2B4OA

Structure of the r258k mutant of selenomonas ruminantium ptp-like phytase
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
313
structure length
313
Chain Sequence
TVTEPVGSYARAERPQDFEGFVWRLDNDGKEALPRNFRTSADALRAPEKKFHLDAAYVPSREGMDALHISGSSAFTPAQLKNVAAKLREKTAGPIYDVDLRQESHGYLDGIPVSWYGERDWANLGKSQHEALADERHRLHAALHKTVYIAPLGKHKLPEGGEVRRVQKVQTEQEVAEAAGMRYFRIAATDHVWPTPENIDRFLAFYRTLPQDAWLHFHCEAGVGKTTAFMVMTDMLKNPSVSLKDILYRQHEIGGFYYGEFPIKTKDKDSWKTKYYREKIVMIEQFYRYVQENRADGYQTPWSVWLKSHPAKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords myo-inositol hexaphosphate phosphohydrolase
publication title Kinetic and structural analysis of a bacterial protein tyrosine phosphatase-like myo-inositol polyphosphatase.
pubmed doi rcsb
source organism Selenomonas ruminantium
total genus 104
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 3.1.3.72: 5-phytase.
pdb deposition date 2005-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14566 PTPlike_phytase Inositol hexakisphosphate
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1690 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2b4oA01
3.90.190.10 Alpha Beta Alpha-Beta Complex Protein-Tyrosine Phosphatase; Chain A Protein tyrosine phosphatase superfamily 2b4oA02
1KAKA 2I6IA 3AWEA 5K25A 1ZCLA 1YGUA 4GE5A 4ZRTA 1A5YA 3F9AA 2I6OA 5BX1A 4GFUA 2DXPA 4OHDA 3ZMQA 2ESBA 2B4OA 1PTVA 1L8GA 4RDDA 1WRMA 1Q6PA 1XRIA 1YTNA 2I6PA 4GS0A 2HC2A 1SUGA 3ZM0A 1Q6NA 1OEVA 2F6WA 3D42A 1U24A 1C83A 5GTJA 2F70A 4WU3A 1U26A 2P6XA 3V0JA 2Q47A 3QCNA 2CNHA 2A3KA 1EENA 4QBEA 2QBPA 1OHCA 1T48A 1G4US 1Q1MA 4Y2EA 5KA2A 2F6ZA 2GJTA 2H04A 3SMEA 3ZMPA 1BZJA 2HC1A 3I7ZA 4WU2A 2I6JA 2I1YA 1OHDA 3S4OA 4KYRA 1EEOA 2I4HA 2CMCA 1P15A 1X24A 3B7OA 1RPMA 5KADA 3QCKA 2HVLA 1BZCA 4H1OA 1ZCKA 4QUMA 3S4EA 3RO1A 4AZ1A 4D3QA 2NLKA 5LXQB 4B04A 4OHEA 4RI4A 1ONYA 2FH7A 2YDUA 2GP0A 1G4WR 4RH5A 2PT0A 1YTSA 5K22A 1PYNA 3PS5A 5M43A 1NNYA 1NZ7A 3V0IA 3O5XA 2H4VA 3S3KA 3LJ8A 4KI9A 4QBWA 4MBBA 1G1FA 4RKKA 2H02A 1OEOX 2PI7A 3QCLA 2M3VA 3A5KA 3ZM1A 1YFOA 3SR9A 3V0EA 1J4XA 2MBCA 4S0GA 1QZ0A 5AWXA 1Q6TA 3V0DA 2A8BA 4H34A 2QBRA 2CNFA 4OHIA 1PTYA 1V3AA 2CMBA 3BLTA 2BGEA 2QEPA 5K24A 3OMHA 3BRHA 1L8KA 2B4UA 4WOHA 3CM3A 4D3RA 5BZXA 3MOWA 2I4EA 2I4GA 5KA8A 4OHHA 4GRZA 5K9VA 3RZ2A 1XXPA 1YGRA 1M3GA 3QCDA 4RHGA 4Z6BA 2JJDA 2F46A 1C87A 1T49A 1NWLA 1WAXA 3QCIA 3I80A 4DGXA 4JMKA 3NMEA 3QKPA 2VEWA 2CFVA 2CM7A 3EMUA 3M4UA 4YAAA 2I3RA 1I9SA 4GE2A 5KA4A 3EZZA 2F71A 5IBSA 4HRFA 2CM8A 3D9CA 1PTUA 2B49A 5EHRA 3QCBA 2B4PA 4ERCA 1R6HA 4YR8B 4BPCA 1OHEA 3F9BA 1PXHA 3GXHA 1YPTA 1LARA 5KACA 1GFYA 4HJQA 3ZM3A 3S3FA 3QCGA 1FPRA 2Y2FA 3A5JA 4WTYA 1LQFA 1C85A 2PBNA 2HY3A 4ZN5A 3OLRA 2H4KA 2I3UA 4NX8A 2WGPA 3D44A 4R0SA 1LYVA 2F6YA 1NL9A 2BV5A 2C7SA 4JBCA 1G1GA 2SHPA 5KAAA 3QKQA 3V0HA 2CM3A 5BUGA 4PYHA 5BZZA 3QCJA 1XBOA 1ZC0A 1WCHA 4OHLA 2QCJA 1G7FA 2HNPA 4NWFA 5I6VA 2QCTA 3CWEA 3O4UA 3S3EA 2OUDA 2VEYA 2CNGA 2OZ5A 3D1QA 1RXDA 5KA9A 3I36A 1D5RA 1Q6SA 2BZLA 5KA7A 1YN9A 2I75A 1FQ1A 3QCFA 3QCEA 5K9WA 1NWEA 5EHPA 4RI5A 3O3LA 1G7GA 5J8RA 5KA1A 1I57A 3EAXA 4IKCA 2B3OA 3QCCA 2NV5A 3V0GA 2BGDA 2F6VA 2FJMA 1ZZWA 2AHSA 5KA0A 2B4SA 2C46A 1OESA 5KABA 3F41A 3S3HA 2QDCA 1PH0A 4RH9A 2OC3A 5KA3A 3F99A 1GWZA 2NT2A 2QBQA 2CNIA 2P4DA 2QBSA 3EB1A 2PSZA 4NWGA 1Q6JA 3AWGA 4JNBA 3QCMA 2CNEA 2GWOA 3D1HA 5K23A 2J16A 2HXPA 2I5XA 2Q05A 2H03A 2HCMA 1OEMX 2R0BA 3V0FA 3ZV2A 2VEVA 4BJOA 1ONZA 1YTWA 3QCHA 3BM8A 4NYHA 1I9TA 3RGOA 1MKPA 3O4TA 2G59A 4NNDA 2ZN7A 1BZHA 1AAXA 4QAPA 1PA9A 2ZMMA 4DGPA 1C86A 4GRYA 2FJNA 4KYQA 1XXVA 3GXGA 2F6FA 2QDMA 4GFVA 4GWFA 1PTTA 1T4JA 2BIJA 1G1HA 2OOQA 2F6TA 2G6ZA 4Y14A 2NTAA 3U96A 3AWFA 2NT7A 2IMGA 2AZRA 2PA5A 1VHRA 2I42A 1YZ4A 2B07A 3EU0A 1C84A 4QUNA 1YWFA 2CMAA 1PA1A 1ECVA 4J51A 1JLNA 4GE6A 4R30A 2HB1A 3N0AA 3O4SA 1OETA 2PQ5A 1U25A 2VEXA 3ZM2A 2E0TA 4R0TA 2QDPA 1NO6A 4TVVA 2H4GA 2J17A 4JMJA 2J16B 3D1OA 2NZ6A 1C88A 3F81A 2RF6A 3BLUA 4I8NA 5HDEA 4D3PA 5MMZB 2Y96A 3MMJA 2HNQA 1KAVA 2I6MA 5IBMA 4HJPA 4QAHA 1Q6MA 4PVGA 1OEUA 3H2XA 1QXKA 1XM2A 1JF7A 2CJZA 1FPZA 2CM2A 3RGQA 2VEUA 3MOZA 4ICZA 4ZI4A
chains in the Genus database with same CATH superfamily
2DNPA 3J80Y 1M5KC 3GE9A 3PTWA 1YGUA 4GE5A 1R8PA 5D0GA 3QWUA 1VQ5S 4ZVOB 3RRGA 2XMVA 2ZVIA 2AW0A 2VONA 3BKTA 2B8QA 1OEVA 2CFXA 1MROB 5K14B 1WOSA 1NH7A 5GTJA 1R8BA 2IA0A 2FY8A 2KG0A 1LNQA 2MQMA 1JLBA 2QA4G 2YNHB 3UCZP 4OI2A 1G2EA 1T48A 3G6YA 2FLNA 3DRXA 2LYVA 1KTVA 2J0XA 4F50A 2LQ9A 1WHWA 3L7UA 1BD6A 2MLXA 4OIXA 5B0FA 2I6JA 4DX8H 3HVTB 2KFZA 3BS9A 2AQ4A 1WSVA 2PMZD 3KDNA 1S1VB 1RT6B 1VQLS 2M7SA 3PR5B 2Y3YA 5L39A 2QTWA 4FF4A 4MJKA 4YUDA 4L3KA 3LP0B 1X31C 3EZUA 5LXQB 2VDHA 2F5GA 3NS5A 2FJVA 4ICLA 3KTQA 5J2PA 1DTTB 2BUNA 5KFGA 3CJQA 2FH7A 1RBAA 2DR5A 1O0PA 3POTB 5HSPA 1VC6A 4FN5A 1K0VA 2DNRA 3DHXA 1PYNA 1RAJA 2V2KA 2NYIA 2KTQA 2DGSA 1RA7A 1CSJA 4LBPA 1M5PC 1PYTA 3RAQA 1APSA 5G0RB 3TQ1A 2HW3A 2RRBA 1R6YA 3KK1A 4KPCA 2GMLA 3ILIA 3A5KA 2GZOA 1S72S 4XDDA 4FZVA 3V6JA 2A8BA 4ED5A 4DV7F 1FWLA 1PTYA 2BGEA 3C16A 3VHQA 5E3QA 2V63A 3UI3A 2JFHA 3UN3A 4C0BA 2Z2LA 2HHHF 1VQ7S 1K44A 3RB0A 4ECWA 1LW0A 5C42B 2F46A 4RL1A 1WHYA 5KFJA 