3AWEA

Crystal structure of pten-like domain of ci-vsp (248-576)
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
316
structure length
305
Chain Sequence
b'KDGFDLDLTYVTDHVIAMSFPSSNPIGEVSRFFKTKHPDKFRIYNLCSERGYDETKFDNHVYRVMIDDHNVPTLVDLLKFIDDAKVWMTSDPDHVIAIHCKGGKGRTGTLVSSWLLEDGKFDTAKEALEYFGSRRTGDVFQGVETASQIRYVGYFEKIKKNYGGQLPPMKKLKVTGVTITAIQGVGRGNGSDLSMQIVSERQEVLLCKFAEGYNCALQYDATDDCVTCEVKNCPVLAGDIKVRFMSTSKSLPRGYDNCPFYFWFNTSLVEGDHVTLKREEIDNPHKKKTWKIYRDNFTVKLTFSD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Voltage-sensor containing phosphatase
publication title Crystal structure of the cytoplasmic phosphatase and tensin homolog (PTEN)-like region of Ciona intestinalis voltage-sensing phosphatase provides insight into substrate specificity and redox regulation of the phosphoinositide phosphatase activity
pubmed doi rcsb
source organism Ciona intestinalis
molecule tags Hydrolase, membrane protein
total genus 101
structure length 305
sequence length 316
chains with identical sequence B, C
ec nomenclature ec 3.1.3.-:
pdb deposition date 2011-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00782 DSPc Dual specificity phosphatase, catalytic domain
A PF10409 PTEN_C2 C2 domain of PTEN tumour-suppressor protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1110 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3aweA02
3.90.190.10 Alpha Beta Alpha-Beta Complex Protein-Tyrosine Phosphatase; Chain A Protein tyrosine phosphatase superfamily 3aweA01
1U24A 2B3OA 1JF7A 2CFVA 2Q47A 5KA4A 1A5YA 2ZN7A 2H4KA 2HY3A 3S3EA 2G6ZA 2H04A 2NLKA 5IBSA 1YGRA 2B4PA 2F46A 4ZRTA 4GE6A 3D1HA 2H4VA 4QBEA 5K22A 4GE5A 3QCNA 1EEOA 3QCMA 1Q1MA 2BIJA 2QBSA 1PTTA 1Q6TA 1NWEA 2OUDA 3A5KA 3QCCA 4YAAA 4YR8B 2I3UA 3EZZA 3V0FA 2QBPA 1J4XA 3ZMPA 5KAAA 2F6TA 4QAHA 1OHCA 1PTYA 1L8KA 1T49A 1L8GA 4OHDA 2NT7A 1RPMA 3ZM1A 3QCIA 2I42A 4PVGA 3S3HA 4DGPA 3A5JA 2CM7A 4JMKA 4NYHA 3B7OA 2CNFA 1X24A 2J72A 2CM2A 2QCJA 2BGDA 4GS0A 1G4US 4NWFA 2I3RA 1RXDA 3AWFA 2QDPA 2OC3A 2YOCA 4D3QA 4ZN5A 2I4GA 3V0JA 1U25A 4KYQA 4MBBA 1PA9A 3O4SA 1ECVA 3SMEA 4RKKA 3RO1A 2CJZA 5KACA 2YA1A 3QCBA 2NV5A 4HRFA 3QCHA 1NZ7A 1ONZA 1YFOA 2Y2FA 4IKCA 4HJPA 2I6PA 3QCLA 1I57A 3I80A 2HNQA 4ICZA 3O5XA 2VEXA 2B4UA 1YGUA 3MOWA 1PA1A 2I1YA 2VEYA 3F41A 1R6HA 2RF6A 1XRIA 4BPCA 2MBCA 2F6YA 2M3VA 1FQ1A 3O4UA 3QKQA 4Z6BA 4Y14A 3OLRA 2PA5A 2I4EA 2A8BA 3AWGA 2F6ZA 2CMAA 2B4SA 1D5RA 4HJQA 1XM2A 5EHPA 2F70A 5KA3A 2YDUA 4TVVA 2VEVA 2CNEA 1C85A 2WGPA 4KYRA 1YPTA 2J16A 2FJMA 1QZ0A 1YTWA 3ZM2A 1Q6JA 1LYVA 1OHDA 2PBNA 3F81A 4QBWA 3ZM0A 1C86A 1AAXA 1GFYA 1KAKA 4AZ1A 4OHHA 1ONYA 1MKPA 3OMHA 4D3RA 1XXPA 4WTYA 3F99A 3LJ8A 5MMZB 1OEVA 1PTVA 2Y96A 3QCKA 1Q6NA 1ZCLA 3EB1A 5J8RA 2OOQA 3QCJA 1G7FA 2FJNA 1FPRA 1I9SA 4OHLA 4ZI4A 2I6JA 3QKPA 3AWEA 2C46A 1PYNA 3QCDA 1GWZA 3O3LA 1G1HA 1C84A 2J73A 3QCFA 2FHBA 2B07A 4RDDA 2E0TA 2HC1A 1NNYA 1QXKA 4I8NA 4WU3A 5K24A 1Q6SA 1T48A 1C88A 3N0AA 1Q6PA 2J44A 1PTUA 4H34A 3S3KA 5K9VA 1YN9A 3BM8A 2SHPA 4D3PA 2GJTA 5GTJA 2H03A 2CNGA 1EENA 3RZ2A 2HVLA 2H4GA 4NNDA 1XXVA 2F6VA 5HDEA 3O4TA 1FPZA 3F9AA 3QCGA 3CM3A 4JBCA 2DXPA 4H1OA 1G4WR 4OHEA 4R0SA 1VHRA 2F6FA 3SR9A 4QUNA 3RGQA 1OHEA 1BZHA 1SUGA 2G59A 4RH5A 1M3GA 1C87A 4PYHA 2FH7A 1XBOA 2ESBA 5KA1A 4RH9A 3S4EA 3MMJA 4GRYA 1C83A 5IBMA 3GXHA 2Q05A 2HCMA 2B4OA 2QEPA 3U96A 3I36A 1WAXA 3NMEA 2I4HA 4JNBA 4GFVA 2IMGA 5BZXA 4GE2A 4R0TA 2QBRA 1G1GA 1OETA 2FHFA 1NWLA 1YTSA 2H02A 2NTAA 3V0GA 2ZMMA 2PT0A 2PSZA 1OEOX 3D1OA 2NT2A 5AWXA 3M4UA 2C7SA 2I5XA 2P4DA 2I6IA 2I75A 2AZRA 5K23A 3H2XA 1LARA 4R30A 5BUGA 2CMBA 1V3AA 1OEMX 4GFUA 5KA8A 2J71A 3EU0A 4DGXA 3D9CA 5KA2A 2P6XA 1BZJA 5I6VA 2BGEA 2A3KA 1Q6MA 2HB1A 1YWFA 2AHSA 1NO6A 2CNIA 3D44A 4NX8A 1JLNA 1KAVA 3ZM3A 3D42A 4JMJA 4WU2A 4RI5A 3EMUA 1I9TA 2J16B 1OEUA 1NL9A 4ERCA 5BZZA 2PQ5A 5BX1A 5KA9A 2I6OA 2CM8A 2OZ5A 3F9BA 4WOHA 5LXQB 2PI7A 1U26A 5KA7A 2BV5A 2HC2A 4J51A 1YTNA 5K25A 3QCEA 4Y2EA 5K9WA 4OHIA 3S3FA 5KA0A 5EHRA 2J17A 3ZV2A 2R0BA 2VEUA 1PXHA 1BZCA 1OESA 5KADA 1WCHA 4RI4A 3V0HA 3CWEA 2I6MA 2QBQA 3V0DA 4RHGA 3MOZA 2CNHA 2B49A 3I7ZA 2HXPA 2HNPA 2QCTA 1ZZWA 4NWGA 1PH0A 5M43A 4B04A 1WRMA 2F6WA 1G7GA 4BJOA 2NZ6A 2QDCA 3V0IA 2QDMA 1P15A 4S0GA 2J43A 3RGOA 2F71A 2BZLA 3D1QA 3PS5A 2JJDA 3BLUA 4GRZA 2CM3A 4QAPA 3ZMQA 5KABA 2CMCA 2GWOA 4QUMA 3BLTA 2FHCA 1YZ4A 3BRHA 1G1FA 3GXGA 3EAXA 2VEWA 1T4JA 1ZCKA 4KI9A 1LQFA 1ZC0A 3V0EA 4GWFA 2GP0A 3S4OA
chains in the Genus database with same CATH superfamily
