2B4OA

Structure of the r258k mutant of selenomonas ruminantium ptp-like phytase
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
313
structure length
313
Chain Sequence
TVTEPVGSYARAERPQDFEGFVWRLDNDGKEALPRNFRTSADALRAPEKKFHLDAAYVPSREGMDALHISGSSAFTPAQLKNVAAKLREKTAGPIYDVDLRQESHGYLDGIPVSWYGERDWANLGKSQHEALADERHRLHAALHKTVYIAPLGKHKLPEGGEVRRVQKVQTEQEVAEAAGMRYFRIAATDHVWPTPENIDRFLAFYRTLPQDAWLHFHCEAGVGKTTAFMVMTDMLKNPSVSLKDILYRQHEIGGFYYGEFPIKTKDKDSWKTKYYREKIVMIEQFYRYVQENRADGYQTPWSVWLKSHPAKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Kinetic and structural analysis of a bacterial protein tyrosine phosphatase-like myo-inositol polyphosphatase.
pubmed doi rcsb
source organism Selenomonas ruminantium
molecule tags Hydrolase
molecule keywords myo-inositol hexaphosphate phosphohydrolase
total genus 104
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 3.1.3.72: 5-phytase.
pdb deposition date 2005-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14566 PTPlike_phytase Inositol hexakisphosphate
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1690 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2b4oA01
3.90.190.10 Alpha Beta Alpha-Beta Complex Protein-Tyrosine Phosphatase; Chain A Protein tyrosine phosphatase superfamily 2b4oA02
3CM3A 1G7FA 1PH0A 3M4UA 3F81A 4NWGA 3QCGA 3V0DA 5K9WA 1LYVA 5KABA 2PQ5A 2CNEA 4H1OA 5AWXA 2CMCA 3SR9A 2G6ZA 1EENA 3GXHA 2Y96A 2CMBA 3RGOA 4RDDA 1ZC0A 1GFYA 3F41A 3EAXA 4GFUA 3QCHA 2J16B 2I4GA 1L8KA 3D9CA 1G1FA 4DGXA 2BGDA 3F9BA 5K25A 4AZ1A 1WRMA 2E0TA 5EHPA 1PTVA 1G7GA 2VEYA 3ZMQA 5BZZA 2H02A 5MMZB 1NO6A 3D44A 2I75A 3S3KA 4OHIA 1I9TA 3MMJA 3AWGA 2F46A 3V0JA 1YTNA 2I6MA 2I4HA 1LQFA 1QZ0A 1D5RA 2JJDA 4NYHA 1OHDA 2FJMA 2VEVA 1C87A 1OEOX 2A3KA 2NV5A 3ZM3A 2QDMA 4OHLA 2CMAA 1YTSA 2CNFA 4OHHA 4YR8B 1ONYA 2R0BA 2Q05A 3ZM2A 2PBNA 4I8NA 1P15A 2I6IA 4WU3A 1XRIA 2HNQA 3QCBA 4Y2EA 2CM2A 1VHRA 3O4SA 1T49A 5KA4A 1PTUA 5GTJA 5J8RA 3B7OA 1FPRA 1PXHA 2F70A 2ZN7A 1NZ7A 1LARA 3EMUA 1RPMA 2B3OA 2B07A 1NL9A 3EU0A 5K9VA 1Q6SA 3NMEA 3EB1A 1T4JA 2CM7A 1PTYA 3N0AA 