3AWEA

Crystal structure of pten-like domain of ci-vsp (248-576)
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
316
structure length
305
Chain Sequence
KDGFDLDLTYVTDHVIAMSFPSSNPIGEVSRFFKTKHPDKFRIYNLCSERGYDETKFDNHVYRVMIDDHNVPTLVDLLKFIDDAKVWMTSDPDHVIAIHCKGGKGRTGTLVSSWLLEDGKFDTAKEALEYFGSRRTGDVFQGVETASQIRYVGYFEKIKKNYGGQLPPMKKLKVTGVTITAIQGVGRGNGSDLSMQIVSERQEVLLCKFAEGYNCALQYDATDDCVTCEVKNCPVLAGDIKVRFMSTSKSLPRGYDNCPFYFWFNTSLVEGDHVTLKREEIDNPHKKKTWKIYRDNFTVKLTFSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase, membrane protein
molecule keywords Voltage-sensor containing phosphatase
publication title Crystal structure of the cytoplasmic phosphatase and tensin homolog (PTEN)-like region of Ciona intestinalis voltage-sensing phosphatase provides insight into substrate specificity and redox regulation of the phosphoinositide phosphatase activity
pubmed doi rcsb
source organism Ciona intestinalis
total genus 101
structure length 305
sequence length 316
chains with identical sequence B, C
ec nomenclature ec 3.1.3.-:
pdb deposition date 2011-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00782 DSPc Dual specificity phosphatase, catalytic domain
A PF10409 PTEN_C2 C2 domain of PTEN tumour-suppressor protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1110 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3aweA02
3.90.190.10 Alpha Beta Alpha-Beta Complex Protein-Tyrosine Phosphatase; Chain A Protein tyrosine phosphatase superfamily 3aweA01
3N0AA 2NLKA 1X24A 2Q05A 2AZRA 4BJOA 3NMEA 1L8KA 2HXPA 2AHSA 3QCEA 1FPRA 5KABA 3RGOA 1PTTA 4YAAA 2ZMMA 2OZ5A 5EHPA 3F41A 2F71A 2Q47A 1OESA 3S3KA 2CMAA 2BGDA 2JJDA 3BLTA 1YGRA 2C7SA 2CNGA 4GE5A 4QBWA 2CM2A 2FH7A 3I7ZA 3V0DA 2F6ZA 2J73A 4GS0A 2SHPA 2HCMA 2J17A 5KA8A 1PH0A 1C85A 3D1HA 2PT0A 4NX8A 5KA2A 1U24A 5KA4A 2J16A 4IKCA 1V3AA 1C83A 3LJ8A 4JNBA 2FJNA 3A5KA 4D3QA 2F6FA 3EZZA 1PYNA 2CNEA 1Q6MA 2F6YA 2I4EA 3ZM0A 2F6VA 4YR8B 2I4HA 2H03A 3F81A 1NNYA 3GXGA 3QCBA 5IBMA 5K22A 4RI4A 2H02A 4OHDA 1ZCKA 3QKPA 1LARA 3GXHA 1PTUA 5J8RA 2I6JA 2F70A 1ECVA 3QCNA 5KA1A 1ONZA 2CNFA 1OHCA 1P15A 4JMKA 1PA1A 2E0TA 2B4PA 2DXPA 2I75A 3SR9A 3CM3A 2B49A 2J16B 1JLNA 3QKQA 4NWFA 2CNHA 2B3OA 2I6IA 4R0TA 3U96A 2B4UA 3AWEA 2P4DA 5AWXA 1C86A 2H04A 3EMUA 5BX1A 4Y14A 3MOWA 1Q6SA 3PS5A 4ZI4A 2F46A 3D1QA 2I3UA 1G1HA 1XXPA 2BV5A 2QBPA 2VEXA 2QDMA 1OEOX 2FHFA 1G1FA 1G1GA 2F6TA 2CFVA 1BZCA 3QCFA 3V0EA 3O4SA 2NTAA 1YN9A 3QCMA 4AZ1A 4GE6A 4GWFA 1NZ7A 1XRIA 1OEUA 1EEOA 2PA5A 4GFUA 4GRYA 1FQ1A 2GWOA 3V0JA 2WGPA 3RZ2A 3S3HA 2QCTA 2F6WA 3QCGA 2PQ5A 1XXVA 4RI5A 3RO1A 2QDPA 4GFVA 4PVGA 2QCJA 2J44A 1L8GA 4GE2A 4GRZA 4DGPA 3D42A 3QCCA 1C84A 1SUGA 1AAXA 3ZM1A 1PA9A 3CWEA 4H34A 1NO6A 2OC3A 4B04A 2J71A 4WOHA 1I9TA 2QBQA 4KYQA 4RKKA 2NT7A 2I42A 3O5XA 4OHHA 5KA3A 3V0HA 1RPMA 3OLRA 2PI7A 4R30A 5BUGA 3V0GA 1Q6PA 1GWZA 4KI9A 5KAAA 3AWGA 3QCLA 1WAXA 2CM8A 2QBRA 2GJTA 2VEYA 4RHGA 2FJMA 4WU2A 1J4XA 2NZ6A 1ZC0A 1ZZWA 3SMEA 2YDUA 1Q6NA 2HNPA 3V0FA 1OEVA 5IBSA 4ERCA 1EENA 2G6ZA 3M4UA 2MBCA 3AWFA 1U26A 4ICZA 5GTJA 3BM8A 4HJQA 1YGUA 2A3KA 4MBBA 4RH9A 4S0GA 1C87A 5KADA 3EU0A 3ZM2A 2VEWA 2Y96A 2I6OA 4ZN5A 2B07A 1OEMX 3S4EA 3BRHA 2R0BA 3A5JA 4PYHA 1YFOA 1BZJA 2I4GA 1YTNA 5BZZA 3EAXA 2QBSA 4ZRTA 4TVVA 1C88A 4RH5A 4QAHA 2H4KA 3S4OA 3BLUA 2J43A 1Q6TA 2I6MA 1RXDA 4Y2EA 3I36A 5MMZB 1XM2A 2CMBA 3ZV2A 1KAVA 3D1OA 1JF7A 3EB1A 5K9VA 3F99A 2HVLA 2GP0A 4J51A 4KYRA 1FPZA 2NV5A 1U25A 3QCDA 4RDDA 1OHEA 4NNDA 3I80A 5KA0A 4D3PA 5EHRA 2FHCA 4HRFA 5K25A 4OHLA 2B4OA 4QAPA 2NT2A 2I6PA 5I6VA 2J72A 3S3EA 2HC2A 5K24A 1ONYA 3QCIA 4WTYA 4OHEA 3ZMPA 2HY3A 4NWGA 1T4JA 2IMGA 3QCJA 2I3RA 2I5XA 5HDEA 1WRMA 2BZLA 1I57A 2VEUA 2VEVA 1MKPA 1T49A 1YTWA 3V0IA 1PTVA 3D44A 1YZ4A 1XBOA 1LYVA 1T48A 4JBCA 5KA7A 1ZCLA 2PSZA 4HJPA 2H4GA 2G59A 1NL9A 2H4VA 4WU3A 3ZMQA 1R6HA 3D9CA 2HC1A 3F9AA 4BPCA 1KAKA 5KA9A 1YPTA 2CMCA 1LQFA 2FHBA 2ESBA 3S3FA 2BIJA 1OHDA 4I8NA 2HB1A 4R0SA 5BZXA 3O3LA 1G7FA 1NWLA 4OHIA 1VHRA 2QDCA 4NYHA 1YTSA 1YWFA 2I1YA 4QUNA 2CJZA 1NWEA 1PXHA 2A8BA 1BZHA 3O4TA 3B7OA 3QCKA 5KACA 4QBEA 1QXKA 1OETA 3MOZA 2OUDA 1GFYA 4H1OA 1QZ0A 3O4UA 5LXQB 2HNQA 5K23A 1Q6JA 4JMJA 1G4WR 1Q1MA 1WCHA 3H2XA 1A5YA 1I9SA 4D3RA 2Y2FA 2PBNA 3OMHA 3QCHA 2CNIA 2B4SA 2YA1A 3ZM3A 5K9WA 2YOCA 4DGXA 2C46A 1D5RA 2ZN7A 3RGQA 2BGEA 4QUMA 3F9BA 2P6XA 2CM7A 4Z6BA 5M43A 1G7GA 2OOQA 2M3VA 1M3GA 2CM3A 2QEPA 1G4US 1PTYA 3MMJA 2RF6A
chains in the Genus database with same CATH superfamily
