2B4UA

Structure of the c252s mutant of selenomonas ruminantium ptp-like phytase
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
314
structure length
314
Chain Sequence
TVTEPVGSYARAERPQDFEGFVWRLDNDGKEALPRNFRTSADALRAPEKKFHLDAAYVPSREGMDALHISGSSAFTPAQLKNVAAKLREKTAGPIYDVDLRQESHGYLDGIPVSWYGERDWANLGKSQHEALADERHRLHAALHKTVYIAPLGKHKLPEGGEVRRVQKVQTEQEVAEAAGMRYFRIAATDHVWPTPENIDRFLAFYRTLPQDAWLHFHSEAGVGRTTAFMVMTDMLKNPSVSLKDILYRQHEIGGFYYGEFPIKTKDKDSWKTKYYREKIVMIEQFYRYVQENRADGYQTPWSVWLKSHPAKAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords myo-inositol hexaphosphate phosphohydrolase
publication title Kinetic and structural analysis of a bacterial protein tyrosine phosphatase-like myo-inositol polyphosphatase.
pubmed doi rcsb
source organism Selenomonas ruminantium
molecule tags Hydrolase
total genus 99
structure length 314
sequence length 314
chains with identical sequence B
ec nomenclature ec 3.1.3.72: 5-phytase.
pdb deposition date 2005-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14566 PTPlike_phytase Inositol hexakisphosphate
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1690 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2b4uA01
3.90.190.10 Alpha Beta Alpha-Beta Complex Protein-Tyrosine Phosphatase; Chain A Protein tyrosine phosphatase superfamily 2b4uA02
2CM7A 1YWFA 3LJ8A 3I80A 2SHPA 1WRMA 4QUMA 1ECVA 5KA2A 3ZM3A 2I3UA 3CWEA 4D3PA 3GXHA 2J17A 4QBEA 3F9BA 4BJOA 3ZMQA 1JF7A 4GE6A 1PA9A 3QCBA 2C46A 4YAAA 2RF6A 3ZM1A 4WU2A 1R6HA 4S0GA 2F6YA 3NMEA 2Q47A 2AZRA 3RGOA 2VEWA 4JMKA 1NWEA 2I1YA 4OHIA 5K22A 1L8KA 1WCHA 4ZRTA 4KYRA 1J4XA 1YTSA 1C87A 2NT2A 1NO6A 5KADA 4DGXA 1PTUA 1LYVA 4RI4A 2PSZA 2HNPA 4I8NA 2F6WA 3H2XA 1T48A 2B4SA 3QCDA 5KA8A 3RZ2A 1OEMX 2OZ5A 5KACA 5IBMA 1YPTA 3A5JA 1LARA 1OEOX 3I7ZA 2C7SA 4H1OA 1G4WR 4TVVA 2CMCA 5KA1A 2B4OA 3OLRA 1XRIA 3V0IA 1PTVA 4KYQA 4PVGA 2QEPA 3AWGA 4OHDA 3BRHA 2HCMA 2HY3A 1C86A 1WAXA 3QCLA 3V0GA 3QCCA 4GFUA 3GXGA 3S3KA 3B7OA 1PH0A 1U26A 2NTAA 1I9SA 5J8RA 1XBOA 1XXPA 2MBCA 2HVLA 2I5XA 1Q6NA 2Q05A 4RI5A 1AAXA 2AHSA 2H4VA 4OHEA 2VEUA 1D5RA 3BLUA 4ZN5A 5KA3A 2PBNA 4OHHA 4PYHA 5IBSA 2NT7A 1T49A 2F6VA 1PTTA 4RH9A 1ZCLA 2BGEA 2JJDA 1OEUA 3S3HA 3D1HA 2G59A 2F6FA 3V0HA 1RXDA 3QCNA 2I6IA 1YTWA 4GE2A 3QCEA 5EHPA 2CMAA 3V0JA 2H03A 3O5XA 4Y14A 2VEXA 3QKPA 3V0DA 1PTYA 1YGUA 3QKQA 1P15A 4H34A 3QCIA 1OESA 3QCHA 2F70A 2H4GA 3O4SA 2B49A 5HDEA 4MBBA 2PQ5A 2FH7A 3ZM0A 1ZC0A 5KABA 5I6VA 5M43A 2NZ6A 2I3RA 4GWFA 2ZN7A 1XXVA 2I6OA 2QBRA 1FQ1A 5KA7A 1M3GA 4QAPA 5MMZB 3D42A 1OHCA 3F9AA 5LXQB 3S4OA 5KA4A 5KA9A 2F71A 2PA5A 1YZ4A 3QCFA 2Y96A 4NWGA 1G1GA 1Q1MA 4NX8A 2H02A 2P6XA 3D9CA 1OHDA 2BZLA 3U96A 1G1FA 2A8BA 1X24A 5K24A 1QXKA 1VHRA 4D3QA 1U24A 2QCJA 4Y2EA 3EB1A 3N0AA 2GWOA 3S3FA 4J51A 2VEYA 2Y2FA 3O4UA 2G6ZA 2HNQA 3O3LA 2I42A 3MOWA 4D3RA 2HB1A 5K9VA 1FPRA 1FPZA 2QDCA 2VEVA 2ZMMA 3AWEA 1YN9A 2I4HA 4QUNA 2PI7A 3EZZA 4WTYA 2BGDA 4GS0A 1PYNA 4ICZA 4ZI4A 2IMGA 4R0TA 1PXHA 2B4UA 3F99A 4HRFA 2CNFA 2E0TA 3V0EA 2CFVA 4HJPA 1OHEA 1T4JA 2BV5A 1OETA 1Q6SA 3QCKA 3RGQA 2WGPA 2P4DA 2GJTA 1KAVA 3BM8A 2OC3A 2OOQA 3SMEA 5BUGA 1NL9A 1OEVA 2YDUA 2I6JA 2CNEA 5K25A 1I9TA 2I6PA 4NWFA 2I6MA 2CJZA 2R0BA 3MMJA 4Z6BA 5K23A 2I4EA 2CM3A 1NWLA 4NNDA 3V0FA 4QAHA 2I75A 3MOZA 1RPMA 4JNBA 4BPCA 1PA1A 1G4US 1NNYA 2HC2A 3D44A 3RO1A 3SR9A 5BX1A 3A5KA 4IKCA 3ZMPA 2J16B 5BZZA 1XM2A 1C84A 1GWZA 1U25A 1EEOA 2A3KA 4RKKA 2QBPA 4JMJA 1ZZWA 2B3OA 2CM2A 1YTNA 4R30A 2I4GA 1NZ7A 1A5YA 1GFYA 2QBQA 3O4TA 1Q6JA 5KA0A 2CNHA 3ZM2A 2CMBA 2FJMA 2B4PA 1Q6MA 1JLNA 1G7FA 2B07A 4WU3A 3ZV2A 4HJQA 3F81A 2CM8A 1ONZA 1QZ0A 2PT0A 3EAXA 4ERCA 4AZ1A 1MKPA 3M4UA 2HXPA 1ZCKA 2BIJA 2NLKA 3BLTA 1LQFA 4JBCA 1BZHA 1BZJA 3S3EA 4RDDA 2HC1A 4KI9A 4R0SA 1G1HA 2DXPA 3CM3A 2ESBA 3PS5A 1L8GA 1Q6PA 1C88A 4YR8B 2QCTA 4GFVA 5GTJA 1KAKA 3QCMA 3D1QA 5AWXA 4RHGA 3AWFA 2F6TA 1YFOA 2GP0A 3EU0A 4B04A 4DGPA 2NV5A 3D1OA 1ONYA 2H04A 4GRYA 4OHLA 4GRZA 1YGRA 4RH5A 2OUDA 2QDMA 3EMUA 1V3AA 1SUGA 1BZCA 4WOHA 3F41A 3QCJA 2FJNA 2H4KA 3QCGA 5KAAA 2F46A 1EENA 2QBSA 1Q6TA 2F6ZA 4QBWA 1G7GA 1I57A 3I36A 5BZXA 5K9WA 3OMHA 2M3VA 1C83A 4GE5A 2QDPA 1C85A 4NYHA 2CNIA 5EHRA 2J16A 2CNGA 3S4EA
chains in the Genus database with same CATH superfamily
2ZFHA 3ZO7A 2YWHA 1EETA 1GEHA 4J9PA 2ATLA 2UUBF 2W25A 3K89A 2CDQA 1R0CB 2LQ8A 2O66A 2HK3A 4GE6A 3J7ZT 4C8MA 2DPJA 2MZRA 4USMA 1HHSA 3MECB 1WDDA 1YRUA 2AZRA 4O0NA 2QSWA 3ELHA 2RQ4A 2V2KA 3C6TA 5KT5A 4MKVA 2A1BA 3R5JB 1S1WA 3DM2A 3IM9A 4DGXA 4KKOB 3CUNA 3A8EA 2AX1A 1PC5A 3ZZ0A 1HNVA 3EJMA 3TJ8A 5IBMA 2C7SA 1H72C 4DL7A 2CPEA 4DU7A 1UPMB 4KYQA 4L3KA 2BOPA 1C86A 3OSNA 2HGLA 4AUKA 1PJ7A 1HPZA 1CJTA 1F0XA 1Q5YA 2NXCA 4ID5B 4RW6A 4K4WA 1N54B 1TL4A 1KN6A 2KXNB 3PO5A 4QF5A 1M5KC 4OYPA 3J81U 4RWXA 1DQ9A 1SI9A 4ZLNA 4X4OA 3OUYB 1PC4A 4Y28C 1SH0A 4ZN5A 3RU0A 2ZNZA 1JLAA 3ENWA 3GSIA 5ETSA 3W65A 2F6VA 1VBYA 4X4SA 1WC1A 3HO1A 2BGEA 2XC9A 3ZM6A 3KYLA 4K4VA 1YITS 3TX0A 1RBOB 2R7QA 4ZA1A 2DHSA 4O3QA 1RT1A 3KDNA 2EBGA 1XC9A 4IR9A 1FKAF 5E41A 3TX8A 4NYPA 1P15A 1RP5A 5EN1A 3QCHA 3GR1A 3HHKA 4TY8A 3LQVA 1YX2A 4IG0A 1LWEA 1LKZA 4GWFA 4PG8A 4UTGA 4WCEQ 3OL9A 3D42A 1X9SA 1RISA 4AL6A 