2B4UA

Structure of the c252s mutant of selenomonas ruminantium ptp-like phytase
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
314
structure length
314
Chain Sequence
b'TVTEPVGSYARAERPQDFEGFVWRLDNDGKEALPRNFRTSADALRAPEKKFHLDAAYVPSREGMDALHISGSSAFTPAQLKNVAAKLREKTAGPIYDVDLRQESHGYLDGIPVSWYGERDWANLGKSQHEALADERHRLHAALHKTVYIAPLGKHKLPEGGEVRRVQKVQTEQEVAEAAGMRYFRIAATDHVWPTPENIDRFLAFYRTLPQDAWLHFHSEAGVGRTTAFMVMTDMLKNPSVSLKDILYRQHEIGGFYYGEFPIKTKDKDSWKTKYYREKIVMIEQFYRYVQENRADGYQTPWSVWLKSHPAKAL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords myo-inositol hexaphosphate phosphohydrolase
publication title Kinetic and structural analysis of a bacterial protein tyrosine phosphatase-like myo-inositol polyphosphatase.
pubmed doi rcsb
source organism Selenomonas ruminantium
molecule tags Hydrolase
total genus 99
structure length 314
sequence length 314
chains with identical sequence B
ec nomenclature ec 3.1.3.72: 5-phytase.
pdb deposition date 2005-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14566 PTPlike_phytase Inositol hexakisphosphate
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1690 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2b4uA01
3.90.190.10 Alpha Beta Alpha-Beta Complex Protein-Tyrosine Phosphatase; Chain A Protein tyrosine phosphatase superfamily 2b4uA02
3V0EA 4KYRA 1QZ0A 1MKPA 1Q6MA 2BGDA 3GXGA 4QAHA 4D3PA 1GFYA 4GWFA 1YTSA 1LYVA 2VEXA 1KAKA 1JF7A 5EHPA 2I75A 2I6PA 1Q1MA 1I9SA 3N0AA 2YDUA 2F6YA 5EHRA 5KA8A 1LQFA 2VEUA 4HJQA 4R0TA 5KABA 4WU3A 3SMEA 2Q47A 3ZM2A 3QCBA 1OHEA 4RDDA 5MMZB 4RHGA 2QEPA 2I6OA 2IMGA 2QCJA 5K9VA 3EU0A 3QCKA 1YFOA 3PS5A 4J51A 3RGOA 2HNPA 3QCMA 3QKPA 1T48A 3BRHA 3A5KA 1BZJA 1R6HA 3QCJA 3O4TA 1Q6JA 4ZN5A 1XRIA 2QDCA 3V0JA 4GRYA 2I5XA 4WOHA 2F6ZA 1OEMX 2I6IA 3S3HA 3U96A 3MMJA 1PA1A 2Y96A 4H1OA 3V0IA 2GP0A 3EZZA 4ZRTA 3D9CA 2MBCA 4KI9A 1VHRA 3SR9A 3ZV2A 3BM8A 2QDMA 3S4OA 2I6MA 2A8BA 4PYHA 5BZXA 3D44A 3QKQA 5KA3A 1C83A 2F70A 3O4SA 2HY3A 2I6JA 2CFVA 5KACA 1RPMA 3I7ZA 2I4EA 1C87A 2F46A 2CMCA 1V3AA 1YTWA 5M43A 3ZM3A 3ZM1A 4ICZA 1U24A 4GFUA 1QXKA 2FJNA 2SHPA 3QCDA 1LARA 2CM8A 2DXPA 2CNFA 1G1GA 2CJZA 2J17A 2OC3A 5K24A 4Y14A 5LXQB 4DGXA 3ZMQA 2PT0A 4YAAA 1PYNA 1AAXA 2F6VA 3ZMPA 4JBCA 4ZI4A 1XBOA 5K22A 1NWLA 4GS0A 1PTVA 3D1QA 2I1YA 3F81A 4Y2EA 5KA7A 1RXDA 1FQ1A 1G7FA 1PA9A 1L8GA 2JJDA 1Q6NA 3MOZA 4KYQA 4QBWA 3F9AA 2GWOA 2GJTA 1G4US 5I6VA 5KAAA 2PA5A 2AZRA 1OHDA 2F6WA 1NWEA 2J16B 2PI7A 1G1HA 3BLUA 2VEWA 1T49A 2H04A 3V0GA 1XM2A 2QDPA 3EB1A 2NLKA 3ZM0A 2BZLA 4NWGA 2RF6A 2NTAA 3QCIA 1YZ4A 2B49A 2ESBA 1L8KA 2CM2A 2OUDA 2B4SA 4GFVA 3RO1A 2ZMMA 4OHIA 1JLNA 2QBQA 3AWFA 4QUNA 1GWZA 2PSZA 3V0FA 1PTUA 2CNIA 2VEVA 2I3RA 4OHHA 2NT7A 2B4UA 2F71A 3QCCA 2B4OA 3RGQA 5IBMA 2Q05A 2Y2FA 4JNBA 3D42A 3AWGA 3OMHA 1T4JA 3RZ2A 1ZCLA 3AWEA 2CM7A 2H4KA 2OZ5A 2E0TA 2BGEA 3H2XA 3D1OA 1BZHA 1PTTA 2H03A 4AZ1A 2R0BA 2HB1A 3MOWA 4QUMA 2B4PA 1YPTA 4JMKA 2P6XA 3GXHA 2HC2A 2B07A 3QCLA 1EEOA 2CM3A 4WU2A 3I36A 1PTYA 2HC1A 3F9BA 2HNQA 5KA2A 2H02A 1NL9A 5J8RA 2I42A 4GE6A 1WCHA 3V0DA 2CMBA 4D3QA 3QCGA 5KA9A 1EENA 2G6ZA 4WTYA 3EAXA 1BZCA 2PBNA 3O5XA 4BJOA 2J16A 4HRFA 1X24A 2M3VA 5KADA 2I3UA 3CWEA 3QCEA 4NWFA 5BZZA 1YWFA 4I8NA 3S3KA 4S0GA 2CNGA 5K25A 4QAPA 1SUGA 1OETA 3LJ8A 1Q6TA 3S3FA 3BLTA 2P4DA 1XXPA 2WGPA 2G59A 3B7OA 5AWXA 4R0SA 5HDEA 3QCFA 3O4UA 1U26A 4OHDA 2F6FA 4B04A 3A5JA 2QCTA 1WAXA 1OEUA 3S4EA 2FJMA 4NX8A 5K9WA 2HVLA 3QCHA 4BPCA 4DGPA 1PXHA 4RH5A 4YR8B 3F99A 4TVVA 2VEYA 1OESA 1U25A 4NYHA 5KA4A 1ONZA 2I4GA 4RH9A 4QBEA 1G1FA 4RKKA 2C46A 3EMUA 4GRZA 1FPRA 2BIJA 5BX1A 4ERCA 2A3KA 1G4WR 5KA0A 4PVGA 3I80A 4OHLA 2NT2A 2FH7A 2CMAA 2H4VA 1YN9A 4IKCA 1FPZA 2CNHA 1C84A 3M4UA 1D5RA 1C88A 2F6TA 1ZCKA 3F41A 2QBRA 1NNYA 2OOQA 4GE5A 3V0HA 2CNEA 5K23A 1OEOX 1Q6PA 5IBSA 4GE2A 3NMEA 4HJPA 2B3OA 1M3GA 4H34A 4D3RA 3D1HA 1Q6SA 2HCMA 4NNDA 1ZZWA 1I9TA 1PH0A 1YGUA 1A5YA 4Z6BA 1XXVA 4R30A 2QBPA 1I57A 3O3LA 1NO6A 2NZ6A 1OEVA 4MBBA 2NV5A 2PQ5A 4OHEA 2C7SA 1C85A 3OLRA 1G7GA 1NZ7A 4RI4A 2HXPA 2I4HA 2ZN7A 3QCNA 2H4GA 2BV5A 5BUGA 3CM3A 2QBSA 2AHSA 1J4XA 1WRMA 1ONYA 1KAVA 1ECVA 1YTNA 1P15A 1ZC0A 4RI5A 1OHCA 4JMJA 1C86A 3S3EA 5KA1A 1YGRA 5GTJA
chains in the Genus database with same CATH superfamily
1F5CA 1MKPA 2HIYA 3TJAA 1WI8A 5A8WA 3ILOA 4OYPA 2OI2A 1JLEA 5DS7A 2RJZA 3P49B 1F5AA 2MJNA 2VJVA 2HBRB 1P27B 3HSGA 4ZVHA 4PPDA 5L9XA 1QD1A 3QCBA 3KXDA 3ZZPA 4NXNF 1SB6A 4C8NA 1HI0P 3QFHA 1HNWJ 4LMZA 4OI3A 3IP0A 1EZZB 3DRSA 4DN0A 2VB6A 5D78A 1U0HA 4JI6F 3HHLA 2VG6A 2UVVA 1AW0A 5DG9A 2ZC4A 3NMAA 3LF0A 4GRYA 1S10A 1Y3JA 4WFAQ 4OLOA 2LXIA 3MMJA 1B4SA 3MDFA 3KLFA 3R5DA 2R7UA 2OPRB 2MBCA 3M6XA 4DQPA 2F8MA 1H72C 5J2NB 4NLPA 3S4OA 2I6MA 2E5GA 1FGSA 1JLGB 4FS2A 2DO0A 2KYXA 2ZDPA 5JMNA 3DLLQ 4ZP6A 1YI2S 1CG2A 3FQKA 3ZM3A 4DPXA 2HQGA 3M8ZA 1JLFB 1UW4A 4LQ9A 2ZWOA 5IT0A 3UAGA 1E6VB 5K8MA 4B3MJ 2CJZA 4G1IA 2FB0A 3T6JA 3I0RA 4ENOA 3GU0A 1P8GA 4EBEA 1IWGA 1X4FA 4O3RA 4F04B 1RAFB 1NJZA 2DEIA 3E3XA 3V5RA 4ECXA 2GJIA 3KKFA 4Y2EA 1WACA 1UFLA 1XIQA 1M1GA 4M5IA 4USUA 1E6YA 5GAEU 2APOA 1JLBB 5DETA 4CTAB 2AZRA 1TL1A 1JQGA 4UQTA 2J16B 3KHGA 1KDNA 1VRTA 1T49A 5JVGQ 1V6HA 3HFVA 