3R97A 2Z57B 3W9JA 4DLGA 3ZZYA 4BCAA 4ZPVR 3MFHA 4DL2A 3AHPA 3R27A 2E7XA 2RU9A 2OI2A 2VB6A 5LMNJ 2B49A 2OP5A 4UOGA 1SUQA 4QR2A 2DR7A 3IWLA 1LWXA 4DV3F 2IIHA 2RF2A 2CQPA 1FJCA 2RVJA 4PAAA 3JSRA 3GU0A 3DYAA 1SPBP 2HNZA 1YRUA 1VRTA 4DR5F 4KKOB 3J7A1 2OSRA 1B70B 3KLHB 2ASLA 5K8NA 1CC8A 1M5HA 1J5EF 2AKWB 4KYZA 4M5GA 2ZFHA 5DQIA 1TKXB 5KG5A 1IQTA 4IFVB 3BM7A 5BZZA 2X7IA 3MM7A 2AJQA 1VBKA 4NLXA 4JI2F 3Q2TC 2CWXA 3Q83A 1S12A 3H98A 1TAQA 3M1VB 4OI0A 1KOOA 2KT3A 3ZZPA 2KHDA 2G4BA 3SDEA 2I75A 1J6UA 5E2QA 3LP2A 4O0NA 2ATCB 4QIFA 4NA1A 3OTOJ 2CRLA 3CD0A 2FJMA 4CDIA 3NRBA 3OHBA 1NDLA 1YI2S 5C25B 4CVKA 1PH0A 2NPIA 3SQOP 2VQFJ 5DS7A 3MCMA 4KY3A 4GC6A 1HYSA 4PG8A 4CP5A 1X5TA 3Q22A 3TJ8A 2HSEB 4CLKA 1FCAA 5B09A 3SCIE 4K5RA 1I51B 4ALZA 4WBFA 3CCUS 4J9QA 1PJ6A 4IRKA 2JC0A 2Z58B 2GMHA 4ECRA 2UUCJ 1R3NA 1PSDA 3QFHA 5SUHA 1S0VA 3DLLQ 1PAUB 1P3DA 1F3VA 1D8ZA 2HS0A 4C48A 5A8KB 5GMDA 2F6FA 2YWFA 2BIJA 4EZ6A 3T1HF 1N34J 2IRUA 2B5JB 4ECYA 1XMOF 2YQ0A 1Q79A 2UXCJ 4F4KA 2QLJB 4UT4A 1YITS 2C22A 2RQMA 1WC5A 4ETXA 1C84A 7AT1B 3OR2B 1ECVA 5KG7A 2W01A 1JLNA 4ZMMA 4R30A 2DXFA 1QDUB 1U6BA 5BR8J 3O4SA 4B3OB 2F8MA 1AFJA 4R5PA 2C3UA 2PMHA 1E8CA 5HDEA 4NL5A 5D0RA 1WG1A 2MYFA 3H8YA 1TQLA 2R4FA 1QXKA 5LJ5Y 2IJRA 1ZYQA 2MY7A 1UFKA 4DPYA 2DCUB 3CDUA 2BW2A 4B17A 4M8LA 3E51A 2UUBJ 1BY9A 3B78A 3MM5A 1AZSA 2CWKA 1ROFA 2ZHOA 1R31A 4B9UA 3SBMA 1RT5B 1P6TA 3CCJS 2HHXA 1ZA1B 1U26A 3CDAA 4URSA 1FKPB 1QUVA 1IR0A 2I2YA 1WF2A 2CQ0A 5J2NA 3VGSA 3C6UA 2W8LA 2HYIB 4Z7YA 3PW5A 3B8HA 3L3CA 1Q1MA 3ENVA 1W7KA 1RSCA 4FS2A 3QRQA 4DSKA 2I38A 2JX2A 4NASA 4KYRA 4J9NA 3K5OA 2UVWA 4M5NA 3I5AA 2HQFA 2WRMA 2CPDA 1N33F 1CULA 2LKZA 2QL7B 4NLUA 5ETSA 3QGIA 1SCJB 3UN5A 1OSDA 1KLNA 1T9WA 4KE5A 4LIWA 2W2OP 1NNYA 1A9NB 2B6AB 1S6PA 3QLHA 3S3KA 4I1TA 1N8RT 2FC9A 2MZ1A 4MBBA 3EGWB 5DDOC 2KT5A 2MSSA 1OEOX 4Y2MA 1YWXA 2M3VA 4N56A 4AQYF 4ZJOA 1JB0C 2XSJA 1X8DA 2HRTA 2CPXA 4N7TA 2JL9A 1V3AA 3BLTA 4K4SA 1S6UA 2IVYA 3OMHA 4X65F 2E5IA 4L74A 1L8KA 4JB8B 1DRZA 4DV3J 3OFHA 4GRZA 7FD1A 3K5LA 1NJXA 4Z6BA 1C87A 4F4AA 1R43A 4DR5J 4I68A 4N8OA 5IT4A 3T6BA 3I80A 4ICLB 4MK7A 2DNMA 1URNA 4UTGA 2I3RA 3TZWA 1JLQA 2KI2A 1GMVA 4HRFA 2XQCA 1RADB 2HNDB 1RT4A 3U1LA 2AWZA 3RR8A 4JI2J 4OJGA 5F9NA 2RSQA 3JSMA 4BUCA 3UQSA 3V4MA 3VR1A 3A5JA 2AJFE 4ZCLA 4WTYA 1U1KA 3O6QA 2I3UA 8AT1B 2D9OA 2VC0A 2RMLA 2ATLA 5IM0A 2P2CB 1SC4B 2K3KA 1K0TA 1IBMF 3KMQA 2Y1OA 2DGXA 2M8HA 2IJFA 1U1NA 2BJDA 3HJVA 1ZC0A 4PQAA 4FP9A 1VISA 4DV2J 2IM1A 1LW0B 1BLUA 2CNLB 2VBYA 5E41A 4LF2A 3PR4A 2HGMA 2C28A 3CO0P 2GVDA 3W2VB 3VAKA 3MXHP 2IMWP 1RXDA 2YXLA 4NRTA 1M1KT 4MIAA 2BZLA 1REVA 1L3VA 2Z30B 2GHVC 1IWGA 3R5AA 1G7GA 1S76D 1KFDA 4OX9F 2H5JB 3Q23A 4HACB 4PG7A 2HNZB 1VRTB 1J5OB 1RTIB 2QDCA 2BOPA 1CEZA 1U02A 3ZZUA 3OPKA 4O3NA 4QPTA 1P27B 3D6MB 2KM8C 1Z4UA 2DYAA 3I6PA 5DG7A 1NO8A 1EP4B 3T1HJ 2CNEA 1EARA 2M8DB 1XNQF 1IKXB 4EBDA 2R2TA 1XMOJ 2NXCA 2MLZA 1VCTA 2JEFA 1WEZA 1HD1A 2VEVA 2EEYA 1UCNA 1LFPA 2W8KA 3A3PB 4KGMA 3ISND 1MKPA 2VORA 4NEYA 1FFSB 2WB1D 4C11A 3SDEB 1FKAF 4GRYA 4P10A 3M30A 5DDRC 2QA2A 1ZTWA 2MZJA 2DJWA 3LP2B 2JLFA 2IMGA 4OZ5A 3KHHA 2GIQA 2XMKA 1YZ4A 4E8UA 4YN3B 2CG4A 4CT9A 2WTFA 3KNAA 1A6LA 1UWAA 3PJXA 3OVAA 1HYSB 2ROPA 4JI8F 1KR4A 1KS2A 3V81A 3UR0A 3W8PA 4X4SA 3ETMA 5LJ3Y 2HNQA 5E5NA 4A46A 3M9MB 4A8WA 3BDPA 2MLYA 2D74B 3W9IA 2MQOA 5D4LA 1NDPA 3MPYA 3K89A 4OFZA 2PIIA 1N5TA 5KFFA 4BBYA 5H9EK 1WORA 2KM8B 4ZP7A 1QLNA 1NK8A 3BGUA 4IOCQ 4LSNA 1S1XA 2QV6A 1WTBA 1FRIA 3W2WB 2ESBA 4DV6F 1PTVA 1T05B 4ER8A 1AROP 4RBVA 4QW8A 1QD1A 1VRUB 5D3GA 1YTNA 3QYYA 4I6AA 1C0TA 3HFZB 1RT3B 4DZ6A 3X1LB 1C83A 4WKYA 2J0WA 4JI4F 1B0VA 4I2PB 2FJXA 2A3KA 1RAFB 2BBEA 4F3OA 2GNKA 3JSYA 2O1PA 2HBZB 3KJNB 5KFNA 1DURA 5LSLA 2QT7A 5C24A 4WU2A 3M8ZA 2MZSA 3EGVA 1E6VB 1SL1A 1XR5A 4P2XA 3GR0A 4YY3J 1DLOA 5B0EA 2ZWOA 1AZSB 4LR7A 4CM2A 1N32F 3EM1A 1Y10A 2V8PA 4KC5A 4L72B 5A5EA 2GC6A 3O44A 2V67A 1HHQA 3MPUB 3EVOA 1UEVA 2QSWA 1RTZA 2ZM6J 3WX4A 1NLKL 3NWGA 1VRQC 2H4VA 3K8WA 1T0TV 3M8WA 4C8LA 1QTMA 2E9RX 1GEHA 5E3AA 5D4OA 5J2NB 3NG8A 5J2MA 2H02A 1VS3A 1HW8A 5KFMA 3SR9A 4ZCKA 4S0GA 2ZUGA 2CIMA 3HSGA 4RW4B 1U1QA 2VFSA 5I3QA 2OPRB 5LMUF 2L08A 4N8NA 3MOWA 5E3RA 1CULB 4K2JA 4DG1A 3QCDA 5AJ3J 2BJ9A 2DH9A 2M9KA 3J81Y 1S9FA 1U49A 2UU9F 1P9YA 2K3IA 3N01A 3V6KA 1B99A 5KFLA 3ONQA 3VWSA 1RYSA 2DR9A 1WOOA 4OYAA 2MB0B 2H5IB 3QLHB 4C12A 4DL6A 4A8FA 3N9UC 5K20B 4WP3A 1SH2A 3UDVA 1Y9OA 3MURP 1NDKA 5GAGU 5KFSA 2PGCA 2VV5A 3B54A 2C2NA 4DR7F 1FGSA 5B0DA 1U0HA 5L8RC 3PFEA 4U7UK 5KG0A 5RUBA 2AZ3A 5KFIA 1UEUA 3HVRA 3D44A 2W1BA 4ZCIA 1TL3A 2C7SA 2BEFA 1PJ7A 2HPUA 4EBEA 3RB6A 5T7LB 4RNMA 3DLHA 3TZZA 2DNHA 4OX9J 1URRA 2HZCA 4ZPTR 1LEOA 1LOUA 1F6TA 3UR3C 1KN6A 1SKSA 2JH3A 5DDPC 2HAFA 4RUCA 2LQBA 2MQQA 1T3OA 1HNIB 4IH6A 4LRCA 1FQ1A 5DQHA 3IA0A 3H4DA 4IG0A 1RT4B 2VOOA 5F9LA 1JX4A 5K9WA 4CLPA 2BACA 3P96A 1OYDA 5CH7B 3BZQA 3QCCA 2F6VA 1SIZA 4WYWA 5HMYA 3MMBB 2FTRA 3AB2B 1UVJA 1OY8A 4A8SA 1VYAA 4DFKA 2G2ZA 2NT2A 3TNVA 4DV4F 4ID5B 2KYXA 1Q6JA 4F2SA 1T94A 2ZBCA 3D1HA 2H03A 4I56A 2FHKA 4A4JA 3FZ2A 4XAKA 5ETOA 2V34A 1VHFA 1YTWA 3NCPA 3TUPA 2U2FA 3JS9A 4E0DA 3O4TA 4WXWA 4PKDB 1MWZA 1HBOA 4K4WA 4JI8J 2HFOA 3UPFA 2J76E 4ED0A 