2B4UA

Structure of the c252s mutant of selenomonas ruminantium ptp-like phytase
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
314
structure length
314
Chain Sequence
b'TVTEPVGSYARAERPQDFEGFVWRLDNDGKEALPRNFRTSADALRAPEKKFHLDAAYVPSREGMDALHISGSSAFTPAQLKNVAAKLREKTAGPIYDVDLRQESHGYLDGIPVSWYGERDWANLGKSQHEALADERHRLHAALHKTVYIAPLGKHKLPEGGEVRRVQKVQTEQEVAEAAGMRYFRIAATDHVWPTPENIDRFLAFYRTLPQDAWLHFHSEAGVGRTTAFMVMTDMLKNPSVSLKDILYRQHEIGGFYYGEFPIKTKDKDSWKTKYYREKIVMIEQFYRYVQENRADGYQTPWSVWLKSHPAKAL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords myo-inositol hexaphosphate phosphohydrolase
publication title Kinetic and structural analysis of a bacterial protein tyrosine phosphatase-like myo-inositol polyphosphatase.
pubmed doi rcsb
source organism Selenomonas ruminantium
molecule tags Hydrolase
total genus 99
structure length 314
sequence length 314
chains with identical sequence B
ec nomenclature ec 3.1.3.72: 5-phytase.
pdb deposition date 2005-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14566 PTPlike_phytase Inositol hexakisphosphate
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1690 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2b4uA01
3.90.190.10 Alpha Beta Alpha-Beta Complex Protein-Tyrosine Phosphatase; Chain A Protein tyrosine phosphatase superfamily 2b4uA02
2GJTA 3CM3A 2CM2A 1BZJA 1YGRA 1BZCA 1EENA 4NWFA 2HC1A 2HB1A 3F99A 2J17A 1Q6TA 3V0GA 3ZV2A 5J8RA 1ZC0A 4WU3A 3SMEA 1ZZWA 1OHEA 5KA9A 2BIJA 1PYNA 4RH5A 5KACA 3EMUA 2I6OA 4GE5A 1QZ0A 2C7SA 3ZMPA 1RPMA 3MOWA 1G1HA 4KYQA 2QBSA 2B4PA 3EAXA 4ICZA 3F9BA 2PT0A 5KA7A 2G59A 5K25A 1Q6SA 3S3HA 2HNQA 1OESA 3BRHA 1FPZA 4Z6BA 2B49A 4QBEA 1P15A 3O4UA 5EHPA 4OHIA 2HC2A 3F41A 1G1GA 2MBCA 3RGOA 3MMJA 3PS5A 1BZHA 2M3VA 1PXHA 3RZ2A 1ONYA 4QUMA 2BGDA 2Y2FA 2I5XA 2J16B 3LJ8A 1OEVA 2JJDA 2F6YA 5K9WA 3CWEA 1I9TA 4D3QA 2GWOA 1KAKA 5HDEA 1NO6A 3M4UA 1OEUA 1XRIA 4KYRA 3U96A 2I6PA 2H4VA 1YN9A 2P4DA 1C83A 5KA1A 4DGXA 1KAVA 5EHRA 1XBOA 3QCBA 3QCLA 2I3RA 4H34A 1G7FA 1MKPA 3D44A 1G1FA 3QCNA 3QCCA 3V0IA 3QCMA 3GXHA 4OHHA 3SR9A 1NNYA 4KI9A 2RF6A 2QDPA 5BZZA 3EU0A 5K9VA 2BZLA 3N0AA 2CNEA 4JMKA 4RI4A 1OHDA 2I4EA 2F6VA 4OHEA 5IBMA 2QBQA 2B4UA 2CMCA 4S0GA 2F70A 3D9CA 4QUNA 1C85A 1LQFA 2F6FA 2CJZA 1GFYA 3AWFA 4YR8B 4GRYA 2I42A 1Q6JA 1NWLA 1XXPA 4NNDA 1G7GA 1C87A 4RHGA 1J4XA 2H4KA 4WU2A 1OETA 2H03A 2QDMA 2QEPA 3ZM1A 5K22A 2E0TA 2QBRA 2ZMMA 1YTNA 2PA5A 4H1OA 3ZMQA 1LYVA 1PTVA 3B7OA 3BLUA 5KA2A 2F6ZA 1ECVA 5BUGA 3S4EA 1Q6MA 1PH0A 3GXGA 4I8NA 1RXDA 1WCHA 3S3FA 3MOZA 4WOHA 3V0HA 3H2XA 4NX8A 2HXPA 2I4HA 1U25A 5IBSA 4GE6A 2B07A 2I6JA 2VEYA 2FJNA 1EEOA 2F46A 1C88A 2IMGA 1Q6PA 4GFVA 1R6HA 4R30A 1PTTA 2NT7A 1T48A 1Q1MA 1PA1A 3D42A 1G4WR 3ZM2A 1PTYA 4D3RA 3QCFA 1YPTA 4HJPA 2C46A 3S4OA 4YAAA 3RO1A 2H02A 5KAAA 2QCJA 2PSZA 3ZM0A 1PA9A 4D3PA 2HNPA 3V0JA 5KADA 3V0DA 2CNIA 3NMEA 3EB1A 2CM8A 2PQ5A 4B04A 4OHLA 2R0BA 1WAXA 2YDUA 3I80A 3D1QA 1L8KA 2F71A 5I6VA 2I6IA 4ZN5A 3QCDA 1I9SA 1T4JA 3O4TA 1JF7A 1ZCKA 2G6ZA 3ZM3A 4GWFA 1X24A 2A3KA 2VEVA 4HJQA 3F9AA 3QCEA 4JMJA 5KA0A 1JLNA 1V3AA 4RKKA 4R0TA 2VEWA 3QCJA 2H04A 3EZZA 2Q05A 2BGEA 4NYHA 2OC3A 2PI7A 2I75A 3QCIA 4GFUA 3V0FA 2CFVA 2OZ5A 2CM3A 2I3UA 5KA8A 2F6TA 3BLTA 1OHCA 4Y2EA 5MMZB 1G4US 4ERCA 1A5YA 2HVLA 3OLRA 1XXVA 4QAPA 2I6MA 4GS0A 2HCMA 2J16A 2NLKA 5K24A 3QKPA 5BX1A 3O4SA 3QCHA 1T49A 2I1YA 4OHDA 2I4GA 4PVGA 5GTJA 3OMHA 4QBWA 1LARA 2CMBA 3AWEA 3I7ZA 4JNBA 4RH9A 4GE2A 1Q6NA 2WGPA 2OOQA 2NZ6A 1OEMX 1NZ7A 2PBNA 3BM8A 1SUGA 4WTYA 4GRZA 2P6XA 2VEUA 4MBBA 3V0EA 1YGUA 3QCKA 3AWGA 1YZ4A 1C86A 1AAXA 1L8GA 2NT2A 5KA3A 4RI5A 4ZRTA 4AZ1A 4R0SA 3D1HA 2ZN7A 1YFOA 2SHPA 3QKQA 2NTAA 2NV5A 1U24A 3F81A 2OUDA 1M3GA 4HRFA 2F6WA 2QCTA 2Y96A 4QAHA 5K23A 1C84A 1NWEA 2B3OA 4IKCA 3O3LA 5LXQB 2VEXA 1OEOX 1YWFA 1XM2A 2HY3A 2A8BA 2ESBA 5KABA 3S3KA 3O5XA 4ZI4A 1NL9A 2CMAA 1ONZA 3D1OA 4J51A 2CM7A 1GWZA 1VHRA 2CNFA 1QXKA 2DXPA 5AWXA 3S3EA 1WRMA 4Y14A 4NWGA 2GP0A 2B4OA 4PYHA 1U26A 1I57A 1D5RA 1FPRA 4DGPA 3I36A 2QBPA 4BPCA 2FH7A 2B4SA 2H4GA 4JBCA 5M43A 3QCGA 4BJOA 2CNGA 5BZXA 3RGQA 1YTSA 4TVVA 2BV5A 2Q47A 3A5JA 1FQ1A 5KA4A 1PTUA 2FJMA 1ZCLA 1YTWA 2AHSA 3A5KA 2CNHA 4RDDA 2AZRA 2QDCA
chains in the Genus database with same CATH superfamily
4WIIA 1P31A 1VLYA 2QTWA 2Y1LB 4PXBA 5LXYA 3MEEB 2KM8C 4LIWA 1CJUB 2DNMA 3DGVA 1JLCB 4AD6A 4MKVA 2DNZA 3A8IA 3FFIB 2D9OA 3S7RA 3CWJA 3FC9A 5D0GA 1T9XA 4RH5A 5D0EA 1BGXT 1L3VA 2BOPA 3SQGB 2U2FA 3LW5C 3U02A 3H42A 1GMUA 2L48A 2FJEB 3BKFA 5KA7A 4PEOA 2LECA 3DHWC 1S1TA 3KK2A 3LK7A 5E3AA 4Z6BA 2Q6CA 1S0NA 3QRRA 2D41A 2IVFB 2L3MA 3Q8RB 1RADB 2BBEA 1F5CA 1SC3B 4O4GB 2JWNA 3D66A 4F26A 4DXLA 1JLFB 1ZBTA 1D9AA 2CWXA 1QDUB 2F40A 3MR2A 4LF4J 1ITPA 3JAMY 3T19A 1XBOA 3QCLA 2I3RA 5A8RA 3D54A 2ZH4A 3RB4A 2CKWA 2CQ0A 3UCGA 2JJ4D 5B0AA 4MK8A 1QY7A 2ZOMA 4RWXA 1S1XB 3QYYA 1T03B 1RE1B 5KG7A 2CNLB 3X3UA 5EN1A 2HWHA 5C5JA 3IBCB 2MKCA 2CMCA 1IR2A 3QAEA 4QWAA 3NCRA 4KH0B 4B3OA 2BQRA 2MJUA 3NP5A 5L9XA 2CPZA 3BBBA 2VBZA 1N4LA 1XWLA 4A8XA 4KHMA 3LA0A 3CD0A 2QBRA 4PQAA 5DM7Q 3AJDA 3ZFVA 1N34F 2RILA 1HYSA 1UJ4A 4C0HA 2QSWA 3O5TB 5DDQC 4UOFA 3MFHA 4TQSA 1S59A 1DQAA 1WUUA 3R1HA 1QE1A 