRL 2X6CA 2HJLB 3L3GB 5FB8B 3H85A 1A6VL 5KA8A 3APNA 4AC2A 1NDMA 5AAWA 1AHWB 2VDRL 3LPPA 4JPWL 1KBBA 1NEPA 4OQ1A 2Q47A 3SKMA 4P07A 4EN3A 4JREB 2XG5B 3KBFA 1U3NA 4AH2B 3MV8E 1BZ8A 1UB6A 5SWSA 2WLYA 4WHDA 1G0XA 2C9XA 5D93C 3QDHA 2H4VA 4MQXC 4DN3L 1JI2A 3BPNC 1KPRB 3EYOB 1KMGA 1YGRA 3N41B 1E4XH 4G3YL 1UM6L 1O5ZA 4Q58C 3M6DA 5KBMA 5EU3B 1NMCB 4TUJA 3CSTA 5EZIH 1R75A 1YC7A 2NX5E 1LE9A 2GCYA 2NY6C 6PAZA 1JGEA 5IVOA 1KB5B 2E4TA 4XMLL 3LH9A 1F6FB 4JM2A 2CDEB 2CNHA 2C4FU 4X6BB 2X4NA 1QRNA 5GZNC 3GI9L 3FQRB 5EU7C 5FHBH 5C09B 1CQYA 2J6EL 2MTAA 3DJSA 3GI9H 4MCMA 4HIJA 4ELKB 2P5PA 2HVKB 3BKCH 3KPNB 4JBSA 3B5TA 3ZKXB 3I9AA 1O5PA 3QPXH 5KBLA 4NWUL 4OCSL 3KYKL 4XBPB 2ROYA 3HC2A 1FGVH 2R0WH 4OIFA 3RO1A 5FC9A 3LRGA 4EUPA 2DQIL 1Q72L 3O4LE 4L3EB 4JN1L 2C7FA 3W57A 3RIAF 4JQIA 5INCA 5LCVH 4DHLA 3TO4A 2LVCA 5HTSA 2CIIA 4KNSA 2IIJA 4I1PA 1N0XL 4G82A 1RZ8B 5IVXF 2Z1KA 3CFNA 4D7BA 3KLKA 4L18A 2JVUA 4P5RA 2EDKA 4L4VB 5T1LB 4MCZA 4NQSB 5F7KC 5C9JB 1Z5YD 3VXOB 5HPMB 1HNYA 3MLVH 1YEHH 3CVHA 4LSRH 5C0NC 1AGCA 2AC0A 3V0WL 5IW6B 5FGSA 3QNZB 1KYDA 3QUXC 4FOMA 4M56A 4U6TA 3E80A 1MH5A 3LD8C 1CTMA 1MI5D 1UD3A 1E4HA 3UMNA 3MRJA 3WU1A 1K8IB 4OFYD 4ZQTA 1KFGA 4N2AA 1DVUA 1YEKH 3VXRA 2QKIA 4DKFL 4JPIA 5DHYA 5AW0B 2WZ5A 4JQVC 2F74A 2BIIA 4I0PA 1FC2D 3GMLB 1BOGB 2HJKB 4PRHE 1F4WL 3IDIB 1L9TA 3EH1A 2DQDH 3W81A 2EIKB 2ZF9A 3MJ8B 4RMVA 1UT9A 3QQ4A 4Q6YA 4LLVA 4WWKA 4HIQA 5C08E 2WWOA 5BO0D 2R23B 1BVOA 1HQRB 3KLHD 2GIYA 5DUBA 5D72H 5CN3A 1BVLB 3BSHA 1KCVH 5B4MC 3ZDWA 3GF8A 2OP4L 3NRFA 4NQQA 3DSFL 4XB8A 1KTLB 2DIAA 4I3SL 1OIOA 3UTSD 3BVNA 2YXVA 5BVJA 2BV5A 4MD4B 3WNIA 2MWCA 4O00A 4NWTH 4XAKD 2M3VA 2C26A 5FCUL 3KWTA 4WW2B 3FB5A 1A7PH 2WLNA 1JWSA 5AZUA 4WW2F 1FDLL 4G7YL 2NW3A 1FI8C 1LL1A 3UTQA 3HR5B 3LSOA 5E56A 3SJVD 1PX4A 1URLA 3STLB 4AEEA 4Y1AB 4OZIA 1VGEL 2YBGA 1AD9B 4YWGL 3ROOA 3MX0B 3U4KA 3QCUH 5DJ0B 2OOQA 2WXHA 5C0CB 4Y5VA 4JCMA 4HC1A 4KOBA 2WN3A 1Z1WA 4PJ6A 2K3TA 2ZG2A 2JB6B 5I74B 1VEOA 2QL1A 2WQ8A 3VG0H 1G7IB 3TBYA 1G1YA 1CE6A 2AQSA 2E86A 4OHEA 2XZAH 5KSBB 3T0EA 2BFGA 2XXMB 1EEHA 3DOSA 1QAWA 2ZMMA 3KNBA 5BV7B 4Q9CA 1T03H 4POZD 4ZO9A 4YSQA 4ERSH 3TN0C 3QK0A 5MMZB 4N1EA 2CDEA 3F7VA 2FD6L 1DHKA 4TULH 3QQDA 1HYSC 3PABB 1UYWL 5CMAB 2GJ6E 3GHPA 1MCIA 3UTTE 5HHPB 1RZKC 4P9ML 3RNQB 4K3EL 3U9PL 3G5XB 3DUSA 3I6LE 4A67A 4ZTOL 1CL7L 2CA3A 3RRQA 3L7FA 4HS8H 4RLDA 5SX4I 1KELH 2Z7UA 5TQ0L 4G70B 5TF1L 3SY0B 1DJWA 5FO8A 1GG4A 1TITA 2OZ4H 3G5YB 4WI4A 4BKLB 4OZGE 1T83C 3P4LA 1N5YL 5J3HC 1OV8A 2WNXA 4F9PC 3SQBA 4EQ3A 1J9RA 1I1YB 4DNLA 1T04B 1H6FA 1BAFL 4FG4A 1RZJH 4KV5F 4QTHA 