2XTJP 2OD6A 2OOQA 1ZTTA 2M88A 4JI0F 1VK8A 1FF2A 2NT7A 1A7GE 3HX9A 3QT5A 1S1TB 1ZM2A 2QL5B 1RK8A 1V5IB 3HD2A 5JXSA 2IVMA 1YLXA 3FMBA 4KHMA 3G71S 3VAMA 4K5SA 5DZ6A 2VJUA 3TOQA 1TELA 2E0TA 1X4EA 4R0TA 1Y00A 3QSIA 1NO6A 1CVJA 3I87A 4OL8A 2LECA 4CCHA 4DV5F 5KG3A 4EU0A 2CPJA 4D3PA 4F25A 3ENAA 1FEEA 5DETA 3KJFB 1WC3A 4P52A 4JV5F 1Q6MA 3H2XA 1QSLA 3QATA 3LGHA 1N0UA 4LR9A 3Q8UA 4C11B 3RRHA 1XERA 4JI4J 2OELA 3UDLA 1RACB 3M30B 4U95A 1FDBA 3FQLA 3AD7C 3PY8A 5IXUA 2KXFA 4KIAA 2X1BA 3KLEA 1KQSR 4M5HA 4ZVFA 4TY9A 3MCSA 1D9DA 2HHSA 1I1GA 1FX4A 1SBRA 3AQPA 2I6PA 3UNGC 2G13A 4RPFA 4WWSA 1Q8BA 1U4BA 4XPCA 3CJKA 1RGVA 3V81B 4LRFA 3P49B 5SZTA 2KXHA 3NOCA 5KG1A 4CH0S 4M5IA 4CVLA 1UVLA 2A1BA 4E98A 3DCAA 3TJAA 1AUSL 2Z2MA 4FNHA 1BZJA 3B6BA 4HV4A 4A8MP 3QNWB 3VVUA 2ERRA 3ZZOA 3S4OA 3R5JB 1YJWS 1EEOA 3IRXA 2IM3A 2MGZB 5HQ8A 1OWXA 3LK7A 1BMQB 3N79A 1QM9A 4KB7A 1PYSB 1FESA 4OHEA 5D3GB 4MTPA 3IFEA 1N48A 2B3TB 3TZXA 2SXLA 3HP6A 2WSCC 4O3QA 3GV7B 4WYLA 1HMVB 3FSIA 3MECB 5GAHI 2FGCA 1Z1ZA 4L3NA 4YOEA 1DQ8A 2OD4A 2NSCA 3I9ZA 3NLCA 2OPSA 2RILA 1N4LA 2UU9J 2H4WB 4B9LA 2CPFA 4IH5A 1PO6A 3V0EA 2AP6A 1VK3A 3GSIA 2LXIA 1TL4A 1VOMA 4ZHRA 4NLRA 4NI2A 2FC8A 1RXOB 4D3RA 1LWCA 1YJUA 2B0GA 4NXNF 3PW4A 4RHGA 2VODA 1MLAA 2ZH2A 4DPWA 1RTHA 4R25A 1JJ2R 2RRAA 1I9SA 4KV8B 3RAXA 1YKWA 2CM8A 1EB0A 1HI8A 4ZS6A 2Y66A 2VFTA 4A48A 1UW9A 4F3MA 3KK3B 2DNZA 3KLFA 1YRXA 2RT3A 3A8KA 2FHJA 3FFIB 2IYGA 1LARA 4Y0FA 1S57A 1TL1A 5J2MB 2C2ZB 1AB8A 3D4JA 1XK8A 4NPOA 2A6MA 2AV5A 2W9BA 4PWDA 3N6NA 2K7JA 2HNYA 4H4KC 4Q7AA 1LYVA 4R0SA 5I42B 3QKQA 3V0HA 2VPXB 3M8QA 3VZIA 4CTAA 3DLGA 5EWEA 4Y3CA 1EZZB 3M4XA 1UEKA 2GIFA 3U1NA 2HHUA 1FXLA 5THWA 3WX8A 2HURA 2UXDF 1EKSA 3GWCA 2ZBQA 3GTYX 3NKYA 2LA6A 2BVZA 3NEKA 1ULRA 3AJ2A 1UVIA 3A8IA 5KA1A 3RBZA 3EAXA 3FQKA 3MCNA 3GR1A 4XO0A 4FS1A 1SQGA 4B9VA 3QSYB 3MUVP 2LDYA 5F41A 1FRHA 2ZZTA 1XR7A 2A18A 3EB1A 4BC9A 2W9CB 2YQ1A 3D9BA 5DRKA 3AWGA 2MZQA 1TL3B 1RHRB 2C2RA 1SQEA 3HKZD 4P73A 3CTRA 3QMQA 5DM6Q 1PBUA 2WVCA 4BJOA 3MPVA 4OYXA 1TP7A 2GGPA 4C0OC 3C66A 1E0DA 2VG7A 2RNEA 1NEEA 1BWEA 4YHHF 3M8YA 2F63A 3GQCA 3DI6A 2NXNA 1F0XA 1HPZA 1DARA 4DGPA 4UOCA 2H4YB 1OO0B 2HMIA 1JLCB 1RISA 3MF5A 3T5HA 5KFPA 4Y14A 1HBMA 4DV5J 4URQU 2JLEA 2AZRA 1KHVA 4I7FB 4JV5J 3TZYA 4QWAA 3OJSA 2B07A 4ZVEA 4QQBA 3FSYA 4J51A 2FVRA 4FVCA 5FD1A 3DC2A 2JDJA 2EFVA 3A3NB 2JEGA 1H74A 3M2RA 3JQJA 2VG6A 5F3ZA 3R2CJ 1NU4A 5E0OA 4F0KA 3D1OA 3UDCA 3DMJA 2EK1A 2CQ1A 1OIAA 3HK2A 5IBMA 1RWMB 3CJ3A 4QAHA 1S59A 3G8QA 4LBIA 3UCUP 2BXJA 1C1CA 1F9FA 1S9GB 3KDOA 1CG2A 2FB0A 4M5JA 5L46A 2I6IA 3RBDA 5IV3A 1RZMA 1N6QA 1A5YA 1IBLF 2XYPB 1S79A 2WBRA 5BX1A 2DXPA 1WC0A 1Q7YT 4C8ZA 4ZP8A 2F4VF 4YP3A 4DQIA 2FIUA 3M2VA 1OQ3A 4KGXB 3MTJA 4FBTA 4ZVTB 4NCAA 2V8VA 4O4GB 4ECXA 3PHTA 2EFPA 1UA1A 1OS5A 3ICLA 1WG5A 2F70A 4USHA 4PG5A 3V0JA 3VV2B 2POKA 3A4TA 3C15B 1K8AT 1KNZA 4ILMA 2WHOA 2HVZA 3HI9A 1OHCA 4CLUA 5KT3A 2P5VA 2V2QA 3H5UA 4FYDA 2YKMA 1JK9B 4B9NA 4DV0J 4NRUA 5DG9A 3IN5A 5J2QB 2CMCA 4CO2A 5AXMA 2BANB 5ETMA 3UDEA 4NLYA 4FF2A 3PIOQ 3W5XA 3I9V9 3RBXA 1ZZNA 3AQOA 1IKWA 2GJFA 4I2QA 3BJYA 3M8RA 4DR4F 1ZBTA 3OLBA 3JYTB 3C46A 3NBPA 1TKTA 1U2RA 5M43A 2Q66A 1UAWA 2DGQA 3AA9A 2GV1A 3GFYA 4X64F 2VOSA 4QBWA 2J7UA 4NXNJ 4CM0A 4PYDA 3HD1A 4Y28C 2DISA 2HZVA 1RU2A 1JBWA 4PG4A 4QIGA 4LF6F 4YB5A 1KLMB 3IWXA 3IO1A 1FNXH 1SB6A 3CC7S 3QJJA 3VCDA 4R0JA 4OHXA 4KQZA 4WP8A 4QU7A 2OJ3A 4LF1A 2RU3A 3QRPA 2XS2A 3D6FB 4LF4F 4DR2F 1V3RA 4P75A 4BS2A 1B7YB 3CJRA 3PEHA 2ZC3A 2VPYB 2GC5A 1JBVA 1T95A 3EMUA 3HXMA 3SEOA 4GKJJ 2AM1A 2XWYA 4UF4A 4X84A 1RI7A 1R6HA 4LIRA 1U8SA 3RW6A 3J7YU 2L41A 2VDIA 5HP1B 4IR1A 2ZBPA 1FRMA 2ZC4A 1UFLA 1FFWB 4ZN5A 1Q1KA 1S5ZA 1WI6A 3KLGB 1D9FA 4YR2A 2MKCA 2G0CA 1FRLA 1NL9A 2I5JB 4AL5A 3FJ2A 3BGFA 3JSBA 4ZHRB 4NI2B 4PXBA 3DU6A 1XBOA 5EDWA 2A3JA 4DX6A 1Q8LA 4F0HA 1SJ1A 1U2CA 3CMAS 4DL7A 2CNGA 1GQQA 2OZ5A 2PA8D 1RTHB 1R0AA 5KA9A 3I5BA 5KAKA 2V4QA 2GJ2A 1FE4A 4B3TF 4B02A 5KFHA 1ZA2B 4NZ0A 1I94J 3NL0A 2K1RA 4HKQA 2OEKA 2R2RA 1WI8A 5KT4A 2CZ9A 1X5PA 2BRLA 4OYBA 2AGQA 1KQFB 1E6YB 1IBKJ 1YBAA 4YHHJ 1RT7B 4NX9A 4DOZA 4QYZK 2W7AA 4U6PA 1LXJA 4M1KA 3G8SA 2PSZA 2VF3A 4AXIA 4ZITA 3A8JA 2DO0A 3MZIA 2DRDA 1IWAA 4CI0B 2J16A 4B9SA 2Y8WA 3I96A 2R0BA 3M8QB 1WF1A 3LGMA 3HJFA 3DLGB 1KQKA 3D54A 3QGGA 1LK7A 3KNGA 3TRGA 4RW6B 1BZHA 3IS9B 5IT9Y 3I0SA 1YBTA 4UY8T 3IGNA 4GWFA 2OPQA 4U67Q 1U47A 1QAIA 1NSQA 2L3MA 3MAHA 1PCAA 4ECQA 2IDLA 3OSPA 1RT1A 2XS5A 2WVBA 4ES3A 3C8YA 2DR8A 4K0KJ 1PA1A 4LF8J 1NNDA 4TYBA 3N0AA 4WXOA 3OL9A 1OETA 4N76A 4JMJA 1IBLJ 3GIJA 2CG8A 4NYOA 4GO7X 3FKBA 2GGPB 2F4VJ 2ZH4A 2B9EA 2H5EA 1P31A 3PKYA 2VTDA 1HR0F 5CCMA 2VG7B 1JJHA 2UV8A 3HVWA 2F65A 4AYBD 3RGQA 1NPKA 4IQXA 2KZMA 2QC3A 4HDHA 1ZCLA 2C2MB 3F9AA 3EZOA 2GA7A 2MKSA 3SI8A 1U09A 2E5LF 3ZMQA 4OHVA 3BR9A 4RDDA 2XI3A 2A10A 4ES2A 4OYIA 4TQRA 2RUGA 1SUGA 3TX8A 2GQQA 1U24A 1I6JA 4XPEA 4IUFA 3FC9A 2AYGA 2Y1LB 2VG6B 4WF9Q 3IG1B 4DF4A 1GAOA 2V4JA 3FCWA 3DMJB 1DY3A 1TFWA 1WTFA 1XTZA 3CUNA 4O23A 2RHQB 2R8KA 1XR6A 5HO4A 1I3OB 1HNXF 4IRCA 2EBEA 2JC1A 2ZOMA 4FKXA 4RZRA 4O3RA 2BE2B 2E66A 1FKOB 2HVLA 1JMTA 1LV5A 2RD5C 2GVZA 2YBVA 1TK0A 1FK9A 4B3MF 2GIRA 3AT1B 5C7PA 5K8OA 2VICA 1OMSA 4WE1A 