1VPOL 2C3GA 3UTPD 1FPTL 3RWFB 3KCWA 3KJ4B 1D6EA 4K3JL 4X98A 5A2IH 2YUWA 2VMJA 3TT1H 4Y4HC 1NC2A 2HH0L 4JFQB 3ZR5A 4FABL 5C3LD 4YR6A 1AGCA 1S9XB 3B1UA 1MFMA 1MJ8L 3PUCA 4Z78A 1N10A 1KLUB 3CFTA 3OGCA 1DLFH 4Z7UA 1OAYL 3GHBL 4PJCB 3HMXL 3O8XA 3TIEA 4JPWH 5BXFA 1AYOA 1NEPA 4HKBA 1RUAH 1XEDA 1IBDA 2WY3B 1AGDA 4UNUA 3DUUA 1CFNA 2Q87A 4H2CA 3P3UA 4IRSA 4GYBA 3A4FA 4BFGA 4RFNB 3RAJL 2FJHB 1XR9A 2Q86A 2AI0H 1UM6L 4ODSH 5IB3A 4XO8A 1JE6A 3P40A 4H26A 1D7DA 5F7NC 4ZFZB 4IJ3B 2ICES 3VRJA 2CM2A 2D7OA 3VMPA 2F54D 4FQPA 3VFMB 5HY9A 2YPLD 1MPAH 1T7YA 2IH3B 3LN5A 1QACA 2VRQA 4Y2DA 5DHVA 4HS3B 5JIPA 2J5LC 2ADGA 5GGTA 2HMID 3QZWB 5F8RC 1KNOB 1GOHA 1CGSL 5I0WA 2X70B 4Y19A 1JV2B 4JVUA 1KB5L 5HI5C 4NZDA 2WZ0A 3FHAA 3QR0A 5DYOB 5G5DB 4M48H 3BO8A 4LQFL 2X9WA 3S4SG 5KYWB 4D3QA 5HYJB 3JV5A 3VD5A 2VL5A 2VERN 2F6YA 2O5ZL 4RGND 3UH8A 2EUZA 5FYJH 3CFJB 4L2YA 2Y06L 4FEMA 1J6UA 1DE4B 3R4DA 1OCRB 4BUGA 5IBUB 4M03A 3UG3A 2YHGA 4XBEL 4HPHA 5DJAB 5LQBL 3P9WB 3RWJA 4NUQA 2H26A 4RNRA 3VXOB 5K22A 1T2JA 2F0CA 4GMTL 2EILB 3V5DB 1WFIA 1IU1A 1ZK9A 3AGWA 3QA3B 2BVQA 2R0LH 3QUML 4J6RH 4MNQA 4HIIA 4LBEB 3S0PA 1PTUA 3RVTC 3N5AA 1BJ1J 3LZLA 4YHPB 2GTQA 2FGWH 1R5VA 2YPVA 3ARBB 3ZQXA 1W0WA 4AC2A 4LSRL 3OAUH 4AMKH 1NWLA 2UUPA 2XY1A 2Z93B 3PHQA 2NZ1A 4KJQD 1WAAF 4ZO8A 4A2MA 2D3VA 3NJGA 3QNYA 3QWRA 4EIBA 2P4DA 2VZUA 1FDLL 4H8PA 4OIIL 5ICYB 2P5PA 4R84A 1JZDC 1PJ9A 4NDMB 1T22B 2Z31B 1ZSDB 2LR4A 3QJHB 4GFTB 2F2HA 4U49A 3NOIA 5F9OH 3DUHA 4X7SH 2YLHA 3T65A 1EAQA 4DAGL 5K9OB 5LNDA 1GC1C 3CHOA 3MV9E 3U7WH 3Q8AA 2XBDA 1SXBA 1CN4A 1KDJA 3HRPA 2F08A 3ZDYB 2OM5A 3MLXL 3NAAH 3L95A 3N0PB 4IW4C 5CJOH 1NICA 1Y6MR 2QADC 4YIQB 2DQHH 1FCCA 3PWVB 5D5MB 2D0GA 1WBXB 5FDYA 4OZHB 3HA0A 1R34A 1PZ2A 3BDBA 5L7XH 2R69L 5DJDA 1JZFA 2XBZA 5EUKB 1O7DC 3GMMA 4W9EC 4D0CB 3VWJD 1HIMH 3VRLE 5D2NA 5TQ2H 1JGLL 3MJ7A 2WINA 1OGAE 3GHEH 5I6LA 2O72A 3QCMA 3B5HA 1PGRB 2WNXA 3TYFA 1X4XA 3AAZB 5JYMA 4PRAA 2YEZB 2GT9A 1LE5A 3U4KA 4JRWA 5HHPA 1PL3A 3UOAB 3RZ2A 2NT1A 1G0DA 1YEGL 3RL2A 5CILH 1EUTA 4M8RA 1P4BL 5EBWA 1MRDL 2LABA 3KLHC 4Y16C 4JMXA 1CLOH 2DH3A 2IPUK 2FATH 3RE0A 4CAGA 1KLFA 2BSED 2FL5B 2KZWA 3TEXA 3ATDA 4FS0A 4M4PA 5IEKA 3Q1EA 2DF3A 3D42A 4JW3A 2IANA 1PZ5B 1LO4L 4PR5B 1NAML 1MREH 1MVUA 4Y2NA 3WD5L 4WW1B 4QOKD 1XF4B 4W9CC 5F0MB 2WQSA 2W9LA 4Q58C 4JG5A 2XV2A 1F45A 1O0VA 3OKMA 2FR4B 3TA3A 3QR2A 1M56B 3HAEA 1JK8A 4Q6IB 4JPQA 3MV01 4Q9CA 3DVFA 1AY1L 3QJZA 4A38A 4XMKH 4HLZG 4AENB 3VB9A 2Z35A 3A6OA 3LQZA 2Q76B 1HQRA 5EWIL 3BN9C 5JXED 1BP3B 1BZQK 5I1KH 1XF2B 1MFDH 1OALA 2ZKMX 4TOYH 1KCRL 4X4YA 5K59F 1YMMB 2YAQA 3SGDH 4XAWL 4XNQA 4Y5XB 3UZVB 3ZDZE 3EJZC 3D51A 4XCEA 3L9YA 3VXRB 3FT2B 3EXJA 1OF0A 4LEEA 2Y7MA 2DWTA 4QF1B 4QRFA 1BQRA 4QY8A 3S3BB 2ILLA 4IQHA 4WW2C 1QD0A 2O4EA 3DX7B 1Y18A 3U46B 3OZLA 3MMEB 4X4ZA 2HNPA 3EG9A 1VGKB 1GHFH 4JM2A 4GXUM 1P5UA 3C5SB 3O2WH 5HGHB 1QSZA 4TQHA 4P46D 3N1FC 5T1LD 3H85A 5EDSA 2ZG2A 2CK0H 4GQPH 1NPUA 1FYTA 3F7QA 1IGIL 1NMAL 1VGEL 3TJEH 4HJQA 1JXKA 1T1WA 3MCLL 3BP6A 1FSKB 5CEXA 1BBDL 3VYPA 4ZMOA 3AQXA 1BD2B 1PX3A 1D5BB 4OGXH 5DJ0A 4D7BA 5DMIH 2VM9A 1G6RH 5B1JC 3ARGD 1WIPA 2OP4L 2Y7QB 3CQFA 3HBQA 4OLZH 5C3IA 4YMPA 2BFVH 2R29A 1DO5A 3KGUA 1NGPL 3EOTH 1TQUA 2W0LA 4KU1A 1E30A 2FWUA 2VEWA 2BVOB 3ZDYF 2CHXA 3NABH 1KN2H 4Y9GA 4P07A 2E76C 3FT4A 3V52L 4UUJA 4R7DB 4Y5YA 5F1IA 3BUYB 4H44C 1S7UA 2WWKO 4LGPB 5IBTH 5ESQB 5FV1L 3V5HA 1P53A 4HKZB 4R5XA 4ZQTA 5MENA 3GSVB 3AS0A 3FQUB 5FWRA 1XBRA 3S96B 2Z6FA 1RIVL 1FNSL 5C0GB 3LAFA 5BS0A 2BRRH 5EIQA 4RSYA 2XIIA 4YHOL 4PGDA 2X4UA 4G6FB 1RXDA 1ET5A 1DTUA 4NQXB 4JPKL 5C2BL 1EDHA 1Y0LA 4DHLA 2HVKA 3Q48A 1KTRL 3FYIB 1YECH 3LN4B 2AEPH 5DSCA 4ETQA 2AEIT 3EFDH 4WF7A 4MCYB 3D0LB 3NG5A 1LD9A 3EB1A 2DD8L 3KGRA 1OGTB 1D7FA 5K9VA 3L4ZA 2A99A 4S1SL 5D1XC 5D4QA 4MQ7B 2QQLH 3ARED 4OGAD 5AAMA 2JMRA 1DJSA 3A6BH 1L6PA 1T6BX 2J8HA 4M5YL 2WAHA 4OR1A 2AANA 4WWNA 5C8JB 2ZCZA 5IQ7L 5AZEL 1RZPA 4G9FA 4B0MM 5IHZA 5H8DA 2NSQA 3CVHB 1YEKH 3SOBL 3KEDA 12E8H 2CRYA 1IIKA 2ITCA 4CN4A 4DGIL 5C0NC 3OXRA 5T3XL 3BC9A 4J3SA 3U4EA 3UTPE 1KIPA 1WQVT 5KSUA 5BV7C 4QAPA 4XWGL 3G3LA 2I69A 3WELA 4FFZH 5JHDD 2XXFA 1OARL 5T3XD 1X7TA 2B3IA 4F7MB 2WMPB 1DQVA 5FC9A 4O02L 2AJ3B 1CYWA 3RVVC 5D96C 3WS6C 3CVHH 1D2PA 3VXMA 5C6TL 2PPEA 4JFDE 3QS2A 2O93L 4EEEA 2WWOA 2JWYA 2J55A 2XG4A 4ECNA 3O3UN 2VXUH 3NA9H 5KVEL 1YYMH 3HUJA 1GKEA 1GYVA 1YPZE 1S7SB 4K7FA 3WV0A 4WU7B 5ICXB 5J9PB 5F44A 4LDOB 5FPIA 5KJRH 1MFAH 2BPBA 4HFWA 4O5LH 1E3XA 3W2DH 2F54E 5DR5L 2YPLE 1WFMA 3CJJA 3MLTB 2ZWSA 4ABWA 3EFOB 35C8H 1WCBA 5FW7A 3VG9B 2YEQA 4WU3A 1XGPB 2GTWB 1L6XA 1F3RB 3PJNA 5ESAB 5C97A 4X6FB 3RWGA 1DQLH 2QZ5A 1Z3GL 4ZUUA 3T2NL 3SD2A 1TEGA 3D33A 4W6XB 3EBGA 2GJPA 4TULH 2NOYA 3PWUB 4EKXA 3IFPA 1UAGA 5D72L 4POZC 5IFHH 4NIKB 1Q72L 2YXMA 1M9WA 3S3FA 5L2JB 1TEFA 1AP2B 3RL1B 4PG9B 1FZOA 2X05A 4CA4A 3VD7A 3EDDA 3NRSA 4UQIM 2ZXEB 2CO7B 2Y2TA 3CVCA 3L1OH 1F0LA 5LCVA 1IZKA 3M88A 5SWSA 2OSXA 4NM4H 4ZD3H 4IOSD 4NGHH 2OL3B 5FA4A 5L8KB 1H3WM 1MFBL 3B7OA 1K4DB 1FL6A 5JR1H 1H3VA 1BX2B 2M2DA 2Y1AA 4KQ3L 3ZVVA 1KC5H 1HOCB 1ONQB 1K5NA 2AJUH 1NDTA 3HLAB 3IVKB 5KVGH 1IKOP 3HFMH 3DYOA 1H5BA 1FA4A 3K2UL 3IU3B 3MLUH 4L05A 1OTSD 4P23D 1ACZA 1FHNA 1NGZA 1A6ZB 3A23A 3BEVB 4QUOA 5DEFB 3MI6A 2HKHL 5ACMA 5TGBB 3QFGA 4N2LA 1IMHC 1I3GH 2H47C 2BP3A 5H35B 3TO4C 4G6KL 1AGEB 3IWVA 3LZFH 3IDJA 3ZE1F 1JTTA 4U1HB 4XP4L 3PHOA 2PBNA 2D73A 4GUCA 2Z34A 5C92A 3BRFA 1U8KA 3MRGA 3DV4A 3WLBA 2HJKA 4MVBD 4HVBA 3EXLA 1QRNA 4FFWD 5D7LB 4ZOCA 2VDQB 3SYAA 4KVCL 2QZQA 4E9VA 4IKNA 5EHFA 1KBBA 3QPQD 4N2GA 4QHLB 5T3ZH 1BMWA 4HX1A 2JI2A 4PW3A 1NFDA 4RMTA 3WUZA 1W2KT 1J8HA 1VACA 3RPBA 1UKQA 3D18B 1OKEA 1ZT1A 3QORB 4N3UA 1RSYA 1DSFL 1TVBA 2V5RA 4HH8A 4NCDA 1T03H 4P2OB 4YHNB 4K9EC 2CR0A 4HFUH 4M43H 1X24A 4OV6F 2F53D 2VDQH 3L5HA 4IHBA 4A7QA 4BCZA 1HEJC 1X5KA 3RLSA 2E9IA 3H7LA 9PCYA 5GZOD 1QKZH 1E2VA 4N8CH 2C3VA 1IGTA 3LPOA 1B4RA 3VFGL 4N0UB 