2XOTA 1HQ4A 1WBXB 2F08A 1XBDA 3FUFA 5IBUB 4DVRH 4X0NA 4XXDB 5CEZD 3ELQA 4JDZA 4L4VD 5T1LD 1A47A 4I18B 2Y7QB 4OD1L 3TCLB 4TVPD 3KVQA 4V1DB 4WTZA 5I73C 4GAGL 1R3KB 3BYTA 4YIQA 1QLFB 1M4KA 3P9MA 4DPBX 1U8MB 2XTLA 2K4WA 5IF0B 3N1MC 3O2VH 4FNQA 1SOSA 1LO3H 5F3HA 3SEPA 3HN3A 3RG1C 1ETA1 1TR7A 2A74C 5I8OH 3OC8A 1WFOA 2BGDA 2VABB 2VLRD 4G7VH 3WFHA 1TVDA 3HVDA 3WY3A 4TUKH 3ZIMA 5K23A 3MJ7A 2CNYA 3CDCA 3N42B 4K5NA 4W4NA 3APDA 1FE8H 3US9A 4MLIA 5AVSB 1MCPH 4OJDH 2J5LB 3VXQA 3R8BB 3UAAA 4XC3H 4G8EB 4JPVL 3S3KA 4N6QA 1GOHA 3ORJA 4J3BA 1FFOB 2NNAA 1I8LA 3EYQC 3WIIH 4I4WB 1YECH 1A14L 2YRBA 5GJTL 4DP4X 4K7FA 2GSMB 2I42A 1H5BB 1HCFX 3BKJL 5J6GB 1QW8A 2F5BL 4DUXA 5EZJB 3PHSA 1XCQB 2NR6A 3ARDD 2JFCA 2BNRB 5HHQB 1I1CA 2IPKA 4PSPA 3KPSD 1MUJB 1I57A 1AIZA 2J56A 3LKQA 3OWEA 3K1KC 1IAOA 2BXZA 4QRSA 5GGTH 1YHPA 3KLLA 1OM9A 2QKSA 5EOCL 3PL6B 2RR3A 3ZW3A 4ETQA 1QYGH 1I7ZA 2CCVA 4G6FB 2H0PA 4NDMB 1U3HB 2P42B 1H9VA 3KW8A 4YE0A 4KI1A 3QJTB 4G11A 5IB5A 4UB0H 2DQUH 2XFGB 3LKNB 1H15B 4Z7NE 1I3GH 1JN6B 1O7DC 2P1YA 2JFFA 1BREA 1I8MA 2B5IB 3WD5H 3EBAA 5KN5B 4XCNA 1LO2L 4WWKC 2N7SA 3VFOA 4AZ1A 3VFSA 3B34A 3P9LA 5GSVB 1S78C 2K8MA 4K3HA 4PJFB 2CQVA 1ZS8A 3WL9B 2V7NA 1F5WA 5IHHA 1OY3B 3WNJA 3BPOC 5DD5L 4P04A 4OCXL 3U9WA 3BUYA 4U7MA 5ICXB 1XB6A 2YAEA 3H9YA 3AQZA 3EYSH 4M5ZH 4F2FA 2JXMB 1DLHA 2IVFC 2CNIA 3QUGA 4UDTB 5EU7E 5HVWA 1JDAA 3R1GH 1RUAL 3DYPA 3VU1A 1UWGL 5B38B 5AB0A 1ONYA 4K71B 2O6PA 3SJVE 1TMCB 5EN3A 3I9GH 4ES9A 2OZ4A 1B9KA 2Q8AH 3CLWA 5IIEB 2PP8A 1U3YA 1XGPB 2ERJC 2YC1B 3UBXA 4EZMA 4S1SL 2YD7A 4IRZL 3PJSB 4RAVB 5BXFA 4I0KA 2R1XA 4YNYA 1REIA 1UWGH 1U58B 5SX4H 5E2UL 3T3PB 4LDLB 3SHSA 2V6HA 1NCIA 3T3PF 2D2CC 1TZIA 2JIXD 4XRCB 2I6OA 1YEEL 4X5RA 4OLWL 1DFXA 1E28A 1U0QA 4L1SA 4OI9A 2XN9B 4PP1C 5C3TA 2E6JA 1HNGA 1MRCL 2XZCL 1YY8A 3ZHNA 6TAAA 1FZOB 3RWJB 2GC5A 1LEIA 1WT5A 1GHFL 1SEQH 4U1MB 3HR6A 1G6VK 3SZKC 4KQ4H 5DRXB 4GUCA 3AT8A 4LVHC 3MZTA 5GZOA 4EI6A 1LO2H 1FL6B 5EUKB 3VXUB 1UUSA 4Z7UE 3TM6A 5GS0C 2QVKA 4K23H 3AW5A 2VEUA 3S8FB 3NCCB 4HKBB 3T2NH 2VSCA 1R3HA 4CBZA 2NZ6A 4JMKA 1QLEL 3QUYC 4POUB 2BSSB 3UCRA 5BUGA 4I3RH 2F18A 5DUMH 4OJEH 4YHYB 3RNKA 3STBA 5GTJA 1YEJL 5BOPA 1ET8A 2XFXA 5CFAA 1JWMA 3OX8B 1PPIA 4V1DD 2X4SB 4LHJB 3BAEH 1HILA 3RIAK 4KMLB 5FYJD 3ARDB 4Q2ZB 4BFNA 4AGLA 4LSQL 4CW1B 4FQCH 4FQJH 5T8IA 2N1TE 1JZJA 4PJCA 3BE1L 5ANMA 5SWZE 4EIBA 1PD0A 5CEXB 1B4TA 1CGYA 1D5MB 3QAQA 3EHBC 5MEQA 1Q94B 2J57A 2ROXA 3QI9B 4ODWA 1HX0A 2OX5A 2ZPKL 4TL5A 1MFCH 3CFMA 3S97C 2DBLH 4HUUB 3UTPE 3S36L 2C3GA 5EEUA 4QNPE 4HUKB 2MHAB 2YXMA 1QUNA 1XR9B 2GQHA 4M1CD 