1YUKB 3I6GB 1P53A 4AQ1A 3EDDA 3Q2LA 1MHCB 1FO0L 2H3NB 3WEAA 4KZEL 2NY7L 3U6RB 4F5CA 1F8TH 2QQLL 2YGNA 3BAKA 1DDHB 5DJDB 3O2WH 1I3RB 1GAFH 3VH8A 1KJ2H 1TJIH 4QT5A 3LEVL 4DP2X 1N64L 2JB6B 5C8JB 3DJ9A 5LNEA 2CRZA 1BPLB 2V17H 1AHMA 5GS1A 4BSWB 3FTGB 1WICA 2UWEF 4JQXC 3JTTA 3I75A 4NCDA 5AOJA 3T65A 4YPGA 2CU9A 1ZVNA 3EJYC 5J1SC 2CH8A 3QCTH 3NCMA 3FT4A 5KVGL 3BVDB 4JO5A 5H37A 2XVKA 3L95A 2B1HL 2CXGA 3N9GH 4XPBL 3RKDD 4BUCA 1QHQA 2NZ1A 4RMRA 4NIKB 3UAJA 1GZPA 3UYRH 2YD7A 4X98A 2GCYB 2NR6C 3HE7C 4LSUL 1NL0L 3QG7L 3V0FA 5DMGC 3IFOA 1A6PA 3AW5A 5ILTH 1G4RA 1OW0C 3H9HA 3U30C 4KITB 2Y1OA 1DVFA 2AHIA 3BHBB 1NGPH 4M6MH 3S5LB 1G9NH 1NCBL 5E0QA 1DCLA 1A6UL 3GIZL 1EXUB 3V5KA 1UWXK 5G4OA 4G8AC 4IRJB 1XGQA 4O02B 1ZLDA 1VADA 5LCVL 4HKJB 5FFOA 3T2NH 5A6MA 2R83A 3S3HA 1R5IA 4XTRD 4ZAKD 5F7LB 2WLIA 4DFIA 3BISA 3UYPA 4D0CB 4HOXA 4JMKA 3U2JA 1E5CA 1NUNB 3DPDA 4W81A 3BZEA 4O2CA 2OW6A 2FEDC 2FX8H 4NO3A 3PU7A 1YMMA 5JQIB 4D3CH 1WSST 2L7JA 4QY8B 4HHGA 4FG6D 3S35X 1ET5A 2Y72A 4LVOB 3MRQA 4FFVC 1SBSH 5FM5O 2B59B 2F15A 2B3IA 2XQYK 4ZN5A 5GPRA 1LQSR 3L08A 1MVUB 4DW2H 4OIIH 4LL1A 4LSPL 1N5AB 4PRIA 2IH1B 3MR9A 4TULH 2UXTA 4KDTC 4E9XA 1JYVA 2NCEA 4B9CA 3ZJAA 4LIQL 2VDLB 4KKPA 4P46D 1MJ7L 4OZIE 2TRHA 3QDMD 5KACA 3EBGA 4XE5B 2C8NA 5EWIL 1DBAH 2B14A 5F3FA 2XZAH 2QTEA 1NZ7A 4RSYA 1NAMA 1RIHH 3RJQB 3P3RA 2HTLD 2I6PA 3QCLA 4QOKE 1I4FB 1EDHA 2I69A 4RIRA 1PYWB 5AOZA 3QDGE 2C5DC 1U3HC 2LQRA 5T5NF 3BVNB 1AKJD 3IN2A 5DD1H 2SODB 5E7BA 1J1XH 5JW3L 3LYRA 5FFLA 1GJUA 1PD0A 3ILQD 2OJ1A 3L2LA 2J1XA 3ARFA 2D9CA 1JHKH 3UBXI 2K9UA 3I3EA 4Z78B 1KTKE 2W9EH 3X3FH 1P7BA 1Y1DA 1FFNA 3GSOB 3B2PA 4I4WA 1HSAA 1MRFH 1GA2A 1YYLL 4G5ZL 4B9ZA 4FXKC 5EZIH 2COQA 2CMRH 4JRLA 5JIIA 5BRQA 5I1KH 2AS5M 5DEGA 1R3LB 1G7IA 3U83A 1U8QA 4G1EB 5AD0A 4JM0A 5H94B 5SV3A 5KBLA 3PWLB 4M1DL 3GINA 5CLWA 1BEXA 5E9DB 3UO1H 2OL3B 3FSZA 2Y7SA 5GZOA 3LRGA 4Z76B 4D9QD 3H7BB 2A9NH 4KYRA 1ZGLB 4JFEA 3VD0A 5DQ9A 4NQEE 3RWEB 1YPTA 3SE6A 1UXSB 1YHPA 1J8KA 5JDSA 3BUTA 3NCFB 4PGEA 4CBPA 1LMIA 1LYVA 2EVJA 2BNRD 1X4XA 3O4LB 1NQBA 1DLHB 1FZKB 1QX1A 3MLXL 4XB8A 1KAKA 3OHMB 4X6DA 3W82A 4FXGA 2HH0H 1XXPA 2ED7A 4R4BA 3LJ8A 4WY7H 5AENA 3QIWD 3GB7A 4LKCA 2JQZA 2BZCA 3K6DA 5ITBH 2L3BA 3PS6A 1JZDC 5D1QA 1PKQB 1CFTB 1J1OH 2ADIA 2RALA 2H0EA 3QEHA 4OAWB 5E5RB 2OOQA 1B0GB 4H1LA 1R0AL 1SLWA 2XOTA 4WUUB 5FUCC 4P2RA 3D06A 3F83A 4FQLH 4M7LL 5DGRA 2I60H 1AVAA 5CLXA 3PWPB 1M7IA 3T5WA 3HE7B 5CSBA 4PWJA 2HAZA 4WJ5A 3ERXA 3DSNA 1KGWA 3OLEA 3QEQB 5C07A 4BEIA 5IBLC 3VWJC 4HJGB 3WHE0 3U30B 2GAZA 2DLFH 2VLME 2EDQA 2KLRA 5DA4A 1TENA 4XRCA 3N91A 2R0ZH 4H2CA 4YZFF 2BVTA 4MS8D 4P5TC 3CK0H 3AMKA 3CSFA 3JVFC 1IAKB 3MLWL 2P8MA 4O2EA 2AMUA 3QUMA 4X7TA 3TN0A 4GAFB 1KPRB 4PJCA 3LOWA 3CN0A 4G6AC 3SDAD 5ID0A 1NFIA 1EENA 1QWUA 3CX2A 2YAQA 5DEFA 1IC5L 1NCWH 2F1AA 3TEUA 4FQ2L 2AJUH 4X4XB 4L4TB 1FFRA 2GI7A 1J9CT 3F9AA 1F6AA 2CSPA 3VXNB 3II3A 3IPFA 4AYSA 4I9WE 2GJ6B 4OKVA 3HG1D 1VFAA 2HT2C 2JQMA 3S2AA 4BZ1A 3CV5A 4G8EA 4X83A 4R97B 5CFAA 3BJLA 2EDJA 4DN3H 2DLHA 2VZSA 3GXUB 2ZUQB 1EJ6A 1ID5I 1UT9A 2XWEA 1MHCA 1ZHBB 2WQWA 3P1VA 4IRZA 2H3NA 5HD8D 4XNXH 1GYUA 3BPCA 3FKUS 2RFXB 5EU6D 2ZPKH 1DDHA 4QHKI 2ESBA 4RH9A 1I3RA 1BD2A 1URIA 5HYQB 1WD8A 4F1ZA 4E5XA 4JY6B 3D4YA 3ESPA 1MXDA 2A99A 2WBJD 4LBAA 1IAOB 1RHHB 4BSWA 3B3BA 3FTGA 3L1OL 3GXPA 4N6RA 5CMAB 3ZQXA 4DPAX 4TNEA 1XTLA 2XVBA 1U3HB 3MRPA 1KNOB 3IMRA 3HE6D 1K2DB 4MJIA 3UEZA 1UKQA 5KVDH 2VDML 5FO8A 1KLUB 4JNBA 1PLCA 4CBZA 3SDDC 2YPLB 5HGAB 4P2QE 1KYOK 4NOFA 5LXGL 2HWZH 1JPTH 1NMAH 4N9GA 3KYKL 4LASH 4UM8B 1JPSH 5KSUB 4N2GA 3B8YA 5AFAA 1J1PH 4JG1H 1X4ZA 2FNWA 4NUPA 1GGTA 2BNRE 2MFNA 1WWAX 3S5LA 2V2TB 1G9MC 1L6ZA 3WYRA 3BDYL 5IP4A 3L81A 4LSSL 1GSMA 4S1RL 4KTDL 3TEZA 1YZZA 1MIEL 3RIKA 3RL1B 4L1BA 3JZ7A 5F6IB 4Z7QF 1S3RA 4UOJA 3A24A 1AHWB 3CHRA 3EBHA 4NKIH 1HHJA 4HMCA 4BE5A 4PTUA 4BSVA 5D2NA 1H3PH 3O6MH 3SOBH 4D0CA 2TRYA 3IWUA 3FQTB 4LCWD 5C0GB 4DP4X 4YDJB 4LCCB 5EOQH 4OH2A 1IFHL 2Z65C 4R8WH 1CL7I 2NXZB 5IVXE 2HFEB 2FQFA 4N26A 1INDL 4TQ8A 1CTMA 5GHWL 4DGIL 3FU9A 1BG9A 3BW9B 4JAMA 1W8OA 4XPFH 2B59A 3DYPA 4HJJL 2XG5B 1KULA 1S5IH 2YEVB 4ILDA 5IEKB 3ARWA 2YPVA 3ZX1A 4OVUA 3U4BH 4OW6A 1N5AA 2D7PA 5L6YH 5KAQF 5HVHB 4IGBA 3T0DA 5JUEH 2HYMA 1FV1B 2I25N 3P30L 4Y88A 1RUPH 5DZLA 3SIKA 3NSCA 4W9LC 4KI5C 4BQ6A 4AIOA 3CDYA 4M7JL 5IOPB 2IAMC 4G42B 4XXWC 1C16B 2J16B 3BVVA 2EYSB 2FJGB 4X42A 2FEEL 2ZQKA 2XBDA 1T89C 3PLYA 5D7JD 4ERCA 3UTPE 4NENB 2QADB 3FTUA 5KOMC 1MKFA 3MGOA 2XX1A 3Q0HA 4G82A 3OSVA 3H8NA 4MQ7A 2WW8A 2F5AH 1AQKH 4K55A 3OF6D 3VXMD 1OTTC 3VWJB 1EEHA 3V9CA 3LRMA 4YSTA 2C7FA 2VN7A 4HOZA 5I6LA 3N2AA 5IJKA 4G9FD 5G4MA 4Z78A 1UT2A 3GI9L 3HG1E 2J17A 4HH9A 4U6HB 4WWKB 3EFOB 3QH3B 4ZX6A 1U3NA 2ESVD 3BLPX 4IRSB 4P5TB 5IJBC 5DZVA 3DOSB 4OT1L 1OESA 2AI0H 1NWOA 1G7MB 3WENA 4L2LA 4RHGA 5E9AA 1BM3L 2F74B 4L0PB 1MHEB 2R29H 3BXNA 3OPUA 2C34A 4NQVB 1F56A 5FW6A 2CG9X 4G1EA 3NTCH 4TQEH 3LNEA 5H94A 1QI4A 2R0LL 3BP5B 3GTVA 1RZQA 1ZZWA 3PWLA 1SUJA 4TSCH 2OL3A 2HT4C 1OGPA 2WXGA 4PJGB 4Z76A 1RZ8B 1MFBL 4YGVA 3RWEA 1EUUA 2WHVA 2QDWA 1JPST 2UUDH 3FUEA 5L9DL 2PTUA 2QDCA 2X88A 5J11B 2YQ2A 5I1DB 2DQHH 2QDMA 1ONQA 1YO4A 1XBRA 4S0GA 1FDLH 2FATL 1KIPB 5HHNB 1UM6H 3GBNL 3K7UA 3MA7B 3ULVD 3BKJL 5JA8B 2HFFA 1Z5HA 4EE2A 3ZO9A 4FQCL 5GS2H 1I1AC 2AQ1A 3MZTA 4JANA 2UZPA 4X7DC 2EVHA 1IKFL 5ABDE 1DQQB 43CAB 4RETB 2CUAA 1PKQA 2IWFA 1CFTA 3HCVB 1J11A 1LO0L 4PJEA 4NRZB 2XICA 1KPVA 1JZFA 3AREA 4KX7A 4JN1H 5KWYC 4HUNB 4WUUA 1ZDQA 3HUJF 5DVOA 4DUVA 3CXDL 4I18C 1QO3B 1E9PA 1FRGH 3PP3H 3TIEB 2Y5EA 4ODSL 5I9QC 1A5YA 1MNNA 1U4EA 3PWPA 5BO1H 1GR7A 1NDMB 3NFPA 2FT8A 2B5IC 3VQ2C 3WCYA 4ZUUB 5FB8A 1HC1A 1D5ZA 3EHBB 4HFUL 5H8DA 1MCOL 4KVCH 3RIFF 3U7YL 1INQA 2N56A 1U21A 1QSEE 4LBEB 2R2HA 4NUGH 5C0JA 4J3UA 4N8CH 3BC9A 4DN4L 1RY7B 5DMKB 2MNJB 4MS6A 3KPRD 1P7KB 4XE0A 1S7SB 1P2CB 1XSOA 4LOFA 4BFRA 3O9WB 4LZKA 4HRFA 1DFXA 3CLWA 3JUZA 1BOGB 