2B77A 1SOSA 1XCXA 2P5WB 4QTIH 4FQHB 3ROOA 3KD4A 4N2OA 2IMMA 3EBIA 3K8KA 4PJDE 5TF0A 5BQDA 4AMXA 2WXFA 2IBZY 4JGNA 2O30A 3S8WA 5I1CH 5JPMB 5IW6A 2HJLA 1HN1A 4ZQKB 4XNUL 1O5PA 1DVFB 3EHBB 4HUWA 2EC9U 4L4TE 4QOKE 2KERA 3IGAA 3UDWA 4Z3EA 5I71C 1RZKC 3L3OC 1FG2A 4P2CG 6PAZA 5D55A 1BGXH 4PLKC 2R4RH 1V8HA 4LCYB 2V2TA 3GBDA 3WHXA 2QV2A 3B2UD 2R0WL 3OMAB 1QTSA 3V4LA 2NQCA 3LJ8A 3VFPA 5A2JH 4M7KL 3IJHB 2J6EL 3MRDB 1FIGH 2BS9A 5ACLA 1AZCA 3V55A 4Z0XB 5DJ2A 4UM9D 3GSWA 1OSPH 2ZKXA 2BNRD 4X6EA 5A2CA 3NCEB 4CU8A 1IKFH 3GYRA 2OYLA 4FNPA 4JJ5A 3IMRA 2I4HA 1ZGLA 4WO4D 4NKOB 1NDMA 4HWBA 4HDIB 3AB0B 2Y69B 4YXLL 2CLVB 5CJXA 2Y1YA 3RIFF 3ARQA 2HTKD 4UQCA 4WSJA 5IVZA 5BO1H 1MCWW 1I1FA 2CHNA 4NKDA 1G43A 3NZ8A 5TE6H 1L7IL 3F7PC 5E6IB 5CJQL 4IRZL 2F1BA 1P15A 4H8WH 4R5TA 2E3VA 1J5IA 1F8TH 3ARTA 2XWEA 4J8QA 1AG6A 3MVSA 2HFTA 3VSTA 1OWRM 2WTRA 1MCPL 3O45A 4NWFA 2D3NA 2R15A 5EBLA 2XQBL 1I9IH 1OSEA 2H4EA 4LSUH 4UQAA 5E8DH 4G6ML 5DD0L 1ETZA 2ATKA 2BW4A 5HHOB 2FO4B 3RWDB 1T89C 1JGVL 2C1PA 3H9HA 4S2SB 5HHXH 1G7LA 1P9MA 3U1QA 3TEYA 4R9HA 3WLWD 3LB6D 2R56L 4TSBL 2IBGA 3QO0A 1UD2A 1M53A 4G7YL 3I6LE 3BLPX 5CGTA 5FUZH 4A2EA 3M1BA 4I3SL 1I1CA 4OLXH 4XOBA 2IADB 3L5XH 4OIFA 5DUMH 2P24A 4PGJA 1JMXA 1QA9A 5FV2A 4QPEA 5LNEA 3TVMA 2UZXA 3O4OC 3MYJA 3D2TA 6CGTA 2A3TA 4CJ1A 3O4SA 2ZONA 3FU3A 4HJTA 1R19A 2OJ1A 3Q9PA 3DBSA 2DOCA 4YDLB 2FJUB 3VD3A 4PJ7E 2DQIH 4WWKA 2EYSB 2YXFA 2BSDA 1HFUA 4X5WA 4NZUH 3BCFA 1AQDB 1S7VA 2UVEA 3H0TA 2WB7A 4X9YA 1N70A 3UPAA 2GWOA 2K45A 3GTTA 4GBXD 1VCAA 3V0JA 1GOGA 4AT6B 1TQVA 3QZPA 3SDDC 2R2HA 1ACCA 3VACA 3Q8EA 1UWXH 1NGQL 1T04A 3DA0A 3V8CA 5C0IA 4D3CL 2YGNA 4P57A 2EDQA 1AQMA 4K94C 3GIZH 5JHDE 5T3XE 3MU3A 3UYPB 1R9FA 4OBRA 1DBKH 5MHSD 2VXQL 1WA1X 2PR4H 4W93A 4BFNA 2C7FA 4LBAA 2ZPKL 2JB5H 1J87A 3P9LB 2WYZA 3FK3A 1U2CA 4WNQB 1SMDA 4N6QA 1QW9A 2Z91A 5C09D 1EGJL 1B88A 3S3PA 5BMFL 1G9ML 3SODB 4Q2ZB 4XPBH 1QLRA 4Y4HA 2PI7A 1P1ZB 3WIAA 1E8YA 3O6FD 2B0SH 2EIEA 5KVEE 4G80A 3QCLA 4NNYB 5FUOH 1JFQH 2K8QA 5F3HB 1CXLA 1GPOL 1XH3A 4XCYB 1JUFB 4GAAA 4X5PA 3WS3B 2IG2H 3WIHA 3POHA 3RVXC 2V2WA 3GUTA 3L5JA 4TMPA 1F6AB 4YAQA 4M8QB 2VNCA 3KDPB 4L5FL 2EECA 2WQVA 1QFHA 5J7CC 3BQUC 1E0DA 3VI3A 5CLXA 4BQ9A 4KJPD 4DO4A 2XXGA 5IJKC 3FU6A 3EYSH 2NY3C 1E6JL 4P48A 4HT1H 4XT1C 3ZTJH 1AOZA 3G5VA 2HCZX 3MX0A 5I75C 3G04A 4OCWL 4DPBX 2R0KL 1M7IA 1OD7A 1WISA 3VGAC 2E7HA 1G6VK 1EPFA 2A77L 3GS0A 1KG0A 4MXVF 5DHYA 4J4PC 3VD9A 4H25A 2COQA 4LHUA 4MD4B 2TRYA 2OQJA 1S8DB 3CPLB 1DBBH 5EIIA 3N43F 5FYKU 2DJMA 2GJRA 4OJYA 3HBPA 4R4BA 4AIZA 4E41A 2PP8A 2DQEH 3B6SA 1ES0A 2DQUH 2ZOLA 2H9GB 1CG9A 4NPYB 5CBAB 4NZTL 3KPLA 4YVUA 2RTTA 4HOMA 2EIZB 3SDAC 2BP0A 1WT5C 3OVUB 5CP3A 5SWZD 3D2UB 3ABGA 3PPEA 4ELMA 5CD3A 3QUKA 4KTDL 3B5GA 1J5CA 3L9BA 1BZJA 3UAJC 3NPZB 1TOXA 1XH1A 4NQCA 5AB9A 3LDBC 4YGVB 2Y6SC 1DBJL 1FIEA 5I6PA 1J0JA 1C88A 4RH5A 3FFCD 4TVVA 4Q9BA 3BPLB 5FKPA 2OA9A 3LQMA 4LAQH 4XR8C 4MXWL 1DZBA 4OCLC 3RIAF 2CGRL 3SGKC 1T5XB 3LZQA 2PCFB 1L7TH 1T0OA 2WPGA 4JBSA 3VFTA 3PGCA 3S3SA 3MGAA 4XC3L 2D7TL 1EEHA 3CC5A 3EDKA 5DRXB 2FT8A 2C7UA 4HPYL 4XMZA 1OEZW 4X5QA 3RNKA 2AXGB 4HWUA 4N3TA 3F7YB 2CO1A 4FI7A 4BQ8A 2OMXA 1IVLA 3WXWL 2NQDA 1T1XA 2J1WA 4KPHL 1HNYA 1ZLVH 1BVLA 3MUJA 3T71A 2R83A 5FECB 5F7YC 4F33A 1NFIB 1A6AB 4IOFD 4R7NB 4Y4FC 1MSPA 4UOJA 2I60H 3QDJA 4J27A 4KAQL 3LMJH 1WZLA 2BRQA 4P9ML 3WUWG 5A3IC 2JCWA 2JJUA 5E2TH 3CZUB 5E4AA 1MF2H 2A7BA 1FL5A 1ZLSH 2BSSA 1UG9A 4WZ9A 2IQAA 4LKXA 4F37F 4HRFA 2DIJA 1DSYA 2IH1A 2P28B 3LRMA 3CPUA 1LEIB 5K25A 5EORL 3FO9A 3CUPB 3DGGA 2X6VA 2F53E 3SJVD 1KEGH 2D03H 4WFHE 4PB0H 2O5YL 4JFXA 3NCFB 5CEYA 4M3HA 1DVTA 3N85H 1A3LL 2CRMA 5DJ6B 3TOPA 4FNSA 1FV1B 4G7VH 4LCUB 3ZMPA 2F19H 3OAZH 4XBGB 1HTYA 2KDGA 2XWZA 5C0CB 5LG6A 5LBSA 2CO6B 4HETA 3JWDC 5G4NA 3X1NA 1A7RL 1VFAA 4X4XB 4XMXA 3HI1A 2EXWD 1SUHA 2EIJB 2JKNA 5E8EB 4HJJH 4PVMA 1C5CL 4F91B 1CK0H 4PWHA 1INQB 5F93C 5FW6A 2APBA 2WLIA 4J1UA 4KUCF 2WP3O 1N0XL 1T0NB 4J28A 5E2JA 4GRWB 1JYWA 3AG4B 4Y16A 2O6PA 5D1QE 4L1HA 4OFQA 4H4NA 5TH2B 4YC2B 2AW2A 4K3HA 4PPTA 3D9CA 1S5HB 3IGLA 3IAQA 2WZAA 3G5ZB 5DUPH 4I3RH 5TPWH 1S7WB 3DUSB 1NC2D 1WC7B 2A83A 4MAUL 1KPUA 2HT4D 2BNRE 1HILB 3FSOA 5GRXG 3QI9C 2PUQT 4QXUH 3VXNA 4MBOA 1TFPA 3I2CH 2HFGL 3V7AG 5LGHH 4PJXF 2JCCE 2XV6B 3SYCA 3DO3A 1SEBA 5KS9A 3DKHA 4GI6A 2AP2A 4ZS6D 5F3FA 1F1GA 1DO6A 1ZLEA 1OW0C 4UTBL 1QSFB 5TE7H 1LDSA 3MCKA 2P5EB 4CC0A 4G8EB 3QEQD 3AM8C 3C08H 1OETA 4PH8A 5FK9B 1F90L 1AHWB 3S3CB 3MOZA 3K1DA 2R2EB 3RIFK 3BP5B 4GI9A 1GFYA 1W0VB 2BSRB 4H88L 2QQKL 2YSTA 4HEMA 3BSZL 3RWHB 4OLUH 4Y2DD 4K7PH 4WW2A 1LWHA 4EDWL 4Z77B 5I8KL 1YNLL 3ARFC 3EOAB 3U79A 4Y19D 3QZWG 2H6PA 2CBMA 3ARDA 5C07E 5IHBA 3RWCB 1ZT7B 2PYFB 3CDZA 3APFA 4MLSA 4TQIA 4EPSA 4HW6A 4ZOAA 3KR3H 3NJHA 3ZL2A 2DMCA 4IBZA 1DLHA 1AQHA 3FB8B 4KK5C 3VD2A 3TH2T 2GW5A 3H6JA 1TJXA 1UM5L 3QCHA 5IBUG 3FH7A 5B1JA 4GKOA 1H15B 5C0BB 4BSJA 5DJCB 4HHWA 5HP5A 4JRXA 5KAQG 3IXAB 4QHNA 4PJAA 1QLFB 4NZJA 3VFSA 1X5JA 3H42L 4MNQD 1S4IA 4NQDB 3BKYL 5M43A 4GRLD 3IPEA 1H3XA 4H1LB 3UFIA 3WFDH 5EEWA 1YLBB 1L9OA 4X0KB 3EZJB 1CR9L 2DIEA 1M3GA 2LV4A 2EE6A 1IC4H 2VLKA 4PS8A 3UBHA 3JV4A 4DPCX 4GAJL 1E8CA 1B4JL 2G60L 2FEJA 4M6MH 3LKNB 1RURH 4MDJA 1Q0YH 1OTUC 1PLAA 