2B4OA

Structure of the r258k mutant of selenomonas ruminantium ptp-like phytase
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
313
structure length
313
Chain Sequence
TVTEPVGSYARAERPQDFEGFVWRLDNDGKEALPRNFRTSADALRAPEKKFHLDAAYVPSREGMDALHISGSSAFTPAQLKNVAAKLREKTAGPIYDVDLRQESHGYLDGIPVSWYGERDWANLGKSQHEALADERHRLHAALHKTVYIAPLGKHKLPEGGEVRRVQKVQTEQEVAEAAGMRYFRIAATDHVWPTPENIDRFLAFYRTLPQDAWLHFHCEAGVGKTTAFMVMTDMLKNPSVSLKDILYRQHEIGGFYYGEFPIKTKDKDSWKTKYYREKIVMIEQFYRYVQENRADGYQTPWSVWLKSHPAKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Kinetic and structural analysis of a bacterial protein tyrosine phosphatase-like myo-inositol polyphosphatase.
pubmed doi rcsb
source organism Selenomonas ruminantium
molecule tags Hydrolase
molecule keywords myo-inositol hexaphosphate phosphohydrolase
total genus 104
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 3.1.3.72: 5-phytase.
pdb deposition date 2005-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14566 PTPlike_phytase Inositol hexakisphosphate
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1690 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2b4oA01
3.90.190.10 Alpha Beta Alpha-Beta Complex Protein-Tyrosine Phosphatase; Chain A Protein tyrosine phosphatase superfamily 2b4oA02
2B4UA 1NO6A 2P4DA 4QBWA 1C84A 3EZZA 1YZ4A 3ZM2A 2Y2FA 4RI4A 4S0GA 5K9VA 3S3HA 1T4JA 2I75A 4QUMA 1NNYA 2NTAA 1ONZA 3V0DA 1FPRA 3O4TA 2VEVA 2CM3A 3F81A 4GS0A 1YPTA 1RXDA 1EEOA 1JF7A 2B07A 4NNDA 1YTNA 1Q6PA 1Q1MA 2I4HA 2F6YA 5KABA 3I36A 2B3OA 3S4OA 3LJ8A 5GTJA 3OMHA 4Z6BA 2J17A 2BZLA 1YWFA 1PTTA 1V3AA 3CM3A 1T48A 5KADA 1M3GA 4JMKA 1MKPA 3O4UA 2I4GA 2H4VA 3NMEA 1G1FA 3QCBA 1SUGA 3V0GA 1G4WR 3MOWA 4DGXA 2I6JA 4QBEA 5LXQB 2F6VA 3D1OA 1XRIA 2M3VA 3RGOA 2PBNA 5M43A 1ECVA 3ZM3A 2PSZA 1LYVA 1L8KA 4NWGA 5IBSA 2F46A 4WTYA 4AZ1A 3D1QA 1Q6NA 1XXPA 4YAAA 2I3UA 3V0EA 1OHEA 2ESBA 1J4XA 3ZMQA 1OHCA 1EENA 2J16B 4R0SA 2H03A 4D3PA 2I1YA 5K9WA 2I42A 2HNPA 1OEMX 3OLRA 4J51A 1YTSA 3QCHA 5J8RA 5KA7A 2I5XA 1P15A 4TVVA 1I9TA 4R30A 4OHIA 3QKPA 3BLTA 1PH0A 1OESA 1KAKA 2Q05A 3QKQA 5K25A 4ZN5A 1XM2A 5K22A 2I6IA 2RF6A 2B4OA 1C86A 2VEWA 5KAAA 4RH5A 1NZ7A 2BV5A 2B49A 4QUNA 3U96A 1BZJA 1Q6TA 4BPCA 2ZN7A 1C87A 3ZMPA 5KA8A 3AWFA 1BZHA 2AZRA 2HNQA 3V0JA 1YGRA 3M4UA 4I8NA 2CM7A 3D1HA 4NX8A 5BUGA 3O3LA 3S3EA 1C83A 2QBQA 4MBBA 1YGUA 2GP0A 2R0BA 1Q6SA 4KYRA 2Y96A 4H1OA 2QDCA 3F9BA 3S3KA 4DGPA 1R6HA 1ZC0A 1PTUA 2VEYA 3D9CA 1WAXA 3A5KA 2NZ6A 4GE5A 2CMBA 1PA1A 3I80A 1NWLA 4R0TA 4H34A 1PYNA 4RHGA 2PQ5A 3CWEA 2CNHA 2H04A 1BZCA 2B4PA 2NT2A 3A5JA 1WRMA 1ONYA 1PXHA 3GXHA 3S3FA 2HC2A 5EHPA 2BGDA 2QEPA 3QCFA 3EU0A 4IKCA 1Q6JA 4B04A 2QBRA 4YR8B 1GWZA 2OC3A 2QCJA 3QCCA 4GWFA 4GRZA 3BLUA 3PS5A 2BIJA 3I7ZA 2I6MA 1GFYA 4QAHA 3AWEA 5IBMA 4GE6A 1G1HA 1I9SA 2VEUA 5KA0A 4RDDA 1D5RA 3RZ2A 1QXKA 1OHDA 1YFOA 2NLKA 4HJPA 3QCNA 4OHLA 3V0IA 2QBSA 5HDEA 5K23A 1I57A 3QCMA 2FH7A 3MMJA 2HXPA 2QDPA 3SR9A 1RPMA 1YTWA 4ZI4A 2CM8A 2P6XA 3BM8A 2HVLA 1C85A 3EB1A 4JBCA 2AHSA 3QCEA 4ICZA 4JNBA 3O4SA 4D3RA 4RI5A 4WU3A 1LARA 2CFVA 2FJMA 3V0HA 4JMJA 3QCDA 3V0FA 4GFUA 1OEVA 2WGPA 3F99A 4BJOA 4RH9A 2PI7A 3F41A 2H02A 3SMEA 4QAPA 2BGEA 3F9AA 1U24A 4GRYA 1U26A 4Y2EA 3ZM1A 5KA1A 3D44A 5EHRA 1G4US 2HC1A 2F70A 2A8BA 2IMGA 2I6OA 2HY3A 3D42A 2OUDA 4OHHA 2CNFA 2G59A 4GFVA 3GXGA 1Q6MA 1FQ1A 2H4GA 2A3KA 2H4KA 3S4EA 1ZZWA 1YN9A 1X24A 5KA4A 1G1GA 1JLNA 2VEXA 3QCIA 2Q47A 2HCMA 3QCGA 4WOHA 2I6PA 1OEOX 4RKKA 1VHRA 4KYQA 1LQFA 1XBOA 4KI9A 3H2XA 3O5XA 1PTYA 1C88A 5KA9A 3AWGA 1ZCKA 1OETA 1PA9A 2I3RA 5BZZA 3EAXA 2F6WA 5AWXA 1T49A 2GJTA 2YDUA 3B7OA 3QCLA 1NL9A 4OHDA 1WCHA 2FJNA 2OOQA 4OHEA 1XXVA 4ERCA 1NWEA 3EMUA 4PYHA 2I4EA 3BRHA 1AAXA 2J16A 5KACA 5K24A 5MMZB 2OZ5A 1A5YA 2MBCA 2QBPA 4NYHA 1U25A 5KA3A 4ZRTA 1G7FA 4NWFA 5KA2A 1L8GA 2PT0A 5BZXA 2B4SA 3ZM0A 1QZ0A 2NV5A 3RO1A 2CM2A 2F6TA 2QCTA 2CNEA 5BX1A 2C7SA 1FPZA 2E0TA 4WU2A 1ZCLA 2CMAA 3QCKA 2DXPA 4D3QA 5I6VA 2ZMMA 1OEUA 2NT7A 4GE2A 2GWOA 4Y14A 4HRFA 3N0AA 2CJZA 2F6ZA 3ZV2A 2F71A 4HJQA 1PTVA 2F6FA 2CNGA 3QCJA 2PA5A 2QDMA 3RGQA 2SHPA 2C46A 3MOZA 2JJDA 2G6ZA 1G7GA 2CNIA 4PVGA 1KAVA 2HB1A 2CMCA
chains in the Genus database with same CATH superfamily
2YQ0A 1HA1A 1NSKL 2JOQA 4PABA 4WIIA 2UUAF 2EC2A 3GV7B 3ET6A 3C15A 1T0TV 2OO4A 1M3GA 4BHQA 2XNQA 2HBRB 2W2MP 2P6SA 4K59A 4USJC 4PPDA 1FJCA 2CQPA 2HIYA 2H65B 4BC7A 2LXUA 2BXJA 1FI4A 2QSFA 3DHXA 1HI8A 1Q79A 4HHJA 4OHXA 1FJGJ 2XS5A 1VOMA 1ZAVA 4RPFA 1TV6B 2HLUA 5MAOA 2O67A 4KYZA 4C8LA 2V4RA 3TZWA 3BKFA 3MECB 2AJFE 3FZBA 5F8JA 3IR7B 2V63A 3QO9A 3VVTA 1S1TB 1RHUB 1P1TA 2I75A 4C8MA 2MHEA 2XHWA 3CJ0A 5D0GA 4ZI4A 2ZH5A 2IYGA 2CWXA 4PR6A 3PO4A 4MYTA 1NK7A 1SI9A 2DH9A 2H5EA 1ONZA 1HBUA 3CNQP 2M8HA 2KJWA 1X4HA 2CQ3A 3AQOA 3D3BJ 3S6EA 3KLGB 4ZIVA 3V0DA 4K0KJ 1F1BB 3O4TA 3M9NB 3AWGA 1ZM4A 2JEJA 2DISA 2JRSA 3HHLB 5D8HB 4GS0A 5F8NA 1CQMA 1N5SA 3H5XA 1Z4UA 2IRXA 5DG8A 3CD6S 1WUUA 2LMIA 4RBUA 3QIPB 2VPYB 1EEOA 1AFIA 1JF7A 2WONB 4FZVA 3OTCA 1X4FA 4RUHA 3S7RA 2KXFA 4J9UE 1M5VC 4DHVA 4JI8J 4IG0B 1Q6PA 1W78A 3ENVA 4OJ1A 3KLHA 3QSYB 2ZUAA 1KFSA 5HJYA 2W9BA 5KT4A 2WGPA 3V4IB 5E7OB 3M2RA 1RT5B 2SXLA 3NNAA 2DNHA 2G0CA 