3B83A 3VW3H 2QADB 1CK0L 3FK3A 3S98A 3MO1A 2AJSL 2ZUQC 3W9EA 2OULB 2HYMA 4FD0A 3RVVC 4B95C 5KS9E 2CJZA 3VXPB 2BNRD 3KM2A 4F7MA 2IH1A 1NGZA 1LO3L 4PJ7B 3RU8L 4HCRA 3MRHB 1DBAL 1XH1A 3I85A 3QXVA 2YXWA 2NY5C 4QRSB 5DDHA 1JBWA 4OTXH 1XH2A 2NT2A 2KS0A 2D31A 2B1AL 2HKHH 3ARFA 2Y36L 2ZXAA 1I7ZB 2VAJA 3ESNA 4FQPA 5DHEA 4XBMA 1QZ0A 4LPCA 4MS6A 4FP8H 3RWHB 4YO0A 5I71B 4X4XB 1NANI 1R3IL 3P0GB 1E90A 2IAMD 1UZ8A 1PD6A 3B3IB 4YDJA 3VI3B 4NM8H 2H1PH 3DDFA 1LDSA 1C85A 1UKTA 2NT1A 5EU4A 4BFBD 1O0VA 3CXDH 4OF3A 2VLKD 5D2NB 4L9LA 1BGXL 4QCIB 4X5LA 1CL7H 1MFMA 4XPGH 3DJZA 2G3ZA 2VE6A 4W70A 1FNFA 2JKWA 1WWWX 2FT6A 2NY6D 4UT6H 1BIHA 2W80C 3DETD 5HDBE 3RBGA 4LRIC 4NC2B 12E8L 1T4KB 1R5VB 3OAUH 3K6SB 1FYTB 1E5ZA 3BH9A 3IFNH 3NK4A 3R4RA 4ERSL 3GXUB 2HVLA 4X8GA 1MXGA 4XNMA 1DDHB 4KRMB 4W81A 3VSVA 4M43L 4W9HC 1QRNB 2ICCA 2PW2A 2FGZA 4F8QA 1JZ4A 1RK7A 3MRNA 2XZQH 1OL0A 3HG4A 3OJMB 2VLKA 1S9XA 4NP4L 5KWYC 4FKKA 1C84A 2WQVA 3VD0A 2J1XA 1O5DT 5KTEH 2N0KA 2VDPH 3P0YL 3QDMD 2NUTA 3RWDA 3RGQA 3QH3B 4IU3B 3D4ZA 4WI0A 4J6IA 1FN4A 4YX2L 5E0FA 1I3RB 2DTMH 2H45A 3L3IB 4LCWA 2OTWA 4LLMB 5DD1L 2R4SH 3DBSA 2MMXA 2Q7AA 1SF5A 2GTWB 3F01A 4LCYA 3TO2A 3VH8B 3LX9A 4I87A 4NN7B 4UM9D 1G9ML 5GSRA 4BSWB 1A9EB 3WIHA 4XCEB 4HYTB 5K22A 4H26B 4KY2A 2IQAA 1JWSB 1A4CA 1WG3A 2VR3A 3EJYD 1MREH 1RULL 1RHHB 4KK8C 4BSVA 3G08B 1WA1X 4YHIA 4YSDA 3WG7B 3KL0A 4OZIB 5DJYA 1LNUB 5HGDB 2NXYB 3DSFH 4Z9KB 4PBVC 4OZIF 1NKOA 2B49A 2I85A 2H32H 4NCDA 4JGUA 2A83A 2YR3A 4RRPG 1QSVA 3JYBA 3N44B 3ULAB 3V4VL 4YR8B 1JGVH 3SCMA 2WW8A 4WHTB 2PABA 3PGDB 3N44F 3IBOA 5A2LH 1CGTA 1T66D 1UB5A 4JY6A 3DX3A 2AMUA 4AYDC 2GK0B 1OKEA 4OB5H 4HPYL 3V9FA 1FPTL 2H03A 3ZR6A 3U30C 1XGYH 4UOZA 6FABL 5TE6H 1HE7A 4HAFA 5D7SL 1W72L 4F27A 1E9PB 1U91B 4PG9A 5T33H 4ZNCD 1S7UB 4GH7B 4NYLA 4R4BB 1ORQA 1YEKL 3V0HA 4V2CB 1YNKH 3MGAA 4ZO6A 4PJAF 3HG2A 2YEQA 4DP7X 3AQXA 4JFUA 3IDYC 2CGRL 2OMXA 3E2HC 4GI9A 2BXYA 4WKZB 1IJ9A 1NGXA 3N2JA 4XNXL 5HYIA 2ZOLA 4IKKA 3SBWC 3KYNA 1P7QB 1YZZA 5EO9B 1Y18B 3V0WH 4N2GA 5I6PA 4O4YL 5CEZE 3MLVL 4M7ZC 3QCTL 4FMKA 4A63A 3L3IA 4NN6C 3GXIA 1UEYA 1P7KB 4HWZB 2MNUA 3EKCA 3BEVA 1CFSB 1EDQA 4JLRB 5A2AA 4DGYH 3K0YA 2HRPH 3MRFA 3PY9A 1EGJH 1QWNA 3RDTD 3RUGB 4DEUA 3KS0J 4AIOA 3N5AA 1OP3K 4YXKH 2DJ4A 2GJJA 3CFDB 4RQQB 1DUZA 1NWOA 2NY4C 1IC7L 5EZOH 1JI1A 3HUJE 5A2JH 3OM3B 1NCBL 1JPSH 1RZQA 2JMRA 2BNQB 1G1OA 3Q8EA 3RVWC 3VAEA 4M4RB 3V0FA 3JVGA 1A7NH 2I4EA 2RHEA 1WDAA 1S9WA 1Z7JA 1PG7H 4Y9BA 4P46D 2H3NB 3LKOA 4P23D 4OCSH 3GBML 1ETJA 4Y88A 3V0EA 2YQ3A 1GH7A 5DQ9A 2EXTA 1ET5A 3UIZA 4OBSA 5CBAA 3FF7A 3PNWB 