2B4OA

Structure of the r258k mutant of selenomonas ruminantium ptp-like phytase
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
313
structure length
313
Chain Sequence
TVTEPVGSYARAERPQDFEGFVWRLDNDGKEALPRNFRTSADALRAPEKKFHLDAAYVPSREGMDALHISGSSAFTPAQLKNVAAKLREKTAGPIYDVDLRQESHGYLDGIPVSWYGERDWANLGKSQHEALADERHRLHAALHKTVYIAPLGKHKLPEGGEVRRVQKVQTEQEVAEAAGMRYFRIAATDHVWPTPENIDRFLAFYRTLPQDAWLHFHCEAGVGKTTAFMVMTDMLKNPSVSLKDILYRQHEIGGFYYGEFPIKTKDKDSWKTKYYREKIVMIEQFYRYVQENRADGYQTPWSVWLKSHPAKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords myo-inositol hexaphosphate phosphohydrolase
publication title Kinetic and structural analysis of a bacterial protein tyrosine phosphatase-like myo-inositol polyphosphatase.
pubmed doi rcsb
source organism Selenomonas ruminantium
molecule tags Hydrolase
total genus 104
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 3.1.3.72: 5-phytase.
pdb deposition date 2005-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14566 PTPlike_phytase Inositol hexakisphosphate
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1690 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2b4oA01
3.90.190.10 Alpha Beta Alpha-Beta Complex Protein-Tyrosine Phosphatase; Chain A Protein tyrosine phosphatase superfamily 2b4oA02
2JJDA 2PBNA 2I4GA 4BPCA 2CM3A 1BZJA 2GWOA 1OEVA 2Y2FA 5GTJA 3BLUA 4GS0A 4GFUA 3D9CA 4JNBA 2PQ5A 1X24A 3I7ZA 3QCBA 1XRIA 2BGEA 2VEVA 3PS5A 2CNHA 1JLNA 1PTYA 2I5XA 5IBMA 3B7OA 2QBSA 1R6HA 2P6XA 3O4UA 2F46A 4WOHA 4QUNA 1WCHA 2R0BA 2I42A 1FQ1A 4WU2A 2DXPA 2QDMA 1XBOA 1YTNA 2B49A 3GXGA 3BLTA 3D1OA 3QCJA 2H4KA 4ERCA 1OHCA 2OOQA 4JBCA 4GWFA 3CWEA 5KA4A 1LARA 2IMGA 2F6TA 2I3RA 2CMAA 2I6JA 3QCKA 2ZN7A 3QCCA 5K25A 1T48A 5K24A 2PSZA 2Q05A 3QCDA 5AWXA 1ZC0A 4ICZA 2PI7A 2G59A 5KAAA 4KI9A 3RGOA 2QEPA 2HY3A 5BUGA 1ZZWA 1G1FA 3QKPA 4QAHA 3QCMA 1OHEA 3D44A 2P4DA 4ZRTA 1OETA 3A5KA 2CNEA 4RKKA 5IBSA 5MMZB 2PT0A 2H02A 2VEUA 2AHSA 4QUMA 3ZM3A 1ECVA 2B3OA 4ZN5A 1G1HA 1G4US 2F6ZA 2J16B 1JF7A 4GE5A 1YPTA 4YR8B 4GRZA 1G7FA 1NO6A 1I9SA 2CFVA 4D3RA 2CNFA 4NX8A 2FJNA 3QCEA 5J8RA 1G4WR 1EENA 4PVGA 2BGDA 1SUGA 2B4PA 2B4SA 2FH7A 4B04A 2I6IA 4OHHA 2CM8A 4Z6BA 2J16A 1LYVA 4KYQA 1J4XA 1ONZA 3AWFA 2CM7A 2F70A 3A5JA 2I4EA 2NTAA 2VEYA 3D1QA 1VHRA 1AAXA 3V0JA 1Q6JA 2CMBA 3SMEA 5KA9A 4TVVA 1M3GA 4KYRA 2G6ZA 3QCGA 3LJ8A 1FPZA 1C87A 2I6OA 1RXDA 1NL9A 1T49A 4MBBA 3RZ2A 2HNPA 1OEUA 2HVLA 2HXPA 2PA5A 4NYHA 1ZCLA 1XM2A 1PTTA 2I3UA 3GXHA 4OHEA 1WAXA 4JMJA 4AZ1A 3NMEA 1C85A 2QCTA 3MOZA 3RGQA 3S4OA 4RHGA 2CNIA 4HJPA 1KAKA 2QBPA 2H4VA 3QCIA 2F6YA 4RH5A 1NNYA 4OHDA 1L8GA 2CM2A 3S3HA 4R30A 2F6VA 1PXHA 2RF6A 3OMHA 3H2XA 1PA9A 4NNDA 1NZ7A 3F99A 2FJMA 1U26A 2VEXA 1XXVA 1YFOA 2HC2A 4RI4A 3N0AA 4I8NA 2CMCA 3AWEA 5KA3A 3CM3A 3MOWA 2B07A 1D5RA 2YDUA 3ZMQA 2A3KA 3O3LA 1C86A 1PTVA 2Y96A 1OEMX 2ZMMA 2QCJA 5I6VA 2I1YA 3F81A 4R0SA 1G7GA 2B4OA 1XXPA 4H1OA 2QBRA 1YWFA 4RH9A 3F9BA 3V0EA 5K9WA 3ZMPA 2QDCA 2I6MA 1Q6TA 3EZZA 2GJTA 5BZXA 5EHPA 2GP0A 1YGRA 5M43A 1PYNA 3QKQA 1OESA 3V0FA 3D42A 1U24A 4WU3A 1L8KA 1PA1A 4GRYA 4J51A 1OEOX 2NZ6A 4QAPA 4IKCA 5LXQB 1WRMA 3S4EA 2NT2A 5KABA 2HCMA 5K23A 3I36A 1I57A 5KA2A 3EAXA 3BM8A 3EMUA 5EHRA 2QBQA 4Y2EA 2Q47A 1C88A 1OHDA 4GE2A 4BJOA 3EB1A 2J17A 4NWGA 2NT7A 4QBWA 3QCFA 1Q6PA 5K22A 4RI5A 5KA8A 2AZRA 2C46A 3SR9A 1ONYA 3ZV2A 2F71A 4OHLA 1ZCKA 1KAVA 2QDPA 1BZCA 1Q6NA 1I9TA 3ZM0A 3QCHA 2I75A 3V0DA 2H04A 3QCLA 2B4UA 1G1GA 1A5YA 4RDDA 4GE6A 4NWFA 2ESBA 4YAAA 1BZHA 5KADA 4WTYA 3EU0A 4JMKA 5K9VA 2SHPA 2BV5A 4GFVA 4H34A 1YGUA 2HB1A 4Y14A 3RO1A 3OLRA 3F41A 3V0GA 1PTUA 2OUDA 4QBEA 2HC1A 2OC3A 2CNGA 1YN9A 4D3QA 3U96A 2I4HA 5KA0A 3ZM1A 2F6FA 2NV5A 1YTWA 4PYHA 3V0HA 1Q6SA 2BZLA 4S0GA 1QXKA 5HDEA 1MKPA 1PH0A 3I80A 3O4TA 3F9AA 3ZM2A 2H03A 3MMJA 3M4UA 3V0IA 1QZ0A 2MBCA 2NLKA 2OZ5A 1EEOA 5KA7A 3BRHA 4R0TA 1Q6MA 5BZZA 1FPRA 4D3PA 1NWEA 5BX1A 1GFYA 5KA1A 3O5XA 1T4JA 2WGPA 3S3EA 2I6PA 5KACA 1U25A 1C84A 3O4SA 1YTSA 2VEWA 2H4GA 3QCNA 3S3KA 1Q1MA 2A8BA 4HRFA 2M3VA 2F6WA 3AWGA 4DGPA 1GWZA 1V3AA 1C83A 4DGXA 3D1HA 1RPMA 3S3FA 4HJQA 1YZ4A 2BIJA 1LQFA 4ZI4A 4OHIA 1NWLA 2E0TA 1P15A 2C7SA 2CJZA 2HNQA
chains in the Genus database with same CATH superfamily
2BANB 2JJDA 1GH8A 4BPCA 2FTRA 1JJHA 3AXMA 3CUNA 2ZEJA 2G2YA 4RZRA 1WNEA 1YWXA 3D9CA 4HH1A 4X62J 1X24A 2KKHA 2HURA 3O8WA 4ZVTB 4Y6IA 2YQ0A 2JFGA 3PYGA 1RWKB 3PO5A 1S59A 2C2NA 1PAEX 3PTWA 3E01A 4WP8A 4ELTA 4PXEA 3OHAA 1BLUA 3PIOQ 5EHHA 1GG4A 1RT1A 4O4GA 2HEKA 4USVA 3FMBA 1W78A 1VJWA 2FZKB 1SCJB 1UEKA 2BE9B 1SJQA 4GKJJ 3QCCA 4IH5A 4WFYA 5AE3A 2J7KA 1GK8A 5K24A 1O8BA 1R0AB 4OZLA 1ZC0A 1RAJA 3H42A 2CA9A 4O3PA 1GXUA 2DGUA 2XSJB 1V3SA 1KR4A 1WG4A 5E3AA 1S48A 1Q8BA 3TX8A 4MKVA 1VQOS 3FC9A 2CQGA 4ZPAA 2K06A 4IG0B 4NCAA 5CYJA 2HK2A 2UXCF 4HL9A 2M52A 5B0CA 1RTJB 2MZQA 1WKLA 1GNKA 4U8VA 4NLRA 5DDOC 2W4DA 3HN7A 1YPTA 5KG4A 1RBLA 1IR2A 1DURA 4XPCA 4QBUA 2YKQA 1ZA1B 4PZVA 1LW0B 2QYGA 3U1LA 4PVGA 4X4SA 2JX2A 2H4YB 5DO2A 3CF5Q 1U7LA 4AFFA 4WK3A 1KHVA 2BJ9A 2XLIA 2FJVA 1FX4A 4B3OA 2PFDA 4KYQA 5A2QU 1F9EB 2W2MP 4DWIA 4LR7A 2AJ0A 2I4EA 1B0PA 3I31A 4ECUA 2W7PA 3G6VA 5E0OA 2ZNYA 2DT9A 2FY1A 4EO8A 2PI4A 5A8RB 