5K22A 4NNDA 2Y2FA 1X24A 2BV5A 2CFVA 2B4PA 4QAPA 4Z6BA 3D1OA 2ESBA 2F6TA 4RI4A 2PSZA 2WGPA 3LJ8A 2CNGA 1Q6TA 1OEMX 1XBOA 3D1QA 2NZ6A 3GXGA 1YN9A 2P4DA 1OETA 1PA9A 3QCEA 3RO1A 1YFOA 2H03A 3AWFA 3BLUA 4RH5A 3OLRA 4GE5A 2PT0A 1ONZA 1PA1A 1OHEA 4PVGA 3S4EA 4GS0A 4ZN5A 3O3LA 1RXDA 2HNPA 3EZZA 3ZV2A 2RF6A 1OEVA 2HC2A 2C7SA 1Q6PA 2I42A 4ZI4A 5M43A 3D1HA 3QCKA 2QBRA 4WU2A 1BZHA 5I6VA 1V3AA 4GRYA 4B04A 3I36A 3ZM1A 4QUNA 4OHEA 3QCIA 3ZM0A 2H04A 1ECVA 1YTWA 4GRZA 1L8GA 2CM3A 1JLNA 1I57A 3RZ2A 2BGEA 4PYHA 2H4GA 3A5KA 1XXPA 2J17A 4QAHA 5EHRA 3RGQA 2C46A 2I5XA 5KA1A 2P6XA 1I9SA 2IMGA 3OMHA 3QKQA 2HC1A 2F6ZA 4RHGA 2SHPA 5KA9A 3ZMPA 2AZRA 4D3QA 2CM8A 2I6PA 1C83A 1YGUA 2QCJA 3S3EA 3QKPA 4QUMA 4OHDA 5LXQB 4BJOA 2QDCA 4HJPA 3V0EA 2YDUA 3F9AA 1BZJA 1Q6NA 2M3VA 3F99A 4JMKA 3U96A 3V0FA 5KAAA 1FQ1A 1Q1MA 4RH9A 2QCTA 1M3GA 1OESA 4GE2A 4YAAA 5KA7A 2F6VA 4RKKA 1G4WR 2QBQA 3I80A 4JMJA 5K24A 2I1YA 2A8BA 2ZMMA 2GP0A 2QEPA 1U26A 1NNYA 2HVLA 5BX1A 1KAVA 2B4UA 2QBSA 2VEWA 2I3RA 5KA3A 5IBSA 1YZ4A 1YGRA 2CNHA 1EEOA 3BRHA 3SMEA 2CNIA 2I6JA 1ZCLA 3D42A 2NT2A 2I4EA 2OZ5A 3CWEA 2GJTA 2CJZA 2HCMA 1AAXA 3S3HA 3BM8A 4D3RA 1C86A 3QCFA 1C84A 2I6OA 2GWOA 4GE6A 5KA8A 3MOWA 4GFVA 2AHSA 3O5XA 1Q6JA 4RI5A 1ZZWA 3PS5A 5BZXA 3A5JA 4JBCA 2DXPA 2F6FA 4WOHA 5KACA 2MBCA 2H4VA 1Q6MA 3MOZA 2BZLA 4KYRA 3QCCA 2OC3A 2PA5A 1PYNA 2B4SA 4GWFA 4WTYA 4R0SA 2F71A 1G1GA 2F6YA 3O4UA 1C85A 2PI7A 3S4OA 3I7ZA 1BZCA 4IKCA 1PTTA 4H34A 4S0GA 1G1HA 2J16A 3QCMA 1U24A 5BUGA 4R30A 2QBPA 3QCLA 2HXPA 5K23A 1WCHA 4R0TA 3S3FA 1T48A 2I3UA 4DGPA 2HY3A 2Q47A 3V0IA 1J4XA 4ZRTA 1JF7A 4JNBA 1OEUA 3O4TA 1WAXA 4HRFA 1SUGA 1NWLA 1YWFA 1XM2A 1A5YA 2OUDA 2NLKA 5IBMA 1FPZA 4D3PA 2B4OA 2HB1A 2NTAA 4QBEA 1U25A 1ZCKA 1YPTA 1GWZA 4QBWA 4BPCA 2FJNA 1G4US 1XXVA 5HDEA 3AWEA 2B49A 5KA0A 1QXKA 4TVVA 3V0HA 1C88A 2VEXA 4Y14A 3V0GA 2H4KA 1R6HA 4NWFA 2NT7A 4NX8A 5KA2A 5KADA 4ICZA 2OOQA 3QCNA 2VEUA 4KYQA 2G59A 4KI9A 2BIJA 2F6WA 1KAKA 1NWEA 4J51A 2QDPA 3QCDA 2FH7A 4MBBA 4ERCA 1MKPA 1OHCA 3QCJA 3H2XA 3BLTA 4HJQA
chains in the Genus database with same CATH superfamily