1IKWB 3DMJB 4RW7A 1C4AA 2DR8A 4U9RA 3JTNA 1N5YA 2YKAA 2MJNA 3I4PA 1IR0A 2G6ZA 2HNQA 5FJ4A 1XMQF 4TY9A 1HBOA 2I42A 1RT3B 1VOMA 2XMMA 2Z57B 4NASA 3RRHA 3FQKA 2NLWA 4BUCA 5DM7Q 2VEVA 1WKJA 4ZK7M 4A8OA 5DG7A 1YJUA 2MZQA 3UD3P 4WTYA 4YFUA 3CCES 3TUJC 2YKNB 2G2YA 2XSJB 1H6KX 4PZVA 2MB0B 4OHWA 4R0TA 4ZJQA 2KT3A 3QNWB 4Q8EA 4ZCIA 1SC4B 2F9JA 5IXUA 1LWCB 3JQKA 3MM6A 2Q6BA 3H8YA 2NCKL 3VAIA 5J1PA 4WTOB 1BQNA 1TMMA 1RKJA 1RA7A 3KG0A 2L9NA 4WPAA 1KBRA 2V50A 3ULHA 3PV8A 2CJZA 3P4UB 3L7PA 2B5JA 5ETMA 2WRMA 3MOZA 2R8HA 4F3MA 3FCWA 3PKMA 3IAS9 4RW8B 3TRGA 5HMYA 5KG7A 1ZH5A 5H9FJ 3JXOA 1M0SA 3IBCB 2J0WA 2FC8A 3JSYA 3R5AA 5RUBA 5DM6Q 2ROGA 2VPXB 2CQGA 2FHOB 4HJQA 5IV3A 3QT8A 1U6ZA 5A8RA 2D7SA 4AZ1A 2M70A 5B0GA 4X4PA 4O4RA 2RS2A 3UN5A 1EHWA 1E8CA 5DETA 2XY5A 2BW2A 4KI9A 2OI2A 3HD2A 4K5RA 2NPFA 2C2OB 4DWIA 1CULA 2DGXA 1RAEB 1S1XB 5L46A 3BO3A 4KFBB 2WVEA 2GQQA 4B9VA 1Y11A 4OI1A 2VDHA 3ZM5A 1T0TV 1FRXA 1S0MA 1JMTA 1SC6A 3CDAA 2XM3A 3JSBA 3MEDB 5KT6A 2W4DA 4WFAQ 4JI1F 1SJFA 2E5LJ 1R8BA 1RTZA 3CD6S 3MAAA 1QTMA 1YDLA 2HQGA 5KAAA 4YN3B 1KTVA 2QBSA 3UDCA 1VHFA 3TEHB 2W8LA 2POKA 1TV6A 3CDUA 4DV5J 2E29A 4KBIA 2CPHA 2C3PA 4UOGA 2ZKTA 1TKXA 3PY8A 1Q8LA 3CD5A 3IWNC 4ZVOB 1BWEA 3ENVA 2G2ZA 4DLEA 4MKYA 2EFPA 3R3TA 5F41A 3DRRB 2PC6A 4ERDA 1VFJA 5E3AA 1GMWA 3M9MB 2SHPA 4AQYJ 3OXLA 4UW2A 2Z30B 4B3SJ 1UWAA 2V67A 5KG0A 5KT2A 1EETB 3QZ7A 2EK6A 2J17A 1TL1B 3HFZB 2BRKA 4DJBA 5H1SV 4BJOA 3OFGA 3NGUA 3GJTB 3HX9A 2MLYA 3BS9A 4UOHA 1X9WA 1RXOB 4KV8B 4CM0A 4O3SA 4NA1A 2VOSA 1S5ZA 4ID8A 2KG0A 3ZTRA 2IMOA 3H5YA 2ZBCA 4XO0A 3B54A 3FFIB 2CPYA 4B9MA 4IO1A 2HRTA 4YY3J 3FSXA 3G82B 2QMXA 2VA2A 2OIHA 1XERA 2CZVC 2XI2A 2CQCA 4F8RA 4YR2A 4LF9F 3QCCA 2UXBJ 1XEZA 1XBOA 4AQYF 3DI6A 4B3SF 1AW0A 4RW6B 2COLA 5J2PA 5KFVA 3M30A 3CC2S 2EK1A 1U1OA 2VEUA 3BB5A 3OXGA 3NCPA 2F3JA 1FT8A 5KG1A 4IDKA 4P7TA 4DPOA 1SIZA 3QWUA 2VTEA 4CO2A 2XMVA 1QVGR 3ZZPA 3CO0P 2IC3A 5K20B 4LR8A 3MM5A 4USVA 4YB5A 3UD4P 3RR8A 1NDKA 1U09A 3QT6A 2AZ1A 4WE1B 4YY3F 3DOKB 3M8PB 4DX7A 1DQ8A 4YS2A 3QKPA 3LP2B 1RT1B 1XMOJ 4LSLB 2EKNA 4C8ZA 2F70A 4LF2A 4CLPA 2UXBF 3O4SA 4BWJA 5GMEA 3ZM0A 2FH7A 1NBEB 2LECA 1WEZA 2HEKA 3RRKA 1HHTP 3DOMB 5FIIA 3VAHA 3NNCA 3VF0B 4LF7F 2VD3A 3T3FA 3OR1A 4KPCA 3N01A 2RUSA 3MM7A 2VKRA 4CO1A 4JI0J 2JFGA 1QSSA 3N0VA 4L75A 4G1IA 2R7UA 2UUOA 2HAFA 4TU9A 1KVKA 2VBYA 3T5KA 2B8PA 3T1HJ 1JLEA 3O3LA 3R6GB 2VJVA 4NXMJ 2HB1A 5SUHA 2IAJA 3EVOA 3KNGA 3VV2B 2KFYA 3C46A 1XMOF 4I2QB 5L8RC 4FKXA 3EZZA 1FRMA 4ZVHA 1XQIA 1WSVA 3PYDA 4OJ3A 3A3PB 1NHKL 1VQ9S 5HN0A 2DTJA 2VG5A 4WP9A 3SQGB 3THTA 3QCKA 3RGQA 3R2DJ 2WGPA 4R8UA 4NX9A 1BD6A 4MT1A 2H4YB 4JI0F 1H73A 4DSIA 3EM1A 4DSFA 3DLEB 2FB0A 1T9TA 5F0WA 3UW1A 3UDEA 5CABA 3ADAC 1RT4B 2M0GB 4F26A 2RILA 2WW4A 5HLFB 3PX4A 3M8YA 3T1HF 1U47A 2RDDA 4NXMF 1R0BG 2VODA 5JVHQ 1NDPA 4DR4F 1IBLJ 3DLHA 5KT7A 3CVKA 4PQAA 1K44A 2Q3PA 4YDDB 4X2BA 4P74A 3KHLA 3MCNA 2I4GA 1G2EA 2DHHA 3UCZP 2W7PA 1Q6MA 1FRJA 5ETPA 2DGVA 2W9AA 4I4BA 2YNFB 4WZQA 3GV7B 2JZ5A 1OPIA 2HXPA 1NPPA 3BR9A 1F2HA 1GTEA 1FKOB 2YKMB 2KG1A 4NCGB 5I3QA 3CCUS 2KM8C 4PWDB 2HPUA 2IMWP 4QW9A 5I3UA 2GQCA 1HA1A 4D3GA 4HI2A 2FQQB 1XNRJ 1S76D 2PEBA 2QLXA 3P8BB 2LQBA 1DTQB 1L3KA 2DXDA 4JB8B 4P2XA 2UUPA 1IBLF 4TYBA 5DQIA 3V4IB 2OUDA 1E6YB 2ILYA 4H54A 4RBTA 2FLLA 2FJNA 1MW7A 2Q6CA 4G1QA 2DRDA 4E0DA 3QIPB 3LOUA 4F4XA 2WVDA 3DRPB 2JX2A 3SXLA 4X4TA 2VORA 3U1MA 2VTDA 2VPWB 2VUGA 4ES1A 1YTYA 1HNIB 3IS9A 4M5MA 4ZP8A 5LMUJ 3CULA 3PYEA 3SCKE 1YWFA 1NK6A 4IFYB 2W24A 1FCAA 2FGCA 3N79A 3F44A 3OJUA 3D0IE 5IT0A 3LPYA 5DGBA 1RTHA 2OMLA 3V81B 1XTZA 2HW3A 2BE9B 4WU2A 4S0GA 1FRLA 2AT1B 4PQUA 2UVVA 1XNRF 2J9DA 2KYXA 3S01A 1VRUA 3E01A 1JBWA 2KHDA 4WIQA 1WCHA 1TUVA 4KYRA 4DR5F 1HBMB 3BN7A 2HHQA 1RT5B 2DGQA 3FJ2A 5ETTA 5C42A 2KVQE 3HLUA 2VASA 2GJFA 3C8YA 4HACA 1NJIT 1UJ4A 3EE3A 3PXGa 2EG2A 2D69A 4Q44A 2JL9A 4A8XA 4L3NA 5GAGU 4ILMA 4H4OA 3QGPA 3DGPB 2QEPA 4ER8A 3BEGB 1WAXA 4I6YA 2EWHA 4GFUA 2HZVA 3DRXA 2LDIA 2Z8QA 1KEKA 1JXLA 2BR0A 3LA0A 2PA3A 1JWWA 1AXQA 4LRBA 2DT9A 4OHEA 2O3DA 5KFSA 2IIHA 5IOLA 4NEZA 5JUMA 4IDKB 3QPIA 2RB7A 4N41A 3NBPA 4LJMA 3CT9A 1SVDA 2N82B 5G4DA 4B3OB 3V0HA 2DIVA 1VK8A 1FWLA 5HQLA 2ILZA 5CH7B 1YTWA 4JI2J 1RA6A 4N76A 4P71A 3BDPA 4OHYA 1W78A 1CJVA 2F7VA 2HHTA 4C11A 4G6VB 1VISA 3PRBA 5HDEA 5IWAF 5EWEA 1C1CA 5KABA 4MYUA 2AJ4A 3EMTA 1XXVA 3J81Y 2QBRA 2EC0A 2QL7B 3D3CJ 2AJQA 1V3SA 5LSRA 2V9WA 4AL5A 1VC6A 4JI3J 2BE7D 5DG8A 1RT6A 1HBUB 4C13A 4X64J 1RHKB 1GT8A 1AYEA 2NXJA 5D4LA 1U8WA 2LU1A 2JH3A 4LUBA 1IWAA 2HYIB 4IYQA 1S6QB 5DQGA 2IRUA 1YJTA 4OZ1A 4TN2A 3M32B 3PM9A 2XLIA 3N0AA 3A8IA 2ZHOA 3HFKA 4J51A 4N7TA 1ZPWX 4JI2F 2JNJA 3DCAA 4F2SA 5FDLA 4DCOB 2KHCA 4PXEA 4A8FA 2ZMMA 1UTAA 2ZZNA 4LF5F 3UVJA 2HFUA 4QUNA 3N5BA 3MR6A 2R7XA 5ITHA 4Z7CA 3BM7A 1LWFA 2MQPA 4N56A 2XQCA 3MMCA 1V3ZA 3MR7A 1NUEA 5ETQA 1Y3KA 3E8OA 2QMWA 5I3PA 2CFVA 3TAPA 1RHQB 2V94A 1YRXA 3OTCA 3X3UA 2WONA 2GJTA 5BYRA 2OSQA 1OEVA 2Y67A 1NMEB 1I9TA 3NL0A 3MMAA 4B9SA 1H7XA 3PYGA 5H9FK 1TELA 4CT9A 3HVTB 5D0EA 1HWJA 1URNA 3PG9A 4QAHA 3P49B 5KFTA 2JOQA 1PA1A 3H40A 1M1GA 2I38A 3HFVA 1NKBA 4JI7J 3W1YC 3D6TB 2NUUG 2QT7A 4KH0B 5KFOA 2C3OA 3LP0A 3I0RB 1Q16B 3KKFA 1HNZJ 4KPYA 3KJVA 3POTA 