2B4OA

Structure of the r258k mutant of selenomonas ruminantium ptp-like phytase
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
313
structure length
313
Chain Sequence
b'TVTEPVGSYARAERPQDFEGFVWRLDNDGKEALPRNFRTSADALRAPEKKFHLDAAYVPSREGMDALHISGSSAFTPAQLKNVAAKLREKTAGPIYDVDLRQESHGYLDGIPVSWYGERDWANLGKSQHEALADERHRLHAALHKTVYIAPLGKHKLPEGGEVRRVQKVQTEQEVAEAAGMRYFRIAATDHVWPTPENIDRFLAFYRTLPQDAWLHFHCEAGVGKTTAFMVMTDMLKNPSVSLKDILYRQHEIGGFYYGEFPIKTKDKDSWKTKYYREKIVMIEQFYRYVQENRADGYQTPWSVWLKSHPAKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords myo-inositol hexaphosphate phosphohydrolase
molecule tags Hydrolase
source organism Selenomonas ruminantium
publication title Kinetic and structural analysis of a bacterial protein tyrosine phosphatase-like myo-inositol polyphosphatase.
pubmed doi rcsb
total genus 104
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 3.1.3.72: 5-phytase.
pdb deposition date 2005-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14566 PTPlike_phytase Inositol hexakisphosphate
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1690 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2b4oA01
3.90.190.10 Alpha Beta Alpha-Beta Complex Protein-Tyrosine Phosphatase; Chain A Protein tyrosine phosphatase superfamily 2b4oA02
5KACA 3PS5A 5I6VA 3V0FA 2M3VA 2HC1A 1PA9A 4GE2A 3CWEA 3QCNA 5KAAA 1T48A 2R0BA 3QCIA 3I80A 3S3KA 4GS0A 2HY3A 3QCHA 2CFVA 1L8KA 1OEUA 2NLKA 1PTVA 3V0HA 5BZXA 1XRIA 1C87A 1PTYA 3NMEA 2B4UA 3QCJA 2VEYA 5BUGA 3EU0A 2OUDA 1GFYA 2H02A 5EHRA 3BLUA 5BX1A 4WU2A 4ZRTA 3OMHA 1P15A 3AWEA 3ZMPA 2I5XA 2SHPA 3GXGA 4OHLA 5K22A 3QKQA 3S3EA 2Y2FA 2HNQA 2PA5A 1SUGA 4RH5A 2F70A 2IMGA 3QCBA 2HCMA 2PQ5A 1KAKA 2QBQA 2ZMMA 1FQ1A 2CMAA 2VEWA 2I42A 2CNEA 3QCCA 4JNBA 3QCKA 1I57A 2WGPA 1U25A 3SR9A 2CNGA 4RI4A 2F6WA 1NWLA 3D44A 3V0DA 4J51A 2I4GA 3ZM0A 1ZZWA 3MOZA 1C88A 3O4SA 2I6OA 1KAVA 1ECVA 3O3LA 4KYQA 4GFVA 1C85A 3S4OA 2F6FA 2HB1A 4ZN5A 1OEMX 3AWGA 4Y2EA 5K24A 2QBPA 1QZ0A 4WTYA 3CM3A 3V0JA 1G7GA 2YDUA 4OHIA 3S3FA 1L8GA 1FPRA 3A5JA 3D42A 4IKCA 2P6XA 2Q47A 3V0EA 3AWFA 3OLRA 4BPCA 3BRHA 4Z6BA 1ZCLA 3F9BA 2H4GA 2I6MA 1YTNA 4DGXA 3S4EA 4AZ1A 1WCHA 4R0TA 5KA2A 1YTWA 4GWFA 2PT0A 3A5KA 2B49A 1NL9A 3D1HA 1OESA 1G4WR 1PTTA 3BM8A 3RZ2A 2MBCA 2OZ5A 3RGQA 2B4SA 2AHSA 5M43A 4YAAA 2GJTA 1YZ4A 5LXQB 2BGEA 1LQFA 3BLTA 2RF6A 4QAHA 2G59A 3O4UA 1PTUA 2JJDA 2Q05A 5K9WA 2I75A 1YTSA 4JMJA 4QAPA 1YGUA 1G4US 3V0GA 2OOQA 4GFUA 1JF7A 5K9VA 1ONZA 3F99A 4RKKA 1YFOA 1OEOX 3QCFA 4MBBA 4YR8B 2I3UA 2CNIA 2ESBA 2QCJA 4ERCA 1XXVA 4QBEA 2BV5A 4NNDA 2I6PA 2QBRA 2A3KA 2F71A 1T4JA 1Q6PA 2NTAA 2B07A 1ZC0A 1Q6NA 4GE5A 4WOHA 5KA8A 1T49A 3B7OA 3EAXA 2HVLA 1G1GA 2F46A 1XXPA 3D1OA 2H4VA 3QCMA 5K23A 1YWFA 2VEUA 1VHRA 1BZHA 1OHEA 1Q1MA 1XM2A 4TVVA 5HDEA 2CM3A 2NT7A 2CM7A 4DGPA 1C83A 3ZM3A 1PYNA 1X24A 3EMUA 2CMBA 2B3OA 1FPZA 2H04A 1ZCKA 1BZCA 3QCGA 3V0IA 2QCTA 2I4HA 4PYHA 4WU3A 4RHGA 4ICZA 2QDPA 2I1YA 1RPMA 1M3GA 2NV5A 4GRZA 3ZM1A 5KADA 1D5RA 3I7ZA 2DXPA 5KA4A 2H03A 1Q6MA 2ZN7A 1U26A 2BZLA 1JLNA 2CJZA 1NWEA 1EEOA 1ONYA 3O4TA 2OC3A 1MKPA 4NWGA 2J16B 2QBSA 4HRFA 2J16A 2J17A 1G1HA 2HXPA 1QXKA 1I9TA 2I6JA 4RH9A 2I3RA 1GWZA 4RDDA 2C7SA 4B04A 3EB1A 2I6IA 2AZRA 4S0GA 1OHDA 1OEVA 5KA7A 4HJQA 4R0SA 3U96A 4Y14A 3GXHA 1YN9A 3MMJA 2BGDA 4QBWA 1OHCA 5KA3A 2FJNA 4D3QA 2QDMA 1C86A 4H34A 4ZI4A 1V3AA 4R30A 4NYHA 2B4PA 4HJPA 4BJOA 2VEVA 1NNYA 1EENA 5AWXA 2CNHA 5K25A 2C46A 2B4OA 3F41A 2F6YA 1OETA 4GRYA 2CNFA 3D9CA 2Y96A 2HC2A 5J8RA 1PXHA 1G1FA 4QUMA 5KABA 3RO1A 1PH0A 5KA0A 1PA1A 1AAXA 2NZ6A 1Q6TA 1WAXA 4KYRA 4NWFA 4QUNA 4D3PA 2P4DA 2FH7A 2BIJA 2GP0A 3LJ8A 4NX8A 5KA9A 4JBCA 2NT2A 1R6HA 4JMKA 4H1OA 1Q6SA 1A5YA 2HNPA 2CM2A 1Q6JA 5IBMA 3QCEA 2VEXA 5MMZB 3H2XA 1YGRA 1C84A 2A8BA 5IBSA 4PVGA 4I8NA 1NO6A 2F6VA 3EZZA 3S3HA 2QDCA 2GWOA 1XBOA 4OHEA 3ZMQA 3QCDA 2F6TA 2I4EA 5EHPA 3ZM2A 3D1QA 2E0TA 5BZZA 1NZ7A 1LYVA 1I9SA 2G6ZA 3I36A 3F9AA 3M4UA 1J4XA 3MOWA 1G7FA 3SMEA 1U24A 2PSZA 5KA1A 2F6ZA 5GTJA 3ZV2A 4D3RA 3N0AA 1LARA 3QCLA 2FJMA 2PI7A 3RGOA 4KI9A 1WRMA 2CMCA 4OHDA 2QEPA 3F81A 1RXDA 2H4KA 4RI5A 2CM8A 1YPTA 4GE6A 3O5XA 4OHHA 2PBNA 3QKPA 1BZJA
chains in the Genus database with same CATH superfamily
4NCBA 5F0WA 4I67A 4HDHA 3PYFA 4TY8B 3C8YA 4KT0C 2MSTA 2DNYA 4HT7A 4OIXA 1PA9A 3EVMA 4HHUA 3ZZPA 1TL4A 3EZ5A 1NKEA 3BO4A 5ADZA 4P73A 2OUGA 3N2AA 4MIBA 1XMOF 3QLHA 4KGKA 9RUBA 2YH0A 4I6WA 5I3UB 3QCNA 2H1YA 2RS2A 2BV3A 2HIYA 5K8NA 2AKWB 5KAAA 4KYZA 1WG4A 1T48A 4O4GB 3OUYA 2IA6A 3G2XA 2R0BA 2B8PA 4CNZA 3QZ7A 4M5LA 1RP5A 5AXNA 2Y1JA 3QCIA 4C11A 3S3KA 1MWYA 1W78A 1TL3A 3VAMA 2RRNA 1L8KA 3QCHA 1OEUA 2VBXA 1PTVA 2OEMA 1YSJA 4X4TA 2ZITA 5E3AA 4QBWA 3KHGA 1RUSA 1EX8A 3OXLA 4P2SA 1TUGB 4K7QA 4NCAA 3MMCA 1C87A 3TJ8A 5CYJA 2VHGA 5CYQB 1H2VZ 3THPA 3WIVA 4DL6A 2ZJRQ 4NLSA 4RW9A 4HYKA 1D9DA 4R8UA 2B9WA 1Z2ZA 3C14A 1JNZB 1YK9A 3DDNA 2B4UA 1EETB 1T3OA 4LF7J 2GAHC 5ETNA 1N33J 2NQPA 4ED6A 5BUGA 2DH7A 3LOUA 2FJWA 3HN7A 2HIQA 3PG9A 4DFJA 2UVUA 3LALA 3BGOP 3Q22A 1GFYA 1RZMA 3A8KA 4L6V3 2H02A 1JLBA 2HQDA 1NK9A 1XK8A 1SH2A 1UWAA 3D0IE 4O0IA 4U7UK 5HVHA 1P15A 3PYEA 2A6OA 3GV5B 3ZMPA 4XDDA 4DXLA 2OD6A 5CCLA 2XCPA 