1PBUA 3FK4A 4DSIA 1LW2B 2BYCA 2L9WA 3H40A 2EFPA 2CQGA 1RHJB 1N6QA 3LJ8A 3TUZC 1YITS 3OMHA 2Z2YB 3H8YA 4Y6IA 2HGMA 1WACA 2HFVA 1REGX 1TELA 3D67A 3H90A 3I5AA 3RAQA 3W5XA 1YWFA 2HRYA 4N56A 2GV1A 3Q8YA 1YIJS 2OTLS 3UD4P 1WG4A 1H7XA 1S6QB 3CDAA 2NR0A 1V3AA 5KT5A 4DR2F 2WVFA 2WB1D 1WKLA 3CJKB 1FFWB 1HPZB 1D9AA 5KADA 1R27B 1UZHA 4N7TA 4OYOA 4Y2MA 1JLFB 1RHMB 4H4MB 4LUBA 3W62A 3ZTQA 1JLQB 2WBRA 5K5MA 5B08A 4N8OA 3G8SA 2RDJA 3CCLS 1Q82T 3K2YA 4DL7A 3NGUA 2GHVC 1N32J 2I4GA 3O4UA 1A0OB 4B3OA 2HQDA 2YX7A 3V5RA 2DY9A 3M30A 4DX5A 1G1FA 3TAPA 2BJ8A 3DHWC 2ASLA 2H4VA 2ZEJA 2YBVA 2VG6A 3KK2B 3MOWA 2MKCA 1UJ6A 4DQRA 1UAWA 2WOMB 1VQSA 1FD2A 1VCTA 3HI9A 3MPDA 5F3TA 1JQGA 5IZHA 1YJ7A 3V81B 3D1OA 4TY8A 2F6VA 1DQAA 4A8XA 2R8HA 5JMNA 3PYZA 3K8VA 2ADCA 2ZH3A 1RAFB 2IM2A 1N8RT 3BKTA 2ADBA 3Q23A 1U1MA 2LDIA 2E5IA 3KTQA 3C8YA 1PAUB 4WTYA 2MLXA 4YN3B 2EG2A 3IM9A 3U1LA 3GCWP 2Y67A 2FTRA 3D1QA 1NK8A 1HNIB 1TVRB 3T1YJ 3POTB 1MMDA 3Q8QB 2QLBB 3KLVA 2OIHA 2I3UA 1RLCL 4NMLA 4O4GA 3R1LA 1OHEA 3HJFA 4ER8A 4GVBA 1U1KA 1TFWA 1J4XA 3KNAA 3FDSA 1OHCA 2IYIA 2ZC3A 3BV8A 3W9JA 4KFBA 5EGYA 4X62F 2GJIA 4XPCA 4L72B 1Y3JA 3ILOA 4D3PA 4B3SF 1KR4A 3EDQB 1O5JA 4FVCA 1B70B 2HNPA 2AEMA 1N33J 2R7XA 5GAGI 2OPSB 1U0HB 3MM6B 2GQQA 4FPRA 4L73A 4GKKF 1JLGA 2HGLA 2ALYB 1AUSL 4DS5A 2FJWA 1FX2A 2VPWB 3D5MA 3HSGA 5KA7A 3QT6A 2I5XA 2GC5A 1TKTA 4YB1P 1RE1B 1N33F 3QKPA 1U09A 4IOCQ 5AXNA 2FC9A 2XMJA 3BO4A 5EWGA 1CS4B 1UWAA 5A2QU 1Q81T 2YNGB 5HK4A 2QMXA 4JI2J 1KVKA 4TLQA 5T41A 2A10A 2MQPA 3LQVA 8ATCB 1JJHA 5HI7A 3OUYB 2QRRA 5A8KB 3HCXA 3DOMB 1KAKA 4DDFA 2V4JB 4DV2J 1DAXA 1XM2A 3E2EA 1VBXA 5K22A 4QWBA 3DOLB 4OI6A 1XMQF 2RDDA 2E5JA 1UEVA 4OX6A 3KJVA 2M7SA 2XLKA 4ICLA 2G0IA 2AM1A 2ZNYA 2CPZA 4B9UA 2O01C 2ZHOA 4O4GB 1C86A 3M2UA 4YMEA 3QCZA 2GW8A 5GADI 2BV5A 1HBOA 5GAHI 4QUNA 2D3UA 2OSQA 2XY7A 5C5JA 1MWQA 1IKWB 1C4AA 1RT6B 1Y4ZB 2HNDB 1YBUA 5FLXU 2W9AA 2CNNB 3W66A 2CJKA 4K5RA 1C87A 3ENQA 3RB4A 3A8IA 5KFPA 2RDIA 4RNFA 2F4VJ 1GTHA 4D3HA 4DUYF 4ZPCA 2NLWA 1LQ9A 1N34J 4NOHA 3DOLA 4EGLA 1L3KA 2H4YB 3BBCA 1SV5A 3MM8B 1NLKL 4Q2LA 3M9MB 4K4WA 3V81A 1S97A 2FVPA 4DV7J 1LWFB 3LO3A 2HQCA 1AT1B 4ZVPB 1KQFB 1KHVA 3DOMA 4FN5A 3OSNA 3M32B 3KK2A 3CT9A 2XO6A 1NK5A 4Q7AA 2F1FA 4ZS6A 3MR3A 5BUGA 1DTTA 4M5DB 4ZVRB 1NU4A 1WHXA 3CCMS 1EIYB 2DGVA 4H4OB 1W2IA 2FUG9 3GZ7A 4ZITA 4LF4F 4PYDA 2VBWA 3G8QA 4I67A 1J6UA 3S4EA 1EQMA 2DJWA 4MKVA 2DNRA 4DSEA 2XGQA 4JI1J 1YGUA 4X66F 2GP0A 4FXWA 4M5HA 3CJKA 1ZM2A 2IMOA 3HVAA 4LQ9A 4OI0A 1HQEA 3J7ZT 1Q6SA 2J0XA 1N52B 2ASYA 4ECWA 2E1MC 2YKPA 2UAGA 1Z1ZA 2LQJA 2ZFHA 2HS3A 1VDHA 1N0VC 3TR5A 1SQFA 3DNCA 5AT1B 1NB7A 1UEUA 3OXFA 3I4PA 4Y2KA 3W61A 2FZCB 1VRUB 3MD3A 4NLWA 3KKFA 1MNEA 3S3KA 3G96A 1QSLA 4EK2A 1NKBA 3PW4A 4ECVA 1GFWB 1GXTA 1R7IA 3BN7A 4RBVA 2JFHA 1ZS6A 2QBRA 4KFBB 5B09A 2B6AB 2JWNA 1BWEA 3BPSP 4GE5A 1YJTA 4CH7A 2KO1A 2ABYA 2Y1LB 3MM8A 1NWLA 5KG2A 2K3KA 2IDEA 2E5LJ 2N7YA 3GFHA 1OQ6A 5A0YB 1RTJB 2VFVA 4ID8A 5KT2A 3QIPA 3C46A 2PQ5A 4L3NA 1CC8A 2CNHA 3CWEA 2H04A 1N88A 4LSZB 3R8YA 1SKUB 4JI0J 2O3DA 1VRTA 4J9VA 3TWZA 4K5SA 4CO3A 5CABA 9ATCB 4X2BA 1RA7A 5D0EA 1QSSA 3A5JA 4EBCA 3JSRA 1IBKF 3DDIA 1PXHA 2E5GA 2HFZA 3NNCA 5IT9U 3UDEA 4Q5VA 1ZBTA 2RUSA 3AA8A 2HC2A 4QR2A 2ZVSA 4J9SA 3I0RB 1EKSA 5DG7A 2WOMA 2BA9A 4USIA 3W8PA 3IS9B 4J9LA 1Q6JA 3M30B 3SCKE 2B8QA 1H38A 1KEKA 1NSQA 4YDDB 1FRIA 2V4JA 3HHDA 2GGPB 1E6YA 4C48A 4F04B 3MEGB 1GWZA 4X4NA 3TZZA 3K0JA 3IGNA 4LRAA 2RE1A 3SMZA 3CXCR 4WYWA 2WTZA 1Q0NA 2EBGA 4ECXA 2GZOA 1DTQB 3BLUA 3PS5A 4GRZA 3OBIA 3JSBA 2EXUA 3DU6A 1VBZA 1S0VA 4OX9J 1RAOA 4I0WA 4I2QB 1GFYA 1U8WA 4NLDA 4KTQA 2BJ1A 2P9EA 3DGPA 2Z2LA 1WC5A 2PIIA 3HFKA 2G0JA 4UOHA 4CLWA 4J9OA 1Y10A 3NBPA 1T05B 4RDDA 4L3KA 2QA1A 1OHDA 3P5BP 5L1KA 1FXLA 3RR7A 4P2SA 2NLKA 2PEHA 3SQOP 2XO7A 3QCNA 1H2TZ 2J5AA 4LSLB 4CP5A 5IXUA 4UZCA 2H9ZA 3RRKA 1RWMB 2HIQA 2D3OR 1OEVA 5HDEA 2DPIA 2Q6BA 4OLPA 5K9FA 2MZ1A 2J17A 1RBLA 1RPMA 3AOAA 3P96A 5HROA 3F0NA 4ZLJA 2RT3A 4YB7A 3MUMP 1N5TA 3R7BB 4CLLA 2CZVC 3O8WA 1RACB 2YVSA 4MKYA 3D4JA 3MR6A 2M5YA 2QLWA 1Q7LB 3BM8A 4O0IA 1OYDA 4UF4A 2A18A 2ILYA 1MROB 2KRRA 4TVAB 5HVFA 2J9DE 2XSFA 4JBCA 3L7UA 4E98A 3US5A 2BQUA 2AHSA 4JNBA 2XSJB 2PFDA 1NJWA 4HV4A 4ZPWR 3QCMA 3DYAA 2OEJA 2BE7D 3ZTSA 2J8SA 2VBXA 1LARA 4URGA 5HBMB 1ZETA 4A8MP 3IO1A 5KAKA 1NJZA 1RWWB 4DR7F 1HBUB 2U2FA 4NWBA 3OJUA 3TP2A 3HZEA 1LK7A 3CCJS 2VORA 4DSFA 3C16A 4NL5A 3B8HA 1G4CA 1RWPB 4DLGA 5H9EJ 4RH9A 1EJ7L 2HHPA 3SMEA 1OO0B 2M3DA 3T9NA 1TMJA 1UMJA 2WVCA 2ZM6J 2Y8WA 4KPCA 1OJ4A 5HMYA 1U24A 4OYWA 3C66A 4YB6A 3GB0A 2IVFB 1URRA 1IBCB 1WG1A 1YZ6A 3UN5A 5BYSA 1FWPA 1SL2A 1LNQA 5T7LA 2A2CA 4DCPB 5HL7Q 1C1CA 1TV6A 2VUGA 2E7WA 1M5OC 1UAGA 2V2QA 4HHHA 3DDKA 1R31A 1RWXB 5DDPC 5DQIA 4O3RA 2HVIA 4DV3F 2DD8S 2EVZA 3W9HA 2V9WA 4KIAA 2I6OA 2DIVA 3PZPA 1R0BG 1R8CA 1FRMA 2BMBA 1AYEA 1HQ2A 3D28A 3LALA 3PEJA 2CNLB 3NY0A 3PYGA 4QW9A 4ECTA 1JLCA 4M95A 5B0FA 2CNFA 4CCHA 3AJDA 1RAHB 2CQ0A 1XMBA 3PJXA 1UVJA 2KTQA 3TZYA 2RHSB 3ENAA 3MEDA 3CCQS 1TK0A 4N77A 3ZNJ1 1KKHA 4KKOA 4ZMMA 5F8HA 2HZAA 2YWHA 2C2NA 2DHSA 3CIMA 2IBKA 3NRSA 2WW4A 3GIJA 4LF6J 4Q8EA 4WZMA 1E0DA 4K4TA 1Q86T 3NXZA 4Q44A 4CTAB 2R7WA 3TAQA 1X24A 2VONA 2HQGA 1JLNA 