4KQ0A 4K9JA 5DEFA 1OCWH 1HH9A 2RB8A 2Y67A 5DJZA 1TLKA 3B4NA 5JXAH 4PR5B 1L5GA 3CDZB 2VH5L 3RBSA 2B39A 3IWVA 4WI2A 5EO0A 5BZWB 3IPFA 2X89A 1NUDA 4NN5B 4QOKA 2XVGA 5DFVC 3F7VB 3H0TB 5CSBA 2TAAA 2VQ1B 3WNPA 1E4XL 4GS7C 4GT0A 4HV8A 3VXME 5E70A 2J44A 3SDCB 3QE5A 4EE2A 3PDDA 1EJOH 2I1YA 4ZXBC 3SDAC 3NCJH 3ARGA 4UT6A 2VZUA 1WBZB 1QSEA 4JO5A 3QNZA 5BRZD 2L3BA 3RZCC 3F58H 1KCBA 2KZWA 4ZUTB 1OSZA 4QPEA 1E4XI 1PIGA 1KCWA 1LMKA 3DI2B 3IJHB 1SXAA 2F5AL 1GJWA 3QCNA 3ETBJ 1RJZA 5I1CL 3FH5A 4ZTPH 4F80A 3HAEA 5DK0B 5KANG 1P4BL 2DQJH 1I1FA 4LASL 3K6NA 4ANWA 2W60A 2ZXCA 5J13B 2EUXA 3BZDA 3FMGH 3BZ5A 3MV8B 4NPKA 4BZ1H 2XETA 4BK5A 2WJ7A 2Q8BH 4HS6B 4M93B 3UAJA 1BLNA 3QEQA 2WAHA 4Z78B 4CU8A 5A6IA 5IJBC 1CXEA 2O4EA 3D39D 5EG6C 3VSUA 3X12B 5I15H 1Y0LB 3ATAA 3OTTA 4K55A 3ZKQD 2CIKB 1N8ZA 5BUAA 2J1YA 4PJEE 1CDGA 1SLWA 4XPFH 4H5SA 3S5ZA 1MRDL 2FH8A 1M7IA 1ONQB 2A9AA 4N8VG 4YSUA 3FCSB 3MRJB 1A6TA 3QUZB 4HCRH 4TNVK 2PPFA 5C0EA 1H3VA 1KPRA 3EYOA 2FQDA 5EOQL 1D7CA 5GS2H 4LSDA 4ODUB 3PAUA 4AQ8C 1IEBA 3DTXB 4X98B 2K6ZA 1K2DA 1VPOH 1OEMX 2VDOL 4RZCA 1PKOA 2EO7A 4ABQA 1KB5A 1CGSL 4X6CB 1AC6A 2D3JA 3N1QC 3PWVB 5AALA 3LH2H 5F6HI 3NFSH 4GY4A 1EEQA 5CZXC 3ILQD 2YGQA 2WXOA 3KJ6H 2EDJA 2OSLB 4IRJB 2K6YA 4Y4KB 3ZE1B 4GXVL 5EDSA 5JR1L 1DDTA 1ZXKA 2D7TL 1LK3H 3THMH 3ZKMD 4R4NC 1U8JA 3WUZA 4UAGA 2KLSA 1E2VA 4JFDD 4EVNA 1NFKA 1MAKA 2QVFB 3U7YH 1HXMA 4NXSA 4Z95L 2V8MA 1BXAA 1ID2A 3PWNB 1XX9C 1B0WA 1XF5A 3BWSA 4GW5A 4PJDB 3U2SA 4X4MA 3C8DA 2X4PA 5IESL 3C6LC 4ZS6C 15C8L 1MFBH 3VI4F 5FDYA 3KW7A 3PXHA 1FVDA 2GTZA 4BH7A 3JT2A 3QDGD 3O6FB 1G5GA 1DBBH 1A5FL 4NKMB 5EORH 3W9DA 1AXSB 2XTSA 3ZZLA 3QUMH 1ZLDA 4BYHA 4PW9A 4HLJA 3FL7A 4QR7A 2F54A 4Z77B 4JFDA 4DT2A 5K9JH 1FO0A 3H9SE 2FO1A 5DFVD 4IOSA 3QCDA 3RWCB 2OCJA 3GMQA 4DEWA 5DA0B 1MNUH 3V7AG 4WGWB 1NWPA 2JTDA 3B43A 3NCMA 4F37F 4H34A 2HT3C 3N9GH 1OGAE 2HKAA 4ACTA 5JHLL 5AWNL 2VXQA 2XJKA 1KGJA 1TJHL 2WLLB 4QF1B 2ADYA 3WXWH 4B6ZA 3I84A 3RILA 5F3FA 5KSUA 4HF5H 5JOEA 1A3RL 4UIMA 3TCTA 1RH8A 3MJ8A 5I6LA 3MO1B 4HFWA 2YHGA 1T1WA 5L4FA 1IGIH 1GL4B 3SGDI 3VVWA 4PB9L 1JE6A 4KUCF 1UM4L 1U30A 2E47A 1QLFA 1DFBL 3R0MA 1NBVH 4HIEB 4GO6B 2WKOA 3EYVB 4QAMB 2V3EA 1FZMA 2VR9A 2ADJA 5CNHA 3GMNA 4XOEA 4M5YL 4XNAA 4DWHA 1MKPA 3MRRB 5A2CA 4M8QA 3VXUA 3P2DA 4XC1H 4AQ1B 5I6OA 2AV7A 3MV11 4X6FA 1JV2A 1QRNE 3IETA 4TUOB 2AABL 2SODB 1TKWA 1BVKB 2CWRA 1YN9A 3GGWB 4KUCD 3HZKA 4IHBA 5DJCB 2VL5A 1R9FA 1S7TA 2JKIS 4CVZB 2E74C 5FUCE 5JXEC 5E8DH 5EIVA 3T4AA 1HAWA 1VSCA 1TEYA 2DQGL 4Z0XB 3UX9B 4R2GB 1GY1A 3GJEB 4JDVA 5KVFE 2MFNA 2LU4A 3MJWA 4G6JL 2J1KA 