2ZHAA 1YZ7A 5A0YB 5GADU 4PWWA 4HDHA 4MYUA 2MKCA 2PMZD 2KDOA 3AOCA 4CTAA 4DBQA 2K1RB 3RGQA 3S4OA 2MZTA 2XZTB 2VICA 4YY3F 4ZPVR 4BBYA 4B3MF 1UA0A 5G4DA 3S3HA 1S6QA 4LF7J 3F99A 1U26A 2WVBA 1C0UB 4O3OA 2P9EA 2EK6A 2L08A 4CO3A 3VVTA 4B9NA 3HKZD 3V6DB 3WIUA 3M8QB 4RWWA 2BJDA 2K3IA 4B3TJ 1QJHA 1NKBA 2V2KA 3UI3A 2JSXA 4ANDA 3MOJB 1K9MT 2X1FA 1Z2ZA 4ZJQA 3IGNA 2VG7B 1U49A 4P2XA 1DQ8A 5JXSA 4WU3A 1FKAF 3KUEA 4P2MA 2BM1A 2FVPA 4DN9A 4OYOA 1YTYA 3RU0A 4KIAA 3N6MA 1J2VA 3ZNJ1 2HNZA 3B54A 4OX9F 3M9NB 1LEOA 5L9NA 2PIIA 2KB2A 3HSZA 5KA8A 4LFBF 2WCXA 3SR9A 1ZCKA 4F4KA 2MLYA 3L7OA 3M8YA 2V9WA 3CD7A 2LDYA 4PKDB 5DQIA 2HIQA 3UNYA 3PYZA 1N36J 4PG8A 3NMAA 4WTYA 1N88A 3DYAA 1AXQA 1UVKA 2HB1A 3F41A 1HWJA 1UWBA 1LW2B 2IDEA 3Q24A 1CS4B 1WHVA 2V8VA 2XO7A 1VQLS 2RAQA 1UW9A 4P6QA 4NI2A 3ZM1A 1TUGB 1UCNA 2NV5A 4CM0A 1RT5A 4F67A 3NL0A 4PYHA 3V0HA 2V9KA 3J7YI 1FE4A 1QXKA 3PNIA 3ENAA 3UWTA 4KO0A 1QZ0A 2ZOFA 4L74A 2NLKA 2ZE2B 2YH1A 2OZ5A 1F9HA 4IUFA 5CA5A 2QLWA 4D3PA 1FE0A 4TLQA 5BX1A 4LF6J 4RW4B 3ULHA 4LRDA 3BS9A 2OKQA 3O4SA 2HBQB 3BKTA 2A8BA 2NXCA 4R5PB 5DS7A 1U02A 3I6PA 4QU7A 1RB0A 4ED0A 1C83A 1IR1A 2UUAJ 3QT8A 3D1HA 5GVQA 2C3OA 3ZTPA 2CPZA 3GMGA 4O44B 3D28A 2ERRA 3UR0A 3RW7A 2M2BA 4HACB 2AV5A 2ZH3A 3CCRS 3BLUA 4OL8A 3R7NB 1MWZA 4AL7A 3QCBA 2NSCA 1YGYA 1XR7A 4L6V3 1VRUA 3CJRA 3GFZA 1LWCA 3MR3A 2GJIA 4MKAA 3NNAA 4K2XA 3Q0AA 1MWQA 3KLIB 1OPZA 2MKIA 4DL2A 1L3SA 1RAEB 4DU7A 3QCJA 3T3FA 1HMVA 2YKOA 4USIA 2E9ZA 3DLJA 3H40A 4LF1A 1LARA 2ZKTA 3CULA 5AJ3J 2DHGA 2J0WA 5J2NB 4DV5J 3KK1A 1GQEA 4N8NA 2XNQA 5LOQA 4ICZA 5I42B 2FC8A 2BMBA 2PI7A 1TUVA 1HWLA 1G4CA 2GIQA 3JSMB 5A8KB 3JYTB 1G1FA 4F0KA 2ROGA 4I2PB 1N32F 3OPKA 5CD4A 4ZCMA 2EFQA 2OHDA 1VRTA 5E3PA 3L09A 2H02A 1HNZF 3IBCB 4KAIA 1K8AT 2VPXB 2BQ3A 1NDLA 2B3OA 1WC4A 1G4US 5FJ4A 2V34A 2A6OA 1KFSA 4LF4J 2XWXA 1Y5LB 3R7BB 3M7VA 1NHUA 3RUBL 2HAIA 3H7HB 1GMWA 2CQBA 2ZH8A 2VDHA 2UXDJ 1S97A 4NYOA 5E2QA 1RAHB 1P1TA 3HVTA 3NXZA 1M1KT 3LANA 1U0SA 3N4WA 4Q0BB 4B9TA 1A0OB 2VA3A 5LMNF 2KYZA 2BBEA 2NXJA 4X64F 2IM1A 3ZTSA 2VEYA 3OJSA 4NCGA 2V2ZA 3MM9A 3GV5B 3SMEA 1UFLA 3NG8A 3FCHA 1S1TA 2CVIA 3LJ8A 2ILYA 4TY9A 1FPZA 1DLOA 1BC6A 2HNPA 3VVUA 4PRFA 2B3TB 1V6HA 2QMWA 2RU3A 2XMVA 1RTDB 2W7AA 2VU5A 4WYWA 2QCTA 5ETQA 3KFWX 1PYSB 1IBLF 3KTQA 3CW2C 3BQ0A 5FIIA 1RWXB 4OHDA 1H73A 1D1UA 2MY7A 3PW4A 1PA9A 2WOMB 2IRXA 1D3WA 2VEXA 3TOQA 1GTHA 1Q81T 3R1HA 3KG1A 2ZDOA 4C8KA 2N3OA 3MOWA 3VALA 4N76A 4U7UD 1HBMA 1EX8A 2VBYA 3FUYA 1BGXT 1IXKA 1QSLA 1N5TA 1U1KA 3G6ES 4KPCA 2RIJA 1PTVA 5CHCB 1MN9A 1K47A 5E7OB 4QOTA 2VOPA 2QBRA 1YWFA 2XWYA 1ZTTA 2OJ3A 4ED1A 3N01A 2RU9A 4YB7A 4KTQA 2VONA 5L1JA 4C8YA 1NHVA 1R89A 4TVAB 4GRYA 3EZ5A 2RH3A 2NZ6A 2N4DA 1S9EB 1VC6A 1PIEA 2ZZMA 2XJAA 1SV5A 2MQ8A 2FGOA 2HS0A 2RUSA 2D7SA 1T03A 1JLAB 1JLEB 4ID8A 3NWRA 1N0VC 5DDPC 2PN6A 4M5JA 5F3ZA 2YKNA 4NWGA 1MROB 2C2KB 1PC4A 3MEDB 3TVKA 3N6NA 2HS3A 1TL7A 2YNGB 1GQQA 1Q6NA 1RBAA 1UJ5A 2I75A 4WBFA 1J5OB 2E7WA 3TYTA 1OMSA 1YX2A 1RE1B 2RF2A 3IR5B 1WTFA 3GFYA 2FVRA 3J7AN 4LRAA 1RTIA 3CDWA 1MG7A 3GTYX 2JFHA 3C19A 1RHKB 4FYXB 1DTTA 3KLEA 4AD6A 4KFBB 2RS2A 3S7RA 2GGPA 1AW0A 1AA1B 1N6QB 2H65B 2WAQD 5DG8A 2GCAA 2HHXA 1FPRA 1H7WA 2WGPA 2RT3A 2VEWA 1R6YA 1VR6A 2H4GA 1WHXA 2CJBA 2BZ2A 1VBKA 1YIJS 4CLYA 1XNRJ 2RVJA 2B6AA 2V4QA 3AWGA 1SJFA 3MD3A 3MAQA 3RR7A 4QQBA 2HFNA 2L9NA 4ALZA 2XBPA 1S1UB 3AD8C 4UZBA 4ZI4A 2A3JA 4CO4A 1NWLA 4C0HA 3FRZA 4PPDA 1RADB 2MY8A 2KT2A 1IBMF 1X5PA 2EPIA 3VAFA 1DRZA 3RBXA 1EAYC 1CJTA 3DDKA 3TA1A 5T14A 4G3IA 1XMQJ 2F4FA 4P7TA 3AOAA 4JOUA 4HYKA 1R6HA 2F00A 5HATA 2WZ1A 4DUZF 1NK4A 2QT7A 3PRDA 3KLFA 2F4VF 1WC1A 2R0BA 2NSBA 4CO5A 1S7IA 3JSRA 2KRBA 3V6KA 2DNHA 4B9VA 1GX5A 1HW9A 5L8RC 5B7WA 1R6VA 2YNHB 3R6GB 2HVIA 1FTCA 3MM7B 1QAIA 2HVHA 1IKWA 2F1FA 2MHNA 3NRBA 4NLGA 3LAKA 2BJ7A 3G82B 4OX6A 1S99A 4J5OA 4G65A 4LBIA 3OXLA 4EYIB 3FK4A 3SXLA 4P73A 3QCMA 5L9XA 4FYVB 3GONA 2M9KA 3Q2SC 1RWOB 5E5NA 2ROPA 4URSA 2RE1A 3ZTOA 4JYAJ 2LEBA 3KK2A 3MAAB 4L3NA 1XR6A 3QO9B 2DGVA 4D3RA 2CNFA 1GMWD 3OVAA 3QCEA 2ALYB 1RHRB 2NPFA 1EENA 4JI7J 2W4CA 3VR1A 2VHGA 3ILOA 2E1AA 2D3UA 2QA2A 2W25A 3CCLS 2EW9A 4P9SA 4XAKA 1IKYA 2AQ4A 2BOPA 3CIMA 1VQPS 3MVNA 1HIYA 4M5IA 3MCOA 3W60A 5F9LA 1PC5A 1OQ6A 2O66A 3QRQA 3AB2B 2HZCA 3M1VB 4MK8A 4A8OA 4M5LA 1HNWJ 3FNNA 1ZCLA 2CQIA 1M0SA 4EWTA 1YLXA 4CLWA 3HVRA 3R7SB 1FWPA 3GSIA 4LF8F 3HX9A 3IC1A 3HHLC 1GXTA 4WKYA 3K0JA 4W90B 1CJUB 1UVNA 2C2DA 4A46A 2BQRA 3MECB 4KC5A 4ZKAA 1BQNA 5DLGA 3CJSA 3SCLE 4ZLPA 3GJTB 3RTVA 3PACA 3DOLA 5LMUJ 4DR2F 4O3RA 3HPOA 2DNGA 1C86A 1TKXA 1G7GA 4IDKB 2DR8A 3L7PA 3FZBA 1YJTA 1HWUA 1JIHA 5KG1A 3GQCA 5J2MB 2QDCA 2I6MA 2LQ9A 3M2VB 2X51A 1NJWA 3IG1B 4CYUA 3H2VE 1XN9A 3BREA 2R2TA 4Y2MA 3UN2A 4G1QB 3CNQP 3AB4B 3PEHA 1WRMA 3W1YC 2C3YA 2NUHA 4ED2A 3LWLA 4H4OA 3MMCA 1WC5A 3VGSA 2HMIB 2FHOB 3CEDA 1RCOB 1P6TA 2MQQA 2CADA 3BDEA 1UWAA 3D67A 4IQXA 5CCLA 1X5SA 2ASDA 1BZCA 3K5MA 5IT4A 3THVA 4QIGA 5J2QA 4CIOA 3CMQA 1A5YA 3LP0B 4GE6A 1XNQJ 3MAHA 3PY8A 3C6TB 1K1QA 2R2SA 3MM5B 2Z2LA 4DX7A 1X5TA 4E2FB 2AGOA 1HD0A 5KFAA 3IWNC 5FDLB 1H98A 3KMQA 4DSFA 2Y68A 3R97A 3C2PA 3N2AA 1RAAB 3GYNA 2G1DA 1VHFA 5AXLA 3N5FA 3SSRA 3DGPA 1NCLA 2IJNA 5IWAF 1N56A 1VIXA 2C2MB 