3KLHB 3MM9A 2I5XA 4YB5A 1CC8A 3TA2A 3S3EA 1V5IB 2KVIA 1JB0C 1JKHB 3M9OB 1UETA 2OP5A 2PA5A 2KXFA 2WBRA 3UFCX 4RH5A 1QSSA 2RQKA 2CXEA 1G6BA 3QCBA 2FDNA 2GMHA 3VZIA 2GVDB 4FPRA 2XGPA 2GS8A 3M1VA 5KFCA 4CNYA 2CJQA 1MMNA 1SV5A 5HJYA 2ZH4A 4EO6A 2DEJA 4KRWA 3VHQA 2H4YB 1VQ5S 1CEZA 2ZMMA 1T95A 1RT1A 2DNGA 2HGLA 5KT7A 1R7IA 4PG7A 1U1NA 3BB5A 5HL7Q 1N48A 3QPIA 2CPEA 4CLWA 1B0PA 1M5SA 2E7WA 4HI1A 5M2RA 3RBXA 1SC4B 1NO8A 2VF3A 3AH6A 3QCKA 5BZZA 3CD7A 2SHPA 2E44A 3K5PA 3SXLA 4TQSA 2JFFA 4MBBA 4OX6A 3BPSP 3CW2C 1X4GA 1F5CA 1JLGB 3N6NA 1RTJA 2DVIA 3LO3A 1X4CA 1Q8KA 2YPYA 3GYGA 5D4NA 1N34F 1PYSB 4IR9A 4MTPA 4FBUA 1NDKA 2IM0A 3IAS9 4P52A 4KTQA 1EHWA 2I5JB 3V0DA 1SJ3P 2I4GA 1LW2B 3ZM0A 2N3LA 4JI2J 2B51A 4X4NA 2L9DA 5HATA 4C3LA 1S4EA 3MEGA 1XMBA 4ZN1A 2JZ5A 3AJDA 2KG1A 2ZHAA 1RT3B 1AFJA 3CCQS 2VPWB 2HNZB 4UT4A 2AJFE 1WI8A 2Z2YB 4Y2CA 2HBZB 3Q8SB 1QUVA 1FESA 4GC6A 3KFWX 4KYQA 2HNYA 3IMQJ 3K8VA 3VAGA 1HNVB 4BHQA 3CJ5A 3POTB 4OMFG 3DOKB 3AJ1A 2J7KA 4O23A 1F5BA 1RABB 3J7YI 3AWGA 3W5YA 5K24A 2IVMA 3UE2A 4WTYA 4JI7J 4JV2A 4K2XA 1QZ0A 1S1XB 4M5KA 2KTQA 3LGHA 3R2CJ 1G7GA 3MR3A 2CJYB 5LL6d 2KFZA 2Z8QA 1LWFA 3NS5A 2DO0A 1H2TZ 1PSDA 4IFYB 3PW4A 2JFDA 4CLSA 3CUNA 3GYNA 1NMEB 5EGYA 2C3UA 4Y3CA 3S3FA 1L8GA 2QT7A 2W25A 1FPRA 5E3CA 3OLAA 1WF2A 4PCQA 2Q47A 3PFEA 4OYXA 3C16A 3T6BA 2MZQA 3VAIA 3V0EA 3TJ9A 1RT4A 3HFZB 3QT5A 1D1UA 3HK2A 3BGRB 2DIVA 4KV8B 3MMBA 4BLGA 3OLRA 4BPCA 3CDEA 4AYBD 1ZCLA 2B9XA 1RTIA 3FQKA 3C6TB 3PRDA 2MKSA 4LF5F 4A8YA 2D9PA 4DL4A 3HPOA 2DH9A 2EC2A 2FHKA 3LWLA 2OIHA 2YX7A 4R0TA 4PAAA 1RWPB 2O01C 5DM6Q 4QWEA 3GV7B 2V6AA 1WTBA 3RGIA 1OSCA 2CJBA 1TKTA 2E66A 2NXCA 5E2QA 4UOGA 2XC9A 3MAAB 4DLEA 3D67A 3R8YA 4K4XA 2WSFC 2AJ1A 3KLIB 4PYAA 4WFBQ 1KNZA 7FD1A 2F9DA 1FJGJ 1NL9A 4CIOA 1RTDA 1TQLA 2IFXA 4KHPJ 3I5CA 3I55S 4G1QA 1Y5IB 3M1VB 4N41A 1YX2A 4DPXA 2IY5B 2F5GA 4D3QA 5HBMB 1AZSB 2MBCA 2OZ5A 3OL9A 4HVZA 4GC7A 2B4SA 2DNZA 1B7FA 2V50A 5J2PA 3LP2A 3UDVA 1JKHA 1RT2B 3R6GB 4F4AA 4O44B 1NHKL 3NBPA 4K8RA 4YAAA 2FJVA 1N52B 4C12A 2J9DE 1YZ4A 4RUAA 2FVQA 1GMUA 2MLZA 3DLJA 3LP2B 3O8WA 4V1Ak 3W8PA 1KEKA 4QW8A 3N79A 4ECYA 1ZYQA 4ATNA 3VGVA 5KOXA 5L39A 2W2MP 3M2UB 1M5PC 3ISNC 4K4ZA 2AM1A 2G59A 4ZN3A 4J91A 3FEZA 2JJDA 3TW0A 2G1DA 1MW7A 2GVZA 4ECQA 1G4CA 3ILOA 2RKIA 5T7LA 1B3TA 4IQXA 2DXFA 4QAPA 2JX2A 3NGKA 2FB0A 3BKFA 3C66A 3OVSA 2VIHA 1B70B 1S0MA 2DHXA 2FY8A 4ILRA 2D3OR 4LF4F 3M05A 2OOQA 1X60A 3RG6A 2G2ZA 1WC4A 3MEEA 4AXJA 4RW8B 2LA6A 3VV2B 4WZMA 5HVGA 1B99A 1WI6A 2BW2A 1JF7A 3JTOA 1FXDA 1W25A 2Y3YA 3RR7A 4OI0A 3F99A 4X64J 1EQ0A 3MEKA 2GQ2A 3GYXB 1CJKB 2I0XA 5IOLA 1DARA 3ZTPA 3BGRA 4EMDA 4Q5VA 2NUHA 3HXMA 3GP9A 1ZBTA 3KHRA 1QTNB 4F50A 1GTHA 1T9TA 1HPZA 1BQMA 1YGYA 3MDFA 2V2KA 4KFBA 4TYBA 4Q43A 1OY8A 2P9CA 4YR8B 2AV5A 2CDQA 1TFYA 2I3UA 2MDAA 4XO0A 2KT3A 3TAQA 1XXVA 1NPRA 5CH7B 3T1HF 4QOTA 2AYBA 1FRMA 2A3KA 3CD0A 3W5ZA 5HQ8A 1NKCA 4F3OA 4NX9A 2MQQA 2R8KA 5HROB 1TKZB 2XLIA 2F71A 1TU0B 5F8MA 1HQ2A 3DOLB 3CCSS 4Q8EA 2M5YA 2NTAA 1JLFA 1S6PB 4U95A 5HP1A 5U47A 1T05B 4KO0B 1Z4UA 1CC7A 1I51B 2XBPA 3DOKA 4USWA 4KHRA 3CXCR 2QA4G 2XHCA 2CVEA 1IBLJ 1T49A 2XMMA 1R0AB 2DKOB 2M70A 2MZJA 3M8YA 4F2RA 3FUYA 3UN5A 2DHAA 4JI3F 5AE3A 4F0KA 3PNIA 3TUZC 2Y1OA 3TP2A 1XXPA 4KE5A 3VVTA 4M5DB 2YKAA 4DCOB 4S0MA 3FGVA 3H2LA 4OYPA 1HARA 1S1UA 2W01A 3ISZA 4ECUA 4ZLPA 2MPUA 1NKBA 3FBBA 1XNQF 5K23A 4OL8A 3IO1A 4BDPA 1Z1ZA 3BR9A 3SMZA 1VBZA 1QUPA 1Q1MA 2VOOA 4FPIA 1YJVA 4P75A 2PMHA 4TVVA 4IO9Q 3FFIB 1FGSA 5HDEA 3AA8A 1RAIB 4YFUA 2HMIA 4A8FA 4X4PA 2GJFA 4XPEA 3RB4A 2CM7A 2DD8S 2RD5C 1H98A 5A6WA 4IG3B 4LUBA 4ANEA 4WKYA 3S4OA 5K9FA 1UP1A 1ZM3A 2ZOFA 3ETOA 2GV1A 2OO4A 3NOGA 4QYZJ 1MMDA 3FMWA 1S5ZA 4IRCA 2ZKTA 4DV1F 3JQKA 1FRKA 4EZ6A 2H04A 4DFMA 5AXMA 3KLEB 4FNIA 2PO4A 1O0PA 3G8QA 3KLIA 4KH0B 1ROFA 4CH7A 3JAMY 4ECZA 2QCTA 4C4WA 3QO9A 1BC6A 1NDLA 2HFNA 5LSLA 1W26A 2M9KA 3EGWB 3OXFA 3I0SB 3TVKA 2LQJA 2ZC3A 3PX0A 4LFAF 4QBUA 3RBEA 1NK5A 4RHGA 4O4RA 4RX6A 4DQQA 2JVRA 2WBMA 1C1BA 2IPOB 3B54A 3KLFA 1MU2A 3KK3B 3MOJB 1V3RA 4E2FB 4LF7F 5KADA 3DMJA 4LBHA 3UDCA 5AJ3F 1S0NA 1W2BR 2Q6CA 1HI8A 2HS4A 3CB4A 3FBCA 2DXPA 1LFWA 2R7SA 2HFVA 1H7WA 1U0HB 3M8QB 2CYYA 3OQ2A 1XQIA 4USVA 5GADU 5DQGA 2H03A 3IBWA 4KC5A 3MM9B 2DR7A 2IBOA 3D54A 5SUHA 1U26A 1VHFA 1RQ0A 4KGZB 3DLLQ 4HV4A 2BX6A 2RDJA 1T05A 1HD0A 3GJTB 4IOBA 1DZ5A 3VAFA 3UCGA 4CVKA 5KT6A 1EEOA 1JLAA 4IOAQ 1Q1KA 4M5NA 2GIQA 5IT4A 3O4TA 4Y6IA 4B9UA 1MKPA 1PJ5A 2QIFA 1R0AA 2VDHA 4DR1F 4K0KF 4TLRA 3DLKB 4ECSA 3FCVA 1S6UA 2I9SA 3M6XA 2J16A 4UQTA 2EWHA 1RTHA 2FJBB 3H2UB 3PRVA 3G6YA 1FNMA 1T94A 3KLGA 1RKJA 2HXPA 3EGZA 2I6JA 1S1TB 2A18A 3GJRB 4J37A 1UVKA 5IM0B 1F5AA 1PJ6A 2K3IA 2Z56B 2EEYA 5DM7Q 1QAIA 1SJRA 3LK7A 4PRFA 4O3PA 3DLEA 3EB1A 1S72S 2XPCA 2XEXA 3IA0A 3VVUA 2QV6A 1AROP 1N33F 3IS9B 4O3SA 2GX8A 5I3PA 3N6LA 4ZPWR 5KT3A 4UQGA 4OYBA 2V4RA 4S0GA 2MZTA 4LRDA 3HLUA 2KZZA 1OEVA 4DFPA 1SC1B 1HPZB 5KA0A 2CQ0A 2FD2A 2JLEA 1C0UA 4PEOA 4CLUA 2D69A 1VHIA 1CJKA 4EEYA 1SL2A 1RU1A 2A2DA 2ASDA 2OTJS 3W2WB 3DXBA 4TLQA 2XHWA 2OEJA 2RH3A 2R2RA 4F4XA 2QFJA 3U96A 4AUKA 1JLCB 3JSRA 3TX8A 1IKXA 2DPIA 2F00A 2QA2A 1OWXA 3H59A 3MMJA 3OXGA 4U8VA 3SSSA 1OHCA 3DOLA 2FJNA 4NOHA 2K2PA 2HQGA 