1T9VA 4M5DB 2I6WA 5GMKa 2A10A 1HWKA 1HQ2A 3W62A 1UFWA 4OYBA 4ILLA 5D4PA 2R8IA 3HVTA 3KLGA 4RBTA 1PTTA 2P5VA 1T05B 1FXLA 1PA1A 4DS4A 3QJPA 4M5MA 5FIIA 3W60A 3HHLC 1C1CA 3L7UA 3VAIA 1RTHB 3ZZZA 5HP1A 3RAXA 2P9CA 4FF4A 1U1PA 2PN6A 4LR9A 4DV5F 4X4VA 1TMJA 3OTDA 4RW9A 4Z7YA 4JV2A 1DTQA 2W9CA 1QVGR 2J6SA 2BJ9A 4K8RA 4ZVOB 2VOPA 2MJNA 2WOMA 5KFBA 5K5MA 3IAM9 3QCDA 1N6QB 1HHTP 5DGBA 2DRBA 4RPFA 4K4TA 3GG0A 5MAOA 3TAMA 3QO9A 1VBXA 1JLGB 1FK9A 4ED0A 2GIQA 4NEZA 3OUYA 1SL1A 2OAUA 4JMJA 1H3DA 4DMZA 1CS4A 1EKSA 4FNHA 4IO1A 1RLCL 1TZ0A 3MM7B 4DCJB 1N34J 4CVKA 1SB6A 3MURP 3CTRA 2Y8YA 3W8GA 1OHCA 5I3QA 3I4PA 3IG1A 3LP2B 4LRAA 4Q7AA 1VK3A 1U1QA 3UI3A 1N5YA 2ZH6A 4D3GA 5CD4A 1NH8A 3KUGA 3C2PA 1B7YB 4FKXA 3BO2A 2AJ0A 2AWZA 1OYEA 2FLNA 2KJVA 1TK8A 1FDAA 2XM3A 4QWDA 1WEYA 3QCKA 4NCGB 2V4JB 1VQ7S 4DV5J 2NZCA 1NKEA 3T6BA 1HI1A 3ITHB 4P2XA 2WZ1A 5CHCB 3OV7A 2EK1A 2SHPA 2Z4PA 3MPDA 2L9NA 2VQEF 3GCWP 1HARA 4HHHA 4KSEB 1YSJA 1YWFA 1QAJA 2UXDF 3S3KA 1QM9A 3R8YA 1GEHA 1VDHA 3N4WA 2PDAA 4DFMA 2RS2A 1N88A 1G7CB 4K5SA 4DPWA 1WELA 1TKZB 4KV8A 1EETA 2ROGA 4KPCA 2DGUA 4NMXA 2YNFB 1RB0A 1UZHA 4RNFA 3E01B 3PX4A 4TYBA 2BVZA 5THWA 1B3TA 3KG0A 3KK1A 2YWWA 1YTYA 2K06A 2FJMA 2OHDA 4EBEA 5BYQA 3CGIA 3LP1A 3KLEA 3VAFA 1S9EB 3Q2SC 4PG8A 2FVQA 1LXJA 2CM2A 2QFIA 2NPIA 2MPUA 2WCXA 3R7SB 5L39A 5LT5A 1C4CA 3K0JA 3O6QA 3M6WA 2LU2A 2CAJA 2G0JA 4OMFG 4NCBA 1PKUA 2RS8A 1UA0A 3FSYA 2WONB 2QBSA 2Y66A 1HNXF 2MHEA 3QJLA 3NXZA 4HDGA 2B3TB 5IM0A 4YFUA 4QW9A 2CNOB 2AZ1A 4J37A 2HFSA 2VQEJ 1G1GA 2K3KA 3M9NB 2UXDJ 3HVRA 4KC5A 5HMWA 4ZPDA 1RU1A 2E5LF 2LVWA 2XSFA 2BMBA 1U0HB 2BQUA 4BDPA 5HK4A 3DNCA 5E0OA 2JLGA 1JQGA 2MY7A 2Y0BB 3DYAB 1RZMA 2IBOA 3TYTA 4KHPF 3MR6A 2RQMA 3TZWA 1UP1A 4DR1J 3T9ZA 2XBPA 3HSDA 1EQ0A 4I6AA 3UDEA 4ZOSA 2V8HA 2RVJA 4KGVB 2KT2A 4PG6A 5J2NB 3HKZD 4K2XA 4KO0B 5SUHA 4FF2A 2QDPA 3EU0A 4B08A 4JMKA 2GIRA 2W25A 2C22A 5IZHA 5IBMA 3OL7A 2Y68A 2HFOA 1F2GA 4TN2A 3NMAA 4IQMA 3M9OB 4Y2CA 2FHKA 8RUCA 3H2VE 4YEAA 5KFMA 1IVZA 3GJTB 1HHSA 1LWXA 1Y4ZB 2GQCA 1S1VB 1N36F 1C0UB 3GP9A 5H9EJ 2D9PA 2IRYA 4LRCA 3TARA 3VVTA 4ED5A 1LYVA 4FXWA 2WTFA 5IWAF 1HNXJ 4OX7A 5IT0A 2C2MB 4WYLA 3MOZA 4X4OA 4X4SA 3PJ9A 2OSRA 2HXPA 1VYAA 3NS5A 4C2MA 2DIUA 1D9DA 3MHYA 1MU2A 3AA9A 5CCLA 3PVXA 3ET6A 2JSXA 2V69A 2J76E 1ZETA 2WHOA 3UAGA 1H38A 1R6HA 3R2DJ 3ZTSA 2DNNA 4URGA 2LXUA 3J80U 5LSLA 2M3DA 4B02A 2E5LJ 4MIWA 4ZN1A 3ZTOA 2A2CA 3GIIA 3BGRA 3OL9A 4NLYA 4MFBB 1F6TA 4KHPJ 3CIZA 4BLGA 2IAJB 4ZP9A 1FD2A 3CCES 4M63A 1SL2A 4NRTA 1SC1B 4F0MA 2V9WA 3Q86A 1URNA 3GYNA 2CM8A 3NLCA 3ZL8A 5RUBA 4B04A 1VGYA 1RP5A 1SQEA 2VA3A 3I80A 4DLGA 1HQEA 2DPJA 2W2MP 4QU6A 2DY1A 2K1RB 3O4TA 1RTDA 1EARA 4DPOA 2XS5A 5FLXU 5LSRA 4FKYA 3RUBL 2B4VA 2CPEA 3R5CA 4CLWA 5ETMA 1TL7B 1WF0A 1RAHB 4DSEA 4ZIVA 1FRKA 1N36J 2AEFA 1TUGB 4X4NA 2XCAA 2PI7A 1GXUA 2Y1IA 5IWAJ 2GJIA 5MMZB 4FVMA 1VRUB 3FQLA 3I82A 1M90T 2MLXA 3PFEA 2GVZB 2HHTA 4WBFA 1Q53A 2HAFA 1IBCB 1XXVA 2ZDPA 3AH6A 4LRDA 3M1VA 2HHXA 3KLFB 1F9HA 5BX1A 1OO0B 1FKPB 2V68A 1ACMB 2WB1D 2VTDA 3AB2B 4P10A 4ATNA 2CPHA 2DNKA 1RACB 4NYZA 1S6QA 5KFYA 1NDPA 2FJDB 4JI2F 3KLHB 4DLEA 5HSPA 3CCLS 4QR0A 4TY8B 3SXLA 5A6WA 2Z2ZA 1LWCA 1L8GA 4B9UA 2VG7A 1RSCA 4AZ1A 4KB7A 1IBMF 2H9ZA 4ZMMA 2XWYA 2HGLA 2H5JB 4CT9A 1YWXA 2HWIA 4MH8A 2F6WA 2ZZMA 1SJ1A 4ZJOA 1GX5A 2YKMA 3JSBA 4UY85 1OEOX 1CJUA 4FZVA 1JLCA 2KH9A 3QWPA 3D1OA 2VQFF 2AD9A 3FFIA 5C25B 1JJ2R 1GWZA 2DXPA 1W7WA 3MCOA 1V5VA 4FXDA 3RBZA 1F5BA 3SQGA 3UNGC 3I36A 1OYDA 3LGNA 5HBMB 4U96A 4B3MJ 2GCFA 3PNIA 1WTFA 3GCXP 4J5OA 3PDNA 4WXWA 4RW4B 2KTQA 3RB3A 2C3PA 2HAIA 1SJRA 4ZPTR 2XLKA 5L8RC 4EBCA 4O4GA 2DIVA 1JLFA 3OXGA 5A76A 1MNEA 3V0GA 5GADI 1ZZWA 1KRPA 4OI4A 4JI2J 2BIJA 1X4AA 2V34A 2Y67A 1YDLA 2EFNA 3G6VA 2Q79A 1OWXA 4DSLA 1GXLA 1UZDA 4ICZA 3PO4A 4DS5A 4F4ZA 1S1XA 1IBMJ 1T03A 2K7JA 2JC0A 2P2CB 1RK8A 3TEHB 1XR7A 4CH7A 3QAUA 3F41A 1BUXA 3ONQA 3UD3P 3PKMA 1G4CA 2Y2FA 5DG8A 3FBEA 4OYIA 1B64A 1I9TA 3VAHA 1XMOF 1G3OA 3CO9A 2X51A 2NUHA 1U09A 2MKSA 3VAGA 1PAUB 3TVKA 1IM6A 2AM1A 1AXQA 1C83A 3BSOA 1H2TZ 1FJGF 3CCTA 3LF0A 3HK2A 3M6UA 3OHBA 3V0IA 2GMJA 5A5EA 4EMDA 4A47A 4GO5X 3PEJA 4M5DA 2H3EB 4IRCA 1OQ3A 2QBQA 3QSIA 1TP7A 2F70A 2WVCA 4ELVA 3AB4B 5D15A 2I1RA 1T05A 2DNYA 3CDWA 4ANDA 1F3VA 2MQOA 1VS3A 1LWEB 1EJ7L 4F2SA 2R2TA 3EMTA 3ZM1A 1RTHA 1SV5B 3UDCA 1NKBA 4HDHA 4OZ0A 4H1OA 2OGUA 3QBCA 1WTBA 1R31A 2VC1A 2JFKA 4UQTA 1PH0A 3VAJA 2F4VF 1RAIB 1J2VA 4QYZK 2XZTB 3ZTPA 1PBAA 4E98A 2B07A 1VQSA 1N6QA 5BYSA 3WX8A 3B54A 5LJ3Y 1JLGA 1N5SA 1U6FA 4L6V3 1UJ5A 2XO7A 4CI0B 3F44A 1XMOJ 1NH7A 3TANA 3P5TL 2B43A 3TAPA 4NXNF 4NYOA 4FVCA 4YR0A 2YX1A 1F0XA 1PILA 5MLCV 5DGAA 3MM7A 1FJGJ 3JB9k 4BC7A 2H02A 5DJBA 4C98A 1JLQB 3LP2A 2GIFA 3KLVA 1PA9A 4ZVQB 4J9PA 3H0PA 1QAYA 1UWAA 4K4YA 4DV7F 4BC9A 1HNIB 4NPOA 4RWWA 2BOAA 1FE4A 1OPZA 4USVA 2FVSA 4DPYA 3K2YA 4CM2A 3PR5B 3POTB 4LQ3A 2HQIA 4HEA9 2LP4A 1BWVA 2ZC4A 3GG1A 4RKKA 2BRLA 2LA4A 4DR3F 2VEWA 2J8SA 1IM4A 4NCGA 3LALA 2V4JA 3HVWA 3IR7B 2LQJA 4IG3B 4DL2A 4F36A 1UVNA 2MQ8A 3UDVA 3ITHA 2F4VJ 2B7CB 3MGJA 1NHUA 1HBUB 2MEWA 4ZVPB 4DL0C 3DRSB 4FP9A 3EZUA 3ZZTA 3BR8A 3LWMA 1NKCA 2YNHA 3SFUA 3I9V9 2CJAA 2FYXA 4OV1A 4AXJA 4NXNJ 5DQIA 3FRYA 1TKZA 2HS0A 3HHDA 