3A1YG 1HBNA 1YTSA 1YQHA 2ZJRQ 4Q0BB 2H48B 4RUBA 1L3TA 4B3SF 2XMTA 4ECUA 3W5ZA 1BQMB 1SVDA 3DRYA 3EDRB 5C2CA 4DR2J 3QWPA 4HLBA 2CZ4A 3C6TA 4ZK7M 4X66J 4FPIA 2LFVA 1DQ9A 1RB0A 1Y11A 1Q6TA 2YKMB 3DU5A 5T14A 4M63A 5HN0A 3PKMA 2PEBA 3IR6B 2DNKA 5K24A 4ZPAA 1Q0NA 1TMJA 2B4UA 4FYVB 2CPYA 5BZXA 3MEKA 2I4EA 3PO4A 2ASYA 4DFJA 2ZH9A 2EBGA 4RX6A 3BSCA 1ZZFA 3KLIA 2XSFA 4RWXA 1S0MA 2JFDA 1UFWA 2AIRB 4OI4A 2CJ9A 4J91A 2XY7A 2DNYA 1HNVB 1LWEB 1LW2A 3T5LA 2CQ4A 2XZDB 2ILZA 4PYAA 2MTLA 3MM8A 4LT6A 1OHEA 2VKZG 3DRRA 1YK9A 3SZ2A 1TR0A 3CCVS 3DXBA 3I31A 2I8EA 3WBZA 1YVFA 4NX8A 4Y00A 1T03A 2M70A 3QO9B 3SYZA 3AODA 2OHDA 3GYGA 3DHWC 3MCOA 2C3YA 1NKCA 4PYHA 3CC2S 2H54B 4B3RF 2WTZA 1PG5B 1WCHA 1S9EA 3CDEA 5A8WA 1ZPVA 2F4FA 3V2UC 1UL3A 2JFFA 2D3ZA 3CJ4A 3WQPA 2HHTA 2NR0A 5D4NA 1D5RA 3I36A 4ED3A 3CJTA 4R8UA 4CLLA 1NWEA 2PN6A 2E29A 5EWFA 3MI7X 2BGDA 1OQ6A 4NOHA 4P7TA 2PFFB 2O01C 1R8CA 1GWZA 4ILLA 5LT5A 2VG5B 4JI1F 3DRPB 4ANDA 5HJYA 3FBBA 3D3BJ 4BLGA 1V5VA 3TVKA 2Z2YB 1CPZA 3VVTA 2IVFB 1N5YB 2JWNA 3DFEA 2BKNA 3D66A 1S49A 4C3MA 1ZM3A 2UP1A 1IBCB 1SJ4P 1NK7A 2GO8A 3EVWA 1FD2A 1G1HA 5JVGQ 2CPIA 2CPEA 5A0YA 2K1RB 5L1KA 2OTJS 4PPDA 1HR0J 1SJQA 2ALYB 4RUHA 2B4VA 1T9YA 2KXNB 4GE6A 1Q8IA 4MKYA 5DDQC 3GB0A 3TA2A 3RAMA 2RRNA 4JYAJ 5EHHA 3ZM2A 2FJAB 2EWHA 1M5VC 1NKBA 2J16B 2YNIA 3T5KA 2CUYA 2RF6A 3MMJA 5M2RA 2ZH7A 1R8HA 3TAMB 1BHNA 2AHOB 2CJZA 1PC5A 3FSXA 3DOKA 3CT9A 4KGZB 1SKRA 5B0GA 1P8GA 3GCXP 2CJQA 4AFFA 2RUSA 2AEJA 3R3TA 2OPQB 4LRBA 3CCRS 3C19A 1YX2A 4QIWD 2NUHA 2YTCA 3EMTA 3W62A 3ENWA 4OHDA 2FZCB 4N41A 5KFBA 2X51A 2YX4A 1XRIA 3DLBA 2LDIA 1HNXJ 1RBLA 4CRJA 3WC0A 4MYTA 2B9YA 1R27B 2R7OA 2OFHX 1RHKB 4QWBA 3JB9k 3L7OA 1YJ7A 2C2DA 4ZVGA 1JLGB 1U45A 2CNHA 3A8EA 2UUWA 1B0PA 1S1UA 2YKNB 4NMXA 1NJIT 2LU1A 4ELUA 4YB1P 5HMXA 2GJTA 4KHPJ 4QIEA 2C3PA 1FTRA 3KKFA 4FVMA 4RNOA 2Y1IA 4B3SJ 1RTDA 3T3FA 4JUZA 3OBIA 2MQNA 2YNFA 5L1IA 4C9DA 5KT7A 1MN9A 1H2TZ 2MEWA 2YKQA 4QUMA 4V19X 3RO1A 3OR1B 4F4WA 3UVJA 3ZXWA 5KFVA 1HWKA 5A6WA 5AT1B 1TL7B 5HANA 2YDUA 2IHR1 5D6GA 2UUAF 3FRZA 3KHLA 1NK4A 1ELOA 2LQ8A 3O5XA 3IBCB 2DPIA 5L1JA 1V3ZA 3LP1B 2V4JB 2V6AA 1G4CA 1FVSA 2PI7A 3W5YA 2G9OA 4AL7A 3ZM1A 1RWWB 3OUYA 4USUA 1AW0A 2XCAA 5CXTA 1JLEA 3CCQS 3DKDA 2GMJA 3PX4A 2A0FB 3H5YA 4H54A 1RCOB 2GJIA 2AJ4A 4CLFA 1HQEA 1F5AA 2OGUA 2GVZB 4K59A 3QJLA 2JJDA 4LF7J 1FK9B 4EO8A 4YB6A 3QZ7A 4IG3B 1WAXA 4J9PA 4DGXA 1RABB 4L75A 2J9CA 3T9ZA 4IQMA 3H25A 4DR6F 3I56S 4B08A 3H42A 1U1OA 3FK4A 4GMKA 2HZAA 1PTUA 1SJRA 2LEAA 4NE9C 5G4DA 5D0EA 4B3RJ 4JI6F 4BPCA 3GZ7A 1YJVA 5FDLA 4KJIA 4TY8A 4DU7A 3R6GB 4FYWB 1UTAA 2B9WA 3BR8A 3O1LA 2BM0A 1KFSA 3G82A 4CLSA 2Z0GA 3AFGA 2Q6CA 4NLTA 2DNNA 5DO2A 2WSFC 2LXUA 4M5DA 1FRJA 4FF3A 1KVJA 4HEA9 5EGYA 1KC8T 3QCJA 3MMAB 4LFAJ 4K4ZA 5LOQA 3W8GA 4XTTA 4NWFA 2P8IA 4PXCA 3CWEA 1U48A 4U9RA 4WFAQ 5KFKA 2AM2A 4M5KA 5A6PA 2YNGA 2VZ9A 3ZZZA 4YMEA 4DBQA 1LW2B 2CPZA 3K5NA 1HBUA 2UV8G 4USTA 3RJMB 1K9MT 2X1GA 2ZOGA 2ZWPA 4WIIA 3LO3A 3NCQA 3CEDA 2DEIA 4EZ9A 2VPZB 3DOMB 2RJZA 3NGSA 1YJRA 5KFTA 4QDIA 3H5XA 4NXMF 2DT9A 2YPYA 4J37A 3F99A 1JLAA 4PCQA 3VAFA 2R7XA 3B4MA 5B0CA 1X7VA 4V1Ak 3S01A 2CADA 4CO1A 3BSOA 5E33A 3BGLA 5F8LA 1D8YA 2IDEA 3LF0A 3IRWP 2KRBA 3EWGA 1S9EB 1GG4A 4KSEB 4LF5F 5K8PA 4O3OA 4FNIA 3T19A 4ID8A 3X3UA 3HFKA 3DDNA 3V5RA 4LF9J 5BYSA 2AX1A 1CJKB 4WZMA 2HBRB 2UVRA 4R8UB 2QDMA 4GFVA 4ZLLA 3ELHA 2BM1A 1YZ6A 3BH6B 3H40A 3M2UB 4ZPWR 4ZVSB 3CVKA 3HZEA 2NUUG 3N6MA 3ULHA 1VDHA 4MFBA 1GT8A 1IXKA 3I55S 3CJ0A 4A8YA 2FVQA 3ZO7A 4OLOA 4C0HA 3MPWA 1YGYA 3R5CA 1VR6A 1FJGF 1SQFA 1REGX 1SXLA 2H4GA 3ET6A 3AD8C 4LSLA 4URGA 2J6TA 4LVNP 4NLVA 3BN4A 2IMOA 1RWNB 3K5MA 4DR3J 3CC4S 2V5HG 4JI7J 5I3UA 1N5QA 4DR1J 4HYKA 4A8OA 1YSJA 5KT2A 4DUZF 1F3FA 5A2QY 2FJEB 2MPUA 3HKWA 2DH7A 3TUJC 1VQOS 4QW9A 4ERDA 3CDBA 4ICZA 2Q43A 2R8HA 4WK1A 3AWEA 5GMEA 4NLQA 3CCLS 2HAIA 3D7SB 3FCHA 2NSBA 2HVHA 4UZBA 2I6OA 2CAJA 3OTDA 5ETLA 2I9SA 3V6HA 3DN9A 1WRMA 4JI5F 3M6XA 2V2ZA 2IJNA 3D42A 1KHWA 1MU2A 3QQCD 5E3CA 4RW8A 1S1WA 2FJWA 4Y65A 1TTHB 2K06A 3BPSP 4IDKA 2MQLA 3OHAA 4C8NA 4DHVA 2AEMA 2D69A 3IM8A 1FTCA 3N0VA 1G4US 2H04A 1HWJA 2Q6BA 3SMEA 5F0UA 2UUAJ 1VLOA 4F4YA 3DOKB 1YJ9S 2GW8A 2KO1A 4RW7B 3QGHA 1TV6A 2R7QA 5U47A 1HFEL 3MEDB 3H7HB 3B7OA 4KPYA 5GVQA 5FJ4A 1HA1A 3K7RA 3E01B 5HBMA 4AZ1A 2XM3A 4UUWA 4H4MA 3AOAA 2DRBA 2R7TA 3J7Z5 4JI3F 2WONA 3L09A 1H98A 4MKVA 5LXRA 3EE3A 5K8MA 1BQXA 1RLCL 5DQGA 3MUMP 2MZTA 4OZNA 1HNZF 2AZ1A 2ZNYA 4J9KA 4H4OB 3FEXB 1PILA 2DKOB 2RDIA 4JP8A 3OL6A 2DBBA 2HKEA 3HHLA 2XC9A 3PO5A 5FLXY 1C0UB 3T6JA 2ZVSA 3RRKA 3M8SA 3KG1A 4CLTA 1RTDB 2BQ3A 1SV5A 3CW2C 3DGPA 3MR2A 5GMKa 4JI6J 2BV3A 1GXTA 1T9VA 4G1QB 2R7SA 1O5ZA 5KA8A 4Y2CA 4WIQA 1M3GA 2HVEA 1RBOB 1F60B 4RNNA 4OJ1A 3OW2R 3QKPA 3R8YA 3AJDA 3NAIA 2MMYA 3ZZTA 1KEKA 4USMA 4I6WA 5CYQB 1T7PA 2E9ZA 3FUYA 3V4IA 2C3MA 1XNRJ 1P1TA 3LOUA 3LAKA 3OUYB 1S6QA 2HFZA 3OLRA 2CYYA 1KDNA 1JLEB 4F4XA 2RS2A 4W98A 3CCTA 3QAEA 2M52A 1G1GA 4DQSA 1JJCB 3SCKE 2FVCA 4ZOSA 1WKJA 3E8OA 4P2MA 1CS4A 2D9PA 1WSRA 1R8AA 3BO4A 1LWFB 4Z2XA 3THPA 2JHEA 4NLDA 3OD2A 4CYUA 3F56A 3KXDA 5KA7A 3O2IA 1NUEA 2O67A 3OXGA 4ZP6A 4K4UA 5J8RA 2XMWA 2Y8YA 1I57A 3LGNA 5FDLB 1TZ0A 4Q8FA 5GAGI 1WF0A 