3AAWB 1LEOA 2GAGC 4DX8H 3W64A 1RT6A 1NPPA 3UN3A 4CT9A 2WB4A 2O1PA 2PD1A 3AB2B 3H5YA 2X1BA 4ID5B 4Q7AA 1HWUA 4ELTA 1QAJA 5LMUF 3UVJA 1V3AA 2LQ5A 4C0OC 3F73A 4K4SA 4NYHA 1WD6A 4R30A 1WDTA 4CWBA 3M8SA 4FNHA 1Q4RA 4LFAJ 4C98A 2FUG9 2HZAA 3M2UA 1JNRB 2J8AA 2PA8D 1XMQJ 2POKA 1RA7A 3QAUA 4PQUA 2R7TA 1ELOA 2EFOA 2GVDA 3NCPA 1VBKA 4PPDA 5IWAF 2BE7D 3PJ9A 5B0BA 4R0JA 1Q8LA 2E5GA 4XIUA 1OYEA 5DDRC 3BDEA 2ACMA 5THWA 4X64F 3DGVA 8AT1B 3OW2R 3MPVA 1M1GA 4GRYA 2HC2A 2AYGA 2BJEA 3WBZA 4OHYA 2WOMB 2EFQA 3ONQA 3H4BA 1G7CB 2W4CA 3T1YJ 1M5HA 5KFJA 2FHJA 1TVRA 3DHXA 3MUVP 3DRRB 2E5IA 1RACB 1TAQA 3MECA 3HZEA 2WK4A 2YNGB 3R9LA 5FDLA 3BYRA 4UY8T 1WF0A 1NZAA 4YN3B 3SFUA 2DRAA 2JEIA 4RW7B 1KQFB 2XMKA 1KTVA 3RO1A 3HDSA 2BQRA 1F2HA 3MI7X 1X0PA 1U6BA 3Q89A 1VRTB 3LPYA 3M8PA 1K1SA 1RAOA 3O2IA 2WCXA 2DGXA 3OFHA 4M1KA 5GVQA 5KFFA 1RYSA 1XTZA 2V67A 3NGDA 2H5EA 1AUDA 2P6TA 1VBYA 2XS7A 4C9DA 1WAXA 4NWFA 3ZTRA 1E8CA 4OYOA 4RW9B 3BM7A 1S1WB 2OMOA 3VZHA 5LT5A 2C2NA 2BRKA 1J5EF 5HMZA 3QATA 2RVJA 3MD3A 2Y8WA 3LJ8A 1GAOA 2DNRA 3HJVA 3BGLA 2QGFB 2G1HA 5K5MA 2B3TB 2EI5A 1S9FA 4MKBA 4IOCQ 4FF1A 2Y1IA 5KFIA 1RB0A 1HA1A 2DITA 2AJ2A 4BC7A 5GAHU 4JMKA 4GO7X 4ZVSB 3EVWA 3W66A 2QE5A 3BKTA 1DTTB 1VGYA 2J8SA 3UVJB 5KG2A 1DHMA 2AT1B 3M9NB 1WJ9A 2DNQA 2YBVA 3IR5B 1Q6JA 2NXEA 3OT9A 3QCEA 2HNYB 1UL3A 1KD1T 2RF2B 3IR7B 1WC5A 2BXJA 2CWXA 3BPDA 1LOUA 4XTTA 5T41A 3D0HE 3W8GA 1YGRA 5KFZA 4JI4F 4OJ3A 1BQXA 3LGNA 2XY6A 4C7QA 4I8NA 4PR6A 2F6VA 1UKUA 4YB6A 3DNCA 1TKDA 1A6LA 2ZM6J 2B7CB 2HHSA 1XBOA 3QRRA 4ZVEA 3I4PA 2BE2A 3SZ2A 2IRXA 3TUPA 2CZ9A 1IBKF 3QCDA 4OHEA 4ZPCA 4QQBA 1EB0A 1TMJA 2Z0GA 4DL3A 3RW7A 4OV6A 2F6TA 4ECVA 2K06A 2ZE2B 3W60A 1R31A 3ZM2A 3VAJA 1VI7A 4U6PA 2YQ1A 4EBCA 3DLEB 4ZK7M 4LQ3A 7AT1B 3P49B 1KOHA 2WONB 4QCLA 2FGOA 4M5HA 2CG8A 2ZFHA 5IM0A 1UZHA 2XULA 1GX6A 3EWGA 2OPQB 3I87A 3QAEA 5D0RA 2HVDA 2G6ZA 3I36A 3F9AA 2EFGA 5IV3A 2W9BA 3IWLA 5A6PA 2ZH8A 1KLMA 4F36A 1J4XA 3QFHA 4J90A 4I7FB 1L3SA 3KG4A 2CRLA 1VRTA 3M8PB 3W5XA 4XK8C 1UW4A 2ZH1A 2MGZB 2JFHA 3CCUS 3H90A 1PA1A 1HNIA 3DOMB 3AD8C 3Q2TC 4KHPF 4D3RA 3CMQA 4EO8A 4EGLA 1PJ7A 5DJBA 2RMLA 4UTGA 4C8ZA 3KNAA 1TVRB 1VIOA 1RT3A 2DISA 3K5OA 3V6DB 4Y00A 4WFAQ 2D3O1 1RCOB 3DU6A 4NASA 5IFMA 5SZTA 4P72A 1KLNA 3HX9A 1VQYA 1FDAA 5K14A 1U1PA 2YY3A 4MKYA 2UXDJ 1SV5B 3ZM5A 1HHQA 1JXVA 3CCZA 3FZBA 4X65J 2NREA 5A76A 2BYCA 1X8DA 1J5EJ 2HRUA 4ZPVR 1YPTA 1NSKL 3D9BA 2QA4S 4EBDA 1VDHA 4GE6A 2ZBRA 3O5XA 4B3RJ 1GEHA 5IWAJ 3G4SS 5DLFA 3QJJA 2HHQA 5CD4H 1PG5B 2PFDA 1H0HB 2KL8A 5AT1B 2ROGA 2E1RA 3GJSB 3HHLD 4OI1A 1UA0A 2KFNA 1AXQA 2IBKA 1R89A 2KXHA 4Y65A 1ZAWA 3TRGA 2X51A 4PG4A 1JJHA 3DRRA 1YVFA 3MECB 4HI2A 4ZPBA 2NPFA 3S01A 2JLGA 5EN1A 2CNOB 3J7AN 2EKYA 1NSAA 2CQPA 3M7VA 4V19X 1S1VA 2JEJA 2QN6B 4USKA 4IYQA 4CLTA 4J9LA 2UAGA 2EFVA 4WXWA 5E3RA 3IN5A 3C6TA 4FN5A 4NLXA 1N36J 3CGIA 1RSCA 2CUYA 3GIKA 3I80A 1CJVA 1R3NA 2VFUA 2ZEJA 2QLJB 3VTIA 2XY5A 4GS0A 3LP0B 3MMAA 4IKAA 4DR5J 1JJ4A 3MMCB 2AYMA 2YWFA 4W90B 1YBUA 4PQAA 4I68A 5HMXA 5HI7A 3I4HX 3R5BA 8RUCA 4DQRA 4DSFA 2UU9F 3PHTA 2ZBQA 4Z7YA 4DFKA 1KQSR 5BYSA 3CM3A 4I69A 2PGCA 3A8IA 3IWXA 4L3NA 3TO8A 3FRZA 5A8KB 1REGX 4CT8A 1AA1B 4KSEB 1HBUA 4NMXA 3JS9A 3RAMA 2QMXA 2R7VA 1B64A 2GO8A 2XI3A 1S1XA 1PTUA 4CLLA 5B0FA 1UFKA 4B3TJ 2KDOA 4FYXB 1KOOA 2G13A 3AXMA 2CWKA 4LF6F 1RWVB 1LW0B 3C19A 4AFFA 3FBEA 1F9EB 4FBTA 2CQ2A 3HP6A 2ZC4A 2W9BB 4OFZA 1NLKL 2YNFA 2YKOA 2V68A 1GTEA 2VU5A 4WU2A 3PJWA 3AWEA 1PGZA 2E9TA 2WB1D 5C25A 5K22A 2ABYA 1IN0A 2HS0A 1FXRA 4KKOB 4KBIA 5KFAA 3SV3A 2KRRA 5KFVA 2C2RA 3T5JA 1IR1A 3HI9A 4DL2A 3R5AA 5C25B 2IM3A 1EARA 1NK6A 1WORA 4PWDB 3HSJA 2HCMA 5KG6A 1N0UA 2A0FB 2JLFA 3W1YC 3X3UA 2L9WA 3OD2A 4H4MB 3LTOA 4DEZA 3TAPA 2PQ5A 1ZM2A 4IUFA 2DGSA 3OL6A 1MNEA 2W9CA 2YX1A 4QU6A 2Y66A 2AX0A 4CLPA 3DM2A 3OFGA 5KG3A 2CIMA 2J9EA 2OFGX 2HURA 2I42A 2GHVC 3ET6B 4FYVB 4RBVA 2P8IA 1C0TB 5JUMA 3OJSA 1RISA 1SC6A 5CZXA 1NJWA 1S0OA 2ZUAA 1HI0P 4CVLA 4DR1J 5B7WA 3HFKA 4WE1A 4JI8F 3R7BB 4F67A 1DLOB 4V19J 4K2JA 2WGPA 2GFFA 1SH0A 1N32J 4WJBA 3NGTA 1FRXA 1RLDA 1GMVA 3PHEA 5A5FA 3QGHA 1Y11A 3DLGB 1IJFB 4NL5A 4RI4A 2RNEA 4C3KA 1MN7A 3HSGA 1BUXA 2XNRA 4BWMA 3D44A 1JQGA 3UNGC 5KFNA 3A8EA 1HL6A 3DMJB 2WZ1A 4NCGA 2E1MC 5A8KA 1D8YA 2FJEB 5LSOA 3PIPQ 1N56A 2L9NA 3MOZA 4LSNB 2BDPA 1N54B 2R3VA 4FXDA 3R5GA 3MPUB 1PO6A 1ZETA 3O4SA 1L3KA 1S1VB 3CCMS 4ZCLA 4Y34A 1KAVA 3UD5A 4DR2J 2FGCA 2LQBA 5DS7A 4ITSA 1O51A 5IBMA 1ZA1B 4Y2AA 5LM7E 3KLEA 2BM0A 2BACA 3IRWP 2JOQA 1JLBB 2F65A 2F8MA 4P74A 1C85A 2BBEA 2G0IA 3E3XA 3ETMA 3I9V9 2F6FA 2X3GA 3GR1A 3HHLC 3IG1A 5B0CA 4NEYA 2BVZA 2XZDB 1OEMX 3MAAA 1DY3A 1S99A 2JL9A 2UUTA 4IRKA 1BZJA 2QBPA 2MJUA 4C0HA 3MR5A 3VR1A 3AD9C 5H9EJ 3CD5A 3MZIA 1REVB 3TX0A 5BR8J 4DPUA 2VQFF 3ZZZA 1YI2S 1ZM4A 4EWTA 3EDRB 4ZP9A 2CVIA 5F8GA 5L1KA 4QZVB 1V3SA 4NCGB 3CIZA 4KV8A 1UVMA 4IKCA 1GXTA 1RT4B 2HNDA 4CO3A 2HFUA 3KUHA 3JYTA 2P6XA 2CADA 2XB2D 2Q79A 1R0BG 1WUUA 2CKWA 3UDEA 3OFFA 4DBQA 5KFDA 4ECXA 1JX4A 2VG6B 4OZ5A 2L48A 2MY7A 5F9LA 3AWFA 1FWKA 4NLPA 3BRHA 3C6UB 1PYTA 2FZGB 3NAIA 3DN9A 4DUYF 3F9BA 5LJ5Y 1T0TV 1TV6A 1EKSA 3HHLA 2Q3PA 3CWJA 4ZIVA 5LXYA 3OHAA 5D8HB 2ZWPA 5EHHA 4P7VA 4DGXA 2G2YA 2H9ZA 3KK1A 4KGMA 2MQPA 