4KPYA 4LR7A 2ESBA 3CW2C 1YTYA 1GX6A 3OPKA 1RAGB 3GQCA 2CQDA 3UVJB 2KZMA 1X9WA 1FKPB 3FGVA 3BSCA 4BDPA 3T41A 2OJ3A 1O5JA 2PFDA 4ED2A 1X8DA 4IQMA 3H0PA 3OFGA 1FJCA 1S0OA 1S72S 1MLAA 3CNQP 3BO4A 2J6SA 1U6ZA 4AQYF 4DG1B 3D42A 4PXCA 2ASDA 4FYYB 2EFPA 2H4KA 3CJQA 1LV5A 3Q0AA 5DLFA 4EO8A 1IBKF 3MVNA 3O1LA 2QEXS 1FD8A 2XLKA 1WOPA 3W5XA 1VFJA 1T7PA 3I36A 3LGHA 4ETXA 1YGYA 3MPWA 4X4QA 1PTYA 2JEFA 4GVLA 1VBYA 3T9NA 3CJ2A 4LF7F 4F50A 4C9DA 2OD4A 2QFJA 4ANCA 1CC7A 3HD2A 4NA3A 4A8QA 4F3QA 1VR6A 1S6OA 2F40A 3M8PA 3MAAB 3UQSA 2ZM6J 1FRXA 1VHIA 2Z56B 3KUGA 3C6TA 2K1RA 1CLFA 3QCEA 1CVJA 4DQSA 3PRBA 2UUCJ 2CPYA 3O6QA 3QT5A 3R6LB 3BLTA 5IWAJ 2M8HA 2FC9A 3T3FA 1PC4A 1YJRA 2HMIB 2LU2A 5A6PA 2WONB 3MM9B 1BWVA 1T11A 3ZZOA 4DX5A 1PIEA 4OJGA 3BDEA 4QBEA 1H7WA 2YH0A 3BO2A 2GQ2A 4AXIA 4UTGA 4OZ3A 3CCVS 3MR6A 2XO7A 2FDNA 4X64F 4KH0B 4ID5B 2HFUA 1FXRA 3HX9A 1NNDA 2N4DA 1RAAB 4WP9A 1C0UA 2P9EA 3RR7A 3CE8A 1GQYA 3KJNB 4KE5A 3ITHB 2GA7A 1OSDA 1Q1KA 1YGUA 2IA0A 2U2FA 1XXVA 4IRCA 1BHNA 3FFIB 3PZPA 1HFEL 4HHUA 4OZJA 2BEFA 2AX1A 3BBFA 2ALYB 3IWLA 2HRUA 4R8UB 4RU2A 4QR2A 5L46A 4CH0S 2WTZA 4OX7A 4USTA 1C1BB 4TXSA 1C86A 4JYAJ 3AA9A 4LF9F 1YGRA 2RMLA 4ZVUB 4QW8A 4OHWA 3GE9A 2ZC3A 1TQLA 3CJ4A 2CNLB 2I75A 2I6PA 1TKZA 1EKSA 1TZ0A 5EHRA 4UT4A 2R7TA 4DUZF 2OO4A 2UXCJ 4RBUA 4KC5A 4ELTA 1HBOB 2MKSA 4I64A 1S6UA 5D0GA 5MMZB 1VQ4S 3THPA 3N4WA 2DYAA 1EHWA 1S6PB 2E7WA 3NY0A 1T0TV 3V6KA 2RDIA 4DL4A 2MQOA 4U7CA 1R6HA 4FVMA 1ZAXA 3G82A 3IRXB 2LQ8A 3W60A 4P52A 2KFYA 2IY5B 1Q86T 3S3HA 3C2PA 3Q8RB 1IKVA 2MKYA 3OUYB 3D9CA 3V4IA 4BCAA 3ZZTA 1FJGF 3CJ5A 1WC0A 4OJHA 1E8CA 3I5AA 3O4SA 2R9LA 2RQCA 2I6JA 1I94F 2HZVA 2IDEA 4ECWA 1NAQA 4KFBA 4F25A 2WB1D 3NCRA 1H6KX 2ZNZA 2MZRA 2QMXA 2G2ZA 2VBWA 1X4AA 3X1LB 1S59A 1G1GA 1DTQA 4P7VA 2OC3A 4NMLA 3AAWB 2ZH5A 5LXQB 1YK9A 1REVA 2MTLA 3ICLA 1KQSR 2VG5A 1AAXA 2V8PA 4JBCA 3AOCA 2XS2A 2NPIA 1AFIA 4O4RA 3ZC4A 4MFBB 2KM8C 1SH3A 2AMCB 3W3SA 4DS4A 4DV7F 4RUAA 1FQ1A 2MLZA 4NA2A 3QAUA 1CQMA 2GAGC 4QBWA 3HKZD 5A0YB 1D9AA 4RW8A 3CCQS 2UUWA 4KBIA 4ZVPB 2UXBJ 4YP3A 4QYRA 4Q0BB 3Q8VA 4X65F 3MAHA 1FJ7A 4CZCA 4QJVA 2EG1A 3JSMA 5E5NA 4OYOA 4BHQA 4YQWA 4ECQA 3ZM0A 4LSZB 4ZLJA 5J2MB 4MKAA 2D69A 4AL6A 1N34F 3FSIA 3N5BA 1NUEA 4LF6F 4ECSA 3EPGA 1IKXA 2W24A 2GGPB 3MUMP 1U1MA 2FTRA 1AT1B 1Z4UA 3NS6A 3HVWA 2B4UA 2M8DB 5T7LB 1NK6A 3NNAA 4QW9A 2UVRA 4L6V3 4NWBA 1SL2A 3H2XA 1FX4A 1MN9A 1DJ0A 5IT9Y 5K8PA 1U8SA 4QUMA 3PR5B 1HW9A 5KFNA 3MEEB 4NYPA 4DOZA 4ZIWA 2PO4A 2HC2A 4ES3A 4XK8C 4S0MA 2JJ4D 2VC1A 3D6MB 1D9FA 3CDBA 5LMNJ 1M1KT 5KA2A 1SIZA 2I42A 4LF1A 4B3RF 2HNYA 3H4DA 2UXDJ 3KLIB 4Y2KA 3BQ1A 4WE1A 4DSJA 2AZ1A 3CMQA 3K8VA 3H25A 2M3VA 2CJYB 3VAHA 3JSRA 3SV3A 2YTCA 5DLGA 4AXJA 4EU0A 3M2VA 1NCLA 3LQVA 4DF8A 3RRGA 2E66A 2I8EA 2BM1A 2XHWA 1MMDA 2ADBA 7FDRA 1S77D 3FRYA 2G1HA 1LEOA 1TL4A 1A6LA 1RKJA 3CCTA 3CJ0A 4R0SA 4XO0A 1RAHB 5C5JA 2LXUA 3UD4P 2RNEA 4FYVB 3F99A 3V6JA 1ZM4A 1V5IB 2UU9F 5C42B 1I5OB 3DLGB 2BQ3A 1XNQF 4RH9A 3KNAA 1G1FA 2MLXA 3OR2A 4ZHRB 3PHTA 7AT1B 3C46A 2DTJA 2BIJA 4WYLA 4Q2LA 4DFMA 2V68A 2RU9A 4ZIVA 4I7FB 2F6TA 5AJ3J 2DB1A 3GCXP 3KMSA 2C2NA 3M7VA 1OEOX 2B3OA 3R5JB 3D0IE 4QIGA 4NNDA 1UPPA 3I5CA 5LSLA 1ZA1B 3DU5A 1U1RA 3P4UB 3EICA 3Q8UA 2WSCC 2F65A 1N5YA 3DRYA 2NV5A 2HLUA 2KXNB 3WC2A 4RLEA 5K8OA 2WTFA 4I6WA 1LNQA 3N79A 1NZ7A 3SSSA 3K0JA 2I4HA 3LP2A 2XYGB 5CYQA 5C7PA 5KFLA 3HFZB 2QBSA 2PEHA 3HHLD 4OHXA 1JKHA 2DKOB 4PWDA 4NLXA 1Q5VA 1OY8A 3PHEA 1RT3B 3MR5A 4JV2A 3ET6B 4X66F 1GFYA 2QLXA 5T14A 4OI6A 2MDAA 3HSJA 3P6YC 3T9ZA 4O44B 2VFRA 1C2PA 4CVKA 3AD9C 1S4EA 1GH8A 2BDPA 5JVHQ 3QNWB 1IUJA 3UDLA 2MGZB 2MQQA 1JLEB 4IFVB 1RAOA 2QLJB 2R7SA 5BR8F 2EBEA 1Z2LA 4OIXA 1APSA 1NH7A 1JB0C 3BRHA 2Z4PA 2O66A 2H4YB 3PIOQ 4KAIA 5KFPA 4ZN5A 2QDCA 3H98A 4DR1J 3OSPA 4UAGA 2MKCA 4A8FA 1BUXA 4ZLLA 4CRJA 3O8WA 3HHLB 1FWKA 3SYZA 4ZRTA 1UJ4A 3OW2R 4FVCA 3IWXA 4DL6A 2WVBA 2YWHA 5KA3A 2BACA 3BH6B 2AU0A 5LXYA 1S1TA 2XWYA 2QGFB 1C87A 1H2UX 2MYFA 2AKWB 2HBQB 2D3UA 2ASLA 3AT1B 1FDNA 1RWOB 3OD2A 1H74A 3C14A 2F3JA 1QAXA 4HI1A 2HW3A 4DR6F 4DV5F 1WDTA 1U4BA 3JTNA 1I6JA 1D8ZA 3NMRA 4LF8J 3K5NA 3R1HA 2YNGA 5G0RB 3RBEA 4P2SA 4YY3J 2QA1A 2MQLA 3C15B 2BRKA 2G9OA 3K5MA 4PG8A 3I0RB 5I42B 2YY3A 4C11B 1F5BA 3J80U 1JMTA 3GJQB 1W78A 4WBFA 4DPWA 2VDIA 3D54A 5LMUF 1F6TA 2C1EB 2HHHF 2I9SA 3D7SB 1S79A 3R2DJ 3CCRS 2CJAA 2VEWA 4TY8A 4OZNA 1UP1A 3V0GA 1U6FA 2AWZA 4N41A 3DLKA 1F60B 2EFOA 1ULRA 2NTAA 2UP1A 2C22A 4F4YA 2HRYA 2Y1JA 3U7JA 2W4PA 4DJBA 2QBQA 5ETKA 2RF2A 3QJPA 2MSTA 2VQEJ 4C8OA 5HN0A 5FDLB 1HBUA 1SUQB 2J6UA 3DGVA 4PXBA 2ZBPA 3MEGA 2LEPA 4ECTA 1MROB 3AWGA 3T1YJ 2X3GA 2F63A 2Y1IA 1GXLA 2MQMA 2BGEA 3H20A 1RABB 1QTNB 4WYWA 2IAJB 1BWEA 4E0DA 1YPTA 4KHPJ 2R2RA 4B3OB 4IQXA 1JLQA 5HQMA 1I51B 4CYUA 1IWAA 1KLNA 4DFKA 1BE4A 2ZH6A 3H2LA 2FHKA 4J9SA 4EI2A 1KLMA 1HNWF 2GIRA 4U8YA 4G1QA 5B0GA 4F7VA 3M8RA 2KJVA 2A6OA 4NLUA 3MPVA 1RT2B 3RTVA 2BZ2A 1SH2A 2O3DA 1T9YA 4YR2A 1TK5A 2I3UA 4IG0B 2G0IA 3CXCR 3FEXB 2LQ5A 4KR0B 2IM1A 5JXSA 3MMBA 3DI6A 1OETA 1SPBP 4CO4A 1SJRA 2FHJD 4KKOB 3BGRA 3N6MA 5HMWA 2B8QA 1ZZNA 2FGCA 1UEKA 5ITHA 4MKVA 2R7QA 1ACMB 2HVLA 1ELOA 4WWSA 4DHVA 2HK3A 2F9JA 3I55S 2AEFA 3G8TA 2GC5A 1RT4A 1T02A 4F0MA 1RQ0A 2I5JA 