2B4UA

Structure of the c252s mutant of selenomonas ruminantium ptp-like phytase
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
314
structure length
314
Chain Sequence
TVTEPVGSYARAERPQDFEGFVWRLDNDGKEALPRNFRTSADALRAPEKKFHLDAAYVPSREGMDALHISGSSAFTPAQLKNVAAKLREKTAGPIYDVDLRQESHGYLDGIPVSWYGERDWANLGKSQHEALADERHRLHAALHKTVYIAPLGKHKLPEGGEVRRVQKVQTEQEVAEAAGMRYFRIAATDHVWPTPENIDRFLAFYRTLPQDAWLHFHSEAGVGRTTAFMVMTDMLKNPSVSLKDILYRQHEIGGFYYGEFPIKTKDKDSWKTKYYREKIVMIEQFYRYVQENRADGYQTPWSVWLKSHPAKAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords myo-inositol hexaphosphate phosphohydrolase
publication title Kinetic and structural analysis of a bacterial protein tyrosine phosphatase-like myo-inositol polyphosphatase.
pubmed doi rcsb
source organism Selenomonas ruminantium
total genus 99
structure length 314
sequence length 314
chains with identical sequence B
ec nomenclature ec 3.1.3.72: 5-phytase.
pdb deposition date 2005-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14566 PTPlike_phytase Inositol hexakisphosphate
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1690 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2b4uA01
3.90.190.10 Alpha Beta Alpha-Beta Complex Protein-Tyrosine Phosphatase; Chain A Protein tyrosine phosphatase superfamily 2b4uA02
3QCCA 1QXKA 3BLTA 1C86A 2I5XA 3QCDA 3D1HA 2I6JA 3ZM0A 2G59A 4WTYA 2GP0A 1U24A 1PXHA 3QCLA 5KA2A 5K9VA 1PA9A 2I4HA 2PSZA 1Q6NA 2OZ5A 2BIJA 2FJMA 4NNDA 4GWFA 3O4UA 2QBPA 1RXDA 2B4UA 1YGRA 2H4GA 4NX8A 5AWXA 1C84A 1T49A 3D1OA 3MOWA 4ZN5A 2F6WA 4BJOA 1PTUA 3I7ZA 3LJ8A 2HXPA 4JNBA 3QKQA 2H4VA 1WAXA 5MMZB 4QBWA 4QAHA 4HRFA 1T48A 4RKKA 2BZLA 2HCMA 5M43A 2H4KA 2BV5A 3V0JA 1LYVA 3OMHA 1XXVA 4OHDA 1WRMA 2B3OA 2QDMA 3EU0A 2OOQA 5K24A 4QAPA 3ZV2A 4OHIA 2H04A 1XXPA 3ZMQA 2B07A 2HC1A 4RH9A 3EAXA 3GXGA 3QCEA 1T4JA 3O3LA 2QBQA 3A5JA 1R6HA 4R0TA 2PT0A 3EMUA 3H2XA 3O5XA 3F41A 4HJPA 3S3EA 2QDCA 2B4OA 1G1FA 2G6ZA 4DGPA 3AWFA 4S0GA 1I57A 4JMKA 2P6XA 2F6TA 2HVLA 3BM8A 3QCNA 4ICZA 1BZHA 4RH5A 2HC2A 1U26A 4KYRA 2CMBA 3CM3A 3QCHA 1FPRA 1ZZWA 1ONYA 2Y2FA 3D9CA 1NZ7A 5BZZA 4JBCA 1PH0A 1G1GA 2A3KA 2C7SA 2SHPA 2QCJA 4OHHA 4YR8B 1C88A 2CNFA 2B4PA 2CM2A 1Q6MA 1GFYA 2JJDA 1I9SA 3O4SA 2I3UA 2F71A 4ZI4A 3F81A 2QDPA 2HY3A 3ZMPA 1C87A 1LQFA 1L8KA 1Q6PA 4GE6A 1XBOA 4WU2A 4RDDA 1FPZA 1YTNA 1OEOX 2HB1A 2CNIA 3F99A 1QZ0A 2CMAA 2AZRA 1G4WR 4KI9A 1AAXA 3V0DA 4OHLA 3D44A 2GJTA 5KAAA 4H1OA 1LARA 2DXPA 3PS5A 3EB1A 2I4GA 4R30A 5BX1A 2FJNA 1XRIA 1NWEA 1Q6TA 2CNGA 4RI4A 1OHDA 4GFUA 3OLRA 1OEUA 1YGUA 4GE5A 2I1YA 1WCHA 3S3FA 5K23A 2CJZA 1A5YA 4ZRTA 2PQ5A 5KA8A 2GWOA 1OEVA 3MOZA 3AWGA 2P4DA 4GFVA 2BGDA 3V0EA 1KAKA 1PA1A 5K25A 1NL9A 2MBCA 4Z6BA 2VEUA 2B4SA 1MKPA 1RPMA 2QBSA 1PTYA 3RZ2A 1ZC0A 2H03A 3GXHA 4HJQA 4WOHA 1NNYA 1ZCKA 4GS0A 1YN9A 1ZCLA 4TVVA 1OETA 3MMJA 3I36A 3RO1A 2B49A 1G7FA 1ONZA 1I9TA 1Q6SA 3M4UA 2F6ZA 1M3GA 1BZCA 2NZ6A 5EHPA 4Y2EA 5BZXA 3ZM2A 1BZJA 1JLNA 2I6PA 2ZN7A 3S3HA 1C83A 5KADA 3U96A 1GWZA 4KYQA 2BGEA 5KA7A 5KA4A 2I6IA 4YAAA 2RF6A 4QBEA 2F46A 1KAVA 2CM7A 1J4XA 2C46A 3A5KA 2CMCA 3D42A 2QCTA 4OHEA 1X24A 2F6VA 1ECVA 2CNHA 4NWGA 2F6YA 2NLKA 2CNEA 1YZ4A 5KA1A 3I80A 1FQ1A 1G1HA 2R0BA 4D3PA 2M3VA 3V0FA 5K22A 4QUMA 1OHCA 2NT2A 2QEPA 2VEYA 3O4TA 3V0HA 3QCBA 5BUGA 2OC3A 3CWEA 4I8NA 3AWEA 1L8GA 3SMEA 2Q05A 2I75A 2ESBA 1OEMX 3BRHA 2PBNA 2CFVA 2F6FA 4NWFA 5KA9A 1Q1MA 3QKPA 2I42A 4GE2A 3SR9A 1XM2A 2J16A 1SUGA 2I6MA 1V3AA 2CM3A 4H34A 3RGQA 4B04A 4PVGA 3ZM1A 5IBSA 1C85A 5LXQB 3V0IA 1YWFA 2YDUA 3BLUA 1JF7A 3QCKA 4BPCA 4QUNA 4R0SA 4RI5A 4D3RA 4PYHA 1YTSA 2A8BA 2AHSA 1VHRA 5J8RA 4ERCA 2OUDA 3B7OA 1NO6A 4JMJA 5EHRA 5KA3A 2PA5A 2H02A 3QCMA 2E0TA 3S4EA 1P15A 4J51A 3NMEA 1G4US 2J17A 3F9AA 1PTVA 4Y14A 1YTWA 1D5RA 5KABA 1EEOA 5GTJA 2I6OA 2Q47A 3EZZA 1YFOA 2J16B 5K9WA 2FH7A 3RGOA 1NWLA 2VEVA 4MBBA 4NYHA 2NT7A 5IBMA 3S3KA 4DGXA 5HDEA 3F9BA 3S4OA 2VEXA 4AZ1A 3V0GA 5I6VA 3QCJA 4GRYA 2I4EA 5KA0A 1G7GA 5KACA 3D1QA 4WU3A 4D3QA 1PYNA 2VEWA 2ZMMA 1Q6JA 3QCIA 3N0AA 2HNQA 2IMGA 4GRZA 1EENA 2F70A 2QBRA 4IKCA 1U25A 2CM8A 2I3RA 2Y96A 2PI7A 3QCFA 1OESA 1PTTA 2HNPA 3QCGA 1YPTA 2NTAA 2NV5A 1OHEA 4RHGA 3ZM3A 2WGPA
chains in the Genus database with same CATH superfamily
3EICA 4CT9A 4OYXA 4L76A 4F3MA 4WTYA 1VQMS 3WC2A 2ZE2A 1FJGJ 4KH0B 2X1AA 1S9GA 1J27A 3V5RA 1SKRA 2I4HA 3K7RA 2EPIA 1WC5A 3KHLA 4IG3B 5LMUJ 1FRHA 4Y00A 1ZS6A 5C42A 4FKYA 1T49A 2EI5A 4FS2A 1FKAF 5DGBA 1IVZA 3C6TA 1MW7A 4O44B 1SJQA 1DQAA 2BX6A 5I3UB 3FEXB 1WAXA 1WTFA 3FMWA 4K0KF 2M0GB 1NJYA 1H7WA 4XIUA 2GQCA 4ID5A 3UW1A 1CLFA 2GW8A 3BGLA 1B4SA 2E1PA 2C3YA 3MEEA 4PZVA 3FZBA 5IFMA 4DSEA 4S0MA 4M1KA 3PO5A 4RW4B 2X1GA 4KHRA 2QA1A 2YNIA 1XXPA 2IBKA 4ZPBA 1Y7PA 2HFUA 2W9CA 3Q8SB 4OX6A 2QBQA 2R7QA 2DD8S 3H2XA 4KB7A 1LK7A 1GFWB 1U48A 2CNKB 1RHUB 1PSDA 2V4JA 2KM8B 1EP4B 2DITA 4DL6A 1VIOA 2RUGA 3M7VA 4GKKJ 1FPRA 1Y3JA 4UUXA 2V8HA 3D6MB 3QMQA 1VGYA 4MYUA 2I3UA 1Y5IB 5KG7A 1GMWD 2GGPB 2RRNA 5GMKa 3UCZP 1RZMA 4N41A 3ILJA 1BE4A 4IFVB 2XG8A 4G3IA 3QGGA 2UUWA 1ZH5A 1OJ4A 2RE1A 4DV7J 1UL3A 1YBAA 3ZTPA 4QIFA 2DNNA 4R30A 1AA1B 2VKZG 3SSSA 3M30A 2OFHX 4I56A 2IY5B 2DTJA 2FY1A 4GE5A 3M8RA 3OUYB 4WF9Q 