2HK3A 2LDYA 2YWGA 3EGNA 9ATCB 2L08A 1KLMB 5EDWA 2BZ2A 4FS1A 5DGBA 1TL7B 3NXZA 1IKXB 3I5AA 4NZ6A 1X4FA 1C2PA 3J81U 3M8ZA 2J0XA 3DXSX 3MCMA 3QYYA 4NLDA 4Z2XA 1DJ0A 1HI1A 3DYAB 3CSKA 3MEDB 1PC4A 2W7PA 1JK9B 1HNIB 3D1HA 2DHHA 3DOMA 4HR2A 3ZZTA 2A3JA 2AWZA 1C1CA 3CC2S 4FYYB 1TP7A 1CLFA 4JI1F 3BM8A 1CQNA 1UFLA 2Y0SD 1SL1A 3BKUA 1LQ9A 4IFVB 4G65A 1NDPA 4PG6A 4PWWA 1K1QA 1UPMB 5C42A 2FPHX 2GZOA 1NHVA 4ID8A 3BDPA 1IWAA 1W7KA 3FJ2A 3FMBA 2PMZD 5B0EA 1RWXB 1HNZF 2AHSA 1WOSA 4QPXA 2IM2A 5D0HA 3PX6A 2GJTA 1GFWB 1UJ4A 3K2YA 2JWNA 3K89A 4NA2A 4ZVRB 5E5NA 3W65A 3BLTA 5LXQB 3N0VA 2CPJA 4ECRA 2V0NA 2IJNA 2RS8A 3HFVA 4PWUA 1Y9OA 3OTBA 4D3GA 1E6VA 3O4UA 3LQVA 2XGQA 1JLGA 1X5PA 1LW0A 3D3BJ 4X4SA 3TJAA 4CH1A 2E9ZA 4LF5J 2RSQA 5T7LB 5J1NA 2Q05A 4ZIYA 4P9SA 5K9WA 4N8NA 3BN4A 2A6MA 4MYUA 2DEIA 5C7PA 1NJZA 3C2PA 1TMMA 2Q43A 3DKDA 3PRBA 1WTFA 1X5TA 2FTRA 4NZ0A 4HH1A 2QL7B 2OHDA 3OR2B 3HMJG 3G9CA 3DU5A 4GFUA 3E01B 4DCPB 2LQ9A 2X1GA 4J9OA 2Y8YA 2RAQA 3DRPA 4OV1A 4R5PA 3DGPA 3V5RA 4OYMA 1M90T 1ONZA 2CPYA 4RKKA 5K8MA 1RT2A 2D3UA 2MHNA 3F0NA 4P2XA 4TYAA 4TY9A 1YFOA 3D28A 1UVNA 3QCFA 2QLWA 1DQ9A 2QZ8A 1RTJB 4OJHA 4DHVA 1NSPA 4EI2A 4YR2A 3I56S 4GKJJ 2QCJA 3M2RA 3I0RB 5H9FJ 2CQGA 2CAJA 4P6QA 1HNXF 2CJKA 1R8HA 5GAGU 5BXIA 1REVA 1HBNA 1VJWA 4I6YA 4MKAA 5GAEI 2XQCA 1SPBP 2PIIA 3T19A 3KJVB 1JIHA 1KFSA 2HPUA 1WNEA 1T4JA 1IQZA 2HWTA 2XMUA 1BQNB 2GJ2A 2WOMA 1RHKB 4FKXA 5E33A 3MM7A 1ZC0A 3NG8A 1TAUA 4ED5A 2VTDA 1HLWA 5KA8A 3TA0A 3NWRA 1Q79A 1VRUA 4DMZA 2KKHA 3I9ZA 3Q86A 4OZ1A 2ZM6F 1RGVA 2V8DA 4C8OA 2HVLA 3BQ2A 4F3QA 1AB8A 2KM8C 2Q6BA 4LBIA 3D1OA 4QWBA 5IQ6A 3ISND 1IBKJ 4PUOB 3QZ8A 5IZHA 1FRLA 3QCMA 4RKUC 3CVKA 3QNWB 5KG0A 3THTA 2WRMA 1Y3JA 4DS4A 3GSDA 2VEUA 1XNRF 3NGSA 2R7OA 2MEWA 1IM4A 2CNNB 2C3YA 1U6ZA 2RDIA 2BKOA 5KFQA 2GC5A 2OPSB 2W4DA 4Y2MA 1LW2A 2IVYA 2P2CB 3NGUA 1NRKA 3CTRA 4P2MA 2H48B 5CYMB 2H5JB 1AUSL 4K59A 5AE2A 5HK4A 3EMUA 1YJ9S 5I3UA 3HVTB 5KFWA 4OI3A 3POTA 1DQAA 1M5OC 3EXYA 4F04B 5CYMA 4I4BA 3OVBA 2FJXA 4ZPTR 1FKAF 1K8AT 3LUYA 3W62A 1P8GA 2XZTB 1A9NB 1IVZA 1GH8A 3SCIE 3V0IA 2XI2A 2R7UA 3KWMA 5BYRA 3ZTOA 3GTYX 4WYLA 1FO1A 2D1CA 2GO9A 3EDQB 1JLCA 1PBAA 2IJFA 4OLOA 1KDNA 1MLAA 2XMJA 3E51A 3VF0B 5F8LA 1RI7A 1ZZNA 1H7XA 2DGQA 3ILLA 3Q23A 4ICZA 1RT1B 2HHWA 2LLZA 2AP6A 2VKZG 3T41A 3G82A 2QDPA 1C4AA 2I1YA 5IQQA 2MKKA 5JVHQ 2NV5A 4ZPDA 2RRBA 1YQHA 1RT5B 3M8WA 4FVMA 3KMSA 1D5RA 1WKJA 2P6SA 2EPIA 2WVBA 4PPZA 3G82B 4YEAA 3T6JA 2F3JA 2V8PA 1E6YA 3CJ4A 5HLFA 4X4OA 2W2QP 3O44A 1UMJA 3WZ0A 5KA4A 3RB0A 4QIWD 4HHJA 1UZDA 3MEEB 5F3TA 3PYDA 5KFGA 4X65F 5F8NA 3N5FA 4J9UE 4USIA 4N47A 5J1EB 4NLGA 2Z4PA 4X62F 1NWEA 5DGAA 4B3TF 1F3VA 3PKYA 3G6VA 4NXMJ 1HBMA 1LWCB 4GMKA 2CPFA 3ENAA 2B7BB 1RTHB 4NWGA 3IFEA 4DUTA 2CQ3A 5ETLA 2J16B 1OQ3A 3WDOA 1KONA 5A0YA 1T3NA 2QBSA 4BUBA 4LT6A 3R97A 3I7ZA 1U2RA 1WOPA 1YJ7A 3AQOA 3OTCA 3HHDA 3OLBA 4DL7A 1VRQC 3ZO7A 2XMTA 2J17A 3NL0A 3R5CA 1G1HA 3G86A 1I9TA 3CDAA 3RAXA 4RH9A 1EETA 3RU0A 3C14B 2I1RA 2R8IA 1UTAA 1T8EA 2ZDPA 4WIIA 3NEKA 1RBAA 4IO1A 5D3GB 2W4PA 1SJ1A 3KK3A 4B9VA 2C7SA 4QR0A 4P71A 1VS3A 4WPAA 4I2QB 5B0DA 2JSXA 4RR5A 3L9ZA 5KFKA 2AZRA 4PABA 2JJ4D 4C48A 2DB1A 2CQ4A 2JH3A 2GQCA 5AJ3J 4LREA 1A7GE 4ED8A 4PUOA 1TL3B 2R42A 2UZAA 3O5TB 3BGUA 4DR7F 4GVBB 2CQCA 4OZ0A 1I6JA 2DY1A 3W2VB 2O66A 2VC0A 3UW1A 4C2MA 2UUWA 1RTDB 5HMYA 1OPZA 1XBWA 4C8NA 4HL9A 3OBIA 1Q81T 1QJHA 1RK8A 3NKYA 2GJIA 3M4XA 4USHA 4YDDB 3H40A 4Z37A 1VC6A 4DR3F 1S59A 2GIRA 3D6MB 1BQNA 5DQHA 1HHTP 2DRDA 3Q2SC 2N7YA 1RAEB 3W9IA 4C8LA 3C3LA 1SUQB 4PZVA 4R0EA 2HS3A 1YIJS 4DV3J 4JV0A 1IKVB 4K4TA 5K8OA 1GXUA 3CC4S 4GKKJ 3H5XA 1C86A 4OZ2A 1EQMA 4C3MA 2OTLS 4FS2A 3AODA 3FQLA 5AXLA 1IBMF 2QC3A 3QRQA 2JVOA 3P3DA 2ZHOA 3HVWA 2KRBA 1KKHA 4DR4J 4AE5A 4ED1A 2O3DA 2MKHA 3ULHA 4MJKA 1E6YB 4J9NA 1VYAA 2IMOA 3T1HJ 2YVSA 2AGPA 3NNHA 4M5DA 1NK4A 1Q8BA 4BJOA 1S7IA 2CQDA 4A46A 1NNYA 4RNHA 1O5ZA 2IMWP 2WVFA 4QYRA 2CNHA 3DGPB 4KJIA 2CZVC 4RW4B 5K25A 2C46A 3CO0P 3KK2A 3NWGA 3F41A 1OETA 1LWEB 4RUHA 1FVSA 5J2NA 1VBXA 1S1UB 3OTDA 2CNFA 3D9CA 3OR1B 1EKRA 1K47A 4MT1A 3D5MA 5I42A 1TL7A 2E7XA 3P8BB 3ZNUA 3BEGB 5J8RA 3EPGA 2MKJA 3JQMA 3HSDA 4IDKA 4DQPA 2BJ9A 2UVWA 1KS2A 4NA3A 2EBGA 1URRA 3PIOQ 5HROA 2YXLA 3GFHA 2Z58B 1U49A 4ERDA 3OL8A 4WP3A 4ELUA 1WG1A 2H3EB 5HN0A 4H4KA 1LXNA 3MAQA 4EZ9A 1YRUA 1D3WA 1G3OA 1KHWA 1AAXA 2HNZA 1Q6TA 2NZ6A 1LKZA 4KY3A 4KYRA 1BQMB 1X4BA 4QUNA 3H2VE 2KZMA 1RTZA 3MWBA 1RWMB 4ZVTB 1YHQS 4X4UA 2DNMA 4B9LA 1NUEA 4L3KA 4JI5J 2P4DA 4NLYA 1Y00A 4WF9Q 2BIJA 1H74A 2OSRA 2LMIA 2K7KA 4LIWA 1CG2A 2C2ZB 2V8VA 4CH0S 5MAOA 1UEVA 1XC9A 3AA9A 4JV1A 4NX8A 3P5TL 2EG2A 4JBCA 6FD1A 2HFSA 1RBOB 2DHGA 3MPDA 3IR6B 2PEHA 1O5JA 1NJXA 2FHJD 1K0VA 1C1CB 2GHPA 2AZ3A 3J80Y 5J2QB 4N8OA 5DQIA 3F56A 2FVRA 3HM9A 2C42A 1KC8T 2BKPA 2VEXA 3J80U 4C13A 5MMZB 1OYDA 1PIEA 2GNKA 2C3MA 2C28A 4NA1A 5KOWA 3KK1B 2R8GA 5IBSA 1WWHA 4WP9A 5F41A 3O6QA 1KRPA 5ETOA 2GWOA 4NLWA 2CPZA 4OYZA 2O5DA 1KFDA 3R5JB 1QDUB 1P9QC 2GCBA 2VG5B 4NWBA 5AXKA 1CJTA 2G4BA 4F3MA 3R27A 4B08A 3ZMQA 3TZZA 4EU0A 2HYIB 3J7ZT 2FC8A 3M30A 3H25A 1VQSA 3ITHA 5LMNF 4RBUA 1JJ2R 1QSLA 3UR3C 2HNDB 3L7UA 1LNQA 1NJYA 4LF4J 1FEEA 2CQBA 2L3MA 2DJWA 2H54B 3AOBA 3MM5A 