1ZH5A 5HK4A 1UEUA 1S9FA 4ES2A 2E1PA 4B3MF 4P2MA 2KI2A 2A3KA 2F4FA 2YBVA 2ZUGA 1UWBA 3VTIA 3PXGa 5KAKA 3RJMB 1YN9A 1Y0HA 4RW4A 4ZP7A 2Y67A 2KKHA 1ZCKA 3G8QA 2YPYA 3EXYA 1H98A 2XY6A 3MPDA 1C1CA 4J9QA 4C4WA 3H7HB 2BJDA 3TX0A 3GMGA 2LXFA 4KJIA 5EX3A 2MSSA 2ROGA 2LEBA 5KFXA 4B9NA 2BW7A 4NEZA 2QBPA 5AXMA 3NNCA 3KUHA 3MZIA 5HVGA 2B4VA 2B43A 1CJUA 1GMUA 3QJLA 1KNZA 4GKJF 3BSNA 3DN9A 1C85A 1HBMA 2BV5A 1NHKL 1BQNB 4O3SA 2GMJA 3GV8B 2FVRA 1KAVA 3OBIA 1RAEB 5DG7A 3L3CA 4U96A 4ZPAA 2WSFC 5HLFA 1XNRJ 3J80Y 1WG5A 1FRJA 3KDOA 3UD5A 3OHBA 3GXGA 3DFEA 1KAKA 3VZIA 1QSSA 2DHXA 1T9VA 2G0CA 1CJVA 4X2BA 3V6HA 3OR1A 5KFSA 5CYMA 2KT2A 1SH0A 3FJ2A 4LT6A 1UVJA 3SMEA 1L5UA 2C3UA 2MY7A 4KY3A 4O3QA 3G6VA 1SQGA 2PMZD 3ZO7A 4J51A 3PS5A 4N8NA 3PVXA 2VODA 3IN5A 3FBFA 4MYTA 1F3FA 4DSLA 1VBKA 1K47A 4WOHA 2BUNA 1S9EA 5I3UA 4IOCQ 2FVSA 2GP0A 2ZM6F 3M6VA 3ISND 2QDMA 5EUHA 4NLVA 3G82B 3D44A 3CO0P 1X7VA 3RG6A 1KVJA 3AH6A 3CJSA 4QCLA 2CQIA 5IWAF 6FDRA 2Z0GA 4GFUA 1LW0B 2EC2A 1AZSA 1LARA 2QA4G 4MIWA 2CAJA 4B3TJ 2KT3A 3W7BA 5KG2A 1UMJA 2KFZA 3ZMPA 1EB0A 2YX4A 1CULB 4J9PA 1TMJA 1XBOA 1TFYA 5K22A 5GMEA 4GS0A 2DPIA 3M8QA 5ETVA 3KK1A 1WHWA 1DTQB 2FJAB 1REVB 1LFPA 5GAHU 3D6FB 1L8GA 4DSFA 1C4AA 2ALZA 2E5JA 4IO1A 3VWSA 1X9MA 3MOZA 4RUCA 1RLCL 2MHNA 1G4US 3SCKE 5I6VA 2W9CA 2XZWA 1L3VA 1IKWA 1VQNS 2OPSA 2AX0A 2H04A 3W64A 4HACA 2ZH3A 5BYRA 2NLKA 3JAMU 4RW8B 2FZKB 2DNMA 4ITSA 3QSYB 3LGMA 2NCKL 1G3OA 1VQ5S 2XZTB 1JLNA 3PYDA 2COLA 4L76A 3GCWP 2PSZA 5F8JA 3DLBA 4ICLB 4YB7A 5IS2A 1EJ7L 4OZ1A 1LWXA 4JYAF 2L9WA 3EPIA 1IKXB 1Q79A 4Y2MA 5E0OA 2IFXA 2ZOGA 5IV4A 3DGPB 3CCSS 1U47A 1WSRA 4J9VA 4OL8A 2OPPA 1R0CB 3NNHA 2ZH7A 4X62J 3MCNA 2ZVSA 3M2RA 1UZDA 2UXCF 2WJPA 5KG0A 1WEXA 2W2NP 1T95A 4DI6A 4F67A 3EUNA 3PR4A 2HS3A 2W25A 2DCUB 6AT1B 3QO9A 3QCGA 1HMVA 1L3SA 2KO1A 1VIOA 4NXMJ 2OPQA 3FEZA 3T1AA 1VRUB 5C2GA 1S1UA 3MURP 1KBRA 3X3UA 1LWCA 3PJ9A 2RAQA 4X4UA 4JI7F 5AXKA 1B0TA 1IM4A 3G6XA 4WXOA 5LSOA 2HIQA 4ZS6A 2A1BA 3DOMA 4FXDA 3V81A 2QCTA 1WAXA 1LWEA 5ETQA 1TAQA 3EMTA 3EGWB 1PXHA 4RH5A 4X4RA 2DY9A 4GC7A 1KS2A 2D3ZA 3W61A 5DM6Q 3OTEA 2BQUA 1XWLA 3MCSA 1RP5A 4ERCA 4DL7A 1NK9A 3BH7B 3I80A 1V9OA 2H4VA 4UZBA 1R31A 3CSKA 3BN7A 4ED0A 4MK7A 4OYMA 4A8OA 3SQGB 4K4SA 3M4UA 2RKIA 4PQUA 1NNYA 4WP3A 2FHMA 2ZHBA 3V0HA 4W90B 2CNEA 1LOUA 3I5BA 2M9KA 4NMXA 1PAEX 2XPCA 2XBPA 1LXNA 2H5IB 3RBXA 4EBDA 5HQLA 3MM7A 4HT7A 2GVZB 4RR5A 2DRBA 2UXBF 3O3LA 4QF5A 1RYRA 4O23A 3OFEA 2BM0A 4ZIYA 3MR3A 2L41A 2ZITA 4O4GA 2C7SA 1G7GA 4HHHA 2ZE2A 4ZVEA 1LFWA 3QCZA 5BUGA 2DNLA 4P72A 1N5YB 2HKEA 2VQFJ 1M90T 4KIAA 2NXEA 2CQHA 2KXFA 1TL7A 4JMJA 3RRHA 2DJWA 3S3EA 3MECB 3LP2B 1YBUA 2Z30B 2VICA 2VC0A 3QT7A 4UZCA 3B4MA 2BGDA 4PG6A 2BJ9A 1U1NA 1N6QB 2VEXA 3T5KA 1CPZA 2VL1A 5IZHA 3R6GB 2W2QP 1I9SA 1UCNA 5KA8A 1LQFA 5CHCB 4NLSA 1VK3A 4CLKA 3T1HJ 4K0KJ 1AFJA 4KV8A 2C2ZB 5F8HA 1Q5YA 4X4OA 4M5KA 4Z2XA 3N0VA 4ID8A 3BR9A 1NDPA 3RGOA 4N7TA 5LMNF 4RUBA 4ES1A 5IOLA 4JUZA 2OAUA 2QE5A 3PKYA 4ZPVR 1U02A 3PFEA 4I69A 2UXDF 3LPEA 4DSEA 2WVFA 2LCWA 3LOUA 5KFRA 1JXEA 4DZDA 1VJQA 1PGZA 1WEYA 2XMKA 1MU2B 1NJYA 3CD6S 5KFYA 3H2UB 2GV1A 2W8LA 7FD1A 4C3KA 1YWXA 2IYGA 3QKQA 1RT1A 3GPAA 4OI4A 3PYGA 3TX8A 1RISA 4P74A 1RXOB 4F2RA 1A0OB 3TWZA 4I6YA 3ZNUA 4C0HA 3E01A 3I9ZA 3DLEA 1RZMA 3GB0A 4DR4J 5CD4A 1DQ8A 1S1TB 3F56A 2CWXA 2ZD1A 4DGXA 5BJRA 3C14B 3TQ1A 1BQMA 4LFBF 3HLUA 1NWLA 4FF1A 3QJJA 3D0HE 5EGYA 4F3MA 4DV6J 3MWBA 4JI2J 3K5LA 2BE2A 2WRMA 4FXWA 4XIUA 3BN4A 1ZBTA 5AJ3F 4OX9J 5IC4B 1KR4A 8AT1B 2ACYA 4I2QA 5IXUA 1QE1B 2XI3A 4B02A 2FGOA 1SJ3P 4OV1A 2PN6A 3GYNA 4JI8F 3BREA 5B0AA 3DOKA 4DV3J 4J9KA 3PKMA 1R43A 3MCOA 2F7VA 2MQ8A 3IA0A 1CS4B 4TY8B 4CNZA 2FLOA 4G1PA 3DLKB 4CT8A 3TAMB 3I0SB 2IC3A 1PTUA 4WJBA 4B9VA 5KFHA 1NB7A 2HHUA 1DQAA 1O51A 4CQ1A 1OMSA 4MIAA 1JIHA 2KHDA 5IBMA 4DEZA 1QUVA 2XMMA 4DMZA 2FUG9 2MXYA 1I3OB 3HDSA 1BZHA 3MEGB 3CIMA 2Y1OA 1N0VC 3KFWX 3OTDA 1M5VC 1JLCA 4KHMA 4WU2A 3JQJA 3TUJC 1RT6B 2W01A 4BC9A 1B70B 3FKBA 5KG6A 3ILIA 2HNQA 2X1AA 4H4OA 1JLQB 4D3QA 2X51A 5HL7Q 4JI5J 3CIZA 4CYUB 4ANEA 1B7FA 3EAXA 3R5AA 1F2GA 4ZITA 4FDFA 1HWIA 1SV5A 3BB5A 5BZZA 2HURA 2PMHA 4Y0FA 1NSAA 5ETMA 4QOTA 3B7OA 3BGFA 1S0VA 4OHDA 1AB8A 4W4MA 5KT2A 5K9WA 4QIFA 2ZZTA 3QLHA 3DI6B 4BLGA 3KJVA 4LF4F 2VORA 5J2QB 3IGVA 1H73A 3V2UC 2YQ0A 2M5YA 4TU7A 1NHUA 3AQOA 2AYGA 4IH5A 4NRTA 3SDEA 1R6YA 2BJ3A 4ZN3A 1NO8A 4OHLA 2HK2A 1YJ9S 2DD8S 4ED7A 4LF8F 5KFFA 2I5JB 4WCEQ 1C88A 2FZCB 4YY3F 1SQEA 3R97A 5B0CA 3LW5C 2OTJS 1C0TA 5K23A 4QWCA 1PBAA 5LJ5Y 5D8HB 2AJQA 3RW6A 1UWBB 2CQGA 3HJVA 1N52B 1FK9A 2B5JB 2HSEB 4ZCMA 1VYAA 2CQ4A 5DO2A 2R7OA 1SJFA 2PQ5A 4RKUC 1YQHA 3BQ0A 3GIMA 2CDQA 2JFKA 2HHPA 2CYYA 4OFZA 3HCXA 3OVBA 1CJUB 3T6BA 2BABA 1P15A 4WPAA 1V5VA 2OTLS 4ZP9A 4C7QA 3FK4A 3OTOJ 3RGIA 1TKTB 4H4KC 2M7SA 1S9GA 3LANA 4ZPWR 3AD7C 2IRYA 3OQ2A 4FNIA 2FJWA 4HJQA 2CPXA 3FQLA 5HMYA 4WU3A 2R8GA 1RTIA 4B9LA 1WHXA 1X31C 4KHPF 2ATLA 2N4CA 3BYRA 4LF5J 3LO3A 2IMWP 2IMGA 1P31A 2QCJA 3OR1B 5CYMB 4HH1A 3QCKA 5CCMA 2W7AA 2V4JB 2KHCA 2QG9B 1M5HA 3CO9A 2DGTA 2UV8A 4QPTA 2CADA 2PEBA 1Y5LB 5EHHA 4USVA 2C2KB 3RB0A 2L3MA 3JTPA 2WVDA 1PA1A 1BMQB 1W7KA 1TKXB 5CCLA 2JFHA 1S99A 4N77A 3MTJA 3MUTP 4I4BA 5KFQA 2DR5A 2HLTA 3KLGA 