2VEXA 2FHJA 4AUKA 1L3UA 2Q47A 2RRAA 4I2PA 4R8UA 5K23A 1QJHA 3ZTOA 5DETA 3TUIC 4S0MA 1IJFB 3ZC4A 1U6BA 3QCGA 2AJ4A 3BH6B 3KNGA 2QG9B 3UWTA 1XNQJ 3DLGA 3IGVA 1NJYA 1QLNA 3GE9A 2V8DA 4C7QA 3S8SA 4KYQA 4KI9A 3D54A 2L3MA 3FFIA 2LXIA 2PD1A 5THWA 5IWAF 4IRCA 3BS9A 2ZH1A 5LSLA 4X62J 1WTBA 2RH3A 1SJRA 4I56A 5KFIA 1AB8A 4KGMA 1ZCKA 1Y9OA 3A3OB 1FE0A 2MEWA 1YTNA 2HGNA 2VC0A 3LP2A 1T05A 4C4WA 2GCBA 3DU5A 4DUYJ 5BZZA 1TR0A 4USKA 3SSRA 2ERRA 1TL4A 3ICLA 3SDEA 1HD0A 3VF0B 2ATLA 2FLLA 2XMWA 2VQFF 1R43A 5KFMA 4TU9A 4JV1A 2Q66A 1T49A 2GJTA 2YDUA 5DQGA 3MPYA 3B7OA 2WW8A 1KONA 2MJNA 3D6HB 1SKRA 1WCHA 5B0AA 4C8KA 1AXQA 2IPOB 4OJGA 1S0OA 3ONQA 4ZPDA 1KTVA 3P45B 2CKWA 2B9YA 4IFYA 4DL5A 5HQMA 1WKKA 2NUUG 3QSIA 4GO5X 1XXVA 3A3NB 4P2MA 3MR7A 4RW6B 5ETMA 4EU0A 3NGDA 2ZH9A 3VAFA 3RW6A 2LEAA 2UVWA 3DM2B 2BJ9A 2OSRA 1IKYA 4PXEA 2HNYB 4DL4A 1LV5A 2MKKA 1SPBP 5D6GA 1VQ8S 3ISND 1CJKB 3CMES 3O44A 1R8HA 4UAGA 3PRBA 3VGSA 3UNGC 3CCTA 2RRNA 4RW7B 3RZAA 5KFBA 3G6XA 2VQFJ 4NYPA 4BDPA 2W2PP 5L9XA 2CPFA 3EZUA 3L4BC 2OPRA 3TA1A 1FVQA 2ZD1A 3R5CA 4O44A 4BCAA 2EFQA 1HBMB 4OHZA 2OZ5A 2VG5B 2VG7A 4JI4J 2MBCA 3Q8VA 1S5ZA 1FXRA 4WYLA 1CJTB 3A13A 1OY8A 3CJ2A 1ZM3A 3ISZA 5DRKA 3TZXA 1ROFA 1U25A 2CPXA 1IVZA 4OYIA 3BRHA 4ZRTA 3TI0A 2CNOB 2VF3A 3AA9A 3TJAA 1XNQF 1SKSA 2DXDA 2Y1RI 3PJ9A 5E0OA 5KA2A 1L8GA 5KFOA 2PT0A 2B4SA 3DFEA 1VRQC 4R5PB 2B9WA 3B82A 1I5OB 3EPIA 5KFFA 1WF2A 3DLKA 2M52A 4YEAA 5AJ3F 2ZKTA 3DGVA 4WKYA 3QJLA 2CM2A 5IT4A 2QCTA 4G1QA 1UCNA 4JI7J 1M1HA 4PG6A 1QE1B 4C9DA 3KXDA 2W01A 5A5FA 4B3MJ 4A8YA 4DOZA 5KG7A 2EFVA 4WU2A 3VV2B 1XMOF 2CJAA 1NRKA 3T1HF 2V9KA 2W1BA 3QCKA 2I9SA 1Q1KA 4NA1A 2YNIA 3GYGA 4QR0A 4K0KF 5G0RA 2CJYB 1OEOX 2IMGA 3PM9A 2A1BA 1S7IA 2UUBF 3Q89A 3ITHA 1JJ4A 5KFJA 2BW2A 2LYVA 3QGGA 1NK4A 2NZ4A 4IH6A 4PUOA 3NOGA 1VLYA 4E0DA 1YRUA 2KYXA 1N36J 4RU2A 4LR8A 4NXMJ 4KHPF 2VFSA 2NT7A 3CC2S 5B0BA 4Y14A 4LFBF 2PC6A 1RWVB 1PO6A 1YZ7A 2W7AA 3KG0A 1RAIB 4DV0F 5KFTA 3H5UA 3WHIA 5BR8F 3W5YA 3GLJA 3KMSA 2Z58B 1PTVA 2PI5A 2ZM6F 2F6FA 3K17A 2LECA 3L95X 1T03B 4JYAF 3C2PA 1IR0A 2UXBJ 1GQQA 2PA5A 3JXOA 3RBZA 4ZN1A 5ADZA 2J0QD 2VDHA 2QN6B 1U0SA 2UU9J 1X0PA 5A0YA 4QPTA 3RGQA 2O66A 3CUNA 5CH7B 2SHPA 3K5LA 1FE4A 1S4EA 4I1TA 1VHIA 1T3NA 3UVJB 3J7Z5 1BQMA 2YWFA 4K4ZA 1SH0A 3MOZA 2CVIA 3PKMA 1NHVA 2R7QA 4DF4A 4ED5A 3ZM6A 3RBXA 3QLHA 3EICA 2FB0A 4ED0A 3GG0A 2XC9A 2B07A 5EWFA 4F4WA 4UY8T 2UZAA 3LANA 2CNKB 3NOCA 1URNA 5JXSA 1KAVA 2HB1A 4DX6A 5A8KA 2YNFA 2ZUGA 5JVGQ 2VPXB 2Y3YA 2B4UA 2CQIA 2OPQA 3DLEB 4PXDA 2P4DA 2G1DA 3IRXA 2BE2A 4FBTA 1C84A 4KGZB 2UV8G 3QWUA 5HATA 6AT1B 2XCAA 4HI1A 5FDLB 4OZLA 1N5YB 3WC2A 1AW0A 3ZM2A 2KB2A 2O1PA 4I6YA 1SC6A 1U7LA 5ETRA 1PGZA 4K2XA 1JXVA 4CLFA 3NMRA 2RKIB 2W8KA 1SXLA 4Y2AA 3GILA 1L3TA 2XS7A 2ZH2A 4WP8A 1ITPA 1T11A 5IM0B 3HKZD 4HDHA 2IRUA 2H4WB 3J81U 2XB2D 1U1QA 2RRBA 5K9VA 4MYUA 2Q1LA 1X7VA 4QW8A 4QPXA 4X64J 1S10A 4O3PA 1T4JA 1ZOTA 2C28A 2XJAA 3HSDA 1SV5B 2N82B 4I6AA 5EDWA 3C14A 3PW2A 3AD9C 1NNYA 4D3GA 2UXCF 3MTKA 4I7FA 1R0AB 4IR9A 2AYEA 5LXRA 2NTAA 3FGVA 2HVHA 3M8QB 1QVGR 1T9WA 2HWTA 2DNNA 2MY7A 5HJXA 1Y11A 3GPAA 5HLFA 2IMWP 4ILMA 4TU7A 4MKAA 4QJVA 1ZAXA 4DS4A 2D3O1 3VQSA 1ICEB 3NS7B 2W7PA 1KD1T 2VEVA 3IM8A 2DGSA 4G1IA 3BREA 1TUWA 3FJ2A 4F67A 3F81A 5LMUF 3NGKA 3SFGA 3UDLA 3DMJA 3UR3C 2B7BB 3W2VA 4CO2A 4LFAF 3KLFB 4Q8FA 3EXYA 3G82A 3I5CA 1SIZA 1P8GA 1WG5A 1RQ0A 2IA0A 2J8AA 2ZKUA 2VTDA 1R89A 2B8PA 4KHMA 4NNDA 4TXSA 2ZBQA 1K0VA 2BE9B 3I87A 4LRFA 4JI5F 2QSWA 1LKZA 3CDBA 3CTRA 2J9DA 1VBKA 2BUNA 3SCJE 2QEXS 2MSSA 1YSJA 2HK2A 5K8OA 3CC4S 2HHQA 3OFFA 1N36F 2B3OA 3I36A 3S4OA 5KABA 3M6XA 1HHSA 1IWAA 5I3PA 1B64A 2J0WA 2P6TA 2HK3A 4U7CA 3CCRS 4XK8C 4BBYA 5EX3A 4JI5J 2CG4A 1X9WA 4ZP7A 1RT2B 4QYZK 3NWRA 2LDYA 3CO9A 3HHNB 3PRVA 5AXKA 1QSYA 2Y8YA 3OV7A 4QCLA 3VTIA 2CPJA 3J80Y 3HN7A 1TKZA 3RW7A 1V3ZA 3W8GA 1U1LA 3HFVA 3OVBA 1MMLA 3G82B 2RNEA 5C2GA 2KL8A 3ILLA 1NDPA 3MDFA 4FYVB 2FZKB 3PYDA 2CFXA 1U0HA 3ZZRA 3LWLA 1TKDA 3BSCA 5F9LA 1JNRB 3DRXA 1SJ1A 3TOQA 4F0HA 5CD4H 4J9PA 1DZ5A 3QYYA 1MKPA 1RCXB 2V69A 3V0GA 4W92B 1VQOS 2C2ZB 1G4WR 3GFXA 3G86A 2DO4A 3DDNA 1IQTA 2I6JA 2HBYB 3KUEA 2JVRA 2YPZA 2EFOA 3AODA 3ZZOA 5FLXY 4FF1A 4B9MA 1EQ0A 1WORA 2JH3A 1SC1B 1S1UB 2K1RA 2XTJP 3FBEA 3I55S 1Q8KA 4K4SA 2FJVA 1ECVA 1FKOA 2PBNA 5M43A 3ZM3A 1LOUA 3MD1A 4KB7A 2C3MA 4DR6F 1LYVA 1EX8A 2DPJA 4FF2A 1X9SA 2YNHB 3B4DA 3H98A 1SIWB 1RT7A 5E3QA 4FF4A 1KRPA 4Q0BA 1ZCLA 5IBSA 4AZ1A 4ZIYA 1T9YA 5CYMA 2D74B 4BJOA 3LUYA 4R25A 1V3SA 4DXLA 1F3VA 1NDLA 3MAAA 5J1EB 2M2BA 2APOA 2GCAA 2ESBA 5KOWA 2CJXB 4XIUA 3ZMQA 3KUHA 2CQDA 2X1GA 4MK9A 2UVRA 5I3UA 1K73T 4IYQA 3M6WA 1R8PA 3QQCD 4J9QA 4MKBA 2BRKA 3EMTA 4R0SA 4IO1A 3O6QA 2DNYA 2J9CA 3W9IA 1BMQB 2GIFA 4B3TJ 2HSEB 2JFKA 4HT7A 2FPHX 5CYQA 3HT3A 2OFHX 3OVSA 1AZSB 4USVA 3Q24A 1XR6A 4LFAJ 2F3JA 2XLIA 5K9WA 2D41A 3EXCX 2V8VA 3BO3A 1TU0B 3MECA 4OYPA 3KJNB 4CH1A 2HVLA 1C2PA 4P74A 4NLYA 3O2IA 2GVZB 4M5GA 1IR1A 5KFZA 3QZ7A 3KLFA 3R2DJ 5J1PA 4CWBA 4TVVA 2CJ9A 9RUBA 4R30A 8RUCA 3M6UA 4OHIA 4F26A 1RWUA 4LF9F 1RYRA 3JS9A 1RU2A 3FSYA 4X4PA 1H74A 1OMSA 2H03A 3LGMA 4RW4A 4DPUA 1RTDA 4DV2F 4D3RA 1UETA 1LW2A 3VAHA 3BH7B 2WSFC 5L8RC 1HR0F 5K25A 2VDIA 2XYHB 4OZJA 