3CM3A 4DZ6A 1JJCB 2ASYA 4CM0A 2LQ9A 1UMJA 3NS7B 4F50A 1JXLA 4K5SA 1NPRA 4FKXA 1GTHA 1YTYA 2XC9A 3RG6A 3LPEA 3ZL8A 1IBCB 3MR7A 4MJKA 3O44A 1EETA 1UCNA 3F81A 4HLBA 3QCGA 2IM3A 3M2UA 4UOHA 1YJTA 2PQ5A 4L3KA 4Y3CA 5HK4A 2VQFJ 5F8GA 1TK0A 4OV6A 3AQPA 3BGLA 2HWHA 4A47A 2DRAA 5KT3A 2Z2LA 4FXDA 3D0HE 3LWMA 2KFZA 3DRPB 1APSA 3BGUA 1VDHA 2UUTA 3GJSB 4ZLNA 4I2QB 4ECWA 3K7RA 3DLGB 2CG8A 4CO0A 5HMXA 5KFPA 1W2IA 4C8YA 1NDCA 3QSIA 2RNEA 1D8YA 2VDIA 4LF2A 4CNYA 4GRSA 4JYAJ 2NYIA 5HL7Q 3IBCB 4ECYA 3RGOA 2AHOB 2YH0A 4DPUA 1D1UA 4IFYA 1ZC0A 2DNOA 4GFUA 1ZETA 2Q3PA 3BBBA 4IOAQ 3QCHA 1UFKA 1XERA 3FBBA 4C8MA 2X1FA 2D74B 5B09A 4YUDA 1L3UA 4DGXA 1IBMF 4AZ1A 4F0KA 2V67A 2DXDA 4TNOA 1S0VA 5J2NA 4C3LA 4RW7A 2B8PA 1G7GA 1RUSA 4EBEA 5IT0A 2Y9HA 2MDAA 4CI0B 1BE4A 4O3NA 2V4RA 1WHXA 5FLXY 3BQ1A 4DL7A 4LRAA 1FKOB 2H02A 3KXDA 3PTWA 4DR3F 2FHOB 3QT6A 4KO0B 4ES1A 4FPRA 3PW2A 1I9SA 3CB4A 5MMZB 1S10A 1S49A 1N48A 2JEJA 4DUTA 4RBTA 4NLRA 4DV1J 3VGTA 4OHIA 3ZTOA 4NZ6A 3VZHA 1RT7B 2LA4A 4FYDA 1I9TA 1HBUA 3DMJB 1GXUA 3H4BA 1HW8A 3DYAB 2F46A 2ZC3A 3BGFA 1U02A 4DX6A 3J7ZT 4DFJA 3NG8A 2L08A 2PO4A 4ELVA 1IVZA 3M30A 1LWCA 2WVEA 3RUBL 4QU6A 3KLIB 3PY8A 2VFVA 1S1WB 4Q5VA 1S1XA 4DR5F 2JJDA 2ZBCA 1O0PA 1P3DA 4K0KF 1JLQB 4YEAA 5HVFA 1C2PA 3ZTQA 2XZWA 3MEEB 3TZYA 2B4VA 4P73A 2FJMA 1F0XA 1T05A 3A3PB 3TUIC 1GT8A 4IG3A 5KFVA 1OEOX 3GIIA 2UV8A 3AA8A 4FYVB 4NZ0A 4AD6A 1F6TA 4LF8F 4LRCA 2CMAA 2QDMA 1YTSA 5EUHA 2YPZA 1WG1A 1ZM9A 3D6HB 4PPZA 4YB1P 2W8KA 2DNYA 1RSCA 4PPDA 3WC2A 3CULA 3T5JA 3BDEA 1LK7A 1VBYA 2R0BA 1MWZA 4ZLLA 3ZM6A 2MZ1A 5J2MB 1P15A 3W60A 2DGTA 2HNQA 3QCBA 1HWJA 1UJ6A 3VZIA 1RZMA 1VHRA 3PG9A 2DH8A 4JV5J 1HBUB 1N33J 1VQ6S 3O4SA 2JHEA 3HHLA 3TNVA 3IXQA 3MR3A 5K14B 1ZAXA 2BJEA 3NOCA 3PHTA 4W98A 5KT5A 1WC4A 4WF9Q 5EHHA 4RU9A 1IXKA 4KRWA 2W4DA 5B0EA 3SQGB 4DPTA 2ZE2A 4NWBA 2JL9A 2L41A 2F8HA 2KXHA 3CTRA 2M0GB 1IBLJ 1FXLA 4NXNF 3MPWA 4NRUA 5DZ6A 1VBZA 1NZ7A 2HFVA 1X60A 2G0IA 1Y11A 3PR4A 2LEPA 3LA0A 2IVMA 5DO2A 5C25A 4F4KA 2B3OA 2OHDA 1C1CB 2XMKA 3LAMA 2NR0A 3VAGA 4B3OA 3C66A 1DHMA 1SXLA 1U7LA 1UPPA 2HFUA 2VD3A 4Q2MA 2LEBA 3UD3P 1R8BA 