1S9EB 5KG5A 4MYUA 2F8HA 4A46A 1WC5A 3GILA 1DAXA 1DURA 1RTHA 2H9ZA 4KO0B 4GKKJ 5D3GA 2ROPA 2ZZMA 4LR8A 2Y66A 1PYNA 4CCHA 4FBTA 3OFFA 2FPHX 2M2BA 2R2UA 5E41A 1AZSB 4QZVB 1ZAVA 3ZXWA 4O0IA 4DSIA 2V2KA 1F0XA 2GO9A 2B9WA 4B9TA 3SCLE 2J7KA 4LFAJ 2DGXA 3MPUB 3B54A 1YHQS 2MEWA 4NLYA 5A8KA 3G86A 1HNIA 3ZM6A 5D4NA 1WHVA 3GR0A 4PPZA 5KFWA 3M1VB 2QTWA 4BWJA 4NEYA 4CLYA 2XSFA 3DC2A 4QPXA 3AFGA 1QVFR 1UWAA 3C66A 3ILJA 3M8YA 1XM2A 2NR0A 3IAM9 1SKUB 4PG5A 3VR1A 4Y2IA 1PYOB 4FYWB 2V2QA 2RIJA 2OUDA 2IJFA 2B4SA 3JTOA 2V8HA 2J9DE 2OGUA 2UUAJ 4YR3A 2OPSB 2CPDA 3AXMA 5MLCV 3UN2A 1Z2ZA 4LIWA 2BE7D 5L1KA 2JFDA 1TU0B 3C16B 2UVWA 1NKEA 4DX8H 3KMQA 4DZ6A 2D9PA 4GC6A 1XNRF 2Y8YA 1S49A 2E5LF 1VJWA 1AUDA 1NH8A 4M5LA 4K4TA 3RB6A 2LQJA 2HGLA 2ZJPQ 3SI8A 5ETOA 2JH3A 4FBUA 4JMKA 2B07A 4NOHA 1SI9A 3K7RA 1K0VA 3MMAA 1HWLA 3R9LA 4A8XA 2QFIA 3V0DA 2OPPB 4F8RA 3ZNJ1 2XYPB 1XMOJ 2QA2A 4D3HA 2GO8A 3FCVA 2EFQA 4BJOA 4KGZB 4EYHB 4NI2A 3OJUA 5J1NA 3D3BJ 2VOOA 3SIPB 3W65A 5HP1A 4DV0J 1S1UB 2P4DA 4TLQA 3DOLA 5HDEA 1HQ2A 2HQ3A 1LWCB 3A5JA 5IC6B 3OJSA 3W63A 2PFFB 3QCHA 2DY1A 5KA4A 1NB2A 4TNOA 2GX8A 1GMWA 3J7Z5 3DOMB 1OY9A 3HZGA 3W9IA 3OXFA 2NSCA 3HHLC 5BX1A 4Q44A 4B3TF 3M8SA 4PVGA 3HI9A 3MM5A 1QJHA 2JRSA 2CNHA 3ZTRA 1VCTA 4YOEA 1MSWD 1U09A 3F41A 4ILRA 1N33F 1AROP 2XM3A 4NZ7A 2GHVC 3V6DA 4P10A 3S6EA 4ED1A 2WBRA 4ETZA 3VGVA 4JV1A 1HARA 1K8AT 1RCOB 1U1LA 4C8ZA 3OLBA 2HNZA 4OJ3A 2JSXA 1N5SA 2L08A 2YKQA 3UNYA 4KPCA 1WD6A 1F9FA 2C42A 4WIIA 4LSLB 2YNFA 2R2TA 3GFXA 2DXDA 1RKIA 2QA4S 2DGQA 3IM9A 2NZCA 1ZC0A 1RHMB 2XY7A 4J9NA 4NCGB 3VAIA 4M5HA 3JSYA 3IS9B 1FXLA 2SXLA 4RWXA 3VAGA 1LKZA 2E1MC 3TAQA 3K59A 4NLWA 3Q83A 3MM8A 1FKAF 4ZP8A 1TL7B 5L8RC 5DG8A 3SV4A 4F4XA 2NUHA 5KFVA 4ED5A 4ED4A 4K4ZA 5GAGI 3MOJB 2I6WA 2EWHA 2OUGA 2HFSA 1JJHA 1VI7A 4OZ0A 3I56S 1X60A 2MMYA 5T41A 1KN6A 1UVNA 4C8LA 2I6OA 1FNXH 3W9HA 2L9DA 4EBCA 2LA4A 1FFWB 4PRFA 4IDKB 1RWVB 3ZZ0A 4EEYA 3IAS9 4XDDA 1NZ8A 2XZDB 3PRDA 4NXMF 2BYCA 5D15A 4NZ6A 1URRA 2C3YA 1VK8A 2DVIA 3PIPQ 3R5BA 3VF0B 4QR1A 3JQMA 4PYHA 2K2PA 3FBEA 1FJEB 2HFNA 2RB7A 1HBNA 1T03A 3CGIA 1C83A 2F70A 2RHSB 2HY3A 2X1BA 1LWFA 2BKOA 2BA9A 4Y00A 4AL7A 2HZCA 1PSDA 4F2SA 3BQ2A 4FKXA 3I4HX 4DQIA 2EKNA 2CM8A 2DHAA 4DS5A 3TZXA 2V4QA 2P8IA 5K24A 1TVRA 3IC1A 2DR6A 1QDUB 4DR5J 3CJTA 3BS9A 4E98A 5KG4A 1RU2A 2BKPA 3AOAA 2DITA 3HHEA 5LJ3Y 1YJNS 3VV2B 1DHMA 2GS8A 2VG7B 2AEJA 2ZD1B 2H48B 2GCBA 3J7YI 1JXLA 1NBEB 3A3NB 1OQ3A 1S1XB 3UI3A 1N36F 1BQMB 4QWAA 2C3MA 3WX8A 2PA5A 3R2CJ 3NWGA 4JI0J 5HBMA 1G1HA 3Q22A 3Q8YA 3CC7S 1B3TA 1HPZA 3HULA 2WOMA 2FIUA 5F8GA 4DLEA 3GJRB 2PI4A 4XPEA 2NSBA 1L8KA 2CM2A 3PY8A 4IH6A 1KOOA 1R3NA 2JEJA 2GC8A 2E5HA 2DIVA 1L3TA 1U2RA 2ILZA 3QGGA 1UW9A 3NEKA 2B0GA 3IG1B 2M0GB 4Q7AA 1WELA 2OFHX 2VJUA 1OO0B 1R7IA 4PYDA 2B4OA 5D77A 1O5ZA 3W2WA 2R8KA 2MJUA 2DR8A 5C24B 4EZ9A 2FLPA 4Q8EA 2WCXA 2R0BA 1Q16B 2HB1A 3G6ES 3QMQA 1FVSA 3NGSA 1HL6A 1RTDB 3TUIC 2OELA 2V63A 3D6HB 2IPOB 3NGUA 3HVTB 1W7WA 2HBZB 4J91A 2POKA 3TR5A 5H9EJ 3T1HF 3D68A 3G71S 3F9BA 1PG5B 1IBMF 1WCHA 5IM0A 4P73A 3C3LA 2Y68A 2W2PP 3US5A 3FZ2A 1MW7A 1X24A 1HHQA 2DXFA 5KFAA 4H4OB 3W62A 1RTZA 3AJDA 3M2UB 2YNIA 3H59A 3KDNA 3NS7B 2H54B 2DBBA 4QAPA 5IT4A 4ELUA 1HNZF 4ZOSA 3ZTPA 2BANA 2AM2A 1TV6B 4NCBA 4NX8A 3R27A 2GIFA 4TVVA 1RUSA 1FT8A 2I4GA 1DTTB 3T5JA 2IVYA 1S1VA 2Q66A 2CZVC 2C46A 3PCOB 4DR4F 3TP2A 1E0DA 1SL0A 1REGX 3A12A 1HLWA 2HNDA 2VV5A 2IVFB 1N32J 2CMAA 4JI3J 2JWNA 5HMXA 4J9LA 1X5PA 1FA0A 4RW9A 4OLPA 4Z37A 4RNNA 1VC0A 4M95A 1SKWA 4RW6A 2QBRA 4DV6F 4OYWA 5M2PA 3RB4A 2BX6A 3U1NA 3PW2A 2HQFA 3VAFA 2XYHB 3J7AN 4IG3B 1M3GA 4CNYA 1FRLA 3DYAA 2G2YA 3MUVP 2A0FB 3D1HA 4OX9F 1Q6SA 4UUWA 1HWUA 2QMWA 4R30A 1RWKB 5DGAA 2NYHA 4TQRA 2B9XA 5I4MA 4TVAB 4JI6J 3IM8A 2HAFA 4B3SF 1RCXB 3FCHA 2V50A 3IBFB 1RWUA 4DV3F 2YWWA 1T05A 2FC8A 2NPFA 1RWXB 2V94A 2E1AA 3OXLA 1D0EA 3FBBA 1DRZA 3NKYA 1IKYB 1OHCA 1PYTA 3VQSA 1NSPA 2W4DA 5B0EA 3NBPA 2QN6B 2VFUA 2YQ3A 5A8RB 3ISNC 4D3PA 4QDIA 2ACMA 4HT5A 3KLHA 3TUZC 1RA7A 2QSWA 1KVKA 3H4BA 4A8WA 1U48A 3PRVA 2YWGA 1SJ1A 2BJ1A 1U45A 3G87A 3IWNC 4M5GA 1SCJB 4FF2A 5KABA 2Z8QA 4A47A 2YKNA 1G4CA 3P8BB 3GV7B 3QZ8A 1Y11A 1X4GA 3W2VB 1FNMA 3EZUA 2LP4A 3U1LA 4K50A 1Q8IA 5K5MA 4CT9A 3QKPA 1T48A 2JFGA 3QCJA 2H65B 4ZVRB 3LAMA 3WZ0A 2ZJRQ 4KH1B 3RU0A 3JB9k 5KTQA 2YPZA 3TO8A 4JI5F 3ILLA 3O5TB 2XSJA 2W4CA 4DUTA 3M32A 1YRUA 2G1DA 3BM8A 3CJ3A 1UJ6A 3DMJA 4PEOA 4Y3CA 1K1SA 3I6PA 2DXEA 4J9UE 3GONA 2QV6A 2I4EA 1WUUA 2CMCA 2JZ5A 2XCPA 4P2XA 1YTWA 4RBVA 3ZM1A 5D0RA 1WORA 1U24A 4DDFA 2KRBA 2KN4A 3L95X 3VGSA 3OL6A 3KLGB 1HI1A 4H4MB 4Y14A 4USJC 3NGDA 2CQ1A 4UY85 1UFKA 2JOQA 4Q8FA 2F6VA 1ZS6A 4ECYA 3ZZYA 2VBYA 1PTVA 2KTQA 3ZZZA 2XC9A 1NPPA 3R8YA 2G2OA 1N54B 3OL8A 1IBKJ 4MJKA 2JJDA 1Q4RA 3AHPA 2I0XA 3CCUS 2RDDA 4HTJA 5KAAA 5KT5A 2GMHA 3GG0A 2JLEA 2EPIA 4K5RA 5I3QA 1HNXF 4LF7J 4LSNB 3CCWA 1RTJA 4R5PA 1S48A 2NZ4A 2V5HG 5A8KB 2QDPA 1QAYA 3GP9A 2RF6A 3DXSX 3FDSA 2V34A 2OLWA 2OPRA 2FJVA 2RU3A 5J2NA 1SJ4P 3I32A 1H0HB 1UAGA 2XCAA 2VEVA 1JLGA 4L73A 2KG1A 5GAGU 3QCCA 3RGQA 2I38A 2R4FA 3KJQB 4JNBA 1JLFA 2PA8D 3OTOF 3PDNA 4MAKA 4K4VA 2JX2A 5KFTA 3TEHB 4GVBA 1A9NB 2AYEA 1D09B 3SBMA 2XGQA 3R7NB 1WC6A 2MQPA 2B4PA 3R7SB 3KUEA 