3M8SA 5D77A 4YFUA 1VC5A 3F73A 1S0MA 2R7UA 4J5OA 4L76A 1S57A 2I6IA 2JLGA 2CJBA 4IG0A 2EKYA 4PG7A 5EHHA 3GCXP 4WE1A 3TO8A 4DG1B 4EWTA 1WC3A 2JX2A 2XY5A 1CJVB 2ACMA 4LMZA 5LT5A 4MTPA 4F4XA 2DXEA 4NEYA 4PPZA 2IM1A 1EB0A 3VQTA 3SBMA 4X4OA 1XMOJ 1NZ7A 3NS5A 4BWJA 1NH8A 2K2PA 3GU0A 3BSOA 4J37A 2OUGA 1QM9A 2OPPB 2WVBA 1NKEA 1TAQA 3ZZTA 3BSAA 4X65J 1CQNA 1EETA 1FVSA 1RP5A 2Z4PA 3DRYA 3H2VE 1TL1B 3J7YI 1YI2S 1CULB 2GQCA 3AOCA 2PFFB 2J6TA 1M90T 2AZRA 2AJ1A 5DDOC 3QJJA 1S76D 3M4UA 1GT8A 1C4CA 2DGQA 3FNNA 4X66J 2MJUA 4CYUB 1UVKA 4O3SA 4NCBA 2CM7A 1FKPB 1YVFA 4N8NA 1XNRJ 5A6PA 2HHUA 1N5VA 4NX8A 2R8JA 2VFTA 2QO3A 3NCQA 4M63A 4QOTA 3OHAA 3MM9A 4YOEA 3S3EA 1C83A 1EAYC 1SJQA 1VHFA 3HT0A 3SFUA 1VK8A 3R5GA 1CG2A 3LP0A 1S6UA 4RJVA 3GIRA 2MKJA 3OSPA 2FQQB 4MBBA 2AJ0A 3VGTA 2EFNA 3HULA 2DEJA 1FRHA 3OR1A 1QDUB 1W26A 2LKZA 3FSXA 4LIWA 4LR9A 4O0NA 4Q2MA 4ELTA 1FJ7A 2R0BA 2DT9A 4C3MA 1K0TA 4PYAA 4I68A 4NEZA 4OIXA 1UVNA 1IKWA 4TU8A 3T3FA 4KYRA 1BQNB 1SH2A 2YX4A 4C8YA 1YDLA 1YBTA 4NMXA 1HBOB 1TK8A 3LGHA 2KYZA 4WP9A 5RUBA 2MGZB 2UVVA 1HNZJ 1NK6A 1RJJA 5KFKA 4DGPA 3CJ8A 2R7RA 1S9GA 2XYGB 4DV0J 2XGPA 1PTUA 2MLYA 1ACMB 1UFKA 3D9CA 1ZH5A 3FZ2A 1Q8IA 3P5TL 2MGZA 1X5PA 4DUTA 3PW0A 3I80A 4NPOA 2HLTA 3PFEA 4R0TA 3ILJA 5LJ5Y 1PYNA 1WF1A 4RHGA 5HAOA 5GAHU 4F3QA 5DM7Q 4M5JA 1NJIT 3UCZP 1BZCA 2OKQA 3CDUA 3M8PB 3T1HJ 3AB2B 3HFZB 2PN6A 2PDAA 1QE1A 1MWZA 1YG0A 2C3OA 3M8WA 2IC3A 2LEPA 5A8WA 4CZCA 3OFHA 4I6WA 1ONYA 4JI2F 3PHTA 3IR5B 4DN9A 5AE1A 1TKTB 4JV5F 3S3FA 3RBDA 3ZM0A 5AJ3J 3LP2B 3VAMA 3N0VA 3IAS9 4OYBA 3IRXB 2X3DA 1R8BA 1RKIA 3AOBA 4IH7A 3R7SB 1JLEB 4CRJA 4NYZA 4CT8A 2AF6A 3M05A 3EE3A 4Y00A 4OL8A 1RXDA 4B04A 5EX0A 4LF2A 4Q45A 1YGYA 1FFGB 3GWCA 1ZTWA 4YR8B 1JLBB 1YJVA 1Q53A 1PJ5A 3BZQA 3MM7A 2KVQE 3PXGa 4JV5J 1BHNA 1UKUA 2Z2ZA 2CZ4A 2QCJA 4YQWA 4B08A 3HHLD 3NG8A 3OTEA 4ZN3A 4OV1A 5ITHA 4BS2A 1G1XA 4DQPA 1QAYA 5KFNA 2UUOA 2QA2A 2ZVIA 1F9FA 2VG7B 3POTA 3UQSA 4F02A 3CJ4A 2MQ8A 2OPRB 4B3SJ 2G4BA 1SJ4P 5EN1A 5IBMA 1I9SA 1F6TA 5F8GA 4OZNA 2VEUA 4ZPVR 3RAXA 3RZ2A 1Y5NB 2B9EA 4YP3A 1Q4RA 3FQLA 3TNVA 5KOXA 2E9RX 3KMQA 3PX4A 2Y9HA 4HTIA 4UTGA 2ZHBA 1U1NA 4HJPA 4PZVA 4OHLA 4N41A 1IKYB 2QBSA 3V0IA 4FS2A 4RNMA 1JLCB 2JSXA 3GYXB 3KK1A 2AYGA 1TL7A 2XEXA 1I94F 3SR9A 4KV8B 5J2PB 3CD0A 2DXFA 2EWHA 3QMQA 2AV5A 3IMQJ 4PUOB 1UWBB 2IVMA 5LSOA 5DQHA 1T8EA 2AM2A 3D2WA 5DGAA 2VA3A 2X1FA 4PQAA 3NL0A 1HW8A 1PILA 4IO9Q 3LOUA 4DR5F 4OV6A 4WF9Q 2CM8A 2CA9A 2GC8A 4AXJA 2P6XA 1JLQA 1VI7A 1QD1A 1CC7A 1IJEB 2HRUA 2G2YA 2HVDA 1C85A 1GQYA 2V50A 4C8NA 3R5DA 3OR1B 4ZVOB 4BC9A 4CLZA 1Y0HA 2QMUB 3EJMA 1SCJB 2X7IA 3U02A 3CF5Q 3SV4A 1QUPA 2RB7A 3LF0A 4CLYA 2LA6A 4M5MA 4F7VA 2IY5B 1PC5A 2OFGX 2FLPA 3T5HA 5LXYA 4K4XA 3V0HA 1S6PB 2Z57B 3IG1A 3I31A 4W90B 1HYSB 1Q7YT 3V0FA 5E2QA 5KG6A 3ETOA 3G71S 2DB1A 5ETKA 2NCKL 2WB4A 3FEZA 2C2EA 1FWLA 1JKHA 4DX7A 1SH3A 4NLUA 4J9RA 3T5JA 2FVQA 3F99A 2DCLA 3W2WA 4AQYJ 2PI7A 5HBMA 2N3OA 1T02A 2W9BB 4RW8A 1G3OA 2LVWA 2YKMA 5JVHQ 2V67A 2HZVA 4ZHRA 2IC3B 5A8WB 4B3RJ 4PWWA 2W25A 2WVDA 4ZPTR 2XZWA 5I3QA 4HTJA 2BQRA 3D0GE 4Y2EA 1S6OA 3M8PA 1WSRA 4HDGA 3OXLA 5KT6A 3MTJA 4DL6A 1VQMS 5EHRA 3ZM1A 2YKQA 1DARA 1FT8A 4U96A 2E1PA 3BBBA 3GP9A 3GSIA 2EFGA 4PEOA 1X8DA 4DL3A 1M5PC 2UUTA 2YKNB 3RYLA 2LFVA 3FBBA 7AT1B 1HWJA 2N7CA 3EGVA 4N47A 2A8BA 2DR8A 2DR5A 2HY3A 1RA6A 1NZAA 3ZZUA 1C0TA 3BM7A 4DV7F 2Y1JA 4IRKA 4LF7J 2VA2A 4BUCA 1RAGB 5KFRA 3VVUA 2OEMA 4HYKA 2FJBB 2G59A 5HMWA 1HBNB 3N6LA 2R3VA 3TEHB 4I69A 3H2UB 1RTHB 3AT1B 2UUWA 4OI1A 2H4GA 3QGHA 1J5EJ 1S1TA 2A3JA 2DH7A 3FMBA 2A3KA 4QR1A 1KSPA 2H4KA 1S1XA 1G6BA 4FNHA 5F0UA 3MCOA 4F2RA 5AE3A 2N4CA 2UXDJ 2E44A 1HR0J 5T14A 2Z8QA 3EDRB 4OI2A 2H5IB 2QA4G 1X0FA 1YN9A 1VQ6S 1TKZB 1ZM9A 4DQQA 5BYRA 1G1GA 4OHWA 4KGVB 3R1HA 1J5OA 4IKAA 5LMNJ 1FO1A 3D3CJ 4BLGA 3PX0A 2E66A 2HCMA 3H2LA 3PTWA 2K7JA 4CLKA 1MG7A 4YY3J 3SI8A 4DU7A 1DRZA 1TMMA 4RKKA 7FD1A 3PR5B 1H72C 5KFYA 1FESA 1S1WB 2ACYA 1LQFA 2GAGC 1XBOA 1K44A 2MZTA 4YHHJ 3O5XA 3V6KA 1PTYA 5A5EA 1C88A 5KA9A 2FJAB 2RF2B 3B4MA 1B0VA 1VQNS 1GMWD 4OX8A 5KG1A 3DYAB 1MSWD 2F4FA 3I0SA 4RW9A 5K8PA 2J6UA 4ANEA 2F65A 3KK3A 5DLGA 3G87A 2NXEA 2OPPA 5F8IA 4X65F 3GFZA 1GH8A 4I2PB 4R8UB 2ZH8A 1NZ8A 3MCSA 1DBDA 3EM1A 2FJEB 1EZZB 3JTNA 2FJNA 4OHVA 1PSDA 2BRLA 3T9ZA 2VL1A 3AHPA 1GEHA 3FC9A 3A12A 2XMAA 4FVMA 2MZRA 1D1UA 3M2VA 4WFAQ 5DM6Q 3OLAA 1REVA 3MPVA 4JI6J 1GMWA 1RABB 4JI3F 3JTOA 5KFLA 2YXLA 2I4EA 1MU2B 1UVMA 3QRRA 4PWDA 4LSLA 4TYBA 4AYBD 2CUYA 2RMLA 2YKAA 2BANA 3D9BA 3ZZPA 4ATNA 2DHXA 4DFKA 1VFJA 4IH5A 5K14B 3MUVP 1QAXA 3UW1A 4Y2IA 3O5TB 4MMOA 1WKJA 2VJUA 3OW2R 2J16A 3NBPB 1WHYA 5K24A 4J9KA 4RWXA 2AZ1A 3J7YU 4UY85 1JLAA 1HW9A 2LU2A 3C6UA 2XM3A 2VOOA 4NXNJ 1FTRA 1WC4A 2QYGA 3H25A 4LF9J 5DS7A 4X4QA 4DUZF 2H54B 3R6LB 3HO1A 4NYHA 1RU1A 3FCVA 4W98A 5D0HA 4KHRA 1U2FA 3FEYB 3VR1A 2JDJA 2BVZA 4R0EA 1RAJA 4H4OA 3TAMB 2IDLA 4QU7A 4IG3B 1NJXA 5IC6B 5KFXA 1G7FA 4LSNB 1H7WA 2Y0BB 4KPYA 1I3OB 2Y1IA 3QIDA 1JBWA 5BZXA 3MZIA 2C3YA 4A8KA 1HIYA 4MK7A 4Y3CA 3WIUA 4RZRA 3PKYA 3ELHA 3RRHA 1XJWB 4AFFA 2DY1A 4YB5A 2DGOA 1VMBA 1R6YA 4DFJA 1HNWF 2HW3A 3ZTRA 1VQYA 3IBFB 2XI3A 1EARA 3I82A 5ETNA 1WTFA 3EWGA 2E1CA 2JL9A 4IQXA 4X4VA 2HVZA 5KFSA 