4L74A 1T9UA 2Z4PA 1VRQC 2WK4A 2C2RA 2CM2A 2OPSA 2Q1LA 1GQEA 1U7LA 3H90A 2B07A 3OFEA 3BO4A 3CCRS 5IC6B 2RQCA 2R9LA 1UEVA 1YBTA 3EAXA 4OYAA 2XO6A 3J7Z5 4OV6A 2CQHA 1IN0A 4ICLA 1NAQA 1PG5B 3K59A 3SSSA 3OR2A 4NLSA 2HC1A 2K7JA 2ASYA 1Q79A 1VBXA 1C88A 2B7BB 3IRXA 2CQPA 1FFWB 4JI7F 1EARA 4QU6A 4DR1J 3DOLB 2F8HA 4R0JA 3UI3A 1O0PA 1HNZF 1OIAA 1YKWA 2PO4A 2PDAA 1CJUB 1O8BA 1S7HA 1WI6A 3FC9A 4ED8A 4MMOA 1Q6TA 4O4GB 2VIHA 1RTIA 2BVZA 3GU0A 4M5DB 5D6GA 3D68A 4ZIWA 3ZZTA 1HBNA 5BR8J 2CNLB 4GE5A 2XMTA 4ELTA 2XS2A 1YBUA 4LSNB 2FVQA 4R5PB 4C3MA 3M6WA 1S0NA 2LA4A 2MZ1A 3W2WB 5DDOC 3KUEA 5GVQA 5C5JA 5DDQC 2M8HA 1CJKB 3NS6A 2RF6A 2DEJA 2VQEJ 4DR1F 2KU7A 1ZM3A 1UFKA 4XPCA 3DDIA 3MD3A 1VRUB 1NJXA 3DYAB 1C87A 1NO6A 5KADA 3NWRA 1D09B 1D1UA 3RAXA 1AFIA 1U1LA 2OPPB 1FDBA 1NNDA 2V8VA 1VQYA 2KB2A 4XDDA 3N28A 3OW2R 3THVA 5M2UA 3BRHA 2CJAA 2ADCA 5BR8F 3BF4A 1RTDB 4W98A 4NLWA 1OY8A 2M9KA 2E7VA 2VZ9A 3D3BJ 3OXFA 4CTAB 4LF6F 2NZCA 2JC0A 1SV5B 2MY7A 4DS4A 4P9SA 2YPZA 4NXNJ 2M3DA 2CA9A 4K4ZA 1X31C 3CTRA 1HD0A 2VQEF 4X66J 2AHOB 2HFZA 4OHXA 3DU6A 2R7OA 1T49A 3MWBA 1YJ9S 1RYSA 1Q8KA 2BE2A 5AXNA 2F6FA 2RMLA 2AYBA 2G0CA 4Q2LA 5DDRC 1LWXA 4O44B 4URGA 3QCIA 4P72A 2J6SA 1OESA 2L9WA 8AT1B 3QMQA 3NOGA 4WFZA 5ETLA 1ZBTA 1GFWB 2QA4G 3RRGA 5KA7A 1M3GA 1TTHB 3QO9B 3KHRA 2GHVC 1SB6A 4Z7YA 4LFAJ 2HQCA 2UZAA 4CLKA 5AE3A 4NXNF 1P9YA 1Q1MA 4WKYA 3D2WA 3FKBA 5KG3A 4F4WA 3CIZA 3QRRA 2QCJA 4ZP6A 2M88A 2H9ZA 3KK1A 2E1MC 5B09A 4ZVEA 4U96A 5E3PA 1P3DA 1EP4A 4RPFA 2W2MP 5E3CA 2YNGB 4NLOA 2RS8A 2IVFB 2HLTA 2V9KA 4C9DA 4HYKA 4HI1A 4JYAJ 1SKWA 2I4HA 2E5JA 2IJNA 1VYAA 2EEYA 4ILLA 5DZ7A 5A6WA 2ZH6A 1HLWA 3F99A 3MMCB 1B4SA 4HT5A 3BGFA 3UCGA 3PX0A 2CQ4A 2B9XA 4IRDA 1DJ0A 1S6PA 2W1BA 1GXLA 3M9NB 1RK8A 2FGOA 4J9QA 1WC3A 1VQLS 4E98A 3HJFA 4IH6A 2I6PA 4G3IA 5J2NA 2I6WA 2OMOA 3VAGA 1EZZB 2MHEA 3SEOA 2DPIA 2XZTB 2CM3A 2F40A 1RHMB 5CCMA 1RPMA 1O6XA 6AT1B 1G4US 1T11A 2HBYB 3AHPA 3TWZA 1IBMF 1AUSL 1FDAA 1N32F 1NPKA 3MMBA 4JYAF 3ZZRA 1XWLA 1U25A 2VDIA 4NL5A 4B9LA 2GZOA 2FD2A 2K1RA 3HJVA 5CQGA 1Q8BA 1A5YA 1Q7LB 1E6VB 3V6HA 2UU9J 4XK8C 2BJ1A 5L38A 1UMJA 4WK1A 4P2MA 1SL0A 2QFJA 5AE1A 2MKYA 3WIUA 4IFVB 4HTIA 3EPGA 1L5UA 5A0YA 4PUOA 1JLFA 3K2YA 4PYAA 2DH8A 4EYHB 4O3OA 4ED5A 1J5OA 3NXZA 1J27A 2QCTA 4NLDA 1JJ2R 3I5AA 5D8HB 5GTJA 2HLUA 4LRDA 5AWXA 3G6ES 5HMXA 4J91A 1QE1B 4DG1A 3FEZA 2HNYB 5J2QB 2H48B 1S9EB 1A9NB 3CJ2A 4GRYA 4UQGA 3AOCA 1HWLA 4USIA 3P96A 3Q8RB 4JI4J 3LGHA 2H4KA 1IKVA 4DFJA 2FY8A 5CD4A 2XI3A 4WJBA 4UY8T 3JYTA 2G1DA 2DGWA 4WFXA 5IQ6A 5JVGQ 1FJ7A 3JS9A 5A6PA 3HHDA 4C7QA 2NSBA 1S48A 2ZD1A 2IFXA 2HS3A 3HXMA 3KJNB 3FBCA 1T3OA 3Q83A 4OI0A 5EHRA 2IYIA 1VI7A 1RT7B 8RUCA 4N47A 3HK2A 3KLIB 3KLHB 3KLGB 3I80A 2I3UA 3GXHA 3OVBA 4B3RJ 3RB6A 4F7VA 1HW8A 1JF7A 4AXJA 1RT2A 3CDWA 2W01A 1U49A 3RGOA 5A8KA 1N0VC 4FP9A 4OZ0A 4AE5A 2VFUA 4RU9A 5G0RA 2JVRA 1WWHA 1T48A 3RZ2A 4JI4F 1OEMX 4RUHA 1YWXA 5F9LA 3G9CA 3W62A 1U1RA 4LSZB 5EX0A 4TVVA 4NMXA 4CO4A 2QN6B 2B4OA 1RYRA 2HNDB 2EPIA 4EO6A 1Y9OA 1YLXA 4Y0FA 1CSJA 1QUVA 1FKPA 4FDFA 3S3KA 2YNIA 1HWKA 5HJXA 1HQUB 4ZVFA 1IKYB 3W5ZA 2CDRB 4Q7AA 4B3RF 4F4KA 1N34J 1PJ6A 1SKRA 3DLKA 4QZVB 2VJUA 1YJNS 2FJEB 1R27B 5C25A 1FXRA 3PJWA 3EDRB 2K7KA 2LP4A 4F36A 3EZ5A 3WX8A 1NSAA 2FJBB 2CPJA 4GKKJ 2FVSA 2C42A 2YX7A 4DV4J 1NH7A 1UVNA 4C12A 2G59A 1I3OB 1IJFB 1I51B 4AXIA 4YOEA 1N33J 1NSKL 1T9WA 1FHTA 1TP7A 2HHXA 2HHHJ 1R0AB 3W3SA 1FWKA 3LP1A 4MBBA 2KZMA 3LALA 1KLMA 2AJFE 2P9GA 4J9NA 4LFBJ 5M43A 1YZ7A 2I3RA 2V8HA 3R1HA 4F0KA 5ETRA 1N34F 4PXDA 3IO1A 4MK7A 4NA2A 3NMAA 1HARA 3L7OA 2G2OA 5A2QY 1EB0A 3S4OA 2I0XA 3R7NB 3BBBA 2J0QD 5AXKA 4WYLA 3CCTA 1U8SA 3C6UA 5KFZA 1IQTA 5IV4A 2D3UA 3M2VA 2BZLA 1AB8A 1G1FA 5T14A 4Y2IA 1VC5A 2R2RA 4GKKF 3S6EA 2XY6A 5HROA 3PRVA 2X3GA 4C8NA 4XTTA 2DXFA 2CG8A 4OYXA 2PFDA 3J80Y 1YK9A 3B8HA 4DV3J 4TLRA 1EIYB 2BGDA 4RLEA 3AAWB 3MCSA 5CZXA 2B4UA 4TU7A 1CS4A 1UPPA 3EXYA 3I96A 4O3NA 1OHEA 1FTRA 5CYMA 4X4UA 3W66A 4WYWA 1KONA 1I6JA 2I5JB 3H7HB 3C3LA 1TL3A 3DRYA 4PRFA 1JBVA 1S6PB 1X4HA 1PKUA 5E0OA 5IM0A 3QJPA 2BKNA 2I6JA 1ZS6A 4OV1A 4I1TA 1C1BA 4AYBD 4CO0A 1L3UA 2MSSA 3I87A 2BV3A 2L41A 1SJQA 1TMJA 1S1TA 4KGXB 1TKTA 3LK7A 5HL7Q 4QIWD 1VLYA 3HN7A 3Q86A 1D9FA 5E2QA 3RBXA 1LW0A 1UEUA 4MJKA 3OBIA 2J16B 2HURA 4LFCJ 4NLUA 2GAHC 5C7PA 1RJJA 1NK0A 2WCXA 1EJ7L 4PCQA 1BHNA 2DR9A 2A3KA 4RKKA 4PWWA 1OO0B 3CJKA 3ZTOA 4R30A 2N3LA 1GFYA 3NNAA 1ACMB 5KFMA 2HIQA 2ZBQA 3IG1B 4EYIB 4M95A 4WU3A 4A8QA 1LOUA 2RQMA 4USKA 3F81A 3A8JA 3LGMA 2P5VA 4WF9Q 2LEAA 2XCPA 3MOJB 2HS0A 1L3TA 4RNFA 4WZMA 1HIYA 2GAGC 3IFEA 4JBCA 3SI8A 4K7QA 4DLGA 3ICLA 2WBMA 4KC5A 5T7LB 3DRSB 1U02A 1ZPVA 4YR8B 3WZ0A 4GFVA 4F3QA 2PD1A 3UFCX 1KAKA 1QAXA 5LT5A 4RHGA 1UL3A 3RTVA 8ATCB 3JSMA 2CADA 4RR5A 1AZSB 2Y1IA 3QATA 3EGNA 4DGPA 2QYCA 4ZPDA 4DR2J 1B0PA 1VRTA 1RABB 4B9UA 1JLBB 3ZZYA 3ET6B 1NO8A 1TVRA 3F41A 4U7UD 3WC2A 4QBWA 1WTBA 3DDNA 3PX6A 4ZDNA 4YR0A 1N56A 1YHQS 3ZZOA 5EWGA 1S57A 4PKDB 4A8KA 3VGSA 2R7VA 1WHVA 3OFFA 1C83A 2GIQA 3WDOA 2CNIA 5H9EJ 5K14A 1RQ0A 1XNQJ 2NR0A 4ZVTB 4W92B 3LJ8A 2WZ1A 5L9XA 5KA2A 3ZM3A 3CWEA 1S1VA 3H0PA 2P9EA 4DXLA 1FD8A 4YAAA 1VMBA 3ZM1A 1YG0A 2OFGX 2VPYB 4BUBA 5BYQA 1D8YA 2CVEA 3DDKA 4MFBA 2HRUA 2GVDB 