2HHXA 2KJVA 2DO4A 2DHHA 1RTDA 4WIIA 4U8YA 4USVA 5D4LA 1KEKA 5DDOC 2CPHA 1PTYA 1HNXJ 1KVIA 5K22A 2IVYA 3D54A 1S77D 2LU2A 1FKOA 3PX4A 4OZ3A 2HK2A 1Q5VA 4JI1F 3DLGA 3HULA 4OHVA 3D9BA 3HHKA 4EO8A 3M8SA 2H5EA 4CLLA 1X24A 4RW6A 3RAMA 4LFAF 1S1VA 1FDNA 3GP9A 2DY9A 1YIJS 2HHHF 3TO8A 3LO3A 1T9VA 4PQAA 4QAPA 3DXSX 1ZAVA 2FPHX 3U02A 3NRBA 4E2FB 2ZMMA 1NDKA 2EFQA 3AODA 3D1OA 4L3NA 4N47A 4I1TA 2NXEA 4I56A 4KGMA 4MK9A 5ITHA 3VALA 3SI8A 3G9CA 4YFUA 5B0DA 3EX7B 3ZM1A 3GJQB 2ZHAA 2BE9B 3PJ9A 2AYMA 3GR0A 5LOQA 5C24A 1L3TA 2YNGB 3VGUA 1NK8A 1ZH5A 2YKOA 4UW2A 4EWTA 1SQEA 3IP0A 2FHMA 3ZO7A 3THTA 3HJVA 2Y1JA 3VF0B 1YJUA 4M5JA 5CZVA 1NAQA 4EI2A 3KLEB 4JI6J 3QCEA 3RO1A 3W8PA 1E0DA 3DOMB 4KBIA 4K7QA 2DHGA 2R2TA 4WIQA 1UAGA 4RH5A 2DTJA 4HEA9 3PJWA 5IZHA 3OLRA 3WQPA 2GNKA 3FZ2A 4HVZA 2PT0A 2H3EB 1NKBA 1PA1A 1YVFA 2OPPA 3AD7C 2XJAA 3MUMP 4WJBA 2VUGA 2NV5A 2OFGX 4X4QA 2CJAA 5A8WB 1DLOB 1WF0A 5AXNA 1TMJA 1RBOB 1U45A 4DUYF 2R8KA 3BH7B 3L7OA 2R7RA 2VG5A 3MUVP 1OEVA 1Y3KA 5C25B 2ZH3A 4UY85 1T11A 2C7SA 2FJBB 3MHYA 3TJ9A 2BJDA 1VRTB 4WU2A 3CXCR 1PCAA 2P2CB 5HBMA 1XBWA 3CC4S 2V68A 2FVSA 1FNOA 3Q89A 1PC4A 4B04A 5CYQB 3BGRB 2DEIA 5LM7E 2QA2A 2UUCF 2EFOA 1FERA 2MY7A 4ZPBA 2WTFA 2HG4A 1HQUB 4WP9A 3E3XA 3HVTB 7FDRA 2NS1B 2BDPA 1T9TA 3KFWX 2NSBA 4XK8C 1UW4A 1K1SA 1KDNA 1NM2A 2Y1LB 4ZITA 1SKRA 3AY0A 2H04A 3IAS9 1V5IB 1PC5A 2IPOB 4ZLPA 2V2VA 2V8HA 1T0TV 4DR4J 3JTOA 1L8GA 1B99A 2CM3A 2UUCJ 1FA0A 1U1RA 1S1VB 1WDDA 3UQSA 1I57A 3RZ2A 4JV5F 3PX6A 1NPPA 3QYYA 1SKUB 3O6QA 1QSYA 3KG0A 3NS5A 1FWPA 5LMUJ 2ASDA 5E3PA 2QG9B 3A5KA 2CNOB 2MMYA 2OSRA 4I64A 1NHUA 4ED8A 3J7YU 1FHTA 2F00A 2MZSA 4CLZA 1LWEB 2YKPA 4HHJA 1Z4UA 3BQ2A 4N8OA 1RTDB 2P6XA 5A5FA 5KA1A 2GCFA 4JI5J 1SJ4P 2ZM6J 2BANB 2W2OP 4A8YA 3X3UA 2GFFA 3OMHA 2BR0A 4F36A 4WP3A 1L5UA 2VQFF 2DVIA 1EP4B 2F6ZA 2SHPA 2F6WA 4DCOB 3QCIA 3OQ2A 5KA9A 4OQJA 2OEMA 2IYGA 3B8HA 2G13A 2F63A 4CLTA 2HWIA 4TQSA 3KK3B 4PWWA 3BM7A 2CZVC 4Q2LA 2CQ1A 1YRUA 3J80Y 4OLOA 3OV7A 8RUCA 3P5BP 2RDIA 2ZJRQ 3S3EA 3TA1A 1H0HB 4QU7A 1A0OB 2LFVA 1WKLA 3QRQA 2JSXA 3IWXA 3K2YA 1KSPA 3QKPA 2B6AA 2BVZA 2UXDJ 