1UAWA 3WQPA 2GP0A 4LR9A 2KU7A 1H38A 3D1QA 2ZH6A 2Y67A 3R5DA 1W2IA 1M1HA 5B0AA 1M5VC 2FHMA 1K73T 1RT6B 3IC1A 1FI4A 2ZD1A 3MCNA 4I2PA 3KNGA 4WFXA 3MHYA 3Q8QB 1PKUA 1Q16B 2EFPA 1C0TA 2RQMA 3Q8YA 3QT7A 4A47A 1G7FA 3SMEA 1U24A 2K1RB 3TVYA 4A8OA 4DV1J 2KI2A 2UUCJ 2AU0A 2F6ZA 2VG7B 3AB4B 3P5BP 4CTAA 1MWQA 2VPYB 4GVBA 4X4RA 3RGOA 3BSNA 3RRKA 5JVGQ 4DWIA 1FJCA 3QCLA 3KG1A 3JTPA 2PI7A 4JYAF 4DV3F 2KN4A 4IDKB 4NXNJ 1U4BA 2XLKA 3HSZA 4PWDA 4KI9A 4DR6J 4NLUA 1N88A 1B0VA 5I4MA 3OR1A 1FFSB 4UZBA 2FVCA 4NPOA 2ZH9A 4DR3J 1BE4A 4LFBF 2CMCA 3GZ7A 2J9DA 4PYDA 1QVFR 3F81A 5E0OA 4OZNA 5LOQA 1ZAVA 4OJ1A 1RAFB 4EFAC 4FF4A 1S10A 1RT5A 4FYDA 1VK8A 2AQ4A 4CM0A 1BWEA 2DCUB 4O3NA 1IBMJ 3C15A 4NLOA 5ETPA 3OUYB 1JJCB 2H51B 5KFSA 3KJNB 2J7WA 2ZH7A 2EXUA 1ZAXA 4KKOA 1FEHA 7FDRA 1UWBB 1H73A 3ZZ0A 3QKPA 1KN6A 4ZP7A 2UXDF 2XS2A 5KACA 3PS5A 1HFEL 2FIUA 2GQQA 4DV7F 3ZTSA 3V0FA 5I6VA 4ZCKA 2MQ8A 3EE3A 5J1PA 4DUZF 1TKZA 2ZHBA 4NLRA 2UP1A 2FYXA 5JXSA 3G8TA 2Q66A 3IBCB 1D9AA 2M4MA 4OI6A 4HDGA 2VFVA 5H1SV 3G6ES 3QCZA 3D68A 1D09B 2OSQA 1HMVB 1U0SA 1QVGR 1XMQF 4NI2B 2F1FA 1TV6B 3HHLB 1U1OA 2GGPA 3PM9A 4ED4A 2LKZA 1HBOA 3H42A 2RILA 1LFPA 2QJ3A 3DHWC 3GIMA 2UV8A 1UW9A 1CS4B 1MROB 4IG0B 4RWWA 4UF4A 4K4YA 2VJVA 4A8SA 2ASJA 1K9MT 1XNRJ 2E9RX 4DQIA 4RBTA 3R2DJ 3V0HA 1EZZB 3I82A 2FZKB 4M63A 1TL5A 1TELA 2QMUB 2VH7A 4ZVGA 1IKWA 3FEYB 4ZVUB 1T03B 3CULA 1PTYA 1NK0A 3NMEA 3I5BA 4URSA 4Q8FA 1NNDA 2R4FA 3CCWA 1S1TA 4CDIA 3HO1A 4CCHA 2PE8A 3PKMA 2RKIB 3A3PB 4O0NA 5CAAA 4NEZA 3QCJA 3LANA 4CTAB 3TA1A 1HQEB 1NEEA 2DNOA 2OUDA 3EU0A 4L74A 1PYOB 5D15A 3W9HA 1RHJB 2DTJA 3H5UA 3NS7B 3TUIC 1X4AA 2HFOA 2OAUA 3S6EA 2HHVA 1F1BB 3MF5A 1HQEA 3IM9A 2KG0A 2NYHA 3PW2A 3BLUA 3AOCA 3P4UB 4ED0A 5BX1A 2CQIA 4ZRTA 5A8RA 3OMHA 4FYWB 3VQTA 1NZ8A 3GXGA 3CCLS 2HGNA 5ETMA 3KMQA 3QKQA 3QT8A 1ZPVA 2RRAA 5E3PA 2IA0A 3M2RB 1RWOB 4BC9A 4DR6F 2HNQA 1FFWB 4Q2LA 4LFCJ 1SUGA 2VTEA 1VC0A 3AHPA 5IT9Y 1CJUA 2IYIA 3ITHB 2R2SA 2MLYA 5G0RA 4FF2A 2C2KB 1HYSA 2IMGA 1KTQA 1RU2A 2OPRA 4YS2A 5HAOA 2AF6A 3T9NA 2LVWA 1VCTA 2KYXA 4H4OB 2E1CA 2QBQA 2ILYA 2LDIA 2FJAB 2KT5A 3HT0A 3I0SA 3NMAA 2CMAA 3US5A 2VEWA 5F9NA 2ZUGA 1HNWJ 3N4WA 3ICLA 2NUUG 3V6DA 4NLQA 2B6AB 4A8KA 2B56A 5KG4A 4DV2F 3PR5B 3QRPA 1KQGB 4FVCA 2M7SA 4NLTA 1WHVA 3ENWA 1U45A 1T7PA 1I57A 4J5OA 2RDDA 1BMQB 1SBRA 4PXBA 5GMKa 4N5SA 2J6SA 1RLCL 5CCMA 2MGZA 1VR6A 3GWCA 4QF5A 4UOCA 3QWUA 1TUWA 3MMBB 2HAFA 3IGNA 2Z2ZA 2U1AA 3D6HB 2H65B 3TQEA 3B78A 4WFNQ 1WELA 2RQCA 5D4LA 3QIPB 3BO2A 2KJWA 1S97A 2OD4A 1X5OA 2GCAA 2CPXA 1C0UB 2BRLA 2R7XA 4RU2A 3BH7B 2BUNA 2LXIA 2BJ1A 3J81j 4FF3A 1FTRA 5L1IA 2Y9HA 4O4GA 3QQCD 1QSYA 1UVLA 1C88A 2YH1A 1U09A 2CNLB 2GHWA 1RAAB 5C2CA 5T14A 1X9WA 3DC2A 5KG5A 4YDXA 1IBLF 4R0SA 3BSCA 4IFVA 3ZFVA 1HWLA 1IBCB 2FLNA 4IH5A 1UEUA 4ZMMA 3CMES 3IAM9 4D3HA 2OGUA 2ZH2A 1FWPA 5EX3A 4ZN5A 4PKDB 3OV7A 5L9NA 4J9QA 2ZVSA 3N01A 4Y2EA 3DLBA 4JI1J 2HVEA 2IJRA 2VQEF 2W7AA 1Q53A 4WBFA 1FERA 2HRTA 2YQ3A 1J27A 2RHSB 4KQZA 4C97A 4K5SA 5KT4A 4QWDA 4CZCA 5HQMA 2FLLA 3UAGA 1L3TA 2YDUA 4GO5X 4I6AA 3VGTA 1NB7A 1FE4A 3KK2B 1DTQA 2B5JA 4OHIA 1HWJA 3M6UA 4OZ3A 1VQPS 4YOEA 1ZS6A 3TWZA 3UQSA 1K0TA 3A5JA 4ZJLA 1S4FA 1X31C 1N5YB 2BJ8A 2JFGA 4JB8B 4A48A 2VPZB 1YWXA 2D74B 3C15B 2V4JA 3SQGB 4RNNA 3OL7A 3LP0A 4DUYJ 1V5VA 3SCJE 1AZSA 4EK2A 3HHNB 2X1FA 1FT8A 3VCDA 1U1RA 4DV2J 3HF5A 1M1KT 1FNOA 1R8CA 3QJLA 1IR2A 3BQ1A 3UN2A 3DRPB 1KP6A 4LVNP 3PY8A 1YTNA 2HQFA 3DI6A 4KGVB 3RW6A 3VWSA 1WCHA 4L72B 3S4EA 4AZ1A 1VOMA 1YTWA 3K17A 2H4KA 2BABA 2LEPA 4JV5J 1HW8A 2PT0A 5K20B 3N28A 2X1AA 4ES3A 2B49A 2QLBB 5KFOA 4LRBA 4HEA9 5LJ3Y 3KJVA 3ELHA 1Q95G 2VODA 3KJFB 1WEZA 4DSIA 1OESA 1PTTA 3SQOP 2HBRB 1BD6A 1IUJA 1WC1A 2VPXB 2YNGA 4MK8A 3FKBA 1SIZA 4ZPAA 5E7OB 5F0UA 5DG8A 1R27B 1SH3A 3CJSA 3U7JA 5GAGI 4RNMA 2PI5A 3RZ2A 1FCAA 3V2UC 4F0HA 3GCWP 3WC0A 4Q45A 2WTZA 3CDBA 3CJKA 5IV4A 5C5JA 3HT3A 1VC5A 4OHZA 2IIHA 4J9RA 3PO5A 1S6QA 2N4DA 4JI5F 1DFDA 1JWWA 3MVNA 2WW4A 4JI0F 2ASYA 2F8HA 3AXKA 1I94F 4DL5A 5FD1A 3J7Z5 2OPPB 1S1WA 1UJ6A 4L76A 4AQYF 3ZM6A 4ED2A 1TK5A 1LQFA 4FP9A 2CFXA 3WIUA 4RNFA 4LF9F 1SL0A 1FK9B 1YDLA 4QAHA 1GQEA 2E1PA 1DURA 1DAXA 3LAMA 1BY9A 1JLEB 1SQEA 1WG5A 3OVAA 3T5HA 2J6UA 3IG1B 4MIWA 1DRZA 3UO0A 2FLOA 1NPKA 2NCKL 1X4HA 3IXQA 4G1QB 2BQUA 1AFIA 2HVIA 3OTOF 3V6JA 1UJ5A 3GIIA 4M94A 2Q1LA 4DR7J 3ZZYA 1U2CA 3BGFA 2J6TA 3KLVA 4JMJA 2MZRA 4QJVA 1IKYB 4J9VA 5GMEA 4E8UA 1YGUA 3MEDA 2CDRB 1AYEA 4ZLLA 5DDOC 1J5OA 1Q5YA 2MY8A 4B9MA 4HACA 3H4DA 2VQEJ 1Q5VA 4OQJA 1HNWF 3MEGB 4CLFA 4TXSA 3PW7A 2A10A 3H0PA 2KJVA 1Q8IA 3D66A 2BJ7A 2P9EA 4PXDA 4RJVA 4ZJOA 3LWMA 3K58A 3M9MB 3ZL8A 1VJQA 4JV5F 5A8WB 2DNKA 2OELA 3F44A 3GONA 3L09A 1TR0A 1KSPA 2AGQA 2HFZA 3UD3P 1LXJA 1NBEB 3ZC4A 1NAQA 4DR4F 1Y0HA 3GQCA 1JXLA 2BOPA 2CNIA 3KUGA 4KFBB 4YY3J 2NXUA 2E5LJ 3S1TA 2ESBA 1SQGA 2L41A 2BV5A 2F8EX 2LXUA 4HT5A 3SSQA 1EJ7L 2AHOB 5HO4A 1ZH5A 2BE2B 3D0GE 1GQQA 3DDKA 3OFEA 2N3OA 1YJWS 1TKXA 3LW5C 2IM1A 1UFWA 2ZWOA 4TNOA 3AD7C 4RW8A 2EG1A 1FE0A 1HQUA 3DM2B 5IXUA 3ENQA 1Q6NA 2V63A 4GE5A 1QD1A 4G1PA 3V4MA 4U7CA 1ICEB 4CYUB 2HBQB 4I56A 1UEKA 1FKPA 3CJQA 1U0HA 1QAXA 1WC0A 3HHEA 3I6PA 3EPIA 3B7OA 3EAXA 4DV0J 2HAIA 4EBEA 1HKAA 4FKYA 3RB6A 2EVZA 