5IQQA 3ULHA 3DOLA 2YNFA 1NJXA 5KA3A 1WOPA 3GFXA 2DNGA 3E01A 4P74A 2PI4A 2GMLA 3QKQA 4DV7J 4C7QA 2BDPA 1TKTB 2BR0A 5KT7A 3KOAA 3M8PA 1NK7A 1S9EA 2UUWA 2ZBPA 4F4AA 2LXFA 1K47A 1PYTA 2ZH9A 3O5XA 4Q8FA 3WC0A 3K8VA 3G6XA 1S0OA 3KMSA 1VHRA 3I31A 4LQ9A 1Y7PA 4DR3J 3B78A 4GO7X 4URQU 2NR0A 2J9DA 5CA5A 3SV3A 3BB5A 2WONA 2DHGA 4DR2F 2CDRB 3CIMA 3PY8A 2LMIA 2B5JB 4P73A 2VKRA 5B7WA 2UXBF 2YKPA 3R9LA 1YTSA 3HPOA 2FVRA 2LYVA 3UO0A 3KJVA 1SC6A 2HKEA 2F00A 3CDBA 2MKHA 3PYGA 1NPPA 2QLBB 3RAMA 1ZA1B 3G8TA 2DYAA 4M5HA 5AXNA 4FF3A 3TI0A 4DV1F 1HL6A 1Q8KA 1TTHB 1X4EA 1G2EA 1U0HA 4WP3A 3FJ2A 1HA1A 3DYAA 1VQLS 3CJ4A 2DNLA 3ZNJ1 4Z2XA 5J1NA 2FVCA 5BXIA 1G1HA 2FZKB 5J2NA 3DOMB 4RLEA 4KO0A 1KLNA 3RGIA 2DH9A 2KXHA 3P96A 2ZOFA 3QRQA 4I7FB 4WFAQ 2C3OA 1M5PC 2XLIA 4QWCA 4YHHF 3BO3A 3HHKA 3MDFA 4X2BA 2Y1RI 3TO8A 3O8WA 2J7KA 2YVSA 4CLTA 2HQCA 1S1VA 1C0UA 3MEKA 4GMKA 4DGXA 4ZJQA 4CH1A 3G6YA 1S0MA 4BHQA 1G7FA 2JX2A 4EWTA 3D44A 1N5TA 3QCNA 3TW0A 3LP0B 5DM6Q 4U7UK 3RBXA 2UXBJ 2ZE2B 5B0EA 2OPSB 3AJ1A 3MCSA 4P2FA 5J2MB 2EFGA 4OHEA 1WWHA 5DLFA 1IKYA 3OR2B 2I9SA 3R97A 1LQFA 2F6FA 1YITS 4DV1J 4K0KF 2ZEJA 3KTQA 2IJRA 3K5PA 4GRYA 1NWLA 2ZNYA 2LCWA 4CO5A 2UVVA 3JS9A 3NAHA 1ZOTA 1X4FA 2D3O1 3S6EA 1UAWA 4MFBA 1RU2A 2AKWB 3NL0A 2IAJA 3M8YA 7AT1B 2JZ5A 1DJ0A 1NNDA 1ECVA 4R25A 4QW8A 2Z2MA 1FJEB 1KHVA 2CWKA 2YNIB 1NK0A 3LAKA 4OFZA 3UE2A 2OELA 1S9FA 3DRRB 3AD8C 4L75A 2HIYA 4FYYB 2HNZB 2K1RA 4YHHJ 1CJVB 5KG5A 4LSNB 3I96A 9ATCB 4NLTA 2N4DA 1M5SA 2BJ3A 2FDNA 3NS6A 3ZM6A 3W7BA 3FVYA 5AJ3F 1H7XA 1TL7A 4ZCIA 2F3JA 2HG4A 2JDJA 3AXMA 5K20B 5E3CA 1NDCA 2XQCA 5LJ5Y 4Q2LA 1X9WA 2EW9A 2IMOA 5KG3A 5ETOA 1VLOA 3QGPA 2MY8A 1LWFB 2GVZA 3IBWA 1Y3JA 3NG8A 3J7ZT 2B8PA 2QC3A 1REGX 3V0DA 1S6PB 5J2QB 2PQ5A 3PYFA 3GYGA 4OHLA 1FVQA 4OJHA 3KLFA 1FKPA 3HJVA 3MM8B 3I5BA 1C4AA 3ZZ0A 5ITHA 1L3TA 3HSGA 1WC4A 4ZIYA 3P45B 4K0KJ 1P3DA 1EQMA 4IOBA 1Y9OA 2W24A 3KLHA 4Q5VA 1L5UA 1TK0A 1KQSR 2UUBF 2QV6A 4DBQA 2DGWA 4PCQA 4TY8A 4ED6A 4Y2EA 1F2HA 4J9SA 4ERCA 4IOAQ 2VUGA 3C3LA 2XPCA 1U1LA 2LKZA 4KJIA 3MEDB 5IV3A 4RUBA 3VGSA 3H25A 1YJUA 1GAOA 2NSBA 4JI1F 1QUVA 2B7BB 4UUWA 3HMJG 4QBWA 1P9QC 3VGUA 3IRWP 2AJFE 1FWKA 4N41A 1TL3B 5C25A 4EO6A 4WTYA 1O8BA 5AJ3J 2GAHC 2P6XA 5JMNA 2ZC3A 2F9DA 4F2RA 4ECUA 3CDAA 2HEKA 1AAXA 4P71A 1RT1B 4YB1P 4K4SA 3KJNB 5HBMA 3HHEA 4ANEA 3C19A 2DGQA 4X64F 5EX3A 2FJVA 2GNKA 5JUMA 5CAAA 2R7TA 2DKOB 4RW4A 2NPFA 3BV8A 3BS9A 1RBAA 4HT7A 1NLKL 2HGNA 1WORA 3TA1A 1D3WA 3FCVA 3E8OA 1VHFA 1XERA 3J80Y 4A8OA 2W8LA 3BO4A 4LFCJ 2UUBJ 1PGZA 1OS5A 4L3KA 2C3UA 1S5ZA 1S76D 2MQLA 5FD1A 2FH7A 4C3MA 1IKXB 2L08A 4K7QA 2VDHA 3EE3A 1IBLF 3RGQA 4HV4A 4TVVA 4PWUA 1FRLA 2IM1A 3EICA 4XDDA 2QMXA 2LQ9A 2GVDB 4F4KA 2OTJS 1HWUA 1RWUA 3HD2A 2B56A 4JI1J 4DUZF 1T9TA 1Q79A 2GJTA 4N8OA 2QJ3A 4DZ6A 1GTEA 5HVHA 2RRNA 2XS2A 3J7Z5 2ACYA 3ZV2A 2DCLA 3M4XA 4JI0F 3VQTA 5GAGU 3ZMPA 1RPMA 3U1MA 1IXKA 4ECYA 2NQPA 1TUVA 3TJ9A 1JB0C 4KYQA 5HVFA 3QQCD 3PW0A 3PX6A 4X64J 3D28A 2LA6A 3OFFA 1FPZA 1DQ8A 3A3NB 1BWEA 1RA6A 3S8SA 2CQGA 2ATLA 3HF5A 3J7A1 3WHIA 2Y8WA 3AA8A 1YBAA 4TKTA 2JJDA 1LWEA 1B0PA 2F9JA 1SV5A 3MTJA 3LPYA 4EO8A 2ALYB 3CJ5A 1UJ6A 4EUVA 2X1BA 3V6JA 2E44A 2VB6A 2V5HG 1MKPA 5D77A 4O3PA 1FF2A 1IBLJ 2V2QA 3WZ0A 1D9FA 5ADZA 4J9MA 2UAGA 1PJ7A 2QL7B 2HW3A 4RW7B 2UVWA 1Q8IA 5CYQA 3RYLA 4DUZJ 1Q8LA 2M70A 2GAGC 1ZYQA 2F8EX 2GC5A 4QYRA 2C42A 3VF0B 3M6XA 1KQFB 2NS1B 3G6ES 5HL7Q 4ZCKA 1JX4A 1VJWA 3W66A 3UVJB 2RD5C 3BBCA 4JI0J 3ZMQA 2XLJA 3N6NA 1JLQA 1PTVA 2BKOA 3PIPQ 4J9RA 2F6ZA 2Q66A 3DM2B 3S3FA 4RR5A 1HNIA 4R5PB 1S79A 1JNZB 2XJAA 4F50A 3N2AA 2FUG9 1VQPS 1P27B 4UZCA 4N47A 3SDEB 4LFBF 3POTA 3ISZA 2BKPA 3MAQA 4K5RA 4GFVA 2C2ZB 3JAMU 4R30A 4DQSA 4F3QA 1SCJB 3O44A 2BE9B 4B3SJ 2YH1A 2RU3A 4XIUA 4YB6A 3GR1A 4IG3A 1PC5A 4HR2A 4L73A 2HZVA 3UCUP 3GV8B 2HMIB 1SIZA 4I2QB 2IFXA 2R4FA 3JSYA 3ZM5A 3UNYA 3CO0P 5IV4A 1NCLA 2KT5A 1HBUA 1V3RA 3DRSA 3D1QA 3JQKA 4LBIA 5KFLA 3HHNB 2R7QA 3TZYA 4J9QA 4DL6A 4FYWB 2G2OA 1L3UA 2DNHA 1HI0P 3TAQA 5HATA 4DJBA 4PPDA 2ZZTA 3CNQP 1KR4A 2BGEA 4E8UA 2OZ5A 4KIAA 3GB0A 1ZM2A 4EBDA 1XK8A 1GFWB 1YRTA 2FHJD 1X9MA 1TKTA 4YN3B 1UW4A 3CCJS 1GK8A 3E2EA 2QLWA 3NGKA 5EDWA 1N33F 2HHWA 3FDSA 4LFBJ 3QT6A 3HP6A 4GE2A 3JXOA 2PBNA 1FNOA 3AOAA 5C2GA 4JI7F 3V6DB 2IM3A 5KFDA 1PJ5A 5A8KB 3IWNC 1L3KA 2V63A 3KNAA 2G1HA 4H4KA 2L9DA 2B5JA 3KLIB 3HM9A 5HROB 1RISA 3UWTA 1OY8A 4C4WA 4BUBA 1SI9A 2IMWP 3F81A 3EGNA 3QGGA 3U7JA 1KWMA 2Y0SD 2QCTA 2W7OA 3L9ZA 1N0VC 1KS2A 3QZ8A 3NBPA 5LMUF 5KFJA 4N77A 1QAXA 4Z37A 3EWGA 1NL9A 4PKDB 1X31C 1ONZA 4Y2MA 4AUKA 2AGOA 1LNQA 1F9EB 1Y5NB 2HFVA 4Y28C 3MF5A 5EGYA 3DHXA 1I57A 3WDOA 3PEHA 3DXBA 4DSKA 2XY7A 1M1KT 1WC0A 4LVOP 3DOMA 1FRXA 4A8YA 1HBNB 4P72A 3GONA 2A3JA 3QCGA 2WVFA 4NLWA 2WVDA 1WKJA 3G2XA 5J1EB 1RKIA 4CLSA 2RH3A 4DR7F 4I7FA 2PI5A 1YZ6A 1N33J 1FDBA 2HBZB 3BM7A 1K0TA 5F3ZA 2PA3A 3HCXA 1W25A 4ER8A 4LF1A 1BZJA 2Z8QA 2HK2A 3CJQA 5C24B 2G0IA 1OY9A 2G4BA 2HB1A 4PWDB 2FGCA 3RBEA 3NOCA 1DLOB 2CZVC 1EP4B 1KVJA 1I1GA 4JI7J 2I6OA 3T1AA 1JJ4A 2ZHBA 2F8HA 2DEIA 3GTYX 3LP0A 3UPFA 3AJ2A 2ZE2A 1FKOB 1LEOA 3V81B 2OPSA 4CVLA 4C8LA 5J2MA 1P15A 1D8YA 1X5PA 2RU9A 3UN5A 3OR2A 3FSIA 5LMUJ 3RZ2A 1Y11A 2HSEB 2ZHAA 3LJ8A 1JLAB 1OEVA 1EZZB 