2B20A 3HG2A 1Z32X 3ZTCC 2I24N 4KRPD 4BH7B 2VRKA 1JG9A 4FG0A 1FGVH 3OKOA 3ILQC 3MRFA 1K8DB 3CSTA 3KJ6L 4FP8H 4FNUA 5GJTH 3VGFA 3GI8L 3IDYB 1MJUH 4U6YB 4GRWF 2GC6A 1P5VA 4P5TC 5C0EA 3BLKA 4YLBA 2RACA 1CDYA 1DR9A 2CUMA 2UUDH 3CQPA 5D1XA 1R24B 4YK4B 2WBJD 5IB5B 2VO8A 2FZ3A 3ARUA 4J23A 1ADWA 2H3NA 3JYBA 3BPOB 4GJTB 4N1CA 5DFWH 4XE0A 1W9XA 3BLTA 2C7SA 3I85A 2WLJA 3LRLA 4PREB 2ITDB 4TUKH 1TITA 5KVFL 4A7TA 3ABLB 3T8XB 5MHSE 4MXQD 1SXNA 2QDVA 2RB8A 3ULSA 2PTTB 3GO1H 1TTUA 1SPDA 3MLVL 4JFEA 5HI3C 3VCLA 4F8TA 4KHTL 2W92A 1THCA 5DK2A 3VFNA 3BUTA 1UD5A 1D6EB 4OLVL 1PH0A 1SFDA 4IKJA 1RH8A 3Q5YA 1G9HA 2JB6B 1S78D 3KH4A 4YR6B 3GMPA 4Z78B 3P2DA 3EFFA 1CYGA 1MW0A 4HUCA 5JDSA 5BQ7A 1F4XL 5DD5L 3CX2A 2C9XA 1EJFA 1XH2A 2VCOA 3CU7A 1JF1A 3BCDA 3KYOA 1UWGH 4TLSA 4PY8I 3O8XB 4PSRA 3RPIA 3WS6A 2J7LA 5BXFB 4HKBB 5MEQB 5EU6D 5JDJA 2BOBA 1CFNB 3CZGA 5GGQH 4LLYA 4AY0A 1BVOA 4IRSB 3D3VA 4ZPVA 2F58L 1IM9B 4XH2B 4L5FE 1ZV2A 5L4IA 2Q86B 3WO3B 4CRPA 4M8VA 3VGEA 5IB3B 1KCSH 3QVAA 3JWOC 4H26B 5GRZA 4R4ND 1LK3L 1RFDL 5HY9B 3QCNA 4K3EH 3DRQA 5DHVB 4CVMA 4TNGA 4XNMA 1J8SA 2E0TA 1TJHH 2ADGB 2AXFB 5KBPA 3WO4B 4YSPA 1KULA 3RFZC 3TM6A 4H0GA 2W07A 3BO8B 2WLLB 1WE5A 1DSWA 1PIFA 4TV3A 1OTTC 4WSGA 3UMNA 3ZTNL 3S2CA 4ZSOE 4NEHB 5K9JL 1DQKA 2CJUL 2GJ6D 3V8OA 3HG3A 2EO7A 1N4XL 3KG5A 5SWZE 4F20A 3ZKXB 4N90D 1E42A 4W9HC 3OHMB 4OLWH 4HOWA 5DHVH 1QBAA 1H0DB 2YMXH 3B2PA 2WXMA 5E2WL 1HU8A 4ZI4A 2H26B 4RNRB 1D9KD 2VH5L 3FFCE 1IEAB 2BSBA 1F5WA 3IU4H 5IHWA 2Z7YA 4EXPX 3TT1L 2BVQB 4H8VA 2ICWA 3D07A 5I1EH 3GSXA 4HIIB 4POUB 4HLEA 3QK0A 1BIHA 4N0CC 4JM2D 2GBUA 2XI9A 1DLFL 1VAHA 4LCVA 3X2QB 4HWEH 3Q05A 3JTBA 3B7RL 2QVFB 3EH3B 4KTYA 1R5VB 1IC0A 4JPWL 2H2SC 4UIKH 4PRPA 1DL7H 3V79C 3FTVA 2JV6A 3IBOA 5J57B 1W0WB 3RIAK 3OKNA 3LCYA 3D39B 2ZTBA 4TTDC 2WXOA 4LRNL 1S7RA 4Z8FH 1NBYA 4K5OA 5CP7A 3RGVD 5HHVL 4XOCA 3TO4A 4Y7MA 2EDXA 1L9MA 5GS2H 2J8UA 2W95A 3KCPB 2AXWA 1EH9A 1MPAL 4KX7A 1KV3A 4MWFA 3S3HA 4W1TA 4N5EC 1JGUH 2OMBA 2WO4A 3DSNA 1IIIA 3JT0A 3O41B 5IROC 2AJZA 4KVNH 3EADA 4M48L 3L95B 4DP5X 2WIMA 3BAJA 1EHKB 1CXHA 2OTUB 3Q2CA 4WTWA 3V6OC 1B2WH 1AAXA 7PAZA 4U7SA 2PYEB 4NM8H 5FYJL 3RY6A 4F37K 4KK6C 5DJDB 5FA3B 4XOEA 4Z7UF 1XGYL 5DO2D 1KCKA 5D2NB 3PGFH 2YPKA 3MJ7B 1H3PL 4P2QB 5DFVD 2WXJA 3JXAA 4UWQB 3N44B 3SGJC 3A6CH 1M1XB 1N0LA 4MJIB 3TBCA 1KGJA 3L2MA 3TYFB 2EXYC 4KKLD 2EUWA 3L9RA 2IWFA 3GB7B 2R0LL 4CU7A 2HT2D 1LE5B 5BUGA 4ZTOL 1N64H 2NNCA 5HHPB 1BPLB 1NCOA 3ZR6A 1VIWA 3AWGA 3RL2B 4EZJA 2OSLA 2FEEI 3AW5A 2FGWL 4FXLA 5EBWB 2DWSA 4L1TA 5F7FA 3U7AA 5CM1A 4KI5D 4HA1A 1KLFB 3OAUL 4AMKL 1LK2B 4XNAA 2GIXA 4KFZC 4NO5A 2IANB 1YAIA 2XNAA 3DLQR 4IOIB 3ET9F 4X6BB 2ZCHH 4J3WA 1QFWH 3OJVC 4WFGD 2WUBH 2AV1A 2FEEL 3QXTA 3RWEA 3L3OA 1E67A 1MHCB 4AZUA 1GJUA 1SN2A 2B1AH 3H6AA 5F9OL 2B2XL 2Z7WA 3TA3B 3VXMD 3MA9H 2AQ2A 3HAEB 3U7WL 1JK8B 3TC9A 3QBTB 4MBBA 2XYBA 4NO3A 3CZFB 1A3QA 4AVKA 3NAAL 3FMGH 2Z35B 3LQZB 4QCIA 5CJOL 5AVUB 5HI4C 2Y7NA 1YNTB 2DQFA 1MRFH 2EUXA 3QEQE 3GI9H 2XVBA 4ZN5A 4X4YB 3F7RA 1HI6B 2YBRB 4HD9A 4XNQB 5L7XL 5F88A 2CKNA 1HHIA 3SYQA 5TQ2L 3D4YA 4QY8B 1CIUA 2HA1A 4ZW7A 3HAEH 3GHEL 1ZLWH 3US0A 3ZM5A 4MAYB 1Y18B 4L0YA 4NN6B 3N50A 4OM0L 4OVVA 1E90A 3EG9B 4N9GA 3TZVA 1MCEA 3WE1A 1P5UB 5FHBH 4BKTC 4X8CA 5IVOA 3VXUE 3MRPB 3RI5F 3ZL8A 3NIFE 2GCYB 1CBJA 1FYTB 1V7NH 5CILL 3DETC 3SDCB 2NSMA 2WIIA 3Q6GH 3WFHA 1T1WB 4KDVA 3BKCH 1CLOL 1FFOB 1L4IA 1IGJB 2P44B 2WCGA 1TQBB 5DJ0B 1B0WA 2ZWKA 3T6ZA 3DTXA 4B9GA 1BZ7A 1JNJA 5JIHA 2P8MB 3V4VL 3QG6B 1PZ3A 2Q7NA 4XN5A 3GK8H 4CDGC 1MREL 2ENYA 3FU5A 5DMJB 4B9IA 4YDNA 1O9ZA 2Z4QA 3T6QC 2UZIL 4UUJB 1WP6A 3CK0H 5F1IB 2AJXH 5HYIA 5ISZB 3V5HB 1ILSA 4NENA 1B4LA 2BINA 5MENB 2VW7A 5L4FA 1PKQA 2ZD0A 2Z1PA 2R29H 4JKNA 1KPVA 4OUOA 4WUKL 5BS0B 2KDYA 4K23L 4PGDB 4LVNB 2E75C 3LNDA 3C6EA 1MFDL 1A2YB 1Y0LB 3HI6H 4U1GB 5TF1H 3JV0A 4LASH 1UH2A 3MJ9H 1CE1L 4FL4B 3VH8B 4TNWK 3B8YA 5IMOB 2EE2A 3GBNL 5CEZD 2HT3C 4ETQB 5DSCB 1CICA 4N1EA 1A6TB 3OPZL 1LD9B 3R8QA 4KKQA 4G9DA 1QABA 5LGJA 2J25A 4BXSV 2B1HH 2CBQA 4CADB 1GSKA 4ZMWA 3UG5A 3IDXL 1VADB 3SGEH 4MD5B 1JZIA 3AU1B 1Q9LB 3C87A 2BHYA 4PSPA 4WI4A 3S35X 2CK0L 4JBCA 3SDDA 4G9FB 5IHZB 3AT8A 3ROLA 3TJEL 4OZIA 1J8HD 1I9EA 3RRQA 4LCCB 2H3XC 2ITCB 5I30H 4JZJB 3B7TA 5KVFE 1U92A 1OVZA 3OXRB 1HQ4A 5DMIL 3DPBA 1G6RL 1KIPB 4ZAKC 4OLZL 1J9TA 4KMLB 2BFVL 1MFNA 3B3BA 1ZGLM 5IVXA 4PJHA 3ULAB 4G70B 4ODHL 1KN2L 2HRPH 1K8IA 1ZHBA 2OJEA 1FVDA 5D8JL 1GCYA 3BAEH 3S5ZA 4X7FC 1XMEB 5EU6E 2NZ9C 1EFXD 5JHMA 5IBTL 1U0QA 3CLEH 4PB9H 8FABA 2R2BA 1LEGA 3O3LA 3L9EA 1G7FA 4YSRA 1C16B 2XG4B 4GXUN 1Y7VA 5B39B 4FRWA 4N5UA 4C83A 3WMQA 1F1AA 4NLHA 2D2OA 4U05A 1MN4A 2BRRL 5F6IB 4K7FB 1OAUH 1ORQA 2XVGA 3A21A 1CYXA 4JM2F 3N41B 5DD3H 3UX9B 5AWNH 2HJFA 4NCC2 5HHNA 1MCSA 4U1NA 2AEPL 1W78A 1WCBB 2BZ7A 3BQUA 1CO1A 3U1PA 4AIEA 4B27A 5K33A 4Z7VB 3RWGB 3ZE0F 5IJKA 3JZ7A 4YGAB 3K0YA 4F7KA 4NN5C 5IF0A 3VNYA 1V27A 1WWWX 5TDNA 1W91A 2BVEA 1IC7H 2WLKA 4YVNA 1WS7A 2WB1A 2WWMD 2GJ6E 2QEJA 4KUZL 1MCCA 4N90E 2E9GA 3UCQA 4J4PA 4XP9H 5SWSB 4JRYB 2VXVH 1INDH 2R1WA 4MA7L 5K9WA 1IAIL 5FA4B 1NBZB 5KANI 1TPXB 1JPFA 4JLRA 2JK5A 1OM3L 1FL6B 3SDAA 1A9BA 1WT5A 2G30A 2VQ4A 4NFCA 4Q4EA 3S36H 3BVXA 4AUYA 5E9AA 4KNUA 1N2RA 5E2VH 