3OJUA 3IRWP 4B02A 4LF5J 4X4OA 3CCES 5HVHA 2Y1IA 3UR0A 4OHDA 3OTOF 2Y67A 2W7PA 4OI3A 2PMZD 3TWZA 3H2VE 3FRYA 5KAKA 1CQMA 4Q0BB 2VH7A 4K5RA 2CJQA 3A12A 4R25A 4G3IA 3RZAA 2VEXA 3MPVA 2DNNA 3MMCA 1CJTB 2ALZA 4USHA 1KWMA 4R5PA 3OTOJ 2V2ZA 3CD0A 4ZP9A 2X1GA 3JSRA 4MYUA 1C4CA 3CCUS 2XZTB 2HK3A 3QZ7A 2XO7A 1GMWA 3CW2C 2O66A 3CO9A 4ZVRB 2E1PA 3A1YG 4ILRA 1SL0A 2ZKTA 1IBMJ 2R8JA 5FJ4A 1JKHA 2WB4A 1R3NA 1HWLA 2F3JA 3U96A 2DNKA 3HHDA 4G65A 3WDOA 5EX0A 1FQ1A 1NK6A 1XEZA 2KI2A 1HNWJ 4UZBA 3EVMA 2BZ2A 2F4VJ 2HQ3A 1IKWA 2E7VA 4ZCIA 2CADA 1ZM4A 5LXRA 4JYAF 1I6JA 1IJFB 1TL4A 4OYMA 3P49B 5H9FJ 3R9LA 1JNRB 3DHXA 1OESA 1M1KT 1UAWA 1VHFA 2GJFA 1O8BA 1SIZA 4LBPA 1FJCA 1S7IA 5KA7A 3FBEA 1VS3A 2EKNA 2W24A 4CVKA 4WE1A 3QGGA 5D0HA 4X4PA 4Q8EA 2MQPA 2N7YA 1FDBA 4WFYA 5EWFA 4DSIA 1N52B 2AEJA 2F6VA 3H2UB 3ILOA 3LALA 4F4XA 4RUBA 3NGDA 1U6BA 4M5DA 3C15B 4M5MA 4K4TA 3I80A 5AXLA 4LRFA 3JYTA 3HSDA 2HS0A 4KIAA 4NLVA 1KQFB 8AT1B 1FJGJ 2RS2A 2VC1A 5AXKA 2YKAA 2A8BA 3J81Y 3UCZP 2CPIA 4MYTA 2KDOA 2RVJA 3TAQA 2DPIA 4ED4A 1RAHB 1WHVA 2RKIB 1UFWA 2FZGB 2GP0A 2J0XA 3QWUA 4OZNA 3MCMA 4N56A 3CMES 1DARA 1UZHA 3KTQA 4TLRA 5HMZA 4DU7A 2EK1A 4KSEB 1PIEA 5BX1A 1TTHB 3Q8VA 3CCVS 4J7CA 4P9SA 3OUYA 2R2UA 1S9FA 4PAAA 3ZZUA 1H38A 2C3YA 3ETMA 2JC0A 4DBQA 2UUAF 4LF8J 2I3RA 1VFJA 2VEWA 2O1PA 2YPYA 3AT1B 3E01B 1T95A 3M6VA 2CQCA 1JKHB 2OUGA 5LJ5Y 4H4KC 4O3SA 4U7CA 2QV6A 3W9IA 3ET6B 2OTLS 4JI7J 2F9JA 2OPRB 4LF6J 3BRHA 4NCGB 3KK2A 1IKWB 3ENQA 3H25A 3SMEA 2W8LA 3CD5A 3OTCA 4LBIA 4LT6A 4ZVQB 3RGIA 1C1BA 2FY1A 1CJTA 4KH1B 5B7WA 3HVWA 1S1TB 2R2RA 4DCPB 1YBTA 2FY8A 3SFGA 5L46A 1AXQA 3D0IE 3DHWC 5DG8A 3Q22A 3CWEA 4DUZF 4AFFA 2GX8A 2WOMB 3ENAA 2PMHA 3ILJA 1TL3B 2XY5A 2AGQA 2HYIB 1U2CA 4P7VA 5M2PA 1C86A 1PBUA 4P2SA 3GV7B 4R5PB 2GWOA 3MOWA 2CUYA 5KG2A 4CDIA 2FB0A 2HKEA 2H65B 2ROEA 2X7IA 5IXUA 3O5XA 2GQ2A 1XWLA 3LUYA 3SEOA 3CD6S 1BQMB 1HYSB 3B54A 4KHPF 1YJWS 4KGZB 2W4PA 3PS5A 3J7Z5 4Z7YA 3G6ES 3OR1B 3VAMA 3A5JA 2F6FA 2Y1RI 5KACA 5L38A 4RX6A 3DU5A 2MBCA 1P27B 4H1OA 3CJKA 3UDVA 1NMEB 4DUZJ 2FJXA 1Q6MA 3MOZA 1S57A 2BZLA 4NLPA 4BWJA 2CQDA 3OXLA 