3Q86A 2R7VA 2KL8A 4RW6A 4OX9J 3GYGA 3UPFA 1M90T 3CJTA 2QL7B 2GVZA 2UUTA 1KAKA 3D0GE 3FBFA 2E9ZA 1DY3A 1UCNA 2Z0GA 2DNOA 1X4HA 1R8HA 2V69A 3IFEA 1T9XA 2D3ZA 3PKMA 2XPCA 1IUJA 2IAJA 1CJTA 1YN9A 4BC9A 4O3NA 3I36A 4F26A 5BR8J 3Q8RB 1QD1A 3SQOP 1M3GA 2KHDA 4Y2EA 4LF4J 5KFFA 3SV4A 5ETKA 1GWZA 3DMJA 2MGZB 4ZN3A 4FBTA 2KRRA 1YGYA 4CP5A 5LOQA 4UW2A 3PVXA 4NZ0A 2E1RA 2BE7D 5H9EK 5SUHA 3CO9A 3H5XA 4QF5A 3WZ0A 1VHIA 1F2GA 3CD0A 2A10A 3KLEB 2CNEA 1F9FA 3LAKA 3Q8UA 1FQ1A 3H5YA 1N4LA 3BEGB 2L48A 5KG0A 3O44A 2FIUA 2R2UA 2M3VA 2IRYA 3V0FA 1S1TB 2ATCB 1GT8A 4WFBQ 2J9CA 2RILA 3MEGB 3ISZA 4ED3A 4GO5X 2YBVA 1TFYA 4MKVA 2AYGA 5DM6Q 2PBNA 3KK1A 1RK8A 1S6QB 2VQEF 4TQSA 4CVKA 2UUCJ 2UUBF 3W2VA 5KG4A 1YJWS 4BUBA 2H4YB 4RW9A 3UR3C 4K0KJ 3OFEA 1OYEA 1S0MA 2G1DA 2VDIA 2B6AA 3QCKA 2DNKA 2DGWA 2YNFB 5CYMA 4DR6F 5J8RA 4IO1A 2J76E 5KOWA 2RH3A 1JLAB 1VLOA 2ZH7A 2A18A 2PA5A 2DHHA 1JQGA 1VRTA 3OL7A 1PTVA 4QDIA 4FXWA 4WZMA 1CS4B 2BR0A 1JXLA 3DLBA 2JOQA 3BKFA 2FGCA 4X64F 2EC2A 1T9VA 2R8IA 3PG9A 1EEHA 4MKAA 3G96A 1ULRA 2CJ9A 1M5HA 5K8MA 2X1FA 2QYCA 4I67A 1HBUB 3V0GA 2LCWA 2HRUA 2JWNA 2DPIA 4MK9A 3HHLB 1Q6JA 2RJZA 4YFUA 2MY8A 3T9NA 4RU2A 2YKPA 4V19X 1YG0A 2BM0A 1XNQF 2B9EA 3Q2TC 3CJ8A 3DOKB 3KUEA 2VBZA 5DGAA 1CJUB 3FBCA 1VC6A 5L1IA 2XQCA 1OHEA 4RHGA 3ZM3A 3M9MB 2CJBA 3GFHA 3D1HA 1I51B 4O3RA 2B8QA 1NKBA 1U24A 5HVFA 4L75A 4UY85 2FJMA 1W2BR 2IA6A 2MQMA 3DDNA 2FJAB 3WC0A 4GC7A 4BHQA 1ZBTA 2VOPA 2FVRA 1H2VZ 1VBXA 5CZXA 4ETXA 2IJFA 1NPRA 3FKBA 3IG1A 4PG5A 3QT6A 1T48A 3PEHA 2HCMA 4K4SA 1SVDA 2B43A 3V0JA 2FHMA 1LYVA 1HNWJ 4DR5J 1BY9A 1P9QC 1JLGB 1UJ6A 2MXYA 4H4MB 2EFVA 1JKHB 4B3OB 1OSCA 2QRRA 1TL7A 4NYZA 5JUMA 4MAKA 4ZJOA 1WKKA 2KRBA 4ECQA 5B0AA 1FVQA 4AXIA 2HBZB 1QSLA 3OV7A 5D0GA 4LBHA 2OFGX 3EMUA 2ZBCA 3KJVB 2J9DE 4OJHA 3S3EA 2OJ3A 3NS6A 1FWKA 1KOOA 1UFLA 2YXLA 4JMKA 4MMOA 2MZSA 1ZPVA 4FNHA 1P27B 4FF3A 4A4JA 3U1MA 2GAHC 5IM0B 3SFGA 2CMBA 2Y2FA 2GFFA 1N5VA 4L74A 2KVQE 4Y3CA 1SIWB 3SBMA 1GFYA 3M2RB 3O4SA 1QVFR 3M4XA 2VONA 2OIHA 3UD3P 3MFHA 2NQPA 3CCMS 3UN5A 4DX6A 2UUBJ 5DQHA 2MQQA 1WDDA 3TAMB 3CE8A 5GAHU 4OHXA 2CPFA 4DFMA 5H1SV 2W8KA 1NB7A 5KT4A 1S7IA 3CTRA 2XS2A 2MSTA 2DK2A 3G86A 4JI3J 2RQCA 5DG9A 4TQRA 1TZ0A 2I5JB 5IOLA 3LAMA 5F8HA 2GA7A 2HZVA 1W7KA 1FA0A 1NK6A 1SQFA 4X4OA 4PG6A 2R8GA 5K25A 4ECVA 2QC3A 4JI1F 1K73T 4F67A 4MK8A 4R8UA 4KGXB 3RZ2A 2GZOA 3JQKA 3VGSA 4WOHA 1J6UA 1NNYA 2B9WA 3C3LA 2C2KB 1FHTA 4DN0A 2KVIA 3GE9A 3VGVA 2ZWPA 1L3VA 3CMAS 4WFYA 3DXSX 2CQCA 3W8PA 4B9UA 2ZOMA 2QLXA 4QPXA 1BZCA 1GMUA 1HI8A 3A1YG 5K20B 3RZAA 2BJEA 2J9DA 1FT8A 1TKTA 2DH7A 3EPIA 2BGEA 4DV0J 1MU2B 5BYSA 2M9KA 1XNQJ 3E8OA 1TKXA 1T03B 4OJ3A 3D9BA 4AE5A 4ICLB 1N5QA 2F6YA 3M8PB 1XMBA 2IVYA 2AW0A 4KFBB 4ZVHA 2MZ1A 4CH0S 2HZAA 2RKIB 4P2MA 5D8HB 3EUNA 1VQ4S 2NT2A 2QYGA 1HW8A 2VF3A 4JI0F 1A7GE 3B4DA 1FESA 1GK8A 2F6FA 3CDWA 5B0BA 4ZHRA 2AJFE 2MKSA 4NZ7A 4C8KA 1YBTA 2COLA 5MLCV 1HA1A 1VI7A 1UEVA 4WP3A 5LXQB 5C25B 2C42A 2W2QP 3T6BA 4WIIA 3HSDA 4R0SA 1MG7A 3JSRA 4UTGA 3T19A 4YS2A 3I9V9 1Y10A 2NSBA 2MTLA 5EN1A 2DRBA 2AHSA 5HL7Q 1FF2A 3D5MA 1PYSB 3SEOA 4EI2A 2F8MA 1KVJA 3QCMA 3E51A 5T14A 2HFSA 1HQEA 1ZETA 2QTWA 1IBCB 4CNYA 3OLAA 1RT2B 1RABB 4UOGA 3F44A 1IWAA 2Y1OA 3HVTA 3EZZA 1WF1A 3WHIA 2MQNA 2HHSA 4MBBA 1PYOB 4DGXA 2HQIA 1OO0B 1CQMA 4I6YA 5BYRA 4CT8A 2HS0A 2QMXA 5EUHA 5LJ5Y 3QJPA 3CIMA 4AT1B 1JLFB 5GAEU 1S9EA 2KB2A 1U6BA 1R8CA 3FBBA 2AYBA 4P74A 1CBKA 4ES2A 4FP9A 5DZ7A 2VTEA 2HNDA 1DURA 3CSKA 2Y68A 3QCFA 2YH1A 1RWXB 5C2CA 3RB6A 1YRTA 1OESA 3QT8A 1FNXH 3GSDA 2UV8A 4HACA 4WFAQ 3EGVA 1GH8A 2HIQA 1UVKA 4P9SA 1FDDA 1JIHA 2HHUA 5HVGA 3V4IB 2E5IA 3ZO7A 3GIKA 5K9VA 3OTEA 1PA9A 1ZM4A 1Q6NA 4IYQA 2FHKA 2QBPA 3MUMP 1HD1A 1YJ9S 3NGKA 2YQ0A 4DS4A 5DZ6A 2DHGA 1NBEB 2AU0A 1XMQF 4FBUA 4JI4J 4GVBB 9ATCB 1IR2A 5E33A 1SQGA 1PJ6A 2HNZA 2VODA 4LF1A 3BBFA 1C0TA 1F9EB 4OX7A 3RU0A 5L1JA 2ZD1B 4NA2A 5EGYA 1M0SA 5BJRA 3CD7A 4DL2A 2GC6A 1KDNA 5KFWA 5IQ6A 2ZKUA 1KOHA 3JSBA 8ATCB 1B64A 7FD1A 5JVHQ 3HP6A 2KXHA 4NL5A 2GJFA 3ISND 3J7YU 1EARA 1Q7YT 3Q22A 2CQ2A 1KNZA 4ZVTB 5CCMA 3QLHA 1NU4A 2HLUA 2EFQA 3BREA 1U2FA 2XYGB 3LP2A 3UDVA 1S6UA 2WB4A 1RTDA 2LXUA 3FK4A 5I42A 3QCNA 4NCAA 1QLNA 2EBGA 4DOZA 4A46A 1MROA 2P6SA 2LMIA 2N7YA 3NS5A 3MUVP 3OL6A 2VBYA 3HT3A 4WP9A 2CG8A 1NK9A 4PWWA 1A6LA 4YDXA 1HNVA 4WPAA 4ELUA 4ZI4A 3NG8A 5A8KA 2QFIA 1RAEB 1UEUA 1GQQA 1UWBA 2RF2A 1VQKS 2KG0A 3TR5A 2NUHA 2LU2A 2DCLA 2ASYA 1LKZA 3AJ1A 3AH6A 3EXCX 2R8HA 3TVYA 2A0FB 3RRKA 3CJ2A 2X3GA 4X4TA 4LRAA 2FLLA 2JDJA 3U1NA 2BBEA 4OIXA 1J5EJ 3W62A 2K06A 1EKSA 2ZVSA 3HSZA 2AX0A 1S1XA 1MN9A 4B02A 1FDAA 3LOUA 1ICEB 3GIIA 3IGNA 2YVSA 4MK7A 4IO9Q 1NL9A 2J6SA 2GIFA 2GHVC 2V2KA 2D74B 1NHUA 2HQGA 2ZNZA 4KC5A 3KK3B 3IA0A 4F04B 5FD1A 4ZLNA 2CRLA 4Z2XA 4OLOA 1KBRA 1I9TA 4ZPDA 1AUSL 4C11B 1JLCB 3ENQA 4ZITA 2BANA 2WTFA 2HMIA 1GAOA 2VASA 2ZITA 4EYHB 1RBLA 4CYUA 3RAMA 1K1QA 1SJ1A 4ILLA 3AT1B 4DPTA 1PAEX 2X7IA 2DISA 3R5JB 4BC7A 1QAIA 1SKSA 3D42A 3VGTA 1RAFB 2CNHA 1BQMA 2WW4A 4HH1A 1AUDA 2CG4A 2OMLA 4IG0B 4NLYA 4PG4A 4YR0A 2JEFA 4JI8F 3JXOA 4KSEB 4LIRA 2XC9A 3VAIA 1R6YA 3AQOA 4I2QB 1DFDA 2V34A 3OTBA 1NZAA 3GU0A 1QDUB 4ZLJA 3QCBA 1AYEA 1TMMA 2CDQA 2ZH3A 2ESBA 2DNQA 1XWLA 2KZZA 