4EDWH 4XWOD 1A6WL 2FECI 1C88A 1QFOA 1FPZA 3GMQB 1KTCA 2AVFA 3D0LA 3VFGH 3B9KB 1LO0L 1HL8A 4P2RE 5EN2A 3M8OH 4EDXB 1XCXA 4YFDB 4XN8A 3PV6A 5L2KD 1USQA 4LP5A 1NGPH 2Y07L 5EH1A 4MBRA 4U1LA 1NIEA 4O5LH 3NACL 1P5UC 4U7SA 1RMFL 3NPSB 4FLHA 1CFVL 1EQWA 4G9DB 4R7XA 4WU7B 1JERA 3GTVA 3UTTB 1X5MA 2WK2A 2EDOA 2OM5A 1E2WA 1DBKH 1YPZA 3FUMA 1ZLSL 3DI3B 4P49A 1C5DA 3S7GA 4JG5A 3TA3D 2RQ8A 4OD2A 2HFFA 1M6UA 3VXNB 3GSNH 5F7MC 3LZPA 1ZLWH 4JG0L 1YEFH 5D7KD 2B16A 2CNEA 2VMJA 3HNSL 3V10A 4CU6A 4H8PA 5J1TC 1BVZA 2EXSA 4QIRA 4PJFA 3WY2A 3PHOB 4JS7A 5LQBL 1I3UA 4R6UA 5DZLA 1IEAA 2UZYA 4PVGA 3H3PH 3HRPA 4PJEB 1ZA6B 3S3EA 4C8XA 4U3XA 3LN4A 3TJPA 2WINB 1I9JH 2AQRA 1JNNH 2E7HA 2I5YL 4OGYH 5G4NA 4ZMOA 5FO8B 2FSEB 3QQ3A 2XQYG 3N1PC 3HE7A 4UDTA 1U3HA 3SYQA 3ZM3A 3TYGH 1J8KA 3LPWA 3Q2NA 4YAQB 2XPGA 1P84K 3BMWA 4W9ZA 2C34A 3GSXB 5SWSD 2RMNA 1JAEA 2Y6SC 2R9HC 3OKLB 5I17B 5I30L 5T5NG 1UENA 4HFUL 1XIWA 2ATPB 2NLJA 1TKWB 4K7PY 4G43A 4QWWD 5DYFA 4ZW6A 3WLBB 3ECUA 4UTBL 4QJ3B 4OI8A 1ZEAH 2QDCA 2P44B 1AKJB 4X6DF 1RK0A 3QEQE 3WJJC 2BP0B 3SPVA 4JFHD 4F91B 1M6OA 2PF6A 3P02A 2HX7A 5D7JC 1T2JA 2ZCHL 1W16A 1CUOA 4PTUA 1N59A 4KJWC 4P4KA 4JDEB 5I16B 4JRFA 1CB4A 5I8CB 3AUWB 4P2QE 3HS0B 1I7RB 2VKXA 3CN4A 2Z92A 1R5VA 3TJEH 1A4BA 1S5HA 1TTRA 4G6MH 4HUXA 4LLQA 1CLOL 1A22B 1SEBA 3LNEA 5IKCA 1RZFH 3CX5K 1WJ3A 3D12B 5I1LB 2IO5A 3DARA 4UILH 2Q9OA 3VFVB 3NFPA 2B14A 4AKOA 2WBJC 4X7SH 5TH2A 4UT7L 2B15A 2J2ZB 3ARXA 1RZKH 1GPOL 5I1HH 1J9SA 5E2VL 5CEZH 1BM3L 2AGJL 2CK2A 3V6FA 4P5KB 2F46A 1JZ6A 3OKNA 4GG8B 4LQFH 5JNYB 1FIEA 4H44C 1AR1B 3DVGA 1GGIH 5KVEE 1KG0A 3MA9L 5F1OB 5J89A 4NJAL 2Z35A 2A9BA 2QLVB 3GMPA 1PZBA 1KYUA 1V7NH 5SV4A 4MMXC 2ZSVA 4J4PC 4AYBA 3WE6B 4RAUA 3SKOB 3TH3T 4X4YA 2VOSA 4J8QA 3QQNA 1GGCL 3A4EA 2OX5B 4W9JC 4YDIL 3F6IA 2FAUA 3TNMB 1HWHB 1GFYA 4LVOC 3KL3A 3MCKB 3P0VL 3E9TA 1ZHNB 4D0BB 1IV8A 5DQJA 5FLUA 3GC3A 1C08A 1O7DE 2YQGA 2XYCA 1XAKA 4FHKA 4NHCL 4I85A 1SJMA 1WS8A 2R8SL 3UJTL 3LHPL 2FBRA 1OGTA 2HRHA 4IMLB 1ND0B 3MV9B 1UQSB 1FBIH 2EDDA 3HTLX 1TU2B 4NO2B 5GS1C 5DQ9B 4QLRA 2BRRH 3I3DA 5DVLA 4F5CE 1GCFA 2EYTA 1WD9A 5ILTH 1SFHA 1KJ2H 4JHVA 4NQCA 2LGNA 5DS2A 2G2RA 2XBZA 2NTFB 3L3OB 4Y2OB 5E7BA 1HHHA 4Q56A 2D73A 3UDWC 1H8SA 5A2FA 2YJQA 3CFEA 1Z66A 2WXKA 3VJ6A 5IMLB 2D9QB 4HUXB 2Y2FA 4M1DH 5LAXA 1VESA 3DMMB 2UYLA 2QQNL 3V6ZA 3P3TA 1ADQA 4P46C 1G1HA 4PGDB 3B8YA 2G3MA 1IC5H 1TTAA 1I9IL 3D3VE 3AXLB 2JJVA 2QQLH 4NPJA 4X0KB 4HJ0C 3FCTB 2DYSB 5HHME 4WSKA 5I0YA 2OAAA 5D5MF 4EBQL 4FFYA 4UMSA 1FL3B 2R1YB 3BIKB 4YK4B 2X0VA 3BW9A 3K74B 4DP8X 2J25A 4YBHA 5IEKA 1FRGL 3UYOD 