4PJ5D 5JHDA 1E4XH 4E9SA 2VUYA 5C0IA 4DH2A 4KRPD 4OLWH 4P3DA 4ZQTA 2A1WH 4EZLA 3FPXA 4X4XA 3QGVA 2F6TA 4WNQB 2OMTA 3IMVA 2YGPA 3O3BB 1PTYA 4L5FH 3VXNA 1FNEA 3WFBH 2GIMA 4HISA 1BIIB 1UJ3B 2VL5B 3WFEH 3HAEA 4C4KT 4O02H 1DBBL 5B1CA 4FFYA 5ICZA 1A1OB 2GY7B 2QFPA 4NERA 3VXME 1O6VA 3EF7A 1UGKA 3HI5H 3DA0A 4GYBA 4KKAC 1IC4L 4XCFL 4PJDF 1ZHBA 2BY1A 2HRPL 4ECNA 1SHMA 4M7KL 4OM0L 4AW7A 4MJJA 4NYHA 1A6WL 2IAMB 3OR6B 3NUKA 4JX0A 4UQBA 5C86A 3FSWA 3ULVL 1JRHH 4Y4KD 2ESVE 3FU3A 5KYWB 3SQBB 2IMMA 3JV6B 4YOKA 3UIZA 2G30A 2M2DA 1SJEB 3APDA 4UT6A 6PCYA 5TE6L 4V33A 3LQMA 3Q13A 1NM4A 5CMAA 3CN2A 3AQXA 3GSNB 3UJIL 1L9NA 3WHXB 2K6YA 4NP9A 1KNOA 1K2DA 3HB3D 4UTCA 1D9KC 5FUZH 3TNNB 5L2KB 1KLUA 5D7IB 4XVTH 1QPPA 4UT7L 5AG8A 2R0KH 2XIIA 4RKKA 2JF1A 2YPLA 5HGAA 2VDLH 4XOEA 4NKQB 3HC3H 1IC7L 1QHPA 3PGFL 4XNMB 5KSUA 1J8RA 2MOGA 2R4SH 4YHMH 4UOW1 4EDWL 3OKOA 2IV8A 4PRHE 4LSQH 2VR6A 5DFVC 2EABA 3ARVA 1LEIB 1VENA 4EDXB 5TE7L 3L9BA 3QCHA 2Q76B 3MV9E 4G8FB 4K3JL 1U2HA 4BA0A 1GZHA 4J4PD 2V2TA 4PV8A 1I57A 4LVHC 1YGUA 3TA4D 4Y5YA 3RL1A 3V52L 1A9BA 1II4E 4JM2B 4ELDA 3L3KB 1FIGH 2BJMH 1AHWA 4BPCA 1I7ZA 3PDDA 4FLRA 5F1OB 4Z7OF 5IG7A 1WDAA 3O4UA 4K73A 5I6XC 5C0GA 3MV7B 2V5MA 3ASWA 2Z4TA 1BVLB 3K0WA 4LCCA 3K6NA 2XTJC 3DPBA 1FF5A 1R9FA 1T5KA 3SN6N 4M48L 2FX9H 4XI5C 2YRPA 4D9LH 2EIJB 2F6ZA 5I5IA 4DT2A 2PYEE 1MI5B 1NFDB 3AGVA 1D5RA 4FEMA 4IDJH 2XG5A 3CSPA 4JDZB 2VYRE 2XN9B 5HHVH 5IEKA 3UAGA 4X9YA 1AZRA 3E9UA 1YDPA 1UD3A 2O61B 5I24A 4YLBA 2JJTA 2E9IA 4NGHL 1KN4L 2YN3A 1FV1A 4MD4B 1C85A 1LO2L 3EO9L 1BYNA 1HCVA 1KGIA 5IOPA 2X12A 4G42A 4ZSOA 1C16A 2J16A 5L8JB 4FG4A 3ISWA 2FJGA 4G8IB 3E2HC 3C8KB 4LSTL 3OL2A 4CW1B 4NENA 3M88A 1ZANL 1SXCA 4NQCA 5I28A 2X3AA 5K93A 3BT2L 5E1AB 2PN5A 4JRWA 1FC2D 4D3RA 3ZDWA 1OAXL 5E6IA 1T0NB 4DEWA 4K3EL 1ANUA 3IYLW 4F20A 1KELH 2UWEA 4K3GA 1ZCLA 5IFHL 1CG9B 1YEDB 1T5WB 3CLFL 4UV4H 3IVKB 4WWKA 3EFOA 1VFOA 4E9VA 3RGVC 2N3JA 5B1JA 4EOWL 4IRSA 3ES6B 4LVNC 2BP5M 5G5DB 3RI5F 3SGDH 4UAHA 3DI2B 4XH2B 5LG6A 4QCIB 3EDFA 4TRPH 4DKFL 5IIEB 3BP7B 2F74A 4LP4A 4M6NH 4NQVA 1IC1A 3M8OL 3PQYB 3ZKMD 3QCDA 4HUXA 1ULVA 1OCWH 3O3LA 3WI9A 4YDIL 1SGKA 3BP5A 1JS4A 2FJUB 1U36A 4NWUH 3KYNB 2B4CL 3D6GA 5DRZB 4CMHB 3V4PL 1F42A 4Z0XA 3ZOAA 1DBKL 1OGTB 4BWTA 1Q6SA 4PJGA 4NJAL 3G6JE 5B8CA 1Q6PA 4P2YA 5D9SB 3SO5A 1KSRA 1L3WA 4H8WL 2R7EB 4MXVE 5HGHB 3S3KA 3FQXA 1N7MH 3DV6B 1YPZF 4DWHA 1OSEA 1H8SA 4XMKL 1MXGA 5HDBF 4Y1TA 2ZKWA 3V2AR 5HHNA 1VACB 3MA7A 2DF3A 4KQ4L 5JOEA 5JPMC 3PWJB 2X9ZA 4O9HH 1RJLB 1RKRA 3OAUL 3WTWA 2CHDA 1T5XA 4MXWH 2H4GA 3F62A 1GPOL 4H8VA 3GLEA 2DKSA 3EOBB 1AGFB 2P28B 3MFGB 2J6EL 5GGTH 4K2UH 3AY4C 4QXVA 3L13A 1CE6A 3GSXA 4KQ3H 43CAA 1QRKA 1OAQH 2YBGA 5AW8B 4YSDA 2X6UA 4NQQA 5KSAC 1F1DA 4PG9A 3VXUB 3ZKNC 1R46A 3VRLE 3R06B 2DXPA 5FV2A 1QYGL 4KKLD 4YDMA 1ORSB 4ZMVA 1D9KB 3IDYC 3EH2A 4IOIA 4ISVB 1UYWL 1QSFA 2CHXA 3DVGA 2CK0H 3KVQA 1ML0A 1PL3A 5IMKB 2AQQA 1QO3A 3IU4H 3L3OC 3I6KB 3TIEA 3BP6B 3PJLA 4NNPL 4OZFG 4WO4C 1I7RA 5ESVA 2VZVA 4NC0B 5C0DB 4BQ8A 1T3FA 1WC7A 4HQQH 3C5SA 2Z31D 4PU2A 4MLIA 1K6QL 3T8MA 4FN0A 5JHAA 4XN1A 2BNQB 2DI7A 3CBJB 2RACA 3PAYA 4GOSA 5H2BB 3MZGB 1WFUA 3GRWL 5G55A 1KACB 3H0TB 5CILH 5IFJB 3X11A 2F19L 32C2A 4P2OC 1IJ9A 4X9BA 4D0BA 2JWYA 3MRNA 3OQRA 2EZ0D 4PV9B 2ERJC 5DMKA 5GGSB 1MQKL 5J8OA 1T6WA 1P7KA 3ZL2A 1P2CA 3O9WA 4PJBE 4XHJD 1E4WL 2VE6A 2FO4A 5C09E 1OETA 4Z9KB 5H35B 3P4NB 4P06A 4YSQA 4GH7B 1I8IA 1DCEA 4JO4H 4MDJB 2ISDA 5FKPA 3T0WA 1QUNB 1UJ3A 2XWCA 4XC1L 1KCKA 2VL5A 1CCZA 2DJUA 1SFDA 4MNQB 2EQDA 2P4DA 2BC4A 1A1OA 4JFPB 4ABVA 1NBCA 5LWYL 2WP3T 4XC3H 5A16A 2I9LB 2Y22A 4L4VB 1XF4B 1VIWA 3OGOE 4YBQD 4Z5RB 1V3AA 1CXHA 1G7HA 2ZSWB 3HZVB 5T3XH 4I2XA 1OQXA 4JPIB 4YSCA 1XCWA 4JHVA 3NEEA 1AO7E 2E5EA 3PWUB 4N2IA 5F7UA 5I8KL 4R2GB 5KYWA 3S96B 4C58B 4G8GB 5DMJB 1QVOB 1H3VA 4ZD3H 1YEJL 1SJEA 3KLDA 2FL5A 4A6YB 3E1ZA 1A4KB 4PSRA 5J06A 2P6XA 4WFGD 3OC5A 5EOCJ 3GSNA 3FCTB 5CKAA 2BGEA 2WXPA 3WHXA 4Q9BA 3FU7A 3D39D 4OGYH 4PM1A 2DWYA 3HS9A 3TBVA 4HP5A 1AQDB 2OMZB 1DQIA 3DX6B 4OLVH 3TNNA 1YEIH 2VXQA 1I9RH 5F2FA 4BKTC 5GSVB 2WQUA 5B38B 2JJWA 1QKZH 3EO0B 3EYOB 4BZ2L 1JNHA 4XNMA 1ORQA 1PY9A 4NXSA 4WI2A 4HK0B 2HVJB 4KROD 5IGXH 1LEIA 1P4LB 5E4EC 5ECJE 2Q76A 4G8FA 4PJ8D 1AI1H 1BP3B 1XGTA 4K7PY 1G1OA 4X9FA 1BCIA 4OIAA 3QI9B 1QBLH 3CFBA 3TZVB 1U26A 3NK3A 3VD9A 4OZGB 1FNSH 4JM2A 3GKWH 3L3KA 2CO2A 4OR1A 3A22A 4R7LA 5E1HB 3FMGL 1G6RL 4LSRH 3U2SB 4WGVB 5K9WA 3ARRA 1KTLB 4PVNA 3MV7A 2WNKA 2DQJH 4WI0A 2QSTA 4CNIB 3ZM5A 1S3KL 2O1AA 1SFHA 1TTCA 3SE8H 2JB5L 3VFWB 3AXIA 4AX3A 4RI4A 4JGUA 5HI4C 4JJ5B 1IE5A 3MOZA 4KTEH 4JFFB 5D2LE 1MOEA 2E6QA 1NFDA 3PIQB 3KL0A 2UXGA 4JDZA 4UMSA 4WZ9A 4F8PA 1JMXA 2XN9A 4JZJC 4GMSL 1AG0A 5E8EB 2EH8H 1OGAB 2VZTA 1C8QA 2Q10A 4QYOA 3NIFB 4PJFA 1OLLA 4APXB 2VM9A 1DSFH 2A74A 3ELAT 1EERB 4PBWD 4KDWA 1SDYA 3T04D 5KSAB 5FWRA 4ZFOB 3CVHH 3O2DH 4S0TD 4YVUA 1JNJA 1WZ1L 3OXRA 1E7VA 1YECH 3IDYB 4G8IA 3TA3C 5F97E 2EDTA 3V0IA 3ZGHA 4E41D 3PXLA 4A2DA 1AAJA 1MQ8A 4X6CA 43C9B 1NC4D 4KOCA 5F7NC 5AB2A 3KGSA 3BPNC 5DJ2A 2DD8H 3FTXA 4WCYH 4WO4B 4YDKL 5CN2A 4TTDD 3FO0L 2Z92B 4JKLA 1H0DB 1UZ6E 2JJDA 2Y06L 4I13B 4NXKA 5C6PB 4GRZA 4Z6AT 3QQDA 2CM3A 3ABZA 3U0WH 1A6VH 4NZTH 4F9LC 1PPIA 2BP0A 