3V4MA 2N82B 3JQKA 4F25A 1WG4A 1X4HA 3EGWB 2BANA 3QGHA 3SQGA 1NRKA 4ANEA 4DPYA 4BBYA 4ECTA 1G1GA 1WC1A 1UWBA 3HCXA 3NCRA 1RP5A 2C3OA 4PWUA 5K8MA 5A2QU 2HIQA 4UQGA 2IIHA 3Q0AA 2HBQB 4PYDA 3UWTA 3RB3A 3C16A 3N79A 4A8OA 1Y7PA 2NYHA 4IKCA 4CIOA 4H34A 3LANA 4I2PA 2BE7D 1Y00A 5J2MA 4M5HA 3V5RA 4UT4A 1S6PB 4ETXA 5JVGQ 4B9VA 3I4PA 2YX4A 4RWXA 3J81j 3RR8A 2HBRB 4ZVEA 5AE2A 2DRBA 3MOJB 3RBEA 2IM2A 9ATCB 1RT5B 4QPXA 1YZ7A 4R30A 2OH2A 5HP1A 1HIYA 2QBPA 2BJ8A 2G2YA 2IJFA 2XWYA 3ILLA 3MM9A 3EM1A 3ZZOA 3OL8A 1TVRB 3GB0A 3MCNA 1KP6A 3G8QA 1S1UB 3BF4A 1OPIA 2DNLA 4XO0A 1FJGF 1KVJA 2B9YA 2J9EA 2B7CB 4JV1A 2I3UA 3HN7A 4DGPA 3QFHA 3OT9A 4ZP6A 5EX3A 5ADZA 5F8NA 1J4XA 2HY3A 2Q47A 2A18A 3U1NA 1C1BB 2QMWA 5GMDA 4RNOA 1JF7A 3IG1A 3FMBA 1PAUB 1P31A 1QD1A 1VRTA 5F8JA 1S1XB 3CUNA 1WAXA 3QIDA 2BABA 2DCUB 2RU9A 2KXFA 4I68A 4J37A 3PKYA 1VGYA 1SKWA 1HR0J 1NWLA 1NSKL 3M8QB 3DDIA 4A48A 4DS4A 2RF2B 3T1HF 1V3RA 3BGRA 4TY9A 1J27A 4FXVA 3L7UA 3K58A 3M6XA 4X84A 4F67A 1HI0P 2JRSA 1M5KC 4QDIA 2NLKA 5IBMA 2D7SA 3V6JA 4EU0A 5GMKa 2C2OB 4OMFG 2HB1A 1FD2A 1HNVA 1RK8A 4USIA 4OYPA 1UWBB 2R7UA 4RW7B 4N5SA 1E8CA 1YZ6A 5F8HA 4GVLA 2VQEF 1ZCKA 2GW8A 1SQGA 4TY8B 3HM9A 1CC8A 3RYLA 4RU2A 5CYJA 4DSLA 3UPFA 1RT7A 2HGNA 3AH6A 2A1BA 3QBCA 4DR1F 2YWWA 2RQ4A 1OSDA 3GONA 1PYOB 1CQNA 4BCAA 1ZTWA 1WNEA 2FJNA 1VJWA 4UOCA 3MMAB 4U9RA 3UN5A 3VR1A 5MLCV 3AWEA 5GAGU 1JBVA 3OTDA 3V0HA 2UXBJ 4IRCA 3NNCA 4Y14A 3V0GA 1VQOS 4OV1A 4DQPA 4DL3A 2AGPA 3UDCA 2DNMA 4KAIA 2FGOA 5A8KA 4Y34A 3AFGA 1A9NB 1LWFB 1UETA 2I5JB 4GMKA 4QYRA 2YX7A 4J9VA 4RUCA 1DY3A 3CE8A 5F3ZA 2BRLA 1RB0A 1N5QA 1S9GA 2RMLA 4QW9A 4DV2J 3NCPA 4C8KA 2UXDF 4RLEA 2QL5B 4P72A 3UCGA 4G1PA 4KYZA 3AOCA 3MFHA 4X62J 2J0SD 4NASA 2HMIB 1BMQB 3M2UB 1XNQJ 2XMAA 2MKYA 2AQ4A 4LFCJ 1XNRJ 1NKEA 5D3GA 1S0NA 2JOQA 2VKRA 1S59A 5J1EA 1REVA 3PNIA 4QQBA 1FRLA 1J6UA 3LTOA 1X0PA 2GA7A 3SSSA 3K5LA 4PG5A 4QWAA 3BSOA 1VC5A 1D9FA 4DR4F 1AUDA 3C6UA 4K4VA 3DLJA 3G2XA 2EBGA 3GU0A 1SV5B 1WD6A 1JIHA 2OPRA 5GAEI 4OHYA 3GLJA 1U6FA 1RI7A 1XR6A 1ZM3A 1YRTA 3R5GA 3DGPA 4WK3A 1AZSA 2J8SA 5T7LB 4PWDA 2BXJA 1HNXF 3W3SA 