2YWFA 5IT9U 3QRRA 4Q2MA 1NHVA 5L38A 3G6YA 3QIDA 3OSNA 3UR0A 2WK4A 1UEVA 5HROB 2CKWA 4LF5F 4H54A 2D9OA 4XDCA 3BJYA 1TKDA 2M70A 2V69A 3H5YA 5DQHA 3GFHA 5DQGA 3ENAA 4R0EA 4A8YA 4BUCA 2FY1A 4CTAA 2OKQA 3MMAB 2J16A 3P45B 5LM7E 3FRZA 4UOCA 3UE2A 5EX0A 5KFMA 2QSFA 5KADA 2CZ4A 3RAQA 2UAGA 4DFJA 4IYQA 5D0EA 4O0NA 5DZ7A 3IBWA 1Q6TA 4YMEA 2R7VA 2HVZA 5AWXA 2VKRA 4URGA 3O4UA 1G1XA 3UVJA 1FKPA 5HP1B 2GVDB 2D41A 4C8YA 2HWHA 4A8MP 2DHHA 4WKYA 2EBGA 5E33A 4Y2AA 2DH8A 2R8HA 4DG1A 3J7YU 1D1UA 1VQ6S 3ONQA 2YX1A 4KSEB 3C8YA 1AYEA 4KHRA 4N47A 2F1FA 3G96A 3VAKA 4NASA 1NK5A 2QLFB 3AXKA 4IO9Q 2GNKA 2W1BA 2OFGX 1GXUA 4IRDA 4GE5A 3I4PA 5BYSA 2V2VA 2J9EA 2ZVIA 4LFAF 4PG4A 3ENQA 3TRGA 3JSBA 3DCAA 1I1GA 3V6DB 2E1RA 2FYXA 2GMLA 3WC0A 4PWUA 2QYGA 3QIPB 3OLRA 3PW7A 1BC6A 2HHTA 4MKBA 4CLSA 3CD0A 1OJ4A 3K89A 4KGKA 3NRBA 1K44A 2XMWA 4Q43A 4ZDNA 3EXCX 4GO5X 3ENVA 5CH7B 3POTA 3CDUA 3T5HA 2DNOA 2BJEA 2WONA 2WVCA 1I94J 1QSLA 3MM9A 2G4BA 1YTSA 3IGNA 1WKKA 2CDRB 2FQQB 2V4RA 3U27A 1FX2A 4DPOA 3HSZA 3CF5Q 3MAQA 1KHVA 3QRPA 1FI4A 1CC8A 4FXVA 2QYCA 3ZM2A 4ZPDA 3CJKB 2ZNYA 2D1CA 3O2IA 1OHEA 3SEOA 5AE1A 3BGLA 4ID5A 1TR0A 4MK8A 1N8RT 4YUDA 2DGWA 2CQCA 1BXNA 2XNQA 1KP6A 5EN1A 1X4CA 2H1YA 1VQLS 1KOHA 2N82B 1FFGB 2Y1RI 4ZPCA 2OMLA 3ITHA 5KT3A 4M5DA 3V0JA 3TVZA 1SQFA 2AJ0A 1XMOF 1KSPA 2J0XA 4FPIA 1OPIA 3FFIA 4C0BA 4DSKA 5KG1A 5KT7A 1NJIT 4ZCLA 1XTZA 5D4PA 2W9BA 2A8BA 2QL5B 2WB4A 1U1QA 1CEZA 4DV0F 4R8UA 1JLAA 1YSJA 2N7YA 1RPMA 4ED3A 3DLHA 4F4WA 1DZ5A 4B08A 1FRIA 3TARA 1GEHA 2YKMB 2FJNA 1WTBA 3E2EA 1HBNB 2HQDA 1T03B 4ELVA 4M1KA 1URNA 2J17A 2B8PA 1PO6A 4ZLPA 4BBYA 5MAOA 3NAHA 3CD7A 2X7IA 1U1OA 1ICEB 2FD2A 3TZYA 4M5NA 2XTJP 1YRTA 4LUBA 3RBZA 3I82A 1JX4A 3A3PB 3JS9A 2K3KA 1FTCA 3NOGA 1W2BR 1TVRB 1HBOA 5IQQA 1K9MT 1HQUB 1VQOS 1GFWB 1PA9A 1FKOB 4OI2A 2HVDA 1Q82T 2H4WB 5F41A 2DNHA 4IRKA 3KK2A 1S6PA 1S97A 1CBKA 3BO3A 2OSQA 4C6AA 3M6WA 4DF4A 4I56A 1N48A 2NLWA 2BZLA 4NWGA 2A10A 3VCDA 4RPFA 3OUYA 1HD1A 1VQYA 3CCES 2HVIA 3BZQA 2WOMB 4NCAA 4AD6A 1WI6A 2F4VJ 2BOAA 2KU7A 3ZTOA 2F71A 1HNVB 2BMBA 5H1SV 3FNNA 2ZBQA 4QYZJ 1Y00A 4M94A 1GTHA 2EW9A 1QTMA 3I9V9 4J37A 4I68A 2UU9J 3MOWA 2IHR1 1PJ7A 1PBUA 3QGIA 4ZVTB 4RL1A 2VPXB 3W2WB 1GQEA 3GXHA 3EGNA 2PA3A 2CM3A 2A2CA 1RYSA 3EM1A 4PCQA 1NJXA 4WFNQ 3Q8PB 3CCJS 3EGVA 2HAIA 5J8RA 3ZTQA 1M5KC 6FD1A 4PXEA 4YHHF 1K73T 1EENA 1XEZA 5H9FJ 3Q23A 5A0YA 4RW7B 1CJKA 2P9CA 1XR5A 4ZVGA 1BZCA 4QBUA 2PBNA 4MK9A 1A7GE 4EYIB 3N28A 1NLKL 1R8CA 2J8SA 1VQKS 1FEEA 3QAEA 4H4KA 4LBHA 5IM0B 4NYOA 2CQBA 5FD1A 2BBEA 3VGUA 4S0GA 4LREA 2FZGB 5J2MA 2Z57B 1Y9OA 5E3RA 1KRPA 1XXPA 4WKRA 1X4EA 2E9RX 1DARA 2PDAA 3HMJG 4DR2J 3N6LA 2FLLA 2HZAA 2W9AA 1NSKL 2EI5A 1SIWB 2ZJQQ 1HD0A 3BDPA 5AXLA 5A8WB 3MGJA 4NYHA 3PX4A 2IYIA 5J2PA 2DGUA 1ZPVA 4ILMA 2BANB 4CI0B 1Q81T 4AFFA 2DNNA 2QZ8A 4ER8A 4RNMA 3CCMS 3QGPA 2JHEA 5KG3A 3D28A 4DR5F 2HGNA 2HQCA 1C84A 2DGSA 1YX2A 2CJBA 4ZCKA 2XGPA 2AZ3A 2EK6A 3DRSB 2HNDB 1U0HB 2DNQA 1KWMA 1KEKA 2VG6B 2B56A 4FF3A 2IM2A 1SL1A 3BYPA 2DR9A 1ZZWA 4RW9B 4AUKA 4RW6B 1A5YA 4OI1A 4N56A 3CDAA 4JI0F 2BXJA 3KLFB 1NM2A 3R3TA 3DYAB 4J9OA 3GIIA 2ZKUA 4ZJOA 2CNNB 2RT3A 3FBCA 1JWWA 3DDKA 2WAQD 3QBCA 9ATCB 3LH2S 3MPYA 2RE1A 1TUGB 2R8IA 3NLCA 3TW0A 4PKDB 4LRDA 1R6VA 5F9NA 3S01A 2ZH9A 3DM2A 3DLGA 1VLYA 3BKFA 4BWMA 4YDXA 3N0AA 4ZHRA 1FE0A 1R8PA 5LL6d 4ZVOB 3UCUP 3G8SA 1FDAA 1SKSA 2CPIA 1E6YB 3NAIA 3HF5A 3EU0A 2FVQA 2CVIA 1KTVA 3BSAA 2LMIA 1TL1B 4OX6A 3EE3A 2RSQA 5AE3A 1VRTB 1N0UA 2MLYA 1WC3A 2VD3A 2I5XA 1ZM9A 2E29A 4NRUA 2MZJA 2CRLA 1C4CA 1FFSB 3SFUA 5L1LA 4DQQA 2Y96A 4D3GA 1UKUA 2V0NA 4OI0A 1MWQA 1NKBA 2V2ZA 5DDPC 2BW2A 2C2MB 3GV5B 4EGLA 3JQKA 3M32B 2UUBJ 1KQFB 4RZRA 3HFKA 3DMJB 1KVIA 1J5OA 2KH9A 4E2FB 1VHFA 3QCDA 3K5OA 4X84A 4ZN1A 3ET6A 2IM0A 4C2MA 3ZMQA 3D2WA 1CQNA 3QSIA 3PJWA 5J1EA 1R0BG 2Q3PA 4OZ2A 4DUYJ 4K2XA 2O5DA 1N32F 3B78A 2QRRA 4KGMA 1ZETA 4JI3F 2EXUA 2MGZA 5DQIA 4U95A 4IFVA 1CSJA 2VPYB 3W1YC 3MHYA 4YB5A 2DIUA 1XR6A 2RVJA 4QU6A 4V19X 4LIRA 1WKJA 5B0BA 3M8PB 2J76E 3LP1A 2ATCB 2NXCA 3C6TB 2NYIA 4W92B 2K1RB 2X3DA 1U6BA 3V4MA 3CMES 4WF9Q 4K4YA 3DNCA 4F0KA 3LP0A 1RTJB 4R5PB 1D9DA 4QUNA 3RBDA 4K5SA 3VALA 3LTOA 1KTQA 3IR7B 2HPUA 2QLWA 1Y3KA 4DWIA 1FHTA 1KQKA 2XO6A 3RZ2A 4HLBA 3WHIA 3TANA 2DHSA 2IDLA 1M0SA 1RE1B 5G4DA 2XULA 2OEKA 3S8SA 1FNOA 3AODA 5ETRA 5G0RA 3AJ1A 4DX6A 2WW4A 3C15A 4GVBB 4IKAA 3CB4A 1C0UB 1TTHB 5I42A 2AEMA 2IJRA 1PILA 2AF6A 4QQBA 5KOWA 2H02A 4C11A 2NREA 4XAKA 3FSYA 3S1TA 1EKRA 4G3IA 5F0WA 2PMWA 2Z58B 3SZ2A 2JC0A 5K14A 3Q2SC 2GQCA 1HI8A 1O0PA 2AHOB 2CIMA 3QRQA 1VQ8S 4NLDA 5K25A 3HT0A 2K7KA 3RAXA 3HVAA 5AT1B 4UOGA 3VVUA 4P71A 2LQ9A 1V3ZA 2KG0A 2WGPA 1RGVA 4GKJJ 2WSEC 4PABA 2F6FA 5KFGA 3HZEA 2IMOA 1OYEA 4DGPA 5FDLA 1SUQA 4YR8B 1XMBA 4WFYA 4ZJQA 1S6QA 1S12A 2AD9A 2DCLA 1IVZA 1YJ7A 1TKZB 1EARA 4M5JA 1MROA 1QSYA 4WZMA 2VDHA 3KK3A 3RR8A 5KA0A 2FH7A 5DGBA 3UFCX 2JVRA 2IAJA 4ED6A 1NRKA 3M4XA 4B3OA 2V8GA 3MXHP 4ZK7M 2CQ3A 1HR0J 1VGYA 1H38A 1YBAA 4HJPA 2MKJA 4HEA9 1GT8A 2EG2A 1JXVA 3VGTA 3NP5A 3KTQA 1IBLJ 2ZEJA 2UUCF 4LFCJ 3MM6A 3F44A 2YH1A 3U1MA 1IKVB 1RT2A 4WZQA 1S1WA 2VOPA 3PM9A 3V4IB 1U2CA 4I1TA 3SCJE 2NUUG 3B82A 5THWA 4IG0A 3SSRA 4CO2A 1NEEA 5DDQC 3UNGC 2P5VA 4V19J 