2QDVA 4LAQL 5IJVB 2VXTH 1CC3A 1FVEB 3H9ZA 1T5WA 2AJZB 1QTYT 3OJMB 1T4JA 3ORJA 4B9PA 1KEGL 3TESA 3ES6A 3H54A 4N8VB 4PB9L 2ERJB 1P1ZA 4QWWD 4B53A 3M1CA 4MDIA 5G5DA 1XGUA 2V8LA 1T1ZB 1ZCRA 2CO3A 3IKKA 4XH2A 2XPCA 4UF7C 1HOEA 3NJLA 5AWNH 4CVZB 4DO6A 5IIEA 1P7HL 3T1FB 2JKXA 3GPEA 2BOLA 5JXEC 3D0LA 4PCKA 1S7QB 2XZQL 3T4AA 5IV2A 4ODUB 3UGXA 2NZ9D 3KYNA 5IBSA 2VZ3A 3FFCB 4NO2B 4R7DB 5C70A 1H3GA 3BRFA 1OGTA 1G9MH 1MDTA 1S9XB 4HFWB 5AW3B 2WMPB 1WBYA 4QBEA 4U1KA 3VI3F 4WFGE 2R7EA 4JMXA 5HGHA 3K1KC 3MCLH 4UNIA 5GIRA 2KBGA 3ZHLA 2RQEA 3DV6A 1HCZA 2J20A 3D39E 4FP8L 4H8UA 4H4NA 4JRYE 4JHUA 3FU0A 4N0UE 3NVQA 2C4XA 2RIKA 2XPYA 1NFKA 3PWJA 4UQ3A 3C9NA 1BX2A 2BVQB 3ECQA 3B8SA 4YBHA 3VMNA 4RFOL 3T0VA 1DQKA 3ARGA 3BP4B 4RGNC 4X9GA 3KJ6H 1A8ZA 2PW1A 3Q9PA 3EOBA 1AGFA 1QNIA 4M8QB 5E8OA 3IFLL 5IFAH 2R9HD 2KKQA 5D4IA 2OI9B 4ODHH 1QSZA 2BOBB 3VXUA 1R3HB 5IMOB 4QRPE 3R06A 3UZEC 1MFAL 4XN9A 1ORSA 1IM3A 3OXSA 4KK9C 2BHZA 3PNWB 5IBUG 4Q9QL 1JTOA 1N10A 1WF5A 2YAMA 3ARDC 3UAEA 5IVOA 4YHOH 3MJ7A 1FORH 1A7QL 3LHPH 2JI3A 4AXWA 4DZBB 5TQ0L 2BNQA 1I1CA 5E4EB 3QDAA 4ZUWB 4U6YB 4H5SB 4GKOA 1PZAA 3SCMD 4ANKA 1B0IA 3OLIA 4UT9L 4YXLL 5IFJA 1A14H 4AZUA 4ATWA 3TBBA 3E0GA 4XMWA 3VW3L 4KZDL 5IB1B 2YMTA 3GXFA 2DYPD 1DJGA 4R5VA 1UT1A 3V6OA 4P59L 3RPKA 4S1QH 2IANA 2X6BA 5GGSA 3T77A 2Q3XA 2LHAA 2XVLA 2Z9TA 3KXFB 2AK4D 2DLTA 1YEEL 2QSVA 2Q86B 3FQ2A 3T2LA 3TO2B 3LEXB 4L1TA 4HJTA 1D5IH 2ATPB 4YAQA 4GKZA 1NSNH 2A9BA 3P4NA 5AYQA 5DRNB 2YXVA 3FDWA 4GI8A 3VM5A 3S36X 4B6ZA 4CC1A 3QISA 1J7VR 1QUNA 4AMXA 5EULV 3LRSB 1NUDA 2CRYA 5EIIG 1IZKA 4PW3A 2PR4H 3EGDB 3B6SA 3C12A 5FS5A 4MSWB 2E86A 3CZSA 3FN0H 4HG4K 3MOWA 2F8VA 1BQKA 2EDKA 3LZPA 4Z5RA 1R6HA 2EDRA 2P3YA 4K3DH 1J87A 4D7BA 3VG9C 1C1EH 4HU8A 1AY1H 3DNKA 2O6EA 4L8CA 1OAUH 1SXSA 1Q9WB 1QVOA 4FL4C 3V8CA 2OR9H 1BJ1H 5IHLB 2F54D 2J8HA 5EMYA 3FH5A 3QZPA 2CLRB 5CBEB 2VOTA 1HQRB 1A4KA 3MDJA 3QQXA 5CU5A 1UACL 1VAHA 3MRRB 4GXFA 3FCTA 2JQAA 4V11A 4BCXA 4C4UA 2F70A 4YXKH 2KYIA 4Q6YA 1MAML 1JPGB 1DZBA 5F0PB 3SPVB 2CDFB 4UM9B 1PCSA 5DUBB 2YUVA 1MIML 1P9MC 2VDKB 2CNEA 2DL9A 1UWGL 1ZK5A 3O11A 2VDOL 4TNFA 4HK0A 1KN2H 3FOLB 4HA1A 1Q6JA 3OX8A 4X6FB 4GUOA 5HHOD 2QMKA 2A83B 1P5UC 3ZM0A 2HCZX 1FFPA 4JFDB 3VG0H 4FADA 1ZLVH 4LPTA 4ZW8A 3BLBA 5HYFA 3MV01 3QI9A 4JDEA 3HMXL 5FECB 4BKLB 3TZVA 4S1DC 5IQ9B 4L05A 1L9SA 2YD8A 2FBRA 4OZGA 1EAJA 3WNOA 1ZWIB 1FHNA 1FGVH 1QPXA 4MX7B 5SWZB 4EIZC 3L7EA 4UQ9A 3U2SA 3SQOH 4AVKA 2JELH 1KTLA 4Y4HD 5E5UB 3S37L 1KCVH 1JFQL 1NCCL 4CNIA 1SBBA 4MD0B 1KTJA 4JO1H 4RRPA 3CN1A 4RFNB 5D7LB 3SDXA 3VFWA 1SJXA 2PWEA 2IDSA 3IDMA 4N8VG 3L9YA 4DTGH 3GJFB 4JJ5A 2I6JA 2ID5A 3QKPA 4KI1A 4BHUI 2WO4A 3GHPA 4FFZH 4HXAL 1QLFB 1Z5LB 4GRMA 1CFQA 5DWUH 5KS9E 3WSQH 1U8KB 4OCWH 4DEUA 4EI5C 3QCFA 5I0ZA 2DQDH 3VQMA 2D0GA 2NY5C 5D5ME 2GUYA 3TEYA 4HT1L 4APXA 2VITB 4GXUN 4WFFD 2NW3B 1O7VA 3H9SB 3MJ9A 4F7KA 4ZFOA 2BFVH 5ALBH 3ISRA 4OJYA 4WWNA 4KK6D 1U3YA 3HVDA 1X5LA 5CIPH 3Q06A 4FNTA 4W9EC 1VRSA 3MRJB 5EBLB 4AENB 5DJZA 5GRUH 4ODTL 5FO9A 2V3EA 3DUUA 2IADA 1ZSDA 2FRGP 2PPAA 4PS4L 5C08B 2HMID 1RH8A 1H0DA 2HVLA 4YSPA 4HIHB 1CD1B 1KF9B 2MCMA 3QT2A 5CBAB 1SLUA 4U6VH 2WY3B 2NSXA 1JXGA 3ZTJH 1J9SA 1XB6A 3MVNA 3CBRA 3J27A 1FYTB 1TEYA 1XF3A 2CCVA 3JT2A 2IWKA 5IK3B 4JPSA 2LE9A 2B15A 3G5ZB 5ACLA 2P4AB 5EPMB 2COVD 3NZUA 5J12C 2KI6A 4IIQB 3TCLA 3T0EE 1JFHA 1T1ZA 1HN1A 1ZY9A 4WTQA 5HJBA 4LHUA 3L3IB 3NZHL 4CVZA 1J0IA 4U0QB 2K7PA 1IILE 4XPGH 5FK9A 3T1FA 1LO4L 3NJGA 1MAKA 3I6LD 3MV8B 1S7QA 1B4TA 3KMDA 1SLXA 1FE8H 3FFCA 4NO2A 4R7DA 4DPCX 4WU5B 5T5FL 4OFVA 2Q05A 1HAWA 4HFWA 2KZ1B 2WMPA 4R84A 2DQUL 3V7AE 2VXSL 3BUDA 4ONGL 3TJPA 3HN5A 2H32B 3WD5H 2HRGA 2ZOTA 3GUTA 2V2WB 4MGXA 2K4WA 2LLLA 2XIDA 1W91A 3P11L 1IBFA 2VSKB 4XN7A 4GSDL 5AZEH 2AXFA 2EIEA 3WFCH 2E27H 5KEZA 3BQUC 4HWZB 3HBQA 1XH3B 5E2JA 2HLEB 3V6FB 3WTUA 3WAJA 3HNVH 1P4BH 4AE1A 4TN9A 5HVGB 1IGJB 1AGCB 4M8QA 1J18A 4LPUA 2UUDK 5I17B 1HL5A 2VW7A 3D1OA 3WIHH 3VX1A 2WJPA 5MENA 4HV4A 2I27N 3QWQB 4WI3A 1R3HA 5SWQA 5IMOA 2C7SA 2KZWA 4JB9L 4HWEH 3VGHA 1B88A 4RESB 1E30A 3W11C 4A38A 3WFZA 3MMEA 2FCBA 3O6LL 4DEPC 2WTZA 4WEEA 2ILLA 2X89A 4Q6IC 1OEMX 3EOYG 2O5ZH 5EEXA 1SDDB 2R8SH 1EXHA 2Y36H 2V0AA 2Y7MA 3R1GH 4ZUWA 2Q7NA 1JHTA 4H5SA 4U6YA 2GQHA 4A6YH 4G7YH 5DK0A 4XBGB 4I48B 4OUOA 2YAOA 3BZDA 5KA2A 4QTIL 2KPNA 5DRWB 2FAUA 4CUCA 2G9KA 1SEBB 1G9HA 3QB7C 1C12B 5DMIH 2XXFA 3PP3K 4PJ9B 5FAAA 3G6DH 1IBDA 1HZHH 1YWFA 1U8NA 1C5CL 5J7CC 1Z9MA 1ZGLM 4HWBL 4JPKH 2O93L 1Y1UA 4TQIA 1NLBL 4ZMQA 1E28B 5L8LB 3TO2A 1YVLA 2D8KA 3HMWH 3SE3A 2Y3NA 3L7FB 3ZDZE 1KENH 1KIRB 3MLSH 2NY4B 2VR7A 1F4WL 2PLTA 2W91A 2H2SC 5BS0D 5JORB 1CDJA 5DS8B 5DFAA 1CTOA 2CR0A 3J7HA 2WUBL 3WO3B 2O5YL 3LRSA 3BN9C 1A0QH 4XCYB 5G2NA 5ANMB 4EI5B 2PO6C 4MSWA 2Q6WA 4U05A 1RIVL 2YEZB 5EU4B 4PHZA 1NH6A 2DH3A 2XNAA 2EDBA 2BW5A 1QASA 4Z7UF 4UOW0 5GZND 5KVMC 4FX5A 2AQ3A 1R5VB 5EUOA 1GGYA 4NO0D 2VAAB 4MNHB 4NHCL 4V1DB 3BAEH 3MLTA 5AB9A 3FTVA 4MMZB 4UUJA 5EHRA 1HNYA 1SF3A 3LKNA 4IOSA 3QR0A 4EIBA 1MEXL 1WCHA 3BKCL 1PLAA 4PI0A 3V0HA 1EUTA 1UCBH 1M2VA 2QBQA 1HQRA 3ZLQC 3WFDH 2D3NA 2KL6A 4AYID 1PQZB 4GKNB 4PRDA 1E0DA 3SYPA 4BQBA 2X3BA 4FI8A 3KWVA 5TF1H 3S35L 4UV7H 4LK4A 2UZYA 4KNQA 3RKDC 1F58L 5BVJB 2CDFA 