1FRLA 1FPZA 4DCOB 2E0TA 5GVQA 1GX6A 4GMKA 4Y34A 1W25A 3TVZA 2O5DA 4C11B 3BGLA 2ZBIA 3MFHA 2EC0A 2DXPA 2JC1A 2VH7A 2JJ4D 3BN4A 3V2UC 4CT9A 4UOGA 3D6TB 3BBFA 4P7VA 3BQ2A 5K20B 4QBEA 3WQPA 1KQGB 1HWKA 2EKNA 4DPXA 3CEDA 5CZVA 4YR3A 1WNEA 3TEGA 4JP8A 1BUXA 1RTIA 3WX8A 3RG6A 1O5ZA 1FNXH 1UW9A 4IQMA 1HWUA 1S99A 2AHOB 2IJNA 1KP6A 2XI2A 2YTCA 3Q86A 2HHXA 2GWOA 4HRFA 3N0AA 3NAHA 4NYOA 4WPAA 2F6ZA 1KLMA 1NSAA 2Z0GA 1RWNB 2ILZA 4HJQA 2F8HA 2GMLA 1QAJA 2NSCA 2GA7A 4DZDA 2B56A 2HWHA 2JNJA 1D8ZA 4OYAA 2AEJA 2RKIA 2XMKA 4DCJB 5E33A 5IQ6A 4X4UA 1FD8A 2QDMA 4ZVUB 1XC9A 1WOPA 3DN9A 2OD4A 1IN0A 1U8SA 5CD4A 3Q2TC 3I56S 3H5SA 3N79A 2AP6A 4Z2XA 4CDIA 1XQIA 3N01A 3M6VA 2DHGA 4QWCA 2MDAA 3HKWA 3DKDA 5U47A 1S9FA 2OPQB 3DLEA 3OTDA 4RO0A 3HPOA 2HWIA 2QL5B 3IG1B 1BLUA 2HS4A 2KVIA 4PQUA 2G6ZA 3IR6B 1Y00A 2KHDA 2XY6A 4LF8J 5B0GA 1NKCA 1LEOA 4KE5A 4NCGB 2KZZA 2DRBA 4F2SA 1NO6A 3OTOJ 5G4DA 4GO7X 4OJ3A 3K58A 4ED8A 4JI3J 2E1AA 3QT8A 3EZZA 3RAMA 4ECUA 5J1NA 2E1RA 2CWKA 3W2VB 5KTQA 3G8TA 3DMJB 4CO0A 4DV1F 4LF8F 3NNHA 1KS2A 4MJKA 4ZCKA 2JLEA 4IKCA 2M70A 4Y28C 2XCPA 1WELA 4H4KA 4NLRA 5E3AA 1U2CA 2JFDA 4UQTA 1YX2A 3GJRB 1XR5A 3KDOA 3R9LA 3WC0A 1HWIA 1OY9A 4USHA 5DDQC 5M2PA 5BR8J 1YJWS 2M88A 1BQXA 1FEEA 3M4XA 3MGJA 3ZZYA 4DI6A 3Q8PB 1UPPA 3DLBA 5I42B 3CD7A 1RTJA 2OH2A 3S3HA 4XDDA 3RB6A 3DM2A 3NKYA 5DO2A 4KHPJ 1XWLA 2B51A 2V0NA 3TA2A 4QUMA 1RAEB 2B0GA 2BEFA 4NZ7A 5IOLA 4UT4A 3A8JA 3CCWA 3WBZA 4DEZA 4Q0BB 4KH1B 4OLOA 2BX6A 5GMDA 2UXDF 4LSNA 2YKOA 2IA6A 3OL7A 2BQ3A 3TX8A 2ZE2B 1FPRA 1FDAA 1HNVA 4WTOB 2HQIA 4HLBA 2MQLA 2GO9A 2YNGA 3PHEA 4M1KA 5IV4A 4AL5A 1VYAA 3EVWA 4LRDA 1P9QC 1JLFA 4H4MA 4ZJOA 4F0KA 3T5KA 2CM3A 1FCAA 2BJDA 3ULHA 3R2CJ 1HD1A 3EVMA 2A6MA 3T1AA 4RU9A 1MLAA 1FRXA 3A3PB 4YDXA 3ZO7A 3UD3P 3GIIA 1H73A 4G1PA 2DGUA 2OMOA 5KFQA 1Q1MA 1JLAB 3LA0A 2R9LA 1VJQA 2I4HA 3PYFA 2Y0SD 4PCQA 5KT7A 2Y66A 4ZDNA 1KOOA 1FHTA 1Q8LA 2Q6CA 2ZDPA 4ELVA 5BXIA 4ZLNA 5GTJA 1RTIB 2FGOA 3H7HB 1M5HA 2OHDA 1TL3A 1RGVA 3DI6B 4X84A 5C2CA 1RCOB 3B6BA 1MU2A 4HHUA 4QIFA 4CNYA 4NA3A 2VFUA 2CYYA 1EKRA 4LRBA 3KLHB 2HKEA 4PWUA 1XIQA 2P8IA 3MMBA 2L08A 1M1GA 1X4CA 4CTAA 4XPEA 2E9ZA 2EK6A 2RIJA 3KWMA 1P31A 4H54A 3MEKA 2C2KB 5KFWA 1T03A 2R8KA 2AT1B 4J7CA 3CCVS 4X64F 2M9KA 2JFFA 2VG5A 1JB0C 2KHCA 4L75A 4P7TA 4MFBB 3DLLQ 2G9OA 2NXJA 1U1RA 2KFYA 2XPCA 2W2OP 1OS5A 1WI8A 1TQLA 3M2UB 4USWA 2UVUA 4JI4F 1HNZF 1SUGA 3TANA 3QCBA 1TTHB 2D7SA 1IR2A 1NPPA 2XQCA 2UV8A 2RS2A 5BYQA 3A1YG 1BGXT 4DZ6A 5F8LA 4TN2A 2M3VA 5G0RB 3VGUA 4O3QA 4DPWA 2D1CA 2QV6A 2PSZA 3KJQB 4NZ0A 4KAIA 4J90A 2AJ2A 3R5JB 4L6V3 1L8KA 4CVLA 1TK5A 2G13A 2C1EB 4GKJF 1YJRA 2MQNA 4KY3A 1FA0A 3KLIB 2FZGB 3AJ1A 1KOHA 4G1QB 1T9XA 4I4BA 4QIGA 4WP3A 5LMUJ 2MHNA 1CPZA 1XXPA 1P6TA 4C12A 1UL3A 3KG4A 4IFVA 4C6AA 2HHHJ 2V5HG 3C16B 1OSDA 3MPUB 1QY7A 4DL2A 4KH0B 4P72A 2ZH6A 3ET6B 5DZ7A 5HMZA 2W9CA 2BKOA 4ED3A 2J16B 4H34A 2EW9A 3M7VA 1RT1A 2GFFA 1RT5A 5J2NA 2IBOA 4CI0B 1SUQB 4EO6A 2KXHA 5HQ8A 3D6FB 3N5BA 3MURP 3OXGA 4FNIA 3HSZA 1K1SA 4MH8A 2I42A 2JVOA 5ETVA 1NCLA 2OP5A 3DLGB 3OLRA 2CZ9A 1LWXA 3P3DA 5H9FJ 3DRPB 5H9EK 1YTSA 1MMNA 1FDBA 1RTZA 5J8RA 4CO4A 2MQMA 4EMDA 3UO0A 4B3OB 1DQ9A 3GFYA 1P15A 1I9TA 1IXKA 2BJ3A 4YR2A 4WCEQ 3QNWB 3A8KA 2KH9A 2JEFA 2V4QA 1HBMA 2C2DA 2GNKA 3THPA 1VJWA 3UN3A 2BKPA 4MK8A 3U27A 3DRPA 4PKDB 3RJMB 1OESA 3CJTA 1PH0A 4QQBA 4JV2A 4ZK7M 2I6PA 3B78A 3GJQB 3AD8C 2Q05A 4QU6A 5GADU 3UAGA 2BZ2A 1H98A 2PA8D 3CJQA 3UE2A 4USUA 4ZLLA 2MQQA 5HO4A 3Q8SB 1V6HA 3GV8B 3KHLA 2ROEA 2RF6A 2KG0A 3NP5A 5L1LA 1RTDB 4RW6A 1FEHA 3DCAA 4K7QA 1KN6A 3CIZA 2C46A 2B4OA 4I2QA 2JHEA 5LM7E 5KAAA 2DGTA 3DC2A 2PMWA 3PDNA 3U96A 2BR0A 1S9EA 2MY8A 1ZPWX 4Y2CA 4U7UD 3TW0A 1BZJA 1Q6TA 1S1VB 2GVZA 2ZN7A 1ZTTA 4GKJJ 2RUGA 4DLEA 3ZMPA 1IM4A 2F8MA 3GTYX 1HNXF 1BZHA 4LBIA 4O4RA 2HNQA 2F7VA 1KVIA 1YGRA 4Z7CA 1LWCA 3BPDA 3GJTB 5CAAA 4HKQA 2CJQA 2VBZA 5E5NA 1LWEA 3ENWA 2I6WA 3IN5A 4F4YA 2FGCA 4ECZA 1U2RA 2VIHA 3V6HA 4LQ3A 1C0TB 4J9NA 2E5LF 2OI2A 2CXEA 2ATCB 1QAIA 1F2GA 2UUPA 3O3LA 3MAAB 1S7HA 1U47A 4KJIA 4F36A 1B3TA 3GYNA 4TYAA 2W2NP 2YX1A 4BUBA 2HEKA 4OZ0A 2NREA 3AY0A 2CPEA 1XNRF 3UCGA 1KHWA 4UOCA 4O23A 2OTJS 2QL9B 4LBPA 3HJVA 1TFYA 2R4FA 1Y5LB 1NDCA 2LLZA 3R6GB 3VHQA 2LQBA 3RU0A 4EI2A 1GMVA 3I96A 5IV3A 3HHLA 3LK7A 1S1UA 1I1GA 1YBAA 4V19X 4XO0A 2CPYA 3W1YC 4RW8B 2QDCA 4H1OA 1T9UA 1NAQA 3F9BA 4TQSA 2IM0A 1NUEA 1TL3B 4ZCIA 3H4BA 1U4BA 4K4YA 1JMTA 3BYRA 1JKHB 1NMEB 3NLCA 1YKWA 4MAKA 5KG0A 4KGKA 1JXLA 1IBMF 3AB4B 2COLA 1X4GA 5KFAA 1MW7A 5JJBA 6FDRA 3SV3A 1LWEB 2X3GA 3GJSB 2NZ6A 4DQIA 3MVNA 3MHYA 4F4ZA 1LWCB 3F44A 5D15A 5KG5A 3MFIA 3OR2A 3HX9A 1VQ5S 1IKXB 1HQUB 1TUGB 3QO9B 2V8PA 4FPIA 1GXUA 3R27A 3R97A 3TX0A 3RRGA 1UVIA 2QL7B 1C1CB 2F8EX 3DGPB 3LPYA 4OX9F 3ZZZA 4PQUB 5T7LB 1D9DA 2B4PA 4ZVSB 2KT5A 3EVOA 1S1VA 3QFWA 3BGRA 1R8AA 1W7WA 4U8VA 3KLIA 2LQ8A 2Z30B 3M8RA 3FSIA 2F00A 1NPRA 4ERDA 1HLWA 2B7CB 3WIVA 1DTTB 2P2CB 3NRBA 4M5DA 3NS6A 4ECSA 3PVXA 2X5OA 5EHPA 1IKVB 2BGDA 3HHKA 1RKJA 4OYZA 1KBRA 2UUCF 1E6YB 3EU0A 2MB0B 4KV8A 3HK2A 3GONA 2VICA 1KLNA 2DR6A 4OHYA 1M5SA 1TL7B 1UZDA 3HHLC 2BJEA 4RL1A 4CNZA 4DPOA 1XBWA 3I4HX 4NX9A 5KFDA 4YHHF 1T9TA 2B5JA 5K8MA 1RYSA 1HI0P 1VQLS 4A8FA 2XNRA 