3D9BA 4D3HA 2KB2A 2HLTA 1K1SA 2BQ3A 5EUHA 2V2KA 1FX2A 5K9FA 1KC8T 2KVIA 4IDKB 1MMDA 4LBPA 3PIOQ 2YNIA 2B8QA 2DR9A 4DR4F 4ID5B 3QRPA 4DR7J 3BGLA 5CYJA 3DMJB 2RNEA 3IO1A 3DRRA 4OI3A 4GKKF 2HNZA 2KRBA 1CJVA 3VGTA 3HHLD 4NA1A 3BJYA 5CH7B 1RA7A 4HACB 3UDLA 2YWHA 4O3NA 1WG5A 1WHYA 4ZVSB 4ZLNA 2ZM6F 1FA0A 5ETTA 5G4DA 2AZ3A 2VA2A 2FD2A 4KBIA 1YTNA 2ZITA 2LU1A 3OLAA 3C6UB 4NZ6A 1XEZA 1LWFA 4C8NA 1N54B 1JBWA 4WJBA 1JIHA 2JRSA 1RWKB 1S6PA 5GAHU 5J2QA 4V1Ak 1ZM4A 3W8PA 5EX0A 3K59A 3LO3A 3ELHA 2QIFA 2R7VA 9RUBA 3F56A 3MM8A 3WQPA 1TU0B 2O1PA 3AY0A 1H7WA 4HT5A 3NNCA 4QPTA 3KDNA 1LW0A 4OLPA 2C2NA 1REVB 3SYZA 2J6UA 3ZZRA 5F8GA 1U6BA 4J9OA 1BXNA 2E1MC 3H5XA 4YAAA 4HLBA 5KAAA 2YQ0A 4LREA 1U02A 2XEXA 2AX0A 1NEEA 3GJRB 1RGVA 4ILRA 3C6TB 3MEDA 4K50A 4DR4J 2GGPB 1ZPWX 3I0SA 4TQRA 3CCUS 2DK2A 1X5OA 4GKKJ 2VPWB 4F4WA 1V3ZA 4J91A 3T1YF 2M4MA 2RDJA 1U8WA 5F0UA 1E6YB 2SXLA 2YWEA 1ZCKA 3PM9A 4GVBB 3CMAS 5KFUA 1TL3A 1X24A 4OJGA 2ZM6J 4ERDA 1V3AA 3W9IA 2NYIA 2HBRB 5KFIA 4QF5A 1WEZA 2GX8A 2H04A 3H7HB 3Q22A 1RT1A 5U47A 4OLOA 4DFPA 2CVIA 2VPYB 3HVAA 3MFIA 3BN4A 4IYQA 4CO0A 1S72S 1S12A 3FCHA 1O51A 5AXMA 5DS7A 2KFNA 3DLKB 2XZDB 4USIA 1NSAA 3HD1A 1KHWA 3VR1A 1J5OB 3HFKA 1S48A 1YLXA 4NA2A 1NZ7A 1EEHA 1RQ0A 4KH1B 5DETA 3PACA 4QIFA 3T5KA 4OZ1A 4MBBA 5HVGA 1RHUB 3DDKA 4O3SA 1B99A 4KPYA 2QT7A 2WTZA 2BJEA 1IKXA 3MR5A 4RI5A 3GJQB 1HW9A 5HQMA 3SCIE 4R0SA 4PQUB 1NXIA 4B9NA 2RUGA 2WSFC 1NK8A 3TWZA 2F4FA 5KFXA 4ZCMA 2GVDA 2MZ1A 2XMAA 4ZLPA 1IBKF 1Y5IB 3T1YJ 2EFOA 4OHZA 4NLQA 3ZTRA 2O01C 1KOHA 4CH0S 2CNKB 1RT3B 1NRKA 5AWXA 4Y14A 1S1WB 4KE5A 4K59A 4AT1B 3NRBA 4P2MA 2Z2LA 2Z30B 1KFSA 3MAAB 1FPRA 4DQQA 1X5TA 2Z56B 1W7KA 4NZ7A 5HLFB 2AYBA 5M43A 4TXSA 3MCMA 2VTEA 5ETNA 2BV5A 4WFYA 2AV5A 3A5JA 3OHAA 4I0WA 5KA4A 2EXUA 1TAQA 1UWBA 3ZZPA 1FERA 2YWGA 2KVQE 3EDQB 1YBTA 3UW1A 5IT4A 2DISA 3IA0A 5LMNF 2RIJA 2ZVIA 4OJ1A 2X1GA 3F99A 1O5JA 2A18A 2J17A 2V67A 5ETKA 2DVIA 3DGPB 4DZDA 3CCWA 3SMEA 1PAEX 1D09B 3BSNA 1S6UA 4DN9A 5DO2A 3EMUA 4DQIA 1GQYA 4LFAF 4WK1A 2VU5A 4JI8F 3LUYA 2RDDA 2MZQA 2CVEA 3EAXA 4QDIA 1NBEB 3CVKA 2E5GA 1PBUA 2W7AA 2IYGA 4WFZA 2M8HA 3GV5B 1WG4A 4WKYA 1R0AB 1RT6B 3QFWA 5F8JA 3NCQA 4ZPAA 3IWLA 4RW7A 3CC7S 3D0GE 2XNRA 2FJAB 2VBXA 3NKYA 4A8SA 3MEGB 2GQ2A 1IBKJ 1FTCA 3IGVA 3P3DA 3M9MB 1SPBP 3P4UB 3B82A 4TU8A 5D4OA 1KAKA 5HDEA 2EG2A 2ZFHA 5B0CA 1JXEA 1OEUA 2M0GB 1FRJA 4KYRA 4LMZA 1BQNB 3UVJA 3F73A 1J5EF 1YN9A 2DR7A 4GVLA 5EHRA 2RT3A 1PJ6A 2WW8A 1FRIA 1K9MT 2MMYA 1FKAF 3DM2A 2G0CA 5KFVA 5F0WA 5BZZA 4R5PA 3I32A 4USKA 3TRGA 1MMLA 4P6QA 2NXUA 4MKBA 2ASDA 2FY1A 3SDEA 2OKQA 4NMLA 4S0GA 3PW4A 1VC6A 2AMCB 3EZ5A 4ECRA 4QJVA 3R5JB 2V8PA 1N32F 3AWFA 1Q5VA 5LMNJ 1BE4A 4YR8B 2I42A 4NXMF 5I42B 4G1IA 3L7OA 1CQMA 4R0EA 2H4KA 4WFXA 4Q8EA 2RDIA 4LFAJ 4CQ1A 3OJSA 1T3OA 1YGYA 4JI8J 2HMIA 3PJXA 4MJKA 3CJTA 4I2QA 2JFFA 5BUGA 4M5IA 1Q82T 3GV7B 1RXDA 2RF2B 2EFVA 2HHHF 1LW2A 5M2RA 5DLGA 2HVHA 2BYCA 5JVGQ 2D74B 4KR0B 3S1TA 4URSA 4A4JA 1Q1MA 3O1LA 5KFKA 3M8RA 4F4XA 1HWIA 3QATA 5E2QA 5DZ6A 2DXDA 1J5EJ 5C42B 3CSKA 5B0FA 2XB2D 2W01A 4B9VA 3QT8A 3ZM0A 2FLPA 3UD4P 3OTOF 2P6TA 3MM6B 2CZ4A 2MXYA 5DDRC 3PX0A 3M6VA 4ZHRB 2YDUA 4JV5F 2DNOA 1L8KA 4W98A 1O5ZA 3R3TA 2B9WA 4ZN5A 2L41A 3T9NA 1YBUA 4PXEA 3EVOA 4X4RA 2XY6A 1N32J 1JF7A 2Y1OA 3DXSX 4GWFA 1HD0A 4NXMJ 5T14A 4CLFA 3AT1B 4WP8A 2GS8A 4RBVA 1WKKA 4WF9Q 3V6DA 1MN7A 1WHVA 2QLFB 1CBKA 2VC0A 5KA8A 3BLTA 3KLIA 2V4RA 2RB7A 5HROA 2G2ZA 2HHHJ 1KQKA 5KFPA 2IHR1 3KFWX 4LT6A 5K24A 2MLZA 3FBBA 3QKPA 3MUVP 3O4SA 4UF4A 4ZJLA 2JFDA 4OI0A 2OI2A 2AHOB 3NMRA 2WGPA 4A48A 4RUAA 1EIYB 3EDRB 2CZ9A 2BJ8A 5L1LA 5H9FK 1T94A 1T0TV 4TVAB 2B6AB 4MKYA 3J7AN 2QYGA 1YZ4A 2GJFA 3A8EA 1RBOB 2C2KB 3Q8QB 1HBNA 4YY3J 3W61A 1RT7B 2MGZB 1KSPA 3I5CA 2H4YB 2PMWA 3OTOJ 5J1EA 2NTAA 1IQZA 4V19J 2KFYA 2OTLS 4YDXA 4JV5J 4HRFA 4C48A 2Y96A 4QAHA 3Q8YA 1VIXA 3O3LA 4EK2A 5LXQB 4Y3CA 1Q4RA 3M2UB 1VQ9S 1RYSA 4DX6A 5C24A 3H5SA 1RHJB 1Q86T 4PWDA 1DLOA 4FBUA 2CNFA 1EP4A 1QXKA 4O44B 4WP9A 1QVFR 5A0YB 4JBCA 1APSA 1NZ8A 1FKOA 5HJXA 3V81A 1ZTWA 4PRFA 4I56A 1A0OB 4Z7CA 2B9XA 4Y2IA 5KG2A 3CF5Q 2YKQA 4J9LA 5ETPA 5DDPC 3DDIA 2AHSA 3A5KA 5CABA 1RCXB 2RRBA 2QN6B 2AZRA 3Q83A 1JLAA 4B9LA 4DDFA 4FYVB 1Q81T 3G86A 4IFYB 4U95A 1YGRA 1NAQA 2CRLA 1KVIA 1Q7YT 4CWBA 2Z58B 4FXVA 1HMVB 2OO4A 1WACA 3AOCA 1WJ9A 2O5DA 5KA9A 4NLUA 1R7IA 3R7NB 2MKKA 4IDKA 1P8GA 1YVFA 1SH0A 5F8MA 3GIRA 2Q3PA 2HFUA 4QYZJ 3S3HA 4B9TA 2FHMA 4KAIA 2VFRA 3MXHP 2YPZA 1NSPA 3CJSA 1TKDA 4JI4F 4C9DA 4ID5A 1S4FA 4IH6A 3D0IE 3DMJA 2VF3A 5ETSA 1Q16B 2UUCF 3FUYA 1Q78A 2CYYA 2HZAA 3PS5A 1XNRF 1BZHA 1PXHA 4HACA 3NGSA 5JVHQ 4DI6A 2J16B 1CC8A 1AYEA 2C28A 2IM2A 2HHUA 2EG1A 3M4UA 4NLGA 4C13A 3NY0A 4ECWA 4CM0A 1KAVA 3GILA 3C6UA 3N5BA 1OJ4A 3DU5A 2ACMA 4HKQA 2OMOA 1IN0A 1XNQF 3FZBA 4NZ0A 2VFVA 4KI9A 3SBMA 2QFJA 5KFAA 4RI4A 3ILIA 2XHWA 5KFQA 3QLHB 3ENQA 1YJ7A 3BKUA 4V19X 1X8DA 5K14B 3D7SB 2JNJA 4CO1A 1M1GA 3Q89A 1C87A 3OD2A 1REVA 4WU2A 3LAMA 4Q44A 5K22A 2E9RX 4ETZA 1HQUB 2F5GA 4UOCA 1N5VA 3ISND 4B3TF 4DV0F 4I8NA 2HGMA 4ED2A 3C6TA 4IG0B 3L95X 4JI4J 4WOHA 2GGPA 4FS1A 1MWQA 4C0BA 5CCMA 5CD4H 4ECSA 1DRZA 1PCAA 4X4UA 2V8VA 4EYHB 2UUCJ 4YOEA 4CDIA 4PABA 5AXKA 3OSPA 1E6YA 1S4EA 2FIUA 