3IWNC 2PI5A 2E1MC 3DLLQ 1JLQA 4OZNA 4GE2A 3PFOA 4CTAB 1TK0A 2I6MA 1TKDA 1HYSB 2QLWA 3TA1A 2ZZTA 3ETOA 5B0GA 3VQSA 3NCRA 1QE1A 3N5BA 3CJKB 2OPQA 3QSYB 5EWEA 5DLGA 4X4PA 3Q8YA 1AT1B 3JB9k 5KFGA 2XO6A 4ERCA 4X4NA 2BRKA 1OY8A 3MWBA 5J2QB 1FK9B 5G0RB 5KFPA 1YHQS 3K59A 4P2SA 1GX6A 2F4VF 4ZK7M 5KFSA 2DRAA 2J16B 4C97A 4LJMA 4R0EA 2YWHA 1NWLA 1RWNB 4ZLPA 3T5KA 5KFTA 3BGOP 3MM6B 2V8GA 2MKYA 4TXSA 1HIYA 5KFCA 5FLXY 2NSCA 4J9QA 2OTLS 3CCSS 1X4GA 1NH8A 3C6UB 2G0CA 4Q45A 1RT4A 4DV1J 1WSVA 2HIYA 2QT7A 4ERDA 3DLKA 2PI7A 3RYLA 4C4WA 1U6ZA 3W9IA 4DFJA 1UTAA 3ZNJ1 2VPXB 1J5OA 3F56A 3N2AA 3A12A 2ZM6J 1PC4A 3T5HA 1V3SA 3QCLA 3VR1A 4X66F 2DR5A 2PSZA 1UETA 3CCTA 3PCOB 1HQUB 2CNNB 4YDDB 1RXDA 2LQJA 2MJNA 4CM2A 2YY3A 2CQ0A 4U8YA 3AXKA 3KMQA 3GTYX 1PTUA 1ZA2B 1DTTB 1VR6A 4DI6A 4IQXA 3J81U 3QKQA 3GYXB 4YB7A 3KLHB 4ETZA 4NMLA 1WF2A 1LOUA 2XULA 5LJ3Y 3SCJE 2GC8A 2HAFA 2J0WA 1Z2ZA 2DBBA 4DCPB 2FC8A 4D3HA 2NLWA 2HGNA 4ANCA 3EU0A 5A8WB 3PRDA 4UAGA 2RD5C 1REVA 4QAPA 1U1MA 3K17A 2OPPB 3AD8C 3R9LA 4OV6A 3H98A 1S6PA 3FC9A 4JI6J 2O66A 4DR4J 4I0WA 3TX8A 3EZOA 2BEFA 3DYAA 3ZFVA 1QAYA 2ZNYA 5IV4A 2H9ZA 1ZTTA 5LL6d 2HVLA 5HATA 2J0XA 1UA1A 3SSQA 3TI0A 5F8MA 2HVIA 3MM7B 4DPUA 1FVSA 2C22A 3B6BA 5FIIA 4FXVA 3I96A 4EZ9A 4QPTA 1G1GA 2C7SA 4AUKA 2CNFA 3MR7A 2YQ3A 4N77A 2XI2A 2LXIA 4C48A 1KD1T 2HPUA 3CGIA 3MEKA 3D6HB 2HHXA 2AMCB 5H9FJ 4Q8FA 2VB6A 5EX0A 4CCHA 3V6DB 2B5JA 4NXMJ 4K8RA 4MKYA 4FF1A 4GVLA 4WWSA 2YWKA 5GMDA 3JSMB 3CNQP 4YMEA 2GJTA 1AZSA 2JLEA 1UFWA 4HL9A 5KAAA 1U49A 3RR7A 1O5ZA 2YWGA 4NCGA 3KTQA 5HANA 1H0HB 3ZZUA 3LUYA 1S9FA 1MNEA 4HHJA 4ZCMA 2AZ1A 2HQFA 2KYXA 3KK2B 2ZBPA 3LW5C 4ED6A 2B4SA 4J9RA 1Q78A 1RPMA 1L3SA 2H03A 1N34J 5K9FA 3K0JA 2DVIA 2Y1LB 1FNOA 4B3TF 4M5HA 4YB1P 2KI2A 3TWZA 3LPEA 4GMKA 1NNDA 1WEXA 3QWUA 5DG8A 1PBUA 4LSZB 4RNNA 3QRQA 5KG1A 2JRSA 2ROEA 3D7SB 4DV3J 3FSXA 4KYQA 5K14A 4IRKA 4B3MF 1KAVA 4DDFA 2Z8QA 3FRZA 3PZPA 5D78A 2K1RA 2VPZB 2EW9A 3MTKA 3DDKA 2W4PA 1HHTP 1MWYA 1GXLA 4IR1A 4DF8A 1SH3A 5J2MB 4X65F 3HVRA 2E1AA 2AEFA 3BN7A 2NCKL 5GAGI 3SQGA 1JJ4A 2WONA 3AD9C 5DLFA 4K5RA 1K0TA 3R2DJ 4UT4A 3SCIE 3CWEA 3IRXA 2XSJA 4J9LA 5HROA 2Q05A 3R7BB 2E5LF 3EZUA 4ZVRB 3ZZRA 1Q1MA 2Z2ZA 5HMYA 2HQCA 3LQVA 5C24A 2AP6A 1HL6A 3TAPA 5L9XA 3NNCA 4YOEA 2PDAA 4O4GB 4FKXA 4PVGA 3NS7B 5IT4A 4B08A 1Y5LB 4DZ6A 3PR5B 2R7UA 2HHHJ 4WYWA 1HHQA 4NLUA 1KLMB 2RSQA 2ZUGA 1VHRA 2XNRA 2G2OA 1NO6A 2V68A 3BQ0A 2F1FA 3HZGA 1QAJA 1R43A 2LYVA 1N33F 3NMEA 1NSKL 2CQGA 2CQ4A 2VICA 2VOOA 1H2TZ 3PX4A 2HBQB 2OMOA 3HHLD 4AQYF 5EWFA 1Y5NB 4CLFA 2IIHA 2OLWA 3KG1A 4FYDA 4PUOA 4LSLB 2XY7A 4OYBA 2NXCA 2DXDA 2HLTA 1RI7A 3H2LA 1LW2A 4OZLA 4X4RA 2LEAA 3M6UA 2IMGA 2IJNA 4IKCA 3M8QA 2CM8A 3C15A 1ZM9A 1KWMA 3PV8A 4ENOA 4RNMA 3CUNA 9RUBA 2NTAA 5DM7Q 3BSNA 4M5DB 5AJ3F 4QIVA 5DDOC 1FGSA 2UXBF 1URRA 3W5XA 2G59A 4L3NA 3NGSA 1W78A 2YNGA 4DV2J 1LXJA 3BSCA 3EDQB 3GWCA 1V3ZA 4Q5VA 3PW2A 3TJ9A 2XWYA 4UOCA 2MJUA 3MOWA 2DHAA 4LQ3A 2BJ8A 3MM9A 2YNHB 3VTIA 2JFGA 5LXRA 4LF5F 3EVMA 4I6AA 4JV1A 3LGHA 2IC3A 3KJNB 1UZDA 4OZ1A 2DNMA 1SV5A 4B3TJ 3QFWA 3PYDA 2VKRA 4ECYA 5IT0A 2Y67A 2VG7A 4KO0A 1C1BA 3A8KA 1GQYA 2FDNA 1RHQB 1IKXA 3M05A 1AXQA 2JJ4D 1RT5B 3NKYA 3MAAB 4CLLA 2NYHA 1Y9OA 2RDIA 3DLEA 2ZH2A 3O5TB 3OR1B 3W9HA 3HHDA 2BJ9A 2B0GA 3D28A 1ACMB 1KEKA 4RKUC 4AYBD 3HO1A 2V50A 5J2NA 1KRPA 3MEDA 2HC2A 1U26A 4KYRA 3PM9A 4QR0A 4JBCA 2SHPA 3T3FA 4M95A 2WSEC 3BO3A 3DM2B 1S12A 3RBZA 2I9SA 2E7XA 3JSYA 5J1EB 1C4AA 3NOGA 5E3QA 1S77D 2QEXS 4DJBA 1XBOA 4JB8B 4USMA 2XJAA 2VPWB 4BWJA 1G4WR 1WC0A 1AAXA 2APOA 3NAIA 1U7LA 1UVIA 1IKVB 2GCFA 4H1OA 2DXPA 4ZPTR 3EDRB 2OEJA 4Y6IA 2HVHA 4NWBA 4LF9F 2XLKA 1RP5A 5KFKA 4DV4F 4ZRTA 1RTIA 2PC6A 1EKRA 5KA8A 4HHUA 1FKOA 2D3O1 5A76A 2EK6A 2VEUA 4AQYJ 4TU9A 2ZE2B 2BYCA 1RT1A 1X60A 5DRKA 1NJIT 2BXJA 2HHVA 1KQSR 3QO9A 2XY5A 3FZ2A 1CC7A 4F4ZA 3RO1A 3H42A 5C42B 4H4OB 2XYPB 4KV8A 4USJC 3FQKA 3C6TB 1YBUA 2KYZA 1WC1A 3OJSA 3R7SB 2Y1IA 2EKNA 3PKYA 2FVCA 4ES3A 3ZZTA 2YKAA 1SXLA 3SIPB 4ID5B 5JMNA 2F46A 2Q1LA 3RAQA 4ZIYA 3QNWB 3I5AA 3OD2A 1X24A 3UQSA 1A9NB 2XB2D 3MEEB 2F5GA 2WJPA 3K57A 4CO2A 4I1TA 3KLGB 2UXBJ 2L08A 5I4MA 3K5NA 2MQ8A 1HD0A 2R7RA 3ZZOA 2W9CB 2C28A 4LRBA 5L46A 1SC1B 4NA3A 2OC3A 3PYZA 3HT0A 3AWEA 1L8GA 2I75A 4RR5A 3DI6A 4RPFA 2ZH5A 3GONA 5CHCB 2HQ3A 3L7PA 4USHA 1I94J 2V4JB 3VAJA 4P7TA 4RUAA 3BM7A 2HVEA 2NXUA 2H4WB 1I6JA 4RJVA 3NGTA 4W4MA 4ECRA 4QUNA 3NXZA 3ENWA 4LFAJ 5KFYA 3LK7A 4PYHA 5HLFB 1YTSA 1RA6A 1LV5A 1LWEA 5C2GA 5HMZA 4DV6J 3CJRA 4JMJA 2HBYB 1NJXA 2DH8A 3R6GB 4NRUA 1SC6A 2BJDA 2ERRA 2J17A 1HNIA 3KMSA 1LFWA 1KQFB 1YFOA 3AJDA 1LWCA 3A13A 3DGPA 3OJUA 2DRDA 3M30B 1HBOB 4NLWA 3J80Y 3F9BA 3BR8A 2R7TA 3CW2C 4RW6B 5A6PA 2ZFHA 2CPDA 3K5PA 2GVZB 3R5DA 2AGOA 3D1QA 3G4SS 4IRDA 2VEWA 3AODA 2LQ5A 2JEJA 4GRZA 5I3UA 2IAJB 4B9TA 1CJTB 1YZ6A 2ZBIA 2ZZNA 5ETLA 3HCXA 3BF4A 1SB6A 4JV0A 1U6FA 3MURP 1NJWA 5KT5A 1T7PA 7FDRA 4ZOSA 3K5OA 3V6KA 3QCCA 1AFIA 3H90A 4U7UD 1E6VB 1TMJA 2QLFB 1FXDA 2R2RA 2FVSA 3GCXP 2PGCA 3SZ2A 4CQ1A 2POKA 4NLXA 2LEPA 2AEMA 5IXUA 4AL7A 4USVA 4QZVB 4U7UK 1NAQA 4DV4J 2NXEA 2ZHOA 3D1OA 4DPOA 4ZN5A 1M5VC 1XBWA 4RBTA 1FFWB 5IS2A 3ZM6A 2BE2A 4E98A 2XY6A 3CC2S 1WHYA 2BZLA 3MECA 3A3NB 4K2JA 5M43A 3BR9A 