4EN3D 4N1HB 1BVKA 1EDQA 2NDGA 2XVKA 2GK0A 2YD5A 3UAJA 2JIXA 1JAEA 2OS7A 1H5BB 1KCLA 3CX5K 2QVTA 1HAUA 3GLZA 2IQ9H 2EVIA 5BOPA 1QBML 2VUKA 3ZE0E 3ULVH 3S37X 2EH8H 1U91B 4PTTA 4AE0A 1RPKA 1NGZB 2Y23A 3NA9L 5CR8A 2HAZA 1YYML 2Q05A 2Q0ZX 4AQ1C 4DOHE 2VABA 1KTJA 1CIDA 3Q0HA 1MFAL 3ILDA 1UENA 4O5LL 3UC0H 1R5WA 5FX3A 2AHSA 1ND0A 3MR9A 2FQFA 3UMTA 3WAKA 2J20A 4ZOEA 3ESPA 4ZZFA 3KVPA 4KI5F 35C8L 2JVUA 3ZRCC 3MRGB 3V7AE 3HB3B 1NOAA 2HJKB 2VOSA 5EHPA 1DQLL 1QRNB 1CDGA 1F58H 1GAFH 4FZEH 4Y4FA 1FUNA 5T5NF 1GS6X 5BZWA 5ID1A 4TULL 3VX0A 4GRMA 5E94B 2Q5BA 2QVIA 4HX1B 5EU4B 5FYLL 1QW8A 3VVWA 1XXFC 4Z7QB 1NFDB 2KH2B 3KPNA 1VACB 2IIJA 2HZHA 3D48R 3QO1A 4XMLL 5K9KB 1OT4A 3OLEA 4KHXH 1X9LA 4FJYA 5FYLD 1ZT1B 4J3XA 1RVFH 4WKZA 3X3FH 1GS7A 1IE4A 3L1OL 5FYJE 1TVBB 3ZL1A 2JELL 1K4CB 3MNMA 2SHPA 4NM4L 2VMCA 2DLIA 3CZSA 4ZD3L 4NGHL 4PJ9C 2DWDB 4ILDA 1CF8H 1PX8A 1V55B 3DIVA 3KPPB 1Z5LA 4MQTB 5KA4A 4WWKD 4AVJA 1PTZA 1V3AA 5E8PA 1SZNA 3HUJF 2C3VB 3ECWA 2VLMD 3TN0B 1KC5L 1XF5B 1MW1A 1NKOA 4I48A 1RV6X 1YN6A 2IWEA 2X4QA 4RCAA 5AVSB 3PFUA 3QQ9D 1PQZB 1RJZB 1A6UH 2AQ3A 3ROOB 2BVPA 2VYRE 4NUJA 3MLUL 4V2BA 3RA7L 1XCTA 1AZBA 3D12B 2OSYA 5FOBB 3HS0B 1KGWA 1WUNT 4MMZA 4PJIA 4ICXA 3TCLA 3S8GB 4NXKA 2YGVA 4RGMC 4DO5A 5D1ZC 4P2RD 5IW6B 2HB0A 2HJLB 4JR9H 4U0RB 5D93B 1CI5A 4HUWB 2ARJB 5JLZA 4WFGE 2QQNL 1H6UA 1ID5I 2RD0A 3IGAB 3LEVH 3FDWA 3NFNB 1FG2B 1GZPB 3AG3B 5EZLA 1XV8A 2A2QT 4BFIB 4C56A 5I76A 1FNEA 2Y22A 1ACXA 4JCLA 2CNFA 1KBKA 1E8WA 1AR1C 2AABH 2WXGA 2V2TB 5CJ5A 3I6KB 4OCRL 1DEDA 2DRUA 2BC4A 4PI0A 3QKQA 3QNXA 4LP5A 5KVDH 4E0RB 3ULVF 5AL8A 3VFPB 4Y4HD 5K9QI 4PS4H 2CMRH 2E0PA 4DEUA 2MNWA 1QFOA 2XKNA 3ESOA 3GSWB 5T3ZL 4EAEA 3QI9A 3THMH 5FB8A 1KPRB 1XB8A 4U6HA 3ZTJG 4JJ5B 5EOCH 2QGEA 4YO0B 3OWRA 1C86A 1J0YA 1ZVSB 1KTDB 4FKKA 5I1LB 1NDMB 2MOVA 4H8QA 4WLCA 1CFVH 4ANKA 5BX1A 5E9DD 3AVEA 1T03L 1G1YA 4LSVL 5AVTB 4HFUL 4G6AC 3L3GA 4WUUA 2NSXA 2X2UA 4OI9A 4XN1A 1VFMA 5IVZB 1I1FB 2LU3A 2WGXA 3QDAA 4NKDB 2NXZC 3HPLA 4IDJL 4N8CL 3NZ8B 3HLKA 5F1KC 5I18H 5D5ME 4G59C 1BWWA 2AK1H 2J4WL 4MDRA 1ORSA 2G4EA 5EBMB 2XN2A 4A2GA 3QFDA 4AM0B 3ARFA 1Z9SA 3V0EA 2NY2D 2WTRB 3VI4E 4P4KC 2LOEA 3O45B 4JHBA 2Z3FA 5HI5D 4N6RA 3IJSA 4IK7A 4OKVB 4PU2A 2ZP9A 5EBLB 4BKSC 3LIUA 5AW6B 4WK0B 5J0BA 3ASWA 2C26A 4WEMB 5IJCC 1VENA 1OEUA 3AS3A 2ERJC 1ETZB 3U25A 3UCRA 4NZFA 1BFVH 1I1YA 4FNTA 2PWGA 5B3JF 3LNHA 1T1YA 3H9HB 2ADJA 1AE6H 4BV1A 1FQ1A 2FO8A 1DQJB 3ESNA 5D7EA 5ERWA 3ATFA 3FFDA 1MLBB 2FIKB 1RD6A 3L3KA 2GSGA 1WHOA 2ED6A 5G4MA 3TFBA 3TX4A 4IIZA 3G7TA 3C60C 3CV5A 3F62A 3QO0B 3LS5L 1E5AA 4HF5L 4PRNA 4TQPA 4MSWA 3MLWH 1EHNA 3PLYA 1NEUA 5C6PB 1OSPL 2VQUA 1HCYA 3CDGB 3MGOB 4L23A 1HSBA 1A0QH 2K9FB 2UZXB 3RVTD 2C9AA 3BVVA 3RGHA 3TVMB 3MYJB 2NY6C 3UTQA 1TENA 1UGKA 3K2KA 1CLYH 2VZSA 2NUPA 3VNZA 4RKKA 5DS1A 3K6SA 1IAMA 2OLDA 3ZIMA 2DL2A 1GGYA 1ETB1 3L5WA 1YQVL 3OHXA 2HTLC 2VZ1A 3L8QA 1T4KA 4E42A 4ZFFA 2CBOA 2BIOA 2I9LB 4L37A 4YDJA 2Z8VC 4Z7OE 1E5BA 2R9HD 2YQGA 4LKCA 2QV4A 4X6CE 1UVQA 5T1DH 3MROB 3SSGA 1W15A 2J6WA 4G7SB 4OZGA 1LP9A 4Q56A 4WI2A 5HD8D 4N9OB 4P5TA 1UOWA 1GH7A 3VJ6A 4BFBD 1YMME 1G1CA 4WQOA 2BVTA 1XBDA 4ACPA 2X6CA 4AIOA 4P57B 4L3CA 2CU9A 1T20A 4IBYA 1CT8B 1GJWA 3KPRB 4V11A 4CMMB 3KYMA 1I9IL 2F68X 5E8DL 3L81A 3CFUA 1A7NH 1QTYT 1XZ0A 5FYKH 2X87A 2QTVA 2G6ZA 5HHXL 3HN7A 4XMVA 5KBLA 3EYVA 1ADQA 1NKRA 3H2WA 2JLPA 5L9DH 3CHXA 4KZDH 4QRQA 2HSIA 1D5ZB 5E4EB 1OV8A 2I25N 1RJLA 3ESVF 4OB5H 2EDWA 3RU8L 1QLRB 4I0KA 1SNRA 2V8LA 4JDVA 2GIMA 3BAWA 5ACZA 4D9RD 4NN7B 4WHYG 4S0GA 1E9QA 1AC0A 3B2VH 1BD2E 1PIGA 3F12A 1T6VN 4ZUWA 3RP1A 3ZBMA 4OLXL 5JUEL 3Q2LA 4G80B 1KJ3L 2VITA 4UT6H 4Q9RH 3CX5J 3F6JA 2BW5A 3GUTB 5I19H 3E7JA 3KVQA 1PD1A 4MA1C 3WOVA 4YAQB 2ID5A 1BYOA 3BDYH 1YRKA 4PRIA 2FTAA 2JKRM 2FIRT 2I4GA 2OMTA 1SLWA 2FE0A 3NCMA 2YSSA 5TJWK 3GFUA 2CR3A 4ZRTA 3TL5A 2C1OA 3C5ZB 3ZYOA 4AYMC 4HSCX 2DQIL 5KZCB 2H6OA 1UC6A 4JHUA 2YWZA 2C5DC 1S3RA 4NZUL 4Q6KA 3G5VB 3FRPA 1MCWM 3S2AA 3G04B 4YQXH 1RPUA 5FDWA 4RBPH 2P8PA 4WEUD 1M7IB 3EGXA 4FXKC 1CGTA 1IAKA 1CDJA 1XIWB 3V4PA 2CH8A 1LGVA 1KG0B 4TSAH 3UTOA 4H25B 4LHUB 1FZKA 3KBPA 1QYGH 2E86A 2KC0A 1BA9A 1JWSB 3GHPA 3RFZA 4E41B 4NWUL 1ES0B 2ZOLB 3GIZL 3DMMB 3KPLB 2WKLA 2JKIS 2BP0B 3QJUB 4ELMB 3GZQA 5CD3B 3V7MA 2DWEA 1MI5D 2PR4L 3ZDXB 3NGBC 4YL9A 3EJZD 3N91A 4NQCB 3U4BL 1E7UA 2JB5L 4FADA 3PXHA 4CMHB 4XN8A 5KA0A 3D25A 3O3EA 1CS6A 3VFOB 4DGYH 5FKPB 3NH7L 4XPBL 5EFIA 4Z7WB 4WY7H 4UDTB 3KPTA 3MNWA 2B0SL 1IC5H 4KZ0A 1TUPA 5CP3H 3PGCB 5FUOL 1JFQL 5AG8A 1B3JA 2WKOA 4QDIA 4J2XA 3KXFB 3QUYB 3I9GL 1A6VL 1E43A 5E51A 1AKJA 4KJQC 5F7BA 1U8CA 5F3BB 1U58A 4A6YA 5K24A 4KOCA 2UY6B 2GTZA 2ADIB 4WTYA 3KWTA 1J7VR 3WBDA 2NY1C 4QRRD 2OMXB 1PCXA 3BVDB 2R59A 3LRSA 3MUGA 4DEWA 2L7UA 4F33B 1ZKAA 5CU5A 2H1PH 1I1RA 3EYSL 1I9RH 3FO0L 4XMPH 4DVBA 4JRXD 5CN2A 3QDJB 1ZXKA 2Y2YA 1MVYA 4ODBD 3MXWL 4UU9A 3SPVA 5FUCC 3X13A 2R1XB 4HYTB 1YEEH 5FCUL 1MFVA 3ES6A 3U6RA 3G5WA 5DD6A 3MFFA 5C71A 5FYLE 2BSSB 4H1LG 5J89A 1ZANH 1ZCLA 3TO2A 2ZUWA 3UIZA 4FA7B 4HJPA 1FO0A 1YSOA 4XVJH 2WVTA 3CFBA 2G59A 2IH1B 5IROA 3FO9B 5IM7A 2VDKB 1ZE3C 4JANA 2QADB 3TJHD 3VWJC 1NMBL 1OT1A 1KGXA 1NGXA 3ARXA 4JFXB 4FFVC 2OCFD 4R0LB 5CEYB 3DXAA 7CGTA 4M62H 5BJTB 5D6CA 2VLME 