4L3EA 3DPBA 3BEWA 4Q14A 4TNGA 2C5DC 3BP5A 4P3WA 2BHFA 4X5XB 2DL9A 5GJSH 4RAUB 3SKOA 3C08L 5C07A 5FDWA 1BX2A 1QFWH 1QP1A 2BLFA 5EC1A 3QIWC 4B0MB 1ZHLB 1KXHA 1NIBA 1HIML 4N0UB 5AZEL 2LQRA 3UPCA 1ID5I 3CZJA 2WYTA 2AXFA 3U79A 3OSVA 2GHWB 3CQQA 3CPLB 3AU1A 3GJFH 3Q3GA 2QTEA 4MB5A 1WQVT 1EZUA 1ND0A 4IJ3B 4OFDA 1D2PA 4Y19D 1KGUA 2ESVD 3P2BA 4KU1A 4TTDD 5DK3A 4JFFD 5HHOD 4L9LB 4WTQA 2YUWA 4YEEA 5AYQA 3VDAA 1PTVA 3FRPG 2IQ9H 3FN0H 4IOFC 3KR3H 2NYYC 2VRKA 4DPAX 1E8WA 1OPGL 3P4MB 4N6RB 5GZOC 3LIUA 1Q94A 1Q6TA 2NTFA 2HLFD 4ODUA 5DJ2A 5GZOD 2VXSH 3G6DH 4JFZH 4NQCD 4Q0XH 1F90H 4GKNB 2BIMA 3FB8A 1WF5A 1XIWC 3O8XB 1GGYA 3DX8A 4N22A 1JYXA 5EU6B 3DO7B 4E41E 2MPVA 5GGSB 4ANUA 3PDOA 5F3BA 4HJSA 1U24A 2MEJB 4AGQA 1U36A 3NIGB 2WLIB 1XCWA 5D1ZC 4JR9L 1E67A 4QEGA 2R2BB 3ZE0F 1CLZH 5FB8A 3A4FA 2YLKA 3NIGF 4MSWA 5ADOH 1G94A 1P7QD 3I6KB 4PJAB 2WZAA 2J2ZA 3HN7A 1NINA 1RAMA 4E41A 4X6DE 1ZLVK 3VQMA 4H25B 2UVEA 3L5WA 1GTNA 3L3KA 3TIDA 1D9KC 2C9RA 2NV5A 2O5YH 3KZ8A 1VADB 1U42A 4WTZG 1ML0A 4TVSa 4XPAH 2MKLC 5AKSA 3K7UA 4WCYH 4U4IA 1NMAH 2FB4H 1H3TA 1XF5B 4JFVA 2FLMA 4TNEA 3TN0A 1RZPA 1GA2A 2B20A 4OY9A 3HMXL 1QSED 3E7JA 5FO7A 3RUGF 5J3HD 4RI5A 2B8OT 4LCUB 1MI5B 1C5CL 3VA6A 1NMBL 3WNLA 5DD3H 4JFFB 1AS7A 2VLJB 5J1AB 3H42L 3VO0A 3Q3GB 4B96A 4KZCA 5FYJU 4ZMYA 2NYKA 25C8L 3QCBA 1TTCA 4U0RC 2HB0A 3GBEA 3CHSA 1W78A 2YPKA 1BJMA 3QIWD 3TH2T 4JL2A 4HG4J 3FFCB 3QJFB 4YE4H 3L9YA 4LL9A 1RPMA 3IYLW 4WUKH 4MNQD 2NX5D 1QR1B 2ZIDA 5DWPA 1PIFA 1HKLH 3B9AA 5CJ8A 3VD3A 3EOBB 4OKDA 4WFEE 1J7VR 1SXSA 5I82A 2I25N 3MJ7B 3MUUA 3EJYC 1K2DB 2VEWA 5INDB 4YSPA 1T49A 1ACCA 1CFNB 2XWTA 3GD1C 5L2KA 3SE3C 5AW5B 2ORBL 1YSOA 5IHUL 5JDJA 1BEYH 1FNLA 2Z4QB 3EOAA 3T77A 1FGNL 4Z23A 5BUPA 1YTSA 1IFRA 4GI8A 1MAML 4GSRA 3QYMA 4X4ZA 4WFGE 4HH9B 3Q6GH 3DPDA 1I7TB 3ZO0A 4XVSH 4NUGH 1HKLL 3B1TA 3RPIB 3AS0A 4M4RA 4RMBA 3DUSB 4BFIA 2D7NA 3CVHB 5IM7A 4CVWA 1ZGLM 1KNOA 1P7QA 5EO9A 1PG7X 2WJPA 2WXLA 5DRZB 3BUDA 2J43A 4XP4L 5EHPA 4XN2A 1ZWIA 2DLIA 4HWBA 4ENED 3SY0A 5CZXD 1MJ8L 5ETUA 3UGEA 1H8LA 2ZCLH 4GP5B 1NMBH 3FOMB 2AZAA 2Z3FA 4MJIA 4GUQA 4PIBA 5HJBA 3FT3A 4DKAA 1N67A 5IVXB 1NICA 3GRBA 1J5OH 4PR5A 3S34H 2AXGB 1TTBA 5FX3A 4FXTA 1HQ4B 1EJ6A 3ZSTA 4EI5D 1DZ0A 4D3CL 2CBPA 3HAEG 1QVOA 2Q7YA 1HHGB 5BO1L 1W0VA 3O3EB 1OTSD 1DJHA 4GYBA 1NM9A 3BJ91 2P80D 3SODB 5D6CA 3VGDA 1RU9H 1FO0B 4IDJL 4ZSOE 4KZDH 1WO2A 4MJ5B 4E9QA 3ILEA 5T5FH 2EADA 3C09B 1I1RA 4QJ4B 1D5IL 4BUBA 5J4MA 1MFDL 3FUJA 2E59A 4DCQA 2LFEA 4CVKA 4AQEB 2DQ6A 2AEQH 5JOFA 4M6ML 4WDIB 3WFHB 4FERA 1WRMA 2EO9A 2JJWA 1GOFA 3EGXA 2G60H 5C08D 1R1CA 