1U1NA 3UN2A 4J9MA 4DR2F 3KK1B 1NSAA 3KLIB 1VQ5S 2QDMA 2GJ2A 4ZP7A 3EJMA 3W2VB 2XS5A 1WOSA 3GJTB 3S01A 2YKNB 3R27A 4RW9B 5LMNF 5B7WA 1YITS 3CMES 3AXMA 1QSSA 3HULA 3C14B 1R89A 3A5JA 1URNA 1CVJA 2CJAA 5CD4H 4FYVB 1R31A 1CPZA 2BW2A 3EWGA 1IKYA 5B0DA 2LA4A 3T1HF 1FRXA 2Y0SD 1C1CA 1VBKA 2MDAA 2PMWA 2LKZA 4RNOA 1HNZF 2WOMA 4ZP8A 3K5LA 4J37A 4X4UA 1ZAVA 1D8YA 3NGDA 2QCJA 4KR0B 4MIWA 3DHWC 4U95A 3G6YA 1Z2LA 2CPEA 1UWAA 1HR0J 4C13A 2R8JA 4P7VA 2QL5B 2R2SA 1VRQC 2NPIA 3S1TA 2HFVA 4WXWA 2DPJA 1B0TA 2Q66A 5KFMA 5ETSA 4PG8A 4OI4A 4OHLA 3WDOA 1IR1A 5HO4A 1QY7A 1O6XA 4K4XA 1E0DA 5ETRA 4DUZF 4N5SA 1QSYA 2CPYA 3FJ2A 4YP3A 4LF7J 3KJQB 3LA0A 4U67Q 2ZH6A 4CLZA 3OLRA 2I1YA 1GNKA 4A8WA 4M8LA 3S3FA 1JWWA 2W2PP 3VGUA 4EFAC 4RNHA 2VFVA 2BGDA 3GJQB 4LF6F 2VQFF 2FLPA 2B7BB 2IDEA 3I4PA 3KLEA 4ZVUB 1S1WA 1NMEB 1RBAA 1GG4A 2EKYA 1Q82T 4KIAA 3QIDA 2I8EA 2B49A 3BDEA 2ZUAA 4L73A 5HMXA 1Q6SA 1KTQA 5I3QA 1R27B 3MEGA 4PKDB 2DO0A 4FZVA 3EE3A 4HR2A 2ZKTA 4DSFA 3IG1B 1S6QA 4YY3J 2QJ3A 2ALZA 4RNFA 1KHVA 2R7XA 2C3OA 3N28A 1CSJA 3IRWP 5KA4A 3LO3A 1N56A 3GV5B 1J4XA 1FKPA 2JFDA 1GXUA 2GMJA 2KFZA 1W2IA 2B8PA 1DQ8A 1B0VA 3H40A 2HQDA 2IRXA 1SH2A 2H5IB 2R0BA 3KLFA 3H0PA 4D3PA 1Q79A 1DTQA 1TL7B 1O5JA 1O8BA 4LF2A 1OHCA 1JLAA 2FJXA 2HHPA 2MYFA 3BRHA 3E01A 5D0HA 4USIA 3CCJS 2HW3A 1XR5A 3DRRA 4LR8A 1LW0B 3KXDA 2DEIA 1S0VA 4ZJLA 1VK8A 4F0HA 2XMAA 4YHHF 1XM2A 4ZJQA 2MPUA 3FCVA 1WOPA 4H34A 2XBPA 1RADB 3UDCA 1YWFA 1HBUA 1WHWA 3MZIA 1HLWA 1RTJB 4MIAA 4D3RA 5IT9U 4DSLA 4BLGA 4C8ZA 2AQ4A 1IBKF 3JS9A 2ASLA 1BMQB 1GX5A 4ZVSB 3D66A 1U1LA 3G8QA 3UVJA 5LMNJ 5DQGA 3BGRA 3MM5A 1SC3B 3OBIA 3MMCB 5KABA 3C46A 1RU1A 1KVKA 4LBPA 5K9WA 1OY6A 3TZWA 3NMAA 5IBMA 4BUCA 4MJKA 1KFSA 4XPEA 2LP4A 2MZRA 4NX9A 4HT7A 1PC5A 4C3LA 4USKA 4ZPCA 3MVNA 4EO6A 3I6PA 2V9KA 1RSCA 4C0HA 3BH6B 1G6BA 4R8UB 2HNQA 3TAQA 1TR0A 4TNOA 5HVHA 3OFFA 3HSJA 2GO8A 2I3RA 1HKAA 1R7IA 3QCGA 4I4BA 2KT3A 3KDNA 2RQKA 3I5CA 1FRJA 4KPYA 2JNJA 3R3TA 4H4MA 3NWGA 4DUZJ 2XHWA 1TKTB 3C66A 2W2OP 3TNVA 1IXKA 1TKXB 3Q83A 4LFBF 2H4GA 3DRXA 4NLGA 3QIPA 4OFZA 4ZMMA 1YLXA 3Q8QB 1HMVA 4JNBA 4U7CA 1PCAA 1SL0A 3N01A 3GZ7A 3NGRA 2ACMA 3W1YC 3MDFA 5IM0A 3W61A 2V63A 1HPZA 4OI3A 4Z7CA 1TVRA 1C2PA 3OMHA 3P5BP 3T5JA 1FRIA 2PN6A 4F0MA 5DS7A 3RJMB 4DEZA 5AE2A 3Q8PB 1DAXA 4ZIVA 5CZVA 3HN7A 3BDPA 4OHIA 2QMWA 5L1KA 2ZJRQ 3M2VA 1FE4A 4YB6A 4ED4A 1H72C 4EBEA 3ZZZA 2CJYB 1NO8A 2PT0A 3MM8A 1RTHA 3GG0A 2LFVA 3TA0A 4KTQA 1NK7A 3VAMA 3MUTP 1IR0A 4C8YA 1NRKA 1H2UX 5LSRA 3OTOJ 1G2EA 1HQEB 1VQ6S 4K4UA 1S6OA 2CJQA 4NXNJ 3D9CA 5BZZA 1HBMA 2RT3A 4KKOB 2C3UA 1N6QB 5F8NA 1N36J 4OI2A 3HVTB 3OLBA 5A6WA 2WCXA 4F2RA 2L3MA 1C87A 1Y3KA 4KAIA 5THWA 3HXMA 4GE6A 4KY3A 4RDDA 1FPZA 3QQCD 3CXCR 1X9SA 5EDWA 1MMNA 2EFNA 1S9EB 2G1HA 4ID8A 2AZRA 1OQ3A 1U1KA 3TP2A 5HN0A 1O0PA 3KHGA 4DR1J 4L3KA 3K5MA 3R5AA 5AXKA 4PABA 4UQGA 1VRUA 1NZ8A 2HBRB 1IBKJ 2HNDB 2HHWA 4PQUB 5DDQC 2LU1A 4WIQA 3GIRA 5K23A 4HACB 3IP0A 3KYLA 2CJZA 4C0OC 1UVMA 2UUPA 2AJ4A 4N56A 2O5DA 4DV5F 2CZ4A 5IWAJ 1LNQA 4K59A 2OSRA 3VZHA 4PXCA 4ZCKA 4E2FB 2BUNA 4KFBA 1ZA1B 3CC4S 1VMBA 2O67A 1Y4ZB 5ETPA 2P6TA 5A8RA 1SBRA 2C2DA 1EX8A 4HT5A 1WG1A 1XMOJ 4C9DA 5BZXA 1TUVA 2J9EA 4OZ2A 5DQIA 3OVSA 4OZJA 3M9OB 5E3RA 5D4LA 2FQQB 2HNZB 1C0TB 4I2PA 4X4SA 1RDRA 2C46A 4F0KA 4HYKA 4O3OA 1N0VC 2MQLA 5E3PA 2NLKA 3HKZD 2KXFA 1WC3A 2P2CB 5K22A 1GTEA 5A2QU 2VEYA 2JL9A 5BUGA 3QLHB 3KHHA 2WVEA 3H2UB 3WIUA 5F8IA 3TARA 3LP2B 2LLZA 4Y28C 4ECSA 1RTDB 3ZTSA 4ALZA 4LMZA 2HYIB 3SR9A 1E6YA 2MKIA 2F00A 1SUGA 2CM3A 2WBMA 4KH1B 3R1HA 5AE3A 3OXGA 4EEYA 3THPA 2RNEA 2M8DB 1EQMA 2YDUA 2A6MA 3P49B 2M88A 1HNVB 2GJIA 1C0UA 4ZPAA 1H38A 5A8KB 2PFFB 2QN6B 3OVBA 2J7WA 2ACYA 1CJVA 1RAHB 1XR7A 4JI7F 4NI2A 5EHRA 1UWBB 1VQPS 2RF2B 2N4CA 2XSFA 2DO4A 4DR7J 3I32A 1U1OA 4NEZA 1RWWB 2VG6B 3GLJA 3CJ4A 4JI5J 3DOLA 2DGXA 2I6OA 2F65A 2QFJA 3DKDA 1EETA 2EEYA 4URSA 3SDEA 4XO0A 3EYZA 3LP1A 5CQGA 2EFPA 1VLYA 1S1XB 1B7YB 3QZ7A 3GFXA 1V5IB 2AF6A 1Q81T 5E41A 3FRYA 2BQ3A 5BXIA 4RL1A 4OZ3A 3P8BB 2J6UA 5M2UA 3OL8A 4HVZA 1XNRF 1IBMF 2BKNA 4GVBA 1V3RA 2QBRA 3AOAA 3THVA 2Y96A 3DC2A 2HZCA 5F3TA 4R5PA 3D2WA 3I31A 1PAUB 3RBXA 1RCOB 3MI7X 2BANB 1SQEA 2HMIB 3J81j 1IJEB 5KA2A 2U1AA 2QA4G 1D09B 1L5UA 1ZAWA 2CQPA 1X5PA 2H51B 3G9CA 1SKUB 2QG9B 2YKQA 3O4UA 4I7FA 1HWJA 2LXFA 3Q89A 4WE1B 4KJIA 2ASDA 1REGX 1BQMB 4C3KA 3LF0A 4X2BA 5E7OB 4B9VA 4KRWA 4LRDA 3BBBA 4JP8A 2JFHA 2JLGA 1D9FA 1RT3A 4HRFA 2DIVA 1U45A 1FD8A 4Y2KA 2CKWA 4DFKA 1U09A 4WKRA 2OPRB 2N7CA 2C2MB 1S97A 4NLOA 1ZAXA 3SCKE 4TU7A 1JLQB 4FYWB 4QW8A 1F5CA 4LF8F 1Y0HA 1QTMA 1MMLA 1CJKA 1MWZA 1IM6A 3VF0B 1QE1B 2RVJA 1U1PA 1TFWA 3BN4A 3M1VA 2I2YA 4GKJJ 4RBUA 1RLDA 3HKWA 4ZP6A 5AXNA 3F41A 3MPDA 1KKHA 2R42A 3NY0A 3UD4P 3TEHB 1VBZA 3BM8A 4OI0A 3CWJA 4KGVB 2GCBA 5DJBA 3PW4A 2UU9J 4Q44A 3VAKA 2E5HA 3D3CJ 2UUOA 2BE9B 1WG5A 4X62F 3KG0A 4DX8H 4F36A 2A3KA 2CM2A 3OHAA 1I9SA 3TJ8A 4JV5F 1P3DA 2GHPA 1F5BA 3F81A 3D68A 4TU8A 3T9ZA 3MPWA 4B3RF 3V6HA 1NB2A 3HJFA 2K3IA 2AGQA 3N0VA 1R0AB 2AEJA 4QIWD 2LQ9A 3KUGA 5KAKA 2K2PA 4PXDA 4ZVQB 4A8YA 3AOCA 4HLBA 3W5ZA 3BYPA 4OI6A 3T1YF 4C11A 2O01C 3A3PB 4DL3A 1RT4B 3HHNB 1HWUA 1RAGB 2CNGA 3DLKB 4JI7J 1JXVA 1NK5A 5F3ZA 4HH0A 4IFYB 1VFJA 