2QG9B 4RH9A 3WHIA 2QBSA 4K8RA 4KHRA 2IFXA 2DGWA 2E44A 3P4UB 1NHVA 4EMDA 1WUUA 4DEZA 1IJFB 2V8HA 3BN7A 2E1RA 1VBZA 2PA3A 2O5DA 2NPFA 1KSPA 3IWNC 2ZITA 4AXJA 1NB7A 1J27A 5H9FJ 2F8HA 2LA4A 2FD2A 2MHNA 2EI5A 4OI1A 4QU6A 3NGRA 2HIQA 1JXVA 1FJGJ 3MEEA 3M8PB 2AT1B 4USJC 1F9HA 1SH3A 2NTAA 2APOA 3HF5A 1IKVB 3AY0A 4LMZA 3T1YF 6FD1A 3EU0A 4DUZJ 1CQMA 3T41A 1JLAB 2YVSA 1YDLA 3FNNA 4J9OA 1ZM4A 2XMJA 2HRUA 1SH0A 1VJWA 4NCGA 2BE9B 2L9DA 4OZ0A 4DV7J 3V6DA 2R7VA 3WIUA 2WVDA 4CH1A 1GXLA 2HHHJ 3EGNA 1I5OB 2XZWA 3DLKA 5D78A 2J8AA 1JLBB 4TN2A 3R2DJ 2G1DA 1FI4A 3K5PA 2VEUA 2F8EX 3RYLA 4NEZA 1DFDA 1KAKA 2WBMA 4DL3A 1SC6A 2IAJA 1CC7A 1G3OA 1T9TA 3D6HB 2D3OR 1AFIA 3D3CJ 5HLFA 4RWWA 3I82A 1GTEA 4USKA 2LVWA 2KH9A 1VQMS 3QBCA 4EWTA 4K4VA 4MAKA 1DJ0A 1JIHA 2DIVA 2QO3A 5GAEI 4IOBA 4EO6A 4F04B 4WU3A 2P6XA 5J2PB 1X4AA 1XC9A 3OFFA 5AXKA 1CJUA 1J5EJ 4ZLNA 2KHCA 2GX8A 2J0QD 1C4AA 1Y5NB 1T8EA 4QWDA 3ITHA 1XMQF 3L7PA 2FVPA 1B4SA 2M5YA 4CNYA 4K4YA 2HIYA 2QYGA 4ZPBA 3SV3A 4BWJA 1RAEB 1KONA 3CSKA 3KK1B 4ZPCA 1NRKA 1N36F 2HK3A 1WKKA 1HNZJ 4GKKF 3P3DA 1WDTA 4RNFA 3CD6S 4MIWA 3C16B 3D68A 2EFQA 2GP0A 5M2UA 4IYQA 2NXJA 1HWUA 2C2EA 4RW8B 3RZAA 3FGVA 3HT0A 1S1WB 2GHPA 3BQ2A 1UVNA 4OZ2A 3LWMA 2DRAA 2NZ4A 3HHLD 1F2GA 3HVTA 1VBYA 4ED6A 3W3SA 1F5CA 4O0IA 1S1VA 1RT6A 5JVHQ 2XLJA 1RCXB 1SUQB 4H34A 1N56A 3UE2A 2RF2B 3O5TB 3LP0A 1UJ4A 1TV6B 2B56A 3DYAB 1DTTA 2JRSA 3CM3A 1ITPA 3Q8SB 1PIEA 4NCBA 4DFPA 2BJ8A 3D0HE 3ISNC 4DCJB 1YGRA 2W24A 2XNQA 3Q89A 3K57A 5IQQA 4H4MB 2HQIA 2AF6A 1UZDA 4QWEA 2DIUA 1KVIA 1HARA 3BDEA 2G2YA 2X3GA 3PYZA 2CFVA 4YAAA 2D3UA 3MM7B 2GQ2A 5E3PA 2R8JA 1WACA 3W60A 1UKUA 4RUAA 4PWWA 1NSPA 3AJ1A 4YR8B 4ZIVA 4YDDB 2XCPA 5ETVA 5HMZA 2DY1A 2XPCA 3ZM3A 2J6SA 3PRBA 2WJPA 3P45B 3GIRA 1LQFA 2HY3A 2ZOFA 4NYZA 1MMDA 5BJRA 4N77A 2ROGA 2HBYB 5C42A 3A13A 1V6HA 2FHMA 4G65A 5KFOA 1GK8A 3LA0A 3DGPB 4XIUA 4MIBA 5BUGA 1IN0A 1W2IA 4P71A 1K1SA 4OLPA 5I6VA 2HFUA 4C8MA 4OX8A 2BDPA 3MAAA 1GTHA 3BQ1A 3PX0A 2KYZA 3TWZA 1NM2A 3R9LA 3NNCA 5DZ7A 4KKOA 2LQJA 2ZH1A 2EKNA 4ZPDA 1EETA 3BF4A 2YWHA 3TUIC 3TX0A 2AHSA 3AXKA 2W4CA 3IAS9 5DGBA 3VF0B 4IFVA 1PBAA 2DNGA 1U1LA 1S6QB 3PIPQ 4YB7A 3M1VA 1DHMA 3LQVA 3MD3A 1VQNS 2HCMA 4O44A 3K58A 2HWIA 1OEMX 2LMIA 2EFGA 4OQJA 2JFKA 3PW0A 3RGOA 2NYHA 2R7WA 2DR6A 5IT9U 3H2UB 1N33J 1O8BA 1Q8KA 4R5PB 4L73A 4ITSA 4U8YA 1Q5VA 1F1BB 3CCSS 4KYQA 2AGPA 3ZTQA 3GXGA 1KTQA 5C25A 3OTCA 1IUJA 3GJSB 2J9DE 4DPOA 4JOUA 2IRXA 4WFYA 2F40A 3CIMA 4U96A 1VHRA 1SI9A 3M6VA 2H9ZA 4F0MA 2J8SA 4DL4A 4F67A 1PC4A 2R2SA 3UAGA 3MM5B 4DS5A 1N88A 2O3DA 3DGVA 4AQYJ 2CQHA 4UOFA 2WAQD 2QMUB 1QSYA 2KVIA 4M94A 1ZAVA 5A8KA 4DSLA 4X65J 4PVGA 4USWA 2HQCA 3WDOA 3KOAA 4WPAA 1NCLA 3P5TL 4ED2A 1H2UX 4MYUA 3C6UB 4OYOA 3EUNA 3GONA 3PYDA 2VBZA 2EG1A 1YBUA 2XS7A 4ZRTA 4DN0A 4OX7A 4HR2A 3M9NB 3LWLA 3MR7A 2YKOA 4F26A 4CIOA 3SCLE 2B51A 4Z37A 3HZGA 1RWVB 2BX6A 3SIPB 3ZNUA 3OTOF 1HLWA 1NZAA 2ADBA 3HSZA 3W66A 3H20A 4NLGA 2W2NP 3CMQA 1C1BA 1KD1T 3V6DB 2DNLA 2VQFF 1IBMJ 2Y1RI 4DCOB 1S6PB 2QA1A 3DLKB 1XBWA 2XZTB 2E1MC 2ZBIA 3R7NB 1G7CB 3D5MA 3TARA 4Z7CA 2UUCF 1C4CA 1EX8A 1RT5A 2XSJB 2G0JA 3S4EA 1BC6A 1FKPA 3SXLA 2ZJPQ 5F8HA 1G4WR 4YR3A 2NZCA 3BO3A 3K0JA 4DJBA 1ZETA 2UXCF 1JKHA 2KFNA 1MMLA 8RUCA 1U0SA 1H7XA 2EW9A 2DCLA 2IA6A 5F0WA 1WEXA 4J9LA 1FHTA 1F9EB 1G1FA 5CCLA 1TKZA 5BR8F 1XNQJ 1JLQB 1GQEA 4CQ1A 1Q78A 3W9HA 4Y34A 1J4XA 3ITHB 3NOGA 4A8XA 1R0CB 1M5OC 4X4QA 4O3PA 4C8KA 3JSMB 3P5BP 5EX3A 1AT1B 2G2OA 4K2XA 4IO1A 4J7CA 5B7WA 4W4MA 1QAXA 1AYEA 2COLA 3VAHA 4OHHA 4EYHB 2UUTA 4C8YA 1MWYA 2B6AA 2XMMA 5IM0B 3PJ9A 4FDFA 2DGTA 3HMJG 3NMEA 2BMBA 2ZE2A 3R6LB 1R0BG 3AH6A 2BRKA 5KOWA 4PUOA 2UUBF 3TP2A 3PYGA 1S7HA 5H1SV 4Q45A 4DS4A 3NGUA 3QRRA 2YWKA 1BWVA 1YPTA 3IGVA 2GVDB 3K8VA 5KACA 2JSXA 1REVB 4USIA 2E1CA 2HVIA 3G96A 3H59A 1T02A 3NNHA 1IQZA 1VI7A 2H4KA 2F6YA 3HHDA 1KRPA 1VQ4S 3B4DA 2JZ5A 5ETPA 1SJFA 2CPHA 3TQEA 2OMLA 1X9WA 2CQDA 2QCJA 1HHSA 2HGLA 2HNDA 2QCTA 5GAEU 4MK8A 2OUDA 1WHVA 4UY85 4DMZA 3NXZA 2PEHA 4DF8A 1FT8A 1W78A 4DV6J 1H2VZ 4QR0A 2VBXA 1X9MA 2CVIA 1MN7A 4WK3A 4F36A 2FY1A 3J7YI 2B3OA 1HQUA 5JJBA 4LRAA 3V0GA 4EUVA 1U6ZA 2GHWA 5KABA 3GV8B 4NLPA 2WK4A 4MH8A 3UNYA 2CNIA 2P4DA 4LBHA 2VH7A 3QT6A 2GWOA 2XO6A 2ZDPA 4Y2IA 2JFGA 1MMNA 4HH0A 1RWOB 1GMWA 3EGZA 3E2EA 2Q05A 3W2VA 2JJ4D 1GXUA 3R5BA 3ZV2A 7FDRA 3AOBA 3UD4P 2RDDA 2DXDA 1U6FA 2EC0A 3BM8A 1I9TA 3G2XA 2ZKUA 4NNDA 4P7VA 4F2RA 3P6YC 3MAAB 1N32J 2H51B 4HACA 4FXDA 1PTTA 3DLEA 4LSZB 1J5OA 1RTIA 4HHJA 2LCWA 1NSKL 2EKYA 3AWFA 1EETB 1UW4A 2YWGA 3S8SA 1O5JA 2PA5A 1RU1A 1EP4A 2I42A 4OI3A 4P74A 3KUHA 1IKXA 2CA9A 3QCZA 4Q2MA 1RHJB 4NLSA 1XMBA 5CQGA 1YG0A 2FJBB 4CT8A 2DITA 4ELTA 4LSNB 1S1XB 2FQQB 1IJEB 2V50A 1JXLA 3OQ2A 2J17A 5EN1A 1YJTA 3TAPA 5IOLA 1TL5A 3M7VA 4O44B 2D1CA 1RUSA 3RGIA 1C0TB 1KOHA 3U02A 5MMZB 4IH7A 5LMUJ 4FYYB 1Y5LB 3EDQB 3IR7B 1KAVA 2GO9A 3AXMA 5KFZA 1SJ3P 3AD9C 1NK6A 1X4CA 1JF7A 1T9XA 3HLUA 1TU0B 4LQ3A 2CM2A 2W7OA 3Q86A 4DV2F 3MOZA 5BXIA 2DEJA 3AAWB 4DDFA 2VKRA 4DL0C 5C24B 4J5OA 2QLFB 1Q81T 2B4OA 3KG4A 3VAJA 2RE1A 2YY3A 2RIJA 1SKWA 4TNOA 1DLOB 1H72C 1JNRB 2WSEC 1N52B 3TW0A 2WOMA 5LL6d 2WB4A 1PAEX 4DR7J 2BKPA 1HWIA 5LM7E 2DY9A 1S7IA 3BYPA 4ZVRB 5HROA 2XWXA 