3MAQA 4Q43A 2ZZTA 4CIOA 2B43A 2LCWA 3JTPA 1WHWA 4USTA 4YY3F 3J81Y 4B9TA 2AIRB 2ZZNA 4WK3A 5B7WA 2VJVA 5FJ4A 4CO5A 4KSEB 3CMAS 2OC3A 4ES1A 2HNDA 4WKRA 5HMXA 1NBEB 2EBEA 2KN4A 2LQ9A 2V94A 4N5SA 2R8GA 2VOPA 3CD5A 3I7ZA 1VLOA 1VRTB 3I6PA 4WBFA 4ZCLA 2UXCJ 1BXNA 4QAHA 4LIRA 4WFBQ 3AWEA 4GKKJ 4OMFG 1EP4A 2K06A 3UFCX 2FVRA 4EYHB 1G1HA 1R0AA 5CCMA 1QXKA 1W2BR 4JI6F 2BV3A 3CPWR 3JYTB 2B9XA 4RX6A 3D7SB 2ZWOA 4JI0F 1WOOA 2HFSA 5E3PA 4YUDA 5DLFA 3WZ0A 1VQ7S 1ULRA 1WEZA 3AJ2A 1I57A 3DI6A 1APSA 4KC5A 2AZ3A 3LGNA 4ZLPA 2FH7A 3MMJA 3HZGA 3JSYA 3BQ1A 5K8NA 2NXCA 1FDDA 2RILA 2XHCA 1OPIA 2MPUA 1AUDA 4M94A 4LF1A 4OX7A 2DBBA 3QWPA 1VRUA 4E2FB 2CQHA 2P9GA 1U48A 3HLUA 1YTWA 5D0RA 3OD2A 4DR6J 3H4DA 1GNKA 1JK9B 1VQ4S 3RR8A 3VAKA 4U67Q 5J2QA 2DR9A 4CVKA 3K5PA 5LJ3Y 2XULA 1DTQA 1X60A 3D68A 2R2TA 1F5CA 1IQZA 2IFXA 2BE2B 3CO0P 3TJ8A 4DPTA 2Z2MA 2KZMA 4P52A 4NLGA 4DV4F 4BWMA 3QCEA 4ICZA 1SJFA 1KVJA 1WEYA 1FK9B 2HAIA 4RI5A 2GGPA 1V5IB 4ES2A 5GMKa 3IWNC 1JBVA 1S12A 2ROPA 1N0UA 3DRSA 2R2UA 1RT4A 2FJMA 4NLVA 4DV5J 1N56A 4JMJA 3QLHB 2W4PA 1HFEL 2C2RA 3R3TA 3IS9A 3M32A 3SCIE 4WE1B 3BB5A 4RBTA 4DG1A 1E6VA 1R6VA 4LR7A 2PI4A 5J2MB 4LF5F 3AFGA 2RQ4A 2WSEC 5M2UA 1FTCA 4MIBA 2J7UA 1DFDA 1ZA1B 5F0WA 3M1VA 3RGIA 3UI3A 2AGQA 2DO0A 2PGCA 3CJ5A 1OSCA 3F41A 3NAIA 4DR1J 2F4VF 1DJ0A 1JJCB 3E01A 4QAPA 2BGEA 2PO4A 2PEBA 4MFBA 4QBUA 3F9AA 2J9EA 2HFOA 4DR3J 4EZ9A 2EG1A 4ZCMA 2HYIB 1U26A 3H42A 2V8GA 2I5JA 2LEBA 1G2EA 2XZTB 2DRAA 1N32F 2HHWA 4RNHA 1S4FA 1EHWA 2XYPB 3DRRA 3MMBB 4TY8B 4F50A 1G4US 2ZBRA 1C0UB 4F3MA 3O1LA 1F60B 1RSCA 3QPIA 1D09B 3ADAC 4RR5A 4WFXA 1CJUB 3UN2A 3OFGA 4R0JA 1E6VB 2NYIA 2UUBJ 2E7XA 3IC1A 4NCGA 4AD6A 2QBQA 4PG4A 2F9JA 1Q8BA 2MTLA 1FDNA 2EK1A 2AW0A 1RT4B 4NRTA 5A8RB 3ZFVA 3EPGA 3BGFA 1Y5IB 3PNIA 2QMWA 2KM8C 5L1JA 4MIWA 5DGBA 2ZZMA 1Q6MA 3TQEA 3TVYA 3GXGA 5H9FK 5CA5A 1DQ8A 1RBOB 2PE8A 2RQCA 1WEXA 3KJFB 3HVWA 5IT0A 3B54A 4LRCA 3D0HE 1HQEB 3T6JA 3J7AN 3ZZ0A 1K9MT 1PYTA 5KA4A 3QCIA 4HL9A 4KBIA 5LOQA 1YRTA 2H5JB 2QLXA 4KO0B 5C42B 1X31C 4HH0A 4TQRA 2AEFA 2YNHA 1HNVB 2C22A 2HNZB 3EGNA 3DXSX 1NK0A 2QFJA 4K4UA 2WVEA 3CB4A 5K14A 3CCES 1P3DA 1VHRA 2BANB 1FRKA 3H2XA 2NYHA 1FNMA 2K1RB 2LXFA 2MKIA 2DCUB 2GCFA 3MEEB 3U1MA 2R8IA 3L7PA 2OJ3A 1X4AA 2CQBA 4HACB 2DHHA 1TP7A 2WONA 2AKWB 2R42A 1X4EA 2YQ3A 3CMQA 3ILIA 2H48B 5D4NA 4PXBA 4DN0A 1ZZNA 2DHAA 1OETA 4RW4B 2CPIA 3OT9A 2GHWA 1RI7A 2HFNA 2GIRA 3K7RA 3PG9A 2CQ2A 4FXDA 3MUTP 1RT6A 5ETPA 4RUAA 1MN9A 4OFZA 1Z2LA 3FUYA 2V2VA 2EEYA 1I94J 1LXNA 2CQ1A 2OD6A 2CIMA 3PW7A 2UP1A 3OL9A 4OHDA 4FYYB 2OOQA 2EI5A 3SIPB 1YJNS 4ILRA 2W7OA 2J7KA 2FJDB 4FYXB 3OFEA 3CDEA 4QIWD 1T9VA 1WDDA 4CO1A 4ERCA 1NPKA 4G6VB 1NWEA 1D3WA 1PYOB 1TKXA 2VC1A 4PYHA 2C3UA 1UPMB 1AZSA 4WFYA 5F3ZA 1RT2A 2CRLA 1DHMA 2D69A 1UP1A 4FYWB 4KGXB 3SCLE 5HANA 2KXNB 3F56A 3C6TA 3KDNA 1PKUA 2ZH4A 2CPDA 3CE8A 4P9SA 2ZJPQ 5LMNF 4K50A 1AAXA 2DNLA 1U6FA 2YWKA 1BY9A 1SC3B 3CJRA 3OUYA 3CC7S 4B9VA 2HRTA 4Z7YA 3K5MA 5MMZB 2BW7A 1CLFA 2KFNA 4OZ1A 2CADA 5A6WA 2MZJA 1L3VA 2FHOB 3FKBA 3TUJC 4A47A 2RHQB 2XWYA 1A5YA 1NM2A 1VGYA 3SDEB 5MLCV 3OL6A 1BC6A 2LA4A 2YQ1A 4AT1B 2QBPA 1S6QA 1S1XB 5KFEA 5DZ6A 3NGTA 5HQLA 3HD2A 2C3PA 2OAUA 2W2QP 4C8ZA 2JFGA 3C6UB 1J27A 2KG1A 2IAJB 1TUVA 2GVDB 4PG8A 4QYZJ 4QZVB 5KA3A 1RHRB 4AE5A 2QC3A 4ZJLA 3M8QA 3ZL8A 3MPWA 3FRZA 3HD1A 1REVB 1QTNB 2GX8A 5HP1B 3M2VB 3DLJA 1OQ3A 2W4CA 5L38A 2RQMA 4LBHA 2XZDB 2R7SA 1YHQS 4NLQA 4ED1A 5B0CA 2ZOGA 1FF2A 5ETQA 3SYZA 1HNIA 1TVRA 2ASJA 2CNEA 2W24A 4ETXA 2GS8A 3T6BA 1C1BB 5DG9A 5B0DA 4AL6A 3PYEA 2DNGA 3HMJG 2DVIA 2A6OA 2HHTA 4DBQA 4GC7A 4IRDA 4LF4J 1U1OA 1S0NA 4A8OA 2ZMMA 3Q22A 3SXLA 4ED2A 3GIKA 3CCSS 1K1QA 3PEHA 1S1WA 5L39A 4C0HA 2C2MB 3JAMU 2NSBA 2M4MA 3CDWA 2RSQA 2X1AA 2BABA 1SC4B 3RB3A 1W7KA 3C6TB 4YS2A 2QZ8A 1B0PA 2AMCB 4ENOA 2CJZA 1T95A 3T41A 3ZV2A 5SUHA 1Y3KA 1A9NB 4J91A 2ROGA 1BQMB 4ANCA 3GV5B 3T5LA 5HSPA 4UW2A 4DFPA 1HPZA 2X1BA 1Q78A 1UVLA 2Y68A 3VZIA 3Q83A 3MMCA 2L9DA 5KG4A 1J5OB 4L74A 4W4MA 1B0TA 1NHKL 3OR2B 3W64A 3CULA 4IR1A 5LSRA 2B3TB 1CSJA 3BF4A 4O3OA 4ELUA 2U1AA 1DURA 3FBCA 5IT9Y 2VOSA 3KK1B 3KOAA 1ZAWA 4B3TF 2K7KA 1RTHA 4P6QA 2QJ3A 2GO8A 1XMQJ 3BKUA 4DV4J 3MEEA 4PVGA 4PWDB 1V3RA 4A8WA 2R2SA 5DJBA 2CMCA 2GJ2A 4HVZA 4DPYA 1UJ4A 4V19J 2Y1OA 1PIEA 2DNOA 4QBWA 3S1TA 2ZC4A 3E51A 5AE2A 2F5GA 2XMUA 4KRWA 4UUWA 1YZ4A 2DNZA 5IM0A 5IWAJ 3CCZA 2YKNA 2HBQB 2VZ9A 5L9NA 5L46A 2E5HA 3CGIA 4U7UK 4ED7A 1VC6A 3DLHA 2Y2FA 3X3UA 3JSMB 4FXVA 2A0FB 1PYSB 4O3NA 1KWMA 4TY9A 4ZVQB 4CLTA 4HH1A 1KDNA 2RVJA 4KT0C 3MR5A 3KYLA 1FKAF 2NQPA 4CLUA 1GTEA 3SEOA 3EX7B 4S0GA 1GG4A 3LP1B 4WFZA 4CQ1A 4ZHRB 2J0SD 5D3GA 5SZTA 1OIAA 4UOFA 1R3NA 1WOSA 1RDRA 3X1LB 3G2XA 3NEKA 1WJ9A 1MN7A 3AD7C 1HHTP 5D4OA 3R5BA 1M5KC 3VAGA 1LXJA 3JQMA 2HZCA 4ANDA 1KTQA 1CJUA 3VWSA 4B17A 4ES3A 5GAGU 3UVJA 4LF6F 2HHHF 1PJ7A 2ALZA 4U6PA 3MMAB 2GHPA 3DRRB 1B4SA 4FS1A 3T1YF 4IDKB 2K8GA 2MSTA 3H0PA 3QT7A 2UUCJ 1X9MA 2HMIB 1AFJA 3GR0A 1P9YA 4ZA1A 1YPTA 4QIEA 1RWOB 1NXIA 3NWGA 5ETTA 5HP1A 2EPIA 2XLJA 2QGFB 1WC1A 4NI2A 3RUBL 3TJ9A 4LFCF 1FJEB 4K4VA 1DLOA 2QE5A 3OTOF 2V6AA 1GXLA 1HKAA 1A6LA 1SQGA 3AAWB 4UUXA 2F6YA 2GMJA 4RW7A 1HBNA 3R7NB 3K59A 3QT5A 1I51B 4NLXA 1RWKB 5AXMA 