2YNIA 1FVQA 2MQOA 4WWSA 4F4WA 4DU8A 2RUGA 3CJ8A 4ZLJA 3CEDA 2HG4A 2M0GB 1FK9A 2CPDA 2QG9B 3BBFA 3M32A 2G2OA 4RW6A 4DR5F 2F4VJ 4DPYA 2KVQE 3DDIA 1OHEA 1XM2A 4B3OB 1HR0F 4WKRA 1U1QA 2YTCA 3AQPA 1BWVA 1YJNS 2QEXS 2R8JA 1GG4A 1CJVB 2CM3A 2NXJA 4WK3A 2HEKA 2XZWA 2AGOA 3FVYA 3BBCA 1SUQA 2JHEA 2ZZNA 3PR4A 1NK7A 2GC8A 4JI8J 1C83A 1RHMB 3B8HA 5KFLA 2QO3A 2ADCA 2ADBA 3BREA 1X24A 3ZM3A 5M2PA 2CMBA 2HGMA 1RT7A 2VD3A 2XTJP 3NRBA 1VQ8S 4ZCMA 3L95X 2ZKUA 3LP1B 3MM8B 4RLEA 4ES2A 5CD4A 3W2VA 1WHWA 2VICA 2PMWA 1YITS 2KH9A 1BZCA 3LF0A 1EAYC 1YG0A 1J2VA 2WVDA 3G8SA 4R8UB 5KTQA 3EX7B 2ASLA 2I4HA 3SIPB 1RXOB 1RCXB 4CM2A 4CO1A 3KKFA 2LCWA 2QSFA 2A1BA 4K4VA 2HHXA 1R8BA 1N5SA 2PN6A 2VB6A 4LSNA 1P1TA 1KVIA 2APOA 1FWLA 1UAGA 1A0OB 4IG3A 4DV4F 3EVOA 4J7CA 3K5NA 5HLFB 1M3GA 4GRZA 4ALZA 5L38A 3KHHA 2LA4A 1S9EB 3DRXA 1F3FA 3MR7A 3G96A 2R9LA 1MU2B 1WC3A 1WACA 1VISA 4WTOB 1HBOB 2DH8A 1ZPWX 3D7SB 4CO4A 3S8SA 1OIAA 3Q83A 4JI0J 1YBAA 3HVAA 3I31A 3TZXA 4JI4J 2IVFB 3ZNJ1 1D9FA 1Q6MA 2ZN7A 3QIDA 5ETKA 3HULA 1XWLA 1N6QA 3FSXA 4ID5A 4DX5A 4DZDA 2IYGA 3K7RA 3Q24A 5A8RB 3HVRA 2UUAF 1R6VA 2BE9B 4UY85 5CABA 1QM9A 4BS2A 4Q0BA 1NXIA 3BQ0A 5HANA 1NH7A 1SI9A 3G87A 1VK3A 4B02A 2LEBA 2OC3A 3FRYA 4HKQA 1DQ8A 3L3CA 3JB9k 1PC5A 1B7YB 4USJC 2IDLA 2ROEA 4OX7A 3RRGA 3CF5Q 1PILA 3SDEA 4HRFA 1R8PA 1V9OA 3MM6A 2UVRA 2Y68A 5JJBA 3Q8RB 4DL0C 1IR0A 2J0SD 1S6PA 2RHQB 2AZ1A 3N6MA 2V69A 4I1TA 4N76A 4K5RA 1AW0A 1PAEX 3BJYA 2I3RA 2D9OA 1HBUB 3ILJA 1P27B 2YWKA 4PG8A 1H72C 4NXMF 4DGPA 4TQRA 2AJ4A 4USUA 1S49A 4LFCF 3UD4P 4E0DA 4DG1A 2IDEA 3CJRA 3GFXA 3JSYA 5FIIA 2I6IA 3G71S 1OHDA 4G1IA 4QIGA 2ZJPQ 3GJQB 4ZCIA 3BV8A 2GCFA 3MMAB 2DHSA 4DU7A 2EK1A 4NXNF 2I5JA 4OLPA 3J7A1 4QYZK 2AMCB 2OLWA 4L75A 5KAKA 2CNKB 1P6TA 1E0DA 3CE8A 2JC0A 2ZH3A 4TVAB 4Y14A 1P9YA 2V34A 2KB2A 5DZ6A 2FY1A 1YN9A 3GXHA 1ZM9A 2W9AA 2CJ9A 3GE9A 1JLEA 1D0EA 2EFNA 1HWIA 5EWGA 2QDMA 4DS5A 3NLCA 3CJ0A 1RHQB 5KA7A 2OPSA 2J9CA 2JRSA 3MR2A 4H34A 3FBFA 1U1LA 4ZVFA 3H20A 3MM5B 1HWKA 4NRTA 4A8XA 2R2UA 4LF9J 4HJPA 1WOOA 3I96A 2NR0A 2MLXA 2VORA 2ZBIA 3GIJA 5ETSA 2NSBA 1FNXH 2UUBJ 2OI2A 5C24B 3ZZRA 4F2SA 1EENA 4ILMA 5F8IA 1D8ZA 1C1BB 3GR0A 3KLFB 4AL5A 3SCLE 4LR7A 2B4OA 4Y0FA 4O3RA 1HR0J 4CVMA 3EZOA 1IKVA 1BLUA 4LSZB 3BO3A 4J9SA 3CD6S 3MPWA 2QRRA 2AX1A 4GRSA 3QO9B 1RAGB 1EEHA 5D78A 4OYAA 5HBMA 3OR2A 4M5MA 1I5OB 2XWXA 5DETA 5MLCV 4RPFA 3JSMA 4HHHA 2XSJB 4JOUA 4QWCA 1PXHA 1HBNB 1G1FA 1FDNA 4QUMA 2AEMA 2HHUA 4B3MJ 1AT1B 1I1GA 4LRAA 5KFUA 5CXTA 1GMWA 1V6HA 2DR6A 2AIRB 3TANA 4F8RA 1E6VB 2AJQA 5EUHA 1UPPA 1F0XA 4DCJB 3QMQA 3SBMA 2WSCC 1RJJA 3JSBA 2JDJA 2R8HA 4B3OA 4G6VB 4C6AA 3GPAA 4KB7A 2M8DB 2FQQB 2YX4A 3NNCA 3M2VB 1Y3KA 3PJXA 2DO4A 4DI6A 2OH2A 5KA9A 3FSIA 2MB0B 2NT2A 3R7SB 4H1OA 2O67A 3WHIA 1Q6SA 2G9OA 2LXFA 2E1AA 4C11B 4JI7F 1A5YA 5J2QA 5HJXA 4JI2F 2MHEA 4IFYA 4R5PB 1NH8A 3KG0A 1S48A 1DLOA 1SJQA 4H54A 4P2FA 3J81Y 1S6OA 1XR5A 3BSAA 5K8PA 3JSMB 4LF2A 4DV6J 3T5LA 3H2XA 5FLXY 1T9WA 3QGGA 2DK2A 5LMUJ 2YKMA 2A8BA 4J9MA 1NO6A 2HWIA 3KDOA 3UWTA 4M5IA 2AEJA 3EZZA 1OQ6A 3S3HA 4LF6J 5A5EA 4ELVA 1H6KX 2C2MB 3HJFA 4RO0A 2UXCJ 2HHHJ 1J6UA 5M2UA 2F7VA 5HVFA 1PAUB 4OYWA 4TKTA 2FLPA 2BANB 3BS9A 2VUGA 3VAKA 2JEFA 1IJEB 2D3ZA 2XYHB 1KVKA 2DR8A 5GAHI 1EP4A 3UDLA 2DNNA 5CHCB 2XY7A 1N5YA 2I4EA 2DGTA 5EHPA 2BANA 4ECWA 1N34J 1QTMA 5ETVA 2F4FA 4DG1B 2J0WA 5KFRA 3GG1A 2QYGA 4LR8A 1OY9A 3HD1A 2HZCA 4LRCA 2QTWA 4YHHJ 3TI0A 1X0FA 2DT9A 4JI6J 3PYGA 3UI3A 4OHXA 4MFBA 3RR8A 1B0TA 4Q44A 4HACB 4CLZA 4CRJA 5KFTA 4P7TA 2WTFA 3QIPA 3EICA 2B6AA 5KFXA 2KFYA 3CCRS 2MKCA 5D77A 3MOWA 1YBTA 2PSZA 1OSDA 1U02A 2XYGB 2PI4A 2WSEC 4NZ7A 1VQ4S 3DLKA 4DPWA 3T9ZA 3K59A 1HD1A 4DN0A 5G4DA 2W8LA 5GTJA 1FXLA 5DO2A 4OJGA 3GV8B 1LARA 1NJIT 2VASA 1SKRA 4QWAA 2FJMA 2DY9A 4CLYA 1O6XA 1KBRA 3JTNA 3JXOA 3L7OA 1L3VA 1HYSB 4C8YA 1G1XA 1WHXA 1CJUB 3GFZA 1WRMA 1T11A 3QGIA 5J2NB 3A13A 3NOCA 3TQ1A 2PDAA 1ULRA 4IRDA 1OY6A 3TAMA 4W92B 3KYLA 3DRSB 2V8GA 3KHLA 4I2QA 1VQMS 4M8LA 1FKOB 1FF2A 2VBYA 3SEOA 3WX4A 3PCOB 4ZITA 2HK2A 3KLHA 1U47A 2CM8A 2NSCA 3S7RA 5LMNJ 4EYIB 3UR0A 2QA1A 3FSYA 4LBPA 2WJPA 3U1MA 1NCLA 2YKQA 2KO1A 5KG1A 2HVZA 4IH7A 4OX8A 5J2MB 3KTQA 1CSJA 5D0GA 1X5SA 3GIRA 4RWXA 3QWPA 3SCKE 5DDPC 3PVXA 2VDIA 4X4QA 1RDRA 1TZ0A 4PXCA 2PBNA 3AT1B 5BYQA 2M52A 4ZVOB 1SB6A 3QSIA 1GK8A 4WYWA 4X66J 2HWHA 4OI4A 2ATCB 2C3PA 3OTOJ 2C2EA 2M3VA 2HC1A 5D4OA 2JC1A 2YKPA 3LAKA 3HHKA 4Y28C 1RHUB 2AW0A 2IRUA 3TR5A 3KXDA 4QDIA 4QPTA 4GE2A 4URQU 5L8RC 3CWEA 1JLQA 3I0RA 3JAMU 2F63A 1Y5NB 3SV4A 4BUCA 4H4OA 1ZTWA 1X4EA 4YY3F 2MZSA 2W2OP 3D6TB 1Q0NA 4OZLA 3PTWA 2J76E 4ER8A 4U7UD 4UAGA 5C24A 2HY3A 1YJUA 4UOFA 2A2CA 1RKIA 3FK4A 5DG9A 2EK6A 4XPCA 1QAYA 3SQGA 1IKWB 2V9WA 1HIYA 3MCOA 2CA9A 3P45B 5IT9U 2NLKA 4ZP6A 2W2PP 3GU0A 1VQNS 5BZXA 1XRIA 3M32B 2VFSA 2QL5B 4DPTA 3PXGa 1F9HA 5F8JA 3PYZA 1FX4A 3FZ2A 2YNIB 3PFOA 4Z7CA 3BSOA 3UCZP 4ICLB 4YUDA 1I3OB 3QSYB 2ZJQQ 2W7OA 2VEYA 2DXEA 1XIQA 3QGPA 4ES1A 1RYRA 1FTCA 5HQLA 3BN7A 2ZDOA 4RUBA 4BCAA 2UXCF 2W9CB 2EW9A 4WZQA 4OHVA 3VALA 3RYLA 2XMVA 3IP0A 1H2UX 2G0JA 5IC4B 3NGRA 4ENOA 3MURP 3MFHA 1N4LA 5EHRA 4K50A 3IM8A 2JEGA 1WKLA 4ZLNA 4DSJA 5ETQA 3T1YF 2BA9A 2BOAA 2ZBPA 4OHWA 4AL6A 1S9GB 3TNVA 