1K44A 3MOZA 1J5OB 4GFVA 1PA1A 3MR3A 1PIEA 4LBIA 2EFOA 3R1LA 4CNZA 1ZCKA 4QWAA 3JAMU 5MAOA 1OETA 3C19A 3MGJA 4ITSA 1YTYA 1N54B 4YR3A 4YB5A 2ZH8A 3ADAC 4K4YA 1HNXF 2CJXB 2IBOA 2CPXA 5F9NA 1YQHA 3RBEA 2Y3YA 4IH7A 3UN3A 3LGNA 4ER8A 1RYSA 4J9OA 4CTAA 3CJQA 2AIRB 4AL5A 4HEA9 5GADI 1KC8T 1U2RA 3CD5A 5KOXA 2GIRA 3FMBA 3M8ZA 2YTCA 3IBCB 1YZ4A 3J7ZT 2OGUA 2YPZA 1REVB 5KFJA 3HMJG 2XZTB 3J7A1 2Q79A 1S6PB 4AL6A 2E5JA 4JOUA 4DX7A 3CDAA 2XMKA 1N32F 5D4OA 5J2QA 4A48A 1H73A 1WWHA 4QWBA 3DYAB 7AT1B 3BYRA 2DYAA 2WBRA 5F9LA 2FLNA 3QKPA 1H6KX 2W4DA 2PMZD 4G65A 2J16A 1YDLA 3F73A 2VA3A 3OVAA 3I9ZA 4B04A 3FEYB 3EXYA 1IQTA 4DXLA 2JSXA 1FDBA 3TVZA 3FQLA 1JF7A 4QWCA 1VC5A 1FO1A 3I0RB 1JJ2R 3IN5A 3HLUA 3B7OA 4LF8J 1VHFA 2GNKA 3HFZB 2ZC3A 2XHCA 3JQMA 1ZZNA 2DNGA 3HDSA 3E3XA 3F9AA 2UVRA 2V2VA 3HI9A 4JI2F 2OPSA 2DY9A 3VVUA 5IC4B 1OYDA 1J2VA 3OL9A 2LEBA 1Y11A 4NCGB 4RU9A 1UPMB 3CMQA 1FRMA 3ENAA 3JYTA 1HQ2A 4IKAA 1HQUA 4WJBA 2ADBA 2XO7A 4OI1A 5KACA 4FF4A 3Q23A 5ETQA 4DL5A 3IS9A 1PYNA 1EIYB 4HV4A 4DU7A 3RUBL 4QBUA 4LT6A 4E0DA 4JV5J 2G2YA 4ED7A 3F0NA 3R5CA 4LUBA 3KLHA 3W2WA 3S6EA 3KFWX 2ZBQA 2BJ3A 4IQMA 2BOAA 1FCAA 4DSIA 2WGPA 1CG2A 1RWPB 1TL4A 4FPRA 3IM9A 2VQEJ 5C7PA 3V4MA 2KH9A 3T1YJ 3R5GA 4J9NA 5K14B 2RMLA 3TX0A 2XLJA 1WC4A 2X51A 2OPPA 3MPUB 3PHTA 3H5SA 1R8PA 2K1RB 2WVDA 3POTB 4DHVA 2K8GA 1X8DA 4O3SA 2M52A 2B9YA 3H4DA 2WK4A 3G87A 4DR6J 4XDCA 5HQLA 2WONB 5MMZB 3MR2A 1W25A 2ZHBA 3J7AN 3ISNC 4O0NA 4G1QA 4P72A 3MM7A 2XSJB 2P9GA 5HROB 5ETMA 2BV5A 3P3DA 2FHJA 2VUGA 4OHDA 4LSNA 4X64J 3SSRA 1RBOB 5L39A 3J80U 3DLGA 5C24B 2GC5A 2JX2A 3I4HX 4DPYA 4ZCIA 1RWOB 3UCGA 4ELVA 2E7VA 3GXGA 1U8WA 1YSJA 3UFCX 4U96A 3G6ES 2IMWP 4DQSA 1GTHA 3EM1A 3LWLA 3O5XA 1MWQA 1VYAA 3JSMA 3EPGA 3MMAA 2G13A 4PG7A 1UJ5A 1FXRA 2ZC4A 1FE0A 1LWFA 1PH0A 2DGSA 4U9RA 3NBPB 4ZA1A 1WACA 1IQZA 1P6TA 1X9MA 1S5ZA 1VCTA 2HS4A 3B82A 2HEKA 1XK8A 4Q2LA 4PUOB 2B3TB 3LH2S 2FLOA 3M8YA 5E5NA 4CLKA 3H59A 2CMAA 2AKWB 1QUVA 1Q16B 3V0DA 1LW2B 1WEZA 5GMEA 4OMFG 4ANEA 2FVPA 4C98A 5BX1A 1FWLA 2FJNA 1M5KC 2DCUB 1FTRA 1NWEA 1Q6TA 3M8QB 4RI4A 3S8SA 4PQAA 3C15B 2DH9A 2F8EX 3IR7B 4O4RA 2HKEA 1H74A 3LP0A 5K8NA 2FPHX 1BQXA 3W65A 4KHPF 1RU2A 1KP6A 1UA0A 1NDCA 5B09A 3HVAA 4DG1A 2QMUB 1APSA 3T1AA 2YNGB 5J2MA 2QBSA 1U8SA 2AYEA 2G0IA 3GXHA 2VZ9A 1SUQA 3MCNA 1WDTA 1NPKA 5AXLA 2XCAA 4ZVGA 4OHVA 3MMJA 3TEGA 4NLQA 1VOMA 3MM9B 2UZAA 4QJVA 2VD3A 1JLNA 3UDEA 4WK1A 3U96A 1IBLF 4HDGA 4DL7A 2IC3B 2I6IA 3NOCA 3MMBA 1GMVA 5F0WA 1SV5B 4O4GA 2QCTA 2EG1A 1MLAA 3R7NB 2NXJA 2L41A 3ELHA 3RB3A 4NWGA 3CVKA 1KTVA 1SJ3P 1JNZB 1KLMA 4FYXB 3OQ2A 4ZIWA 4EBCA 2VG7B 4A8QA 2FD2A 4KO0B 1OQ6A 1C1BB 4QUMA 1IKXB 3GQCA 2QEPA 4DR3F 2YWEA 2UVVA 3DLEB 3W5YA 3GFYA 4A47A 4A8XA 1IKWB 4K4ZA 1T11A 4DQIA 2XYHB 1U1QA 3PACA 3EGNA 5KA9A 4EMDA 2OHDA 5KFOA 5J2NB 3PDNA 3K2YA 4DFPA 5LMUF 3QFHA 1UW4A 2XMTA 1OSDA 1NDKA 3JTNA 2CQDA 3WBZA 3TYTA 2JVRA 3G82A 3FUYA 2EFGA 3VAGA 4Z7YA 4JI1J 2KU7A 1Q5VA 1AB8A 2C1EB 1S57A 2Q3PA 3BH7B 2R7OA 1SL2A 4Q2MA 2W2NP 1P15A 1YJVA 1SJFA 4WBFA 2CPJA 4NRTA 3TUJC 4UZCA 3HD2A 1YTWA 1L3KA 1EEOA 5CD4A 5A5EA 1SJRA 1WELA 2NXNA 4M5DA 2CNOB 2KHCA 3O6QA 2E44A 1GQEA 1Y00A 3CCES 2DR6A 2J8AA 3JQJA 5KT2A 3IM8A 4P73A 5I6VA 2VOSA 3U02A 1RTIB 1JMTA 1CULA 4OV1A 5L8RC 1FKOB 1JLBB 4KGMA 2OTJS 2GVDB 1T95A 3LPYA 3UO0A 3QCIA 1RT1B 3TO8A 2YNHA 1GMWA 4F4KA 3CCVS 4LVOP 2VBWA 5E2QA 2CAJA 3N79A 2R4FA 4GKKF 1BLUA 4JI0J 4I68A 2NPFA 3QCDA 1VQOS 3H8YA 5DDRC 3PW7A 1RAJA 3RG6A 2HHTA 2M4MA 1X4FA 2VJVA 3KNGA 2BIJA 1HBNA 3K8VA 2H1YA 3O8WA 4TN2A 2D3OR 1PILA 4BJOA 3PHEA 4QWDA 4B9NA 3CT9A 5DETA 2KM8C 4QBWA 3J81Y 2C2RA 2HFZA 4OX9F 2HK3A 2V6AA 3DI6B 3ET6A 1P31A 2MLYA 3PX6A 1MN7A 4DMZA 4RWXA 5H9EJ 5LM7E 5K24A 1Q95G 2LA6A 5J1EA 2QSWA 3VAFA 1IBLJ 2HC1A 3VVTA 3M6VA 4F3QA 5KG3A 1D0EA 1T4JA 5GAGU 3BSAA 4R0TA 3BJYA 3W8GA 5AE1A 4LF4F 4NLDA 3C2PA 1U1RA 1G1FA 3A8IA 5HP1A 1I3OB 3DLHA 5GVQA 3LALA 1IKVA 2CXEA 4Q8EA 4B9SA 3GR1A 4MH8A 3OR2B 2OELA 4D3GA 3SYZA 1KSPA 2ATLA 1NZ7A 4N76A 1FDNA 2XMWA 2IDLA 4NCBA 3DGPB 2MSSA 3NWRA 1U0HA 1S1VB 4LRCA 4M94A 3ZMPA 2FHOB 5BYQA 2V8VA 2H3EB 1K47A 3IXQA 1UJ4A 2KKHA 2I6WA 1XMQJ 3D54A 4H4OA 2HRTA 1LXNA 2AJ1A 2UUCF 2WW8A 1ITPA 1XRIA 1P1TA 1CC8A 1TUWA 1OHDA 1OEUA 2CNLB 5LT5A 2W7AA 4H4KC 1RT6A 2OO4A 4CLPA 2W7PA 1D9DA 3M32A 2A6OA 1T94A 5D4NA 1OWXA 3SV3A 2A2CA 3QSIA 4NASA 1NDPA 1DRZA 3KLGA 1XTZA 2DR7A 3IO1A 4QYZK 3VHQA 1M1KT 4TVVA 2XGPA 3DXBA 4F25A 1F2HA 1G7FA 5CXTA 3EGWB 5EHPA 3DOMA 6FDRA 2BRLA 2ADCA 1BZJA 3S3HA 5KADA 5T7LA 4J9UE 2BE2B 4UQTA 3MECB 2RF6A 4QBEA 2P9CA 5HAOA 1DZ5A 5K5MA 4DLGA 4CI0B 3W7BA 2O1PA 2ZHAA 2Z2YB 3E2EA 3HK2A 2M2BA 4KT0C 1RWMB 1OS5A 4ILMA 5L1LA 2I38A 1U02A 5KFBA 1W7WA 2DNRA 1RB0A 5HLFA 3TVKA 5A0YA 3KDOA 4U8VA 1ZTWA 2AJQA 1NM2A 1BD6A 4DCOB 2ROPA 4USTA 4AD6A 2PEHA 5KFZA 1VQYA 2FB0A 1IKYB 4P71A 2BABA 3AB4B 4FYYB 1C1CB 2Y1JA 1VQ8S 4F4AA 1YZ7A 1S4EA 3PO4A 5HBMA 4MFBA 5JJBA 3L4BC 3H5UA 2WOMB 1HBOA 5D77A 1K0VA 4N7TA 5IBSA 3V6JA 2MZJA 1TELA 4KYZA 3CCUS 4M5IA 3HHLC 4CZCA 2N3LA 1BWVA 1TK8A 4M5JA 2LQ8A 2OUDA 3RR8A 5HK4A 1BQNA 4ANDA 3A8JA 3UD5A 2HURA 2IM1A 2J7UA 2V2QA 1JX4A 4DN9A 4HTJA 2OEKA 1S49A 1HNWF 4DR5F 3G2XA 4MTPA 3TW0A 4X4VA 1TKZA 2Q47A 5LXYA 3RGOA 3SI8A 2ILYA 