2RU3A 3BJYA 1N48A 1S9GB 4Z6BA 4USMA 3LAKA 3PRDA 4JB8B 3L3CA 2BZLA 2V68A 4P73A 1PC4A 2I0XA 3OL8A 4G65A 5C7PA 5C24B 2DGXA 2CPHA 4IFYB 5H1SV 3KHHA 2HURA 3VALA 5J2PA 2YH1A 1UA0A 4MIAA 4B3MF 3VAIA 1T48A 3CM3A 3N6MA 3HSJA 2D9OA 4RKUC 1XN9A 4ECQA 2ZOMA 4IDKA 3TQ1A 2BOPA 1LFPA 2ZWPA 3I5BA 2AYMA 4FDFA 4ID5B 3MM7B 5D78A 4JMKA 2RD5C 1B7FA 3V6DA 2YKMB 2FHMA 4DV5F 2FVCA 4LT6A 3NMEA 1JX4A 1RT1B 1NB2A 1CBKA 4JI1F 3OLBA 1JLBA 3WDOA 4PRFA 2HAFA 4P71A 4DGXA 5JUMA 4IUFA 4PXCA 1VR6A 3QRQA 4U8YA 1HYSA 2AJQA 3FMWA 1S6PA 3PCOB 3GQCA 5LXQB 2GAHC 1H6KX 2KRBA 4RNNA 3HXMA 4CM0A 2MQOA 1XRIA 2MZSA 3RGOA 1AA1B 2H51B 1CULA 2VB6A 3OPKA 1F5BA 1H0HB 2QLJB 4NWGA 1RUSA 3IP0A 1WSVA 4Y0FA 1D0EA 1EP4B 2F46A 2FHJD 3HVTB 3G6VA 2HPUA 3S01A 4ZP6A 4U9RA 3DOKA 3NGRA 1Q6NA 2I2YA 4QYRA 4A8QA 4LF7F 4YAAA 3V0EA 3BDEA 4RNOA 2C2OB 4C3LA 2BOAA 4FYDA 3R5AA 4MT1A 4C0BA 3BDPA 2I1RA 2QFIA 4HT5A 1EENA 2V2ZA 1N34F 3GG1A 3CCUS 3M8YA 2POKA 3OJSA 2YWEA 4OZ3A 4ZVTB 2I1YA 3VAJA 1SKWA 4OYMA 2R7VA 4ALZA 4F4AA 4NLSA 3PACA 3SSSA 2BDPA 2NXNA 1BQNA 2VBYA 3E8OA 3GMGA 1RBAA 3SSQA 3U1NA 2H1YA 4QWDA 1JJ2R 4FBUA 4J51A 2LQ5A 3AXKA 1LW0A 3QCHA 1D8YA 2HVEA 4EFAC 3G9CA 2Q79A 2ASDA 2JEGA 4DFMA 4GE6A 1PG5B 2FC8A 2XMTA 2AGOA 1FX4A 2DK2A 3BLTA 1X4BA 1S59A 1UFLA 3HDSA 1F9EB 4ITSA 3LP0B 5AXLA 2ZJRQ 1GX5A 2HG4A 5F8MA 2KT2A 3KJVB 5IS2A 3MR2A 2D3ZA 4KR0B 1Z2ZA 1SB6A 2DR7A 3QKQA 1UFWA 2AWZA 2QTWA 4HI2A 1FKPA 5CYQB 3K5NA 3RTVA 4U95A 2FY1A 1S79A 2WRMA 2VQEF 4URSA 2KFZA 1LFWA 1SVDA 3BYPA 3MM9B 4P2XA 5IQQA 2MMYA 4A48A 2R7TA 3FFIB 1FERA 1X5TA 1JLEA 5I3UB 4DV6F 2VD3A 2RQKA 4WK1A 3LP1A 1EETB 2F40A 2QYCA 1P27B 3D0IE 1XTZA 2CAJA 5L1IA 3QBCA 1HL6A 4ZVHA 3SZ2A 2I8EA 1RB0A 1YLXA 2VEWA 3EUNA 4RH5A 2JZ5A 3FBFA 1RT3A 3IBWA 3NCPA 6FD1A 1N54B 2FDNA 2B49A 2QX0A 1WHVA 1QVFR 5CZXA 1VQKS 4DF8A 2XWXA 4BPCA 4J9MA 3PIOQ 3K8WA 1MROA 3HP6A 2I38A 1JLGB 3HM9A 4JI7F 1TAUA 2XMMA 3QJPA 1CJVA 3CWJA 1FKOB 4EYIB 1N5QA 5KA8A 3IA0A 4KKOB 3AWFA 1V9OA 3V0JA 5CXTA 3QRPA 2D9PA 1RISA 3QATA 4X4TA 2R7OA 1WD6A 4I8NA 2IHR1 3QAUA 2YWWA 2FD2A 5IC4B 2OLWA 2RS8A 3D1HA 5HROB 3PX6A 3EYZA 4ZPAA 2XBPA 4NRUA 4K8RA 1X4DA 4FKYA 2CQCA 1MWYA 5E3CA 2DH8A 1OYEA 1RHKB 3FEXB 2VKZG 3G6ES 2OEKA 1NNDA 1NK9A 2GVDA 4PAAA 3SQGB 1S48A 4C13A 2J76E 5I4MA 3UD5A 4ECRA 2FHKA 2C42A 5HVHA 3UNYA 2N4DA 5KG3A 3NGSA 3QZ8A 3P4UB 1A7GE 3OHBA 2MXYA 3JQKA 2BACA 4DR3F 3QGPA 1T7PA 1HWLA 4TNOA 3LTOA 4OI3A 1R0CB 1L3SA 1G7CB 2H3EB 2NUHA 2OELA 2V8HA 1SJ3P 2UXBF 3EZOA 2VV5A 2WHOA 1S9EB 2Y96A 3J7A1 3IXQA 3MAHA 4X4RA 2ZJQQ 2F9DA 1VK3A 1X5OA 1J5EF 4DR2J 1R6HA 4X4SA 3BEGB 2RU9A 3ETMA 5D4PA 4DQSA 3MEGA 1ZC0A 2VG6B 3KLEB 4QWEA 4LFBJ 2VEYA 3AQPA 4JOUA 2FLOA 3BR9A 4WIQA 4A46A 5A2QY 3HHEA 4NZ6A 1RXOB 1WAXA 2DKOB 2CMBA 3A5KA 1PA1A 1XK8A 3N5FA 3THVA 4FF3A 2GC6A 1DY3A 3W7BA 3UDVA 5EUHA 4A8SA 4P75A 4JUZA 4ZIWA 3L09A 3H59A 4DSLA 4QF5A 3Q0AA 1N4LA 1F9HA 1WWHA 2LU1A 2XSJA 3I0RA 2L9NA 1RT7B 1BWVA 1VIXA 2AU0A 2VTEA 5C25A 4NCAA 4NLOA 3KG1A 5CYMB 1UTAA 3LPEA 1VIOA 3FCHA 1KLMB 3DXBA 3K5OA 2JC0A 3ZTPA 2WTFA 1YQHA 1WRMA 4ZOSA 3GXHA 3N28A 2WZ1A 1T3OA 4DR4F 5FIIA 4GVLA 1KFDA 3A8EA 2NZCA 1KQSR 1XEZA 3MOJB 2QEPA 3QCFA 4QDIA 4AQYF 2DITA 2VU5A 3FRYA 3C14B 3EGZA 3M2RB 2KKHA 1RZMA 1Q16B 4Y65A 3TRGA 3Q2SC 2AGPA 1Q95G 4C97A 2M0GB 1M0SA 4H4KC 2VHGA 2WBMA 2NPIA 2FJXA 1YWXA 2B6AA 2HHSA 2DNQA 2BKNA 2IAJA 1IWGA 4WXOA 5A76A 3D6MB 5DDRC 1K8AT 2NT2A 1YRXA 3M8ZA 4LJMA 4XTTA 3PO5A 4ILLA 4IOBA 1GQEA 2W9CB 1WF0A 3QCCA 1X5SA 1L5UA 1U49A 5KT3A 4GWFA 4UZBA 4KO0A 5C42A 4CH0S 3N4WA 4FP9A 2WSCC 1WC0A 1RT3B 2MLZA 3CSKA 4IFVB 4RUCA 1B99A 4RWWA 3HVRA 1SBRA 2I6MA 5C25B 2AQ4A 2DEIA 4DR4J 1YTYA 4DR7J 3C3LA 4B9LA 2J7WA 3MMCB 2IJRA 3PJWA 4M5KA 2P5VA 5E3RA 4RW9B 4E8UA 4ZVFA 3J81j 3G4SS 5KA0A 3IAM9 4ED6A 1HMVB 1D5RA 1YFOA 4B9SA 1FJGF 2OGUA 2RF2A 2IM3A 1PTTA 1B7YB 2HS0A 4CM2A 3OTBA 4GC6A 2DNKA 2VASA 3QGIA 3TAMA 1GMUA 3GR1A 2FYXA 4F25A 3PY8A 4F4KA 3PV8A 3MXHP 2HXPA 4DWIA 2QDPA 1UEKA 2G2ZA 2UUAJ 1LWFA 1HMVA 4IOAQ 2YPYA 1O8BA 2ZBCA 4OI4A 4ZPBA 1PAEX 3NMAA 2WJPA 1OY6A 3IFEA 4ECYA 5J1EA 1ZPVA 2GJFA 2OMLA 5ETLA 3ZNUA 4DMZA 2B4VA 3I9V9 4F0MA 4F8RA 1U6ZA 4EUVA 3V4MA 1LW0B 3N6NA 4EBDA 4RI4A 3C15B 1FWKA 3GSDA 3ISNC 3EB1A 2WCXA 3D66A 1TZ0A 5D4LA 4DR1F 4YR0A 3O4SA 3TA0A 3SQGA 4HACA 4WU3A 2CFVA 3M1VB 2BJ7A 1GAOA 2G2OA 3C19A 4RUBA 5KFUA 4CLSA 3KHGA 3UCUP 4LF5J 3LWMA 3QCDA 2AYBA 1F0XA 1WI6A 2FIUA 4PG5A 1WC6A 4GFUA 5KFHA 1O0PA 4A4JA 3UPFA 2DRDA 1Y7PA 1Q5VA 2DIUA 1NSPA 1T94A 2DNPA 3N9UC 4K2JA 3Q8RB 3M9OB 3RB0A 1NO8A 2HNZA 3DRSB 5M2RA 2KM8B 1EEHA 4M5LA 2DNMA 2YNIB 2H02A 1KQKA 3DOKB 4ZVGA 3PR4A 1F5AA 1SQEA 5GAEI 5HVGA 3MWBA 2AX0A 2PMHA 1VS3A 2MZQA 2ZOFA 1N5YA 1QTMA 4GRYA 2HQ3A 2ZDOA 1BE4A 1HARA 2IRYA 4B9NA 4NXMF 1CS4A 5KA1A 3D44A 1F2HA 2YH0A 3MCNA 2L41A 5J2QB 3I0SB 5F41A 5EWEA 3K57A 5FDLA 3BO2A 1UA1A 2HC1A 3TARA 2Q43A 5KFGA 3TUPA 1FGSA 2F70A 2IVYA 3QFHA 2ZE2A 3MCMA 3L7OA 3T19A 3WX4A 3P6YC 2OPSA 3MM6A 3OQ2A 3J80U 4C2MA 2VFRA 4DJBA 3KLEA 2VQEJ 3D42A 2OUDA 4OHHA 2YY3A 3GIMA 2F63A 1PCAA 5CHCB 2DTJA 4NASA 5GMEA 4AXIA 3V6DB 2AX1A 4GFVA 1C0UA 1RADB 4DV6J 1HNXJ 4LFCJ 1FQ1A 1K47A 3W63A 4EEYA 4EO8A 3FCWA 4NLTA 1NHUA 1TKXB 3TYTA 3I32A 5I42A 1ZYQA 3N2AA 2JEIA 4M5IA 4QWAA 1ZZWA 4OZ5A 2NPFA 