1UWBA 4URGA 4DF4A 1U6FA 2GC6A 4OHLA 4RUCA 3BYPA 1FFGB 3TZWA 1NHUA 4YR3A 4RW6B 1PBUA 1FA0A 1N6QB 1LWEA 4EYHB 2AYEA 2NXNA 3CJTA 3VQSA 2NZ4A 5C2GA 1EP4B 2F70A 3J7YU 3Q8PB 3TARA 1JBWA 1R8AA 2GMJA 4KPCA 4RU9A 3AJ2A 2EC0A 4NI2A 1OO0B 1KAKA 2GIFA 2DGWA 1Q7LB 2C3OA 2XG8A 2YKNA 3MM6B 4F25A 3UPFA 1LK7A 1FQ1A 1RWUA 4KO0A 1TK0A 3GLJA 3K5LA 2DIUA 2CNEA 1LV5A 5L1LA 2YKMB 3QCCA 1QY7A 2CZ4A 4NRUA 4QIFA 4LSLB 1TKXB 2E5HA 2ILZA 3EMTA 4OYIA 1JLAB 4JNBA 3RZAA 4TN2A 2WVEA 4TU9A 2UXBJ 2X5OA 5DLGA 3R6LB 4JI6F 1U25A 2IAJB 3W61A 2E29A 3MXHP 2XMWA 3SR9A 3Q8UA 4KIAA 2CNGA 1XJWB 1Y10A 2W24A 5B0GA 4WP8A 3ADAC 4DSEA 2F6WA 1WSVA 2OKQA 3R7NB 3RTVA 4MH8A 3Q0AA 4TU8A 4F02A 2DCLA 1NWLA 3RJMB 1FJEB 3K8WA 4GVLA 4WK1A 5A8WA 5KA3A 2PC6A 1S9EA 5DRKA 4J51A 2HHTA 2HMIB 4ZIWA 5LXRA 1ZZWA 4ZA1A 2XMAA 3SFGA 1S12A 3ZTQA 2PA3A 2QL9B 4ETXA 4L73A 3MR6A 4DV4J 3R1LA 1RA6A 2I6OA 1F60B 3VAHA 2UVVA 3EUNA 1S79A 2KHDA 5A2QU 1ECVA 1KVJA 1WEXA 1IKYA 4RL1A 3NP5A 4CQ1A 2OEKA 3O3LA 4DV5F 4K0KJ 4AXIA 2BJ3A 4RW7A 4GFVA 2VG5A 1O8BA 2VV5A 2VG7A 5A2QY 4CO2A 1ACMB 2SXLA 4FZVA 3CMAS 4FDFA 1HNXJ 3GG0A 3BF4A 3C46A 1F2GA 4ED7A 5ITHA 2WW8A 5A0YB 4ANDA 2UUAJ 4YP3A 3V0JA 1SCJB 2VA2A 4XDCA 3THVA 1RWKB 3TEGA 1MMLA 3WX8A 5H9FK 3GILA 4A8MP 1RWWB 4Y2IA 4F0MA 2LFVA 2HZVA 4B9TA 2V2VA 4Y2KA 2VL1A 1T03A 2X3DA 2ACYA 3V81B 1TK8A 5K14B 3TYTA 5J2PB 2BMBA 2K3KA 4CP5A 2Z57B 3D42A 2G0CA 4HH0A 1S76D 3EYZA 2ZE2A 1GX5A 3PEJA 2R7QA 3OPKA 4HTIA 3TEHB 1CS4A 5E41A 4NLVA 2BR0A 4B3SJ 4ZVPB 4Z6BA 4YQWA 4DV7J 1DBDA 4A4JA 1FKOA 1VLYA 5CQGA 2H4GA 4KAIA 2IC3B 1YRTA 1RHRB 2F40A 4CLKA 2I6MA 3E01A 1N0VC 2FJDB 2EKNA 4CI0B 3U1NA 5JMNA 5I3QA 3PX4A 5KA2A 1U8SA 4GWFA 4QR1A 3CPWR 2AM2A 3FDSA 1UCNA 2VOSA 5IS2A 3A5KA 4UUXA 4ZHRA 1NU4A 2V5HG 1YRXA 5KFPA 4ZKAA 2AEFA 4AQYJ 4ZJQA 1SJ4P 1G4WR 1WF1A 2WONA 3JQJA 4WFZA 3TVZA 5LSRA 1WHYA 1XMOJ 4I0WA 5B09A 2DPJA 2I2YA 1FJGF 3MTKA 3HVTA 4NYPA 1KQKA 3C6UA 5HSPA 1NSQA 2H4WB 5I42B 3RGQA 1QLNA 3NCQA 3PACA 2CQHA 1IQTA 4R25A 4HTJA 4YMEA 2PFFB 5M43A 2KM8B 3HKWA 2NZCA 3B4DA 2DYAA 4MKVA 4B9SA 1YZ6A 2V2QA 5DZ7A 1VQKS 2YPZA 2BGEA 2M8HA 4MK9A 1CQMA 2RF6A 1LK5A 3IBFB 2P5VA 3NS6A 4O44A 3V6KA 2DXDA 3LA0A 2NS1B 4AL7A 2Y0BB 4LF1A 3KOAA 1URNA 1X7VA 2DR9A 1HHSA 5CZVA 1LWXA 2Z30B 2ERRA 3AY0A 3TOQA 1Q86T 2DGOA 2I75A 3RAQA 1YTSA 3IWNC 1VMBA 3DYAA 4LRFA 1VQOS 3RRHA 4ETZA 2VC1A 2R2TA 2BEFA 3CT9A 1BXNA 4DX6A 1VFJA 3AOAA 4DLGA 1G4US 1GQYA 3V0GA 3H8YA 3SYZA 1BHNA 1Y5LB 4QW9A 4O3OA 3UCUP 1NDCA 2IC3A 3DI6B 3PDNA 5F8HA 2RE1A 2YNHB 3CO9A 4B17A 3MD1A 4NYOA 3MFIA 2UUCF 2J7UA 5K9VA 5BR8F 3QFWA 2VQFJ 2CG4A 3VGUA 3NBPB 4DDFA 1RTIB 2RQ4A 3GMGA 1S6QB 2KYZA 4ZOSA 1OEOX 2QYCA 5GMDA 1APSA 1U8WA 3DRYA 3CDWA 2GMLA 4QIVA 1FDDA 2N4CA 4ERCA 1YKWA 2DGUA 3ILIA 1OJ4A 5CA5A 1FD8A 4YHHF 5H9EK 2M88A 3V81A 2AD9A 2OJ3A 4QBEA 2XSFA 1SQFA 4NNDA 2I6PA 2MKYA 2QBRA 1CJTB 2MJNA 4F7VA 3CCES 5D3GA 2W2NP 1ITPA 3NRSA 2C2OB 2HQIA 2MMYA 4DQSA 1YTYA 1DTQB 2B5JB 2YWHA 2FVPA 3MPYA 1FRJA 4KHMA 1Q6PA 2BQ3A 2VZ9A 2B07A 2V9KA 3T1AA 3T3FA 3IRXA 2CQ1A 5EWEA 1F9FA 2VOPA 1OMSA 1RT7B 3B6BA 1S57A 3RBZA 2VFRA 4WOHA 5KFBA 1FRIA 4WCEQ 3CCJS 3NY0A 4F4YA 3P6YC 4U8YA 2E5JA 2OMLA 5FLXU 2KXNB 3PO4A 2FVSA 2HVHA 2CJXB 2VFTA 2C1EB 3CCTA 4Q2MA 2XLJA 5G0RB 5J2MA 3WC2A 1G1GA 2Z2MA 2QFIA 2EBEA 3M6WA 3V4IA 2COLA 1SVDA 1QE1B 4U9RA 2E7VA 3ZZUA 4DX7A 3EJMA 5KT2A 2MKIA 2H4VA 3D4JA 3EZUA 4USMA 4B3SF 1YWFA 1VHRA 1T9YA 1BZHA 3H7HB 4IR1A 1HNZJ 4YR0A 4C8KA 4MAKA 5D6GA 5GAEU 4W4MA 4B3MF 2HLUA 3MCSA 1U7LA 1MN9A 3GCXP 2UV8G 2ZH5A 3PW0A 3OSPA 1UVIA 1SKUB 2DBBA 3QJPA 2J5AA 1SKSA 2QMWA 3SI8A 1FKPB 1T9VA 2HLTA 2ROPA 3EXCX 5F3ZA 3KLGB 1PYNA 1HMVA 4PG5A 2CJAA 3SSRA 4BWJA 2B3OA 2GW8A 1TTHB 1Q82T 1XN9A 2MQLA 3W2WA 2QLXA 5BJRA 4WE1B 2JNJA 3FCHA 3ZXWA 2XCAA 3PZPA 1FPZA 1RXDA 4C0BA 2OPQA 1ZCKA 4TY8A 4ZHRB 4WIQA 5CYQA 4EUVA 5J1EA 4DR2F 1M0SA 2KT2A 4OX9F 2LU1A 4PYHA 2HW3A 4WU3A 1MG7A 1IXKA 3KJQB 4X2BA 4ZVQB 1N36F 5FJ4A 4AT1B 3PW5A 2FHOB 3B4MA 3UNYA 1Q7YT 3U27A 4RW4A 1RPMA 4QU7A 3CIMA 2XO7A 3ZM1A 2LYVA 2ALZA 2DNLA 2GGPB 2LECA 2RIJA 2VG6A 3RBDA 1PCAA 4F4KA 1RE1B 3D2WA 3NAHA 2OFHX 4QIEA 3DCAA 4IH6A 2QLFB 4UUWA 1XERA 3VGSA 3JYTB 4J9KA 2MYFA 2VA3A 1RAHB 1N5TA 1C4CA 1OPIA 2ALYB 4MYTA 2BZLA 6FDRA 1JLNA 2ZOMA 3CJ3A 2ZNZA 1QE1A 4FXWA 2RT3A 2CJZA 1ONYA 4MIAA 4LMZA 4UZCA 1NK8A 2DR5A 3OTEA 5KFHA 3OHBA 1V3ZA 1P1LA 3A8JA 3N5BA 4UOHA 4F26A 3Q8VA 2NPIA 3AFGA 4I64A 4M95A 1G2EA 1YZ7A 2ZZTA 4A8QA 1CBKA 1JMTA 4FXVA 4NE9C 2WVCA 3HKZD 4DJBA 2B0GA 4RZRA 1GMWD 1QXKA 1SIWB 1IWGA 1VIXA 2BKNA 3M2VA 2OPRB 3A1YG 1RAJA 2MQNA 5KT5A 4DSLA 1XNQJ 1WKKA 2B9EA 4W98A 1GWZA 4RDDA 2DNHA 1TUVA 4OZJA 1WSRA 4QR2A 2RB7A 2MZ1A 2HRYA 4B04A 1U1KA 4ZS6A 1T02A 4U67Q 3TAMB 2XO6A 3M8QA 5HMWA 3HZGA 3CJKB 2HQ3A 2GA7A 4BBYA 1S0VA 2YQ0A 4DF8A 2R7WA 3V4IB 1L3UA 3MAHA 1MROA 4HJQA 4OHDA 3NMRA 2MTLA 1U48A 2V2ZA 2DGVA 4CO5A 1MWZA 2M2BA 4ED3A 2B8QA 2RU9A 2AJ0A 3LP1A 1KWMA 3MM8A 2UU9J 2WAQD 3E2EA 3N9UC 1GNKA 3W9JA 3I32A 4LF8F 3K57A 2QX0A 1JLQB 4NMLA 2YWWA 2D41A 4B3RF 2NLWA 3GB0A 4PXEA 2BGDA 2I8EA 2XYPB 4HLBA 1SJFA 5HP1B 2UXBF 1ZA2B 1TFWA 4LJMA 1UA1A 2C22A 3FNNA 5EWFA 4DZ6A 1N32F 3BR8A 1FHTA 1CULA 1XR6A 4LSLA 4N56A 3OJUA 4F4ZA 3FEXB 1CPZA 4ZVHA 2D7SA 1NB2A 1RBLA 2I38A 3K0JA 