3DDKA 3FDSA 1CEZA 2ZBPA 4MBBA 1FTRA 1MKPA 1P6TA 1RHJB 3ELHA 3BLTA 1VBXA 2FLPA 3KDOA 4C97A 3K8WA 2G0CA 3B82A 3H8YA 2W01A 4NLUA 2QGFB 5KFUA 1SKSA 1P9QC 4ZJLA 4I0WA 1S6UA 2F8MA 2ZWOA 3BSCA 4PG7A 1F60B 2GVZA 4AT1B 2OP5A 1LYVA 5KABA 3W5YA 2QMXA 1JQGA 2CNEA 1B70B 2DHXA 2B43A 5B0AA 5F9NA 2KXNB 4RNMA 3D0GE 3C15A 3KJVA 2XHCA 2UUBF 4OHWA 3SR9A 3H7HB 1VQSA 1WTBA 3P4UB 5J2PA 2YWKA 4JB8B 1S1UA 4A8XA 9RUBA 2MLYA 2UU9F 1NO8A 2DRDA 4ZDNA 3KYLA 1U1KA 2QJ3A 3E51A 2LQ5A 2DR8A 1MSWD 4C12A 3BKUA 3HSZA 1Z2ZA 2VPYB 3RB4A 3KDNA 4ZPTR 1H3DA 2KRBA 2CFXA 1IKXA 1MU2A 1TL5A 2B3TB 2GIQA 2WONA 3D67A 2FTRA 2YQ3A 4LR7A 1VQPS 1DRZA 3E8OA 3P8BB 3W2WA 3BPDA 3PEHA 4ZP7A 5IWAF 3CMQA 2F65A 1XMOJ 3KUGA 4ES2A 1WRMA 5EHPA 4QWBA 3SXLA 1PTVA 2AW0A 1MWQA 3NKYA 1WUUA 4CLFA 3W2VB 4D3GA 1X4DA 1H7WA 5IM0A 3A8KA 4FS1A 1VQ4S 3O5TB 3HFVA 5L1JA 1VQNS 4DSFA 3OHBA 2VJUA 1JX4A 2AYGA 1UP1A 4URQU 3C2PA 2MZQA 4PQUB 1CPZA 4X4TA 3UW1A 1RHKB 2B9XA 3MUTP 3QGIA 4FDFA 4C48A 1TUGB 4HYKA 4FS2A 1FK9B 2KHCA 3MMJA 5THWA 3DDNA 2YWHA 1S9EB 4PG8A 1SJ1A 4KO0A 3MMBA 5E33A 4BHQA 3KLHB 1H2UX 3K89A 1YTNA 1HBOB 2I6MA 1DTTB 5CH7B 1I94J 1B0TA 1X4EA 4LF7F 1JB0C 1M1HA 2DKOB 2XZDB 2YNIA 3IGNA 3PX0A 4YY3F 2XI3A 2ZNYA 3GFZA 1B7YB 5A6PA 1XIQA 1HQEA 3KG1A 1TZ0A 1XK8A 3I32A 4LRBA 1SL2A 1S48A 4G1QB 4KH0B 4KPCA 2QE5A 1JBWA 4DV4F 2V8DA 4LFAJ 2J6TA 1REGX 1I3OB 4YQWA 2KJWA 2HPUA 2GJ2A 4JI1J 2N3LA 4DV4J 2ZJPQ 3I4HX 2UXCF 2A3KA 1N0UA 1WKKA 4ER8A 1RT6B 1EP4A 2CNFA 1R8AA 2QDCA 4OHHA 4UY8T 4B08A 1WTFA 5J1EB 1R27B 1RAJA 1U2RA 3KUHA 4WTOB 4YR8B 2YWGA 2Q05A 2VOPA 3ZM2A 2I6IA 4YB7A 1XRIA 4F0HA 1Y10A 2J7WA 3CCSS 2CQ4A 2ASJA 2B9EA 2NCKL 4NLDA 1MMNA 3DXBA 2WB1D 2WCXA 2CPDA 4LF4F 4WCEQ 1T49A 3TAMB 2E29A 4IKAA 1EB0A 1LW2B 2AZ1A 2JX2A 4AL6A 1PTUA 2YQ1A 1FRHA 5J8RA 5E3AA 4ED5A 1R43A 1R6VA 1TFYA 1IKVA 5EDWA 3GV5B 1PSDA 1JLEB 2UXCJ 1LXJA 1PYSB 2X3DA 2IDEA 3BR8A 2GVDA 4XDCA 2F40A 2Q66A 2G1DA 3GFYA 3MD1A 2I1RA 4ID8A 4M5LA 4DXLA 5H1SV 4RW8B 3GWCA 4UQTA 1IN0A 2LQ8A 2XULA 3MEKA 1P1LA 1VLOA 2XGQA 3MURP 1S79A 1KHWA 2W9AA 1FNXH 2B07A 5SUHA 3QJJA 1EETB 2H48B 2WSFC 1SL1A 2PE8A 1N33F 4YY3J 1T9XA 