4PY7B 3WE6B 1Q72L 1TCRB 4AE0A 2P42B 4PJHA 2EE9A 2G3XA 3JSSA 1XIWB 1EO8H 2M1KA 1T1WA 1WZKA 5K9JH 1XFPA 2LV4A 4JW3A 1DVXA 4LXFA 3FOLA 5FDYA 5J12B 4PH8A 4GXVH 4EBQL 4BK5C 1DE4A 5LXVA 1WCBB 1RJYB 1FL6B 3V6ZA 4ZYKA 5KVEL 4D2NA 3CFCH 4HUKB 3DBXB 1D7DA 2M83A 3EJPA 4OCRL 2APFA 4TSAH 1JZ4A 3B4NA 3FUKA 5FECA 2Y25A 3EH1A 1CGYA 2R51A 3MLUH 4FAAB 3ZMQA 4XTRC 4ZAKC 1P4IL 3P77B 4MX7A 4HPYL 5SWZA 4BV1A 2X44D 4FQ1H 2JE8A 4KI5F 4ODWB 2VXUH 2L8AA 4Y5VC 4MD0A 1CLYH 3ZIYA 3KH4A 5GS0D 3MRLB 3PUCA 5D7LA 4QAWA 4YGAB 4M00A 4M1GL 3BQUB 3UAJD 15C8L 1QLFA 4NNXB 3SD2A 3TURA 4QDGA 3O45A 1U8KA 3MCKB 1E8WA 2WVUA 2OYLA 3Q44A 2XN0A 3BUYB 3JBG7 4KNUA 1RULL 4F58H 4Y7OC 1E9OB 4PUBL 5JTWA 1DVFD 4K07A 5D7IF 4P46C 2QTVA 4C13A 2D3LA 1WZMA 2CLVB 3WKQA 5DC4B 1AFVH 4LLWB 2IG2L 1TU2B 2Y67A 2W9DL 3JVGA 1YN6A 3MRJA 3PJSB 4U1GB 5EBLA 3RP1A 1T83C 4AENA 5K5YA 2HTLC 2IH9A 4DEPB 3BZFB 1DL7L 3QCCA 2VW4A 3II2A 4XP5H 5JHLA 2OQJA 5MEQB 3EZZA 5DO2D 3E8UH 4HCRL 1G9EA 1JV5B 4OUUB 4DESA 5K1NA 1X44A 2WGXA 4JHWH 1YMMD 1K8DB 5DTFB 4HUVB 3LS4H 1UA6L 5BS0E 3HBGA 4OZIB 2JFFA 1GTFA 4WTZA 2R0WH 1FYTA 1LVEA 2X38A 4F9PA 4N2HA 4ODVL 5LGJA 2GCAA 2AVGA 1KT2A 2OR8A 1YJDL 5TPWH 3QW9A 4GRWB 2ODIA 4OCNC 4PRID 4E42A 4IIQA 2Q0ZX 4QOKB 2I42A 2HN7B 1GY1A 5DUPL 3L3IA 2QLVB 1INEH 4ZTPH 2C7UA 1YEKL 1HSBB 2A77L 5CINH 1HIML 5E00A 3HNSL 3MV8A 4N0YL 4HIIB 2YD2A 4N2BA 3E80A 1BJMA 2YLKA 1C5BH 1E3XA 1MLCB 5DHVB 5BMFH 2OC3A 2BXYA 3JT0A 3GRGA 5IESH 1A7RL 2YQBA 4LHJB 2H32A 3SPIA 4KFMA 3DJSA 2V2WA 3MLRL 2AXJA 4PJAE 1G7QA 3EADA 3ARFD 3ZZSA 3B9DA 2G3MA 4LLYB 2F53E 5I1IL 5GS0L 1HHIB 5AW0B 3V5HA 4HWZA 1YA5A 1XH3A 5SWSE 5E2WL 4FABH 1JTPA 2IDQA 3QIWC 5HTSA 2J57A 1IAIM 1AGCA 1EEYB 3QORB 1BZ8A 2GYSA 3RU8H 4NQEB 5I17A 1A7NH 1E27B 2J1KA 5F7EH 5GGVH 4X8CA 2Y2TA 3ETBF 4OQTH 4Y9FA 2QL1A 2ZX7A 3NN8B 3X13A 1YMHB 2GVYA 2VSDA 4N86A 4UAOB 3IMBA 4Q0XL 3JTBA 4Y16C 5AVYB 1X5KA 5GZOD 4JKWA 1AR1C 3SGEH 3L9RB 5DS1A 4TVPD 1EHLL 2K9FB 3KLHD 2F68X 3VFGH 2ICWA 2OZ4A 4I88A 3WIIH 5TH2A 2EACA 1DQML 3KD4A 4F8QA 4AJYV 4I48A 2GK0B 4MB3A 1BBDL 4NM8L 1K5NA 1ZVSB 2B4SA 3IEAA 4MS8C 3MREA 4JY4B 1UB5B 4LRNL 4PJ9A 5CJOH 1BEYL 1FIEA 5CP3H 4ZAKB 1OIOA 2ICCA 3SDAC 3T71A 3WTYA 5GGQL 4UIMB 2OMVA 4F15C 1QFPA 4PMEA 5D1QD 3PV7A 2DJSA 3DYMA 4UILH 5DEJA 3L7FA 4YSUA 3BIKB 4UTBH 3NCJH 5DHYB 1NCHA 1S7XA 4NZDA 1T0MB 1KJVB 1LO3L 1YQVL 2ZNXA 4P2RD 4ZS6D 1BZOA 3UPRB 5JORA 1WT5A 4LCIH 3LKOB 4AK1A 4NKDB 2ZF8A 2MCPL 2R2CA 1UKSA 1HILB 2V3FA 3LS5L 4XCYA 5F7WC 3US1A 5AYUL 5ANMA 4NQDE 1NAML 5JOFA 4ZS7H 2YEZA 3NZSA 5EU4A 5C07D 3KHOA 1MKPA 3CH8A 1P5VB 5HD8C 5IR1B 5DA0B 4P46B 4X6EB 4MZ3A 3GSUB 4N2DA 1HEHC 3RFZC 3QDMB 2Z8SA 2ARJA 4E9TA 4MNHA 1HJBC 2I32A 4MMZA 1N5YL 4ENED 1IGMH 5J9PA 2CDGB 1F3JA 2WBJC 3TVMA 4I1RA 2YAHA 1OPGL 4ES9A 3TN0D 1TETH 2NXYD 1EHKB 4PRIE 3P3YA 4PS7A 5I1GL 2B0SL 3GJFH 3OGCB 3RHWF 4AEHL 5CP7B 3S9DB 2B1OA 4G71B 3OWEA 1UWEH 1EJFA 4RX4A 3RZCB 1AKJB 3HE6C 1PQZA 1U0QA 2ZJSH 4M62H 1I9IL 1PU0A 5A2BA 2J21A 3LIZH 3VGAC 5BVJA 4Y0GA 3EO1B 2HC1A 2XBTA 4PY7A 3HS0C 1VPOH 5J1TC 1OHQA 7TAAA 4WAFA 1C88A 3BKML 2HXAA 1QPKA 1TCRA 4CADB 3PGDB 4GAAA 1DDTA 1PJ9A 1SM3H 1XIWA 3I2CL 4CGUB 2Q2LA 4W68A 1YRKA 4NO5B 7CGTA 4M4RB 2B08A 2SEBB 3SDYL 1KLGA 1TPXC 2HTKD 4TVPL 3WG7B 1I8LC 1RU9L 2ZX5A 1WCBA 4XPHH 1RJYA 4EPSA 4IOFD 4PIRF 1A22B 2WPGA 1ASQA 1FZMB 3MXVH 5DHXB 4CDGC 3DBXA 5KYUB 2CNGA 4LSVL 5AYTA 4BD4A 3MNMA 1WO2A 3RWCB 4AGPA 4GAJH 3PP4L 1UZGA 2PMZA 5GRJH 1BD2D 1NBQA 3V8OA 3MBWB 4G7SB 3GMPA 4JPQA 5CNHA 4C83A 1RIUH 3BGAA 5DC0A 3DJZA 4M7ZB 1PJWA 4P4RB 3P77A 1X5MA 3L5XH 3K2UL 4R0LB 2AZUA 4R3SA 4QKTA 4YSRA 5D7KE 1MJUL 3BD5A 4JG9A 5ID1B 1U8IB 3GEFA 4KKZA 3O3UN 4PS8A 1H6TA 4YPJA 1WISA 3HLAB 2BNRB 4MJID 3ASOB 4OM1L 3D48R 5D6DA 3RDJA 1E2WA 4GEIA 3MRLA 3OAZK 3QYNA 3QHFH 4HBCL 2GTQA 1D3CA 4JR9H 2LAGB 3M86A 1KIUB 3A23A 3POCA 2VZ1A 3ZO0A 4RH5A 3NOIA 4NNXA 3WGVB 3LZOA 1KFAH 2PUQT 1AIFB 1F3DH 2DMBA 3MCKA 3QIWB 4ALAL 2C1PB 2X70B 4N2AA 1E9OA 2V37A 5DVNA 3CHSA 3ZE0E 4G3YH 4LLWA 1R5WA 1NAKL 5JXAL 1T7YA 4PBVC 5EO9B 1TU2A 2WQ8A 3ZMRA 2VTFA 4D8PB 5IVXB 2WTRA 1UM5L 3O0LA 4I0CC 4U3HA 5D7JC 5CZRA 1XZ0B 5A2FA 1E8ZA 3HR5B 3KM1A 4Z95H 1RV6X 4MMXA 4ZW3A 5BZDB 2X7LB 5F0LB 3T0XA 5I19H 5D1QE 5FO7B 2DTMH 3UTQA 3QUML 5FYLD 2W88A 4CRPA 1T6VN 2LT9A 2X1QA 1I9JH 2ZWKA 5F44A 2DOCA 2KMWA 2VNCA 3CZGA 1ADQH 1KC5L 1K8DA 5DTFA 5IB4B 4HUVA 4OZIA 2PSZA 4N8UA 2QZ5A 4S1SH 4UDTA 3SKNB 3GRBA 5D6CA 5JQ6H 1X4YA 3S3SA 1VCAA 4MKMA 3GSQA 4GG6E 2Z91B 3MODL 2A6JB 4DGVH 3SDAB 1AQMA 4IGBD 4QOKA 4BZ1L 5B21A 3GMRB 2X3CA 5KANI 4AMWA 3MRDA 4A7GF 4U0RC 1HSBA 1NGQH 3MCG1 3QDGA 4FKEA 3FCBA 4EQ3A 2FGWL 3AS1A 4DP6X 4HPOH 4IRZL 3ZDYE 2YK1L 1KUMA 1RAMA 3SGKC 4K8RD 3NIFF 3HG1B 4KMQA 4CKVX 4TUUA 4PWKA 5DD3L 5I1AA 5I0VA 1OV8A 4HAFA 4KY2A 4OTXH 2FNBA 2A38A 2AGJH 1EGJH 2CBTA 4Q97A 3ULVC 2D03H 1NGWB 4OGXH 4BGLA 1E5AA 1WA0X 2CGRH 4LLYA 2ZP0T 5DVPA 3L3HB 3IS0X 2D7TL 4RI5A 4JJHA 2D9QB 2AW2A 1QFWL 4OF0A 5HYJE 4OCSL 2WBJB 2NCMA 3ZGIA 4FFTA 3U9WA 3QORA 3UTSA 4NQEA 5DLMH 3STBA 1Q1PA 1E27A 4HYTB 4DKEH 3L4TA 4YMPA 3GHEH 1ZE3C 3ZTDC 3VFNB 5LGKA 3F9BA 1ZS8B 4WW1A 3NN8A 2YHGA 3H3KA 1AGDA 1MWAA 1NPNA 2NY5H 1ZRUA 5DJAB 3VGAB 3WEOA 3G9AB 3F7RA 3RYMA 5E4IA 1FYHB 1WG3A 1MUJA 4Y2EA 3INOA 1EEZA 1T22A 