3J81j 5D4OA 1MROA 2NT2A 3RZAA 5A5EA 4DR2F 1TU0B 3NOCA 4RI4A 3GG1A 4DL2A 3HULA 3FRYA 4I7FA 5KFGA 1UVKA 2WHOA 2FJXA 4P52A 5KFBA 1EEHA 1UEKA 1FGSA 3ZFVA 4H1OA 1G4WR 1X9MA 2ALYB 2VL1A 3MAHA 1XRIA 4OX9F 1PILA 1S4EA 3MM8A 2XYPB 3AOBA 3AH6A 2AJ1A 2H1YA 1FERA 3QAUA 1YZ6A 4YMEA 2Y1JA 3DLGA 1XNQF 1NKEA 4CLSA 2DGSA 2I5XA 2Q05A 4ZS6A 3W5XA 1TKZA 1DTTA 2JFDA 4Q43A 5IFMA 5K9FA 2CPFA 3HMJG 2QIFA 1HKAA 3AD7C 4K4YA 1GQQA 3TJAA 1D3WA 2K3KA 1Q4RA 4H4MB 4JUZA 1TFWA 2XNRA 3HHLD 1SUQB 1LNQA 2IM1A 2KT2A 3S7RA 4BBYA 3MEGA 3T9NA 2BQRA 1MU2A 4RO0A 2IM3A 3IXQA 3RBZA 3Q24A 1K73T 2CMAA 3V0JA 2JEGA 1IVZA 1WKKA 3QAEA 2Y8YA 1PTYA 1TL5A 4N5SA 5D3GB 1CG2A 4H34A 2ZWOA 2RF2B 4ZLPA 3BSAA 1RCXB 1YQHA 2WAQD 1BQXA 1W2IA 2OEKA 2Q66A 2B56A 4QOTA 2B6AB 4F67A 4FF1A 3ZC4A 1LK5A 1NSQA 1R8AA 2IYGA 3K57A 3AODA 3K7RA 4C97A 1U6FA 2GW8A 2VG7A 2E1RA 2OH2A 4LIRA 3AQPA 2CUYA 4GC6A 1QXKA 1F9EB 2FVPA 2CPIA 3K17A 1EQMA 4J9LA 2ZEJA 4YHHF 1ZAXA 2HNZB 1NJYA 2Y2FA 4NWBA 2G0JA 4NLYA 1KRPA 4HVZA 4EWTA 2CPDA 4D3RA 2QSFA 4HDHA 1PAEX 4Y2AA 1RKIA 3I0SB 3O1LA 3R9LA 2NPIA 2VOOA 2PI7A 3R97A 1N6QB 4GS0A 2PIIA 5D15A 2BQUA 4ECTA 3L09A 4MK9A 4BDPA 1PBUA 2DITA 1Q6SA 3X1LB 5U47A 1A6LA 1HHQA 1IM4A 4WIIA 2YX4A 1M1KT 2OC3A 2ERRA 4O23A 2E66A 1B7YB 4MKBA 1S77D 3D54A 3CEDA 3NGTA 1VHIA 2IVMA 3NP5A 4X4VA 3CJSA 4DL4A 2GMJA 2ZM6J 3IC1A 3MAQA 1Q5VA 1U4BA 2GVZA 4EMDA 2HFSA 3UN2A 4DV6J 3DLJA 2IY5B 3MF5A 3H4BA 2K8GA 3V5RA 4LF8J 1WG4A 2C2ZB 3K8WA 4ZVQB 1BQMA 1RWUA 4FZVA 2VPZB 1X5PA 2F00A 3CDBA 3B4MA 3PCOB 2LMIA 3D66A 4QQBA 2ZE2B 2FIUA 3R5CA 3Q2SC 2QJ3A 1S0OA 2B3OA 5HI7A 5KT3A 1PSDA 5KFXA 1WG5A 3A3NB 3TW0A 1R6VA 2GC8A 3BGLA 1T9XA 3ZV2A 5F8GA 2R8JA 5HMWA 2W9BB 1YJ7A 2CRLA 1QZ0A 4YP3A 3TR5A 3SV4A 3QLHA 2DNZA 2V4JB 2IJFA 2J0XA 4C8YA 1BZHA 1G1HA 4DV6F 4LF8F 4BS2A 4LR9A 1PIEA 4ZKAA 2LA6A 1RAHB 4I2PA 4CLTA 5KFQA 2XZWA 4JP8A 5F8LA 2H04A 4G65A 1C0UA 3I32A 4GRZA 5HBMA 3ZNUA 3HI9A 3A13A 2QDMA 2AEFA 2BDPA 3QCJA 3QCGA 1OWXA 1HFEL 4DR6J 3IWLA 2YQ1A 4KHMA 4B17A 2XB2D 2LXUA 4EBDA 4A8YA 4PG6A 4RW4B 4KGVB 3FVYA 3A12A 1ZAVA 2CM7A 2UUCJ 2BYCA 4RU2A 1T05B 4C6AA 3K5MA 2C46A 5DZ6A 1XJWB 3ITHA 3KMSA 5HQMA 2J7WA 1T02A 2VFVA 3W8PA 5EGYA 4TYAA 3ETOA 2V5HG 1P27B 1T94A 3GJSB 4CO3A 4LR7A 4HHJA 3TUPA 2KO1A 5L39A 1B0VA 2CJYB 2B3TB 3MXHP 2F6WA 1S1UA 4ZHRB 3HT3A 3ISND 1LW2B 4J9VA 4CLWA 2GCBA 4ECWA 4RW9B 2RU9A 3OT9A 3WHIA 2R2SA 2LLZA 3OV7A 2Z0GA 3AWGA 2HCMA 2DNOA 4NLRA 1S49A 2ZUGA 3R8YA 3T6JA 2ZNYA 3MM8B 3QT5A 4TXSA 4A47A 4LQ3A 4MIWA 1TUWA 2UUCF 3KK3B 1F9HA 3GIRA 2HVLA 1DARA 2QTWA 2BJEA 3HSJA 4FXDA 2AHSA 1RWMB 1DTTB 3RJMB 3AD9C 4IG3A 3PEJA 3BLUA 3C19A 4C98A 5CYQA 5HP1A 4PYHA 5K8PA 4CLUA 1N4LA 3AT1B 2NT7A 4QYZJ 4I67A 4F0HA 1J5EJ 4GRSA 1UW4A 1JNZB 1X4BA 2MMYA 1FJEB 3V6KA 4Z37A 5CZVA 3RW7A 2YVSA 3EZUA 4QWAA 3O5XA 3M05A 4CYUB 4DFKA 5ETVA 2K3IA 1Y5IB 1WC4A 1NU4A 5KFNA 1S9GB 2ZH8A 4OJHA 1RWWB 1B0TA 3SSQA 1RLDA 3CCZA 4RX6A 3F73A 3KNAA 4CT8A 1JNRB 2C2MB 4OLPA 3W5YA 3JTPA 2ZJRQ 3M8QB 3I4HX 4IRKA 2AKWB 2VFRA 1HD1A 2XHWA 4OIXA 4ED3A 1G1GA 4NPOA 2AGPA 2DD8S 2BJ7A 2GJIA 1OHDA 1RTJB 4KO0A 1NB2A 3TAMA 2W7OA 2RKIB 4Y2EA 4L76A 4F0MA 2X1BA 2VEYA 3GG0A 4QIVA 2BZ2A 3KLVA 2XBPA 2BOAA 2XPCA 1QJHA 4DL0C 2W4CA 1C0TB 2G13A 2MSTA 2OKQA 1X5OA 4JI6J 2JVOA 4ICZA 1BC6A 3W2VB 3W64A 2QLFB 4KHPJ 2HS4A 3OJSA 4CLFA 1T03B 2WOMB 1WG1A 4HJPA 1OETA 3NS5A 2NYHA 3KWMA 2VG6A 3CC7S 2DBBA 2VHGA 1MMNA 3A3OB 2I2YA 5HQ8A 1FD2A 5I4MA 3MFHA 1REVB 2V2VA 2OPQA 3PW5A 2LEBA 4P7VA 4NNDA 1D9DA 4EGLA 3HHEA 2C28A 1S79A 4DUZJ 3LAKA 3SR9A 2HWTA 4HT7A 3A5KA 2U2FA 4FN5A 4N77A 2MGZB 2NSCA 3EUNA 3C16B 1OJ4A 1I5OB 4UY85 4JI6F 4ZN1A 1J2VA 2UV8A 4NEYA 1ZYQA 1SBRA 4KHPF 2R7WA 5KA0A 2I8EA 1VQ4S 1U0HA 1G7FA 2J0SD 3J7YU 1FO1A 2AX0A 5KFRA 5EHHA 2VU5A 3EYZA 1FK9B 1UWBB 3C14B 3M4UA 4L6V3 3PR4A 2BIJA 4Z2XA 5GAHU 3T19A 4DUZF 1WI8A 1NM2A 5GADU 2F6TA 3CSKA 3P5BP 1VK3A 4OZJA 4ZITA 3HKWA 3TVYA 1UAGA 3HM9A 4BC7A 5E5NA 5E3RA 4FNIA 1U2FA 2H5EA 2ZWPA 2XJAA 2DB1A 4C8OA 1C0UB 1R8PA 4CP5A 1WC6A 3UO0A 1X0FA 4I56A 1SQGA 1FE4A 1GXTA 1YI2S 2H5JB 2CQDA 4CNYA 2RRBA 4AT1B 3NAHA 4M5GA 2ASLA 2C2KB 1QAJA 4I6WA 2ACMA 3BGRB 2WB1D 2MPUA 1XMQJ 3IP0A 3MD1A 2DNMA 3QFWA 3VQSA 2ZBRA 3QCBA 2BQ3A 3MEEA 4TU8A 1R6HA 1ZETA 2IBOA 2K2PA 3V2UC 1T8EA 2ZZTA 3VAKA 3RBDA 3ITHB 2ROEA 3GE9A 3MM9B 3RB0A 3FSIA 1SIWB 4M5NA 3AQOA 1LQ9A 2J9EA 2IBKA 1CLFA 2UXCF 3KLFB 2VBXA 2JDJA 3M2UA 4ZPCA 1ZM2A 4R0EA 3I7ZA 1FRHA 2ZBIA 2J6TA 4FPRA 1F5BA 2V8DA 5C24B 5JMNA 5HVGA 5F3TA 2DNQA 1WNEA 2QEXS 1WUUA 3KK2A 4PXBA 4TLQA 2M5YA 2R7SA 2HRYA 3R1LA 2OPRB 5A8WA 2JWNA 5DLGA 3GIKA 3TUZC 2CQ3A 1QDUB 4M8LA 4OMFG 4OHHA 2QLBB 3GSDA 3ZNJ1 3TO8A 2BMBA 4GO5X 2HK2A 1OEUA 3S3HA 3QSYB 1ELOA 3HDSA 4ED0A 2H65B 3H20A 2WJPA 2ACYA 2AM1A 3CJ8A 4HTJA 2DGUA 3SZ2A 3TARA 2E1PA 4JV1A 3C2PA 2VEXA 4KTQA 4RNMA 3QKQA 2CG4A 2C3UA 2XS7A 5I42B 1SPBP 5HK4A 2UUWA 3RAQA 2H4GA 4CRJA 3KOAA 1PCAA 3T1AA 1WOSA 5B0CA 3MPWA 2X1FA 4ECYA 4JI1J 1IXKA 3R2CJ 5HVFA 2IHR1 2CJ9A 3SMZA 1FNMA 1FVQA 5LXQB 1IUJA 3I56S 5KA4A 4KE5A 1JLQA 4PEOA 2B8QA 2H02A 4V19J 2P6XA 2WVBA 2ZHAA 4NI2A 3SSRA 2R8KA 4GVBB 4IQXA 3MPDA 3DKDA 4TQRA 4Q0BA 1M5HA 3I9V9 2XULA 5SZTA 3AB4B 3LO3A 1RHUB 3M1VB 4CH7A 2A2DA 3DLBA 3MOWA 2WBRA 3W9IA 4NCAA 1JLGB 3M2RA 4V19X 