1TV6A 3GIJA 1E6VA 2VEVA 4NYHA 1V5VA 2VIHA 1JJCB 4M63A 1RQ0A 2QE5A 4U6PA 4CVLA 1SJ4P 1X31C 3AHPA 4DL0C 3GIMA 1X7VA 5EX3A 4DUTA 3QPIA 1S1WB 4URGA 5FDLB 1OY9A 4JI8J 1S1UB 2P9EA 1VDHA 5CYQA 1RWUA 1XN9A 3DRSA 1B7FA 2MZQA 4PCQA 1SL1A 4AXJA 4KE5A 2DJWA 2Z57B 1YPTA 4IDKA 2HWIA 4CO1A 3NCPA 2QV6A 3PFEA 2NV5A 4PAAA 1RWKB 4ECTA 4CLTA 3UI3A 2K7JA 3X3UA 5B0CA 1M5SA 1YRXA 3KLIA 5HSPA 4TY8B 5HI7A 3NRSA 5KFXA 3P6YC 5JVGQ 2YKNA 1FKPB 3QGPA 2KFNA 3C14A 1VISA 2KJWA 3TZXA 3IBFB 4DS5A 3HM9A 2HXPA 2AWZA 4M5LA 1D1UA 4WYLA 3KLFB 1NK8A 2BACA 2UXCF 1DTQB 4DPWA 4JI3F 3ITHB 1H98A 1PG5B 2RS2A 2H48B 1K8AT 2H4KA 1VIXA 3E01B 3X1LB 3KLVA 2F4VJ 3DRRB 2QL9B 1FJ7A 3G8TA 1T05A 3W9JA 3WX8A 2YQ1A 3EX7B 4J7CA 1T3NA 4RH9A 3FFIA 3BKTA 3C16A 3CC7S 2OSQA 1WORA 1XR6A 1S99A 3AWFA 3PJXA 4S0GA 2NZCA 2BKOA 1FJCA 2G9OA 2F6TA 1N5YB 3M2UB 4ICZA 1TL3B 3UVJB 2CQ3A 2OD6A 4DV0F 1WI8A 3BGRB 3MM5B 1N5TA 2XZWA 1S4FA 4NA1A 3KKFA 1N52B 4XAKA 3RTVA 4OLPA 4PPZA 1TL1A 1M5PC 4HHHA 1C88A 2B4PA 1Q8IA 1B3TA 2JJDA 3KHRA 3C8YA 4UF4A 3FCWA 3GG1A 1TK5A 3V81A 2VG5A 1JNRB 3DFEA 4X66J 2LDYA 1X9WA 5HJYA 4K2XA 4KGKA 4URQU 3MD1A 2RB7A 1QZ0A 1M5OC 2ZVIA 1X4DA 5ETOA 3L7OA 5M2RA 4QWEA 1XJWB 2ZZMA 4LRFA 2L9WA 1P1LA 4GFUA 2VBXA 2XS7A 2KZMA 3ZZPA 2QIFA 3CO0P 3ILLA 4R0JA 2WSFC 1UEKA 2H54B 1WKJA 4RUHA 3KOAA 1WJ9A 2GS8A 3ONQA 2MBCA 1S10A 4C2MA 1RHMB 4A8SA 4EZ6A 2VFTA 4GS0A 1ROFA 1V6HA 4OHYA 3SMZA 4ZVFA 2PEBA 3QIPB 4EWTA 3NP5A 3NEKA 1HMVB 3CCWA 2VC1A 4IOAQ 3GR0A 1DLOA 2BQUA 2FJVA 1C83A 1LW0A 4G1IA 2CZVC 4NYOA 4C6AA 5CA5A 4I69A 4WTOB 2DY1A 1OIAA 2FGOA 1U4BA 2CM7A 2KT5A 1HPZB 1TVRB 4OHEA 2YH0A 1RT7A 4ELTA 1SCJB 4FVCA 3BV8A 5DDPC 2PA3A 2YX4A 1RTJA 4CIOA 2W9BB 1S72S 1G1HA 2YWFA 3M2VB 1QTNB 2V8PA 3QJLA 3L95X 2H5JB 3UDLA 3WQPA 3V0HA 1FEEA 1FEHA 3G6VA 2XM3A 3MM8B 3W60A 4BDPA 1RTHB 3MMCA 2CFVA 5KFUA 2EK1A 1X0PA 2Q6CA 4PR6A 1Z1ZA 2E5GA 2LECA 2UXCJ 2CPIA 3K58A 3GMGA 2VFUA 3UE2A 2CWKA 3ZC4A 1NDLA 3V0IA 1HBMB 2M3DA 6AT1B 4AFFA 1N8RT 5H9FK 2PFDA 4KPCA 1RISA 3KNAA 4WKYA 3QATA 2J8SA 4JI4F 2W7OA 2WZ1A 4P2FA 4WK3A 3OXFA 1HFEL 5ADZA 3ZTQA 3HSGA 3ZTRA 4PWUA 3TRGA 2Z2LA 4W90B 1ZZFA 2HNYB 4WXOA 1WTBA 1LQ9A 2E0TA 4IR9A 4OYZA 4IH6A 5G4DA 4F2SA 5IV3A 1YRUA 1UVNA 4BCAA 3QT7A 1NK4A 3R97A 5LSOA 1G4CA 1HWKA 1VRUB 4EUVA 3DRPA 4CH7A 5J2PB 5ETTA 2FH7A 3MAHA 1KVIA 2XI3A 2NZ4A 4C8NA 4ECZA 2OAUA 4B3MJ 2MHNA 2VEXA 3QCJA 3QGIA 4WU3A 4D3QA 2OD4A 1TL5A 3H4BA 3UNYA 2QZ8A 4X65J 2X1BA 4KHMA 4YUDA 1IN0A 3BO4A 2DXFA 4HDHA 2N3OA 2F70A 3QGHA 5ETNA 1K9MT 2PA8D 2R7WA 2DKOB 2F9DA 4RW8A 4V19J 5A8RB 5D4PA 4K4WA 1NK0A 1CQNA 5K8OA 2E5LJ 2QGFB 3MXHP 1PJ5A 3ZM0A 1JJHA 8AT1B 3BQ1A 1YI2S 4Q0BA 5SZTA 3MTJA 2WRMA 4TLRA 4I2PB 3GILA 3M6WA 3I0SB 1SC4B 1RJJA 3I56S 3CJ3A 4NNDA 5KFAA 5M2PA 4OYWA 4F50A 2IVMA 2XEXA 2AHOB 1UAWA 1ZYQA 2F6WA 1FERA 3IR6B 2SXLA 3MR5A 1J5EF 4Y2AA 2MHEA 3RGIA 2FC9A 2C2OB 1N33J 2CYYA 4QR2A 4PRFA 3S7RA 1DBDA 5D0EA 4KKOA 3Q0AA 2VV5A 1N6QA 1S9GB 2B3OA 2MKCA 1NCLA 1JK9B 1E6YB 2V67A 3FEZA 3HZEA 2H04A 2B07A 1NEEA 2GMHA 4WFZA 3NAHA 5KFEA 1C0UB 2QDCA 2G6ZA 1S76D 4DGPA 3PJWA 3ZZ0A 1CJVB 4WFXA 1RAOA 3FGVA 4NI2B 4B9LA 4KGZB 1RKJA 2PO4A 1F3FA 4QIGA 1I1GA 4PQUA 3VWSA 3PIPQ 3W3SA 3UAGA 3HFKA 1W26A 4RW7A 3DOLB 3I55S 5AJ3J 1EETB 4PWDA 1FFGB 2YNIB 3SDEB 1T9TA 4DPXA 2QDPA 3LP1B 1T9UA 1LQFA 4HI2A 5HQ8A 1BUXA 4WU2A 4TY9A 5E3CA 1YTNA 1M1GA 4TYAA 2YKMA 4QYZJ 1JLEA 2ZH4A 3PS5A 1Q4RA 2AM2A 3EB1A 2B9XA 3OXLA 2CQIA 4LF5J 1XEZA 5D3GA 3LANA 2UXDF 4QR1A 4R5PB 4CLYA 1B70B 2XMMA 1V9OA 3N6NA 3CCRS 3DU6A 3UR0A 1BXNA 3V0EA 4JV2A 4IH5A 3J7Z5 3NCQA 1T3OA 4ZDNA 2GIQA 1F60B 3ZZYA 3FNNA 4OYOA 1DQ9A 2BOPA 3PYFA 4OHZA 3BQ2A 4I7FB 4P52A 2BM1A 2NR0A 1HI1A 2AJ0A 1RHRB 3QWPA 2VH7A 3U1LA 2NZ6A 1X4AA 3PW0A 2I6PA 5I3PA 2HFOA 1WUUA 2D3UA 3AA9A 3AOBA 3PR4A 1RT3B 5KA7A 3T6JA 4USWA 2RDDA 1PBAA 4IG3A 3R8YA 2ALYB 2HK2A 3B4MA 1PKUA 4P2XA 3ZL8A 2J6TA 1NPPA 3TZYA 3HX9A 2FUG9 2QLBB 2CDRB 2DNYA 3TUPA 4O44A 4C0BA 3GCWP 4ILRA 1CJKB 4J91A 2QLJB 4DSKA 1KR4A 4DV1F 2DHXA 4F02A 3EVOA 1MMDA 3L3CA 2WHOA 3O4TA 4DF4A 4ZPVR 2PI4A 2OI2A 5DO2A 3M1VB 4B9MA 1RAAB 3SMEA 3CPWR 2RDJA 2MKKA 2VG6A 1TUGB 1F3VA 4J9SA 2ZM6F 1RAIB 3MCOA 3DMJB 5F0UA 5L38A 2DXEA 1HWIA 4RW4A 1HI0P 2H65B 1AFJA 2GQQA 3QJJA 4LF9J 1FI4A 2CQ1A 3OSNA 2XWXA 1EHWA 3AY0A 2VL1A 2CQHA 4NLPA 1S79A 4BPCA 3D6FB 2A8BA 4ZVPB 2J7KA 3ZXWA 5GAHI 4FPIA 2CVEA 4EU0A 5IT9Y 2ZOFA 1KS2A 2F9JA 1EP4A 1RHJB 3BKUA 2DNHA 3BZQA 3S4EA 2Z58B 3H20A 2W9AA 2W25A 3HPOA 4ECWA 2WVBA 4OYIA 2J0QD 2DGUA 4DQRA 2CADA 2GGPA 1ZM3A 3HHEA 5AT1B 3OHBA 2VORA 2ILZA 2MKHA 3PRVA 3LWMA 4JI6F 2B6AB 2I4EA 3BGFA 4IFVA 4DR4F 5ETVA 2UAGA 3DNCA 1C4CA 4WE1A 4OZ0A 2GO9A 5CYMB 3CD6S 2G4BA 4CO3A 2CIMA 2VJUA 1N48A 5KT7A 2DT9A 2IVFB 4NE9C 5KFDA 2IPOB 1TU0B 1B99A 1HHSA 1VRTB 4NLTA 2AGPA 3OUYA 2NUUG 1PTTA 2UV8G 5CH7B 1ZM2A 1UMJA 3IMQJ 1IJFB 2F7VA 2OPRA 2MZTA 4RUBA 3KUHA 1C86A 2IJRA 2MB0B 1F1BB 3BS9A 5KFIA 2Z56B 3PEJA 2OZ5A 3MR6A 1L3TA 1VJQA 4X84A 1EZZB 4NXMF 2UXDJ 2FTRA 2B4UA 5KT6A 3ZNUA 3LJ8A 2ABYA 1TP7A 4J9KA 2RHQB 1B0PA 3CJ5A 2RQ4A 2YKOA 4CLSA 2MGZA 4QAHA 4RKKA 1E8CA 3PRBA 1JBWA 2F3JA 4H4KA 3HFVA 2BA9A 4BWMA 5B0FA 5KT3A 4ED0A 2Z4PA 4K5SA 4K50A 3T5LA 3DGVA 2M7SA 4CO5A 1WD6A 1N34F 3ZV2A 2D9PA 2G0JA 4OL8A 1S1TA 