3VAHA 5BZZA 2DK2A 2GC8A 4EMDA 4C11B 2QIFA 1YKWA 3UDEA 3W9IA 1C84A 1FEHA 4DS4A 4C4WA 4AYBD 1Y5NB 1Y00A 3ZZRA 4X4RA 1EP4A 3BB5A 3F44A 5HQLA 1Z2LA 3A4TA 2MQOA 1K0TA 2IVYA 2O3DA 1U6ZA 2KHDA 4ZJLA 2LCWA 3PDNA 4FF3A 5SUHA 2GIFA 4IO9Q 1WKKA 2C2OB 4DV7J 2Z56B 1JKHA 3M8WA 4HI2A 4IFVA 2WRMA 3Q8SB 2MSSA 4ECSA 4C3MA 1Y9OA 2V5HG 5KFCA 2V0NA 3SDEA 3KJVB 1IM4A 3OHBA 1TL3B 2PQ5A 1KQGB 3NS6A 2DGXA 2CJYB 2BKOA 1U0HA 1WSRA 2HWHA 1KC8T 2H1YA 3OSPA 4JV2A 3H5YA 2B5JA 1TAUA 8AT1B 2NCKL 4NWBA 2BANA 3OBIA 3CTRA 3DLGB 4OZNA 4QUNA 4LVNP 1FQ1A 2UUBJ 3Q8UA 2IAJB 1GAOA 3BLTA 1NH8A 2IMWP 1Y10A 2IM2A 1VI7A 2HQ3A 4URGA 4V19J 4ERCA 3ZZZA 2A2DA 5IV4A 5A6PA 1H7XA 2ZNZA 3PJ9A 4KHPJ 2XMUA 1RWUA 4CVKA 4X4PA 4JV5J 1GQYA 1CC7A 3K8WA 1OQ3A 1N33J 4MYTA 4A8MP 4WTOB 2WBMA 2HVEA 4Y3CA 3NOCA 1HD1A 4RKKA 1U6FA 3TO8A 2H5IB 1JXLA 3OTOF 4QUMA 1PKUA 4ZN5A 2GS8A 2O01C 2XSJA 4ECXA 4CQ1A 1T05A 3NY0A 2DKOB 4GRZA 4IRDA 4N41A 4IG0A 1WSVA 2EG1A 2UVRA 5CABA 4NZ7A 2FDNA 4DL3A 2BGDA 3AXKA 2L48A 5KFEA 3EPGA 3GV8B 4PEOA 4MK7A 1KLMB 4TQRA 2MJUA 1N4LA 3QIPA 4ZHRB 1WC3A 1QSYA 2DHAA 3UVJB 3AWFA 2X1GA 2CYYA 1YVFA 4ZIYA 2R8JA 1AAXA 4XK8C 1X9WA 1VJQA 5GAHU 1M3GA 4KYRA 5IS2A 2XMAA 4O0IA 2JC1A 3OSNA 1OEUA 2HVLA 7FDRA 4Q2MA 4NOHA 4M63A 3V4IB 1Q8LA 1BWVA 4K0KJ 4N5SA 1SQEA 1EHWA 4HJPA 2QBPA 5E33A 2GHWA 4Q44A 2HIYA 5A8RA 1N52B 2X3DA 1S1XB 1NNYA 1L8GA 5IQ6A 2MDAA 5A0YA 4HHJA 5F0WA 1S0VA 3KJQB 1YZ6A 3CJKB 1YITS 3WC0A 4RWXA 3ZZYA 2FYXA 4PUOB 5DM6Q 4DFMA 4MAKA 2NYHA 5I6VA 2I1YA 3WX8A 2D1CA 3TUJC 4I56A 2PEHA 4BCAA 4PQUB 3F9BA 1QE1B 4MKBA 4KGVB 5B08A 1HI1A 4OI6A 2YNFA 1Q6TA 2CUYA 4DZDA 3FCWA 1PG5B 2V8DA 5BZXA 2IHR1 1FDDA 1P3DA 1LWFB 2OPRB 4GVBA 3KK3B 3V6DA 1PYNA 1VQKS 3OUYA 3M8QA 4A48A 3H4DA 1B7YB 4J51A 1OEOX 1FD2A 1J27A 2AGPA 4EU0A 1DBDA 4LREA 4PYAA 1B0VA 3MD1A 2K3KA 3G6XA 1X4FA 4X62F 1KWMA 1WDTA 5K23A 3D3CJ 4P75A 5HBMA 3U02A 3BBBA 4GE2A 5GAGI 2ZC4A 1UVIA 3UR3C 3AJ1A 4YB1P 2C22A 2B9YA 2P9GA 1ZM3A 3RRGA 3QGPA 2MMYA 2VDIA 3FSXA 1FVSA 1RAIB 2L9WA 2BDPA 1WWHA 1LXNA 4GKJF 3OLRA 1FI4A 4QYRA 3CCMS 2IM0A 3BPSP 3VAGA 4KQZA 1YK9A 5DETA 2HQDA 1VQ6S 4K4WA 5G0RB 3LUYA 4ID5B 4DR4J 4OYPA 4C0BA 4J90A 3W5ZA 3AD9C 2R7QA 4JP8A 1EKRA 2QFIA 2RUGA 4F4WA 3M4UA 4F50A 2J9EA 2RKIA 4I64A 2J6TA 3HSJA 1LW2A 1JJ2R 2R7VA 3P49B 1CS4A 4C2MA 3BF4A 4TY8B 2V2VA 4J9PA 1T9UA 3MR7A 2MKJA 1VQNS 1O51A 2DO0A 2R7TA 3OTDA 4LQ9A 3O2IA 4GO5X 2EK1A 3BO4A 3QCNA 3CJ3A 1HBNB 2MZSA 1X0PA 3PJWA 3HSGA 3I5AA 1NO8A 3MPYA 2ZE2A 5KFWA 1C1CB 2ZWOA 5EWGA 2IPOB 1PGZA 3CVKA 5U47A 4RW4A 1U1PA 3M2UA 4DG1B 2MGZA 1JLBA 5GADI 3OR1B 5K8PA 1WORA 4PCQA 4AE5A 5C2GA 4R5PA 2GO8A 2CJXB 4ANEA 5HVGA 2OIHA 1DHMA 2QZ8A 5C2CA 2OEJA 3CGIA 5KT4A 1HQ2A 2NPIA 4WIQA 2QL5B 3BGOP 3D5MA 4M8LA 5M2RA 3T1YJ 2QLBB 2VPWB 4F4AA 4I4BA 2Q1LA 3PJXA 4JI3J 4OI3A 2I42A 4HACA 2HNDB 1F5CA 1S6QB 2E1CA 4LF7F 2VFVA 3HHLD 2XY5A 2AJFE 2BQUA 1YRTA 3K89A 2CWKA 5CYMB 4OYWA 5KT2A 3ENQA 1VMBA 1JLCB 4BUBA 2PEBA 2I0XA 4B3TF 2F9JA 1QAJA 1SC6A 3NBPB 1PAUB 5JMNA 2KJVA 5KAAA 2I9SA 1HNVB 3BGFA 2VTDA 1ZZWA 4ITSA 4ZPTR 3WQPA 2P4DA 4RUBA 4ZRTA 4KGKA 3BGRB 2C2ZB 5I42A 5DGAA 1OJ4A 3JSMA 5A8KA 3VGVA 3R1LA 3T6BA 5J8RA 3DNCA 5ETSA 4OYIA 1UW4A 2YKPA 1HNZJ 2E9TA 3J7A1 2FH7A 3CO0P 4Z7YA 4Z6BA 3DXBA 3Q22A 3JSYA 2WVFA 3HP6A 2UUOA 3W3SA 3D1QA 3T1AA 2XQCA 2R8IA 2DBBA 2VA2A 3HJFA 4Q0BA 2HXPA 4NI2B 6AT1B 4N7TA 1YG0A 1WAXA 3FJ2A 2C1EB 1C85A 4PYDA 3MOZA 3CJ0A 2HRUA 1D8ZA 1EB0A 3I0SB 1NDCA 1PYOB 3PVXA 3DMJB 1M5PC 4EBEA 1RTDA 4LF6F 1XXVA 4USTA 1PSDA 2DNKA 2FJBB 2LQ5A 1FDNA 4WFXA 5D0HA 3O3LA 2UUPA 2L9DA 1VLOA 2B4OA 3EVWA 5L1KA 1RYRA 3OL7A 4RNFA 2UUAF 1ZPWX 3EDRB 3QAUA 5CAAA 1Y0HA 3KG0A 3TW0A 3FQKA 4C0OC 3K5PA 1L3KA 3FBEA 3ZFVA 1SL1A 2FC9A 3LK7A 4ZP9A 2PDAA 1FNOA 3NGKA 3GJRB 2AZ3A 4RBUA 4R0JA 2J9CA 4QCLA 2RRAA 1NM2A 3GR0A 1BMQB 2HCMA 1WACA 5B0EA 2OPPB 3IAS9 3DDNA 1RYSA 3DN9A 4ED4A 1VS3A 3C3LA 4HLBA 2C46A 1S9EA 4XDCA 3ZZ0A 5HJYA 3OL9A 3ZM0A 2PE8A 1KSPA 4DL6A 1HMVB 4USWA 1JLAA 1JLEA 1SL0A 2HWTA 2OPQB 1N5QA 4CM2A 2Z2ZA 1ZZFA 1CPZA 3EU0A 4KGZB 3E51A 4U96A 2BV5A 1VLYA 1I51B 5AJ3F 3KK1B 3GIJA 3EM1A 1WTBA 2DIUA 1W7KA 2ZJPQ 2QA4G 4DV5F 2HC1A 3RW6A 1NK5A 4WKRA 2YNGA 3MPWA 3DHXA 1NSKL 5GMEA 1DZ5A 3N79A 3GJSB 3N9UC 5AE1A 1I94J 5EWEA 3PZPA 1RLCL 1VC5A 3ZM2A 2E1MC 2MZRA 5ADZA 3T1HJ 2K2PA 1JX4A 4OQJA 1UKUA 4TYBA 3ISND 1EEOA 3LALA 4Y2KA 4F04B 2JL9A 5HMXA 4QWBA 3NGTA 3IRXB 4I68A 5T41A 5DDRC 2QMXA 3V81A 3SBMA 4LF4F 2H4WB 1T4JA 2W2OP 4KFBA 1YTSA 3GR1A 4JI6J 2NXEA 5J1PA 2UXDF 5LM7E 1N6QA 2XMTA 1NXIA 1JLFB 4IQMA 3D68A 1WEZA 3K5OA 5D0GA 2VORA 2UXBJ 1N5YA 5F8MA 2KM8C 3UQSA 2ACMA 1P31A 1EIYB 4C9DA 1NPRA 1F9FA 1S1TB 1UVLA 4DSJA 4LIRA 2YPZA 1QY7A 1Y7PA 3I5CA 1S1UA 1UVJA 3RB0A 3EX7B 4YR2A 5EDWA 2YTCA 2ZITA 3FBBA 1U1LA 5KG5A 1LWEA 3SI8A 3KLVA 2UVWA 4F36A 3KUGA 2E5LJ 4F2RA 4C12A 1K73T 4G6VB 1YTNA 5D77A 1APSA 3ILLA 2XS2A 4X66J 1YBUA 4CRJA 5B0BA 2LP4A 1Y3KA 2QN6B 2I6JA 1T9YA 5K25A 2HKEA 3VAKA 1T48A 1NAQA 2UAGA 4A8YA 2EXUA 3MEGA 3CC4S 2OSRA 2CNNB 3UD5A 3RGOA 5F8GA 1MMNA 2LA6A 2Z4PA 2VFUA 2YNHA 3LH2S 3MM7A 1ZBTA 1UFWA 5C24B 2DNMA 1SKSA 2E5IA 2M4MA 3DRXA 2ZZNA 2AHSA 1B7FA 3CD0A 3G82A 3ENWA 1FTRA 4UQGA 3OVBA 1T03B 1YJUA 4GE5A 2DXFA 3ADAC 1S77D 1MWYA 4ES2A 1C4AA 4KT0C 