4DDFA 1SJ3P 4ZLJA 3D6HB 4EUVA 1D8ZA 4HKQA 3WBZA 1NK7A 2HMIB 1WEXA 1RZMA 2WW8A 4IOBA 1LK7A 3VQTA 4MTPA 5KG5A 4QR2A 4PR6A 1G7CB 4ZPAA 4LRAA 2QZ8A 2YH0A 4O3RA 2LEPA 3PACA 3O8WA 1KAVA 3EGVA 1FFSB 3VHQA 5CA5A 1SJ4P 3JAMY 1M1HA 3CXCR 5J1EA 1JXEA 2VH7A 2GHPA 1RBAA 2ZH3A 1X5SA 4CM2A 3M6XA 5GAEU 4DI6A 1UP1A 3BKFA 3V0FA 5ADZA 2Y3YA 2WTZA 4LF9J 4DF8A 2DR7A 3RO1A 1ITPA 2ZC3A 3M9OB 1KR4A 3Q8QB 3MFIA 1NJWA 4NRTA 1TK8A 1FRKA 4J7CA 1R8CA 4DX5A 1N52B 1C84A 4NLTA 3QFHA 4BC9A 4ECXA 2JEJA 1EEOA 2DK2A 2E5HA 2FDNA 2FZCB 1QSYA 4FVCA 2JFFA 5EX3A 1N88A 4E8UA 2AQ4A 2E9RX 3PDNA 5ETNA 3FBBA 1IKXA 1YTNA 1GX6A 2FHKA 2FJMA 3RAMA 3C6TB 4WK3A 3M8WA 3TANA 1S1WB 3DM2B 2VBZA 4DU8A 3I31A 2OEMA 2KFZA 1HNVB 3NGKA 4EI2A 4UOCA 1F5AA 4R0SA 3LWLA 3NGSA 2ESBA 1OPZA 1HWUA 3HF5A 5LXRA 2JLGA 3GLJA 2YKOA 1KVIA 1NSPA 3CC4S 2HFNA 4ZCKA 5D0RA 4K59A 2FY1A 1HPZB 5LM7E 2QMUB 3UPFA 1CJTB 2NQPA 1YFOA 4LF7J 3V6DA 1LFWA 4QYRA 3BV8A 2KYZA 3K5PA 2FLNA 2YWGA 5IS2A 1CVJA 2UAGA 2DR5A 2F46A 2YWEA 3ILLA 3CJ5A 1JLAB 2F1FA 5AXMA 2HGNA 3QGHA 3I36A 1ZTTA 1VQOS 2PA8D 3GYNA 4N8NA 1DAXA 4HDGA 3KG1A 2RT3A 4M5HA 2IM0A 2PE8A 3OHAA 3J7A1 4K2JA 2W4PA 1G3OA 3TI0A 1L3VA 4XDCA 2M4MA 5ETOA 5B0EA 3LAMA 3PEHA 1AA1B 3NMEA 5K8MA 4QPXA 1M5VC 4TY8B 1RAAB 1RCOB 2F4VJ 2D41A 4IG0B 2E1CA 1LWEB 1UFLA 2ZH9A 4FYVB 1YJWS 3KFWX 2GGPA 3QCDA 1BE4A 5KA8A 3VVUA 3LGNA 4ED1A 2GMLA 1FVSA 2MZTA 4RW7B 3W8GA 3MPYA 1Y00A 3H98A 2OO4A 1HNXJ 4PAAA 4AD6A 1OS5A 3KLEA 4EBCA 1H0HB 1JX4A 1N5YB 3QCLA 1JKHA 4QBUA 3OL8A 1O5ZA 1KFSA 1R3NA 2L48A 1U26A 1RLCL 4DL3A 1HBOB 2KXFA 3HHLA 2ZZMA 1HR0J 4DR4J 1TR0A 1PJ5A 1TFYA 2BKPA 2KM8B 4X62J 5A8WB 1TKDA 1MNEA 1MN9A 1NRKA 2U1AA 4MK8A 3PJXA 4S0MA 2AGOA 2GJ2A 1KDNA 2HAIA 2F4VF 5BJRA 3QRPA 4KYZA 1ZCLA 2UVWA 3K5NA 1F2GA 1RADB 3H5SA 4A48A 3QRQA 4YB7A 3MM6B 2V8PA 3FBEA 2MKKA 2V34A 1BQNB 1R6YA 3UDLA 3CJRA 3HSDA 1HNXF 4RBUA 2L08A 4OJGA 3BO2A 4F4YA 3MR5A 2HHPA 4LRFA 4U7CA 2J9DE 2B5JB 3MECA 1XMBA 2QLWA 1VIOA 3ZTPA 5KFAA 1MN7A 1ZC0A 4CIOA 1S4FA 5LMNF 3EVMA 3GFXA 4KKOA 1HR0F 3MZIA 1MWZA 2LXFA 4DUTA 5KA9A 4X62F 1BY9A 1JK9B 2MLZA 2A3JA 1RAJA 3DNCA 5C2CA 2DHXA 2CJQA 4IO9Q 1S9FA 2GC6A 3LWMA 1GX5A 1K0VA 2HBZB 3AOAA 4D3QA 3P3DA 2CJXB 1FX4A 3OFHA 3GILA 1U0SA 2HVEA 5J2MA 2KL8A 2ASJA 1HQEA 4ID5A 5A8RB 2N4CA 4DSKA 4IOAQ 3NWGA 4A8SA 2GMHA 1FPRA 1QSLA 3GR0A 2MHNA 5CCLA 4ZVGA 4ECQA 3OUYA 1B3TA 1RWOB 1WKLA 1Q95G 4OX7A 4QR0A 2O67A 1CULB 3N5FA 2IMGA 4ZVRB 1PXHA 4RL1A 3LUYA 3PO4A 1BUXA 1OQ3A 4DR5J 4M1KA 2FYXA 2M8DB 3GJQB 2JSXA 2RJZA 2DCLA 4EEYA 4BHQA 2P4DA 1MG7A 2Z2MA 2XO7A 1RAIB 1NL9A 4MIAA 5D0GA 4RUBA 2BXJA 3O44A 3P6YC 3MAAB 4RBVA 1S6UA 3EICA 4DOZA 4P10A 2RQKA 3MMJA 1TV6B 1WORA 3WC0A 2L9DA 1P9QC 2FTRA 4XAKA 4KSEB 3CJQA 1NK8A 2ZOGA 2HC2A 3D44A 5EDWA 4ZJOA 3MTJA 1TKXB 1HMVA 4CZCA 4QW8A 3C66A 2YNHA 1T95A 3CJ3A 4NA3A 2YQ3A 3OL7A 1IKWA 4A46A 3RR7A 3DMJA 3VVTA 2V4QA 3TZZA 1X4CA 1MMLA 5DQHA 4K8RA 4NMLA 2WSFC 3TOQA 4OZ5A 3KG4A 1Q6JA 2CNHA 2DO4A 9RUBA 2B4PA 4ITSA 1K1QA 2MKIA 3WQPA 1RT3A 4NLPA 2UUTA 2BX6A 1FEHA 2RDJA 2BJ3A 3D6FB 2YKNA 2CZ4A 2XSJA 3G4SS 2H54B 3M4XA 4FYDA 3GMGA 1UVMA 3VALA 2XMAA 5IWAJ 2X51A 2Y1LB 1H2UX 2IA0A 4B04A 1LWCA 3DI6B 1LFPA 2VICA 5IT4A 3TZWA 1Y10A 5J2PB 4RH5A 1EKSA 3M30B 2JC1A 5IZHA 1U1MA 3V6DB 1SUGA 2LU2A 1KOHA 2LQ9A 1TAQA 4X4QA 2DGOA 3CCLS 4ZMMA 1CC8A 1DHMA 4I64A 1SL1A 2FZKB 4WFYA 4JOUA 3ZTSA 2VC0A 2IC3B 2PI4A 1IR2A 3MM5B 2MLXA 2EW9A 4LF5J 2GO8A 3CW2C 3ZMQA 1PA9A 3GZ7A 1Q78A 2EI5A 5KT4A 1SQEA 2IA6A 5K22A 1L8KA 1N36F 1EQ0A 2Y9HA 1GTHA 3PVXA 4LQ9A 3OR1B 1D9AA 3MM7B 2GGPB 1YPTA 1OEOX 3UNYA 3FNNA 2GIFA 1NZ8A 3OLRA 3KUGA 1S1XA 4KFBA 2LQJA 3FBFA 1TK0A 3Q8SB 3GXGA 3PYZA 3MEDA 4MKAA 4ZVPB 1JLEB 3OQ2A 3IR6B 1Q6NA 5GMDA 2ZH1A 1AAXA 2IAJB 1NEEA 3OTOJ 2F63A 3BN4A 4HLBA 4A8WA 4DFPA 3A8KA 4NRUA 2DNKA 1SH2A 5E7OB 5D4NA 1UZHA 3FMWA 2HQ3A 1TK5A 2BJ8A 2JJDA 2VG5B 3D1HA 2ASDA 4R8UB 4QCLA 2VB6A 3QCNA 1T9VA 1YJVA 2RHQB 2I6IA 3DRRA 3KJQB 3H5UA 6FDRA 2Y0SD 5EHPA 1WF2A 1A0OB 1TL1A 1XN9A 3T41A 3V0DA 1VJWA 3I5BA 1DQAA 1YGYA 4K4XA 1KQSR 5DGAA 4ED4A 1XR7A 4EZ6A 2MKHA 2CQBA 3PIPQ 4KV8A 3LTOA 3PW2A 3VAMA 2APOA 1XR5A 4P6QA 1P8GA 2N7CA 3OTOF 4ETXA 2FJWA 3FFIA 2OTLS 2UVUA 3ZZUA 2M2BA 3G82A 1ZA1B 3GJRB 1IBCB 4RJVA 1C2PA 2DGTA 1RSCA 3WX4A 3GONA 3OLAA 4ZVSB 3VZHA 2D3ZA 1UAWA 5D77A 4ELUA 2H3EB 3HKZD 5J2MB 5LSLA 4I6AA 4KHRA 4QIEA 1HQEB 1FPZA 2A2CA 1WACA 2XMJA 3HHLC 1LXNA 2FJDB 3GFHA 3G8SA 1IJEB 3M8ZA 4J9OA 2ZC4A 3J7YI 2B43A 2HWIA 4ZI4A 4CCHA 4ENOA 4OZNA 4DL5A 5I3UB 1AROP 3L95X 4KB7A 2H51B 3V0EA 7AT1B 5CAAA 2X5OA 5GAHI 1I94J 3IBFB 3GV5B 2QO3A 2WSEC 1CQMA 5GADI 3W9JA 4WP3A 4WE1A 3B4DA 5K25A 3DOKA 3M8PA 1Q1KA 3RUBL 3LP2A 3NMRA 2J8AA 2QA2A 4LSLA 4G1QB 4HH1A 3Q2TC 4FF4A 1GAOA 1NWLA 2XMWA 2Y1OA 2RHSB 2VONA 1TUGB 3CF5Q 2AU0A 2RH3A 4MIBA 3W63A 3DOMA 5IT9U 3IS9B 4DQSA 1R31A 3PHEA 2DNRA 4LF6J 4UUXA 2G4BA 3UWTA 1HMVB 3WIVA 3G6YA 1FE0A 3TUIC 1GNKA 2YNHB 1GWZA 1N5QA 4ECUA 1RTHB 2OSRA 2AYMA 3HCXA 2C2EA 3D6MB 4PQUB 4O0IA 2GHWA 3E01B 4B3MJ 3HVAA 3ENAA 2ZH4A 4DF4A 1I94F 1U6BA 1RAFB 2B51A 3BBCA 2PEHA 5C42B 4ERCA 5B0AA 4D3HA 1OMSA 3ONQA 2HWHA 2HKEA 3VWSA 4ALZA 4HACB 3MI7X 4I2QA 4DCPB 3M6VA 5AT1B 2VF3A 3K8VA 3CM3A 4NCBA 4H4OB 1W2BR 1VDHA 1RWNB 2RU3A 3D1QA 2CQ0A 2Y68A 