2ORBH 3DIDA 4Z8FL 3QDHA 3ZV2A 3CU1A 1OAKH 4P3CL 1NOAA 3OAWA 2GJRA 1TPXB 3F7VA 1Q1JH 5DJ6B 3Q2CA 5F1NB 5FYLL 4YJZL 3DX7A 4NC1C 4ERSH 4ICXA 3V0DA 2GK0A 1PLGH 4YLCA 2RCSL 4M6OL 2IOOA 2NY6D 4MWFA 1JBWA 3QIUA 1TYRA 4MCYA 4JY4A 1UB5A 3CX5K 4UINL 5JW4N 2DQEH 4I3SL 3Q1EA 2YPVL 4UIMA 4LCWB 3O2VH 2OYKA 1TFPA 2Y23A 1CGSL 4KRPC 4B60A 3PNRB 1EH9A 1QRNE 5DHYA 2K70A 4KUZL 1HH6B 3ARED 1KJVA 2ZICA 2CCLA 4WUUD 2KERA 1QSEB 5ELIA 3UPRA 1E4HA 3RGOA 3LKOA 4GT7A 4NKDA 2X4UA 3TP4A 2BZLA 3CZKA 1ZV2A 5C0FA 1ZIBA 2IQ9H 1SEQL 4TSBL 1MLBB 4K8RL 2J5LC 4YX2H 4L3EE 1QEXA 4ZZKA 4FMKA 3C60C 1P5VA 4KO9A 3AVEA 1KY6A 3GSUA 3T0BA 3ZR5A 3C5XA 1FO0H 4LAJH 2CRIA 4ZDHA 4KZEH 2NY7H 4Y4KC 1S7UB 4QO1B 2QQLH 1FH2A 4HX1A 4NBXB 3QFJE 1ERNA 4FMVA 4ZO7A 1A6TA 2JFCA 5TQ2L 2IH3A 1KCLA 3LEVH 4B5EA 1N64H 4POYA 2GUOB 5AL0A 5TK4A 5F3BB 3OGCA 3EBAA 3N3EA 4KWUA 5CP7A 1BVNP 1FL3B 3DJRA 2Q47A 2RHEA 4RAHA 3VXMB 3BFQG 5KBNC 5JHDD 5J0BA 3RZCA 5GJTL 1M6UA 3HB3C 4OY9A 1CFSB 5LQBL 3OKDB 4URTB 4CMMB 5FF6B 5K59F 1IC0A 3R4RA 2FEJA 3ZMNA 3HNTL 1KGCE 4G9FB 4OLEA 2UXVA 5KVGH 4XO3A 1BQUA 1TVBB 1YN7B 1O7DC 1YGRA 1VLXA 4PQXA 2B1HH 2J56A 4XPBH 3FUHA 4R7NB 4CADA 3PGDA 2ESVB 3VCLB 1VEPA 2CBPA 2H7WA 2OL3L 4BFBD 3QCMA 4LSUH 1NL0H 3QG7H 4NO5A 5E70A 3SZ6A 2O6CA 3GMLB 2ITDA 4RISL 1OHZA 2ICEA 1H3XA 3QAZB 2NY0B 4J4PC 4QRSA 2B4CC 2CO6B 3CFKA 1EO5A 4PLOB 5E24E 2F1BA 1W72B 3A5KA 5KYUA 3NCEB 3TT3L 1NCBH 3NIDF 1LLAA 1A6UH 1EANA 3RY6A 3GIZH 1XVSA 1H5BC 4RAVB 4RLDA 3UG5A 4H8WC 4J3OG 2QBPA 3MBWA 2VISB 3OKEB 3KVDD 4P2QA 4P4RA 4Q58C 1V7NL 4YHYC 3VFSA 4A2FA 3GSVA 3NH7L 4R0LA 5K39B 2LLNA 2UVFA 4CSTA 3WY2A 4Z7VA 5ID1A 1RP8A 1U8IA 4PRHB 5DHDA 1T49A 4LSDA 2VN3A 3ILPB 2G2PA 3MV9B 4GRWH 3U1PA 3HLAA 3MJWA 5EORL 4DUXA 5JR1L 1OP4A 1L0PA 3VTTA 2XDHA 4FE9A 4ZNEE 1X5YA 4XGZB 1ZLVK 2V7NA 5BW7A 3PAUA 2JK5A 2YPLD 4Y19E 3Q48A 3UBXB 3TOPA 3VB9A 3ATDA 1AIFA 4K4KA 4XAKE 4UBDD 4AGOA 2AJSL 2BIMA 2K7QA 1J8HE 4LSPH 1EV2E 2GBVA 4M6NL 2I9TA 5DHVH 1AD9B 1RXDA 1BLIA 2DKUA 4JHBA 5HPOA 2A73B 4LIQH 3WS6C 1MJ7H 3EZ8A 2G75B 5CJXC 3I50L 4D8PA 5IVXA 2R69A 3SOTA 4N85A 1KV3A 2KLSA 5EWIH 3NACL 8PAZA 3HR5A 2PYEB 4NZFA 3C5JB 5EC2B 3AG3B 5FYKD 2Q9OA 3KCPB 1AE6L 1BQHB 4PJEE 3GMQB 5EU5B 1JXJA 3ALWA 5IJDC 3GM8A 4Z0BL 1E8CA 4AV5A 4DVRL 3D2UA 2BOCB 2NXZD 5D1ZI 5JW3H 1Q9LB 5IB4A 1SXNA 4EZMA 3SKNA 1MNUL 3RWDB 4Y4FA 3JWOL 4IKCA 3DROA 3TPKA 2QGCA 2WKOF 1S2EA 5T1MB 2BO0A 4XCCL 4JFHD 2CIKB 1XR9A 3BEWB 3BEVB 3P73B 5EIVA 4EN3C 1B4RA 4KO7A 4KX8A 2H3KA 1PZ2A 2EDEA 2W60A 3W5NA 4FFYL 1ILUA 4PJ5B 4YXHL 5LB1A 1KBKA 1YYLH 2WAHA 4G5ZH 2W0KA 2BVPB 4NS0A 3ZKMC 1FQ1A 4RRPM 1X9QA 3O3DA 5HVWA 2AZAA 4X50A 3HR6A 3FBKA 1A6AB 3I02B 4M1DH 3LQAL 3W39B 1G1CA 1V05A 4YDVB 4ZQKB 3QC5X 2QADD 2WYIA 4NQCD 2CMAA 1P84K 3WJLA 2DMHA 1OT2A 2QKSA 4EKJA 1JZ8A 4UT6L 4KOBA 3SE4A 3WIFA 5JPNB 2VM3A 5E6ID 4OZFA 2YAFA 4JFQB 3UC2A 1PGRB 2QJDA 3KGTA 3HRPA 4Y4KB 3L3HA 3MLXH 1NIEA 2BWIA 2CCWA 3DARA 4PJXE 1JXDA 4IRSD 2VH5L 1JMZA 4Y1AE 4IMKA 3ZUCA 2X6AA 4UAGA 3ALPA 3G6JB 3ZM2A 4W9ZA 4G7VL 4OGQC 2UZXB 5E6RB 2PBNA 3CMGA 3F81A 1NGXA 1WWWX 2ZXBA 3ZE1F 5AZ2L 1ZT4A 2WVVA 3GZKA 4KKLC 4PY8J 3LV3B 3FFOA 5LHDA 1ITBB 4R7VA 2QBWA 1R0AH 1F2QA 2H3XC 1YEWA 4U49A 1C08A 4YSOA 2WZ6A 4M7LH 4B97A 1FZOB 4GW4B 1NIFA 4X5XB 3BZ5A 4U6TA 3CSGA 2Z31C 4F8NA 1DUZB 4TM9A 4Z7WF 5GRYA 1A4CA 5FYKL 1SHSA 4DP5X 5T3XL 2Z7YA 1J0ZA 3QUGA 2P45B 4KJPC 5F1NA 4AITA 4HD5A 4ZI4A 3IETB 2WLKA 3OKKB 3V0VB 3V4PB 3NPSB 4MQXD 1UXWA 1IB5A 4MB1A 2EVIA 1PYNA 2EZ0C 1JCKA 2WOBA 2V5YA 5FCSH 1G1HA 3EH3B 3GGWB 1F11B 2E0TA 1W0WA 4ZFGL 2OMYB 3B43A 3MLWH 4YHYB 1QXKA 4I8NA 2BERA 1J5OL 1XGPA 3ARQA 3B34A 4FNSA 1IGTB 1WLHA 4OGYL 4F2EA 4AZ8B 3FQ4A 4FI7A 3PDOB 1F00I 1IC5H 2CA3A 4RVBA 1BMZA 3AY2A 3PV6B 4FQ2H 3LDBC 1QSFD 2R4RL 1QSEA 3MGTB 4IW4C 1TJXA 4KJYB 2SHPA 2HX7A 5FYKE 4PHXA 1UATA 2Y4SA 3NGBB 3AT8A 2P5PA 5D72L 3HOGA 1BIHA 4ZW6A 2E59A 2YGVA 1CYGA 2G2RA 2PTTB 4YBQC 2BSSB 2APTA 1IAIL 4EZJA 3WL9B 4WSKA 3EHBD 4PJBB 4BZYA 5C97A 3QCGA 5ABAA 5C09B 3P3UA 3N50A 5BRZA 3C6LA 3F5WA 1KEML 4YNYB 1IQDA 3CQFA 4WKZB 1RI8A 1S7UA 2YQ3A 4QO1A 2FWUA 3BSHA 5CZKA 3RTQB 4H1OA 3U25A 5KJRL 1I1YB 3VXPB 2CGZA 2XQYG 4AEFA 3IF1B 4CN6A 3CIQA 4OD2B 4TYUA 4QUNA 3QZBA 3OKNB 3O9WD 5HDOA 2LU5A 2MQGA 4G6KL 1JGEA 4N24A 1E6OL 1YY9D 3L1OH 4BJLA 4J5VA 1CWVA 4W9FC 3P0VL 1H6EA 1XBOA 2J88L 3FONB 4GKLA 4ZODA 1ESOA 2BSBA 5IMLB 4GIOA 2VDMH 1YN7A 2X4QB 1AO7B 4JEGB 2NDGA 4JREB 2ZUTA 3SO3B 5F88A 2F58L 3BPLB 4RDBA 2AQSA 4KROC 5LXGH 3KYKH 4K9JA 2EIMB 4PJ8C 4Y2DC 2GJZB 1CD9B 1N68A 3GMLA 3TBWB 2P5EE 5CCKL 2DQFB 2BRRL 2NUPA 1E3FA 3BVTA 2GEQA 1W72A 1YECL 1A21A 2UWEE 1BDYA 4WIQA 2ENYA 5GGRY 1UA3A 3BDYH 4LSSH 5F9WC 1BQHG 1KCRL 4KTDH 4QIRA 4S1RH 2ZKXA 5D7HA 2AJYL 2QHRL 3L8QA 3LN4A 1MIEH 1SUHA 2VISA 2ZMMA 2BVUA 5F96L 4M3JA 2E46A 4M7LT 1YNLL 5K39A 2Y7NA 5I23A 2CBMA 5AWXA 4PRHA 2DLIA 2I7SA 3Q6FB 3EYUL 4N28A 3ILPA 2NUTA 3MV9A 1XEUA 2XKNB 1KB5A 4J3XA 2YPKA 1IFHH 4BFIA 1ICTA 4XGZA 4ETQB 4HW6A 1MFEL 3GUFA 4M8UA 1INDH 2XRAL 5GHWH 3UBXA 3LKSB 1U95A 4QPEA 4DGIH 4PG2A 5C3TA 3HPLB 1DVZA 3MBEA 4HCIA 2R2EB 4UQ2A 2AF2A 4HJJH 3WDHA 4ODXB 2MPVA 4A66A 2IGFL 2DH2A 2DBLL 3EYSL 4QHMA 5I5MA 3U6XA 1TVHB 2WN2A 2J2ZB 5FFGA 4NI6A 5DU7A 1URLA 2MH4A 3P30H 3F7LA 3F84A 2WAQA 