2A2CA 2B7CB 1VQ6S 1TK5A 2I1YA 1DTQA 3W2WA 2BOAA 1T05A 1XWLA 1VRUA 1P15A 3FRYA 4HHUA 1EJ7L 5KADA 5E7OB 2UUOA 4AE5A 1ZCKA 1RT3A 3QT7A 2OIHA 3PW7A 3KJVA 4KRWA 2HQ3A 3JAMY 1D0EA 1IKYA 1NPRA 5CAAA 3J7AN 4I2PA 4RI4A 5H9EJ 1D9AA 4DG1B 1H6KX 2DNQA 3GG0A 2IPOB 2PC6A 4YQWA 2HS4A 4CNZA 3GYXB 4DV4J 1C1BB 4U7UD 4Q2LA 3CD5A 3F44A 1VGYA 2CQGA 1E6VA 1ZOTA 3NAHA 4LJMA 3PRVA 3KHGA 3GJTB 4AUKA 1U8WA 3V0DA 1CJTA 1M1HA 3OVSA 4ECVA 2CNFA 3UW1A 3D0GE 1NSAA 2Y0SD 4DI6A 1VC5A 1H38A 2I4GA 2QJ3A 1U0HB 3ZM6A 2AJ0A 5K9VA 2QIFA 1G1XA 3J81j 3ILOA 4JI0J 1CLFA 1GNKA 2CNOB 1QY7A 2VEWA 4OV1A 4BHQA 1RHUB 2CVEA 2NXEA 3EZZA 1B7FA 4K4XA 1JKHB 2OMOA 3QCBA 4KFBA 1KBRA 4PPZA 5IT0A 4RW4A 1V3SA 1GFYA 4HJQA 4DSFA 3FDSA 1FEHA 1TKZB 4ZLJA 2OPRA 3QCGA 4ZN3A 2EC2A 3G86A 3N5FA 2OSQA 4IG0B 1C85A 2PBNA 3Q8YA 2ZH8A 4WCEQ 2EFNA 2DHAA 3R1LA 1FXRA 1N5VA 5KAAA 2J7WA 3FVYA 2G0IA 5DLFA 2UVVA 3FZBA 2NS1B 4BWMA 5J1EA 2GCFA 2I0XA 1L5UA 2HFSA 4UW2A 3Q2SC 3NGKA 2W2MP 2IM2A 3HCXA 2VIHA 2FDNA 5CZVA 2HHPA 4YY3F 2ZE2B 1T11A 1Q6SA 4PUOB 2PI5A 2IM0A 5EHPA 1X9SA 4DZDA 4HL9A 1RAIB 3M05A 1ACMB 1HBOB 3BPDA 2DHGA 3J80U 3H90A 1ZZWA 5D15A 2DTJA 2ZM6F 5T7LA 3S3HA 2R2UA 1GMWD 1UVMA 1BUXA 4C4WA 4XK8C 4IRDA 3Q24A 4EFAC 1RLDA 5BYRA 4DQQA 4HHHA 3QCMA 4Q8EA 5K23A 2Z56B 2WW4A 2KN4A 1S77D 1Q5YA 1LFWA 3OXLA 4CO0A 2MXYA 2EG2A 1OJ4A 1KWMA 4I0WA 2L9NA 1HNIA 3JQKA 4P6QA 3BREA 3GPAA 5KFAA 4UQTA 1L3SA 2OTLS 5CZXA 2N3OA 3GG1A 4QAPA 3HSDA 1X4BA 4F3QA 5CD4A 2FJNA 3CJ8A 3MMBA 1XXVA 4RR5A 2XMAA 1JXEA 5AJ3F 1Y3JA 2IC3A 1VC0A 3K2YA 4NYPA 4ID5A 1HQUB 5IS2A 2N4CA 3LW5C 4S0MA 3PDNA 1UJ5A 3KLEB 5I4MA 3OJUA 2HB1A 1W26A 8ATCB 4FPRA 4ZJQA 2HBQB 4EGLA 3DM2A 1Y5IB 2W2PP 3RR7A 5D77A 4IOAQ 1C88A 3F81A 4I8NA 1QAJA 2V94A 3PNIA 1WKLA 3CJKB 2CZVC 5A2QU 4ANCA 2Y68A 1X0PA 2KJWA 5DG8A 4X4RA 4J90A 2DGVA 1S1TA 1X5SA 2NXUA 4K4TA 4IR9A 1GMUA 4OHZA 2AYBA 3DLEB 2FUG9 4J9SA 2NREA 3RTVA 1UPPA 3MR6A 3GFHA 1EQ0A 2C1EB 1NXIA 1MG7A 2E5HA 4UOHA 3MTKA 2VTEA 4RJVA 2BKOA 4ECSA 3IRXB 2XLIA 2WW8A 2ALZA 2PO4A 2XGQA 3ZM0A 1Q6NA 4ECTA 2ABYA 3N4WA 2KZZA 3GJQB 1NDCA 3LH2S 1VHIA 1G6BA 3CJSA 2JLGA 4WTOB 3I0RA 2GS8A 3SV4A 3GIKA 2FLPA 3BBCA 5AE3A 3I5CA 4Y2EA 2FLLA 5KOXA 2BABA 1FERA 4M95A 4WFXA 2OEMA 5DGAA 1FE0A 3DOLA 4C98A 2OPSB 2K2PA 4B9MA 2WVEA 2UXDJ 4TLQA 5I3PA 3W1YC 4PXDA 1TUGB 4H1OA 4PWUA 3L95X 1TUWA 1WJ9A 1IR1A 2CXEA 3NY0A 1S48A 5HI7A 1TFYA 3QPIA 2XNRA 5F8MA 3PYFA 3OL7A 1LWCB 3KMSA 3K59A 1JQGA 2G1HA 2WOMB 2MJUA 3D67A 2QGFB 2XB2D 1Z2LA 2KB2A 2QYCA 1EHWA 3F0NA 3CNQP 3ISZA 3QGPA 5HROB 3GIMA 2DHSA 2VFVA 1WHXA 3IMQJ 4TXSA 3DLJA 3VAGA 5FLXU 2MGZA 2MBCA 2ZH6A 1Q53A 3KLFB 5IZHA 1XJWB 3PCOB 2PDAA 2X3DA 1DTQB 2KDOA 1TL1B 1JLFA 2QEPA 5HL7Q 4HH1A 4ZIYA 3PJWA 4WOHA 2W9BB 4PWDB 4ZA1A 1NHUA 1PJ5A 2HNYB 1Q86T 2ACYA 4ANEA 1HMVA 3KJVB 4PABA 3MECA 5CHCB 3BKFA 3ZC4A 1IKYB 4JMKA 2ZD1A 1RP5A 4ED1A 3LPYA 3MVNA 3EICA 4FF1A 5L9NA 2HHWA 3AB4B 3HHKA 4CTAB 4V19J 3ZTRA 2VFUA 1FA0A 4ERCA 3S1TA 1K1QA 5A5FA 2CDQA 3GXHA 2QSFA 1M1GA 4FYXB 4N47A 3ILJA 1OPZA 2K7KA 4BUBA 1CJTB 3UO0A 2DGOA 2MY8A 3GV5B 2CJXB 4DSEA 3TA1A 2CM3A 4JV0A 1NJYA 2PD1A 4KV8A 2LLZA 3UN2A 4OYWA 4OHLA 4WKRA 2A6OA 4UZCA 3O4UA 2R42A 3KK3A 4YR0A 3M6UA 3FFIA 3VGTA 1YN9A 1U2FA 3EXYA 3K17A 1EEHA 2CDRB 3QCEA 1RTJA 3MM9A 4KFBB 3OLAA 3DI6B 2LXFA 1W7WA 2RQ4A 1HPZB 5I42A 2ADCA 2AX0A 4C3LA 2HMIB 1HBMB 2QBQA 4KT0C 3H5SA 1FNOA 1WNEA 1Y3KA 4ZDNA 4K50A 1K47A 1WC1A 3IM9A 1FXDA 3FMWA 4PG6A 4KGVB 1VIXA 3M32A 3IR5B 2V4RA 5J1EB 4X4VA 3M2RB 1RE1B 3J7ZT 2ZUAA 1BQNA 3PYEA 4KGKA 4RW9A 3SSSA 3W65A 3WIVA 4OZ3A 2HEKA 4QOTA 3CD7A 3EPGA 3MUTP 1T4JA 1GX5A 4OI6A 3U96A 5IC4B 4DR4J 1HI1A 1C1CB 5ITHA 2W9CA 2Q1LA 3DNCA 4MKAA 4ETZA 3MM6A 4X64J 3CULA 1GH8A 4YDXA 1N6QB 2AYEA 4RNHA 4LF6J 3KK2A 3NCRA 1UAGA 3M2VB 2RKIA 3R5GA 5KG2A 1VQSA 2NZ6A 4F4ZA 3EXCX 2PI4A 1CBKA 3Q8QB 1JLCA 2X1FA 3VQTA 2BJEA 3VALA 2XY5A 4H4KA 1OEUA 4X4NA 4KTQA 4LF4J 2F1FA 4EEYA 4I7FA 5ADZA 2HQDA 2M0GB 4LUBA 4ZI4A 1HQ2A 2BE7D 2DNOA 2IC3B 2F9JA 2VD3A 3G87A 3GIIA 2GC8A 3LANA 2HLTA 2KKHA 1L8GA 2GFFA 1B3TA 2QFJA 4GS0A 5A8RA 4KH1B 1PYOB 3CE8A 1ZH5A 4ZP9A 1XN9A 4OYPA 2IYIA 1S0OA 3DM2B 3HFVA 1S9GA 1IKWB 4I2QB 1BGXT 5J1PA 4U7CA 4RU2A 1EENA 2M2BA 3NBPB 1TKTB 4QBEA 3RG6A 1HWLA 3CJ5A 2QBPA 1M5SA 2LEPA 1ZAXA 5KA2A 4PZVA 5F8IA 1S4EA 4EYIB 2YX7A 2HC1A 2FYXA 4QR1A 3I7ZA 4HVZA 1VBXA 3OL8A 1NPPA 4W90B 2LEBA 3B82A 2QLWA 1X4FA 1FRXA 1NZ8A 3PM9A 1B64A 2DHXA 4TU8A 2VC1A 4J9VA 3BBBA 2CQCA 4QIVA 4DUYF 4O4GA 4NWBA 1U7LA 4D3QA 5HJXA 4B3TJ 2B9XA 3KUGA 4B04A 3GCWP 2J0SD 3C15A 3LTOA 4AT1B 3CXCR 5KFWA 2PT0A 4ILRA 1YIJS 4LVOP 3G4SS 3HULA 2W9AA 2UVUA 2EFOA 2ZDOA 1WC4A 2YWEA 1EAYC 3LJ8A 3KG0A 3I0RB 4RKKA 1VIOA 2QMXA 4X4PA 3OV7A 4BC7A 5J2QA 3QCLA 4J9RA 2EPIA 1X5OA 2BANA 1RYRA 1RAOA 2CQBA 5GADI 2YX1A 2JEJA 3MPDA 3DOLB 1HNWF 2IBKA 1S0NA 3G8TA 3NS7B 2XULA 2OH2A 2MQ8A 3MR5A 3N5BA 3QZ8A 1HL6A 3MAQA 3KWMA 3JYTA 4HTJA 5L38A 3JTPA 1YHQS 1XXPA 2RB7A 1O6XA 5ETKA 3HPOA 1RJJA 4I69A 2K8GA 3QCIA 4ELVA 1SKUB 3JQMA 4NMLA 2V9WA 3M4UA 1ICEB 4CVMA 5KA4A 1RWUA 1D3WA 2JVOA 2DXEA 4PR6A 3D9CA 3PG9A 1KLMA 3C14A 2LP4A 4U8VA 1O51A 2XHCA 3RB3A 1R0AB 2RS8A 4UUXA 4TQSA 2OAUA 1QE1A 5IFMA 3VZHA 3LUYA 2GAGC 4J9MA 2KFYA 3CPWR 2HWHA 3ETOA 4JBCA 1JLFB 2D7SA 