3AWFA 3HZEA 3SQGA 4C3KA 3GIMA 4DX6A 1ONYA 5F8NA 4DSEA 4CVLA 1RB0A 1WF1A 2HHVA 3CCVS 2ZDPA 3DLEA 2ZOMA 4B3MF 4TKTA 1RT4A 3NBPB 5HLFA 2Z2LA 3OMHA 1U1QA 1REGX 3EGWB 3S8SA 2E7WA 1WRMA 4QUMA 3MUMP 2GC5A 1EKRA 3QYYA 1V9OA 2F9DA 4HEA9 3JTOA 1M5OC 1NXIA 1CJVB 3FCVA 1OSCA 4DQIA 4OZLA 4C11B 2Q47A 2J9CA 1C1CB 1YIJS 1GK8A 4ZRTA 4KGZB 4CVKA 2OFHX 1YTSA 2KKHA 1PYSB 3D28A 2YNFA 1GH8A 1B7FA 2KJWA 3Q0AA 3IR5B 3SIPB 3OTBA 4F2RA 4HHUA 4I8NA 2B4SA 3SBMA 1F3VA 1T9YA 1RT6B 1FKOA 2YKMA 2RDIA 3W7BA 4KJIA 4NCGA 4OYWA 3TEGA 2IDEA 4CQ1A 4PWDA 2CMCA 5KAKA 3SFUA 3VGVA 2GCFA 1PTVA 3SYZA 2ZDOA 1Y3JA 3IRWP 4DHVA 2BJ9A 1U45A 5KTQA 1IBMJ 2AJ2A 2YWFA 4OFZA 1DTQA 2HQIA 1I9SA 1N32J 4RI5A 1BWVA 3V4IA 5FDLB 3TVKA 1HI1A 1VGYA 1E6YA 1VS3A 3BGUA 2GX8A 3UVJB 5CYJA 4UQTA 2V4RA 1LWFB 4C3LA 3OD2A 3QIPA 4ANDA 3DRPA 2V2ZA 2BM1A 2GCAA 2LKZA 4DPXA 2MYFA 5HVHA 5B0FA 4G1PA 3GCWP 1Y4ZB 2HGMA 3T6BA 1D0EA 1HNIA 2AJ0A 2E5IA 4PG5A 2ZKUA 4Y2KA 2A18A 2WONB 4ZPBA 3OL6A 4GE2A 4IFYA 2R8IA 2H03A 4C0BA 5EUHA 1JJCB 3IBWA 5D78A 5M2RA 1R8HA 3MMAB 3T9ZA 4NLXA 4NLGA 3V81A 1Q86T 1QLNA 4YDXA 4KH1B 2B49A 2BACA 4CH1A 1FFGB 4V1Ak 5F8HA 3ISNC 1HBMA 2AW0A 1HWIA 1FQ1A 1WOOA 4OL8A 1RT5A 5GAEI 2DNYA 5KG6A 3LP0B 2E5LF 3AJ2A 1OY9A 4USJC 2EFQA 2KDOA 3ILIA 1JJHA 4NX8A 3KJVB 3OTDA 3POTB 4KT0C 1VQPS 1NK9A 2A8BA 3TZXA 2PMHA 5K24A 1PBAA 1VHRA 2OPSB 2AV5A 3BZQA 1MLAA 3DGPA 4DV5F 3G8QA 5HATA 2F65A 3PHTA 2OUGA 3O4UA 4J9RA 2FVRA 3HSGA 3L4BC 2L3MA 2EFOA 4ICLB 1XK8A 3LANA 3OR2B 1VBKA 4M5KA 5B7WA 3H4DA 2BEFA 2ABYA 5KFEA 5AXLA 1UETA 4YB6A 1N5SA 1PYOB 3IRXB 4QR1A 2V0NA 2HBRB 5KFKA 3E51A 4B3OA 2GA7A 2RD5C 3Q8PB 2PMWA 2XZDB 1YRTA 2DIUA 2C2NA 3AJDA 2ZH7A 3N9UC 2MKSA 4DQQA 2EBEA 2PGCA 5K23A 1RTIB 4A8MP 1O51A 3NLCA 2I75A 2D3OR 5BX1A 1HBNB 4IKCA 5L1LA 3HHNB 4ZJLA 3SDEA 2OHDA 1T7PA 4IH7A 4ED7A 3MDFA 1HBUA 3G71S 4DZ6A 3TYTA 5JXSA 3QWPA 4Y34A 1S6QA 3KDOA 4PG7A 4OJ1A 1QM9A 4FYWB 1M5SA 2A0FB 3M32A 1KHWA 2FLOA 2HSEB 1KOOA 1FDDA 2H4WB 2XGPA 1KKHA 4DX8H 4DL6A 4EU0A 4ZPTR 3FSYA 2BBEA 3KHGA 2D3O1 4ZCLA 3RW6A 1FJGJ 5JJBA 1N8RT 3EPIA 2UP1A 2XY7A 1TAUA 1NHUA 3PNIA 2VFSA 3DFEA 2AWZA 2QL9B 2KFNA 2Z2ZA 2DCUB 2YKQA 3DGVA 3EU0A 1WDTA 3D9BA 2W2QP 3PZPA 2DY1A 4LF4J 2EKYA 2WVFA 1APSA 1V3AA 3MR2A 3F56A 4GVLA 2PI5A 4F4AA 2JEIA 3HVTA 3A1YG 4WXWA 4ZIYA 4USWA 1KNZA 1I57A 2BE2B 2M3VA 4EFAC 1M90T 3BYPA 3MTKA 2D9PA 2DXEA 5DRKA 1N5TA 3I0RA 4DPUA 1FJGF 3GYXB 1S72S 2KT5A 1NHVA 4B9TA 4L72B 1KQGB 1J4XA 1RAGB 4LF4F 3B78A 4OI4A 2PSZA 4ZCMA 2OZ5A 2QFIA 2QYGA 4WBFA 4NZ7A 3A5JA 3BSCA 5KA1A 4UT4A 3LF0A 4OQJA 3SV3A 3V0IA 4F04B 4DV1J 4PVGA 4Y2MA 3KK1B 5HMZA 2QG9B 1KLNA 1EP4B 2C3MA 1NLKL 3DOLA 4OX6A 4EBEA 4DFMA 2XNQA 4XPEA 2MBCA 3NS7B 3QBCA 1CJUA 3FZBA 2UV8G 1NDLA 2G9OA 2RE1A 2JRSA 2YY3A 1CC7A 5MLCV 3MGJA 3R6LB 4O4GA 5CXTA 2XSFA 4Y00A 1H98A 4M5DA 2ZHBA 4XIUA 3TAQA 4ED6A 3MCMA 2P8IA 4RH9A 2MEWA 1S12A 3KXDA 5CHCB 3H59A 1M5PC 1WHYA 1KSPA 5IQQA 2LVWA 4LSNA 1WSRA 4R5PA 4I0WA 4FNHA 3PKYA 2FUG9 4ES3A 3W2WA 5J2NB 1W26A 2DO0A 1CJKA 4DV1F 1MWYA 4OI6A 1U1PA 4Q8FA 2X1GA 5L9NA 4FS1A 1V3RA 2HHUA 4FF2A 2V63A 1RWXB 4M94A 3DYAA 4J9KA 3JQJA 4W90B 4ELVA 3MMBB 3HVWA 3TVZA 2ZH5A 3LH2S 1VQSA 4NWGA 2JLEA 2OPPA 1H3DA 2K1RB 3HZGA 3Q23A 3NAIA 2MDAA 3ZL8A 3NKYA 4UUWA 1RTDA 1G4CA 2BABA 3S3FA 4KY3A 4B02A 2VFTA 5KFUA 4U67Q 4CTAA 5K9VA 2BA9A 5LMUF 3M7VA 2O1PA 1SV5A 5A0YB 2DNPA 4PUOB 2R8GA 1JLFB 3N6LA 1J5OB 1QD1A 5K8OA 2YKPA 4ZPWR 3PJ9A 4OLOA 5A2QU 1BMQB 2NZ4A 2XLJA 7FD1A 2E0TA 1FF2A 4RUCA 4DG1B 1V6HA 2DNHA 5GAGI 2ZUAA 3UCUP 2QC3A 4USUA 3BM8A 4F50A 3FCHA 2W9CA 2XS5A 2YDUA 4B3TJ 4CVMA 2NXNA 2CVIA 1IKVB 3EWGA 2R0BA 4O44A 4PWUA 2DY9A 4OX9J 3JYTB 3J80U 3SFGA 3AB2B 1K0TA 2BANA 1S10A 2HHWA 2ZD1B 1NKCA 1URRA 3BQ2A 1V5IB 3ZMPA 3QO9A 2CNKB 2LFVA 3BDEA 1XM2A 3SDEB 2E1AA 2AF6A 2DH9A 2Z58B 3U1NA 1Q7YT 2HG4A 1RT2B 1ZZWA 4K2XA 4PXCA 1VQ6S 1NZ7A 4O3PA 5A8KB 1SL2A 5GMKa 1WHXA 3THPA 5LOQA 2RVJA 2XHCA 4UZBA 5G0RB 2YNGA 2CKWA 1H2VZ 1HI8A 1MMDA 4B3TF 3PFOA 3T5LA 1LQFA 1R89A 2N4DA 1WTFA 3TA1A 4RUAA 3Q8UA 3SCJE 3EDQB 2GNKA 4WP8A 4F4ZA 1RU2A 1B99A 1FEEA 5IT9Y 3GPAA 1F5CA 5FLXU 1FKPB 2YNIB 2AM2A 3PIOQ 2WSCC 2FJVA 3QJJA 2IJRA 3A4TA 4JI3F 3DLKB 3EMUA 5F9NA 4X64F 4WOHA 2VQFJ 3I9ZA 3CE8A 4Y2CA 3BBFA 5C25B 3ISZA 4MYTA 2D1CA 1SXLA 4MAKA 3Q8YA 1UKUA 4B08A 1MWQA 5BZXA 4YHHJ 1P1TA 2XEXA 5A5FA 5KOXA 4C8LA 2CWKA 4J37A 4YB1P 4NYHA 2V68A 1FX2A 1X4DA 4D3PA 2B9EA 4M5IA 2E44A 2OD6A 2XGQA 4P2FA 3BKUA 4RNOA 2GQ2A 3R5GA 2F6YA 4DQRA 1VQKS 2G0IA 3CMES 1E6VA 2YTCA 1G6BA 3LP1B 1NB7A 4JMKA 5KFIA 1NWEA 2I1YA 2XYGB 4I68A 1KLMB 2EVZA 3D4JA 1R7IA 1PTUA 4IFVA 1W25A 3N4WA 2RUGA 1F60B 3H2XA 3SQOP 2XLKA 1WOPA 2X1AA 2VQFF 5KFPA 4MH8A 2WB4A 3C6UB 1LARA 5CD4H 4KGKA 3EGZA 3UR3C 3M2VB 5BYSA 1K1SA 2OEJA 1ZA2B 1SC3B 4AL7A 2HY3A 3V0GA 2JJ4D 4LF1A 5HROB 2XMUA 1WD6A 1QE1A 2HNYA 3B7OA 4UAGA 1PH0A 2FVCA 5J2QA 1DY3A 2KRBA 4U8YA 1S9EA 3G6VA 1ZM4A 4RZRA 3QJLA 1S7IA 4JV2A 3NCQA 2OP5A 2V69A 2H4VA 2HFVA 4X4RA 5A76A 1RWKB 2VBWA 1H7WA 4BLGA 2DYAA 5IBSA 1F1BB 1VBZA 1CS4B 5CYMB 4FXVA 1TL3B 4DBQA 2A6OA 1RT7A 2J5AA 3P5TL 1RXDA 3KLIA 3KLHA 3KLGA 3QCEA 3FDSA 1IWGA 5IM0B 4Y6IA 4USHA 1C1BB 2A6MA 2MTLA 3J7AN 1YGUA 1AT1B 5F8JA 1X4FA 2CQ1A 2Y0BB 4J9MA 1G1XA 4OZ3A 3NNHA 1Q81T 1S1TB 