2UVVA 4OHWA 4CLUA 5THWA 5JJBA 4ED3A 2EVZA 4F7VA 1TV6B 5ETPA 3MAAA 3O1LA 3OFFA 3QO9A 3M32B 1S76D 1WOOA 2WSEC 5M2UA 1R27B 2LU1A 3W61A 1RLDA 1WJ9A 2MYFA 4JI1J 4UF4A 4DF4A 1M5HA 5IXUA 1C87A 1KVIA 2I6OA 2AHOB 4Y2CA 1T49A 5KFTA 1V3ZA 1PTTA 4S0MA 4JMJA 4DUTA 2V8GA 3R5DA 1FRLA 1S1WB 3CJ4A 2AJ2A 1BUXA 4JI4J 2GQCA 3JQKA 3LF0A 4LRFA 5KT3A 3M1VA 2R8KA 4IR9A 3QJLA 3NGRA 4GKKJ 2YBVA 2DR6A 1BHNA 2OI2A 2DYAA 2Z30B 1NK8A 2DR9A 4WE1B 3DFEA 3AOBA 3MMBB 1D5RA 1YJ7A 2N82B 2WTZA 2JFKA 2HHSA 2WVCA 3DDIA 1CJUA 3QSIA 3IBFB 1W26A 1XNRF 2DY1A 1NJZA 2X5OA 4R0SA 5E3QA 2NXUA 4MH8A 5LXYA 3Q23A 1QLNA 1X4CA 1RACB 3W2WB 2QGFB 2VG6B 2M8HA 2OTLS 2QRRA 3ZNUA 4NLXA 5HP1A 1RWNB 3BGLA 4MTPA 2J0SD 4TU9A 4K8RA 1TK8A 1FO1A 3M8PB 1O5ZA 4Q45A 3DOKB 4NLWA 2GQQA 1YDLA 4IDKA 2W8LA 3B4DA 4NEYA 1SUQA 3ZZPA 1XMQF 4BUCA 3M2VA 4F0HA 3OFGA 1SQGA 3CMES 1VISA 1NEEA 2IA0A 3SSSA 3G8SA 2EFVA 4G1QA 5LXRA 4HHUA 3QLHA 4QIEA 3HDSA 4TQSA 1YBTA 3I32A 1ZZNA 2KN4A 2HMIA 4NWFA 4TYAA 5KFIA 2NXNA 5K9VA 2HGMA 1A9NB 2VPYB 2W9AA 4OLPA 2ZOMA 3ZZTA 2RRNA 2BE7D 4KSEB 2C3MA 4D3HA 4RUAA 3N6LA 1LK7A 2LXUA 4RW8B 3OQ2A 1UZHA 1ZETA 4ECVA 3CE8A 1GX6A 3LP0A 2IA6A 4DR1J 3Q89A 2QJ3A 3C6TA 3MM5A 5BJRA 4YHHJ 2CKWA 4G1IA 4P2FA 2DXEA 2WW8A 5L38A 3X1LB 1Q7YT 3ZO7A 4JYAF 1Q6MA 5FDLA 1TFYA 4IFYB 5KAKA 3CJTA 1MN7A 1RISA 3L9ZA 3EDQB 4L75A 5KACA 1E6YB 2PI5A 2O67A 2EFPA 2ZHBA 2BKNA 4AQYF 3VQTA 2K8GA 2A2CA 4JI7F 4CO0A 3G8TA 5KT6A 2CFXA 2D9PA 1OY6A 1UFKA 4C8NA 1D9AA 1IKYB 5I3QA 2XCPA 4HH0A 4C11A 1NDPA 3BM7A 2FY8A 2BVZA 3QIDA 2ILZA 2CJZA 2HNQA 1MW7A 4M94A 2BYCA 2JZ5A 4O3QA 2BACA 2YKAA 4DV0J 3FMWA 4CP5A 4DR3J 4W92B 4YFUA 2R7RA 1HNIB 1IJFB 5J1NA 3H2LA 5IV3A 3PS5A 4WFBQ 3C15B 2QA4S 2UUCJ 4PXCA 5IBMA 2QBSA 3GSDA 3B8HA 2Y8YA 3CO9A 3WBZA 3KNAA 4B17A 2MB0B 5HMWA 4OJ3A 3O4UA 5ETOA 4YB6A 5D4OA 1WCHA 3KJVA 1S4EA 4RX6A 3FSIA 2G0JA 1KHWA 1TL3A 2CZ9A 5ETNA 4NXMJ 2VTEA 5KA4A 2KVQE 5LMUF 1FFWB 4KV8B 1EQ0A 2KZMA 3IRWP 1TKXB 2ZN7A 4MK9A 5KFXA 4ECWA 3DLGA 2H5EA 3VV2B 1U8SA 5AWXA 2UUWA 2ADBA 4K59A 2IAJA 3M30B 2A0FB 2E1RA 3UPFA 5F3TA 2GQ2A 4M5NA 2P6SA 3MCSA 1NSPA 4QAHA 4FF4A 4RO0A 3A5KA 2XYGB 5IBSA 2W7OA 5MMZB 4IG3B 3M2RB 1MMLA 1CJVB 4GO7X 3HVAA 4KYZA 4PABA 4HTIA 3M6XA 3MPDA 1B4SA 4H4OB 3MMCB 3V6JA 2HHTA 4WWSA 2XGQA 1X0FA 4DL7A 1U4BA 3J80Y 2X3GA 1RA6A 3RB3A 1W2IA 1ZA2B 1P1LA 1FX2A 2FPHX 4IO1A 2FHJD 2BW2A 4PWDB 2GFFA 2Z58B 4OHHA 3RAMA 1LYVA 2GO9A 3CJQA 4I6YA 4B9MA 1ONZA 3TQ1A 3J81Y 4DF8A 3EXCX 3JTOA 2HQFA 1XNQF 3CJ2A 1Q53A 1VHRA 3BPDA 1FKOB 4ZLLA 2M70A 2VKRA 4LRBA 3QCGA 2HZAA 3TZWA 1NL9A 3K5LA 1MNEA 3SQGB 3UVJA 3ZL8A 2APOA 1UEUA 2WVDA 3JAMU 2DCUB 2CIMA 4ZVUB 2VBXA 1NSQA 3I55S 4P71A 4DZ6A 3D6TB 2HG4A 1NHKL 3QGIA 2DY9A 2OPSB 2F6VA 1FNMA 3V4IA 1OY9A 2FJMA 1PO6A 3NCQA 4DPYA 1SC4B 4LR8A 1EP4B 3UCGA 1H72C 2OD6A 2A3KA 2HVZA 3EZUA 2AP6A 4NEZA 1B3TA 4IR1A 3F81A 1S1XA 3J7YU 1R3NA 3J81U 3CJ8A 3CJKA 3VQSA 4CO1A 5EN1A 5J2PB 4DV7F 3H5SA 5EHPA 4IFVB 2DH9A 4PUOA 2XGPA 3QKQA 4CVLA 4BS2A 1M1HA 3HSDA 3V0FA 4TKTA 2UU9F 2W8KA 3OL6A 2PC6A 3I4HX 1WD6A 2JEGA 4PQUA 4DQIA 2MXYA 4ILRA 1JK9B 1OIAA 1U1QA 4DX6A 2RHSB 1RDRA 2PD1A 5H9EJ 3PW7A 2QSWA 2Q6BA 4L72B 3CCJS 3POTA 1LWFA 2OPRA 3KK3A 1OHDA 1LXJA 3FCVA 4BJOA 3EB1A 5EWFA 1NPPA 1IVZA 2KRRA 4RI5A 2W1BA 1FRIA 1TL1B 4KHRA 2UUBF 1U47A 4G1PA 1NB7A 4QR1A 3HFKA 4ED6A 4FF1A 2KXHA 4MT1A 4DV3J 5LSOA 3MTKA 4F3OA 3ELHA 2ZWPA 2UV8G 4RDDA 4YAAA 4A4JA 2KFYA 2XNRA 1KQSR 4F4ZA 3I87A 1RU1A 5F41A 3M6WA 2AYEA 4OYZA 5A8WA 4KHPF 1SPBP 1KNZA 2OC3A 1T11A 1RJJA 3IM9A 4JV5F 2I4HA 3GYGA 4URQU 2K7KA 5A2QY 1HNXJ 2AEJA 3OTBA 1N33F 3PFEA 3O4TA 4K4YA 3HULA 4NA3A 1VHIA 1AFIA 1NUEA 4C8OA 4RR5A 4C6AA 4CT9A 1D8YA 3DGVA 2QV6A 2MBCA 5JUMA 3UN3A 3NCRA 2BUNA 2FHMA 1T05B 3PYDA 2VUGA 2KI2A 2R4FA 5G0RA 4YUDA 4ID5A 1U25A 1URNA 3SZ2A 5EX3A 2W9CA 3K5NA 2QLFB 1HFEL 1Q1MA 4H4KA 2PMHA 3NRSA 3HZGA 1Q5VA 1PJ6A 4J9QA 4WFAQ 4DUYJ 1N5VA 3QIPB 2DNRA 4TY8A 1Q79A 5B09A 5KT7A 2FHKA 2P5VA 1S57A 4MIWA 1HBNA 3MUVP 1XMBA 5KFBA 1P15A 2VBZA 2NREA 2C7SA 1LFPA 4QF5A 4HT5A 4Q8FA 4ELVA 1C1CA 3BKUA 2F8EX 5F8JA 2Y2FA 2E5HA 2UVUA 3I4PA 3D66A 1T9VA 1IBKJ 3TA0A 1SVDA 3W8PA 2BGEA 1NB2A 4DV6J 4DG1A 2VZ9A 3D0HE 3FFIB 2E5JA 1B70B 4K0KF 3OR1A 2BOAA 2HNYB 3BKFA 4DXLA 1T3NA 2DTJA 4FPRA 3A13A 3NKYA 4WZMA 2NR0A 4NYZA 3D1OA 4A8QA 1RUSA 4USUA 3QRPA 1RT2A 3KMSA 3ZZUA 4PXBA 2KH9A 3HHEA 3LO3A 3K57A 3LQVA 3CCVS 3LWMA 5AXKA 1RT3B 2HNDA 2WSFC 4Q5VA 2DD8S 3W2VB 4YS2A 4LT6A 4RBTA 2YNFB 1Q0NA 1KBRA 2CNKB 4DPWA 3QKPA 2V50A 4GVBB 5CYMA 3OUYB 1HW8A 3EYZA 2R9LA 3IR7B 4H4MA 1JLCA 4YP3A 5B0DA 2J7WA 1DTQB 5DJBA 4B3SJ 3NBPA 3W65A 1OYDA 2CQ0A 1G3OA 1HNVA 3ONQA 2ZUGA 1S1VB 5HBMB 5BYSA 2OMOA 1EKSA 5DZ6A 1RCXB 2CQPA 4EK2A 3BGRA 1QM9A 3QSYB 3L7UA 4Y0FA 5CQGA 3IAM9 3SSQA 2CM8A 1R31A 4N47A 4BDPA 5KG6A 1WI6A 4B9LA 3P5TL 2PGCA 3V0JA 2GHVC 4DV2J 2DHHA 4OV6A 2W9BB 1O0PA 3SCJE 4ZCKA 3I9V9 2G9OA 3ITHB 2XY7A 4PAAA 2W4PA 4UAGA 1X8DA 2A1BA 2MLZA 1QVFR 4ZCLA 2AGQA 2D3ZA 3PX0A 4DR4F 2YVSA 2DNPA 2JEFA 2FJEB 3R5CA 4WK1A 2U2FA 2H4VA 2IVMA 2RKIB 3E3XA 2CPFA 4HI1A 2FLPA 2CRLA 4RH5A 1UJ6A 2JLEA 3BO2A 1PXHA 2HFOA 3OMHA 2CPJA 1R8BA 4HV4A 4NNDA 4RU2A 4Z7CA 2FQQB 1S6OA 3N0AA 4I8NA 2R7OA 2ZBCA 3GLJA 5D15A 4RU9A 4KRWA 1EZZB 4MMOA 3JSBA 3W64A 