1QBML 3M7OA 1BM7A 2A73A 4A2GA 3HA0A 2YUWA 4M7JH 4QHUA 3F00A 2JXMB 5EU3A 2ZG2A 4JM2D 2FWOB 2PYEA 3FBQA 5D2LB 1R6VA 4W9DC 3KYAA 4TTDC 4HJUA 5C0AE 4YHIB 3Q3GB 5EU5A 2FK9A 3MV7D 4CN4A 1GG4A 1MCWW 3DGGB 1MHHA 1ZLUH 5GISL 2NOYA 3D51A 4ZMTA 4HC1A 4MDRA 5BZZA 2Y66A 4H44C 2GY5A 4FZ8L 3UC0L 1A65A 1G6RB 4XNYL 5HGDB 3CZFB 3X17A 1E0OB 4C55A 1FH5L 1KXVC 4QWWC 2I07B 2XN9D 3GI9H 3PABA 2ZAGA 3P9LA 4KKRA 5T1MA 1M7DA 3RG1C 3KPNA 2CIKA 4AVJA 3BEWA 3BEVA 3P73A 1JTTA 2PI7A 4Z3TA 4RBPH 1LE5A 2WCSA 5KA7A 5KVFE 3RY4A 2APBA 3K8KA 3LB6D 4J51A 4RFEA 1AANA 5E08L 2CA4A 4JRXE 3QCEA 2Z8RA 1BM3H 4OHIA 5ISZE 3E7JA 3O41B 2VQ4A 2NZ9C 5CR1A 3WJJA 2ZXEB 5CUSL 4ZFZB 2G5BB 2R0LH 1Q8MA 3BGFC 1CD8A 5DEZA 3TLRA 5DYFA 2AFNA 2GTWB 4HPHA 5J6HB 1MFBH 2WNXA 3II1A 4A68A 2C9QA 5L9DH 4AC2A 3QCVL 4ANUA 1U8HB 1QZ1A 3QIBB 3WNJA 1PNDA 2WD0A 5JPNA 3GSNL 5I6KA 2FATH 1VGKB 4YDLC 4BDVB 4ZBJA 2O6PA 2EAEA 4XO9A 3GBNH 2EE2A 3BKJH 5I1JL 5EDSA 3FCSB 2VXQL 4KJWD 4H8QA 4ZX3A 1K3ZA 4FQCH 2X0WA 1RZIA 2R2BB 2R9HC 4FJYA 5KOVC 1IKNA 3G08A 2Y69B 1IKFH 1KPUB 3MOAL 4OGAD 3TTYA 3NQKA 5E56A 2E6PA 3DX8A 3D39B 4QRUB 3RWGA 1FZJA 3PS5A 3QCUL 1LO0H 4IMLB 5F93C 3VFMB 4JRYB 4P2AA 2GPZA 1XV8A 3B2UD 2C9AA 4GRWF 1JIBA 1U42A 4QAPA 4U2YA 3CXDH 5C0BE 2OCJA 1FZOA 3FAWA 4AVIA 5A40E 4GW4A 4ODSH 3FQNB 2KLTA 1IL1B 2AKRB 1ZCKA 4AK2A 3SCMC 3HVNA 4PJ8B 3RFZB 5JNYB 3WLBA 3KLLA 1LQFA 4NN6B 4PFEA 4GWFA 3GMOB 3IXAB 4HFUH 5EIIA 3IETA 2B3OA 4F7CA 4QRPB 3OKKA 4WK4B 2CFVA 1MCOH 2Z7WA 4IM8A 4KTGA 4L8SC 1J05B 1PZBA 1U58B 3U7YH 4WFHD 3N41B 1KGUA 1GHFL 3ULSA 2H45A 1GMIA 5F9WB 3ARGD 3J2PA 3OZ9L 3EOTL 4PGJA 3GXNA 4XZUA 4DN4H 4K5PA 4HGMA 5CAYB 4YR6B 3V55A 2ODHA 2ZXAA 2ZUSA 3RKPA 1KYFA 3L4UA 3SBWC 3ZXAC 5HGBB 1QWNA 1IM3D 3PV6A 2QBSA 2JJUA 1G0XA 4X99B 1EAQA 1X5XA 3MGTA 1BVZA 4Z3IA 2AVFA 1SVZA 2WZ5A 4WI4A 5DC9B 4YZFE 4Q4IA 3CLEL 4HETA 1WA2X 4YAAA 3T8VA 3B3IA 1BXVA 1BZDA 1SYVA 2IFGA 1DBBH 2DBJA 4M43L 5I1LB 4UZUA 2BNQD 2I26N 1ECZA 2K8QA 3JV0A 1UWFA 3FUNA 1IC4H 5IROA 2GFBB 3FT0A 4FKKA 1OHCA 1TIUA 4H26B 1EEUA 4XCFH 5C09A 3S3JA 2HRPH 1CYXA 3K2IA 4M7KH 4OM0H 4YNYA 1GJIA 2R39A 4WKZA 1A6WH 1XR8A 1WITA 3ETSA 4HLZG 3RTQA 1KJMB 1FVDB 2XT1B 1JHLL 4N1HB 1NC4B 2GK2A 2IAND 3ULVH 4YDNA 3VXPA 1AH1A 3JXAA 4U4IA 4DK3A 2QT6A 3IF1A 3KVPA 5CF3A 4OD2A 5HHXL 1CU4L 2AJ3B 1NJ9A 3A5JA 5TE6H 1X7TA 3NSYA 3PHAA 4JKKA 4LEOB 1FGNL 1XF5B 3B7OA 2CNFA 6CGTA 1CFNB 4LDCA 5JIHA 2XXGA 1NEUA 3UJIH 3U4AA 3FHAA 4KV5F 3P02A 1G4US 5EO0B 4Z7NB 1JZ6A 8CGTA 2DMGA 2GT9B 4LLAA 2X4QA 4X6CE 1AO7A 5CU9A 2Q5BA 4UT7H 3WN6A 1K85A 1ZE3H 3G5XA 1IC7H 4CVLA 3OHXB 1U8LB 3PGFH 5F9OL 3E3QE 3GJFK 5CD3B 3SY0A 1L5GB 4EDWH 1OEZW 1U25A 2GJZA 2VXVL 1UG9A 4C57C 2EDMA 5TE7H 4GLRH 2EDLA 4K3JH 4LLQB 1MCHA 1RK0A 1C9SA 3RO1A 3UPAA 1AZCA 3FRPB 2WKLA 1GRWA 3N85L 4R2GD 4XHQA 5BO0D 4F91B 3MX0B 3N42B 3ROOB 1KMGA 2D3VA 3KL5A 3BGFB 1HE8A 1EFXB 5DQJA 3V52H 1CLOH 1OT4A 4ZPTA 4Y4HC 1ZHKB 4OD1L 1DR9A 3L4CA 1BF5A 1V5JA 4D94A 4YBLB 3KWUA 1NIDA 5CLZA 2E4FA 2JKIS 4MRBA 2XWTB 3VFPB 3VYPA 3ZYOA 5IUSA 2VEYA 4M5TA 1N8OE 1FBIL 1OTUD 3AUWB 4ETQA 4M48H 2RF6A 1JCVA 3ZN6A 2JCCB 1EDYA 4QRQB 4LO9A 5FR3A 2XSKA 3LNDA 4PS3A 2C4FT 3TBYB 1URZA 3UBGA 2R2EA 1GMEA 3WKML 4XO8A 4HS6A 3D4ZA 3PPEA 3FT9A 3Q5YA 4AV0A 4Z7QE 1TVHA 1UD6A 4J2QA 3MAWA 1B0WA 2XV6B 4NGHH 1KN4H 2XU9A 3MYJB 4LL4A 4FOMA 2YGQA 4WFHE 1LO2H 3EO9H 4IYKA 5DQDL 3VE0B 3IDIB 1XM2A 2WKGA 3QI9D 2IBZX 2JXMA 4W9IC 3TZVD 1XCTA 1BGXL 2VDOB 3CFEA 4EUPB 1TOXA 2XQ0A 4OFIA 2VEVA 5D2LA 2ICWJ 4LSTH 2FQGA 3ZYJA 1AKPA 5KS9B 1ZK9A 1ZANH 3Q8EA 1I8MB 4YHIA 3MSPA 3Q3GA 3BT2H 3Q5TA 5D5MB 1H8NA 5EZJB 3SCMB 3DGGA 1M7XA 1A5FL 4GQQA 2FJMA 1FVCB 4NOBA 3HG3A 1OAXH 4KO5A 2RA1A 3QQ4B 4IJTA 4LQFL 2GBUA 2DZEA 2ZWYA 4K3EH 2DYPB 1C86A 3ARBB 3CZFA 4PGBB 1R34A 4XNAA 5AVZB 4MFHA 5IFHH 1GFYA 2I07A 3CLFH 5FW7A 1LWHA 5I5JA 2AK4B 4EOWH 3BYTA 4OCYL 3MPCA 2HZHA 2OMBA 4JCMA 5AOMA 3ZSSA 1IVTA 3NZ8B 1AGEB 2Y96A 5ES4B 4DKFH 1IFGA 3VFVA 1Q6NA 5C9KA 2LW3A 3M8OH 3WOVA 2PPEA 2Y9RT 3BWAA 2UV3A 4ZFZA 3V6OE 4YDIH 2G5BA 2IANE 2GC5A 2UY7B 1GQQA 1I9SA 2XWZA 2B4CH 3HPJA 1AS7A 3C5ZD 4OJFL 3V4PH 1WTLA 4DCQB 1DBKH 1X9RA 4GMTL 2GTWA 4NJAH 5J6HA 4F93B 2DQMA 3GJEA 4NNYA 4H8WH 3SGJC 3T0EB 1D7CA 3ABKB 1AZBA 1U8HA 3QIBA 4AT6A 2UUOA 3S6CA 1GGCL 3EG9A 4XMKH 4KXAA 1JAEA 5F72S 4KQ4H 5ENWB 4MA1C 1RUAL 4C4KO 1QI5A 3FCSA 1CMOA 3OAUH 2NNCA 3QO1B 3C6SB 5B22A 2XTSA 4L2YA 3PXHA 1F6LL 4LNRA 3OJ2C 4LF3B 1GPOH 5JHMA 2AK1L 4DPBX 1N4XL 4WFED 3SJVE 2J6EH 1FSKC 3LXAA 2JKRM 5E8PB 4GW5B 4LHUD 4MNGE 4HJ0D 4UU9A 3SE9L 4QRUA 3FT3B 3VFMA 1K9TA 4JRYA 1QYGH 4N0UA 4KHTL 3IJYA 1EVTC 3FFCD 1UYWH 1FPZA 5AB0A 3FB7B 4R4FL 4O51A 3WHE1 2H9GB 3ULUD 1E4XI 4NNPH 3PHOB 4RSVA 4X7SL 2YLHA 4YHNB 2CUIA 4X7EC 5HHOB 1CI3M 3RFZA 4P23A 5JNYA 1K6QH 3WN5B 3EOAB 3IXAA 8FABB 4QRPA 3GRWH 1V3MA 1HDMB 1ZT1B 1J05A 4DHLA 2WCPA 3RUGB 2F19H 1CXIA 5ICYB 4N20A 2Y7OA 1VKXB 2MCG1 4IBZA 1NKRA 4C8XA 4PGCB 4W9CC 3HUJE 4QR7A 1BJ8A 4IK7A 1M3JA 4ZO9A 1MQKH 4Y4HB 1J86A 4J39A 4YR6A 5IBMA 3U7WL 2NLJB 5MEND 2WXLA 4GQ9L 2DI9A 4FYTA 1OOWA 1JRHI 1E4WH 3U96A 3Q1SL 5HGBA 4RMWA 5IHBA 1WE5A 1OE3A 2FECI 3HKZA 3DX3A 3MJ9L 1I1RA 1UCTA 3W0WE 4ZFOL 1IBZA 1G1YA 4XNZC 4IU2B 2X89D 3DK0A 2BPBA 4XC1H 4AQOA 4N6QA 4ZO6A 4YFEA 5I1LA 4HGWA 5LWYH 