1TKTB 1RI7A 3FUYA 1FXDA 1LW0B 2I6OA 3OHBA 2EXUA 2A10A 4TVAB 1VQ5S 2NREA 2DH7A 4DN0A 1X8DA 3AD8C 2RNEA 2HFOA 1PYTA 4FPIA 4FKYA 3D67A 3B82A 2B4VA 4U8VA 3GFYA 3U96A 3CJKB 3Q8VA 4YEAA 3IN5A 1H38A 2HNDA 1X24A 2YXLA 1SKUB 5T41A 1LXJA 1U24A 4HH0A 4QWCA 4LMZA 3H2VE 1S6OA 4EK2A 4FVMA 1HQUA 1IKYA 1DRZA 3E3XA 2F8EX 1YN9A 2ROPA 1ZOTA 1MSWD 3QCZA 3FZ2A 2OGUA 3FMBA 5KFYA 4HRFA 1Y0HA 4ECSA 2GS8A 3BH7B 1EX8A 3JSMB 3R5BA 2W2OP 3QT7A 3M8RA 3CJ0A 4E2FB 2GV1A 4C2MA 3CB4A 1Y7PA 2IRYA 1VRTB 3SMEA 2C1EB 2FLPA 2ZVSA 4ES2A 1TVRB 2W9CB 1LEOA 2W7AA 1R0AA 5D0HA 4IH5A 3DLLQ 1NPRA 1U2CA 1YSJA 4RWWA 2DNNA 2ZITA 4ZIVA 3NGRA 2BANB 3OPKA 1FJCA 4IUFA 2DKOB 5K14B 5BZZA 1A7GE 1T3NA 4RKUC 2JFHA 2J6UA 1S1VB 5K8NA 1N5VA 3DXBA 4J9SA 2CJKA 4RNNA 4FBTA 4X66F 1DFDA 3TP2A 2QBQA 1GMVA 3O5TB 4DPTA 2VC1A 1OY6A 4ECVA 4MFBB 1GMUA 2Q43A 1MROB 2CM8A 4ZVUB 2FHJD 4ECZA 4EO8A 5B0DA 1RU1A 3CD0A 5F8MA 4I7FB 4USTA 4EZ9A 2MZSA 1SJ1A 1VJQA 1XR6A 4RDDA 3S3EA 3NCRA 2EFVA 2MJUA 2KZZA 2ATCB 1Q6PA 2UVRA 4J9UE 2MXYA 1LV5A 2HHSA 5F3ZA 2CIMA 3FGVA 4UF4A 2I5JA 1DLOA 3DLGB 2GP0A 4QWDA 3D1OA 1RGVA 4GKJJ 3OLBA 1W7KA 1TKZB 1ZZFA 4LFAF 2CFXA 2LDYA 2QE5A 2B7CB 3PTWA 2MKJA 4ATNA 1BZCA 2AP6A 4DV2J 3HP6A 3GV8B 4WFBQ 4U95A 5KFCA 3BGOP 2GFFA 3D5MA 3OSPA 4LVNP 1N0UA 1V5VA 2V6AA 4PPDA 3LW5C 2QDPA 4KR0B 3MEGB 1C85A 1MU2B 3AA8A 2J16A 2NXEA 2WVCA 3S4EA 3VTIA 2FHMA 4DSJA 5D4PA 4B9NA 2KVIA 2HVZA 2O01C 4QBEA 2R7TA 4IOCQ 1SKSA 5F0UA 2PFFB 3BYRA 3TJ9A 4PABA 2AGQA 1UCNA 4QWBA 3PW7A 4I69A 5LJ3Y 4OHIA 3QQCD 3UNGC 1ROFA 3IG1A 4GKJF 2Y1RI 1WF0A 5DJBA 2QL5B 4K0KJ 3OVAA 4DV2F 2W8KA 1FNOA 3W9HA 2VG7B 5T7LA 3DRSA 2XCAA 4OHDA 3BSNA 5KFLA 4C4WA 1U1KA 2OLWA 4QIFA 2DISA 3O2IA 4YR3A 1AZSA 4KIAA 2NTAA 3RBEA 1XXPA 3HVRA 2CZ9A 1VQ7S 1FTCA 3LPEA 3IGVA 1JLBA 1VC0A 3ET6A 4QPTA 3V6JA 1RUSA 2CAJA 1S99A 3I5CA 1UFWA 5KFWA 1OYEA 2UU9F 1PTTA 3H25A 1QY7A 2B0GA 2DJWA 1P1LA 3RGIA 1DBDA 4K0KF 1RHRB 3FRZA 1K47A 5E3QA 3T1YJ 1Z4UA 4KRWA 2MZJA 1SQFA 3RB4A 3MEKA 4ZLLA 2AYEA 3H2LA 2IDLA 2GIRA 5KFJA 2GVZB 2CQ2A 1DZ5A 5I6VA 3VZIA 2GVDA 3U27A 2ZN7A 2X7IA 1X60A 3BKTA 1BQMB 4UZCA 3D7SB 2JHEA 2F71A 3BQ1A 4X4NA 3VGTA 4CH0S 4GC7A 1RE1B 2E7XA 3R7BB 1Q8IA 3ZTQA 2ZOFA 2P9CA 3MVNA 3M8SA 4KQZA 3CCJS 3T1YF 1AFJA 3QLHB 1JIHA 3U1LA 1TL7A 3FEXB 3ILJA 1RWPB 1PYNA 3UAGA 4H4MA 4DCJB 1SUQA 4P75A 3GIIA 1T4JA 2N7YA 4I2PB 4OI3A 2AD9A 1E0DA 1K8AT 3N2AA 2ZJQQ 5H9EK 2UXCJ 2EC2A 5HBMB 4NE9C 2RIJA 2J7UA 2XTJP 3MPUB 2CNEA 4Y3CA 3U7JA 1UZDA 4OI2A 4NWFA 1XBWA 4Z6BA 5D3GA 2RF2A 2I4EA 2RSQA 4BPCA 3BPDA 5BXIA 3FEYB 5L1IA 3NEKA 4TQSA 2CQIA 2HIYA 4UOFA 2B6AA 5KG2A 2OTJS 2MQOA 4LRCA 2I9SA 2E5GA 3VGUA 2AZ3A 4CLZA 4KGMA 4YUDA 1HNWJ 1U48A 2DHAA 5LXYA 3O4TA 2CMBA 2J8SA 1JLNA 2AMCB 4ANEA 2HNZA 4DV4F 2KRRA 3IGNA 1ONZA 3DHXA 2Z2YB 3MR3A 1S1UB 1MKPA 3TA2A 3I0SA 2QA4S 1N33F 4ECRA 1X0PA 3BLTA 2KN4A 4Q45A 1N6QA 4LBPA 2HHHF 2KTQA 1CBKA 3NRSA 2AYGA 2KXHA 2F8MA 1FXLA 3RB3A 2MQMA 2OJ3A 3QCMA 4OHVA 1PAUB 3H5XA 1IQZA 4LFBF 2DR6A 1NCLA 2CNOB 3FK4A 2EFNA 1S97A 4U7UK 1QAIA 2NV5A 3W61A 2MQNA 4OHLA 4OYOA 1DLOB 2DEIA 3TQ1A 4C8KA 2M7SA 3PYFA 4URQU 1YBAA 3CCWA 2D9OA 3EZOA 2ZBPA 3GQCA 1HNWF 4HHHA 2K06A 4IG3B 2QV6A 5EWFA 2F6ZA 5AJ3J 3CMQA 5CYQB 5HP1B 3GP9A 1G7GA 1H74A 1K9MT 4NZ6A 1NZAA 4DMZA 2BKOA 1FNXH 1HL6A 1O5JA 2RRAA 3KMQA 3TA0A 1NK4A 1B70B 1WJ9A 1IR1A 1KS2A 2PMZD 4DQPA 2DRBA 4DV3F 2BRLA 3F9BA 2ZE2A 1X5TA 3B6BA 2R4FA 3I6PA 3CCSS 3NG8A 5FLXY 3JSRA 2LYVA 3EVWA 5HAOA 4OX8A 3NY0A 2BUNA 1GMWD 4DEZA 7FDRA 1TQLA 3AXKA 5B08A 3D0HE 3QZ8A 2W9BA 3C15A 2HNPA 3M6UA 4RNHA 3G2XA 3U02A 1ULRA 2P6SA 2V4JA 2MY8A 5KACA 3DN9A 1DURA 2KI2A 5AJ3F 1FESA 2IVYA 3BR8A 4KO0B 4K4UA 2QGFB 4M63A 3TAMB 1PGZA 4LIWA 1KTQA 3MUVP 4FF3A 3MURP 3HT0A 5J8RA 1TZ0A 4H4KA 4IQMA 4DPWA 2DNGA 2B9YA 4LFCF 4X65J 2LQ5A 5M2PA 4LVOP 4YQWA 5MAOA 4NLVA 1UA1A 1D5RA 3R27A 5K5MA 3KTQA 2UXDJ 3GCXP 3DC2A 4ZOSA 3CNQP 3L9ZA 2ADBA 2XWYA 4KAIA 2GO9A 2HZAA 2HVIA 4RW4A 2VG6B 4OZ2A 3CCMS 3GWCA 1T05A 1Z2LA 4P2SA 2O5DA 3CPWR 4N8OA 5HSPA 4FS2A 2HBQB 1SC1B 2OELA 1CQNA 2OPQB 1KVJA 1KQFB 1R43A 4JI8J 4C0HA 4ED2A 2NZ6A 2CXEA 1H2TZ 3BJYA 1JQGA 4ZN3A 4X65F 5FD1A 1OHCA 4OYZA 4ZHRA 1YZ4A 3QCFA 2Y96A 1LW2A 2UXDF 3D9CA 2ZVIA 4RW9A 1SH3A 1ICEB 2AIRB 1U0HB 4K4SA 2GWOA 5HO4A 4IKAA 1NH8A 2MQ8A 4LBHA 2LCWA 4JV0A 2EG1A 9ATCB 1BGXT 3KK3A 2G1HA 3G6XA 2LXIA 2QDCA 2XMKA 1JLCA 2QLJB 3AXMA 5J1NA 3AWEA 1TL7B 2R3VA 4JI8F 4ZPVR 5AE2A 1X7VA 2CJBA 1Y5NB 4HL9A 4Y65A 3HSZA 3MUTP 3I82A 4DUYJ 3UR0A 3SCLE 3GFZA 2MQQA 5BUGA 2YQ0A 3I55S 4M5JA 2ZH2A 4DR3J 2WTFA 2AEMA 2IPOB 1J6UA 4CYUA 3CO9A 4K4TA 2NXUA 1Y5LB 1VR6A 1S9GA 4JNBA 3UE2A 2R7RA 2FC9A 1NNYA 4P73A 3PW0A 2XWXA 1I1GA 2M52A 4Q2MA 3G8TA 1RHJB 1GG4A 1GQYA 1S59A 3M8QA 4ILRA 2B9WA 4TNOA 3H2UB 1ZTWA 3QIDA 2QBPA 1RTJA 3MEEB 3IM8A 5DLFA 1IBKJ 2RKIA 4DPYA 2YBVA 4C48A 3ZM2A 3JAMU 4CI0B 1XIQA 2E9ZA 4DUYF 1FWPA 4R25A 4C0OC 2R2TA 5LL6d 2RAQA 4K5SA 3G96A 2PT0A 1YJRA 4DR3F 1RAOA 1UJ6A 1C0TA 3M2UB 3NGDA 1ZCKA 3R5DA 3MPVA 1BZJA 1UW9A 3OTEA 3US5A 1UA0A 4U6PA 1OQ6A 3PS5A 3W2VA 4F25A 3K5OA 1NJZA 5KFFA 1VQNS 4QYZK 1HYSA 1T03A 2VA3A 2WOMA 5LMNJ 3KK2B 1IM6A 4CNZA 2MQLA 4F02A 2J7KA 2W2PP 1YGRA 2J76E 1VIXA 2P6TA 3KJFB 1Z2ZA 2YWWA 2MKCA 2R42A 4IR1A 4FXWA 3TNVA 2CNNB 1IBKF 2HQDA 