1C12A 1HHIB 2OFQA 5FYKH 1E8CA 5SV3A 4AM0A 4IBUA 2ZNWA 2ATKA 4AJYV 4JO1H 3P3SA 4LO9A 3GSWB 4JDTL 4ZUVB 3AAZB 5DD0H 3MMJA 4ZMVA 1KLUA 3F62A 1KENH 4HIJB 1W8EA 3WS6C 1Q0EA 2EDRA 1G87A 3F83A 2FBJH 3DX6A 4L4TE 2O5XH 2FT7A 2PTUA 4WWID 2EE3A 4E42A 2ZOLB 5I0VA 1IAOB 3FH7A 2WKOF 1AKJD 1N8ZB 3D7PA 3K2IA 4XZUB 4I9XA 4OJFH 2VW4A 1LEIB 3LJ8A 2FEJA 1WWCA 4IU2A 1G7JB 5D1QD 2XN2A 5I0ZA 2QEPA 4Y2DA 2Q0ZX 4KHXH 3QNYA 5FUCC 5IOPB 5BVPH 3BDXA 5MHSD 3QIUC 4YAQA 4JFDE 2YA1A 1ZPUA 1G4US 1IEBB 3L9EA 4NNXA 1OCCB 3Q8CA 3EBHA 2CE6A 4XOBA 3GEWB 5FF6A 2P5EB 2AANA 3C8KB 2K1MA 3N85H 4M9PA 1LE5B 4WJ5B 5GJSL 1NL0H 2HTLD 4JFFA 4LSUH 4CVZA 3EOTH 4KXBA 1DL7H 2X0UA 2XN9D 3K1DA 1L6XA 1HKFA 4Z7QE 5I5RA 1BZDA 2AXJA 2P5WE 3X11B 1J0KA 5DMGD 1EAPB 4HU2A 1I85C 3HRZC 3R7RA 4LFHD 1XL4A 2H32B 3JWOC 4P23C 3NSDA 3BZEA 4MQSB 4OCWL 2QQLL 5J5EA 3KYMB 1MZZA 4MXQD 4XVOA 4PJ9B 3F6JA 4WWOA 5B38A 2DH2A 3KWUA 3FF8A 5KSBF 1E6JH 3D39B 1OK0A 1BSIA 4J8RA 2C3VB 5FO9A 1XQ4A 1SJHA 3HC3H 3MVSA 4XAWH 1KJ3L 3PWNA 4TSAH 4ZUWA 4FABH 3OKDB 3CD4A 3OPZH 2A9ML 3OLGA 4QYAA 5SWQA 3BQUC 4JFPA 2HMIC 3ULSA 3LEVL 2MHAA 3D1OA 4EUPG 4YXHL 1JIBA 5H4YA 1S9YB 3WFDL 5I18L 3VD2A 4A2MA 4JL1A 4F15C 3GMMA 2R2HA 3MTRA 1FJ1B 1RUPL 4N87A 5HHXH 1U8OB 1RUQH 4S1RH 4EOWL 1B0GB 4C12A 3GJFB 4LLYA 3BOVA 2BHZA 1DLFL 2F53A 3F9BA 4MBBA 3LVTA 2IAMA 2Q3ZA 1H0DA 5C0DB 1GYCA 1F3DH 3S3BB 4EQ2A 1HN1A 3UJTH 4DK6A 3HHSA 4QBEA 3TPUB 5MEPA 4PUBL 4AGNA 5E23A 1PQZA 1VZIA 3HAEB 2VABA 4PV9B 4NQVA 1PW3A 2YRLA 1YYLH 4G6AC 3SBQA 2EE2A 3OB8A 4XWOC 1HH6B 3UO1H 2EDXA 4GKZB 4OLVH 5DTFA 4K94C 4XZ4A 3O0RL 5DQJB 5B39B 5LNDA 5HI4C 5F89B 2OMYB 3X3FH 1W80A 3CDFA 4JM0A 2MNJB 3NGBC 5B1JC 1RJCA 3K2KA 4HJGB 5HI4D 3X1GA 2OK0H 5JPNA 2OMUB 4Q89A 4DZ8B 1XXPA 1HHKA 3FXIC 3HPLA 3I75A 1HL9A 1IKOP 3TIEA 5C2BL 3BGMB 3UADA 1YCSA 2AGJH 3UZEA 1YQVL 2B2XH 3QZPA 5EO1A 2QVIA 1G7LB 1CQKA 5K9WA 4UT7H 2Y2WA 3VB8A 3ESMA 4KTEL 1MELA 2EXYC 4J4PA 1WTLA 4IIQC 3N42F 4UILL 3IAQA 1NCWH 3QI9A 3D39E 4Z5RB 3D06A 5I74C 1IGTB 1SGKA 4YUEL 2VXUL 3DURB 3EJZC 3RA7H 3RGVB 5AW6B 3APFA 2QSCL 2FATH 3T0DA 4JK0D 3MZGB 3HC4L 4G6ML 1D5XA 3ISRA 3FU8A 2X70B 4Z7IA 2X4UA 5BS0D 3A67H 1TZAA 3TJEL 2MBCA 3CFUA 3L3GA 1UG9A 2BZLA 2H6PB 2QGDA 2V9TA 5KZCD 3TC9A 1JPFA 3WENA 1CT8B 3NA9L 4G8AC 4QHMA 4BJLA 2F53B 4APQB 4ONFH 1ES0B 3V9EA 3ZTNL 4Z8FH 5BOJA 3VWKC 2Q5BA 3EFOA 4OV5B 2B4PA 4PRIA 3DK0A 2D4DA 3R06A 4TM9A 1DVFA 3VGAC 5IK3B 4DGVL 3EDJA 1BX2B 1IM3B 2H41A 2QHRH 3WFBH 4D2NA 4W6WB 5I0XA 4RGNE 4Y5YA 1GJUA 3SQBB 4A66A 3V5HA 1OD9A 5IT2H 5JW4M 1ZT1A 2HG5A 2GBAA 1AZRA 1GQQA 2FL5B 2VEVA 4NUJB 2OMUA 1JNNL 4H8QA 