2B9WA 3GCXP 3LA0A 3NLCA 3I0SA 3RBEA 4H1OA 2DPIA 2AD9A 2HHWA 3DMJA 2AYMA 2CG4A 1HWKA 3ZMPA 1RI7A 4X84A 3M2UB 2RD5C 1F5AA 2CQ3A 2MGZB 1JLBB 2GJTA 2IVFB 3CT9A 5LT5A 2HVDA 3UN5A 2GC6A 1X4BA 3UW1A 5C5JA 4Y65A 4J9OA 3TAMB 4C8ZA 1DQAA 3UNGC 4TXSA 4QAPA 2QX0A 4FBUA 4FYWB 2C42A 3WC2A 4AT1B 3SV3A 2ACYA 4DPUA 3I36A 2AIRB 3CDUA 2W2PP 2CVEA 1C88A 3T1YF 4ENOA 3DLKA 1S6UA 2AZRA 4JI3F 3ZV2A 3W5YA 3GZ7A 3OFHA 3QJJA 3TAQA 2BM0A 3IA0A 1VIOA 1CBKA 5F9NA 1FXLA 4JI8F 2OPPA 3G4SS 2GMJA 2AM1A 3L95X 3W63A 2VF3A 2CWXA 1T0TV 2GVDB 2CNGA 2DNZA 5ITHA 5B0FA 2X7IA 3W62A 3E2EA 1HQUB 3TZYA 2FGCA 2DHSA 5KFRA 1ZH5A 1FJGJ 2OPQA 1I3OB 2OEMA 1Q5YA 2H03A 4W4MA 3VZHA 1S6PB 2E66A 2Y1LB 2OELA 2AF6A 2YX4A 3C46A 2OUGA 5JVGQ 5KA1A 3K2YA 4OYBA 3SMZA 4FPIA 3UDVA 1U1RA 4QPXA 2CQDA 4YDXA 3A8JA 3AAWB 2BW7A 1H2UX 2KU7A 2C2EA 1F6TA 2HK3A 3DLEB 3IRXA 4ZK7M 1NU4A 4U95A 4JI2F 4DGXA 4O23A 1RPMA 4HJQA 4MIBA 3U27A 3G8QA 1N0UA 1IN0A 3HM9A 3H0PA 5D6GA 3NGUA 4K5RA 2HFVA 2ATLA 3MGJA 3DRPB 1QTNB 1RQ0A 1JLFA 2DRBA 2WONA 1UZDA 2MKSA 4LF9J 3QNWB 1XRIA 1JLGB 2RSQA 2FVCA 1MLAA 1JLQB 1JBWA 4CLSA 4DI6A 2N4CA 3E8OA 4OZ2A 3R5AA 3TQEA 1TK0A 2B49A 5F0UA 4AUKA 2XMWA 4TU8A 4GWFA 3DRSB 2Y3YA 2XPCA 1HBUB 3HD1A 2J8SA 4YB5A 1YBAA 3ENVA 5DM7Q 5H1SV 1B64A 4BLGA 2Q3PA 3W9JA 4FZVA 4A8WA 5L1LA 2CZ4A 3TNVA 3JQMA 2H48B 3DLLQ 2X1BA 1WF2A 2Y1JA 1XK8A 1OHEA 4IOBA 1QD1A 2QFJA 3BEGB 3BYRA 2CNEA 3CDEA 4BC9A 1P9YA 2PT0A 1TUWA 6FD1A 2NYIA 3PRVA 2EG2A 2X1AA 2HLTA 4I2QB 2AWZA 2J16B 3G9CA 3H5XA 1T94A 2M3DA 1NO6A 3D3BJ 2AX0A 1Y5IB 4HHHA 3PX6A 3MEEB 3GE9A 5C24A 3MURP 1TKDA 1TMJA 2BA9A 2VG5B 4I69A 4L73A 1FRHA 3D6MB 3MI7X 2I6IA 4YR0A 3S1TA 4UOHA 2ZKUA 2AU0A 5IFMA 4CH0S 4ED7A 1TP7A 7FD1A 3MF5A 3CCTA 3D6FB 4P2SA 4F0MA 2FJXA 3B4MA 4DR7J 2F8MA 3TJ9A 4J9RA 2Q66A 1TV6A 1KEKA 4Y28C 1RKJA 1KTQA 3KDOA 4K2JA 4ZP7A 1I94F 3M32A 1TKZB 3O6QA 2XLJA 3M9MB 4J9VA 3T1HF 1KVKA 5K5MA 2DH8A 4RBVA 1UVMA 4OI4A 1UP1A 4KGMA 2YWWA 2OAUA 3EVMA 5KFPA 5IC6B 3V81B 1QAXA 4UY85 3GILA 4DL4A 3CCSS 1W2BR 1NLKL 4NA1A 2ZH9A 1VK3A 1S1WA 3AWEA 4K7QA 2R7WA 4JI6F 3TARA 2IJFA 1A6LA 1DFDA 2Z2MA 4MFBB 2LXFA 2DGSA 3BR8A 3I82A 4KB7A 2SXLA 2V67A 5ETLA 1N5YB 3PG9A 4WE1A 4DQPA 2UXBF 1WF1A 2VQEJ 3MMBA 1ZAVA 2ZC3A 5CZVA 4OI0A 2PA8D 1LKZA 1S10A 1U1MA 3MMAB 1FJEB 1HA1A 2HFUA 1L8KA 3G86A 4UY8T 5A6WA 2EBGA 5LXQB 2JDJA 3DU6A 3W2WA 2Y9HA 2VG6A 1WKJA 2RS8A 1LFWA 1I57A 3IS9B 3VTIA 2F9DA 2UV8A 2XULA 3ILIA 3M8PA 4DR6J 1UTAA 3PR4A 4QBWA 3DOKA 1LWEB 1R0CB 1NPKA 3BSNA 2CXEA 4DR5J 1NK9A 4KY3A 3VZIA 2E5LF 1FD8A 3IGVA 2CQCA 1L3VA 2J0QD 4WFZA 2DRDA 3V0DA 2D3O1 2O1PA 3NOGA 4AL6A 4X66F 2AYGA 1G2EA 1S12A 4ZVRB 4LFCJ 3GU0A 4QYZK 4R0EA 4I0WA 3TRGA 2Z0GA 8ATCB 1PTUA 4IH6A 1EQMA 3OXFA 2BRLA 3S6EA 3MEGB 2MQMA 2WBRA 1JWWA 4CH7A 1R8PA 3HF5A 1Y3JA 4WPAA 3IN5A 4BHQA 3V0IA 2AKWB 2P8IA 2GJ2A 1VQ9S 3PW2A 2J6SA 4E8UA 3CCUS 4RW8A 4Z2XA 1GFYA 2GVZB 5DG7A 5IT9U 3QQCD 3TEGA 2UUTA 4HR2A 4NRTA 1U2RA 3L3CA 4X4QA 1L3UA 2EFOA 4U67Q 4ZPDA 2N7CA 5H9EK 2DEIA 2L3MA 4XDDA 3CWJA 2HFZA 3KXDA 4IFYA 5C7PA 3IO1A 1E6YA 2GAGC 4Y00A 3QYYA 4AQYJ 4DCJB 3G87A 1H2VZ 4EBDA 4JI1F 1M1GA 2QA1A 1YHQS 3ZTQA 2AM2A 2R7XA 3BSOA 4J7CA 4NXNJ 2KO1A 2FZGB 3NGDA 4ILMA 2WTFA 1OSCA 3D9BA 2FLOA 1S72S 3PEJA 1PTYA 4JI4F 1GMUA 3MEKA 5MLCV 1WI8A 3AHPA 1U6BA 3KLGB 2HZVA 2VFSA 2B8QA 5HN0A 2P6XA 2RDIA 4PQAA 5AE2A 3GV7B 1TL5A 4GKKF 1W7WA 2MZJA 3O44A 3R2CJ 1F2GA 3N28A 2LXIA 3KDNA 2CNLB 1HNIA 1SJ3P 1HKAA 3C15A 2VIHA 1HLWA 3BBCA 3HFZB 3NGSA 3Q86A 4X4OA 3HCXA 4KGXB 1TFWA 1LQ9A 1R43A 3EE3A 3RB6A 3QCDA 2H5JB 1F60B 3VCDA 1U09A 3VGUA 1RAOA 2F3JA 5HP1B 2FVSA 3M8ZA 3EWGA 3PX4A 4XIUA 4CWBA 4ZPCA 4GC7A 5IOLA 4KV8A 3QFWA 5KFMA 1OETA 3LP2B 4DV1J 3IR6B 1BXNA 1H2TZ 3OD2A 2YH0A 3B6BA 4WXOA 1SUQB 2F6ZA 3M30A 2ZUAA 3Q2TC 2E44A 5F8NA 4YR8B 1T9WA 2JH3A 1Q1KA 2BABA 2AYBA 1RZMA 4EYHB 2DGQA 4NLQA 3GWCA 4ANCA 4CVMA 4IG3A 3M2RA 3QLHB 2MQPA 2ZBIA 1CJVA 4FVMA 3LP1B 3PFOA 2VH7A 3TJAA 4M5HA 5GAEI 1X60A 5CZXA 1J4XA 2CM7A 2RQKA 3HHLB 5HVHA 2DNQA 4QJVA 1JNZB 4PWDA 2NZCA 3DCAA 3RZ2A 5C25B 2YWGA 4LQ3A 1DARA 1XM2A 3PV8A 1AUSL 3BSAA 5GAGU 2XCAA 4DR1F 2MQLA 1FKOA 3Q8QB 2CPYA 2DGWA 5LSRA 1KAKA 4CLFA 2R8GA 4YHHF 2F6YA 1FFSB 3BBFA 2V8HA 1IQZA 5CYQA 3SQGA 2MPUA 2ZH6A 2W2QP 3UAGA 2DH7A 1YFOA 3KOAA 1LWXA 3QJPA 2B8PA 1X9MA 3VAMA 3R2DJ 3FGVA 4RW6B 4B02A 2ZMMA 3TX0A 2QMUB 5ETVA 3GFHA 2OPSA 2FLLA 2QTWA 4RH9A 3V0EA 2PA3A 4Q7AA 2MTLA 2GHPA 2KYXA 2B56A 2J5AA 1V5IB 1NJXA 2KZZA 3CC7S 3Q8PB 2AJ4A 2XSFA 3ZC4A 4U7CA 3A8KA 3EGVA 1S0MA 3ET6B 4CLZA 5AXNA 2ROEA 4DV0F 1XQIA 1S9GB 2Q43A 1QUVA 4DEZA 4UUWA 4DR3F 2DO4A 1YQHA 3MTJA 4O3NA 2I8EA 3N5BA 3DC2A 5J2PA 2RHQB 4YEAA 2J8AA 3BM8A 4NMLA 2UUCF 2KXNB 2QYCA 1G7CB 1AROP 2UU9J 1UPPA 2Z8QA 2BJ1A 3QCFA 5K22A 3EICA 1ONYA 2F71A 2VFRA 2YY3A 3S01A 1VGYA 2B43A 4NXMF 4ECYA 1RGVA 1U45A 2OEKA 5A76A 4CI0B 4RNHA 1TKTB 4JI0J 3GG1A 1WF0A 1PBAA 1TL1A 4LFAJ 4QBEA 2VC0A 3FEYB 5CXTA 4D3QA 2F6FA 1E0DA 1BQMB 2ASLA 1S0OA 1Q6SA 2BZLA 4I7FB 3BZQA 2ZH1A 5D4PA 1OS5A 3VHQA 1NJYA 3RR8A 5DZ7A 2BJ3A 2CPXA 5HROA 2Y67A 1J6UA 3ISNC 4C3KA 4K4VA 2XMKA 4D3GA 1FESA 3DRRB 3RJMB 1FHTA 4I6AA 2DEJA 1H74A 4W98A 2C2RA 4HRFA 1Y11A 1K44A 5ETMA 4DGPA 3AH6A 3PM9A 2MJNA 3SQOP 3QATA 5M2PA 2CAJA 4L76A 2BIJA 1Q82T 