5DQDL 4JY5L 1PCSA 4JZOA 2F8XC 3HZMA 1M57B 2VJXA 3QUZA 3UADA 1E27B 4MASA 3DSFL 4PVLA 3SGJA 4HEPA 5AW2B 3Q6FB 1VFAB 3OB0H 3NZSA 1KLGA 4LARL 2VDKH 2JI3A 3P3YA 5DVNA 3VI3F 4XX1E 4LAQL 5D1XD 3VG0H 1UD4A 1H8NA 4P2RE 2WLIB 2M1KA 3FL7A 1AZRA 3ATAA 4J1UB 4DGVH 4UI2A 3EUDA 4YHKL 1T66C 4JM4H 1N5YL 3O6LL 3E8VA 4Y16B 3ZKQD 1I85C 1CTMA 3K2MC 1JZGA 2FLMA 2MHAB 5C0ND 1M9SA 4JFED 2VZ3A 4ONGL 5DRNA 4QTHA 1ZVHA 2PCYA 4NP4L 1J8RA 4L8SC 3S7GA 1QATA 2EVGA 2Y2WA 3NZHL 4F24A 3IMWA 3CFQA 1KIQA 2A83B 4ODXA 2I60L 1KPUB 3LMJL 1A7PH 1LLAA 4CC1A 1Q1MA 3H9SB 1SGKA 25C8H 3MJWA 3QT2A 3QPKA 3VXNB 1F02I 4NT6A 1A5YA 5GRWA 1MF2L 4BWWA 4ELMF 1CL7I 1C7TA 4O00A 1ZLSL 2FX9H 5T3ZE 3NBNA 4LE8A 1I8KB 5KS9B 3D06A 4NIYE 3L13A 5E9DE 4FEIA 3A22A 4BEIA 3VTTA 2BOLA 5D2LB 1RY7B 4GG6A 2D03L 2DH2A 2N7AA 3GC3A 4JY4A 3MCKB 2QJDA 3N85L 4PI2A 4DP4X 1ZWIA 3GLDA 2P6XA 2X4PA 3SY6A 4J3OH 1KBGL 4NRZA 4U1SA 1UJTA 5E8OA 5BOJA 4G7VL 1ZV5A 5GJSH 1F4YH 2E6PA 2EICA 2I7OA 4P46C 1MWAA 2CM3A 2EINB 1PMYA 1RCYA 3OKKA 2EH7H 2H6PB 3ARDB 3FUKA 1Q94A 1P6WA 4HJJL 2ICWI 2WN2A 1A47A 1M3JA 2C4XA 4JO8A 4IRJB 4JDTH 4LLUA 4Z0BH 4JHWL 4RQQB 3ZN6A 2X4RA 3LZOA 3VXQB 4POZD 2D7MA 1OSZA 3H9YA 3NCBB 4A67A 1L8KA 1HH9B 4PD4K 1FPRA 2VW6A 2OULB 4F1SA 2P5WE 1U8HA 1I4FB 3TASA 2I7SA 5I6XC 1H8LA 3F41A 2OMZB 4F93B 4HP5A 4I3RL 4JQIA 4PJAB 4QHNB 4JPVL 2JE8A 3V6FB 2BFGA 4NQTA 4EZLA 4PY8J 1KJ2A 4HWZA 3VFSB 2DZEA 1YYLH 5DEGB 3Q43A 3EIFA 1CDUA 4YN3A 3UAGA 3L6FA 1E28A 1GGUA 4KROC 4OJAA 3GM0A 3F7VB 2LFEA 4XP5H 5HJDA 1JDCA 1UXLA 4XCCL 2X3BA 1I31A 2FSDA 3I2CL 4JL1A 4P2AA 2AGJH 2B39A 2VLKB 3SYOA 2J73A 2XTLA 3JV4B 2G75A 2ZICA 4AEHL 1T80A 3FF8A 4ZX6A 1CLZL 4K8RL 2MCMA 2XG5A 4MDJB 3ZYIA 1U24A 4X9GA 1TEYA 5GGUA 4IKCA 1Z5HA 1OP9A 1KJMB 2VQ1A 4P5RA 3Q8BA 3TO4D 3C08L 3CDCA 3QHFH 4K8RD 2CNEA 3KWXA 3MRFB 2WANA 2X12A 2R8SL 3UYRH 4OGAC 3IF1A 5L0QB 5IMLB 4F2MA 2K7PA 1R33A 4I18B 4JG1L 2DTSA 3A67H 4LCWA 4OLUL 1P5VB 3UGXA 1ZHLA 3T3MF 1E4WH 2RR3A 4OJCA 1O6VA 1YVLA 3U36A 4OJDH 4FG2A 5ADPH 2FZ3B 3BN3B 4FXGB 4DW2H 4MQSB 4OM1H 4UMSA 4JE0A 3PYZA 3LVTA 3P3TA 3DTDA 1DN2A 1ZGLP 1TZGH 4OCYH 4ZPTA 3QKPA 3ULSB 4C59B 2I6JA 2P46B 2M26A 3B5TA 1L6ZA 2WWKT 3NJMA 4JFUA 3VCLB 4TVPL 4ZFOA 4NUGL 3L17A 4JFFA 5DK2B 2BCMA 4ZAKA 3O6ML 5BCAA 3EJCA 3MNZA 2AMUA 5HDLA 5JIDA 2AK4D 2AEWA 4GG8A 1N18A 4JFZH 4TVPD 4D9RE 2BVUA 4YBLB 1SY6H 3EFFB 5FF6A 5F7DB 1DQDH 4I1NB 3QAZC 5BQ7B 5JDSB 3L08A 5I73B 1LO2L 3U6XS 3KYOB 1JF1B 5INDB 4WK2B 4WHTA 4KTEH 3RPIB 2DMBA 3F5WA 1QASA 1NWPA 4UQ2A 5AEAA 1ZCRA 1DQQB 5D70H 4WV1C 2WZ5A 2D7QA 2GUOA 4LLYB 1YEFH 4DZBA 3K6OA 3KNBA 3FUEA 2F18A 2KPNA 4G71B 3D3VB 4U1IB 4ZPVB 5DWUH 2NY0D 4WW2F 3BFWA 4ONHA 3BKJL 2WTZA 3UTTB 2A6DA 3LEXB 1RURL 3OX8B 1DBAH 1Q0YL 4GUQA 1C8PA 3QJOA 3RDTA 1DHKA 1F97A 5ETUA 1FORH 3HRZA 3OJ2C 3ZKSD 1FGVL 2EACA 3DVGB 5GJTL 4LDLB 1FFNA 3DRQB 2NLJB 2DI7A 4G43A 2FJFB 1E3FA 4F15C 5EZIH 1E5CA 3MREB 4PLKD 5AOMA 3STBA 5TQ0H 5CUSH 4PBWD 1WD9A 2W07B 3HAEG 2YR3A 2NY5H 2CM8A 3I50H 4XWOC 4HJGA 1D5IL 3B2DC 2CNYA 1QAWA 5HTSA 4HCRA 5AD0A 3T77B 4CVWA 1OAKH 3J8F7 2ODIA 3EDEA 5AYQA 1MI5E 3L4YA 3GO1L 1NGWA 4G8GD 5FCSH 3SBRA 3RFRA 1BECA 4HHGA 1XSKA 1T3FA 4O9HH 5A2FA 4LSTL 3E1F1 2Z9TA 4ORZC 5HDWA 2OW7A 3WNNA 1HKFA 2ICWB 1DJWA 4GFVA 1EEUA 3QIUB 3R06B 1U6AH 2BM3A 4P23C 2ZXDA 4UILL 5FFGA 3N3EA 2DKSA 1J18A 2CHZA 1RI8A 1HKLH 4PRPB 1MAMH 4CVXB 4EMZA 1CD1A 1AI1L 3FOLB 4G5ZH 5GGQL 4QRRE 4NZRH 5E00A 3OKNB 4V33A 1Q1JH 4BINA 2OK0H 3QIBC 2DV6A 2HN7B 3D69A 1NCAH 2OAAA 3UEZA 3SBQA 4AQ1A 2O6FA 2P8LA 3N40F 2CCLA 4U6XA 4E5XA 1ZEAH 1KCSL 1LO5A 4XXCC 1BQHA 2BP5M 2KI6A 4I5BA 1LO3H 1KYDA 2J8UB 1MCHA 3BESR 4MVBC 3VXPA 3QQDB 4Y4KC 3CIQA 1OCZB 3QXVA 4MWFB 4AV5A 4F8NA 4K3EL 3N06B 4H5SB 2IAMC 5DVLA 3QPQC 1HYSD 2WC7A 1TJHL 2GUYA 1ZY9A 2ZSWB 4I7ZC 3OV6A 4OGYL 4Y5VC 5E8NB 5FO9A 5LKNA 3ULUL 4BK4A 1KJVB 1VSCA 4KJWC 5EBGA 1N6VA 5HYFA 3WGVB 4HWNA 3TONA 2AJZB 2SEBA 3C09B 3ULUD 3V6ZB 3HPJA 3T8MA 3MV9A 3K4DA 5ALCH 1SHWA 4PGEB 1TJMA 1KT2B 4RMQA 3MLRL 5T5FA 1RUKH 2CKBH 2X5PA 1S3KH 4ABVA 3G6JB 5IBSA 5CZVH 5I1AA 1EENA 1WUZA 3W9EB 4OLWL 4HUXA 3AWFA 2YPKB 4PRDA 3FOMB 4U1LA 1JRHH 3VH8G 2FWOA 2YD6A 4XRCA 3QEGL 4E9RA 5GTJA 4PJ9A 4OUUA 1N0LB 3U2IA 2WXRA 1KGYE 2A3KA 1OGAA 5D1XE 2E4TA 1ZA3A 2GBTA 4AUUA 5IJVA 2UZPA 3GMNB 3T0WA 4B50A 4NNPH 3MBED 1A5FH 3NDYE 1N8OE 1FNHA 2B07A 4UIKL 3SDDD 1DL7L 3Q1SL 3A5JA 4Q7DA 4BZ1A 4K94L 4K9EH 4YHYC 2GJZB 4DKFH 2AV7A 2ENPA 4DESA 2RCSL 4FOMA 4HSQA 5D1QC 4NFDA 2GC5A 1PG7L 2JXMB 5DZLA 3WFBH 1JV5A 3GIVA 1FRGH 3RVWC 5FO8A 3BLUA 2XZAH 2WOYA 4R97C 1ZOXA 3DURA 1HL9A 3RWEB 1WD8A 3L3OB 4PD4J 4YDKH 5EN2A 1Q6TA 2I6MA 5EDXA 3SKJL 3O0RL 3VAEA 1KFAH 4HMEA 2NY7L 1ITCA 1EANA 4RX4A 3SPGA 3ZV2A 2BOCB 2YAPA 4X5XA 1NOLA 1C5DB 4NO3B 1QPPA 1UZ8A 4ZMPA 4KVNL 4GLRI 2YD4A 1UACH 3S5LB 5B39G 4ABQA 2W60A 2DQFB 1B0GA 5DC4B 1G7HA 2F74A 3PU7A 4PS3A 3B3IA 3EGDA 4LXFA 5GIRA 1RZKH 3POCA 4XPGH 5F88B 3MRNB 2PXYA 3RVXD 5D7IB 3PGFL 1TTFA 2AZUA 4QAMB 2GKIA 3C9NA 1KCWA 3QQ3A 3I80A 1NOFA 3WKYA 2UWEF 2FHCA 4KRMB 1SMAA 1J1XL 3DOSA 5I5RA 4B5ZA 3TZVB 2NY3D 3SKNA 2ZWLT 2ZUVA 4R2GB 2ZYIA 4FG6D 1VZGA 1DJYA 4JFHD 3UTSD 2FX7H 5TFSH 2VN3A 3QRFM 5H37A 1OPOA 2X4OA 3DK2A 4UCFA 1MXGA 2ODHA 1EVUA 5BPPA 1WAEA 3O3AA 5ES4B 2DLFH 3BD3A 2KLSA 