2CJQA 3FZBA 4RWWA 5E3AA 2QL7B 4KFBB 4KKOA 1CJTA 5EWEA 2XG8A 3J81j 3NGKA 5KA1A 5ETSA 4J7CA 4KRWA 1QZ0A 1SXLA 4DR7J 3RZAA 1Q6MA 4ED8A 3TI0A 4OJ1A 1D8YA 1TFWA 4QR0A 3Q8SB 2VG5B 3EJMA 1N5TA 1FRKA 1QUPA 3GIRA 4DN9A 2F6YA 3POTB 1UVLA 3TA2A 1NZAA 3D0GE 2J9DA 1WHYA 3AD8C 4DR3J 5A5FA 1EEHA 3GLJA 4HYKA 4USHA 4TN2A 3TNVA 1YFOA 2KDOA 1YRXA 2HWTA 4L3KA 1RB0A 1Q6JA 3S7RA 3GSIA 2V8DA 2WHOA 3JSMB 2F6ZA 1F9EB 4H1OA 1NMEB 1EAYC 3R5GA 3EZZA 2FHJA 2ZH4A 3TUPA 3ZV2A 1ZPWX 4M5DB 2JDJA 5KFCA 1BQNA 2QIFA 2XY5A 2F46A 3EX7B 3QFWA 2W9BB 2RQ4A 4AE5A 2E44A 4ICZA 3E51A 2CQ0A 2HG4A 2CXEA 2CNFA 1JLAB 2MZSA 3CPWR 4DL5A 4NA1A 2AGOA 2F00A 2PT0A 4M63A 2Z2YB 4CO0A 3BR8A 1Q8BA 1S7HA 4ZI4A 3WIVA 4A48A 1RWMB 3W5YA 3D1QA 1HW8A 4WFBQ 3M30A 3K17A 4ZVFA 1RXDA 1Q8KA 3LALA 3ULHA 1RWWB 5HVFA 1Q6NA 2AQ4A 2HNYB 1IJFB 1TMMA 2ZOMA 4DLGA 2VH7A 5HANA 4WE1B 3GFYA 1RA6A 3CUNA 2HS0A 2W7OA 1UETA 3BLUA 2DGOA 5KOXA 1U8WA 5KT4A 2CUYA 2KB2A 3M2VB 3EZ5A 3KK2B 5H9EK 4LVOP 3PX6A 3RO1A 2RQMA 1R0AA 3UDVA 2O67A 5F8NA 4JI7J 3DHXA 3ZFVA 3IR6B 2DHGA 1ZYQA 5DRKA 2B9EA 2VZ9A 2Z2MA 2AJ1A 5F8IA 4LRBA 3P96A 4TKTA 2BVZA 3KHLA 2KL8A 3OR2B 4B17A 1LW0A 4PZVA 3AWEA 2DEJA 2CM7A 3D1OA 2J7UA 2YX7A 2CG8A 1HIYA 4GMKA 4U7UK 1CULA 1MMNA 1EEOA 1RBAA 2MB0B 2IA6A 3PYFA 1Q0NA 2RILA 2XI2A 4F3OA 1RHUB 3PTWA 4JI4J 4Y28C 4DV1J 1GAOA 3BPSP 1ROFA 2V67A 4ALZA 3THTA 4U6PA 3IR5B 2DNPA 2Q6CA 4IR1A 4N5SA 1NK4A 4HRFA 4FPRA 2C3PA 2GCFA 3AB4B 3CWEA 1N56A 5CYQB 1CJKB 1WOSA 3WDOA 1SUGA 5HMZA 3AA8A 2CPHA 2ADCA 5GMKa 1JKHB 1XQIA 4PWDB 1XERA 3QCFA 2R3VA 4ICLA 3PV8A 1PKUA 2BJ7A 3MD1A 1BD6A 1ZOTA 3L7OA 2DH9A 3QWUA 1R8HA 3J7ZT 3CVKA 2L48A 1U1KA 3CDEA 2IBKA 4NX9A 5KFEA 2PIIA 3DGPA 1WC4A 1L3KA 1FPZA 5J2PB 3M8WA 3P5BP 1D5RA 5JUMA 3HK2A 1IR1A 4ZJLA 2OOQA 2XLIA 3H5XA 5IBSA 3NMEA 3HM9A 2DNZA 3BF4A 4D3RA 2DT9A 1DFDA 1Q8LA 3CC2S 4PR6A 1I9TA 3ELHA 1RHRB 1QVGR 2OIHA 1VRUA 1YITS 2J9CA 4OYIA 4MBBA 3PG9A 2XB2D 3JYTA 1YKWA 4OYZA 4FF4A 1WJ9A 3GYXB 2H4GA 1XN9A 3NRSA 2VBZA 1Q78A 3KG4A 3CM3A 2EFVA 1J2VA 1J4XA 2KJWA 1WRMA 2OSRA 1WTFA 5AE2A 4EUVA 4RX6A 1BLUA 3T5LA 1B99A 4DV2J 2F4VF 2A6MA 4EO6A 5DDRC 3V0EA 3GSDA 5D4LA 1QAJA 3Q89A 3WIUA 4DFPA 3TEGA 3CDWA 2RUGA 5DZ6A 3A1YG 3MI7X 2YNGB 3A13A 1YJTA 3P3DA 3R1LA 5KFKA 1SC6A 4ZVSB 4I67A 3DM2B 2Q47A 2H5JB 3A8KA 1SC3B 2JNJA 5C25A 3SQGA 1SC1B 4JV5J 5K9VA 1XR7A 4LFBJ 1XBWA 1P6TA 2G0JA 2JL9A 1QLNA 1OQ6A 3DRXA 2AIRB 3QT6A 2RRAA 3PACA 2RH3A 4CLFA 3HP6A 4EZ6A 2NQPA 2V9KA 1BGXT 2GVZA 3KLVA 2PI5A 1FTRA 3NS5A 5F8MA 1SBRA 4I6AA 5E3QA 2PGCA 3UR3C 1Y7PA 1L3UA 4ECRA 2RS8A 4JI8J 2RF2B 2GFFA 2O1PA 3BM7A 2EEYA 2BE9B 1XMQJ 2R42A 4RNOA 1HBUB 2CFVA 5GAHI 3UN3A 1FXDA 2HVHA 4DR2F 1LK7A 4OZLA 3W8PA 2FVPA 1AXQA 1IM6A 2CPFA 3TVYA 3MECA 1QXKA 1TAUA 5EDWA 4JI1J 4ECUA 4MT1A 4PWWA 4HL9A 2QL9B 1N6QA 4YAAA 2W2OP 1MMLA 2KYZA 3EVOA 1QY7A 4F4ZA 5IQ6A 1J5OB 2KVQE 1FESA 1T9WA 1UJ5A 5M2UA 1GMVA 1TL3A 2GZOA 1OSCA 4FN5A 2J8AA 3A8IA 1KLMB 1Y5IB 2QJ3A 4DR1F 1FWLA 4G1QB 5J1EB 1G2EA 4RJVA 2YNHA 4ILLA 1YG0A 2RRNA 2F6WA 5SZTA 4LBPA 3TVKA 1RT5A 1R27B 2E1CA 1LK5A 1PAUB 2BRLA 4U8VA 5K8NA 4CLZA 4HTIA 2ZDOA 4FKYA 3MMBB 5AXNA 4R0JA 4KTQA 1WWHA 1MU2A 3BGRB 3LP1B 4CLUA 3MEDA 3UDCA 2ZFHA 3HPOA 2EK1A 1VIXA 2H5EA 3AWFA 1EP4A 2LA6A 1GWZA 2UV8G 3ZM5A 4RNFA 4ANDA 2DNGA 1VMBA 2MZQA 1RT4B 1IJEB 2Q05A 1VLOA 2Y2FA 5GVQA 3LP0B 3BKTA 3D6TB 2YXLA 2CNKB 3OMHA 2CQ2A 2K06A 2VA2A 2LU1A 4LF4J 4RW4B 2N3OA 1PC5A 4TU8A 1WNEA 2CG4A 3I31A 3DRRA 1C1CB 3TZWA 2UUPA 4P75A 4C12A 1VDHA 2E9TA 2XNRA 3BBBA 2FVCA 5F3TA 4C97A 2G6ZA 2DNYA 1J5EJ 4WFXA 1QE1A 3P5TL 1SC4B 4L74A 4B9MA 3NGRA 1HBMB 4AYBD 2VQEF 1FERA 1TELA 2R8JA 3S3KA 2IVMA 1Z1ZA 2CNGA 2QT7A 4Y34A 4RBTA 5K14B 4OYBA 4X4SA 3T1YF 1CS4A 5HLFB 3AJ2A 4B04A 4DV4J 3S4EA 2FJMA 3TAMA 3I0SA 3HHKA 3KG0A 2UUBF 5KT6A 1K0TA 1PJ6A 1CJVB 3GFZA 1ZZFA 5LSRA 4OX8A 4V1Ak 1RHJB 3HSDA 2NS1B 5EWGA 2XWXA 2W2MP 1S6QB 2EFNA 2GHPA 4IOBA 4OHVA 2Y9HA 3H90A 2OEMA 3MD3A 4DUYF 2HBYB 2EVZA 2A2DA 3KK3B 3K57A 1VRQC 3Q24A 4CP5A 3LWMA 1RT6A 1RHQB 4TLRA 2HCMA 2KZZA 4UUXA 3D4JA 1W26A 4HVZA 3VQTA 1UPMB 3KNGA 1I57A 2P2CB 2C2OB 3CULA 5I3UB 2FHOB 2GAHC 2B6AA 2XQCA 3J7A1 1OIAA 5ETLA 3ZTSA 4RI4A 4I2PA 2J0WA 2DPJA 1F9HA 4C8KA 3MM6B 5B0FA 4PAAA 4USMA 2AHSA 4URSA 1S1WB 1ECVA 2L9NA 3SCIE 2QO3A 2A18A 2VFVA 2V6AA 4RI5A 3A4TA 2QLBB 2B7CB 4CDIA 2ILYA 3LUYA 4KQZA 2J7WA 3EDQB 4EK2A 5SUHA 4GWFA 4DPYA 4NLTA 1LYVA 3DRPA 5I3PA 5J2QA 3AQPA 1JF7A 1CJTB 4C48A 4Q45A 1FRMA 1Q1MA 2DNRA 4K8RA 2VTEA 5LOQA 2VEUA 2H51B 3EWGA 3M8QB 3KK1B 2MKKA 2ZBIA 2JLFA 2XS7A 2VPWB 4CLPA 4DL0C 1RU1A 2CNOB 1ZM3A 1WF2A 4RDDA 1JNZB 1SKRA 1TK0A 2HHSA 4RHGA 2QEPA 2YVSA 4ZA1A 4OZ5A 2W7PA 4Q5VA 2W9CB 4URQU 1IKWB 4P2FA 4PYAA 5HI7A 3PEHA 3RYLA 4WXWA 4HACB 2B5JA 1OEMX 3CJRA 2PD1A 4NLOA 3FSXA 4Z7CA 3THVA 1S76D 3CMAS 4EFAC 1WG4A 3RB3A 3HHNB 1ZA2B 1F2HA 2GIQA 2VFTA 2C2RA 1Q7LB 5RUBA 1U0SA 2VFSA 5CZVA 1IR2A 2FJDB 2HVEA 5CAAA 4PG7A 5GADI 4G65A 1TKTA 2LFVA 3MMCA 2LDIA 4UY8T 2FJBB 4F26A 3M2RB 2PC6A 2E5LJ 1O8BA 2I1YA 3F81A 2ZZNA 1YZ7A 1FEHA 2VPZB 1VC6A 2BOPA 1GTEA 4YS2A 4F4AA 4QYZK 3QO9B 2D74B 1HMVB 1HR0F 1DQ9A 2RRBA 3ZZRA 2OPQB 2V4JA 1FF2A 3T19A 1OHDA 2HFZA 1FVQA 2OP5A 3M30B 1N5QA 2MQNA 3PW0A 1IBLF 2CZ9A 4NL5A 4CO3A 4TYAA 4LFCF 2ASJA 3KHRA 