9ATCB 5HVFA 4WFBQ 2GCAA 2QZ8A 4IKAA 3SSQA 4DV0F 2R7UA 1IR2A 2HNPA 2UZAA 3S3EA 4KO0A 3W61A 3RBEA 3MWBA 2ZD1B 3UFCX 3VGVA 1FJEB 3OSNA 2E5LJ 4DN9A 2VJVA 5HP1A 4QCLA 4YFUA 2ZH3A 2VPWB 2OPPA 2P9EA 3BGRA 3L9ZA 4OV6A 3KLGA 1N0VC 1SL2A 2AJ1A 1U1RA 4G6VB 2QX0A 2CNNB 3H0PA 5D8HB 3I0SB 2J6UA 2I5JA 2P9GA 1XEZA 1H3DA 2C2OB 2KT2A 2ZJQQ 2QFIA 1EIYB 3BBFA 3JXOA 4JV1A 4IO9Q 3GJRB 2VFRA 1VMBA 4JNBA 1RT1B 2F9DA 1IVZA 2E5JA 5KFUA 3CCZA 4LFCF 2N82B 5D4PA 1EQMA 3V0FA 1ONZA 1NJWA 5IWAF 2H65B 4F02A 1KKHA 4ED8A 5IV4A 2R9LA 5DM7Q 4ZVQB 1DZ5A 3KUEA 3SSRA 4B3MJ 3SMZA 5AXNA 2BJ7A 1E6YA 2HGNA 4G1PA 1C86A 1RT7A 4TKTA 1RTJB 2G6ZA 3MM9B 3FCVA 5F8GA 2VUGA 2HRYA 3FBCA 2B8PA 1S6OA 4OZ1A 4GKJF 2F3JA 1YWFA 3OXFA 1ZPWX 2OFGX 2HHVA 5KFYA 1R89A 3PVXA 2M4MA 3NP5A 1U25A 2VEXA 4ZVHA 2AU0A 2UXBF 5D0HA 3MFIA 4RW6A 4MK9A 3N2AA 1FD8A 2VBWA 3G9CA 4DX7A 2JEIA 3IS9A 2YPZA 4CH7A 2XEXA 3HO1A 4QYZJ 3M32B 1VFJA 4GC7A 4L6V3 2HQGA 2VOPA 4DL5A 4ECZA 2MHEA 2W4PA 1BQNB 4RW9B 5IQ6A 1W25A 1FPZA 3IAM9 3NS6A 5JUMA 4F8RA 2CQIA 2V8DA 3KYLA 3CMES 2YH1A 3Q8PB 3R7BB 1NK9A 2NQPA 2XJAA 3I32A 4YEAA 4PRFA 3WC2A 1Y4ZB 3HSJA 4TU9A 1MWQA 4DU8A 3NMAA 1U1MA 4GFUA 3MM6B 4Y6IA 2Z8QA 2KVQE 3LPEA 3DDIA 3BYRA 1I94F 3J81U 3H4BA 3NMRA 4DQPA 3KK2B 1EKRA 1IBKF 3SQGA 2RKIB 2ACMA 2RQCA 1KP6A 2Q47A 4WP9A 3NRSA 4WE1B 4DUYJ 2R8GA 3QCNA 5BYQA 1HBNB 1Y0HA 2ZZMA 1X60A 5HQMA 3THTA 2F6ZA 2OKQA 3ZMPA 2P6SA 1R7IA 2DGUA 4MKBA 2QMWA 3C6TB 2QN6B 2JOQA 2I4HA 1X24A 4OYMA 3ZTPA 1TUVA 1OPIA 1RPMA 2CQ2A 1TVRA 2DK2A 2Y0BB 4TYAA 4J9UE 2QA4S 1X4GA 4K7QA 2Z2ZA 2Y1JA 5EWGA 1WD6A 3IG1A 5A8RB 1HNWJ 3LAMA 6FDRA 2EVZA 3PHEA 2WZ1A 4QYRA 3TA0A 6AT1B 3D6TB 5K22A 3PS5A 1RAAB 3KLIB 4QPXA 2VHGA 4B9TA 3C3LA 5KT6A 4W92B 3V0IA 2OO4A 2R3VA 3G6ES 3AA8A 1OSCA 4K0KF 1L3KA 4LF8F 2RAQA 4JI1J 1X4DA 1N54B 2M3DA 1OY6A 4IFYA 2BE2A 1GFWB 2W7PA 1FKOA 4C3KA 1H73A 2Z4PA 3MM8B 4LRDA 2AGOA 3DRRB 3KLVA 2EK6A 4ZCMA 3ADAC 4OHIA 2CMBA 2NCKL 2W25A 2VASA 2N7CA 3TR5A 2N4DA 2XG8A 4Q0BA 2L9WA 4NZ7A 5AXLA 3I4PA 1T03B 4EI2A 2KRRA 1NWLA 1BQMA 1UPMB 5B0BA 3BQ0A 2MSTA 2MKJA 3FEZA 4GE2A 1FVQA 3CCES 2R8IA 1DBDA 1WDDA 5A8WB 2ASJA 2FZKB 2N3LA 3BO2A 9RUBA 1AA1B 5EHRA 4AL6A 4E2FB 2KJVA 3IP0A 3QFWA 1B0TA 2MQPA 3S3FA 4CO4A 3OFGA 5ETQA 4TU7A 5EUHA 1AXQA 1FPRA 4I4BA 5HAOA 4RO0A 2E1PA 5LXYA 4P2FA 4L76A 2ZNZA 4I67A 2V2VA 1CJVA 3H2VE 1HIYA 4Y2AA 1HNVA 1L3UA 1JNZB 1LWEA 2CQ3A 2DD8S 3UD3P 1YJNS 3QT8A 4HI1A 3ZFVA 3NNAA 2J7KA 4GRSA 2VEYA 2O66A 3BGOP 4FXVA 3DRSA 3D1QA 1LKZA 4UQGA 3W64A 4ZIWA 1VQ8S 3QCFA 4LFCJ 3EYZA 3C14B 5HMWA 4RI5A 3O3LA 1SL0A 1RAGB 2BQUA 2NV5A 1VQ9S 3QO9A 5IWAJ 4PEOA 5DJBA 4DPUA 3OFEA 1Q82T 1HI0P 4RLEA 1OESA 4WFZA 1QVFR 1QE1B 2YQ3A 2D41A 2OC3A 1UZHA 3BB5A 2I1RA 3IXQA 2OUGA 5A0YB 4KAIA 1WOPA 2B43A 3BKUA 3QIPA 4R0EA 4X66F 3QJPA 4FBUA 3R7SB 2HXPA 4C13A 4HI2A 2FHJD 5ETTA 3VQSA 2CJBA 4ES1A 2JVRA 2MKIA 3MR3A 3BV8A 1F5BA 5K5MA 2WVFA 3A3OB 2E7WA 2G59A 4KO0B 2ZN7A 2YNIB 1FWKA 1WC6A 1RT2A 4OJ3A 4OZJA 2ZMMA 2UXBJ 5HK4A 2BJ3A 4AD6A 2MDAA 2OPPB 3BGRB 3EZ5A 5GADU 3SFUA 2VG5A 1NHKL 4DX5A 3EJMA 2BQRA 3DRPA 1GX6A 2GCBA 2CNKB 1OY9A 4C2MA 3QAUA 3R5DA 3G6XA 2E9TA 1N5YA 3ENQA 3MEGA 3PEJA 1LXNA 2RDJA 4WFNQ 2LU2A 2QE5A 4A8KA 2QDPA 4TVVA 5CD4H 4GVBA 2AD9A 5HATA 3VGUA 4QZVB 3FEYB 2E7VA 3HN7A 2QEXS 1RKJA 2I6MA 5CYJA 4NA2A 1XM2A 5C5JA 2FGOA 1S99A 3F73A 1S1UB 2PMWA 2ILYA 4A47A 1VLYA 2OLWA 4CZCA 2BW7A 3GILA 3EPIA 4C7QA 1RWXB 4DR6J 4FXWA 3CF5Q 2JNJA 1M0SA 1QTNB 1Q16B 2DH8A 3VAIA 4Y2KA 3MMCA 1FFGB 2YNFB 2WCXA 2Y9HA 2HC2A 2EXUA 1SC1B 4DWIA 2GAHC 2MKYA 4CWBA 2F6WA 3NGTA 3TAQA 2X5OA 3TAMA 2CJKA 4DXLA 3UVJB 4M5LA 5GAHU 3HT3A 1QUPA 2DB1A 2P6TA 5F8JA 2H1YA 1S10A 1RWPB 2D3O1 1UP1A 5F8NA 5HVHA 3OTBA 5B08A 3CIZA 4RBTA 4RBUA 1RDRA 2HFNA 2IRYA 4O3SA 3T9NA 2ZBRA 3U27A 2CJAA 5T41A 1OHDA 1N5SA 1BXNA 1T9UA 2MZRA 2VU5A 2IBOA 4D3GA 5CYMA 5HQLA 3US5A 1HW9A 1BZCA 4D3HA 3OTEA 1DQAA 2HFVA 1SIWB 3JAMU 3TI0A 1JLGA 1QAYA 3ZZRA 2C3OA 1YTYA 2DPJA 1ONYA 4RH5A 4QBUA 2ZH5A 1HQEB 2YKNA 1HD0A 2LQ5A 4KBIA 5CABA 4NXMJ 5JMNA 2GQCA 2V69A 1ZM9A 3SQGB 4KI9A 3L4BC 3S6EA 2CKWA 1J2VA 3I4HX 4OMFG 1AUDA 3PZPA 3U7JA 4LREA 5KT5A 4JYAF 1YFOA 5IC6B 4NZ6A 2MJNA 1QZ0A 5AWXA 3UCGA 1D09B 3VTIA 1Q7LB 4JV2A 2YKAA 1RWKB 4TVAB 3OR1A 1XIQA 4LF5J 4TY8B 2RHSB 4RU9A 1TK8A 3N6LA 1H0HB 3Q0AA 3BSNA 3G82B 1TL7A 1SC3B 5K9FA 5DLGA 2UUPA 1TVRB 2W2QP 1Q4RA 1NH8A 4M5DB 3D0IE 1FNMA 4LFBF 1XQIA 3HDSA 2VA2A 1T49A 3LP1A 1UA0A 2V8GA 4O4RA 2CJYB 2CM7A 2BYCA 4QJVA 2J5AA 3KJQB 2DHHA 4HDGA 2UAGA 4QF5A 4NA3A 3T1AA 2Y67A 1PXHA 2YNGB 3WZ0A 3GYNA 3THVA 2FPHX 2NLWA 3D2WA 2OEJA 2HK2A 3HM9A 1OYEA 1HBUB 4IFYB 4I6YA 2Y2FA 1UMJA 4GO5X 1WG4A 1UJ6A 1UWBA 4ED7A 1KVKA 1NK0A 1TMMA 1HHTP 1NKEA 4IG3A 3ZTSA 3TO8A 2XMUA 4KHPF 2XYGB 3HHNB 3FBFA 4ATNA 2V68A 1G7FA 5EX0A 3GFXA 4DFMA 3ZNJ1 4Q5VA 1RA6A 4X4OA 3N28A 4JI5J 4PQUA 1RKIA 3PACA 3SCJE 2BJ1A 2AMCB 2HVDA 5LSRA 4IKCA 3RB4A 4EBCA 1JWWA 5F3TA 1PGZA 5KA0A 3NWRA 2C46A 3F41A 3RU0A 5KG4A 1YRTA 1HKAA 5KA3A 5KFCA 1T3NA 3MMAA 2XHWA 4P2SA 4DV1F 3GLJA 3FBEA 4NWGA 5KFQA 2HG4A 2DVIA 2R7RA 2E1AA 2J9DA 3TUZC 1CJVB 3RW7A 4MT1A 4EK2A 4MFBB 2ROEA 3GMGA 4DCPB 2XGPA 2ZHAA 4ZJLA 5AE1A 1H7WA 3CWJA 3EVMA 5KTQA 3ET6B 4LSLB 1WEYA 3DRSB 1PA9A 3P8BB 1ZS6A 3TANA 