3IS9B 4GVBA 2J9EA 2ILYA 4OZ2A 2GW8A 3FZ2A 5D3GB 2ZDOA 3BBFA 4BWMA 4USTA 4X4TA 1G4WR 3QCFA 1QTMA 1R0CB 2HVEA 1DTTA 2OSQA 2DCUB 1WC1A 2CJBA 1Q7LB 2CQHA 2HNYB 1XNQJ 3OFEA 4FYDA 2CNIA 3PYDA 3G87A 2MQQA 4P75A 1ZM9A 2EFQA 2O66A 3IC1A 3EX7B 1X4GA 3DLKA 3CJ2A 1U1KA 3PW5A 3EGWB 2FC9A 2LLZA 1NJZA 1J5OA 1BY9A 4BS2A 2A3KA 4C0OC 3MTKA 1K0VA 5KA0A 2DXEA 2XYHB 4ECZA 3SZ2A 1KTQA 2Q05A 3I87A 4J9VA 3QPIA 1RLDA 2CQ4A 2WAQD 4AFFA 4USHA 1TKXB 3RG6A 2BXJA 4B3TJ 4ES2A 4PQUA 2BABA 3Q0AA 2FHOB 3MZIA 5A8RB 4JUZA 3JTNA 5F8NA 2BEFA 2QL9B 4O0IA 3DLLQ 4PVGA 3BYRA 4WXOA 5FDLB 2FTRA 3I7ZA 1GX6A 4ZVHA 4PXCA 1OEMX 4MMOA 3W5XA 1RT3A 4PPZA 4X66F 2VODA 4LR7A 1OPIA 1S1WA 1NO8A 2CJKA 3MAAA 3H8YA 3TQEA 5F41A 2KZZA 3S01A 4ALZA 5HLFA 1UKUA 1NJWA 2ZN7A 2XMUA 2Y3YA 4LJMA 4A8MP 2COLA 1BQMB 2UV8G 2D3OR 5GAGI 2VEXA 2CPDA 2A8BA 2ESBA 2P6SA 4ZI4A 1P9YA 4GKJF 1SJ3P 5IFMA 3VZHA 3DGPA 2KU7A 4O3QA 1LOUA 3A4TA 4PYHA 2VPXB 2M52A 3FBCA 4CP5A 1F1BB 2CPXA 5HP1B 1RUSA 3HLUA 4I68A 1R0AA 4QCLA 1RT6A 1TFYA 5HO4A 3C15A 4TNOA 1YI2S 2AP6A 4RBUA 3M8WA 5LSOA 4Y2AA 3MEGA 2VHGA 3V6HA 3A3OB 3GIMA 1YRUA 4PG5A 1R8BA 3L09A 2ZJRQ 3TVZA 1S9GB 2HRTA 3DFEA 3PHTA 1FHTA 3LTOA 1NSQA 2DH7A 3CC4S 1WI6A 2N3LA 4X66J 3G96A 1OHEA 3NS7B 2N7CA 3OL6A 1TL4A 5EWEA 3HULA 1IKWB 2DHHA 2BJ1A 3QIPB 1FXRA 3OUYB 2Z0GA 4G6VB 1KN6A 4MT1A 4B17A 2PT0A 1TL5A 2ZBIA 1FESA 4NLXA 5KFCA 1H0HB 1SH3A 5AE3A 3GMGA 3R6LB 3CUNA 1XR5A 2HC2A 4FPRA 2CDQA 5IOLA 4M5LA 1SQGA 5KFNA 2GZOA 2AJ4A 2BJDA 1SXLA 3G4SS 4HHUA 8AT1B 3CWEA 2W7PA 5I42A 3BN7A 4GKJJ 3OQ2A 1XRIA 4WE1B 2DT9A 2W9BB 3QT5A 3H4DA 4M94A 3U96A 1H74A 1Y0HA 3K5MA 3CJ0A 4GC6A 2JLEA 2WVEA 1G1FA 3T1HF 2RF2A 3M2VB 3DRPB 3V4MA 2V2VA 3ZZYA 4ICLB 2N82B 2QX0A 4M5JA 3ENAA 3AQOA 2CNEA 4ED4A 4RW8B 3H59A 3FRZA 2D3UA 2B4UA 4DV4F 2XYPB 1PIEA 2JC1A 3N6LA 4QUNA 2R7SA 1NU4A 3OXLA 1U8SA 3J81Y 4YB5A 2E29A 4LSZB 2AW0A 1V5IB 1S7IA 4NE9C 4JI3F 4BWJA 1U4BA 4NLVA 5C42A 4C3LA 4AXIA 1H2UX 2VZ9A 1JWWA 5F8HA 2MZJA 3MOJB 2LFVA 3MM6A 4MYTA 2BE2B 3KG1A 1J27A 4ZHRA 3IR6B 5D6GA 5IBSA 2DXFA 3FKBA 2ZKTA 3M8ZA 2VEYA 3EXYA 2FJNA 4NI2B 1SKSA 1FD8A 3HSJA 1FNXH 2UVUA 1O6XA 2GMHA 2NT7A 2QA2A 2R8KA 4ED7A 5LXRA 2FJWA 1NB2A 3TVYA 2MKYA 3TP2A 1PYOB 4HJPA 2AEJA 4BCAA 2C2OB 1BHNA 2FQQB 3MECB 2AYEA 4NLPA 3FSXA 3SSSA 3T1HJ 4UOHA 4ZCLA 3HI9A 2MKIA 3CB4A 2R0BA 3MEEA 2HS4A 4DX5A 1VQ6S 3PO5A 1RAOA 2XI3A 2RUSA 4DV4J 3W2VB 3CJ3A 2KKHA 1IR0A 2RE1A 3C16B 1UL3A 3ZM3A 1KQGB 2VG6B 2VEVA 4QOTA 5KT2A 3EUNA 3KK3B 2B6AA 1SQFA 4JI3J 3H2UB 2BW7A 1URRA 4O3OA 1FFSB 1RHKB 4S0MA 1FEEA 2FJBB 1G4US 5DRKA 4JV1A 3BPDA 1RT7A 2MGZA 2XG8A 4ZPBA 1QLNA 5EHHA 1B0TA 3BQ1A 5JXSA 2DITA 2I6MA 1ZS6A 1MLAA 4DL5A 4CLUA 4U8YA 3E51A 4CNYA 2HIQA 3W9JA 3QCHA 3QSYB 3BKTA 3OMHA 2C2DA 3M2UA 4NA3A 2XC9A 3CJ8A 4U7UD 4RH9A 4AL7A 1FE0A 2YKOA 3I9ZA 1MN9A 1CEZA 2VEUA 1PC4A 4QBUA 1N0UA 4AYBD 3D0HE 4O44A 2HRUA 3VV2B 1YHQS 2F65A 3IM8A 2HRYA 3MI7X 1HBMB 4TLQA 5A0YA 3OR1B 2QLJB 4MK9A 1U47A 1IKVB 1NZAA 3TA2A 3C66A 1VC0A 2PD1A 3D2WA 4UAGA 3Q8UA 1M3GA 3J7YI 1F9FA 1KD1T 2VQFJ 3ETMA 2BKNA 2X5OA 2ZBCA 4ELTA 5KABA 4IFYA 3DRXA 1VQ5S 4HYKA 1MU2B 1HNZF 2KYXA 2XULA 1KVKA 1HMVA 4WWSA 1SUQB 3B6BA 2VASA 4H54A 1HLWA 2GA7A 1WI8A 4IRKA 2B4OA 3HT3A 1GXTA 1X5SA 4M1KA 4CLZA 1DAXA 3DLJA 4CZCA 2B4SA 3L7PA 2C2EA 2M2BA 2OEMA 3BPSP 3ILOA 3K57A 3VVUA 3NOGA 5KFOA 2Q47A 1MROB 1YX2A 2BUNA 1WNEA 4XAKA 2QLXA 3PHEA 3DLBA 1XR6A 2QDCA 2V2ZA 1T9YA 1LFWA 2KT3A 3CC2S 2BACA 4GC7A 1V9OA 3R5DA 3R5AA 5KG6A 3ADAC 4EZ9A 3CCSS 4O0NA 2XY5A 5ETRA 1UFLA 2H48B 3MM5B 2VJUA 2Q6BA 3BZQA 3NAIA 1N5QA 2G59A 5K25A 3TUJC 2J9CA 4PZVA 3P5BP 4YUDA 2DBBA 2ROPA 4R8UB 2FZCB 2R8HA 2UUOA 3QLHA 4Y6IA 5AXLA 2PFFB 1FJCA 2CQCA 5K14A 2ADBA 1MWZA 2XMTA 1ONYA 2BGDA 4C11B 1SJ4P 1N48A 3VALA 2F6YA 5K9WA 4KGMA 1HNZJ 1C0TB 2QA1A 4EGLA 4QZVB 5GAHI 2C3MA 4RNMA 4KHRA 1HQUA 2YKNB 2LEPA 3OTBA 4KTQA 2CQBA 3G71S 2RHSB 2XMWA 4OHXA 5KFZA 4I2PB 1KP6A 2ERRA 3ISNC 1SJFA 4IG0A 4R0JA 3BDPA 5K9VA 4X4QA 2QO3A 3N0AA 5A2QY 1X9SA 1JLEB 5IT9U 1H6KX 3UD5A 4CIOA 2VG7B 3PW7A 4IRDA 4IH7A 1X4BA 5KFEA 4FBTA 3IS9A 3BSCA 3ICLA 2R7RA 2YKMB 2ALZA 5D3GA 2DGTA 1MMNA 4K2JA 1YJRA 1MG7A 3KUHA 5F8LA 3ETOA 3H5UA 4OI6A 2RMLA 3B7OA 3PYEA 2HNYA 3GXGA 1E8CA 1D8ZA 1JNRB 1CULB 5GVQA 4DG1B 3MR7A 4ZPVR 2YTCA 2MKJA 2OD6A 4GE6A 4USMA 2EEYA 1YQHA 3BREA 2MSSA 1OY6A 2F46A 5T7LB 3W65A 3M30B 2VICA 3OLBA 4CRJA 3MMBB 2LEBA 3JQMA 1FI4A 3W64A 3ZM2A 2V6AA 1DFDA 3W3SA 1YPTA 4I4BA 4IR1A 3VCDA 1RT2B 4M5GA 2HVDA 1HHQA 1GTHA 2QCJA 1IWAA 4KY3A 2J0SD 4CNZA 3TA0A 1TKXA 2GO8A 2NSCA 4UW2A 2D1CA 2MDAA 4LR8A 1UVIA 2XWXA 3KWMA 5KADA 2MTLA 3EB1A 4RU2A 1KLMB 2W4CA 2F71A 4HL9A 3TUIC 3CCMS 4ED8A 3D6FB 3R27A 1Y00A 1AA1B 5FDLA 2AJQA 3MMAB 3HXMA 4F8RA 4P9SA 1R8PA 3TOQA 2NUUG 2XMMA 4MAKA 5HQLA 1QAIA 5IQ6A 3F9AA 1G6BA 3V6KA 3GU0A 1P1LA 2W2NP 1R3NA 2YWFA 4NYHA 3R5BA 3HFVA 2EKYA 2CFVA 4J9NA 1OIAA 2DRDA 3JSMB 1XIQA 2JEIA 1RTJB 1GH8A 1WD6A 1VQ8S 4QAPA 3OVSA 2R2UA 4RNHA 1BQMA 3PR4A 4OIXA 2XMJA 3NEKA 1VFJA 4G1QB 3IWXA 2LQ8A 4FPIA 2UUAF 2CMBA 1NK6A 3QGHA 2RQ4A 2I2YA 1KOOA 4OYXA 2KG1A 5E3PA 1IWGA 1UTAA 1YGUA 4CLPA 4ZPWR 5G0RB 2G13A 4ZP7A 5KG1A 3OFHA 1WEXA 2IIHA 5E3RA 3UN2A 2VDIA 3SCJE 2HPUA 4PUOB 2N4CA 3UR3C 2QZ8A 4MKAA 4ZLLA 1HD1A 2VD3A 1U24A 