5GISH 3CFJA 3GJEA 4X6DB 2EIBA 1PJ9A 3W3BA 3VXSA 5J9PA 1B6UA 4TQ8A 4RFNB 1XMWA 5LQBH 2VLLB 3S2AA 3GIVA 5LXGH 2Y5TA 4L0PB 4PJEA 1CMOA 1ETZB 3GK8L 2BSBA 4QRFA 4ZD3H 3P4MA 5AAPA 4EUPB 4N2MA 3FBKA 3GLEA 4S1DC 2R29L 3RJQB 1SJHB 4PLJC 2Z1PA 1JRHI 2Q3XA 2CIIB 4Y2DD 3SDYL 2H0JA 1RMFH 4OGAD 1P5VB 5LJYH 3NH7L 2R69A 5C09A 3DBXB 3OHXA 4F92B 3BZ4B 1SHXA 4IOIA 4IS6A 2ID5A 1CDBA 2P5WA 3Q6FB 5F6IC 5CKAA 2C1PB 1CF8H 4OLEA 1LO0H 2PETA 1NAMA 2A4EA 5KVEH 5HYJD 1GAFL 3MOBL 4S2SB 4MKMA 2Z8WC 4BFRA 1KGXA 1P9MC 5JHDA 5J11B 3NRSA 4K07A 3LK7A 3BIKA 2QHRL 4MNHA 3D07A 3L81A 5LVEA 3CVDA 3UZEC 4DGVH 1CD8A 4OV5A 1I3RA 4LCWB 4NENB 3BEWB 3IS1X 1Q9OA 1WZMA 4XN9A 5IK3A 1II4E 1CFTA 2AABH 4FQHA 4CSZA 3CFCL 4WVRA 4Y2LA 1KIPB 3WHXA 3VFRB 1P5UA 4AUUA 1FLRL 3RZCD 4XC1L 3IGAB 2YRPA 1NC4B 2XA8H 4N26A 2BC4A 4ONFL 1WCQA 2F19L 2NY1C 4F33B 4O02B 2OS7A 3Q5YA 5AD0B 1BVKA 1P4LA 3NA9H 2NR6C 3VRJA 4RESB 4AE1A 4MXVF 2WLHA 3WHE1 5BX1A 5FV1L 4W4OC 1OAXL 4GUPA 1C9SA 3PU7A 1DFBH 2WYIA 4QHPA 2OJEA 1TQVA 4RVBA 5SWSB 3HC4H 1JPGA 2M8XA 2OMWA 4BFJA 2QSCH 3BPOB 3IT8D 2JXMA 5C0FB 4L29B 1EPFA 2A6IB 1FAKT 1L0YA 3HEIB 3IF1B 1IAII 3D52A 1OT2A 3NP4A 5KYYB 2H5UA 1MLCA 3QQXA 4KTEH 5C6PB 4QGYA 3KPRD 3UC2A 2PW1B 4ENZA 1TSRA 4W9GC 2PR9A 4FS0A 1FVEA 5IBLD 4N1CA 4D9QD 3D0VA 5EUOE 1S7VA 3QPQC 2B0SL 1I82A 3DBXA 1IC4L 2O72A 4LSTH 2Y66A 3LH8A 5CN1A 1OETA 4PJ7F 3SDCA 4ELMF 1E5CA 2KI6A 2WXFA 4IRSA 4JZNB 3ZGIA 4BQCA 4P5TC 2YS4A 4ELMB 3EYFB 5ESAB 2R1WA 2D0FA 3BRDA 1G9NC 4YSOA 2JI1A 3L5WB 3EFDL 4IKIA 2VSMB 3DX2A 5F93C 3B7YA 5C70A 2NZIA 3SGEI 2ED8A 4CAGA 3D1MC 2UXFA 1OGSA 3T8XA 5MP6L 2UZXB 1MVUA 2IWEA 4D0DB 1VFMA 3O2DH 3CG8A 1DO6A 1BZEA 3BN9C 3P73A 5D1QA 2Z65C 5E4AA 1NGYA 3Q2CA 4QRRD 4OKVB 1ZRUA 3QORD 5MENA 2VXTH 1RPUA 1KEGH 3US0A 3BVXA 4CVXA 2WXMA 3MLXL 3MJGX 3O2WH 4H4NA 4JNBA 1T0PB 1RUQL 1RIUL 2UY6B 4S1RL 2K9FB 3RDJA 3VU2A 3U7AA 2CR6A 3E1F1 2PCPB 5B7MA 1JPEA 1T0MB 4CMHB 4AQAB 2WUBL 4R7NA 4K7PH 2V5MA 3FN9A 4LSVH 3MV9A 3ULVE 4BZYA 3L3DA 1MEXL 1TZOA 1LK3L 3THML 4DW2H 4FNLH 3GIZL 1C83A 2I3UA 1A6UL 4P4KB 3RY4A 4QHKJ 1WFUA 2PXYA 3HC3L 4UNIA 4ADGA 2NT0A 5GRUH 1A6TB 3ARDC 4WTYA 2DEWX 2OR7A 3PNWA 3FPXA 1Y1DA 2H4EA 1E6JL 1ONZA 3UERA 1C16A 1MLBA 5D7HA 4Z3EA 3BPCB 2XN0A 4DESA 3SYPA 4KJWD 1C12B 2VR6A 4OCWH 2DI9A 4R8WL 4BH8A 4QRTB 1TJXA 5EC1B 3NOIA 2CHWA 3ZYJA 2NDGA 4GP8B 4GW4A 5E8EB 4LAQL 3DIFA 3REVA 1E4KC 1RK1A 3MROA 4HCRL 1PXHA 2CO6B 2P5WB 3FO1A 3S5LA 1NGZB 5ALBL 3WTYA 4OZ4B 5IROC 5E1HB 2V17H 1O75A 4W9FC 4LT7A 2MKWA 5CZVH 4P9HH 3MRHA 4MZRA 1WK0A 5I1KL 3VCLA 4H0IA 4LNRA 1B90A 2OZ5A 4L8DA 1S3KH 1PCXA 1QBLL