2HZCA 2C2DA 1REVA 2VKZG 1WC5A 3PR5B 4ANCA 2DRAA 4OYMA 4W4MA 3ZZZA 4F3OA 3BQ0A 4DV0J 5DG9A 4NYOA 1QTNB 2DHGA 3DHWC 2MGZA 4DSLA 3IR7B 1Q53A 2CNGA 4PG4A 3KUHA 2ZJPQ 3IWXA 2RRNA 1ECVA 2OAUA 3RG6A 3C16A 1WELA 4CO5A 1X4EA 4ZP7A 2EFGA 1BXNA 2Y8WA 5L1JA 3JB9k 3HPOA 3ENQA 4DR7J 5IC4B 2VEWA 4HV4A 2Y66A 3K0JA 3SCIE 1U1NA 1KD1T 4NLQA 3E2EA 5HANA 1RDRA 1LYVA 1FK9A 1UWBA 2OD4A 4DV7J 4WXOA 1FI4A 3C14A 4QDIA 1QVFR 2NYIA 2CWXA 2JFKA 3C15B 2HVHA 3BPSP 1JLQB 3CGIA 3P45B 4NI2B 2ZM6F 3OVSA 3BSOA 3R7SB 3G86A 4Q0BB 3G87A 3F0NA 4DV0F 5F8IA 4NYZA 5DDPC 3CJ4A 1ZM9A 1GXUA 2PN6A 1X4GA 5KOWA 2XG8A 2C3YA 3PW4A 2Q79A 4OYBA 1JXVA 2QX0A 3M2RB 1VQMS 4NZ0A 4LREA 3W60A 2D74B 3GTYX 4DR7F 1FRIA 3HD1A 5KA3A 1JB0C 2V2QA 5THWA 3CDEA 2PBNA 1RWVB 1NK5A 4JV5J 2YH1A 2H5IB 4QWEA 4CLLA 3Q22A 3BGRA 4DV7F 5KFHA 2JLFA 3GYGA 5KFDA 4A4JA 3QSIA 2NS1B 1KQKA 2E9TA 3ZXWA 5J1EB 4Y14A 1Q0NA 3CJTA 5L1KA 4PPZA 1L3SA 1KC8T 5HJYA 3RYLA 4K50A 1ZAWA 4M5LA 2HQFA 1F9FA 1FDNA 1P6TA 4OYIA 3H42A 2PQ5A 2IRXA 4BWMA 3MM9A 1KWMA 1KP6A 3VCDA 4QAPA 2SXLA 2KH9A 5MMZB 3D0GE 1SCJB 3L7UA 2BM0A 3UQSA 3F9AA 3TZYA 2BJDA 3KLFA 4WKRA 2PA5A 2QRRA 1F6TA 2YX1A 2FPHX 2N3OA 1VQ8S 5B0BA 1ZZNA 3UD5A 2DVIA 3CWJA 1U2RA 1IKXB 2R2UA 4DR6F 4JV5F 1Q82T 3QGIA 1RBLA 3VR1A 2CYYA 1VLOA 5C24A 3EB1A 3MCOA 1CEZA 3DXSX 1JJ4A 1UVJA 3IA0A 2KJVA 2C22A 3IMQJ 2FJAB 2OPRA 3BH6B 2NUHA 5ETKA 4NOHA 1Z1ZA 4H4KC 1HQ2A 4IRCA 3GB0A 3GIJA 3PRDA 1JLCB 1NDCA 4J5OA 1RACB 1C4CA 3O6QA 1AUDA 1X4AA 1VCTA 4GMKA 2V8GA 5DO2A 1PO6A 1N36J 1KFDA 3CCQS 2CNFA 3L3CA 2X3DA 5DS7A 3K5LA 1B64A 2BV5A 4CLYA 3CIMA 3ETMA 2P2CB 5LSOA 1WC0A 2F5GA 2F4FA 2IM2A 5KG4A 2OOQA 3FQLA 1WHWA 4J90A 2DNLA 3EX7B 4CWBA 4X84A 2I6MA 3N6MA 6FD1A 2HVDA 1FA0A 3CMAS 5I42A 4ETZA 2YWKA 4ZP9A 4DN9A 3DU5A 3T5HA 2Z56B 4RW8A 3MHYA 3AFGA 2UUAJ 1UJ5A 4Q5VA 4BCAA 1W7WA 2CPZA 2VV5A 1N48A 4FBUA 3Q89A 2ALZA 3PFEA 4CDIA 3V4MA 4JI5J 2FHJA 2JEFA 1CPZA 1EAYC 4LBIA 4JMJA 3KHHA 3K58A 2YPYA 3UDVA 4L73A 4QU7A 4GVBA 2XYHB 1SJRA 3BREA 4GO7X 1UVLA 4HR2A 1J5EF 2QA1A 3M1VA 3S1TA 1YVFA 1JLGA 1BLUA 4DS5A 3VAFA 1HI0P 1UVIA 2NLKA 1WEYA 2UUBJ 2I1RA 3TQEA 2AEJA 3T5JA 1F3FA 4LT6A 2DXPA 2HMIA 1L8GA 3JQMA 3KLEB 4AFFA 1OSDA 1JKHB 4QIGA 3N6NA 3QGGA 2UUAF 4DZDA 1HYSB 1QAYA 1OYDA 3EXCX 4WWSA 3HHLB 4PYDA 4URSA 4WFNQ 3AA9A 4FYYB 4JI5F 5LJ5Y 1S0VA 2CPXA 1HW9A 1EENA 3AJ1A 1QUPA 3CD7A 3ILOA 3VAJA 4QJVA 3NRBA 2W2NP 2VOPA 3AY0A 2FZGB 3IAM9 4OHZA 4FYXB 5K9WA 1P31A 5C2GA 3UN3A 5E33A 1KHVA 2BW7A
chains in the Genus database with same CATH topology
2ZFHA 4N47A 2PE8A 3OHAA 2YWHA 3HK2A 3KLIB 1EETA 3KLGB 3KLHB 3J7A1 3I80A 4J9PA 2W4PA 2ATLA 2I3UA 2UUBF 1X4DA 2W25A 3GXHA 3OVBA 4D3PA 3RB6A 1G3OA 2E44A 3TI0A 2CDQA 1L3VA 1HW8A 2OD6A 1JF7A 2XGQA 2O66A 4AXJA 4GE6A 4XDCA 2M4MA 3J7ZT 4C8MA 1RT2A 2DPJA 3CDWA 2MZRA 5B0EA 4RNOA 1HHSA 2GQ2A 3LAMA 3PEHA 3MECB 1U49A 2F6YA 1YRUA 4DQRA 2AZRA 3NMEA 1VQKS 3RGOA 3CMES 1E6VA 2YTCA 1G6BA 3LP1B 5K8MA 2QSWA 4QPXA 1NB7A 5KFIA 5A8KA 4TY8B 1M5VC 1NWEA 2I1YA 2RQ4A 2V2KA 4I68A 1KLMB 2D41A 4IG0B 2E1CA 1N0VC 1LWEB 2EVZA 1UFLA 3C6TA 5KT5A 4FP9A 4OZ0A 2ZH9A 2A1BA 4AE5A 1YJWS 1S1WA 1R7IA 3DM2A 3KFWX 4DGXA 2VFUA 4KKOB 1PTUA 4RU9A 5G0RA 4IFVA 3CUNA 1W25A 2JVRA 3N4WA 1WWHA 2RUGA 1F60B 3A8EA 3H2XA 2AX1A 1T48A 1PC5A 2GGPA 3QCDA 5KA8A 3RZ2A 2XLKA 4JI4F 1OEMX 3ZZ0A 4RUHA 1YWXA 2X1AA 1HNVA 3LGNA 2VQFF 4ED1A 5KFPA 2GMLA 4MH8A 1FVSA 2MZTA 4RW7B 2WB4A 3C6UB 5F9LA 3G9CA 3MPYA 5IBMA 1LARA 1Y00A 5CD4H 2C7SA 4KGKA 3EGZA 3UR3C 3M2VB 1U1RA 5EX0A 3H98A 5BYSA 4DL7A 4CO4A 1RYRA 1K1SA 2B4OA 2CPEA 4TVVA 2OO4A 2HNDB 4KYQA 2EPIA 1OS5A 3KLEA 4AL7A 4EBCA 1H0HB 4EO6A 1JX4A 2BOPA 1C86A 2HY3A 1N5YB 3QCLA 3V0GA 1Y9OA 1JKHA 3OSNA 4Y0FA 4QBUA 2JJ4D 3OL8A 2HGLA 4AUKA 5HROB 2XMUA 1CSJA 1HPZA 1QUVA 1FKPA 1QE1A 1WD6A 3S3KA 1KFSA 1R3NA 2L48A 2HNYA 2YNIA 3B7OA 1PH0A 1U26A 1F0XA 1HWKA 2FVCA 4ID5B 4RW6A 4K4WA 5J2QA 1N54B 1TL4A 2KRBA 4DL3A 1S9EA 1HBOB 3G6VA 1KN6A 2KXNB 2KXFA 3HHLA 3PO5A 2ZZMA 1HQUB 4ZVFA 1IKYB 1ZM4A 4RZRA 4Q7AA 1TR0A 4F4KA 1M5KC 3QJLA 1SKRA 4B3RF 1TFYA 4JV2A 3DLKA 4RWXA 1DQ9A 2KM8B 3NCQA 4QZVB 2OP5A 1SI9A 4X4OA 3OUYB 2H4VA 5A8WB 1YJNS 1TKDA 1PC4A 1MNEA 2FJEB 1R27B 1NRKA 4Y28C 4X4RA 1SH0A 5C25A 2U1AA 4ZN5A 3RU0A 1FXRA 3PJWA 2K7KA 2ZNZA 4MK8A 3PJXA 2VBWA 1JLAA 1H7WA 2AGOA 3ENWA 2GJ2A 2HAIA 2F4VF 3EZ5A 5BJRA 5IBSA 1VBZA 2F6VA 1VBYA 2FJBB 4X4SA 2CPJA 3HO1A 2FVSA 2C42A 2YX7A 1ZCLA 2BGEA 2XC9A 2UVWA 3K5NA 1NH7A 5CYMB 1F2GA 4FXVA 1UVNA 3H5SA 2G59A 4A48A 3KYLA 4YB7A 4K4VA 1TL3B 1IJFB 4DBQA 3MM6B 1YITS 1RT7A 2J5AA 4AXIA 3P5TL 1RXDA 4YOEA 3KLIA 3KLHA 3KLGA 3QCEA 3FDSA 2MKKA 1BQNB 2R7QA 1R6YA 4ZA1A 2DHSA 3UDLA 5IM0B 4O3QA 1RT1A 4Y6IA 4USHA 1FHTA 1TP7A 1C1BB 2HHXA 2EBGA 1XC9A 4IR9A 1HNXF 4RBUA 2L08A 4OJGA 3BO2A 4F4YA 1FKAF 1YGUA 5E41A 3TX8A 3MR5A 4NYPA 1X4FA 2CQ1A 2HHPA 5F8JA 1R0AB 1P15A 1RP5A 5EN1A 4J9MA 4U7CA 2J9DE 2B5JB 3MECA 1XMBA 3QCHA 3W3SA 1G1XA 3NNHA 3GR1A 3HHKA 2QLWA 3LP1A 1S1TB 1Q81T 1TKTB 1RI7A 4TY8A 1VIOA 3LQVA 2KZMA 3LALA 5KFAA 4MBBA 1ZC0A 1KLMA 2AJFE 4IG0A 1LWEA 1FXDA 2P9GA 4J9NA 5M43A 4CIOA 1S4FA 1LKZA 5LMNF 2I3RA 1LW0B 4GWFA 2I6OA 4PG8A 2V8HA 3GFXA 3OHBA 3R1HA 4KKOA 4WCEQ 1HR0F 3OL9A 2A10A 1N34F 4PXDA 3IO1A 3D42A 3MZIA 4MK7A 4NA2A 1VQ5S