2OUDA 2ABYA 3KJFB 3MR3A 2HHPA 2CA9A 1S9GA 1M0SA 2HY3A 3H20A 2H4WB 5KOXA 2CG4A 2M5YA 4QR2A 4DR2J 3GFZA 4N76A 2HFNA 5D0HA 4KGZB 1IKWA 3QIPA 1U26A 5I3UB 2N7YA 2QBPA 1HKAA 2RRAA 1RT5B 4H4OB 4F3OA 2DD8S 4Q0BB 4F02A 5BZXA 4OZNA 2AT1B 2F8MA 2VOSA 3AAWB 1SJQA 3PRVA 3LPEA 1AFJA 4KGKA 2CNHA 1RWVB 2UUAJ 2AEMA 3MMCB 2CJQA 4WTOB 1UVMA 5B0DA 1WHWA 4WE1A 2AGQA 4RX6A 2W9BA 2MB0B 1PYNA 1QD1A 4EZ6A 2XHCA 1QZ0A 1RAGB 2HHVA 3NRSA 3M2VA 3DRPA 1Q6SA 2R9LA 4ICLA 3CCVS 4JV0A 4RW8A 1T11A 4QBEA 2VPZB 3THPA 4HH1A 3A13A 1UEVA 2ZBQA 2HQGA 3CXCR 3RW6A 3TNVA 1SH2A 4W92B 4ZVUB 2WJPA 1BC6A 1AUDA 4OZLA 1Q1KA 3KHRA 1NO6A 3DN9A 2YNHB 3TX8A 5HI7A 1UETA 1GQQA 4L72B 2FB0A 2VFUA 1DQ9A 1VRUA 4DR6F 1FVSA 2I6PA 1VCTA 2E5IA 1T3NA 4YB7A 3RBDA 4WK3A 2VONA 1JJHA 1RAFB 2CUYA 2ZD1B 4CLYA 1NPRA 4DV6F 3QCCA 5KFFA 1TV6B 4RW6B 1HW8A 4DR1F 1IJEB 4OHHA 4IUFA 1NNYA 2BE2A 2UUTA 4DPXA 3DOLB 5CZVA 2C3YA 4ZVEA 3G8SA 2G9OA 2DNPA 3L4BC 4NI2A 1RDRA 4H4MB 4X65F 1ZAVA 3GLJA 1GG4A 4RNOA 4ITSA 4DU8A 1GT8A 2CJZA 3M8PB 2MYFA 1PO6A 4N7TA 1YKWA 4DHVA 4F0KA 1Q6JA 1XXPA 2VBWA 2ZUGA 1G7GA 1S57A 4MK7A 1U1NA 4QR1A 2H1YA 3A8JA 4UUXA 2QEPA 2ZNZA 3FGVA 3FMBA 4HHJA 2DTJA 3MECA 2HYIB 1RI7A 3MVNA 5KA2A 1FGSA 3KNGA 3V4IB 3S4EA 1Q6MA 2ZH1A 3N0VA 2W2QP 1M5KC 4NX8A 2CADA 4OL8A 2VG5B 5HQ8A 2OJ3A 3KJVB 3W2VA 1WHXA 4ED1A 3C16A 1XMBA 1X0FA 4O23A 3VWSA 3CCQS 2VG6A 1NDLA 2V0NA 1R27B 5B08A 5DDOC 3D42A 3GSDA 3KK3A 2B51A 4DR6J 4D3RA 4OX6A 2C46A 4ZVFA 2OIHA 2E1RA 4YQWA 3X1LB 1VOMA 5D4LA 4DV6J 1X0PA 6FD1A 3PTWA 4U6PA 1E6VB 2AJ1A 1X4DA 2BM1A 2WSEC 2IVMA 2X3GA 2F7VA 2BM0A 2FPHX 1HR0F 4RUHA 3T5LA 3V2UC 4DF8A 1TUWA 4KFBB 4F04B 4X65J 4K4WA 1TK5A 2JEFA 1U2RA 2NLWA 1SKUB 2XS7A 5K8MA 3IFEA 4FYXB 5J1PA 3SIPB 3BGUA 2GFFA 4KKOB 1HBMA 2LDYA 3NNHA 3U27A 4A46A 3V0FA 3D6MB 2I3UA 3M2RB 3OR1A 2F6TA 3N79A 1IKVA 4OYAA 1CPZA 4UY8T 2HVLA 3HFZB 4NLRA 1DURA 2HCMA 4YP3A 2H54B 4NEYA 2I1YA 1X60A 4OHDA 3LWLA 2ZUAA 3ZO7A 3Q8VA 3KHGA 1Q6NA 3EGVA 2ZOGA 2GHPA 4RZRA 1SUQA 1IKYB 1B0VA 3ZZUA 4EYIB 5ETVA 3TUPA 4GRZA 4N56A 1U1OA 2HFZA 4QWEA 2Z2YB 3BH6B 1CLFA 1C2PA 1Q0NA 5F9NA 3AQPA 3O2IA 3FMWA 2ASLA 3RAQA 4ECXA 3GIJA 1AROP 3EVWA 4L76A 1MROA 2H5EA 2VIHA 5GMDA 3RB6A 4EU0A 2WW4A 1HR0J 3SEOA 5K23A 4Y2KA 1C84A 1NWEA 2B3OA 3OSNA 1F60B 4QIWD 1EKRA 3OL8A 1XM2A 4AL6A 1VIOA 2Q1LA 2I38A 2H51B 3QFHA 1YJVA 1XTZA 4PG4A 1PSDA 4DEZA 2GP0A 2FLOA 3HSZA 4DSIA 2R8JA 1YJ9S 3MM5A 4NASA 3IRXB 1X4CA 1D5RA 3Q8PB 3VHQA 3H4BA 2GHWA 2BW2A 2MLYA 2CQPA 1S6OA 1XQIA 3KDOA 4R8UA 4O3RA 2MQNA 1NPKA 4B3MF 1B4SA 1P1TA 3BF4A 4UQGA 4A8WA 1YTWA 4RDDA 5GAEU 4JI5F 4JB8B 4C11A 5LOQA 5K8OA 1Y5LB 5CXTA 4RJVA 1FEHA 4WZMA 3WX4A 1C0TA 4YR3A 4USWA 4NLDA 4C6AA 3MAHA 1ZC0A 3JTOA 2YQ3A 3N01A 5KACA 2YKNA 3RR8A 2QMUB 2C7SA 2YBVA 4RL1A 3K17A 1CVJA 2DGSA 2B4PA 2YY3A 4I2PA 2E9TA 2DNRA 2QRRA 2FY8A 4F4YA 3BRHA 5B0BA 5E5NA 4U9RA 3HX9A 1JLEA 3RB0A 3IR5B 1RT4B 2AQ4A 5A6PA 1DHMA 2W4PA 4PYAA 3T6JA 2E9ZA 4ZK7M 3RGOA 3MMJA 2CQ1A 4QUMA 2EBEA 1KKHA 1LK5A 4D3QA 2GWOA 5F8IA 4RKUC 3RZAA 3EPGA 1W2BR 4W90B 1VBKA 3H98A 1N8RT 2OP5A 1JJCB 3CPWR 2P4DA 2FVPA 5HMYA 8ATCB 3UN3A 3QCBA 1NHVA 1DZ5A 2NZ4A 4HH0A 2J5AA 1CULA 1J6UA 4DG1A 2CPIA 1B70B 3CCRS 2RF6A 3UR0A 5IXUA 1OHDA 1TVRB 1GMWD 3D6HB 1M5VC 3R5GA 3D9CA 5T7LA 2DH8A 4JI5J 2UXCF 3M30A 1C85A 2EI5A 1VQOS 1GFYA 2CPYA 1GMVA 5L9NA 3MMBA 4I6YA 3K58A 3QNWB 3AD7C 2QDMA 1OETA 1R8HA 1U0SA 1RT2A 1Z1ZA 2DRAA 3CEDA 1EB0A 2E7WA 1MSWD 4FF1A 4G3IA 5GMEA 3H2XA 1KLMA 4N5SA 1TFWA 2IA0A 1HNWF 1U25A 1RYRA 1NM2A 5HMZA 4Y0FA 2IPOB 2YPYA 2W1BA 2OPRB 2VORA 2PEHA 5KG4A 3MMAA 2AF6A 4QU7A 4ETXA 7FDRA 2XMVA 2WSCC 4QIVA 3FCWA 2ZVSA 2JEGA 5H9FJ 4PYDA 4L3NA 2U1AA 3IBFB 4KYZA 1AB8A 2JVOA 1QUPA 4M95A 3S4OA 3RO1A 4I1TA 2CFXA 3SSRA 2ASYA 1Y3KA 5AE1A 4L74A 3JSMA 4MIBA 1RTJA 4PG7A 3NMEA 3IAS9 3CJKB 2ZH2A 2OEJA 3KJQB 4G1QA 5I6VA 2EC2A 2I6IA 1ZH5A 3DCAA 1N52B 3GJSB 2K3IA 1T4JA 1U6ZA 3ZC4A 3FNNA 2UXCJ 3W1YC 1VRQC 1Q8BA 5KAKA 1VI7A 1VQYA 3B4MA 3CD6S 3QGIA 2XYGB 1JKHB 5G0RA 4RU9A 4YMEA 3QCIA 1H2VZ 4PUOA 2XI2A 1I94F 1GMWA 5M2UA 2PFDA 3RRKA 3MPYA 1HNWJ 2XNQA 3AD9C 4K4ZA 5IT9Y 4Y34A 3D3BJ 4J7CA 5KOWA 4I67A 4DFJA 5DG9A 3BDEA 4DU7A 1AW0A 1JXVA 1MWYA 2R3VA 3OVAA 2NZ6A 3NGUA 5L38A 1TR0A 2KFZA 4UT4A 3US5A 5CYQB 3PZPA 1VK8A 4WFNQ 3CULA 5I3UA 5AE2A 2CIMA 3THVA 1C86A 2QG9B 4LSLB 1RT5A 3P8BB 4H4OA 3Q2TC 2FZGB 4XDCA 4ELUA 4O4RA 4DFKA 4Q0BA 2I8EA 4NLSA 1E0DA 2ZH8A 1AFIA 1NSKL 4OV6A 4AL5A 4Y00A 1DY3A 2A6MA 1OQ6A 1VR6A 2XSJB 1YIJS 3HDSA 4CVMA 4CT8A 3MUTP 3MMCA 4JP8A 3MM9B 2BRKA 4ZP8A 2OPQB 1K44A 3LOUA 1O0PA 4LF8F 2G1DA 1WRMA 2UV8A 2JHEA 4NWGA 2DGVA 1UAGA 1S10A 3D4JA 5A8WB 3DU6A 1RKJA 4BBYA 1I94J 2E7VA 4P52A 3MD3A 1ULRA 4OYOA 2X7IA 1VQNS 3IGNA 1T95A 2KL8A 3M8SA 2HNDB 4LSNA 4NL5A 2IM0A 3CMES 1PTUA 3RW7A 3KXDA 1ICEB 1JLBB 4LF7F 1EENA 3FEZA 4NWFA 2HC1A 5C2CA 2UP1A 1WF1A 1T8EA 1Q6TA 2AIRB 2R7UA 2D7SA 3BGOP 3EXCX 4OHYA 3OTEA 3OBIA 1RWPB 4GE5A 2BJ7A 1WSRA 2J9DE 2L9WA 3G9CA 2MSTA 1KNZA 2ZD1A 2CXEA 7FD1A 1TV6A 1ZA2B 4RW6A 1FNMA 2CJYB 4C3KA 2CPFA 3FBFA 3SCLE 3GZ7A 5KT5A 4X4PA 3TJ8A 5EHPA 1UW9A 3VQSA 1A9NB 4PR6A 4H4MA 5D0RA 1FX4A 5KFHA 3JTPA 1G1XA 2M3VA 2BA9A 1NB7A 3NGTA 4USUA 5F9LA 2CNNB 3CMQA 4LF8J 3W63A 1SIWB 4OHWA 2H4VA 2J7UA 1CJTB 3MPVA 3V4IA 