4ZI4A 2LP4A 3MTJA 2DNPA 2B4PA 5L46A 2CPIA 2P9GA 2CPHA 3H98A 5E3QA 4RNOA 3K5MA 4IQMA 2V4JB 4MMOA 3G6XA 4MK7A 2RUSA 3CDUA 4USTA 3CC7S 5ETRA 4IG0A 2X7IA 1WEYA 1N8RT 1K44A 2C2DA 2VEVA 1WDDA 4K4WA 5AWXA 1U2FA 3V6HA 2MSSA 4N77A 1H3DA 1YJTA 1KR4A 2BW7A 1LWFB 3GFYA 2F6YA 3GSIA 3NNAA 5ETTA 1X4DA 3CCVS 1FRHA 1OS5A 4TU7A 1FD2A 3QLHB 1S7HA 3R3TA 2Y96A 1Z2LA 4DV5J 2FC9A 4H4KC 4XAKA 3BZQA 1VQ6S 1FJ7A 1IM6A 1J5OB 3B82A 2V4QA 2VKRA 2YNFB 4X62J 2ZZMA 1FX2A 5GADI 5KABA 1U1MA 4KGXB 1SKWA 4CYUA 3LH2S 4GKJF 5IT0A 1PH0A 8ATCB 2E0TA 1M5KC 5DDQC 2Y2FA 1SC3B 2V94A 3EM1A 4I7FA 4X84A 1DTTA 2V8HA 5EX0A 1HQUB 5B08A 5L1JA 1X9SA 2F9JA 2F4VF 1JLFB 1Y7PA 4JP8A 4M5JA 3D6FB 1CVJA 1R6YA 3PEHA 5AE1A 4MFBB 3A4TA 3W63A 4N7TA 4YB7A 1VQ9S 4P10A 3X1LB 4ICLA 2ZD1B 2UUBF 4D3PA 2RJZA 1B4SA 1GT8A 1N5QA 4UW2A 4WXOA 2F46A 3QBCA 2ATLA 3A3OB 1F6TA 4JYAJ 3A12A 3H5SA 2FH7A 4OX9J 1Q78A 3ENVA 1TL1A 3FCWA 1I94J 2VONA 2NT7A 3NCRA 3U1LA 1P3DA 4KR0B 5C42B 2PEBA 3U02A 4LFBJ 1Y4ZB 2B4VA 1BGXT 5D0EA 4ILLA 2H5IB 1R6HA 3A3NB 1HW9A 3E8OA 3SDEB 2VJUA 5RUBA 2U2FA 2K8GA 3M30B 2K7JA 1T9XA 3EGVA 2HNPA 2CM2A 3CJ2A 1EIYB 2Y1RI 3O1LA 1VRUB 1CULB 3KUEA 2HBYB 2VBZA 2LEAA 5FDLB 3TZYA 3BH6B 2MXYA 4DUZJ 2XSJA 4Q0BB 2K1RA 2BM1A 2ZOGA 3MM7B 3M6VA 1C84A 3IRXB 1TKTB 4AD6A 4PVGA 1ZOTA 4NYZA 4I2PB 5D4PA 2RF2A 4C8MA 3MUTP 2QDCA 2UUPA 4K4UA 1GXLA 1RADB 3KDNA 2WHOA 3L7PA 2UUOA 2OPPA 3LGMA 4KH1B 4OI2A 2GVZB 3RB3A 4B9NA 1R43A 3QT6A 5IC6B 4ANCA 3HD2A 2N7CA 1ZZFA 1R0CB 5KG7A 3TUJC 3ZZOA 2R7RA 3M8RA 2IRYA 4DN9A 2HHHF 1FDBA 2W1BA 2YWEA 2XS5A 1YLXA 4LF8J 3IGVA 2B9YA 1YJRA 3PV8A 4JI3J 2B43A 2JFKA 4LQ9A 3BBBA 1VLOA 1ZTTA 1MSWD 2XWYA 3MGJA 2IAJA 4M5GA 5KFMA 1NM2A 2YNHA 3DRSA 1XR7A 2N82B 3R1HA 1X9MA 1LYVA 1I9SA 1NZ7A 2ZBCA 2FZCB 4A8WA 2RU3A 4ZDNA 4G3IA 3M4UA 3MUMP 1XEZA 4X4VA 4E98A 2J0QD 4DSKA 1JBVA 3P96A 4KPYA 5KA1A 6AT1B 2HSEB 1JXEA 2E5LF 4DV0F 1WC6A 4O3QA 2I6WA 1HNVA 2CFVA 4DV6F 2IHR1 3ZV2A 1HBMB 1LWCA 1SXLA 4H4MA 4LIRA 2XJAA 3HCXA 2HKEA 4ZP8A 3N0AA 2LQ8A 5L9XA 3FFIA 2DRBA 2LU2A 4J9PA 4CO0A 2W8KA 3ET6A 3C16B 5KFYA 1VQ7S 2Y1LB 2MQMA 3OSNA 2ZNYA 3QCGA 1KHVA 4ECTA 1TL1B 2HHPA 2Z2LA 3W7BA 1L5UA 3IS9A 2BJDA 2QSWA 1RWNB 2YKNB 3RUBL 3T5KA 2QEPA 4LVOP 4RI5A 1T9UA 1UVJA 1W7WA 2KHCA 3DLHA 1S9GA 4GKKF 1N5VA 2VBWA 3D3CJ 3LPEA 1S77D 3CNQP 4PQUB 2ZVIA 2HB1A 3W3SA 3L4BC 2NYIA 2HQCA 2XNQA 3DLGA 4JUZA 4DPOA 4WFYA 4YB1P 3FC9A 1P31A 4X66F 4OHHA 4U96A 2XM3A 1VQLS 5KFEA 5DG7A 3DFEA 2M3DA 4DOZA
chains in the Genus database with same CATH topology
4NCBA 5F0WA 4I67A 4HDHA 4TY8B 3C8YA 4KT0C 2MSTA 2DNYA 4HT7A 4OIXA 1PA9A 3ZZPA 1TL4A 3EZ5A 1NKEA 3BO4A 5ADZA 4MIBA 1XMOF 3QLHA 4KGKA 2YH0A 4I6WA 5I3UB 3QCNA 2RS2A 5KAAA 2BV3A 5K8NA 1WG4A 1T48A 4O4GB 3OUYA 2IA6A 2R0BA 3QZ7A 4CNZA 3QCIA 5AXNA 1RP5A 2Y1JA 3S3KA 4C11A 1MWYA 1TL3A 3VAMA 2RRNA 1L8KA 3QCHA 1OEUA 2VBXA 1PTVA 1YSJA 4X4TA 2ZITA 5E3AA 3KHGA 3OXLA 4P2SA 4NCAA 3MMCA 1C87A 5CYJA 4DL6A 5CYQB 1H2VZ 3THPA 2ZJRQ 4NLSA 4RW9A 4HYKA 1D9DA 4R8UA 2B9WA 1Z2ZA 3DDNA 1JNZB 5F8NA 2NQPA 2B4UA 1EETB 1T3OA 5BUGA 4ED6A 2DH7A 3LOUA 2FJWA 2HIQA 4DFJA 2UVUA 3LALA 3Q22A 1GFYA 2H02A 4L6V3 1JLBA 1NK9A 1XK8A 1SH2A 3D0IE 4O0IA 4U7UK 1P15A 3GV5B 3ZMPA 4XDDA 5CCLA 2OD6A 2XCPA 3KLHB 2I5XA 3MM9A 2SHPA 4YB5A 1CC8A 3TA2A 3S3EA 2KVIA 1JB0C 1JKHB 3M9OB 1UETA 2OP5A 2PA5A 2KXFA 2WBRA 3UFCX 4RH5A 1QSSA 2RQKA 1G6BA 3QCBA 2FDNA 2GMHA 3VZIA 4FPRA 2XGPA 3M1VA 5KFCA 4CNYA 2CJQA 1MMNA 1SV5A 2ZH4A 4EO6A 2ZMMA 4KRWA 1VQ5S 1CEZA 1T95A 1RT1A 2DNGA 2HGLA 5KT7A 1R7IA 4PG7A 1U1NA 3BB5A 5HL7Q 1N48A 3QPIA 2CPEA 1B0PA 1M5SA 2E7WA 4HI1A 5M2RA 1NO8A 3AH6A 3QCKA 3CD7A 2E44A 3K5PA 3SXLA 4TQSA 4OX6A 1X4GA 1F5CA 1JLGB 3N6NA 1RTJA 2DVIA 3LO3A 1X4CA 5D4NA 1N34F 4IR9A 4MTPA 4FBUA 2IM0A 3IAS9 4KTQA 2I5JB 3V0DA 1SJ3P 2I4GA 1LW2B 3ZM0A 2N3LA 2B51A 2L9DA 4C3LA 3MEGA 1XMBA 2JZ5A 1AFJA 2KG1A 2ZHAA 1RT3B 3CCQS 2VPWB 2HNZB 2AJFE 1WI8A 4Y2CA 3Q8SB 1QUVA 1FESA 4GC6A 3KFWX 4KYQA 2HNYA 3K8VA 3VAGA 1HNVB 4BHQA 3CJ5A 3POTB 4OMFG 3DOKB 3AJ1A 2J7KA 4O23A 1F5BA 3J7YI 3AWGA 5K24A 2IVMA 3UE2A 4WTYA 4JV2A 1QZ0A 4K2XA 1S1XB 2KTQA 1G7GA 3MR3A 5LL6d 2KFZA 2Z8QA 1LWFA 3NS5A 2DO0A 1H2TZ 1PSDA 4IFYB 3PW4A 2JFDA 3CUNA 3GYNA 5EGYA 2C3UA 4Y3CA 3S3FA 1L8GA 2QT7A 2W25A 1FPRA 5E3CA 3OLAA 1WF2A 4PCQA 2Q47A 3PFEA 3T6BA 3VAIA 2MZQA 3V0EA 1RT4A 1D1UA 3HK2A 3BGRB 2DIVA 4KV8B 3MMBA 3OLRA 4BPCA 3CDEA 4AYBD 1ZCLA 2B9XA 1RTIA 3FQKA 3C6TB 3PRDA 2MKSA 4LF5F 4A8YA 2D9PA 4DL4A 3HPOA 2DH9A 2FHKA 3LWLA 2OIHA 2YX7A 4R0TA 1WTBA 2O01C 5DM6Q 4QWEA 3GV7B 1K8AT 1OSCA 2CJBA 1TKTA 2E66A 2XC9A 5E2QA 4DLEA 4K4XA 2WSFC 2AJ1A 3KLIB 4WFBQ 1KNZA 7FD1A 2F9DA 1NL9A 4CIOA 1RTDA 1TQLA 2IFXA 3I5CA 3I55S 4G1QA 1Y5IB 3M1VB 4N41A 5HBMB 2MBCA 2OZ5A 3OL9A 4HVZA 4GC7A 2B4SA 2DNZA 1B7FA 5J2PA 3LP2A 1JKHA 1RT2B 4O44B 3NBPA 4YAAA 2FJVA 1N52B 2J9DE 1YZ4A 4RUAA 2FVQA 3DLJA 3O8WA 3LP2B 1KEKA 4QW8A 3N79A 4ECYA 1ZYQA 4ATNA 5KOXA 5L39A 1M5PC 3M2UB 4K4ZA 3ISNC 2G59A 3FEZA 2JJDA 3TW0A 2G1DA 1MW7A 4ECQA 2RKIA 5T7LA 4IQXA 4QAPA 2JX2A 3NGKA 2FB0A 3C66A 3OVSA 1S0MA 2DHXA 4ILRA 2D3OR 4LF4F 2OOQA 3M05A 4AXJA 3MEEA 4RW8B 2LA6A 4WZMA 2BW2A 1WI6A 1JF7A 3JTOA 1FXDA 1W25A 4OI0A 3RR7A 3F99A 3MEKA 2GQ2A 3GYXB 2I0XA 4Q5VA 3OW2R 1DARA 3BGRA