3QCEA 5KG5A 3GJSB 3AD7C 3GV8B 1Q86T 2F40A 3AA8A 4EYIB 4NLVA 1R0AA 4PYAA 4HJPA 1WHVA 2HWTA 2B4OA 3P96A 2WTZA 1UVLA 1IWGA 3LTOA 4J9PA 4DV3F 3LGMA 4IRCA 3RRHA 1LWXA 2X3DA 3VAHA 4IFYA 2OPSB 4Y65A 1VQLS 1CEZA 1XC9A 3TJAA 3CB4A 3OTCA 3I82A 3FSIA 2IMOA 4ZCLA 2UVWA 2YNFA 4O23A 3FCHA 3JTPA 4PXBA 5GAEI 3JYTB 4CVMA 3CIZA 4RBVA 4NOHA 5LSLA 4M5MA 4K4TA 3VZIA 1CS4A 3IS9B 4M5NA 2VFRA 2QSFA 1UFKA 4LFCF 4ES1A 1T8EA 4CRJA 3TQ1A 3W2WB 1OMSA 4HKQA 2NS1B 1TAQA 1Q7LB 4RWWA 1FX4A 1YKWA 4C7QA 1A5YA 4XK8C 2MY7A 3VQTA 1S0OA 2HHHF 4DR2J 4PEOA 3N4WA 2KFYA 4Z6BA 4ZP9A 2UVUA 2FVQA 3HHLA 2FJEB 4FNIA 3IAS9 4F4XA 2G2ZA 4OZ5A 2ZH9A 1RUSA 1ZCLA 3DOKA 4R25A 1PYTA 2IM0A 1CJUA 2CPHA 3DLJA 4QIEA 4OJ1A 2RQMA 3PNIA 3PIOQ 4C8OA 3GB0A 4F8RA 2I0XA 3JTOA 3T1HJ 3ULHA 1IM4A 3GP9A 4DU8A 3IWLA 4DQQA 1T9YA 2DGTA 2EG2A 4G1QB 1HNZJ 2E1CA 2M70A 2OP5A 2MEWA 2EVZA 3CF5Q 3A3OB 2R3VA 4LSNB 3HHKA 3DU5A 3DLGB 1QAXA 3J7YI 1KFDA 2MQOA 5FJ4A 3I0RA 3EVWA 3TANA 3DDIA 1EAYC 2PIIA 2HAIA 2FJWA 4LQ9A 1BWEA 2Y66A 5A2QY 2C2ZB 1JLGA 2BJ1A 4OYAA 3MMAB 1JKHA 2I42A 3K8WA 3OW2R 4A8KA 1EB0A 4DV2F 1RYRA 4B3OA 5EHHA 1V3AA 4JYAF 3RGQA 1LWFB 2DGVA 1X4BA 2RIJA 4EK2A 1WF0A 5C5JA 1C85A 3TZZA 2FJDB 2F4FA 1TTHB 2ASJA 4RI5A 3KJVA 4LF6J 2VQFJ 3NGUA 4MKBA 2XCPA 1ZPWX 4TYBA 4PXEA 2HVZA 5KA3A 4DL4A 1F6TA 3UNGC 3IGVA 3QCZA 3PY8A 2V9WA 3NNHA 4G1PA 4YQWA 4Y14A 3PW5A 4F4YA 1FFSB 3VV2B 3US5A 4ZHRB 3M2RA 3MAQA 2L9NA 1DARA 2KDOA 1Q53A 2XTJP 1KN6A 2VC0A 4UOHA 2HG4A 1U47A 3S4OA 3LP0B 3TAMA 5FLXU 2WVCA 2X5OA 4A8OA 5KA0A 4C8MA 2N4DA 2VPYB 2E29A 5KFVA 3POTA 1M1HA 4DG1B 3DRYA 1A0OB 1QUPA 1UZHA 4TLQA 5KFLA 2JC0A 2JVOA 1SUQB 1UPPA 1EENA 4MYTA 3D0IE 4GRSA 2W1BA 3Q8VA 2I5JA 2CA9A 2BV3A 4DBQA 2I6JA 2GP0A 3N9UC 2NREA 1RTZA 4YHHJ 4LFCJ 1WNEA 2W01A 4OYPA 3MMBB 5F41A 1L3UA 4UOFA 4NX8A 3BSOA 2W2MP 4A8MP 2HWHA 3OT9A 4RX6A 2FYXA 4CLWA 2R2TA 4OX8A 3B8HA 2B4VA 3MPVA 4GO7X 3UWTA 2A2DA 1MU2A 1MSWD 1VQ7S 4NEYA 5KTQA 4F3OA 1T03A 4CLUA 1XXVA 2KG1A 4ICLA 1WRMA 5GADU 4XPCA 2VTDA 3M8PA 3NBPA 3OFGA 4UY8T 2DB1A 2RKIA 1LEOA 2W8LA 3EAXA 2M5YA 2A3JA 2FJBB 4RUCA 4V1Ak 1R6HA 5B08A 3G82B 1UP1A 2VFSA 2MQPA 4F4WA 4HI1A 1UKUA 4K4VA 4YEAA 3QCHA 1ONYA 3PYGA 4J9VA 5C25A 4YR8B 1Q6MA 4I64A 4TVAB 1S59A 2F71A 4K7QA 2CZ9A 1Q6PA 4EGLA 3NMRA 3SCLE 3IR5B 4JYAJ 4ZLLA 3G8SA 1P9YA 2HB1A 3Q24A 2CNIA 2CQBA 4LFBJ 1CULB 3N6LA 4G6VB 1NHKL 2XMJA 1RT2A 3MOJB 3D44A 2HS3A 4IUFA 3W64A 5I42B 1OPZA 1LARA 2ZDOA 2I4GA 1MROB 4RO0A 1I94F 2RRAA 3QZ8A 1P8GA 1YGUA 3TUZC 2Y1RI 3A4TA 1S7HA 3R5BA 3CCLS 1JLFA 3RRGA 2K7KA 1OEVA 2GWOA 2P4DA 4LFAF 2DIUA 2PMHA 4UUWA 4BS2A 4OJGA 4B3SF 2BZ2A 5DG7A 4DV6F 3OSPA 3GPAA 2GCAA 1HBNB 3BPSP 5ITHA 2BQRA 3NL0A 1FX2A 4FN5A 4ZS6A 2WAQD 1D8ZA 3JAMY 1VK3A 2GV1A 1IKWA 4BBYA 5CABA 1JBVA 2Y8YA 3V4IA 4ZVOB 2U2FA 3DN9A 1WKLA 3MHYA 2C2NA 4LR9A 2BVZA 3OTDA 5F8JA 4YAAA 1NHVA 4I6WA 4Y2IA 3IAM9 2CMCA 3ET6B 2F6VA 2V94A 2V8DA 2E7WA 4Q7AA 2B56A 2QO3A 3PYEA 3VCDA 1NJZA 2V5HG 4OHWA 2LVWA 3RB4A 1KLNA 4QQBA 2ZD1A 3WX4A 3NRBA 2ZEJA 3KJFB 4Y0FA 2JLFA 1JXEA 4FDFA 1OEMX 2HGLA 5HP1B 2RRBA 4CYUB 4NWFA 3D6TB 2IHR1 3FBEA 3GJRB 2Q43A 4KQZA 3CJSA 4CO0A 2OKQA 2V4QA 2BDPA 1YJTA 4DV5J 4WZQA 1Q1KA 4J90A 3QRRA 1U0HB 1JLBA 2GVDA 1FWPA 3GYNA 4DZDA 2JFFA 5L9NA 4NYPA 4E8UA 4EBDA 2B51A 2ZWOA 2WVFA 5KFNA 1WEYA 2KTQA 1TQLA 4KBIA 3L7UA 5T41A 4CH1A 4FS1A 3CDUA 2UP1A 4PYDA 2Y8WA 6FD1A 2NT7A 2MMYA 3HD1A 2C3MA 5HDEA 2JHEA 2Z2MA 5K8PA 4H54A 2JEGA 2CVIA 1RT6B 1O51A 2W4CA 2AX1A 2OPQB 1AROP 1Q5YA 1OPIA 3M32B 2CUYA 1G7GA 3CDEA 4L72B 2PD1A 4OYMA 3U27A 3HJVA 2I1RA 1X4CA 2GX8A 4EO8A 4FXDA 4YR2A 3G71S 3FVYA 4XTTA 2HNPA 3L9ZA 2BW7A 4M5KA 4ATNA 2VA2A 4Y2MA 1WI6A 3DOMB 1QXKA 2I5XA 2XLIA 1HR0F 5T7LB 1VC0A 3CCZA 1RLCL 3OPKA 3THTA 2DNPA 3VALA 4A8FA 3ILIA 3KK3A 2D41A 4YN3B 4CDIA 5AWXA 1C84A 3I7ZA 1JLCA 4QOTA 1R0BG 1TAUA 3QBCA 4LF7F 5A0YB 4B3SJ 4MT1A 2VHGA 3IBWA 3OR2A 2V4RA 3CDBA 3SXLA 3TUIC 5HMWA 2ZH1A 3QRPA 4MIBA 2HRYA 2OOQA 4IG0A 5HBMB 4MFBB 1UW9A 5AXMA 1S1VA 3MCSA 1VQNS 4I2QA 3O3LA 1NKEA 2ZJPQ 2EC0A 2A1BA 1NXIA 3R2CJ 3T41A 1YJUA 1YJ7A 2RU3A 2XMUA 1I57A 5CAAA 1H3DA 2P6XA 1FTCA 1XNRJ 1IBMJ 4YY3F 5HQMA 2CFXA 1BQNB 1BZHA 3RAXA 1X5OA 4N8NA 4W92B 1F9HA 4GC6A 1HYSA 5IQQA 3GSIA 2AZ3A 2HSEB 4NLRA 1Q8LA 4OHHA 3CJKA 1TKZB 1TV6B 3BB5A 2HY3A 3P45B 1WG4A 2D1CA 4Y34A 3D0HE 4DX5A 1I5OB 2C3PA 2RUSA 3HVWA 3MFIA 2FZCB 1FK9A 5G0RA 2C2EA 1WHXA 2DR9A 2JZ5A 2AM1A 4ED1A 5D0RA 2B7CB 5KFHA 4L6V3 3M8SA 3RW7A 1HWLA 3D4JA 1R6VA 3CJ0A 5CYQB 2BMBA 2IYGA 3DRSB 2AYMA 4J5OA 5IZHA 4WFNQ 2V2ZA 3MM6A 1ELOA 4IDKB 3MF5A 2ZOGA 3AQPA 4ECUA 1YIJS 2PQ5A 1DHMA 4ZKAA 3AWGA 2CJKA 3N5FA 1YK9A 4RLEA 1PTYA 1ZC0A 3C6UA 4O3QA 2B5JB 4ZPWR 3EZ5A 2JFKA 2XZDB 1VQ9S 1U0SA 2OH2A 2QA4S 1AZSB 4W98A 1HW9A 2F6ZA 2H5EA 1QJHA 2QA2A 2R7SA 3PX0A 1NUEA 4XDDA 3L09A 4DCJB 2YPYA 3GV7B 1NLKL 2RHSB 2MLXA 2RU9A 4X62J 3A5KA 1Q8BA 1ECVA 3CULA 2O3DA 2ROGA 2IYIA 4O3PA 1DTTA 1T05B 3BPDA 5KA1A 3U7JA 3I80A 3PXGa 3IC1A 3R6LB 1Z4UA 3FFIB 4B3RJ 2F63A 2KN4A 3C16B 2P8IA 2JC1A 5KG2A 1BHNA 1UAGA 2M8HA 1GEHA 1R3NA 1YX2A 1X4EA 1AW0A 2OEMA 2Y9HA 3ENVA 2MLZA 5A8WA 3FSYA 2QX0A 2KT2A 1EJ7L 1G1XA 3ZM1A 2RS8A 4QU7A 4ED8A 3MCMA 2AT1B 1TL1B 2FZGB 2YWWA 1UVJA 3I5BA 3SQGB 3V81B 1NSPA 2ZDPA 2VG5B 1U2CA 2AJ2A 