4OHIA 2XHCA 2DIVA 2FLNA 1S79A 1RTZA 3MM8B 2GMHA 1TZ0A 4LJMA 1MSWD 3JB9k 4GS0A 3S8SA 5KOXA 3C6UB 1NZ8A 2W01A 4WZQA 3R9LA 4K4UA 4C3LA 4DFJA 2YQ3A 3B7OA 2D69A 3BN7A 1SKWA 2HHPA 4OZ3A 1TVRB 4FYYB 1S9FA 1O6XA 1GT8A 5BR8J 3SCIE 2ABYA 2UZAA 3CWEA 2MQNA 3FFIA 3P4UB 5ETRA 2HNYA 4RW9B 2CMAA 3TVYA 1FF2A 2KG0A 4A8KA 5D3GB 4QDIA 2XMJA 2V4JA 2VOOA 1XWLA 2HAFA 4Y2IA 4CLTA 3RRKA 3IM8A 2DXDA 3CD6S 3D54A 2BXJA 5CD4H 4ETXA 2I5JA 1S7HA 1HYSB 2B0GA 3D44A 2Y1RI 3R5BA 1RT3A 1R8CA 4O0NA 3ZM3A 3W2VA 2N3LA 1JF7A 2IBOA 1X9SA 1E6VA 3CCES 1I9SA 2COLA 5HQMA 3FEZA 4UQTA 3POTB 2FJNA 4ILLA 9ATCB 2LVWA 4RJVA 3AJDA 1SUGA 4V19X 1QSSA 5A5FA 1DTQA 1CJKB 2BJ8A 1UMJA 2CDQA 4B04A 1FK9B 1MMDA 5HJXA 5DDQC 3PIPQ 3RBZA 4DV3F 1S1VA 5IC4B 2EKNA 3PO4A 4Q43A 1K0VA 2IM3A 1RT6B 1HHSA 1SIWB 4CDIA 3EJMA 5A8WB 5K9FA 1WHYA 1BE4A 3EPIA 3QAEA 4P52A 2CG8A 3VAJA 1ZM2A 1RXDA 3GP9A 3GIMA 4DHVA 3MR5A 2J6UA 1HNXF 5C42B 4PG6A 1J5EJ 4EZ9A 5EUHA 2W9BA 2XI3A 3ITHA 2M7SA 3OT9A 1XBWA 4LBHA 4ZA1A 5DGBA 2IJRA 3NAIA 4DN0A 2JLFA 2HC2A 2ZFHA 2W9CB 4RI4A 1IKXB 1KTVA 1ZM9A 4NLDA 4YR3A 2IC3B 5I3UB 3C66A 3FSYA 3C16B 4ZVPB 2P6TA 1HPZA 4DUYF 2E29A 4C8LA 1Q95G 5HK4A 1FVQA 5K20B 1KRPA 2DGOA 3FBCA 1WOPA 4EI2A 3NMRA 1QTMA 3WHIA 3LTOA 4FS1A 3PYEA 1WOSA 3TUPA 3WX4A 5IM0B 3D42A 4DCOB 2VC1A 1OSDA 2GX8A 4JI5J 5LJ3Y 5KFDA 1IBKF 1AFJA 3DOMB 1BQXA 1X31C 2ZM6J 3KHHA 4ERDA 3GFXA 4P72A 4DV6F 1RTHB 2QBQA 1CULB 3AQPA 3TAMA 2CDRB 5HSPA 5DQHA 3QT5A 4DX5A 3JQJA 1SJRA 3TEHB 2BE2A 2DITA 3PXGa 2HQGA 2CPEA 3QWPA 1NK7A 5BYQA 1RT2B 1G1GA 2D9OA 4J91A 4CNZA 2ESBA 3W7BA 3A3PB 4FBTA 5KADA 4X65J 2BRKA 1UPMB 1T02A 1XMOJ 3BGUA 3RO1A 3A3NB 1NKCA 3GIIA 4C98A 3W66A 2UP1A 1T9XA 1CSJA 4JI8J 1P8GA 4QU6A 4QWDA 2D74B 3SEOA 1JJCB 3G96A 1WHWA 3VGTA 2VD3A 4H4MB 2HQCA 2RDDA 1DAXA 3Q8VA 3I0RA 2QSFA 1AB8A 1TK5A 1HR0J 2ZBQA 2GVDA 4K4XA 4B3SF 1ZTWA 1HQUA 4GVLA 1NWEA 1T3OA 1VOMA 5E3CA 3D6HB 2I6PA 3G6YA 2HPUA 4YDDB 1S6PA 4CH1A 4DQSA 3OLBA 1RP5A 2QLXA 4C97A 1YRUA 2PMWA 4OX7A 3NEKA 1X4EA 4ZP6A 1KQFB 1TL4A 4FYDA 3M05A 4M5DA 2E0TA 4DV2F 5HL7Q 1FGSA 2IRUA 2CM3A 3DLEA 4LSZB 1R8HA 3GCWP 2AJ1A 4JI2J 4EZ6A 4FNIA 2E7XA 3HHKA 4JNBA 3HXMA 4F8RA 4EFAC 1T9TA 4F2SA 4ZS6A 1YSJA 4U9RA 3BSCA 3IP0A 4ZPBA 1N5SA 1C4CA 4IRCA 1I5OB 3DRPA 2L41A 5K14B 2F46A 1VRQC 2ASJA 1IM6A 2LQBA 4RUHA 2QDMA 2WVEA 3M6UA 1XEZA 1U1OA 1JLGA 2YWFA 4DL0C 2VOSA 3X3UA 5SZTA 1JLQA 2JEJA 2I3RA 2XG8A 1U2CA 3US5A 3TANA 2AJQA 1TMMA 3SFUA 4Q2LA 2GMLA 1EETB 4OYMA 3R5GA 4O4RA 1IKVA 3P96A 1JXEA 4ZIVA 2RILA 4U7UK 4K50A 3ILJA 3MR6A 1NBEB 2YX1A 5T7LB 2Y1OA 3DRSA 3PHEA 4LRCA 4PXDA 1HBUA 1RT4A 2YWEA 1NMEB 2LYVA 4NLYA 4CCHA 3CPWR 2I2YA 3RGIA 2ZD1A 1N48A 2LECA 3DLHA 1QUPA 3N0VA 2VB6A 3DLKB 2OLWA 3UO0A 2AMCB 5IZHA 5KFNA 1BD6A 3TWZA 2VV5A 4OJGA 4CLKA 4I2QA 2J16A 3T5LA 1NJIT 4I67A 3AT1B 1ELOA 3T5JA 2KHCA 2F70A 2F5GA 2HHUA 1F3FA 2NTAA 4ZVSB 3MEEA 4MIAA 1Q6JA 4GC6A 2VG5A 2H54B 3OW2R 2GNKA 4UZCA 4HDGA 4OZJA 2HYIB 4PWUA 3MCMA 4NYHA 3C14B 2I6WA 3H5UA 1FJGF 2DCLA 4YQWA 4RPFA 4ZVEA 2VASA 4J9LA 4M5MA 1U48A 1WUUA 2V8PA 5HAOA 1VQSA 2YPYA 1KLNA 3CCWA 1W25A 4FKXA 1OPIA 3QFHA 3DLBA 1TKZA 1RAGB 2XTJP 3HLUA 2EI5A 2GW8A 4NASA 5KFSA 3P3DA 3LGHA 2R2RA 1IBCB 2XM3A 3DI6B 2G1HA 2Y66A 4M5GA 2YWKA 2HRTA 2QCJA 3MWBA 1XC9A 1IWGA 4DPOA 2LEAA 4Q8EA 2KXFA 2VJUA 1H38A 2FZCB 1WG1A 5A5EA 1NZAA 2WONB 4MFBA 1HQEB 3OTEA 2PFFB 2HQIA 1TELA 4PG4A 5KFKA 5EGYA 3JXOA 3OV7A 4LF9F 1ZOTA 1WG5A 4LSLA 3S4EA 4QWAA 2IBKA 2VFTA 4USJC 5D78A 2R3VA 4E98A 1KDNA 3EAXA 4OZ1A 4Y2EA 3KJFB 3MMAA 3TI0A 5J1EB 3TAPA 3LW5C 1S49A 1Q6PA 2F8HA 3FBFA 1S0NA 4J9UE 3QGGA 4NE9C 1PJ7A 4QIFA 1FDAA 1FWLA 3T41A 1FXDA 3OVSA 3OLAA 2R7UA 4WP3A 3QCLA 3IS9A 2OH2A 1NK0A 4ZVFA 2Y0BB 2QC3A 2MLXA 2SHPA 5MAOA 4I6WA 5HLFB 4Y14A 3NS7B 2JRSA 2XZDB 4C7QA 4EUVA 1YN9A 9RUBA 2IIHA 3A3OB 3U96A 2HHHJ 2VQFJ 2OMLA 2GV1A 3CDAA 1UAGA 1IUJA 1IR0A 1I1GA 4S0GA 5HDEA 3DRYA 1MKPA 4DV4J 2AX1A 5KG2A 2KTQA 5AT1B 2HBRB 4R0TA 3MM6B 3QCZA 4NA2A 3UD4P 4QW9A 2LMIA 3CXCR 5DG9A 2KM8B 1YJVA 1URRA 2VPZB 2BR0A 3U1MA 3HFVA 1Q8KA 2V2QA 4F26A 1N34J 4KH1B 3VAIA 1AZSA 4WYLA 5K8NA 1SKUB 2GVZA 3U1NA 5F8HA 4QWEA 3BYPA 4DQRA 4IKAA 2RB7A 4NLSA 4DR7F 1DY3A 2YKMB 2ALZA 2YXLA 5D4LA 1HWIA 1D0EA 3I7ZA 2XI2A 4O3SA 4P74A 1F1BB 4ES3A 2CNHA 3P5BP 3QRRA 1Y4ZB 3P8BB 4E0DA 3RRHA 4MJKA 1HHTP 4XO0A 1RWWB 2HSEB 3EGZA 6FDRA 1F2HA 3BQ1A 1FERA 2WK4A 3CCZA 3CMAS 3WIVA 4U6PA 1VQ5S 2POKA 1F0XA 3OJUA 3QCKA 3KLGA 2YNIB 1AT1B 3HKWA 2WB1D 4C8MA 3THTA 4RUCA 1SXLA 2HW3A 4KI9A 4ZVHA 1X4AA 2BJEA 2HY3A 1YI2S 1CC8A 2ZH5A 2VQEF 4N8OA 3JTNA 1YJ9S 1DJ0A 2ZZTA 1ZS6A 4MKYA 1FKPA 2HLUA 3OR2A 4RNOA 1ICEB 4N77A 4IYQA 2VEUA 2BV3A 2VBWA 1VYAA 4IH7A 3T19A 3LAMA 2JFDA 4R8UB 3GJQB 4QR2A 1CQMA 1G4WR 3T9NA 3LP2A 4DR6F 4ZP8A 4OV1A 1Z1ZA 4UT4A 4B3RJ 2E9RX 3V4MA 3SV4A 1REVB 3TP2A 4DR5F 2LQ8A 3HD2A 3V2UC 5L1IA 2A10A 1S5ZA 4NLOA 4LF5J 2IY5B 2WB4A 4HTJA 1NDKA 2AZ1A 4LFCF 4HVZA 1XTZA 4DPXA 2CMBA 5KA9A 2DHXA 5DRKA 1NH7A 3O5TB 2KL8A 3LP1A 1JJ4A 5KTQA 1D9DA 3GB0A 3B82A 4OX8A 1U2FA 4ZN1A 4KE5A 4KR0B 3HHLA 1RA7A 1RBOB 2CNIA 3NNCA 4ZDNA 2Z2YB 4BC7A 5C25A 1SJ1A 2ZH7A 3H2XA 1NZ7A 4J37A 1RT7B 4OI1A 4DJBA 5KFVA 5KA3A 2B07A 3I5BA 1I6JA 1AYEA 1KOOA 1OEMX 3K58A 3TR5A 5KFGA 2MEWA 1R0AA 3DM2B 2WHOA 4FP9A 