2QYCA 3OXFA 3I55S 2V50A 1LV5A 3RJMB 3GXHA 3CDUA 1NK4A 3SR9A 3TJAA 2BZLA 1S49A 2VG5A 2JOQA 2F6VA 3C46A 4K4UA 2KHCA 1S1UB 5C7PA 1HBOB 5J2PB 4LF7J 3NBPB 1I51B 1J4XA 3R2CJ 1I3OB 4Q45A 2W2OP 2WBMA 2ZMMA 2GC8A 1NJYA 4B3RF 2BANB 3SQOP 3DLEB 2MZRA 3BLUA 1R43A 4TY9A 1VQKS 2UZAA 3WIVA 1K73T 1E6VA 3ZXWA 3V0HA 2I4HA 4DL4A 2RKIB 4KFBA 3GE9A 4USJC 1EEOA 2ZH5A 1C88A 2E7XA 1S0VA 4CO4A 2FGOA 5KFRA 3DLGB 1LXNA 4FDFA 4KKOA 5CYMB 4QIEA 3EPIA 4WPAA 4RO0A 2DHSA 3M2RA 3PFOA 2Z57B 3MPWA 3G8QA 3HZEA 3IM9A 2AX1A 3V0JA 2N3OA 2JH3A 1IR1A 2XGQA 5DQHA 3DI6B 1CJKB 2PA8D 4OYMA 1FFWB 2OLWA 3M7VA 2P9GA 1ZAXA 3J81U 4PXDA 2R7OA 5ETLA 1WDDA 3W9HA 1UEKA 3C14B 1VQMS 1EHWA 2IDEA 3MWBA 3T3FA 5BYRA 4OYWA 4HJQA 5D4NA 3NWGA 1H98A 2JFGA 1I6JA 1KFDA 1N56A 1A7GE 3I4HX 4QWBA 3N6MA 4IFVB 4KQZA 2DPIA 2OC3A 2I75A 4B3RJ 4GFUA 2OMLA 4ECQA 4QIGA 2ZH7A 5H9EK 3QMQA 2CPJA 3GR0A 5CQGA 4LRBA 1A5YA 4DQRA 2EWHA 2YXLA 2ILZA 2MQPA 4KGXB 2KM8B 1YG0A 2DGOA 2LXIA 4XPCA 4M5NA 1SC4B 4ZA1A 1UA1A 3AWEA 1FT8A 2IVYA 2GHVC 3MCNA 2O67A 4OJ3A 3M8QB 1VMBA 4ZP6A 2HBQB 4C8ZA 3AWGA 3IRXA 4TU9A 4Q2MA 1FJ7A 3SSQA 1X4HA 3THTA 1C1BB 1FRHA 3BGFA 3VGVA 2PEBA 2A2DA 2XMKA 4IKCA 2JFHA 2HHSA 3HN7A 1K1QA 1Q95G 5KFTA 3TZXA 1HPZB 1RWNB 2YNGB 3QWUA 2CM7A 2EKNA 5A5FA 1XMQF 2FJXA 1UEUA 1LW0B 4BPCA 2KXNB 4LFCF 1P6TA 4YS2A 1FXDA 5DG7A 1WC5A 1I5OB 2A0FB 2CNGA 1U45A 1RTIB 5SZTA 1AT1B 1FQ1A 1ZZFA 1RT4A 5EWFA 2J6TA 1TMMA 5AT1B 1OSDA 2Y9HA 3GPAA 3I0SB 2M9KA 2HK3A 1M5OC 2DGXA 2P9EA 5KFSA 1OMSA 3NCPA 4WU3A 4ES1A 1LK7A 4ZVTB 1R8AA 1FTRA 4AQYF 2A1BA 2B9EA 4CTAB 1SKRA 1RAEB 2R7WA 3I0RB 1R89A 3O4UA 3D3CJ 2RQCA 1TVRA 3KG4A 2KYZA 2HLUA 4ENOA 2BZ2A 3HHLB 1R6YA 4E0DA 1YK9A 2DHAA 2V4QA 3LQVA 2AJ2A 3M32B 1HI8A 4P7VA 4LF6F 2OUGA 4X62F 3KHHA 4AE5A 4NRUA 2YKAA 3BSAA 2D69A 1XMQJ 1D0EA 3WBZA 4CO3A 3K89A 1B7FA 4IQXA 1BLUA 4ZITA 3TZZA 2APOA 1IQTA 1DBDA 3B4DA 4ZVGA 1IJFB 3Q24A 4M5KA 2HVIA 2IY5B 1T7PA 2AU0A 1PYSB 4K4VA 2I4EA 1YJNS 2RJZA 1HWJA 2OPRA 1QSSA 4F3MA 1WKLA 2GQQA 2PGCA 2MHNA 2AM2A 2GJ2A 4RHGA 3GYXB 5A8KA 1BD6A 5HJYA 2D3ZA 2B9YA 2E0TA 2GCBA 5IS2A 3LH2S 2KDOA 2W9AA 5FLXY 3H5YA 2IRXA 2V9KA 1UPMB 3OT9A 5CZXA 3U1NA 2BV3A 4AQYJ 4M8LA 4DL3A 4LF5F 1KTVA 1QSYA 5DZ7A 1U1MA 1WCHA 2A6OA 3CJKA 4CO2A 1VQ4S 3W2WB 3RRHA 3SI8A 4YDDB 2MZSA 3DDNA 1RABB 2CQIA 3CD7A 3K5OA 2K7KA 2NXCA 2VJVA 2AGPA 2IDLA 1UWBB 4LF6J 1UMJA 4X62J 4UZBA 1T48A 5KFGA 2VH7A 4TYAA 2KJWA 4U67Q 1PTYA 1JKHA 4EEYA 3PJWA 3Q23A 1T9WA 1HNVB 5HAOA 4B3SF 5A2QU 2WRMA 2PSZA 5E3QA 4J9UE 2OPPB 1ZAWA 4I64A 1CG2A 3EGZA 1WC6A 3A12A 2RAQA 2HNPA 3G82B 4DL7A 2FC8A 4YR2A 1NMEB 2KRRA 4JYAF 1X7VA 2EK6A 5HN0A 1WAXA 2VFSA 4BUCA 2HS3A 1FWPA 2PO4A 5I4MA 4CLKA 1RXOB 3KKFA 3CE8A 2JLFA 1GNKA 3ILJA 2IC3B 3DOKB 4LBHA 2KXFA 1RWOB 3E3XA 4ZLJA 1TELA 3IN5A 1SKWA 3PRBA 5D8HB 2ASJA 3EZZA 4ZKAA 2V94A 2DEJA 3U1LA 4LSLA 3R1LA 2CM3A 2QMWA 1Z2LA 4LF5J 4DV3F 3ILLA 3TX0A 3BQ0A 3OLRA 3FEYB 1MW7A 5LM7E 4DX7A 3QT7A 3PG9A 1V3SA 2XSJA 2W8KA 3RR7A 1KBRA 2NCKL 2M8DB 2EBGA 3LANA 1RHMB 1TL1B 2I5JB 3MM9A 1SVDA 1T9UA 2OPQA 5B09A 2OOQA 3QJJA 3VTIA 2KHDA 5KT6A 3LGMA 3K5LA 3Q8SB 3BH7B 3EJMA 3RRGA 2OFGX 3V0EA 4DF4A 5A8WA 3VZIA 4HVZA 1RBLA 3NGRA 3KUEA 4EI2A 3GFYA 3WC2A 2NT2A 2UUPA 5BJRA 4F67A 1AZSB 1JK9B 2HNDA 2IYIA 3OVBA 2HWTA 1F5AA 3W5ZA 1T02A 4JYAJ 1Z2ZA 4TU7A 3K5NA 1R0BG 2WBRA 2QSFA 4HI2A 2EPIA 1JXLA 1JLBA 1LW2B 2OD4A 3PCOB 2WB4A 1CC7A 2CMAA 4NCAA 1KDNA 2MZTA 2KZMA 2GV1A 3S3EA 2KN4A 3CJRA 1HFEL 4C8YA 5I3PA 3PW2A 5KG0A 1R8CA 1GQEA 3KMQA 4DV3J 3CDEA 2JVRA 3VAKA 2F1FA 3JYTB 1XJWB 4BJOA 2M88A 2G2YA 3BQ2A 4ED3A 3ENVA 1ZCLA 3QCZA 3HJFA 5BR8F 4LUBA 5KT3A 3CM3A 1U48A 2NXJA 3QIDA 2J8AA 2PIIA 1TQLA 1VISA 3VAMA 1KONA 1F3FA 3F0NA 4CYUB 2GO9A 4PWWA 1CJTA 3MOWA 3H90A 3MD1A 2KG0A 1U49A 3F9BA 3TQ1A 1VRTB 2EC0A 5KTQA 1EX8A 1UVLA 4EFAC 3A1YG 2AYGA 1S99A 2VKZG 1XNRJ 2B49A 1NK5A 2JL9A 2ROEA 4OHIA 4C8MA 1NK9A 1UCNA 1S1UA 2VOOA 4XK8C 4DR5F 2UVRA 1HBOA 5J2PA 1TAUA 1CSJA 2HURA 4C97A 3PV8A 3EM1A 3WIUA 5ETQA 1VC5A 2Y1JA 1RJJA 2HZCA 4WCEQ 4WYWA 5KA1A 1UVJA 3CD5A 2BANA 3DLEA 4ID8A 4PAAA 4K4XA 4H34A 3T5HA 5FJ4A 2IJFA 2DY9A 5GADU 2PMHA 1S1TB 3KK2B 4A8FA 3K7RA 3AFGA 2RKIA 1PG5B 1L3SA 1RAAB 5BR8J 3C8YA 3AHPA 4A8KA 1HIYA 1FCAA 2E1AA 4Q43A 1U7LA 4IR9A 3DLGA 4XO0A 2DR8A 3HT0A 5CYMA 3PXGa 2X1FA 2PA5A 3DRYA 4DV0J 1M1HA 4DN0A 4OZJA 1XBWA 3J7YU 2IRUA 2E5HA 2FHJA 2QGFB 3FEXB 1ZZNA 5E41A 2W4DA 2V8DA 5DQGA 4U7CA 3TEGA 2POKA 3P6YC 2OFHX 3DI6A 1CJKA 3PRDA 4HTIA 5T41A 3KHLA 1SBRA 3EVMA 4NWBA 2I6JA 2QA4G 4IOCQ 2YWKA 3C14A 1IUJA 4WZQA 4DR5J 3ZTQA 1NUEA 2VBYA 2IMGA 4B3OB 4U8VA 2ZWPA 4MTPA 2CQDA 1FFGB 2HVZA 4HTJA 3ZNUA 4ZPCA 2Q43A 2F63A 4N8NA 3BYPA 4IFVA 2CQ2A 1HYSB 3D68A 3UFCX 2DO0A 4D3PA 5KT4A 5E7OB 3HZGA 4XPEA 1UVKA 3D5MA 3I6PA 1YJWS 2HQ3A 1QE1B 2DJWA 2EFPA 2LEAA 1I9SA 3ZZOA 1XN9A 4I6WA 3M8QA 5EWGA 3HVTB 3KLGB 2ZJPQ 3QCEA 2CG8A 4C8OA 4R0TA 1NJIT 4F0HA 1C1CB 4IH5A 1D1UA 3JQJA 2UU9F 2NYHA 3DLHA 2QEXS 2X1AA 3A3PB 4LIRA 3GFHA 1C1BA 4WIQA 4LF9F 4LF2A 4RW9B 1DTQB 2W9CB 1Q5YA 2ZHOA 4GS0A 1FDNA 2DNQA 1FO1A 2WOMB 2X3DA 1T49A 2ZWOA 2LQBA 2CQ3A 4F7VA 5GTJA 1YJTA 2P8IA 3TAMB 1BQNA 1HPZA 2YNGA 1FDDA 1EAYC 3QO9B 1FK9B 3BM8A 4UOGA 2CJXB 1WOOA 4NX9A 1CS4B 4P7TA 5L1IA 3UQSA 3AODA 1OSCA 5GAEI 1LKZA 