3MRBB 3UPRA 3QB7C 4J4PD 2WBKA 4TVUA 1CPUA 4P4KA 4NWGA 3K7UA 1SVBA 3DTXB 2I5XA 4HQQL 4AX3A 1RZ8A 3QEUB 4QT5A 2YXVA 3LXUX 1ASPA 2XQ0A 3LB6C 2ZCHL 3OLIA 1QFWL 4LPYA 1TIUA 4E9LA 2WUBL 4AYGA 3SO3B 5BRQA 5C7XH 2QFPA 1S5IH 2B1AL 4BXVA 5BUPA 1R0AH 2JJTC 3OB0K 5KA7A 3CHQA 1BZ9A 3B1TA 3CH8A 2Y4SA 2UWEE 1JZ7A 4DP2X 4H0LC 1KPVB 1XB6A 2HC1A 2EDTA 1FJ1A 3DJSA 3FMGL 4TN9A 5K39A 5I8CA 1AHMA 4BPCA 3KWWB 4XX5A 1MRFL 4B3EA 2DN7A 4JJHA 4TLKA 1EAJA 3O4OB 1AZVA 1DQIA 3A3YB 3W5MA 2IDSA 3MCYA 2W0FB 4NBZB 1U8IB 1EMTL 1NUNB 1BQUA 4JEGB 2FHBA 1NIBA 1CICB 3CC1A 4HK3N 2R1YA 3P1VA 4G9DB 2ZYSA 1V3JA 1MLCA 4DKEL 4MJ5A 5EF3A 4MNHA 5I8OL 1J9QA 1KBVA 4GQ9L 5JPNC 3MJGX 1BREA 2XU9A 3ZO9A 3JV6B 4I2XB 3S88H 2K4AA 3EYFA 3VXSB 4U2YA 5A3ID 1QSFE 2H45A 3ROLB 4GKSA 4Z76A 5DWPA 4OZIB 2BS71 3L7FA 1JNLL 1LHZA 1QPKA 1U92B 5IY5B 3AABA 2ZXAA 4ENEC 1HQ4B 2IFFH 1BJ8A 3OMIB 4IMLA 1IGFH 4JGUA 3MSPA 5DURD 1OP5K 1TFHA 5EF2A 2AK4E 1I8IA 4APQC 1MHEB 3QJRB 3SE9H 4TVPE 1JXGA 3T08A 5IVXB 3OF6D 5JIIA 4PJHB 2X2YA 5CSZA 3BQVA 1CBVL 2XFGB 3GK8L 3QRGH 4NP9A 4HBCH 1DYZA 4YZWA 5DK3A 5I74B 1FVDB 5CBEA 4P06A 4LCIH 3QUXD 4QRSB 1I8UA 3JWDL 3CK0L 3CGTA 2APSA 5L88H 1PLBA 3MRKA 1R3JA 3T0EC 2R2BB 1HH6B 4KBPA 2WCSA 4C83B 4JFDA 5HDQH 3LQAC 4K5NA 5A2BA 1RZ7L 3F04A 3HMXA 2ZN7A 2V9RA 4GSRA 4JFPA 3LNEA 4L9LC 1ORQB 1N8ZA 5DVOA 5CKAA 5GXBB 2DQGH 4L0ZA 1IFHH 1ZDSA 3HI6L 5TE4H 1YPZA 2EC9T 3KWUA 5A6MA 3D85D 4LASL 2HJFB 5HHNB 1JD7A 3MJ9L 5JOEA 5IB1A 2FYYA 3RWIA 1SBSL 3I84A 1MH5B 2QELA 3BQUB 4U1NB 4C56D 4YPJA 2F54A 2P47B 3OKLB 4GUPB 2YPLA 5JIMA 1I75A 4ZUVA 4PJBA 5IF0B 4X9IA 1AIZA 3S8FB 5TDNB 4OF7A 4XCFH 5J5EA 5I75B 4RMBA 1BCIA 2MSPA 4FQXB 4LSQH 1N5AB 4A68A 4FXKA 4BJOA 4PG2C 2LTQB 1AGBB 2DMGA 3CSYB 2WVVA 3GSNL 2JSFA 1PS3A 1UA7A 1HX0A 3QI9D 2XX0A 3QZBA 1KB5A 5I30L 4G8GE 3JVGC 2R1WB 2FQGA 3MBWA 4AC4A 3SPHA 4ONFH 5I0XA 1SDDB 1A4AA 1JPFB 4JLRB 1JNHA 4OF8A 1I1AB 4ZUSA 2CO4A 2JK5B 4WUUD 3SDAB 2FX8H 1CWVA 1A9BB 4NI3A 4GOSA 2XUWA 3G08A 2ZUTA 3BXNA 2NXYB 1N2RB 4XNZC 4Z95L 1T7WA 5IHLB 2CNGA 3BAEL 2JIXB 4MKTA 4UOW0 2FH7A 4NKMA 3CLEL 4K71B 3QUMA 2NY4B 4IS6A 4UQDA 3HE6C 5FAAA 2GITB 1DQML 3B56A 2OJZH 4YE4H 3ARFD 5JO5B 3FSAA 5CLWA 4J39A 3LH2H 5AAPA 1ESOA 2B59A 2PMZA 3K6DA 3CMGA 1V3KA 2A73A 4NX8A 2VABB 1OAUL 1LDPH 1QUNA 4UAOB 2CD0A 4JKWA 3QG7L 1RUMH 4QYOA 1R5WB 4Y2LA 4JNBA 1ND0B 3MR9B 4KK5D 5DGQA 5I1GH 1NZRA 1OHQA 4NO0D 4W9LC 1P6FA 5B1BB 4PJGF 2QR0B 4FYSA 1E2ZA 4XC1H 1HE7A 1N3NA 4Y4FB 2VN4A 3ULUE 5EOTA 3GS7A 5BZWB 2QGBA 1TDQA 3MRHB 4EOWH 5ID1B 1IC7L 2EUVA 1DANU 2ZUSA 5L4MA 3NP3A 3MCG1 2OZNA 5ENWB 4Q9QH 1KEMH 3QO1B 3WDJA 1JPGA 3DHMA 4ZUTA 5C0JA 2O6CA 3V4UH 1AXTH 4ADGA 4WKZB 2JJWA 2QT6A 4PAZA 1INDL 4PY7A 1NIFA 3JWNE 4V1DD 3BWAB 3BRDA 1X5GA 5KSBB 3VWJA 4M6NH 4ZXBC 3G5YA 4FDWA 5INCA 4OD1H 2R69A 1O9WA 2Q20A 1HZHH 2AQNA 5BUAA 1C9SA 1NUFA 3FONA 4MLIA 1HT6A 2H2PC 3S36L 1OCOB 2EXWC 3BH9B 3ABZA 1XR8A 1AGFA 2A9NH 4JRLA 4WCYL 3U96A 4G1MA 3ILQD 2X4QB 5HVFB 1OHZA 4BFFA 3STLA 1CFBA 1A8ZA 3MYZA 5E1GA 2BVPB 4NUJB 3V0VB 4NOBA 1CURA 2IQ9L 2IAAC 2YARA 4KOBA 4PJGE 4P5TD 2EH8L 4MMZB 4PJIB 3TCLB 5FFLA 1YY8B 3GBEA 5F1NA 4J8RA 2IVFC 3D1QA 2I3UA 3WYRA 5F9JA 5JHBA 3L4WA 4PJDA 1MFCL 5DT1L 1ED3B 1GOFA 1SDYA 4FTVD 5DTFA 3FQXA 4P9HH 5ESVA 5JLZB 3JTTA 1JWUA 4GW1A 2QL1A 2QSQA 2Q8BL 2Y7LA 1AQ8A 1BLNA 3BT2H 3W3BA 4L4TA 1G1GA 4QOKA 5ICUA 2F6TA 5DC2A 5HI3D 2CFVA 2FD6H 4BJLA 1FFRA 1PX4A 1NAMA 2VRAA 2WO3B 4MJ2A 5C86A 1NIEA 3BUPA 2ZUXA 1XGQB 2BC4B 4F7CA 1F58L 1NCJA 1NC4B 4P5MA 1GAFL 4FZEL 2NTAA 3OJDA 4FFYL 4UV7H 4HCGA 3UJTH 2XKNB 3D39E 3O6KH 4JDZA 4PLJC 3MJ6A 1XRIA 4U6HB 1ASQA 4YBQC 3RUGB 4HJSA 3IAGC 3PWPA 4KHXL 2O61A 5HHMD 4A2LA 5KSAC 1EHLH 3AGVA 3BIKA 3WTTA 2FRGP 4U3CA 1ZLDA 2X89D 4TUJA 1TTRA 1JZHA 2D0HA 4PRID 5I2IB 3EGSA 4C4BA 1KN4H 1CF8L 1TTBA 2X7LA 3JWOL 3L3GB 3PFQA 1I3RB 3UBXA 1BJ1H 3LHPH 3DJTA 1JZJA 3B2MA 2XN0A 4TTGA 4C12A 5JW5B 1PLGH 3HPLB 4ODUA 4WGKA 3GDBA 1VDGA 3UTSE 4HOZA 1OF2A 2EEFA 1CLCA 4DPAX 1JZ6A 1EVTC 1L9RA 2BNUA 3WJJA 1PA9A 3TT3H 3F3HA 4P46A 1ORSB 5T1LA 3FQTB 2J71A 1ACYL 4PWGA 4DH2A 1UB5A 3QFDB 1Z9SB 4D8OA 4KYQA 4LHUG 4YWGH 3O5XA 1MCDA 1SYVA 3VW3H 3BAKA 3QJFA 2N7SA 3QXAA 3IE4A 4P2QE 1A9VA 1RPMA 3CMOH 2PW2A 3QUGA 4JR9L 4HKXA 2HRHA 3BYTA 4PWFA 1AXSB 4MJIE 3U7YL 5AZ2H 1JHTA 1NBVL 2N1KA 3TV3H 4QYAA 5D7SL 4RMSA 3KPMB 4RFOH 3RB7A 5JW3H 4LU5H 3HZYB 4A55A 1IQWH 1UH4A 3UBFA 1ZIBA 2RALA 4Z18A 4KRLB 1HINH 5E1IA 3FFDB 1WAXA 4RFEB 4AUJA 4ODTL 2AABL 3C6LD 1QI4A 3L3KB 2GSGB 3IJ8A 2K4WA 1E65A 3MNDA 4F27A 1UB6A 5D71L 4WTXA 5DF0A 5FGCB 1UT1A 4I85A 4ALAC 4PS4L 2CMRL 2F5AH 2WVUA 1T6WA 1Q6NA 3THML 3V95A 4L8CA 1BEYL 5EOCL 3UTQB 4ERCA 4XB8A 4B9CA 2H2SD 3X1GA 1AQKH 1O6SA 3EDJA 4GKZA 3K6SB 4BE5A 5AQ0A 1U8NA 4N20A 2XETA 1SJHA 3L5WB 3MLZL 3OHXB 4UOQA 4JO2H 4G3YH 1JZEA 1T4KB 1TZIA 4TTDD 5AYTA 2ADFL 2H0PA 4PJIF 4YDJB 1XQ4A 2BSCA 5CSBA 4HAKA 1FNLA 1DVZA 4LKCB 4PJ7A 5IB2A 1OB0A 2YD7A 1YNKL 3AREA 1TJGH 4OZGB 3NJVA 3L16A 3S4SA 1LP9B 5I18L 3T4YA 1YEDA 1MIEH 2AK1L 3JQOB 4LMQE 3P3SA 3NCYP 1X9QA 4G42A 2PKDA 2XZCH 1YFOA 5MP6H 4I77H 1TKWA 2DLEA 4L3CB 3DRTB 3EH5B 4YFDB 5IROD 1O5ZA 3KYMB 3ZE2F 1MVFA 2IWKA 2OR9H 3CVIH 3DJRA 1XZ0B 1BFVL 2CGZA 3P4NA 4PP1D 4KK6D 1H6TA 3CNKA 3EYVB 4WIQA 3MA7B 4MCNA 1UURA 