3CDWA 3DOMA 3U1MA 2QL9B 4RKUC 5I3UB 2HS3A 1JJ4A 3MGJA 4LF7F 4OJHA 3MHYA 2F6TA 3G6VA 4N5SA 4ED4A 2FLOA 3PW2A 4JI3J 4C97A 2XLKA 4P72A 1M90T 4UAGA 3LALA 1R6VA 4YS2A 2VQEF 1UETA 3R1HA 2FHOB 1MROA 3C2PA 4OX6A 3BH7B 4CO5A 5K14A 4DLEA 3PRDA 2HWTA 3HHLC 2AYMA 3QIPB 2YH0A 3ILLA 2VL1A 4BDPA 2W4DA 1CJKA 2YNHA 3PV8A 1MU2B 2Y96A 2ZEJA 1PKUA 3TEHB 4HJPA 1UVKA 5CA5A 3M2UA 1VQYA 4FKYA 4IDKB 3HHEA 2ZZNA 1RT2B 3SFGA 4LFAF 2FVSA 1Q95G 4I64A 3MD1A 5K25A 4PXEA 2YWWA 5KFDA 1RAHB 1VQKS 2U1AA 1Z2ZA 2AJ2A 5HVGA 4C6AA 1Q6PA 4M5MA 2FZGB 4X62F 3POTA 1WWHA 3MEGB 5M2PA 1S97A 4QWCA 4OZLA 3DXSX 5HBMB 1VJQA 1YZ7A 3W63A 1NAQA 1W2BR 2ZKTA 4GVBB 3A12A 4OHWA 5G0RA 2WONB 1FDDA 1RQ0A 1RHMB 1F2HA 1NBEB 3RUBL 4G1IA 1RHQB 2XI2A 4ZLPA 3D28A 4HTIA 4G3IA 5KFXA 3QCKA 2QRRA 3HHLB 2N7YA 4LF9F 1FRKA 2Q3PA 4TLRA 2NLKA 1SV5B 1LQ9A 3MMCB 3O8WA 3TVYA 3KHRA 1GQYA 1FDNA 4X4UA 1IM6A 2XBPA 5ETNA 1ZAWA 4C8OA 1NZ7A 1IM4A 5L1LA 4HT5A 3E3XA 2L48A 1P9QC 3QIDA 3BEGB 1K73T 3TYTA 2BA9A 1NK5A 1LK5A 4RW7A 4GVLA 2ASDA 2XY6A 4LFBJ 3IBWA 3HVAA 1D1UA 1Y7PA 3MEDA 2V9KA 3KLHA 3V4IB 1TKDA 3OT9A 2QBRA 3E01A 4DR3F 4JI7F 1KQGB 4ZN1A 1QJHA 1TKXA 4MMOA 4DR1F 3BRHA 3H2LA 5CYMB 2XO7A 3TJ9A 1C2PA 1BE4A 1DAXA 2Q79A 5AE2A 3RZ2A 2I6WA 4CLYA 5L9XA 1FDAA 5C2GA 2VA3A 1VQPS 4Q43A 3OVBA 1FX2A 1CS4B 1FJ7A 2F71A 5IBSA 3T1YJ 4H4OA 2F00A 2KL8A 3ZZ0A 3CJ2A 2B4PA 2RH3A 1FWPA 3F9BA 1C0UA 4CYUB 3S7RA 2IY5B 3GSDA 5J1NA 3T5JA 2MKKA 4CO3A 1WELA 2FJDB 4G1QA 2BZ2A 5KG6A 1MW7A 2J9EA 2WGPA 5H9FK 4KR0B 2KG1A 4USVA 2BV5A 5FIIA 2SHPA 2C42A 1QSSA 3W7BA 5LMNF 3NGDA 4OHYA 1NB2A 2PFDA 1NMEB 4F7VA 4A8QA 1MSWD 1CQNA 5CYQA 1P1LA 1FO1A 3IBFB 4DV1J 3TEGA 3CCMS 1V9OA 4X2BA 5ETRA 2B7BB 4P9SA 2PE8A 4DUTA 4CLZA 2B5JA 2X1AA 4DSIA 5LSOA 1TAUA 5KFEA 3MEEB 4ZVPB 2V0NA 2ZHBA 3Q8VA 2B4SA 2KU7A 2C2KB 3OR2A 1U1PA 1X4HA 1UWBB 4CLWA 3AOCA 4DQRA 3M6WA 3UWTA 2HLUA 4B3OA 4DSJA 4DPXA 1LWFA 2A2DA 3CCWA 4NLWA 4LQ9A 1XMQJ 1A0OB 2QLBB 1X0FA 2I5XA 3PX6A 3DDKA 2HHQA 3KFWX 3CGIA 5MLCV 3QCHA 3Q8RB 3CO9A 3PFOA 2VQEJ 4NYHA 1N36J 2F7VA 3BSAA 4OYZA 2YKPA 1AAXA 4NCGB 4GKKJ 4NLOA 2QLXA 3MDFA 4ENOA 5MAOA 5A76A 4PQUB 3JTOA 4ZKAA 2P9CA 3M9OB 4WZQA 1S4FA 2AEFA 3PXGa 5KFRA 2RQKA 2DO4A 3ZTOA 2E5GA 2XYHB 4ZVUB 3TVZA 3ZM5A 3MOJB 4QUNA 3IC1A 4LR8A 4WJBA 2CMAA 2IAJB 1MNEA 4HT7A 3GP9A 1NJZA 2PQ5A 1XNRF 4XDCA 5B0AA 3UD5A 4DPTA 4KH0B 1QVGR 5HLFB 3JTNA 1N34F 3BLUA 3M8PA 2BR0A 4X62J 3CB4A 4Q44A 2H3EB 1CJUB 4X4TA 3GFZA 1IKVA 2MKHA 3EX7B 3ZL8A
chains in the Genus database with same CATH topology
2DNPA 3J80Y 1DFDA 1KAKA 1M5KC 2I6IA 3GE9A 2DNOA 2WBMA 2IC3B 3RBDA 4DL3A 1SC6A 2IAJA 1YGUA 2F9JA 4GE5A 1CC7A 2VD3A 1R8PA 1N6QA 1G3OA 1A5YA 3GIIA 1IBLF 1S79A 2WBRA 5BX1A 2GC8A 2DXPA 3QWUA 1Q7YT 3LANA 4C8ZA 4ZP8A 1VQ5S 2D3OR 2HLTA 1AFIA 3RRGA 4YP3A 2KKHA 2FIUA 3M2VA 4DQIA 2F4VF 1L8GA 2GFFA 2XMVA 2QFJA 5HLFA 4GS0A 5A8RA 4RWWA 3I82A 2AW0A 1OQ3A 2VONA 1GTEA 3MTJA 3CE8A 1ZH5A 2LVWA 2KH9A 1VQMS 4ZP9A 4FBTA 1OEVA 2CFXA 1XN9A 4EWTA 4NCAA 4K4VA 4MAKA 1DJ0A 2IYIA 2V8VA 4O4GB 1MROB 4ECXA 1JIHA 2EFPA 1S0OA 2DIVA 1OS5A 2QO3A 3ICLA 4IOBA 5K14B 4EO6A 5GAEI 1UA1A 1NH7A 1WG5A 1R8BA 5GTJA 2IA0A 3DM2B 2F70A 4WU3A 4USHA 2P6XA 4PG5A 2KG0A 3V0JA 2POKA 2MQMA 1K8AT 1KNZA 5J2PB 1X4AA 1S9GA 1XC9A 1IKWB 3OFFA 5AXKA 4ILMA 1JLBA 2WHOA 4I2QB 2HVZA 2QA4G 1BGXT 5J1PA 4U7CA 4RU2A 2YNHB 1EENA 2M2BA 3NBPB 3HI9A 1TKTB 3UCZP 4QBEA 1HWLA 2KHCA 3CJ5A 4OI2A 1M5SA 1G2EA 1OHCA 2LEPA 2GX8A 1T48A 5KT3A 3G6YA 2P5VA 1ZAXA 2J0QD 5KA2A 2FLNA 1C4AA 1Y5NB 3DRXA 2LYVA 1T8EA 1KTVA 2J0XA 3ITHA 5F8IA 2LQ9A 4QWDA 1WHWA 4F50A 4EYIB 1XMQF 3H5UA 3L7PA 2YKMA 2YX7A 1JK9B 2FVPA 1BD6A 4FYDA 2HC1A 4QR1A 3I7ZA 4HVZA 4B9NA 4OIXA 1VBXA 5B0FA 2M5YA 4CNYA 4K4YA 2I6JA 3OL8A 4ZPBA 3SV3A 4W90B 4BWJA 4NRUA 4DX8H 3HVTB 2KFZA 2LEBA 3B82A 5DG9A 3IN5A 1KONA 3CSKA 2QLWA 5J2QB 1X4FA 4ZPCA 3KK1B 2CMCA 1FRXA 3BS9A 4CO2A 3PM9A 1B64A 1NRKA 5AXMA 2BANB 2DHXA 4TU8A 2AQ4A 2PMZD 1N36F 1S1VB 1RT6B 2VC1A 2CQCA 4NLYA 1VQLS 2M7SA 3PR5B 4QIVA 4DUYF 4FF2A 4O4GA 4GKKF 3P3DA 3PIOQ 4NWBA 1U7LA 5L39A 3I9V9 4RNFA 3CD6S 4D3QA 4FF4A 4MJKA 4YUDA 1ZZNA 4MIWA 3LP0B 2B9XA 3EZUA 3AQOA 5LXQB 4B04A 3NS5A 2J0SD 2FJVA 4ICLA 3KTQA 5J2PA 3CXCR 1IKWA 1DTTB 2BUNA 2EFQA 5KFGA 5KFWA 2FH7A 2GP0A 2PT0A 4I2QA 4ILRA 5M2UA 1O0PA 3POTB 3BJYA 3M8RA 1VC6A 2DR5A 1ZBTA 4FN5A 3OLBA 3JYTB 4DR4F 1K0VA 4IYQA 3NBPA 3C46A 1TKTA 2DNRA 1YIJS 1U2RA 4LVOP 3DHXA 3G4SS 1PYNA 5M43A 1RAJA 2Q66A 1WAXA 2W9AA 2V2KA 1HWUA 2NYIA 1UAWA 2C2EA 2KTQA 4RW8B 3RZAA 2DGSA 2UVUA 2EFOA 1RA7A 2DGQA 1S1WB 2ZDOA 2YWEA 3AA9A 2GV1A 3FGVA 3GFYA 2GHPA 3BQ2A 1UVNA 4X64F 3LJ8A 3KG0A 1CSJA 4QBWA 3LWMA 2DRAA 2J7UA 1M5PC 2NZ4A 3RAQA 3HHLD 3I0RB 4RKKA 1VIOA 1APSA 1F2GA 4Y28C 5G0RB 2DISA 3HVTA 3TQ1A 2RRBA 2QMXA 2HW3A 1VBYA 4X4PA 4ED6A 4PG4A 4BC7A 1R6YA 3OV7A 5J2QA 4QIGA 1F5CA 4O0IA 3KK1A 4LF6F 3QCLA 2GMLA 3A5KA 4J9RA 2EPIA 1X5OA 2BANA 4YB5A 1KLMB 3IWXA 1RYRA 1S1VA 2CQBA 1RT6A 3IO1A 5JVHQ 1S72S 1FNXH 4XDDA 5GADI 2XLJA 1SUQB 1SB6A 2YX1A 2JEJA 4FZVA 3CC7S 3QJJA 3V6JA 3VCDA 2A8BA 4H34A 4R0JA 3DOLB 1N56A 4ED5A 1HNWF 4DV7F 3UE2A 4OHXA 2RF2B 1PTYA 3O5TB 4KQZA 3LP0A 1UJ4A 2BGEA 2IBKA 4QU7A 1S0NA 1TV6B 3G8TA 2B56A 2XULA 3DYAB 2OH2A 5E3QA 2OJ3A 3UI3A 1DTTA 3MR5A