1DARA 3N9UC 3IG1B 2PE8A 4OX8A 1RTIA 3GSIA 3D1HA 2ZKUA 2RQKA 1YZ7A 2W2PP 3OJUA 1N5YB 1NDKA 4DPUA 2BE7D 4MYUA 3JSRA 1A6LA 1BMQB 3K8WA 3CW2C 1WSVA 4J51A 3GIKA 4OYZA 4FNIA 2YQ1A 4CLLA 1K8AT 4LRFA 4NLOA 2VFTA 4DOZA 2IJNA 3P49B 4B9SA 1W26A 3PKYA 2XCPA 2K2PA 2DB1A 4F25A 2UU9J 2YH0A 4DGPA 4RNNA 2QE5A 2XTJP 1CQNA 4CTAA 3GWCA 4LF9J 1V6HA 1YRXA 2C2RA 1WG1A 3I0RA 1DTTB 4G65A 1Y10A 1VJQA 2AYMA 1RHRB 4DCOB 3AOBA 3HHLA 2PMZD 3LGHA 1H73A 2KO1A 2E5JA 2HQDA 2ZZNA 3M32A 1BZCA 3RU0A 4WFBQ 2LDIA 2GC6A 5D78A 5J8RA 3I5AA 4P2SA 3NNAA 2YX4A 4ZVRB 2DR5A 5IC4B 1RCOB 4OI2A 3TR5A 4KV8B 1EETB 5KFWA 3N5FA 2RSQA 3T41A 2HNQA 1VBZA 2NREA 1OESA 2DHXA 1LQ9A 2J0XA 1WOSA 2HQFA 1RTZA 3FK4A 2DO4A 3KK1B 3CCZA 4DUYF 1RWWB 3LP1B 3KLEB 2MBCA 4GRSA 5K8PA 3OPKA 3A8KA 1ELOA 2EVZA 5LL6d 4E2FB 2I5XA 2QA4S 3ENWA 4ECTA 1S97A 3T5JA 5HANA 3DKDA 3MUMP 2J7WA 2FLLA 4X84A 3CT9A 3QCMA 4XTTA 4WKRA 3IXQA 2J0WA 2R42A 5IM0B 3W2WA 2DR6A 4A8QA 4W4MA 4DV2F 3W5YA 1RAJA 3D67A 2M7SA 3H2LA 4ZS6A 4ECVA 4DQPA 4NOHA 3QZ7A 3TUZC 4NNDA 4ANCA 4DX8H 4FN5A 3OFGA 4OYPA 4MIAA 1W2IA 2H03A 1FRMA 2ZJQQ 1SL0A 3MPUB 1HNVA 3IP0A 1JMTA 4B9MA 6AT1B 2XGPA 5IC6B 4C12A 2XO6A 1RHQB 2OPPA 4ZDNA 3V5RA 3BR9A 3G82A 1UPPA 1QTNB 2IBKA 3NWRA 3D6TB 3HO1A 3UCZP 2H65B 4QPXA 2CJ9A 4DUYJ 3C15B 4ILMA 2E66A 1WF2A 2IC3A 3R7BB 3DOKA 4DCPB 1WDTA 1Q6PA 3SFGA 1BQXA 2ATCB 4DWIA 4LVNP 5B0GA 2V8GA 3AXKA 1UFKA 1ZM3A 4I69A 4OQJA 3GQCA 2KI2A 1U2FA 2OH2A 3M05A 1JBVA 3B8HA 1M5HA 5E33A 4NYPA 3EZOA 1RWMB 4OZ5A 4DV2J 1TL1A 2I5JA 1W78A 4CCHA 3ET6B 2RHQB 2H5IB 2JEJA 1ROFA 3OW2R 3IMQJ 2VV5A 3L3CA 2G6ZA 3I56S 4OX9F 4H4KC 2J0QD 3NGDA 1JLNA 3SV4A 3J81j 1HWLA 3QCJA 5M2PA 1WC3A 3FQKA 5F3TA 4J9KA 2ZBRA 4Y65A 3BGRB 4QQBA 3EYZA 4HI1A 4FS2A 1U2CA 3OTCA 1VBYA 2ADCA 4TLRA 3HKWA 3DC2A 3KYLA 3N28A 2I0XA 1AZSA 4KT0C 4OZ3A 4C8KA 2WK4A 2VL1A 2J16A 2NLKA 4OHVA 4JI6F 4RUCA 2WVBA 1U1RA 1HQEB 2I4GA 1NHKL 2BX6A 1FWLA 2R7XA 1QJHA 1LARA 4JNBA 1S7HA 1Z4UA 1LFPA 1RTDB 5L1JA 1SUGA 2HBYB 2O3DA 2HHQA 1VHIA 6FDRA 1XC9A 2NXEA 4J90A 3JYTA 2E1CA 1R6VA 4ZRTA 4UTGA 5K8NA 5JJBA 4DSJA 1YFOA 2R8GA 4ZN3A 4JOUA 2NV5A 1AUSL 4YY3F 4KRWA 5L46A 4IO9Q 2PC6A 3M1VB 2E1PA 1ZPVA 2GCAA 5HMXA 2LQ5A 2R2RA 2IA6A 3SCKE 2K8GA 4ES3A 4DSFA 4IKAA 4OX9J 3SMZA 1ZTTA 1S6QB 4CYUA 4LF4F 3H40A 2NXNA 2QL5B 4DUTA 2C1EB 1KEKA 2ZH3A 4DPTA 2MQMA 2YX7A 4G1PA 5H1SV 2B0GA 3RTVA 1VRTA 5L1KA 2H4GA 1LWCB 3PYZA 4OI1A 3BEGB 4ZIWA 1S77D 1QSLA 1RWXB 2R2SA 1H72C 3R6GB 4JI6J 2OEKA 2XZWA
chains in the Genus database with same CATH topology
4WIIA 1JLBB 4PG5A 4DUZF 2GJTA 1Q79A 1VLYA 4PXBA 1R8BA 3L09A 2ZJRQ 3TVZA 5LXYA 3MEEB 1S9GB 2KM8C 4N8OA 4LIWA 2DNMA 1GTEA 4LF7F 1EENA 3FEZA 1JLCB 3DFEA 2HC1A 4NWFA 1FHTA 2RRNA 2UP1A 1WF1A 2DH7A 1T8EA 1Q6TA 2DNZA 2XS2A 3J7Z5 1WI6A 3CC4S 2ACYA 2R7UA 2N3LA 3ZV2A 3FFIB 3G96A 1OHEA 2D9OA 3S7RA 3CWJA 2N7CA 3OL6A 2DCLA 2D7SA 1TL4A 3EXCX 3M4XA 4RH5A 5EWEA 4OHYA 1BGXT 3OBIA 3OTEA 1IKWB 4JI0F 1L3VA 4GE5A 3QIPB 1FXRA 3VQTA 3OUYB 2J9DE 2L9WA 5GAGU 2BOPA 3G9CA 2Z0GA 2MSTA 3ZMPA 4G6VB 3SQGB 1KN6A 1KNZA 3U1MA 1IXKA 2ZD1A 4ECYA 2NQPA 1TUVA 1RPMA 2U2FA 4KYQA 1JB0C 3LW5C 3U02A 2L48A 4B17A 2FJEB 3PW0A 2PT0A 1TV6A 7FD1A 4RW6A 1TL5A 5KA7A 3PX6A 2ZBIA 1FNMA 4C3KA 3D28A 2CPFA 2LECA 1FESA 2LA6A 4NLXA 5KFCA 1H0HB 3DHWC 3OFFA 1S1TA 3KK2A 5E3AA 1FPZA 1DQ8A 1SH3A 4Z6BA 2Q6CA 3SCLE 5AE3A 3GZ7A 1S0NA 5KT5A 4X4PA 2D41A 1BWEA 3GMGA 5EHPA 2IVFB 2L3MA 3CUNA 1RA6A 3VQSA 3Q8RB 4PR6A 1A9NB 1XR5A 2CQGA 4H4MA 3S8SA 2ATLA 2HC2A 4FPRA 3HF5A 5KFHA 3J7A1 3JTPA 1G1XA 2CDQA 2M3VA 2BBEA 3AA8A 5KFNA 1YBAA 2BA9A 1NB7A 1F5CA 2AJ4A 2BJDA 4TKTA 1SXLA 3G4SS 2JJDA 4O4GB 2JWNA 3CWEA 4F26A 2W7PA 5I42A 3BN7A 5F9LA 1LWEA 1JLFB 1B0PA 1ZBTA 1D9AA 3OQ2A 1XRIA 4WE1B 2F40A 2DT9A 3MR2A 2F9JA 1SV5A 3MTJA 2W9BB 1SIWB 3LPYA 4OHWA 3H4DA 4EO8A 4M94A 3U96A 2H4VA 2J7UA 4WOHA 3JAMY 1Y0HA 3CJ5A 1UJ6A 3MPVA 4EUVA 2X1BA 3T19A 1XBOA 3V6JA 3QCLA 2E44A 3K5MA 2VB6A 5A8RA 2I3RA 2V5HG 3D54A 1MKPA 3CJ0A 4GC6A 5D77A 2JLEA 2ZH4A 3RB4A 2CKWA 2CQ0A 1G1FA 3UCGA 2JJ4D 3V4IA 2QYCA 3OXFA 3I55S 3T1HF 1LV5A 3GXHA 4O3PA 1FF2A 2RF2A 3CDUA 3M2VB 5B0AA 1NK4A 3DRPB 4MK8A 3SR9A 1N36F 1QY7A 2ZOMA 4RWXA 3V4MA 3ZZYA 1S1XB 4ICLB 3QYYA 3WZ0A 2N82B 1T03B 2BZLA 1S49A 3AQOA 5KG7A 1D9FA 5ADZA 1YJNS 2CNEA 4RW8B 3H59A 4J9MA 3FRZA 2D3UA 2VG5A 2JOQA 3X3UA 5EN1A 2F6VA 2HWHA 2HW3A 5C5JA 1OHCA 4RW7B 3C46A 2B4UA 4DV4F 4K4UA 2KHCA 1S1UB 2MKCA 2CMCA 3QAEA 2UVWA 3N6LA 1Q8IA 2JC1A 5CYQA 4QWAA 3NCRA 4QUNA 3RYLA 2R7SA 4B3OA 1HBOB 2BQRA 1Q8LA 2MJUA 2M70A 5J2PB 1ZYQA 1NU4A 3NP5A 3OXLA 5L9XA 2F8EX 2CPZA 4QYRA 1U8SA 2C42A 2VBZA 3M6XA 3VF0B 3J81Y 4YB5A 1KQFB 1N4LA 2NS1B 3NBPB 1XWLA 2E29A 4A8XA 2AW0A 4KHMA 3G6ES 1J4XA 5HL7Q 4ZCKA 3CD0A 1JX4A 4Q45A 1VJWA 2WBMA 2QBRA 4PQAA 4JI3F 4BWJA 2ZMMA 5DM7Q 1U4BA 2GC8A 2RD5C 1NJYA 3ZFVA 4NLVA 1N34F 5C42A 2RILA 4C3LA 4B3RF 1HYSA 3ZMQA 2XLJA 1UJ4A 2BANB 3DLEB 4C0HA 3N6NA 2QSWA 1JLQA 4AXIA 1PTVA 1H2UX 2VZ9A 1JWWA 2MZRA 3O5TB 3BLUA 3PIPQ 5DDQC 4J9RA 2F6ZA 5F8HA 1R43A 2MZJA 3MFHA 4TY9A 1VQKS 2UZAA 2Q66A 3MOJB 4TQSA 3DM2B 1DQAA 1K73T 1E6VA 3MM6A 3S3FA 1HNIA 4MYTA 3V0HA 2BE2B 3KG1A 4R5PB 1S79A 4ZHRA 2I4HA 3IR6B 1JNZB 5D6GA 3R1HA 1QE1A 5IBSA 4M5DB 4F50A 5GMKa 2A10A 2FUG9 1VQPS 1P27B