4J9SA 1WDDA 2FIUA 4OI2A 2DISA 2MSTA 4RW6A 2UXCJ 4QW8A 1VBYA 4N56A 1PA1A 2OTJS 1WELA 1M5KC 1C1BB 4IKCA 1R0BG 1RTJA 4Y34A 1C0TB 4LSNB 1XERA 4NXNF 2RJZA 1MU2B 4ECZA 2MKHA 5B0AA 5HO4A 1LOUA 4ECQA 2Q47A 3R27A 3KWMA 4NLPA 4P7VA 1SI9A 2NT7A 1LW0A 3BR9A 3PRBA 3GPAA 3ET6A 4OFZA 3AJ2A 5KFQA 1S9GA 2QDPA 2IRYA 1I9TA 3RZAA 2A6MA 3QCHA 1RXOB 3PYFA 4RW7B 4ZJOA 3J81j 5D0EA 3BJYA 1PJ5A 4KH0B 3UFCX 3MCNA 3UDLA 4IOAQ 4RKUC 3IFEA 3ETMA 2M8DB 3GG0A 2OUDA 2EEYA 3P45B 4NYPA 3KLHB 2R42A 5KFZA 2CZVC 4ICLB 1BY9A 3TZXA 5KFJA 4RL1A 2V63A 2G0CA 1TKTA 2K1RA 3MMJA 1VBZA 4DV1F 5KFFA 2XC9A 3CB4A 2EBEA 4YY3J 1HBOB 3JS9A 2XO6A 3OL8A 4B3MJ 3UE2A 1RK8A 2MKYA 4FNHA 4UW2A 1ZAXA 1SL2A 1BQMA 2P2CB 4NRUA 2N7YA 1C0UA 1RSCA 1RHQB 2XHWA 4I7FA 3LGMA 3V6HA 2AEFA 4KKOB 4OLOA 3JAMY 4PPZA 4H4KC 3PW5A 2B9XA 1CVJA 4UUXA 1ZM4A 3HVWA 2F6WA 2NS1B 8RUCA 2J7UA 1GWZA 4IOCQ 1TQLA 1PBUA 2KJWA 1FRXA 1O5JA 2J0XA 3DRRA 4OJHA 2VG7A 1KN6A 2GAHC 3EMTA 3G71S 4CLPA 4UTGA 2PBNA 2FUG9 3E01B 1OEVA 1RU2A 3HT3A 2LFVA 2EFGA 1OYEA 3AD7C 4GFUA 4ECRA 2GCBA 1H0HB 3Q8YA 2BKPA 3HZEA 3BQ2A 3H4BA 4KJIA 1RT1B 4O4GB 2JC0A 1IJEB 1NSAA 2O5DA 5HMYA 3T9ZA 4X2BA 2WSCC 3J7Z5 4OX9J 4NLTA 1DQ9A 3MM8A 2OFHX 4LFBJ 4H54A 7AT1B 2B51A 5CYQB 4NL5A 4K4SA 1IQTA 3H8YA 3C6UA 4TLRA 1Q16B 4JV1A 2H4KA 1ROFA 4JBCA 1D09B 3CD5A 1IWAA 4WF9Q 3Q8RB 3THPA 1TVRA 4F3MA 4OYAA 2PSZA 1KKHA 3HHDA 2NUUG 3IWLA 1PYTA 5HVFA 1GTEA 3J7ZT 1SIZA 1HARA 4I1TA 3M8SA 3FQLA 3R6LB 2WJPA 4RW9A 4A8FA 1RWPB 5D3GA 3AFGA 1QDUB 2CJQA 1JMTA 4J9NA 3T6JA 2DR5A 4DSIA 1XJWB 4B3OB 4ZN3A 1PCAA 2RNEA 2CFVA 3TJ8A 3H25A 1HYSA 3RAXA 1C2PA 2V69A 5GMDA 2H51B 1CG2A 3IXQA 2M0GB 1ZPVA 1FA0A 2W24A 3QT6A 4F4YA 1KOHA 1JQGA 2BEFA 3Q83A 3BH7B 2HHQA 3EGWB 1LV5A 1BWEA 4YMEA 4CTAB 4XPEA 2EFNA 1TTHB 4O44A 4X4TA 4JI0F 2BX6A 1XR5A 4LFAF 2HGNA 1CJKA 1PILA 4KBIA 2PA5A 1FK9A 3GXHA 4OHEA 3AY0A 4AZ1A 3TVZA 4M5KA 2XB2D 4QIVA 2ZJRQ 3MR2A 1RT6A 5LJ5Y 1VQ7S 1TU0B 2H9ZA 3R5JB 5H9FJ 3UCZP 5HROB 2P9CA 1V5VA 3KLIA 2ZH4A 2FJWA 2CM2A 2RF6A 4FXWA 4M95A 5C42A 2CMCA 5ETTA 2RRBA 1A7GE 2YDUA 2IFXA 3ZMQA 1ZYQA 3OXGA 4DS5A 2Y96A 5J2NA 4DQQA 3DU5A 2JHEA 5K9WA 5BXIA 3PKMA 3RBDA 2CQ2A 3K17A 1IKXA 2AW0A 3JYTA 1KD1T 4I2PA 2HNZB 1N32J 2MZ1A 2CQHA 1FWKA 2IC3A 5I3UA 2Y1IA 4XTTA 1FFGB 3C16A 3KKFA 3RAQA 5GAHI 1JXVA 2VODA 2DVIA 2MHEA 3MXHP 5KA2A 4KHMA 4L3KA 3EMUA 2JLGA 2DNLA 1N36F 2J17A 3DYAB 5IM0A 2EKYA 4K5SA 4J9KA 3D0IE 2OP5A 4FXVA 1VQYA 1UWBB 3C8YA 5BR8F 3DOMA 2G13A 1X5OA 3MHYA 5LMNJ 1RT5B 3MUTP 4X64J 2B4UA 1RTHA 4RLEA 1BZHA 2NLWA 4NCBA 4JMKA 1CULA 4KO0B 3MFHA 4H34A 2V4JB 2AEMA 3T5KA 1Q4RA 4ED8A 3MZIA 1WC6A 5LL6d 2M5YA 1YTWA 2I5JB 2KT5A 4ZVGA 2JOQA 4FS2A 1X4HA 3D0GE 4GMKA 2ZJQQ 1PH0A 5I3PA 5HANA 1IBLJ 3EUNA 2DR7A 3SYZA 2LEPA 4HKQA 3BRHA 2V6AA 1V3RA 3KHRA 1E6VB 3FRYA 2PO4A 4CZCA 2WOMA 1QAYA 4ZITA 2B7CB 3TZZA 3I56S 3KG4A 3AODA 2LKZA 4USKA 5L46A 5JVHQ 3RG6A 1T7PA 3AQOA 3ICLA 1UA1A 2DNYA 2JJ4D 3S3FA 1KFDA 2GCFA 3M6VA 2GJFA 4NZ6A 1VRUB 4JUZA 4ECTA 1LWCB 2IMOA 3PR5B 2LQJA 2I4GA 1BZJA 2GWOA 5HI7A 4YOEA 4ZLNA 3H98A 2JVOA 5CCMA 4DLEA 3QZ7A 4DPTA 2E7VA 4F02A 1TR0A 4JV0A 1Q86T 2C28A 1VDHA 5CH7B 1J5EF 3W5XA 2I5XA 1SC3B 1FT8A 3NAHA 2JVRA 4ED5A 4PG5A 1MROA 5GMKa 2DNNA 1JNRB 3MEDA 4NZ0A 2QEXS 3GXGA 2GIRA 1YJNS 1X4DA 1N54B 2F7VA 1J5OA 1Q8IA 5LSLA 3V5RA 1UEVA 2IMGA 1SBRA 1B0TA 2HFSA 2XZWA 2F6TA 4ETZA 3ZXWA 1VRTB 5K14A 1HPZB 3SIPB 1FJCA 2OSQA 4TN2A 1LNQA 2XS5A 2Q05A 2D41A 1N8RT 4CO2A 4FVCA 4OHVA 4A47A 2CJKA 2ZBPA 2B7BB 1V9OA 2LA4A 1VK8A 2YWHA 4ES1A 4EEYA 1WC0A 1B99A 1P9QC 1EETA 1G6BA 2XMMA 4JI5F 3HVTB 4B9SA 1R7IA 3F73A 5KT5A 3GYXB 1T8EA 3NP5A 2V68A 4OYXA 2ZM6F 2F40A 1G7FA 2LDIA 4NX9A 5T7LA 1SKRA 2KVIA 4RNNA 1SH3A 5L39A 4NCGB 4X4NA 1RABB 3MM9B 5F8IA 2DGTA 2DRAA 2BE2B 1T95A 2LLZA 1L5UA 3HO1A 1G1XA 1DLOB 1EARA 4NLVA 1RHUB 1FEEA 2OD4A 2ATCB 4AL5A 3A5JA 3LPYA 3WDOA 4A8XA 4ZVOB 3D4JA 2KFNA 4X65F 5KFUA 3KHGA 5D0RA 1RHMB 1IBMJ 1XMOF 2Q6CA 4TVVA 1SB6A 3EGNA 3KNGA 1RWMB 1FRMA 1JBVA 4P10A 3UD3P 3TUZC 4X4VA 2QL9B 1CQNA 3AA9A 3QZ8A 4NLUA 4U8YA 2I3UA 3JTPA 4OMFG 1UL3A 4DL5A 2HBYB 1VQ8S 4WCEQ 4PR6A 3A8IA 5FD1A 1HBMB 1FXRA 3I0RB 1OY8A 3DKDA 4DUZJ 5HQ8A 4WIIA 2ZOGA 3LPEA 1HR0F 3NNHA 3DHWC 3AA8A 3R3TA 2F4VJ 3NWGA 4F4XA 2C3PA 4R30A 4R25A 1SH2A 3C14A 4USHA 3DXSX 2CJ9A 3EXYA 2G2ZA 2RQCA 2G4BA 4IRKA 3LOUA 2HHVA 1R8AA 3UCUP 2EC0A 4B08A 3PW0A 1AUDA 5FLXY 5KG3A 4OZ5A 2K7JA 1FRKA 4HT7A 4DSKA 3R8YA 1SV5B 1P27B 1FRJA 1GEHA 4M5DB 2VKZG 5M43A 2YKNB 1F3VA 2JNJA 1OESA 3DI6A 4FKYA 1RAFB 2RQMA 2RDJA 4TU7A 3FZ2A 2OO4A 3RYLA 3MFIA 1TL7B 3KJNB 2FHJA 4DLGA 5KABA 2WW4A 1GXLA 2OFGX 1KQKA 5EHRA 1KVJA 3BDPA 5DLFA 2RF2B 4FF2A 3HK2A 4J9MA 4QWCA 3H20A 1FDBA 1HQEA 2J9DE 1KAVA 1RTIB 1SC1B 3W8GA 3MPVA 1DTTB 4ZLJA 3KLEB 1Q78A 2DJWA 2CPDA 4WXWA 4UOCA 3ETOA 5J1EA 4GFVA 2GGPB 5FLXU 1U8WA 3IBWA 5IT0A 1IKVB 2HS4A 1KONA 1KP6A 2B9EA 2LU2A 2FVQA 5KFLA 3OFEA 5KA0A 4OIXA 3EVOA 2GZOA 2I1RA 2E5GA 3M9OB 3QBCA 4LF8J 4ZCIA 1RT4B 4JB8B 4ZIWA 4DFPA 2MKKA 1H3DA 5HLFA 1VC0A 4WFNQ 1RHJB 1WEYA 5KA7A 2B6AB 3ZM6A 4RNMA 3MECA 2ZD1B 5I4MA 4OJ1A 2R8HA 2JEIA 1ULRA 1U1NA 3S3EA 4CT8A 2H3EB 2DB1A 2ZH2A 4DR2J 3KUHA 4C13A 1RKIA 3FVYA 2M3VA 3VF0B 1SH0A 1VBXA 1CLFA 4AXIA 2EC2A 1UETA 3MM6A 2Y0SD 2V4RA 1V3AA 