3GJSB 2K8GA 4IOAQ 3DDIA 3SMZA 1NU4A 3QCIA 1TKXA 2B49A 4RO0A 5CABA 1WDDA 5JJBA 2WBMA 4OHIA 9RUBA 3V81B 1LWEB 5H9FK 4Y65A 1F3VA 2CNIA 3B6BA 3BV8A 2I3RA 4OHHA 1X5TA 5E7OB 4QIEA 1R0AB 3BBCA 3RRKA 1DLOA 1JNRB 5L9NA 4DR7F 1EX8A 1ZCLA 1RSCA 4KO0A 3L7UA 1PTTA 4DL3A 2D3OR 3CJ8A 2P6XA 3L09A 1RBLA 5B0DA 2RKIB 1X9SA 4DL2A 3QCLA 4PQUB 5A2QU 4LBIA 4Y6IA 3QYYA 4DCOB 4DR3F 1P9QC 3G4SS 2F9DA 1QM9A 2P9GA 3NCPA 1SJQA 2JLGA 3LK7A 1NL9A 4DCPB 2CMBA 3LPYA 3MM7B 3N01A 4LR9A 3TOQA 3EVMA 1N33J 3O5XA 2WW8A 3Q8QB 5L1JA 2C3OA 1IR0A 4YFUA 3M1VA 2HFVA 5KFIA 4O4GB 5U47A 5A5EA 5L39A 2ZE2B 2LKZA 1GQQA 1YWFA 1K1QA 1OYDA 4QIWD 4YDDB 4OHYA 4OMFG 1M5SA 4WK1A 1Y10A 1NPKA 2BQRA 2JC1A 3CCZA 3ZL8A 3OL7A 4CH7A 1YLXA 5C2CA 2R7XA 2ZBRA 3C16A 1VISA 1LQ9A 3GTYX 3NXZA 2R7WA 2CJKA 1B7YB 2R7RA 2BKNA 3BSOA 4X62F 3HO1A 2AP6A 3EMUA 3NCQA 1EQMA 1RBOB 2ERRA 4NLQA 2I1RA 2M88A 4GO7X 4KV8B 3PJXA 3UPFA 1XJWB 2F5GA 2KRRA 1IQZA 4X4PA 2OEJA 4NE9C 4FS1A 2HHQA 4GE2A 3OV7A 2NXUA 3H5UA 1N5VA 2Z2LA 4ECZA 1PH0A 1T9UA 2MZ1A 3DU6A 5FLXU 1NSQA 2ABYA 2LVWA 2MY8A 1PYSB 3AOBA 1OEVA 1PCAA 1NK7A 2CPEA 3BGUA 4A8SA 1HYSA 1RT1B 2O01C 4CO1A 2AYBA 3G9CA 1ONYA 2KXHA 2LYVA 1Y5NB 5BYQA 3E01B 3JYTB 2Y0BB 4JV0A 1RK8A 4QIVA 2X1GA 3DLEB 3FVYA 2KT5A 4QWEA 2HFOA 3IMQJ 2MZTA 2IJNA 5CA5A 3KLEA 2DH7A 1JBVA 4LRCA 2YDUA 3OLAA 4R0TA 3O44A 1HKAA 2E9ZA 1PJ5A 1ZAWA 3N2AA 2BE2B 4O3OA 1NK8A 4R25A 4FYDA 2HHXA 1Q95G 1S57A 4WFZA 3F0NA 2RDJA 2FLNA 3DLJA 1P1TA 2HNPA 4I2QB 3ZZUA 2V9WA 2AJFE 2YKAA 1R8AA 1B0PA 4JI4F 2Y1LB 1U49A 5C25B 4DV1F 1X0FA 3A8JA 1N36J 1OS5A 3DOKB 3H40A 2VQFF 1W2IA 3CC4S 1RT7A 1Q53A 3QGHA 3OT9A 4ERDA 5GMDA 5BZXA 3B4DA 4CIOA 2JVOA 2DK2A 4LSLA 3EGZA 2ZH8A 2IC3B 4P9SA 1ZM2A 2J5AA 5A2QY 4CVMA 4F36A 5KFUA 2CA9A 2KFNA 4QWBA 3TQEA 3BPDA 5HSPA 4IUFA 3AB2B 2UVUA 4NCGA 1UA1A 4U67Q 3IS9A 2CFXA 1V3RA 2GQQA 2NXJA 1NDCA 1DBDA 1UVIA 4KB7A 4K0KF 4C13A 1M5PC 4IFYA 2VIHA 1JLCB 4K4UA 3KOAA 3FMWA 2VKZG 3MTKA 3W8GA 2J0SD 4LRFA 1BY9A 3PEJA 3OL9A 1KKHA 2GJTA 2OD6A 4BC7A 1TL3B 3JAMY 3CCLS 3Q86A 4IH7A 1NWEA 5LT5A 4IDKA 5D0HA 2UUOA 1WSVA 8ATCB 1EETA 2CVEA 1T9TA 1IBMJ 3FMBA 1SV5B 4P6QA 3N6NA 2AT1B 2YNHB 5CQGA 5B09A 3KG1A 1OY6A 1S7IA 1QAIA 1YVFA 1RT5B 1W25A 4FZVA 2ZBCA 2DRAA 3V0FA 3QLHB 5DM7Q 3KJVB 3M9MB 1H2VZ 3ADAC 3PO4A 3MEDB 4UQGA 2WVEA 4N76A 1HNZJ 4DV2F 1EP4B 4NLGA 1DY3A 4MTPA 1JJ2R 3SDEB 4JI2F 2OZ5A 1TL5A 2FJEB 4AZ1A 5FLXY 3N5FA 2CWKA 1YZ6A 1HQEA 3A8EA 3IFEA 3R7BB 1IXKA 2QC3A 4NXNJ 4HHJA 4LQ3A 3F73A 4K4XA 1VBXA 3FCWA 1NK0A 3MCMA 1C0TB 1N4LA 2VG7A 1UAWA 1HWKA 3PNIA 3C6UA 2GW8A 4JV5F 2XMTA 1F1BB 1S1XA 4ZVQB 1R8BA 4A4JA 2XMUA 1FK9B 4KGXB 4YN3B 3DRRB 5HAOA 3GWCA 4NZ0A 3H8YA 1YJWS 2EC0A 1U7LA 1AUSL 4U7UD 3K2YA 4USWA 3TZZA 1J27A 2Q43A 2Y3YA 2E7VA 3A3OB 2UUTA 1YIJS 1RJJA 3H2VE 2XMJA 1RADB 4F02A 2IIHA 3EZOA 3S3FA 1AA1B 2GC6A 2OMOA 4PUOA 5GADU 2KM8B 4K4WA 3QZ7A 4KT0C 2Q1LA 4B3SJ 5E3CA 2ROEA 3RUBL 1XMQF 4XTTA 4GRSA 1MN7A 2Z2ZA 2V8VA 4ZLNA 3IG1A 2VEYA 2F8EX 3QPIA 1ONZA 1S9GB 3DDNA 3QT8A 5FIIA 4F0HA 5F8LA 4JI1F 1VQ9S 5C24A 1FPRA 4HI2A 1FCAA 2DRDA 1G4WR 1XK8A 1LW2A 2ZOFA 2NT2A 1R89A 2JEIA 1RTIB 2RD5C 3W66A 1YJUA 3ENWA 4FYXB 1RTDA 1V3SA 3HVTA 2U1AA 4C98A 1NKCA 3OTCA 1Y4ZB 2X5OA 3RW7A 4Z6BA 4PXDA 5CD4H 2AGPA 1WF1A 4OHEA 2B9YA 1OWXA 2Y8WA 1H3DA 4NYZA 4JOUA 3D3CJ 3M2UA 1NJWA 3QCNA 3L9ZA 1UA0A 2AM1A 3CD5A 1KONA 4BUBA 4A8KA 5DJBA 2CPJA 3TA1A 2MKIA 1YTNA 2B6AB 4LJMA 3HJFA 4BS2A 4AQYJ 3M9OB 4I2PB 1TV6A 1GNKA 5B7WA 5GTJA 1RTHB 3MR7A 1NDLA 5D3GB 4QAHA 3LAKA 3OVAA 4K7QA 4WK3A 2AJ2A 1UFWA 5EHPA 2HQIA 1DTTA 1X5OA 2VASA 4J9RA 3PO5A 4X4TA 3DRPB 1FWPA 1T3NA 3UCGA 3L7PA 2ZKTA 1O6XA 1B0VA 3OHAA 1VC5A 1ITPA 1FDDA 2RHQB 1G7CB 3MFIA 3MF5A 1UVMA 1HNIB 4YR0A 4IG3A 1BZJA 3CTRA 3FEYB 3O4TA 1XRIA 5HJYA 1J5EF 2I6IA 3U96A 5ETTA 1FD2A 2LDYA 3V0IA 2P6TA 3QATA 2OH2A 2VOSA 4KI9A 1VHRA 1HNXJ 1T94A 4MH8A 1KFSA 4L75A 1HA1A 2XMAA 3QWPA 1E6VA 4JB8B 5KACA 2YKPA 3I7ZA 2VF3A 4L72B 3U02A 1N88A 5J1PA 5M43A 1IQTA 1IKYA 1X5SA 4DV4F 2CJXB 4I0WA 2XJAA 3HVRA 2Y0SD 2DXPA 5A8RA 1RWNB 2FJXA 1IBCB 1GG4A 1GMWD 4X64J 4NLRA 3VHQA 4OV6A 1FDBA 3CEDA 5E3PA 4HDGA 1JLBA 4MKYA 2DISA 4PQAA 2XMVA 2B7BB 2M52A 2PE8A 3MMCB 3GG1A 5BXIA 1VQMS 1YJVA 3W2VA 3UD3P 4KYQA 1RHKB 2GWOA 3LGNA 4ZPTR 4DXLA 2RS2A 2C2EA 2PI7A 2X1FA 4NI2B 3OXGA 4ZPBA 3KJFB 1KFDA 5DDOC 3EB1A 4M5MA 1KQGB 1VQ7S 2GCAA 2ZHOA 4JP8A 3DOLB 4C8MA 4HKQA 4HR2A 2ZMMA 5K20B 4DPUA 1RAIB 4RU9A 4J5OA 4LF9J 4GKKF 4OHZA 4LF2A 2NT7A 4TYBA 2MHEA 3SFGA 3WQPA 1FRHA 1P3DA 1T8EA 4G6VB 4EWTA 4HV4A 4DQRA 3GIJA 3RAMA 2GJFA 2RUSA 4H4MA 4DUZJ 3MM5B 5IFMA 4CLWA 2XLJA 1J6UA 3FC9A 3TYTA 2JFFA 2R2SA 3JXOA 1DLOB 4LVNP 4DPTA 1EQ0A 3FUYA 3PYZA 2GHWA 2HC1A 3MAAA 3PYEA 3ETMA 5HO4A 2XEXA 5HVHA 4CH1A 1VOMA 5KA9A 3D5MA 5IV3A 2HNZB 4WTYA 2IBOA 5F9LA 3PW4A 1JK9B 4KYZA 5KFBA 3IXQA 4YB6A 2UUAF 4CWBA 4UW2A 4CLTA 4LSNA 1Q7YT 2Q6BA 3NOCA 8RUCA 1FJGJ 5KFDA 2B51A 3HXMA 3M05A 3OFHA 2HHVA 2E7XA 2YNFB 1T3OA 2HRTA 2HMIA 3LJ8A 4MMOA 4DU7A 4LRAA 3UDEA 3HKWA 1RI7A 3NWRA 3C19A 4AL5A 4FP9A 2HHWA 1MWZA 1U25A 1GK8A 3K58A 3CT9A 3MM8B 5CYJA 3DKDA 5HJXA 4DCJB 2VUGA 4DBQA 3I87A 4C0OC 4OYAA 5K9FA 4DV7J 1GXTA 3KYLA 5E2QA 2J0QD 1JJCB 5FJ4A 2HGMA 4TQSA 3ISZA 4USKA 2YWEA 4OYXA 1TUWA 1Q6PA 1UTAA 2D3O1 2K7JA 