1PSKL 1BVKA 1N0LB 1R24B 1YAZA 5GZNC 1NWLA 2OMXB 1AXSB 3UGUA 4FMFA 3SDXE 2GFBA 4G59C 2EE3A 3HBPA 3IE4A 4HLZH 3BN3B 1D5MA 3ZDZB 3DHUA 5B4MD 3QJFA 4QF5A 4NSKB 4NZUL 1RMFL 2EC9T 1KJMA 2HLAA 5DT1L 4PJ7B 5HJDA 3SKMA 3K6SB 2I75A 5I8KH 2B20A 1S9VB 2LVEA 3SQRA 1RPQA 4HUMB 4ETYA 3KBFA 3HZKB 2CBOA 1YEJH 1E9QA 4LCVA 3ATEA 1I3GL 1OAZL 5C3IA 2AJ3A 1I53A 3F12B 3RPIA 3RVTD 4Y5XB 4LEOA 1DANT 1FFQA 1MHPL 3MRIB 4HZLA 2YO3A 1CFNA 2IGTA 3PGCA 1HJCA 4ELMF 2HKHL 4APQD 5J5EA 1HH9B 2FUQA 2HG5A 1U2CA 1YJDC 2OSXA 4L3CA 2V5TA 5EO0A 3WNPA 3L4WA 3EXJA 4PJDE 4Q9RL 4ZFFB 2J71A 3EUUA 3PHSA 3EU0A 2GSIB 4UQDA 4BZ2H 4YHLL 3OHXA 4NQUA 1JF5A 3RBSA 3KEDA 3VRIB 4AQ1C 1L5GA 1HYRC 1KY7A 1OM9A 5D1XE 1E5BA 3ULUL 1JK8B 2ZKYA 2NSQA 4F33B 5ACZA 1XB3A 1WA1X 3QXDB 3V95A 1JLNA 2WLLA 4LLQA 4K5OA 1A6ZB 2NX5E 3N1FC 1TCMA 1VEOA 5DLLA 2RMNA 3FRPA 2DI8A 4IOSD 4ZTOL 2BSRB 3ROOA 4NZJA 3MRKB 3FSAA 1EFXA 1GS7A 5GS1C 3S0PA 2KQNA 2WTPA 3EJUA 1ZHKA 2AV7A 1G6RH 3FMGH 3GLZA 3RWJB 2NY1B 5E2UL 1QZNA 2I6OA 5GS0C 1S4IA 1CGVA 3WLWD 1MH5A 1A3RL 3VFPA 2BCMA 4AYGA 3L45A 3CZUB 4PWEA 5DI8B 5CEXB 3QFGA 1S3KH 3UAJC 2BV5A 2JB5H 4QRQA 3QBTB 2XCMC 4TUJA 3TBYA 1Z0NA 5ICUA 2JTYA 5IQLA 1UD4A 5KA0A 5IQOA 3RWFB 1KXQE 4GMSH 3NK4A 4KKBD 5BZWB 1DVFC 1FAIL 2QEJA 4NN5C 1RXLA 2X1OA 4KPHL 1FSKB 5C0CE 4AQEB 1NGYB 5E99L 3QE5A 4Z7OE 1LNUA 1G0YR 3MYJA 4X5WB 4OCLC 5DVLA 4M3HA 5DJ8B 5DUJA 3VE0A 4W6YB 2H6PA 1TNMA 3SGDI 1JGUL 1WZ1H 1R3IL 3UX9B 4EUPA 2W80C 2OM5A 2IQAB 1N3NA 4B04A 5SWZD 3JWNC 3UPCA 2PWHA 1PD1A 1A4BA 2XPGB 2ENSA 5KS9A 1VFBA 2VCOA 2W0FB 5DO2C 1I8MA 2X2HA 3VXQB 4YDKH 1G7JB 2JIXA 1XF2A 1E8XA 3EF4A 3FO0H 3LZLA 4R90L 5EZJA 2Y06H 3ET9F 5FA3A 2IJ0C 3KL3A 5D7LD 4YN3A 4HEPA 3TONA 3VJ6A 1JUFA 3FFDA 3ARBA 5ECGA 4PGBA 4LAQH 2G9HB 2BNUB 5ITFA 1F45A 5MEOA 5HPMB 1LL1A 1KEGH 4PB9H 5LDUA 5HYSA 4XZ4A 3ULVF 4X0KB 4EEEA 1TQWA 1AGEA 3CVDA 4OFPA 4QRTA 1YZ4A 2ALWA 1DVSA 1YC7A 3CMOL 4KHXL 2ALAA 3EAXA 3K1DA 4FQHB 4XN8A 2VEWA 2RGSA 3RJDA 4UNVA 5A43C 2NNXA 5BS0B 3FRUB 2XZQH 3FQYA 4JPWL 2E7DA 5EBGA 4B0MM 2UY7A 1AZNA 5GSRB 3VXSE 1MCCA 4ANWA 4GAYB 4N1CA 4XNZB 2EEFA 4IKNA 1OAYL 2VWEE 5EZPA 4N1EA 2ZUUA 3PYCA 4MB4A 4WSGA 1QR1B 5DJ0A 3O8XA 2V8MA 3WY1A 2H4KA 1FP5A 2BWQA 3T0EA 5K9QG 3ML8A 4L37B 1MDAA 2JVUA 1SJVA 3ARFC 4FP8H 1BOYA 2H6OA 3WXVL 4D0DB 4ZO8A 3KPOA 3LCYA 3B7RL 4NO0B 3WTVA 3KLSA 1FYTD 2F46A 3JV4B 5IHZB 3D3VA 3VD1A 2HFTA 5K22A 1LEGB 3QO1A 1NBYB 2VDKL 3C6SA 4KGJA 4RFOH 3ZUNC 1JXFA 2XYCA 3KNBA 4WNJA 4XX5A 4PRPA 4XMPL 2VERN 5KVDE 3IFLH 4RZCB 1Q6TA 1NWEA 3LD8C 5AVQB 2L4OA 4M93C 1W7KA 3MUZ1 1VJSA 1PDKB 4XB7A 2YKLL 5EUOE 5IB5A 2AQNA 4PJAB 3MV8D 2DQ6A 2YZ1A 1YPZE 5INCA 1MFAH 3UZVB 3W9EB 5GZOC 1TQTA 4LFHD 1MFUA 3N6YA 4WK0B 5EEVA 3OLGA 4Q9QH 4QAHA 4XXDB 1Z9SB 1LP9F 3B5GA 1QNZL 4JNXA 1LD9B 4YHNA 1LILA 1A7QH 1ACXA 2D4DA 3FTYA 5CZVL 4IBVA 4AQ1B 5IQMA 4I0KA 5C92A 3WN5A 5TQ0H 3N44F 2OMWB 3EOAA 3MNDA 4NLHA 1ZT1A 4G11A 4UT9H 4YXLH 3HFML 1G7LB 4N90D 4FXGC 3WMPA 1NMBL 4ZUVB 3VH8B 2NSMA 3VW3H 5ICYA 4KZDH 2F7OA 2CM2A 1RJZB 4GFXA 3H42L 1KJ3L 4L48A 4PGCA 3KPQB 4P59H 3W57A 4EMZA 5BOJA 4K94L 1SMOA 3ZMEA 5D1QC 4XMVA 1QAWA 3JTTB 5CJQL 3T65B 3UCQA 1YEEH 2NLJA 2FX7L 1HWGB 4W4NA 4F7EA 3FT4B 1IBBA 1NA8A 4YL4A 3FUJA 5BQ7B 5LNDA 2I4GA 3L95B 2C9XA 2XXMB 4ZS6C 5GQBA 4ALAC 4MAYB 1MCLA 1YCSA 3G6JF 1GZPB 4N9OB 5IQNA 4X98B 2PR9A 1ECVA 1HHKB 4JCWA 4UIKH 4XP6L 2BCKB 2A7BA 1CGUA 2F1EA 2ZONA 4LPWA 4CGTA 4AKQA 1A1MB 3HFFA 5JHLL 1N0LA 1R24A 1CS6A 2LLGA 2C9PA 2OMXA 2MKLC 3FL7A 2IOMA 3EDKA 4L1SA 3GSWB 1EJ8A 1PLBA 3V5KB 4I77L 1XGQB 2Y2FA 1I9EA 2GSGA 4XB3A 4ENEC 4HJPA 1VADB 3FQWB 2HNQA 2JFHA 3H2QA 4Y8DC 4NSKA 3TN0C 3K6SA 2NXYC 4PJ9D 4ENZA 4K23L 1R5IB 4NWTL 2I1YA 3QUZB 2C3GA 4G80A 3UYPB 2H4EA 3GBDA 4JO3L 3RL2A 2QVIA 4W9JC 4LEBA 4NQDB 3GYRA 3F12A 4LOUD 3VRLF 2F6YA 4Y5XA 3BZEB 3X1FA 4O2CB 4DFHA 4NO3B 4QEGA 3A47A 1A64A 1UACH 3G9VA 2NY4D 1HH9A 2OW7A 1DO6A 4AUJA 3LZRA 4PIBA 4KKNA 1MAMH 5LCVA 4ZFFA 1MIMH 1T4WA 4J28A 4MXQD 1EXGA 2LFGA 2X1XR 3LX9A 5JOPE 1UWGH 4NZRL 4P0DA 3S88L 4PRIB 1ZDSA 2HTKC 3IN0A 3MR9B 2VDOH 5F21B 4Z3HA 3VWKB 1ZLEA 4ONHA 4O4YL 4OD3L 4IOFC 3MCYA 1JK8A 1QEWB 3CZLA 3MHZA 4AYMC 5TFSL 3CXHK 4HIEA 2VLKE 3Q5OA 2JKNA 2Y2WA 2B2XL 1NCUA 5B7FA 2P7TA 5DVMA 4KJQD 3TVMD 2BSRA 2DW5A 3HMXH 5G4NA 3MRKA 12E8L 4PCTA 3DK2A 4U1IA 4PJBF 4RIRB 3VYNA 3DO4A 4EI0A 4S2SA 1H8OA 4RX4D 4M6AA 3CX5J 3K2MC 4JGJA 3S37H 1JFQH 1NCCH 5CEXA 5DI8A 1FJ1A 4BWUA 4ZPVB 4N25A 4G7QB 4WTYA 4JZNB 4G1MA 2YEQA 4BUHA 4C56E 1B2YA 3HC2A 3OQ3B 3ZHNA 1M4KA 1XIWD 1FFNB 3NCCB 4HXAH 4I4WB 5BZWA 3D4GA 4RMTA 1DVTA 1XO8A 2YD3A 4W9HC 2ZX9A 3SDCB 3TCXA 3FO1A 3H55A 2OFQA 1NCIA 1NGYA 3LD8B 2WQAA 1G7IB 4HT1H 4M02A 1U8QB 4H8HA 4M93B 1BVNT 4H13C 4XNDA 5AD0B 2PWGA 5DJ8A 1N67A 2OZ4L 2PCYA 3KS0J 3K2KA 3NSXA 4Q52A 1GWZA 5LKNA 1RZKL 4XCEB 1RZPA 2VMEA 3IFPB 2XJKA 4DERA 2IQAA 3EYFB 5D2NC 4UNTA 4BRVA 4ODTH 4FLHA 3CDGA 2W0FA 1JDDA 1U92B 2VLLA 4PS4H 4ZFQA 1JYXA 1G7JA 1TQCB 2NTFB 2Q8BL 3D0VB 1HOCB 1RLBA 3FO9B 1SY6A 4WW2A 3CFQA 3O0RL 1GYVA 2DEYX 3ZE0B 9CGTA 3R0NA 3DVFA 1JZ3A 1CXKA 4FXGB 2ICES 4QTFA 4R4BB 2G9HA 3P3TA 2IGLA 3GB7B 4IGBC 1RP9A 3AQYA 1X5HA 4GUPB 2K8MA 3LKQB 5D1QB 2DICA 1U4FA 5T1DL 1NEZA 4QJ3B 4DZ8A 4L5FE 3NZHH 1KLFA 4GAGL 1ZLUK 3LPFA 4WSJA 2EIZA 1LO4