3M8RA 1CJTB 4DMZA 4K4ZA 5EX0A 4DCPB 3IMQJ 5J2MA 1LQFA 2IDLA 3KHLA 3IG1A 3HMJG 3PCOB 1D9FA 3HT0A 5GTJA 3KLFB 4OHZA 4YN3B 1S4FA 4UOGA 1FJ7A 4USMA 2G2OA 3MUMP 4WJBA 2VEVA 3KYLA 5B0GA 3ZZOA 2CQ4A 1JLNA 4A8SA 2QE5A 5F8LA 3FDSA 1VQ4S 2E1PA 2NZ4A 1NRKA 1ACMB 4ZPWR 3H59A 1IKWB 2YKMA 4WOHA 5GAEU 4WU2A 2DXPA 1YJRA 3FEXB 4LUBA 1XBOA 1OHCA 2OOQA 2KFZA 5KOWA 2D3OR 2F63A 1HI0P 3RB4A 3HHNB 3ZM5A 3QGHA 1RWVB 2QLJB 1X4GA 1M5OC 3TA2A 1YRXA 2DNOA 1YJWS 3CSKA 1OWXA 3KK2B 3U7JA 2G59A 2IYGA 2Q79A 1FNXH 2QEPA 5BUGA 4Z37A 4ELUA 4LBPA 3MDFA 3GIRA 4FN5A 3F0NA 2YNIA 4DDFA 5IWAJ 2ZBRA 2CNOB 3H2UB 2RQ4A 4LSLB 1ECVA 1G1HA 4QR0A 2ZHOA 2NQPA 3QWUA 2J9DA 2CJAA 2QG9B 2JFFA 5E41A 1UAWA 1WEXA 4ZOSA 4NX8A 1QVGR 3FKBA 5KG7A 4DFKA 3QMQA 3PKYA 5K8MA 2B4PA 5D8HB 2B4SA 4NPOA 4PG7A 1OO0B 4CLLA 5KFYA 1GFWB 3HI9A 1HNWF 1X7VA 5IT9Y 4LIWA 2XY6A 4DU8A 4R8UA 2QL7B 2ADCA 2CPHA 4EO6A 3QPIA 2HWIA 1JB0C 2V94A 3ZTRA 2G6ZA 2ZDPA 1KS2A 1REVA 4AXJA 4X4UA 1BQNB 4FDFA 4MBBA 2IYIA 2A18A 1UJ4A 2HHHF 3B78A 1F5BA 4CNYA 2VQFF 4ZMMA 1Z4UA 2F65A 4KPYA 3ISZA 3D7SB 3NMEA 5KFHA 2C3UA 4DV4F 3DOLB 2HRYA 4RHGA 3GIKA 3A1YG 4LF2A 1M90T 1HL6A 3QCIA 2I38A 3M4XA 3PHTA 4TNOA 4DOZA 3W9HA 2W2NP 4DSLA 2KG1A 2AT1B 3LGNA 3D2WA 2VJVA 1REGX 2R2UA 3QT7A 2YQ1A 4V1Ak 3BV8A 2VL1A 1NK6A 3CM3A 2ASYA 4CYUB 3SFGA 4ER8A 1N34F 4B9UA 5ETKA 1AZSB 5AXMA 5IQQA 1M5SA 2XS7A 3MPUB 2R7SA 1XXPA 3K59A 4FXDA 4GRSA 5HMZA 5KFOA 1XIQA 5K8OA 1HHQA 2KT3A 1RT7A 3EZZA 1VFJA 2FB0A 2XYPB 2GP0A 4UOFA 4F3QA 1YGRA 3CC2S 2B4VA 3NS5A 2XEXA 4EGLA 3I9ZA 3L4BC 1U24A 2CQ1A 4NMXA 1VQMS 3OTOJ 2XLKA 1SJ4P 1SQFA 4OZ0A 2OGUA 3DM2A 4F25A 2M88A 2NT2A 2DPJA 2HGLA 1LK5A 5J2QB 2HBZB 3TUIC 4OHXA 2EWHA 2JWNA 3T5HA 4LVOP 2ZVSA 3A8EA 5DQGA 1C1BA 5D4NA 4LR9A 1NKEA 3EZOA 4OHLA 2YX7A 4Y2AA 3I96A 1C0TA 1FCAA 1KLMA 4LSNA 1VCTA 4ZHRA 1MU2A 3UDCA 1ZAWA 2H04A 5H9FK 5KG0A 3BN4A 3CDBA 3G2XA 4HEA9 3DGPB 1EJ7L 1YGUA 3NCPA 4C48A 2GC5A 3V0GA 3K7RA 3HJVA 1NNDA 3A12A 4QYZJ 4BWJA 4RW7A 3H90A 2G0IA 2U1AA 4QZVB 3CCQS 3WZ0A 3I80A 3F9AA 3J80U 1FKPB 1CEZA 3OR2B 4WP9A 4ATNA 1K1SA 1ITPA 3F56A 2GA7A 2FD2A 3KLHA 3BO3A 3O5XA 4ICLA 3P6YC 2ZVIA 3BH6B 4M1KA 4DX8H 1JKHB 2QO3A 3IWXA 3OTCA 4ZVQB 3S3KA 1E8CA 4K4TA 1TAQA 1L3TA 1M5VC 4LMZA 4EBCA 4B3RF 3CIZA 4BWMA 3K8VA 1HBOA 4QPTA 3SDEB 4OHYA 2Y8WA 4DSEA 3VWSA 5BYRA 4QIWD 2FJDB 2FJAB 2Z57B 1QE1A 2J76E 5E3RA 1YZ4A 4LF5F 1H6KX 1U0HB 1GMVA 3SCKE 4KKOA 5RUBA 2XYHB 2B5JB 3CJ5A 1HI8A 1EEHA 1Q7LB 2CPIA 2RMLA
chains in the Genus database with same CATH topology
2BANB 2JJDA 1RQ0A 4DR7F 1JLFA 1GH8A 2DRBA 4BPCA 2WONA 2MKSA 2YKMB 2ALZA 2FTRA 1JJHA 3CUNA 2OIHA 1DHMA 2QZ8A 5D4LA 1HWIA 4RZRA 1WNEA 1YWXA 3CGIA 5KT4A 1D0EA 3D9CA 4HH1A 1X24A 3I7ZA 2XI2A 4O3SA 2KKHA 2NPIA 1XRIA 1JLGB 2RSQA 3O8WA 2FVCA 4Y6IA 4ES3A 2CNHA 3D5MA 4M8LA 5M2RA 1JLQB 3PO5A 1Y4ZB 2N4CA 2VPWB 4I4BA 4E0DA 2Q1LA 3E8OA 3E01A 3PJXA 4OI3A 3RRHA 4MJKA 1HHTP 4XO0A 2I42A 4ELTA 2HNDB 3R5AA 4PXEA 3OHAA 1F5CA 1S6QB 2E1CA 1TK0A 1BLUA 3EGZA 3PIOQ 5EHHA 4LF7F 2B49A 5F0UA 2VFVA 4AUKA 1RT1A 4O4GA 2XMWA 3HHLD 3FMBA 4TU8A 2XY5A 6FDRA 4GWFA 2AJFE 1VJWA 2BQUA 1YRTA 3BQ1A 1FERA 5CYMB 3DRSB 2WK4A 3CCZA 5KT2A 3CMAS 3ENQA 1SJQA 4U6PA 1VQ5S 1VMBA 1F0XA 2POKA 1HBUB 3OJUA 1JLCB 3QCKA 3QCCA 3KLGA 4YB5A 4IH5A 4WFYA 2YNIB 1YBAA 2J7KA 3ENVA 5AE3A 2I0XA 5DM7Q 4B3TF 2F9JA 5H1SV 5K24A 3HKWA 1QAJA 1B64A 1O8BA 1R0AB 2WB1D 4OZLA 1RAJA 4C8MA 3THTA 1SC6A 3NBPB 4RUCA 1ZC0A 4O3PA 1GXUA 2DGUA 2Q3PA 2XSJB 1SXLA 2KJVA 1V3SA 4FZVA 1KR4A 4A8WA 5L1LA 2HW3A 1WG4A 5E3AA 1S48A 1Q8BA 2CZ4A 1X4AA 4ZVHA 3TNVA 3TX8A 2I9SA 1HNVB 2BJEA 2HY3A 1YI2S 3BGFA 1ZZWA 1CC8A 4ITSA 1VQOS 3DLLQ 2ZH5A 2X1BA 2VQEF 1WF2A 2CQGA 4ZPAA 2Y1JA 1XK8A 4IG0B 4N8OA 4ZPTR 5CYJA 4NCAA 3JTNA 4IOBA 1OHEA 1YJ9S 2P4DA 2QFJA 1DJ0A 4ZRTA 2UXCF 4KGKA 3BEGB 4MKYA 2CNEA 1FKPA 2HLUA 3CDEA 3BGRB 4BC9A 3OR2A 4HL9A 4RNOA 2M52A 5B0CA 2PT0A 6FD1A 1RTJB 2NYIA 2MZQA 4N77A 4IYQA 2EG2A 2VEUA 1GNKA 2X1AA 2BV3A 2HLTA 2VBWA 5I42A 4NLRA 5DGAA 4I2QB 5DDOC 2AWZA 2W4DA 2J16B 3G9CA 3H5XA 4IH7A 1T94A 1YPTA 2M3DA 3T19A 5KG4A 1NO6A 3JSMA 5A8KA 2AX0A 1Y5IB 1DURA 3LAMA 4XPCA 2JFDA 3R1LA 3T6BA 4QBUA 4R8UB 3PX6A 4QR2A 3MEEB 3DNCA 5J8RA 1CQMA 3GE9A 1G4WR 2YKQA 3T9NA 1LW0B 3LP2A 5C24A 3U1LA 4X4SA 3MURP 1TKDA 2JX2A 4ZP8A 4DR6F 2BA9A 1UW4A 4OV1A 2VG5B 1Z1ZA 5DO2A 2YKPA 3CF5Q 1U7LA 2E9RX 4I69A 2E9TA 4AFFA 4WK3A 1FRHA 3V4MA 3J7A1 1KHVA 3SV4A 1REVB 3TP2A 2XLIA 4DR5F 3MI7X 2FH7A 2FJVA 4B3OA 2I6IA 4Z6BA 4YR0A 3S1TA 3DXBA 3V2UC 3Q22A 5L1IA 3JSYA 2ZKUA 2A10A 4KYQA 2AU0A 5IFMA 3HP6A 4NLOA 4DWIA 2AJ0A 4CH0S 4ED7A 1TP7A 7FD1A 2I4EA 3MF5A 3W3SA 2WB4A 3CCTA 3D1QA 3T1AA 4HTJA 1B0PA 4P2SA 4LFCF 3I31A 4HVZA 4ECUA 2W7PA 2FJXA 1XTZA 3G6VA 3B4MA 2CMBA 5KA9A 2R8IA 5E0OA 2ZNYA 2DHXA 2DT9A 2DBBA 2FY1A 4EO8A 2F8MA 5DRKA 2PI4A 2VA2A 5A8RB 3HJFA 1NH7A 3O5TB 4J9RA 3LP1A 2Q66A 4Q0BA 2HXPA 2ZHAA 1TV6A 1JJ4A 5KTQA 5GADU 5A0YB 1D9DA 3GB0A 1KEKA 4HDHA 4Y28C 4MYUA 1YG0A 1RKJA 1KTQA 2MKCA 3B82A 4ZP7A 4OX8A 2PMZD 1WAXA 1I94F 3M32A 3FJ2A 1TKZB 2KDOA 3O6QA 1C85A 2XLJA 1U2FA 3M9MB 4KE5A 4KR0B 3HHLA 4CTAA 1RA7A 4DBQA 2K1RB 3MOZA 3RGQA 3S4OA 2CNIA 3T1HF 5K5MA 2MZTA 2HRUA 3CJ0A 3NNCA 1D8ZA 2DH8A 4RBVA 4ZDNA 1UVMA 4OI4A 4YY3F 1UP1A 4KGMA