1QX1A 3I9PA 3EOYG 5BVPH 2VN6A 5EA0H 1ID2A 4BUBA 5H94A 3JTSA 5JORB 4AZ8A 5I17A 2ITFA 2F5BL 1E9QB 1JF7A 1TZAA 4O02A 5D7KE 3E3QE 3QFJB 2OYPA 1WBZA 1AAJA 5H4ZA 3QE5A 1CXFA 2E9WA 3FAWA 4LGRB 3CHRA 3MGTA 1DUYA 1A0QL 3QDMD 4XO3A 4KYRA 1PZUB 1GYWA 3TEWA 3NCYS 3U1SH 2DBLH 2C8NA 5CZXD 2AITA 3P3RA 2O1AA 1MCIA 2YSSB 4R4NC 3WY2A 2C9UA 4ELKA 3FCUB 2DQMA 3QCUL 4X4KA 2C1OB 4YSUA 4QDGA 5ISZE 1P4LA 4C54A 4KWUA 1IO4C 5CJ8A 1EJOL 2E6QA 3ZE2E 5DLMH 4JFWA 3WN5C 5FDWB 2OMWA 3AFLA 2P8PB 1YC7A 5EZJA 3EGXB 2WBWB 5T1DL 4UZGA 2XPGB 4LLWB 1FNFA 3V4PB 3T5WA 1T1ZB 3VMOA 3T09A 3O9WC 4J3OG 5JA9A 2Y9RT 3QJTB 3CFEA 4TPRH 5F8QC 4GSDH 4E9QA 1L0PA 5IUSA 4KKRA 5E1AA 1DDHA 4YS4A 1HXMA 4F9PC 1AOHA 4I4WB 2K6ZA 4DFHA 3OZ9H 2VEVA 3L7EA 2VR9A 1WWBX 3FT9A 1D9KC 2VSMB 1RK0A 5FYKL 4ZO6A 3ALXA 3VE0A 4KV5F 2ZJSL 5GS3A 3V4PH 1S7TA 5B7MA 2UX6A 2YAFA 4GP8B 1MCRA 1DJXA 2A9CA 1Y6NR 1AC6A 1TT6A 4YHMH 2B5IB 2WO2B 1XAUA 3LSOA 1E4XI 3O3EB 1S9WB 4U1KA 5EU7E 5F70A 4C55A 1B2YA 3GJFA 3ECBA 3MRRA 1VFBA 3MNWB 4HIXH 3HOGA 3VYNA 1KAKA 4P23A 3K5SA 4YSDA 1N67A 3WHE0 5HDBF 2DW5A 2LFGA 3RGVC 1AKJB 1JF5A 5DGRA 2HWZH 5I19L 2WOBA 3OXSA 3DETD 4A6YB 3KJ4C 3NCCB 1KENH 2GTZB 4OZGF 2ESBA 3WFCL 1E4XL 2IH9A 2PNDA 3LRSB 3QIBA 4OBSA 1BOGB 1AMYA 4I8NA 3MUGB 4H20H 4HXAL 4QRPB 3QEHA 3WEXA 2WHVA 4MMYA 1TO4A 5AVXB 1J0IA 4JZNA 2AJYL 4UZSA 1M7XA 4XXCA 4JPIA 3OR6A 4M3KB 3FTGB 4UU9B 4Y4KA 3SPVB 4ORGA 3O2DH 4H0IA 3ES6B 1OE2A 5EULV 2IAMA 3MFFB 4DEPC 3LRKA 1BF5A 2DQCL 1FE8L 4TSAL 4S1RH 1BJMA 4Y5VA 5ECGA 4FMFA 3TO2B 4A6YH 5KG9B 2ATAA 4RFNC 4ES9A 1QYGL 3RX7A 3PABA 3CFBB 3ME0B 4V1DE 1IILE 2YRBA 1LJMA 2VTDA 4HHAB 4JANB 4FG4A 4LDCA 1NGXB 1GZQA 4X2UA 3O4UA 1IAOA 4U1MA 4Z7VE 1FI8C 3DXAB 5HDBE 5D6CB 2VR5A 2F53A 4KKLC 4YHLH 4JZOB 3H1ZA 2TSAA 1U42A 3QUZB 5GZOA 1XWVA 1MW2A 4NRXA 2LLGA 4OD2A 4LLVB 2ETWA 1CMOA 2HT3D 2ICWJ 4UIMA 5GRVL 1G7JA 3UZEC 4CKVX 2Y2FA 1FZJA 1AKPA 1KLGB 5CIPA 3OMHA 4UV4H 3P0GB 1JTPA 4DGYL 2CNIA 3L1EA 3W0WA 4WY7L 1W8NA 4Q0XH 1MRCH 2C46A 3NK4A 4FTVE 3DNKA 3MOAH 4GQZA 1COBA 4MJ6B 1M4KA 3R7QA 1UQSA 1BXVA 4Z3FA 4KJYA 4CNIA 3M86A 5KWYC 2ED7A 2ZOKA 4RISH 4UINH 3B7UX 2AEQH 3REVB 3UXFA 1C08A 2OXGA 2KZKA 4QTHB 4JN1H 5PCYA 5D1QA 5DD1H 4ZAKD 2CXGA 5C6WH 3CFDB 5EZOH 4DP1X 4K5LA 4PJ5A 3GSOB 4XNXL 4XMPL 5B1AB 2BY0A 1WA0X 1HDMB 5FM8A 5GGVH 4D8PB 1OO2A 1QLEL 3RZCB 2DI9A 5E08H 1JHKH 2VMFA 2IDCA 2AZRA 2WXIA 5EUOE 1ZLUK 1HEZA 1FNGB 3WEOA 4UM9A 3QCEA 2BNRA 1ZANL 2NZ9D 5E5UB 3VD4A 4HLJA 1KY7A 5E03A 5KYUA 1EEZB 2J6EA 5DVKA 4B7LA 1AD0A 4FTDA 4WO4A 3WSQH 3P2TA 4IGBB 2OZ5A 2JCCA 4GG6B 4XODA 4F8LA 4W9GC 4FQQA 3FTWA 5FLUA 2Z31C 4M62L 3UP1A 1ZWIB 1LE9A 4KK9C 2X6MA 4U1SB 4NRZB 5K5YA 4OFIA 5EMYA 5JIKA 2WKOF 1MWAB 4TL4A 4Z7QE 2W8CA 5E23A 4CSTA 2UXFA 3OKKB 4HXBH 3ZY7A 1XX9C 1HXYB 3VDBA 4F57L 2VDOB 5DCCA 3WTWA 1Q94B 4QNPF 2OMNA 1G7QA 1LQBC 2VDML 4IRZA 4A1RA 1T5KA 1LQSR 2PT0A 3IJEA 2Z4TA 5C07A 2X4RB 5D7JD 4ENZA 1NLDH 3FT1A 4DGVL 1OSZB 3HC0A 2CK2A 4JM4L 1YJDL 1WO2A 3OKDB 5LN4A 2DS4A 1MWAH 2KUTA 2OTPA 4WENB 3W39A 4B97A 3ZM0A 1PPIA 4F1ZA 1U8HB 2O5XH 3NCJH 2I32A 2ENJA 1ZTXH 4CVZA 5KSVA 1LEKA 3NA4A 3VYOA 3MN8A 1KJ2B 4HWZB 5F71A 3IRZA 3VRIA 4BSVA 3GXFA 3L6FB 1E28B 3OD3A 3L48A 4FKEA 3HNSL 2WQXA 3ELAT 4O2CB 2JJTA 3I75A 2DQJH 4OHDA 1O75A 5DC0A 3QNFA 2F70A 4KDTC 4AVHA 5KA1A 2G75B 2Q9OA 1OHCA 2ZKHL 1BFTA 4BDVA 1Q38A 2FNBA 3IFLH 2XG5B 5LBGA 3O4LD 5GGUB 1WITA 1KJ2H 1ROWA 4XOAA 3BSHA 3BPCA 2ESVB 1XL4A 2CNHA 4PBVC 1XTLA 1OANA 2A9ML 4F2MB 1QI3A 3CBJB 3R1GH 4JKPL 4KZEH 4Q6IC 1IEHA 3LKPA 1TQCC 2MTAA 4LCWB 2ZSVA 1NGYB 1JNNL 1V10A 3IS1X 1GSMA 2WWNA 5M94B 1YEIH 2D31A 4MHHI 5J11C 2EH7L 2VERA 3U36B 3U0PB 2CO2A 2VISA 1WSST 1NCIA 3MV7D 2DDQH 4A7GA 4ERSL 4L4JA 4Z0BL 2QMKA 3V6OE 4HIPA 2QSCL 2VEXA 3PDOB 2BXZA 3DX0A 2CJ3A 3S34L 2E7LA 4L4VB 2N0KA 2CO3A 3VWKB 4ZFOB 3NDZE 4JFFB 2APXA 1GGBH 2ZZUT 2X1OA 3TPUA 3MNZB 5ABDE 2YRPA 1YUHA 3ZM6A 5D1ZI 1E4JA 3Q2WA 4PJ9D 4APQA 1DN0B 4IBQA 3P69A 2VXQA 3MRJB 3QWOA 4G2AA 4NSKA 4Y9FA 2VLJB 1A6PA 3LV3A 4LFHG 3H3KA 1YYLL 1KIUA 3P73B 1K5WA 3QDME 4OCSH 2CDGA 3F5WB 3O6FA 3ZYJA 1T0MA 2GEEA 1EGJA 1MHHA 1YEHL 4Z6AT 1ANUA 4KH9A 3T0EA 4RSVA 2GUOB 5H2BA 4DZBB 4S0TD 3SOTA 4AQ8A 2KQMA 4GUOA 1CVRA 5J6HA 2F6WA 3EO1A 3GMOA 1DEEA 4G7RB 2KL6A 4ABUA 2A6DB 3E8UL 4AG4H 5D1ZD 2AC0A 2PO6B 1S7XA 15C8L 3PP4H 3RDTB 3ZDWA 5DJYA 2YWYA 3HRZB 3RTQD 3QHFL 1IM3B 2KS0A 2QLYA 1QVOA 3UYRL 4ZG1A 3O2VH 3FTUA 4M7LT 4B04A 1AR1D 2IH8A 1U95A 2XN9B 1E7VA 1YZZA 3PQYB 1T2QH 2GPZA 1L5GA 2YZ8A 4N2KA 4OM1L 2Y72A 5KA3A 1MKFA 3GRGA 2OZ4H 3HHSA 5AD0B 4NB7A 4NPJA 3S5LG 4JDEA 2X10A 3X1BA 1HVXA 3QYNA 5IG7A 4OCYL 1NEZA 1Q6PA 4ZSOA 4O2EA 2CXKA 3JVGA 5SWZA 5E7FA 2UZYB 4IBUA 1G1KA 5FYKE 3ZUCA 3R0MA 2BP8A 2IGLA 2YBGA 5K1NA 2D7NA 4A2HA 1XD1A 3GXPA 4JN2B 4G6AD 3CLFL 4JFZL 5E7BA 5LBVA 3LX9A 3LPWA 2FJMA 1EUUA 1SY6L 3FFCA 4NQSA 1DQDL 4HCRH 5C08B 4MRCA 1F3JA 1NTDA 1WZAA 2NXZD 2ZOTA 4FJ6A 3K6IA 4QXTB 4UZUA 1RUQH 2CQVA 2QQQA 3KPRE 2WNWA 1PYWA 4JY6A 5DVMA 1ZA6A 1CD1B 1QHOA 2EYTB 4PYGA 5D70L 2HVBA 3TESA 2X4TA 3MHZA 3HE6A 5E00B 5HVHB 2CM5A 2ROXA 1FC2D 1FH2A 5DWUL 4P4KD 3D69B 3OKYA 3UACA 4AQ1B 2IOOA 4P99A 4V2CB 2P8LB 4U6XB 4E5XB 1WH0A 1DBAL 4B95C 5MI0B 1DJGA 4HV8A 4I5BB 3IETA 2W59A 1MFEL 4N25A 3FU8A 2R23A 5L6YH 1B0RA