3QYYA 3N6MA 3ILOA 2YX7A 4LVNP 4LREA 2DHSA 5FDLA 3O1LA 1S1UA 4ZVEA 3IRXB 3M8WA 4J51A 1DJ0A 1G4US 5F8GA 2PE8A 2GAGC 2E9RX 4WP8A 5GTJA 4O0IA 4IOBA 4NPOA 1HNXJ 4LR7A 1RGVA 2HHQA 2EXUA 1RCXB 1LFPA 1R0CB 1PO6A 3QT5A 2CWXA 2XNQA 3MD3A 1F0XA 4TY8A 3V6DA 3PTWA 2DR8A 3H7HB 5A5FA 4P6QA 5IC6B 1NH7A 3I87A 3M9NB 3D67A 3AFGA 4N47A 4C8LA 5HJXA 3MPYA 3NNAA 2BKPA 3N0AA 1H7XA 1U25A 4UZBA 1VJWA 2DGQA 1FRKA 1RWVB 1NSQA 3ITHA 2D69A 3OTOF 1N32J 4N8OA 4NXNF 3RB0A 3CEDA 5U47A 4RZRA 1X5TA 1N36F 3B78A 3A8EA 2KO1A 3BLTA 1DLOB 3KK2A 4HTIA 5EWGA 1PXHA 4FVMA 5CCLA 1KQKA 1QVGR 5J1PA 4CM0A 2Q6BA 4LIWA 4GWFA 1T9WA 1LK5A 1XERA 1YGRA 3SFUA 1RT7B 1YVFA 4DR1F 1X5SA 2GHWA 4ZN1A 2CPZA 2EWHA 4OQJA 5CYJA 4Z37A 4WCEQ 2H4VA 2ZBRA 2E66A 2HGMA 1N5YA 3M2UA 1QM9A 1TL3A 3RBDA 3D3BJ 2KJVA 2RAQA 5KG6A 4P10A 4JI2J 2BJ7A 1BC6A 2NYIA 5IWAF 2KXNB 1GXTA 4Q43A 3P5TL 1WOOA 2AD9A 3ZMQA 3ZTOA 4F7VA 1D9AA 2IA0A 1XMOF 3Q2SC 2HFNA 4QCLA 2GQ2A 1S0NA 3W66A 4RH5A 1VS3A 1N5SA 4DWIA 2MKJA 2IM3A 3CM3A 3DCAA 1ZZWA 1R8BA 4TKTA 3B54A 3TA2A 1SPBP 4DUYF 2UUAF 3AB2B 3DRPB 2IFXA 4QYRA 3IWXA 1RE1B 4ED5A 3BBCA 4QU6A 1SKWA 1L8KA 1JB0C 1ZOTA 2YX1A 3M6XA 3KWMA 3G6XA 1PGZA 1OEOX 3F99A 2JH3A 3WIVA 4X4QA 4KI9A 1NKCA 5E0OA 1HARA 1FJGF 2Z30B 1RXOB 3H25A 1RKIA 3MEDB 2DNLA 1YJNS 4C12A 2FZKB 4Y2CA 1R8AA 4RW8B 4LSLA 1WCHA 1XIQA 2VDHA 1Q0NA 2D9OA 3PJ9A 3V2UC 1KHWA 4DLEA 4Q0BB 1MKPA 1KONA 2J5AA 4HJQA 2W9BA 2L9DA 3EGZA 1SH0A 2HVDA 4NMXA 1G7CB 5D15A 3O2IA 4DR7F 2FHJD 2FY8A 1ONZA 4PPDA 3M4UA 4JI5F 3H2VE 5D6GA 3ZM2A 3FDSA 2ZN7A 3HF5A 2DNZA 5J1NA 1VBYA 2WSCC 1WC6A 1YWXA 1PJ7A 2EBEA 5RUBA 1N88A 5JXSA 2F8HA 2K3KA 4B17A 3ZM5A 1G3OA 4P75A 4JUZA 2WB1D 3DHXA 2N82B 1WSRA 2IRUA 1VQSA 2D7SA 4C3MA 8RUCA 1X0FA 1F5AA 2VU5A 1T02A 3TQEA 1FRLA 3QO9B 1S48A 4CO4A 3QAEA 3AAWB 4KV8B 2HNYA 1KQGB 4I8NA 1FNMA 5KFQA 3BGUA 4M5GA 1N0UA 2R8KA 1K1SA 1FD2A 4USUA 5J2PA 1EQ0A 1RHKB 3ETMA 2DGOA 3KG4A 2Y0BB 3OFHA 1RA7A 4RW7B 1RT5A 2IM2A 3MAAA 4DV7F 2P5VA 4KHPJ 4CWBA 3BLUA 4ECXA 4DSJA 3QAUA 1Q8KA 4PWDB 2J0SD 1RACB 3OR1A 4IOCQ 5F8LA 2XGQA 2JEIA 5B0EA 2H02A 2LQBA 1FJEB 2YKMB 1D5RA 2W24A 1JLEB 1FXLA 1D3WA 2R9LA 4DQPA 1BGXT 3DM2A 3AJ2A 3UCUP 2AV5A 2E9TA 3K89A 2GMLA 3S3KA 1XQIA 5D3GB 3W63A 3TOQA 3I0SA 4NZ6A 5BR8F 4QW9A 4AZ1A 4NLSA 5KFRA 4GRYA 2V0NA 3RW6A 5E3AA 4GKJF 4DUYJ 2UUAJ 1LWEB 2ZMMA 1SIZA 3CCQS 4ED2A 2DEJA 2LDIA 2UU9F 3NLCA 4FF2A 3BO2A 2XMVA 3P4UB 2OUGA 2ZJQQ 1YJRA 3EMTA 1T0TV 1HNIB 4DR3J 1SI9A 3GFZA 3ICLA 1LWCB
chains in the Genus database with same CATH topology
1TL4A 4FPRA 2MZTA 4QIVA 5DDOC 2UXBF 1C86A 4CT9A 1URRA 2MB0B 2G59A 3BS9A 4L3NA 4F3MA 4WTYA 5KFIA 3V4MA 1VQMS 2KH9A 3WC2A 2ZE2A 2YNGA 1LXJA 3BSCA 4J9NA 5K14B 1S9GA 3GWCA 2RMLA 3V5RA 2X1AA 1V3ZA 4Q5VA 1SKRA 2I4HA 3K7RA 3PEJA 2OZ5A 2EPIA 2XLJA 2X51A 3MR6A 3PW2A 1L3TA 2OPPA 2XWYA 3KHLA 4IG3B 3H5SA 4UOCA 4X84A 1R8PA 4NXMF 1FRHA 4Y00A 2FTRA 2K1RB 2B4UA 3POTB 4DHVA 2MJUA 5C42A 2K8GA 1T49A 2EI5A 1X8DA 2DHAA 5KT6A 4LQ3A 4O3SA 3MOWA 4FS2A 3MM9A 1FKAF 5DGBA 3LJ8A 2M52A 2B9YA 2ABYA 3C6TA 1TP7A 2YNHB 3H4DA 1MW7A 3VTIA 4J9KA 4O44B 1SJQA 2WK4A 4XDCA 1DQAA 5I3UB 3FEXB 1WAXA 1B0PA 2WONB 3CJ5A 5LXRA 2RQ4A 1WTFA 3FMWA 4LF5F 5MMZB 3MR2A 1W25A 2ZHBA 2YKOA 4I6AA 2MGZA 4JV1A 4K0KF 2M0GB 4QAHA 1NJYA 4RKKA 3ISNC 1H7WA 5AJ3F 2IC3A 3PRBA 4XIUA 4G1QA 2GQCA 4ID5A 2F3JA 3MM7A 4OZ1A 4H4KA 3UW1A 2DNMA 2XSJB 2GW8A 1SV5A 2BA9A 2P9GA 5HROB 3BGLA 4BWMA 5B0FA 2BV5A 5KT3A 3P3DA 2Z4PA 4ED0A 2FHJA 4K5SA 2C3YA 2VUGA 3MEEA 3FZBA 5IFMA 4OHDA 4LSNA 4DSEA 4K50A 3T5LA 3SSRA 2M7SA 5L39A 4M1KA 3DLGA 5C24B 3PO5A 2VKRA 2JX2A 4RW4B 2X1GA 4CO5A 4ECYA 4KHRA 1WD6A 3I4HX 5IT0A 2QA1A 2YNIA 1N34F 3ZV2A 4ZCIA 2D9PA 3UCGA 4ELVA 1XXPA 2IBKA 4ZPBA 1Y7PA 2VG7A 4OL8A 1S1TA 3GXGA 1YSJA 3QCEA 3UFCX 5KG5A 4KO0A 2W9CA 3Q8SB 1C1BA 4OX6A 3G6ES 2FDNA 2IMWP 3GV8B 2R7QA 1IKXA 2QBQA 3M05A 1AXQA 2JJ4D 1RT5B 3NKYA 4DQSA 1Q86T 1GTHA 1Y9OA 2F40A 3AA8A 4EYIB 2DD8S 2RDIA 4NLVA 1R0AA 3DLEA 3LWLA 3H2XA 4KB7A 1LK7A 3O5XA 2ZH2A 4HJPA 3O5TB 1WHVA 3OR1B 2HWTA 2B4OA 3HHDA 3P96A 3JSMA 3EPGA 3MMAA 1UVLA 1U48A 4J9PA 4DV3F 2B0GA 3D28A 2G13A 3LGMA 4PG7A 1KEKA 4RKUC 1UJ5A 1PSDA 1FXRA 2ZC4A 2V4JA 4AYBD 4IRCA 3RRHA 5J2NA 2KM8B 1EP4B 1KRPA 3VAHA 2DITA 3MEDA 2HC2A 1U26A 4DL6A 1FE0A 4KYRA 1VIOA 2RUGA 3PM9A 1FPRA 1LWFA 1Y3JA 4UUXA 4QR0A 4IFYA 2OPSB 2V8HA 4Y65A 1VQLS 4JBCA 1CEZA 1PH0A 1XC9A 2SHPA 3T3FA 2DGSA 3QMQA 4M95A 3CB4A 3NBPB 3OTCA 4U9RA 2WSEC 1VGYA 3I82A 3DM2B 4MYUA 4ZA1A 3FSIA 2I9SA 3BO3A 1WACA 2IMOA 2I3UA 1IQZA 1Y5IB 2E7XA 3JSYA 5KG7A 1P6TA 4ZCLA 5J1EB 1C4AA 2UVWA 2YNFA 1X9MA 4O23A 3FCHA 2GGPB 3JTPA 5E3QA 2HS4A 4PXBA 2RRNA 3B82A 5GMKa 1S77D 5GAEI 2QEXS 1XK8A 4Q2LA 3UCZP 4PUOB 3JYTB 4DJBA 2B3TB 3LH2S 1XBOA 3CIZA 2FLOA 4RBVA 4N41A 5E5NA 4IFVB 3H59A 4NOHA 5LSLA 2XG8A 2CMAA 4G3IA 3QGGA 2VPWB 4BWJA 1G4WR 4K4TA 1QUVA 2UUWA 1Q16B 2APOA 3VZIA 1ZH5A 1LW2B 1WEZA 2RE1A 1AAXA 3NAIA 3V0DA 1U7LA 3IS9B 1UL3A 1YBAA 1UVIA 1IKVB 2GCFA 2VFRA 4OMFG 2DXPA 4H1OA 4ZPTR 4QIFA 2DNNA 2QSFA 4R30A 4LFCF 4ES1A 4C98A 2VKZG 2FVPA 5BX1A 3SSSA 4Y6IA 1T8EA 2FJNA 1M5KC 2DCUB 1FTRA 1NWEA 1Q6TA 2HVHA 3M30A 3M8QB 4NWBA 3TQ1A 4RI4A 2OFHX 4I56A 4PQAA 3S8SA 3W2WB 4LF9F 2DH9A 2XLKA 4HKQA 2DTJA 2F8EX 2FY1A 4GE5A 2NS1B