3BGUA 4GVBB 1CEZA 1CJTA 5IFMA 1FRJA 3FVYA 5CQGA 1QUVA 5FD1A 1U1PA 2QT7A 1NDKA 1UWBA 4M8LA 4DR5J 3KFWX 3FQKA 2QIFA 3MM5B 5KFCA 5HLFB 2KDOA 5LL6d 2VODA 4JYAJ 4WOHA 4WJBA 4RLEA 4WFNQ 4DV1J 4ICLB 2W8LA 4EBEA 4C0OC 2J6SA 4I7FB 4CLPA 1Q5YA 4NXNF 4JV0A 2WAQD 3PIPQ 3BSNA 2B5JB 4F3OA 3ITHB 2CDQA 2UU9F 1IUJA 2E29A 4DUZJ 3BR8A 2KU7A 4NI2B 1YJUA 3KK3B 1FK9A 4HEA9 3JQJA 1IKVA 2YWGA 1PA9A 2I3RA 2V2KA 2HMIA 4LREA 5HN0A 3EAXA 2F6WA 4FKXA 1XR7A 5AWXA 2FVSA 4ETZA 3P49B 1H2VZ 4XDCA 1NEEA 2XG8A 4DU8A 3JAMY 1VQPS 3CVKA 3HVTA 1NL9A 3QCLA 5F9NA 2BBEA 2Z56B 3DLKB 3W3SA 3W2WB 1IBLJ 3RBEA 3TVKA 1FFSB 5B0EA 3ZXWA 4C3KA 3CW2C 2R2RA 1VC0A 4OHEA 1IKXA 1HQUA 2BM0A 4DSKA 1KNZA 1OWXA 3W60A 1JWWA 3EMUA 2YNFB 1BD6A 1LK5A 3I9ZA 4G3IA 4R5PA 3PFOA 1SL1A 2XS2A 1CVJA 1IM6A 1D9FA 5A8RA 4Z37A 2BM1A 2ZBPA 2PA3A 1V5VA 1VQ9S 5KACA 3V4IA 2RAQA 1U02A 3HF5A 3V6JA 3JB9k 1UJ5A 3JSMA 3P8BB 1YK9A 2AD9A 1FXDA 1ZZFA 1WDTA 1O6XA 4ID5A 1M1KT 1XERA 3EGWB 3VZHA 1HI1A 2WK4A 3KUGA 3Q8UA 5E41A 1RHQB 4C11A 4P2FA 3G6YA 2I5JB 4HR2A 3THTA 4LVNP 4V1Ak 4ZVEA 3BQ0A 1AROP 4P10A 1OPZA 2K3IA 3CJSA 4O44B 4ZP8A 1J2VA 3E01B 2HNYA 4M5NA 4NA2A 2NS1B 4NE9C 2KT3A 3VCDA 4NWFA 3U7JA 4DSJA 3NCRA 1O51A 3MF5A 3KLGA 3KHRA 1S72S 3LH2S 5KFVA 1OEMX 1PJ6A 4C98A 3L9ZA 2CVEA 2RJZA 2W4DA 1VISA 3MM5A 4URQU 5J2MA 2XMVA 2VPZB 1HHQA 4WXWA 1HNWJ 1QZ0A 3UDCA 2NV5A 3OVAA 4GRSA 1KC8T 2ZH7A 1UW4A 3MI7X 3RO1A 3W65A 1DLOB 3CJ3A 3IWXA 4IG3A 3H5YA 4C8OA 3ZM5A 4DV3J 1PBAA 2P9CA 2ZITA 2MKSA 2KI2A 2HFUA 3BGRB 4OZ2A 4QIVA 5BX1A 2GMHA 1TL5A 1IBKJ 2X51A 3AH6A 2C7SA 3A4TA 3LAMA 1SL0A 2LP4A 4XAKA 2Q3PA 2MYFA 3VGVA 4NLPA 1H2UX 1S49A 1JIHA 2NXUA 3MMAA 4TLRA 3QAEA 2GQ2A 1RLDA 1I6JA 2FLNA 2A2DA 2QLFB 2PMZD 4TKTA 2CMAA 2N3LA 4CVMA 3E3XA 2CQ4A 5ETSA 1U45A 4D3QA 5I6VA 2MKYA 1RK8A 3H20A 1FNOA 7FDRA 5GAEU 4ZN5A 1OEUA 2KJVA 4EZ6A 4B3RF 4I64A 1N6QB 2MKHA 2V34A 5CYJA 4CYUA 4GE2A 2L48A 5CCLA 2ZNZA 3PW5A 3IWLA 4AL7A 8AT1B 2JLFA 1IBMJ 2M8DB 1F3FA 4N76A 2DGWA 5BJRA 5D3GB 3BGOP 4DL0C 4WWSA 4ZJQA 1TL1A 2IIHA 2IJFA 3JYTA 2QA4S 2HHVA 2F71A 3UR0A 1C1BA 4DX8H 2CNGA 5ETOA 1YJ9S 2BIJA 1GK8A 4KQZA 1ELOA 2CDRB 2E7VA 3IRWP 4OQJA 4OYXA 3QCJA 5C24A 1JXEA 1RAAB 3EZ5A 2E9TA 1VBYA 4JI8F 1IBLF 2CG8A 2ZD1B 4ZP9A 2VKRA 1P1LA 3AXMA 3IBCB 3W5ZA 2ZHAA 2FY8A 2HBZB 4ZKAA 3K89A 2HQFA 4WZQA 3LW5C 4ED4A 1E8CA 4OJHA 4UQGA 4LVOP 4B02A 1CJKA 3MEDB 1S77D 1NH7A 1JNZB 1ZA2B 2JJDA 2G1HA 2F6TA 1H3DA 1SUQA 2DYAA 2GIQA 1G7GA 5J2NB 2CNIA
chains in the Genus database with same CATH topology
1HA1A 4WIIA 2JOQA 2UUAF 3GV7B 2OO4A 4BHQA 2XNQA 4K59A 2P6SA 4USJC 4PPDA 1FJCA 2CQPA 4BC7A 2LXUA 2BXJA 2QSFA 3DHXA 4HHJA 1HI8A 1Q79A 4OHXA 2XS5A 1VOMA 1ZAVA 5MAOA 1TV6B 2HLUA 2O67A 4C8LA 2V4RA 3MECB 2AJFE 3FZBA 5F8JA 3IR7B 3QO9A 1S1TB 2I75A 1P1TA 4C8MA 2MHEA 2XHWA 3CJ0A 2ZH5A 2IYGA 4PR6A 3PO4A 4MYTA 1NK7A 1SI9A 2DH9A 2H5EA 1ONZA 1HBUA 3S6EA 2M8HA 2KJWA 1X4HA 2CQ3A 3AQOA 3KLGB 3V0DA 3O4TA 3M9NB 3AWGA 1ZM4A 2JEJA 2DISA 2JRSA 3HHLB 5D8HB 4GS0A 5F8NA 1CQMA 1N5SA 3H5XA 1Z4UA 2IRXA 5DG8A 3CD6S 2LMIA 4RBUA 3QIPB 2VPYB 1EEOA 1AFIA 1JF7A 2WONB 4FZVA 3OTCA 1X4FA 4RUHA 3S7RA 2KXFA 1M5VC 1Q6PA 4DHVA 1YTNA 4IG0B 3ENVA 4OJ1A 3KLHA 1KFSA 2W9BA 5KT4A 3V4IB 5E7OB 3M2RA 1RT5B 2SXLA 3NNAA 2DNHA 2G0CA 4DSIA 1LW2B 2BYCA 2L9WA 3H40A 2EFPA 2CQGA 1N6QA 3LJ8A 3OMHA 3TUZC 1YITS 3H8YA 4Y6IA 2HGMA 1WACA 3I5AA 3RAQA 1YWFA 2HRYA 4N56A 2GV1A 1YIJS 2OTLS 3UD4P 1WG4A 1H7XA 1S6QB 3CDAA 2NR0A 1V3AA 5KT5A 4DR2F 2WB1D 3CJKB 5KADA 1HPZB 1D9AA 1R27B 1M3GA 4Y2MA 1JLFB 4H4MB 4LUBA 5B08A 3G8SA 1JLQB 2WBRA 5K5MA 2RDJA 4N8OA 3CCLS 1Q82T 3K2YA 4DL7A 3O4UA 2GHVC 2I4GA 4B3OA 2YX7A 3V5RA 2H4VA 3M30A 1G1FA 3DHWC 2ASLA 2VG6A 3KK2B 3MOWA 2MKCA 1UJ6A 4DQRA 1UAWA 2WOMB 1VQSA 1FD2A 5IZHA 3HI9A 5F3TA 3V81B 4QBEA 2F6VA 3D1OA 4TY8A 1DQAA 4A8XA 2R8HA 3K8VA 2ADCA 2ZH3A 2IM2A 1N8RT 2ADBA 3Q23A 1U1MA 2LDIA 2E5IA 3KTQA 3C8YA 4WTYA 3U1LA 2EG2A 2FTRA 3D1QA 1NK8A 1HNIB 1TVRB 3POTB 1MMDA 3Q8QB 3KLVA 2OIHA 2I3UA 4NMLA 1OHEA 4O4GA 3R1LA 3HJFA 1U1KA 1TFWA 1J4XA 3KNAA 3FDSA 1OHCA 2IYIA 2ZC3A 4KFBA 5EGYA 4X62F 2GJIA 4XPCA 4L72B 1Y3JA 4D3PA 4B3SF 1KR4A 1O5JA 4FVCA 2HNPA 2R7XA 5GAGI 2OPSB 3MM6B 4FPRA 2GQQA 4GKKF 1JLGA 2HGLA 4DS5A 2FJWA 2VPWB 3D5MA 5KA7A 2I5XA 1TKTA 4YB1P 1N33F 3QKPA 1U09A 4IOCQ 5AXNA 2FC9A 2XMJA 3BO4A 5EWGA 1Q81T 2YNGB 2QMXA 4TLQA 5T41A 2A10A 2MQPA 3LQVA 1JJHA 5HI7A 3OUYB 2QRRA 5A8KB 1KAKA 4DDFA 2V4JB 1DAXA 1XM2A 3E2EA 1VBXA 5K22A 4QWBA 3DOLB 4OI6A 1XMQF 2E5JA 1UEVA 4OX6A 3KJVA 2M7SA 2XLKA 4ICLA 2ZNYA 2CPZA 4B9UA 2O01C 2ZHOA 4O4GB 1C86A 3M2UA 4YMEA 2GW8A 5GADI 2BV5A 1HBOA 5GAHI 4QUNA 2D3UA 2OSQA 2XY7A 5C5JA 1RT6B 1IKWB 1C4AA 1Y4ZB 2HNDB 2CJKA 2UXDF 2W9AA 4K5RA 1C87A 3ENQA 3RB4A 5KFPA 2RDIA 4RNFA 1GTHA 4D3HA 4DUYF 4ZPCA 2NLWA 1LQ9A 4NOHA 3DOLA 4EGLA 1L3KA 4K4WA 3MM8B 1SV5A 4Q2LA 3M9MB 3V81A 2FVPA 1S97A 4PQUB 1LWFB 3LO3A 1KQFB 3OSNA 1NK5A 1KHVA 3DOMA 4FN5A 3KK2A 3M32B 3CT9A 4Q7AA 2F1FA 4ZS6A 3MR3A 5BUGA 1DTTA 4M5DB 1NU4A 1WHXA 3CCMS 2DGVA 4H4OB 1W2IA 2FUG9 3GZ7A 4LF4F 4I67A 2VBWA 3G8QA 2DJWA 4DSEA 2DNRA 1YGUA 2XGQA 2GP0A 4X66F 4FXWA 3CJKA 1ZM2A 2IMOA 3HVAA 4LQ9A 4OI0A 1HQEA 3J7ZT 1Q6SA 2J0XA 1N52B 2ASYA 4ECWA 2E1MC 2YKPA 1Z1ZA 2LQJA 2ZFHA 2HS3A 3TR5A