5HROA 2ZH1A 4H34A 2FY8A 3EDRB 4X65J 1RDRA 4YEAA 3TAPA 4B9SA 2N7CA 3UW1A 4Z7YA 3GZ7A 3H5SA 3WBZA 2ZWPA 2GJ2A 3J81U 4WP8A 1N34J 1C1BA 5GAEI 3D9BA 1TP7A 4CM0A 2AJ4A 1T9XA 4LF6J 1SVDA 3VAJA 4MIBA 2HEKA 1HWJA 1LWFB 1XC9A 1WC1A 3OVSA 3BGOP 2EKYA 4RNHA 2ASYA 1HYSB 2MPUA 4U9RA 3M9NB 4KYRA 2GVDA 5F3ZA 4O3PA 4F4KA 4KGVB 4WIQA 2ZH2A 4L3NA 1FO1A 3NL0A 1X4DA 2QX0A 5L1IA 5KFJA 2DR7A 2AW0A 3KLEB 2A3JA 1UZHA 2WZ1A 3IRXA 2VTDA 4B3RJ 3MR2A 4X4NA 5ETNA 4AT1B 2K3IA 4UOHA 3QCMA 3A5KA 2D7SA 5HBMB 3UN5A 4IR9A 2LQBA 1HPZB 1B64A 3Q2TC 2ZHAA 2M3DA 5KFOA 1ZTTA 2KVIA 1GX5A 2QMUB 3KHHA 1U2FA 3GYGA 4OQJA 3SR9A 1S0NA 3QIPA 4DX7A 4HDHA 5KFZA 5ADZA 2JEGA 1X0PA 1RT7B 4RUHA 4NPOA 3I96A 1V3AA 1JBWA 1XNQJ 4N8OA 1HHTP 2SHPA 4FNHA 2IM3A 5CZXA 4CVLA 3MFHA 1LXJA 4MFBA 1S5ZA 2RQKA 1RWPB 4QWDA 3PX0A 4ZKAA 3SQOP 3GR1A 2VHGA 2DNKA 1U1PA 1HHSA 2HYIB 5KA7A 2XHCA 3CJKA 2DGVA 4C3MA 4Q0BA 1G7FA 1H7XA 3CWJA 4IFYB 1G6BA 2AYMA 2BV3A 2BR0A 4QU7A 3DHWC 3F9AA 3GIKA 1NPRA 5B08A 3L4BC 1M1HA 2IRUA 3PW5A 4UF4A 2C28A 3UWTA 2VU5A 2YNIB 5M2RA 2GGPA 4YHHJ 1JJ4A 3NGTA 3IBCB 2N3LA 4P7TA 5KG7A 2VONA 1YZ4A 2EFGA 4GFVA 4WTOB 3VAMA 2UZAA 1IN0A 5T7LA 1S0MA 1EETB 3G2XA 4ATNA 4EMDA 2P6SA 2Q79A 1ZTWA 1H2TZ 2LECA 2VBXA 2E5IA 3DXBA 3ETOA 4X66J 4J90A 2W8KA 3M6UA 3MEEA 1S1VB 4M8LA 3W5ZA 1KD1T 1MWYA 2YKMA 1MNEA 1T4JA 2E0TA 3SSQA 2H03A 3LWLA 3D67A 1X4HA 3EVWA 2ZUAA 3OTBA 1WOOA 4E8UA 3E8OA 3J81Y 5A76A 5D6GA 5BR8J 3KLIA 3TJ8A 2YQ1A 2C2DA 3GJTB 5LXRA 1VS3A 3UO0A 3TA0A 4K59A 1HQEB 1HQUA 2HS4A 3HHDA 4W98A 2XS5A 1FKOA 2YWKA 4GE6A 2OHDA 5HQ8A 1TUVA 2AV5A 2IRXA 1P9YA 1X4BA 2NXNA 2CQPA 1UL3A 3MEKA 2YKOA 1TK8A 3NG8A 3TJ9A 3AY0A 3D66A 3C6UB 2BJ8A 3H42A 2HWIA 1NXIA 1RLDA 4NWFA 1WEZA 3KWMA 4I8NA 4C3LA 1T05B 3UCZP 4ECVA 3VVTA 3WX4A 3R5CA 2H3EB 4UOFA 1VQPS 5C42A 3IRWP 2DO4A 4CM2A 2G59A 3B8HA 2I2YA 1U26A 5F0UA 1VQSA 3QQCD 4YB1P 2B3TB 3NBPB 1OEUA 1BQXA 1WKLA 4X4VA 5ETPA 4BPCA 4DR6J 5HATA 2M4MA 4DV5J 4CLLA 3KLHB 1OESA 4K2JA 4PUOB 1HNVA 4I7FA 4ZMMA 4ZCIA 4RKKA 3VZHA 2MKHA 4GRZA 1RACB 4B9UA 4J9MA 3HD1A 1KHWA 1OPZA 2YKNB 3LA0A 4TY9A 1WF0A 5D4OA 3EYZA 1VBZA 1YDLA 4IKCA 3BKUA 1KC8T 3BEGB 2J6TA 3SXLA 1LW2B 5EWFA 1M5OC 4O3NA 2LEAA 5LMUJ 3K5PA 2HHHJ 4CO5A 1D3WA 1P1LA 3W9JA 3IO1A 3K8WA 4XPCA 1YBTA 2XSJB 4RW7A 4DU8A 2CPZA 1RAJA 1NO6A 2NZ6A 3HT3A 4HH0A 1MG7A 3PFOA 1FE4A 5A6WA 1S4FA 2HXPA 2ZN7A 1EIYB 4TU9A 2VA3A 3HN7A 1RT3A 1WG1A 1NDKA 2G13A 1UVKA 4USIA 2AGQA 2CJ9A 3N9UC 2LLZA 4Y2CA 5CXTA 4O44A
chains in the Genus database with same CATH topology
2VC0A 3LUYA 4KQZA 1F5CA 1MKPA 2J7WA 3CDUA 3T5HA 3B4MA 2BGDA 2DNOA 1WI8A 4PG6A 5SUHA 5A8WA 2BJEA 2WONA 2G4BA 4NLTA 1QSLA 3MM9A 1U1NA 3DRPA 1N6QB 3T5KA 5I3PA 1LYVA 1YTSA 5J2QA 3AQPA 2VEXA 1CPZA 1JF7A 2VL1A 4Q45A 5IZHA 5DS7A 1JLEA 3IGNA 1FRMA 2RJZA 1Q1MA 3P49B 1F5AA 2MJNA 1I9SA 2DNRA 2V4RA 3U27A 5KA8A 4DPOA 1P27B 4ZVHA 1LQFA 2VEUA 3CF5Q 4PPDA 3MAQA 1KHVA 3M8QB 5CHCB 3KK1B 2MKKA 5L9XA 2ZBIA 2JLFA 2XS7A 1CC8A 4FXVA 2QYCA 4NLSA 2VPWB 1VK3A 4DL0C 3ZM2A 3QCBA 4ZPDA 3CJKB 2ZNYA 2D1CA 3O2IA 1OHEA 3ZZPA 3SEOA 4NXNF 1ZM3A 1SB6A 1WF2A 4KV8A 4C8NA 1JNZB 5AE1A 5F8HA 1AFJA 4RDDA 3BGLA 1SKRA 4ID5A 1HI0P 1TR0A 4X4OA 1TK0A 4MK8A 4LMZA 4Z2XA 1N8RT 2HHSA 2QEPA 4RHGA 4YUDA 4OI3A 2YVSA 2DGWA 2CQCA 3N0VA 4ID8A 2XNQA 3BR9A 5EN1A 4ZA1A 4OZ5A 1X4CA 2W7PA 3RGOA 4Q5VA 2W9CB 3DRSA 4DN0A 5LMNF 4ES1A 2VB6A 5D78A 4URQU 1VQLS 1KOHA 2N82B 1IKWB 4JI6F 3HHLA 2VG6A 2OAUA 4JUZA 2QE5A 3PKYA 2UVVA 1AW0A 2Y1RI 4ZPCA 2OMLA 4ZPVR 5HI7A 3ITHA 5DG9A 3PFEA 4I69A 5KT3A 4M5DA 2UXDF 3PEHA 3RYLA 3V0JA 2ZC4A 3NMAA 3TVZA 3LF0A 4WXWA 4DSEA 4GRYA 2B5JA 2AJ0A 1XMOF 1OEMX 1S10A 1Y3JA 2LCWA 3LOUA 5KFRA 1JXEA 4OLOA 4WFAQ 1KSPA 2J0XA 2LXIA 3MMJA 1PGZA 1OPIA 3FFIA 1WEYA 3MDFA 2PD1A 3R5DA 2XMKA 4C0BA 3KLFA 4DSKA 4NLOA 3FSXA 5KG1A 5KT7A 3THVA 1NJIT 1S76D 2OPRB 4ZCLA 1XTZA 5D4PA 3M6XA 1MU2B 2F8MA 3CMAS 1NJYA 4DQPA 3CD6S 5J2NB 1WG4A 4EFAC 2W9BA 4NLPA 5KFYA 3H2UB 3S4OA 2I6MA 2A8BA 3RB3A 2GV1A 2E5GA 2W8LA 2WB4A 7FD1A 4C3KA 1YWXA 3HHNB 2IYGA 1U1QA 3QKQA 1RT1A 4OI4A 1CEZA 3TX8A 1RISA 1JLGB 4FS2A 2DO0A 4DV0F 2GIQA 2KYXA 4R8UA 1JLAA 2ZDPA 1YSJA 2N7YA 2VFTA 2C2RA 4ED3A 3DLHA 4F4WA 4F2RA 1Q7LB 1RPMA 3DLLQ 4I6YA 4B08A 1FRIA 1DZ5A 4ZP6A 4C0HA 3TARA 2VFSA 1YI2S 1CG2A 3FQKA 3ZM3A 5CZVA 3E01A 3I9ZA 1JLFB 1UW4A 2YKMB 4LQ9A 2FJNA 3DLEA 5IT0A 1WTBA 2FJDB 3E2EA 1HBNB 2F70A 3GB0A 1T03B 4ELVA 1E6VB 4M1KA 5K8MA 1DQ8A 4PG7A 1S1TB 2CJZA 1URNA 4G1IA 2FB0A 3F56A 5GADI 2J17A 3T6JA 1TKTA 1PO6A 3I0RA 4ZLPA 4BBYA 2ZD1A 4DGXA 5MAOA 3MMCA 1P8GA 5BJRA 4EBEA 3NAHA 3CD7A 2LDIA 1X4FA 4O3RA 1U1OA 2FD2A 3TQ1A 4UY8T 1YRTA 1BQMA 4LFBF 2FJBB 3HLUA 4LUBA 1NJZA 4F26A 1NWLA 3E3XA 4FF1A 3M2RB 2PC6A 3V5RA 3I82A 1JX4A 1O8BA 4ECXA 3QJJA 2K3KA 1FTCA 2I1YA 3D0HE 2GJIA 4F3MA 3KKFA 5EGYA 2ZZNA 3F81A 3MWBA 3K5LA 4Y2EA 1W2BR 1FEHA 1TVRB 1WACA 2BE2A 1UFLA 2VPZB 1HBOA 5IQQA 2WRMA 4FXWA 4XIUA 1VC6A 1K9MT 2BOPA 1HQUB 1VQOS 3BN4A 1ZBTA 1GTEA 1PA9A 1FKOB 4OI2A 5AJ3F 1Q82T 3QO9B 2D74B 1E6YA 1KR4A 1HMVB 1HR0F 5GAEU 2APOA 1DQ9A 2RRBA 5F41A 3ZZRA 2OPQB 1JLBB 2DNHA 2V4JA 1FF2A 5DETA 3T19A 4CTAB 4IRKA 2ACYA 3KK2A 4I2QA 5IXUA 2AZRA 1OHDA 1S6PA 2HFZA 1S97A 1TL1A 1FVQA 1QE1B 2OP5A 3M30B 3BO3A 4UQTA 2OSQA 1N5QA 2J16B