5D6GA 1AB8A 4PG4A 3TR5A 3QATA 5JJBA 1V3SA 3VTIA 5C2GA 4J9RA 1Q6SA 1RA7A 4DQIA 1TL7A 4ZIWA 1UFLA 4NMXA 5E7OB 5E3CA 3SCLE 4I67A 2CM7A 3PYZA 4DV2F 3H5YA 4LIWA 1Y0HA 2I38A 2RHSB 4WE1B 1BQNA 4RW9A 3ADAC 5HO4A 4GC6A 1VQMS 1R0AA 4C8LA 3HSJA 5D4NA 3SBMA 1KFDA 4KV8A 5HAOA 2YNFB 1GXTA 3H20A 3P45B 4DF8A 4H54A 5E5NA 4W4MA 4YR0A 4QR1A 2V4QA 1FEEA 2B4PA 1GQEA 2LQBA 3NMAA 3KHLA 1CBKA 2HQIA 3UI3A 3HZGA 1RCOB 4IH6A 4QZVB 5KFYA 3VAIA 1X9SA 2R7WA 3MM7B 4BDPA 4OI2A 2MKIA 2XCAA 1RBLA 1HHTP 5ETSA 4A8QA 4E0DA 1Q6TA 3IWLA 3OVBA 3DOMA 2K7KA 1OEMX 2P6TA 2NZ6A 3GXGA 5JUMA 1UWAA 3POTA 2XYPB 3PYEA 4DX5A 2UP1A 5A5EA 4TU7A 1OETA 2AYEA 4Q43A 2VTDA 3NRSA 4NA2A 3MM6B 4Y2AA 2AZ3A 1R0BG 2XG8A 2LXIA 1OYDA 2QZ8A 4TVAB 3T19A 1U1PA 5CXTA 5KG3A 3GTYX 3M8RA 3GIMA 4LMZA 2B56A 1SH2A 2Y1OA 1S6PA 4EEYA 1HHSA 5DRKA 3LH2S 3OVAA 1RKJA 1HR0F 2QA1A 4U96A 3I55S 3R2DJ 1VQYA 4O4RA 5FD1A 4DF4A 3QRRA 2FHJD 2DGOA 1RTJA 1ICEB 3GFHA 3Q8PB 4MK8A 4DLEA 1VYAA 2Q43A 3RAQA 5DGAA 1YI2S 4AL7A 2R7SA 1A7GE 1DJ0A 1JLBB 4OI6A 4ANCA 3O3LA 1TV6A 4RKKA 3FSXA 5E2QA 3H5XA 2PIIA 1F5BA 2EG1A 3HX9A 1RXDA 4ZI4A 1N5YA 2OPSA 2ZEJA 2DXFA 1JLQA 2AEMA 3VHQA 4X66F 2HNPA 3EZZA 1CS4B 3PCOB 1RHQB 4K2XA 4DDFA 2E9RX 2QTWA 1JXVA 3CCZA 2IJNA 3D1HA 2I42A 3QCKA 2QBRA 2YKNA 1OY8A 1SUQB 2OLWA 4F2SA 1BZHA 2Z2MA 2UUOA 2W2PP 1V3AA 1J2VA 3CD7A 2GCAA 2VEYA 1RAIB 3AB2B 3MMBB 1OQ6A 3I36A 2HRTA 4FF3A 4NLOA 1NK4A 1X31C 2CG4A 2EVZA 5KFXA 2PI7A 4QUNA 1XQIA 5KT2A 1FF2A 3FEZA 4MH8A 3PXGa 3RB0A 1K9MT 3OW2R 1TAUA 2AD9A 1A6LA 4X64F 2DNHA 4M5IA 1ECVA 4J9LA 3CCMS 4MIAA 4B17A 5KFBA 3MPDA 3U7JA 1YJ7A 1KKHA 3QAUA 2BGEA 2GIFA 5KG0A 3IR7B 3MAQA 5HMWA 3EWGA 3MPYA 3W2VA 3PIPQ 3CJ0A 2UUPA 3IM8A 1Z2LA 5I3QA 3CO0P 2ALYB 3G82B 1BC6A 2CJYB 1SB6A 1XXPA 2VA2A 2R8IA 2J17A 4DEZA 4URSA 1MW7A 3TX8A 2EEYA 5I4MA 3DLBA 2XMJA 4NL5A 4CCHA 1EKRA 2RSQA 1V6HA 4B3TF 2I5XA 1CJVA 1JJHA 1NDPA 1OIAA 5IQ6A 1IKXB 1MU2B 2CJKA 1RT4A 4LSLB 4LQ9A 1DZ5A 2IMGA 3ZTRA 3QKQA 1K44A 2OTJS 4C6AA 4EK2A 4RHGA 1FD8A 2AZRA 5AT1B 2ACMA 4ZCMA 5IT9Y 1B0VA 3PFOA 2J76E 2V2KA 2WW8A 5IT4A 5DQHA 2YVSA 1C83A 1XTZA 3AQOA 5C2CA 3PW0A 1N5SA 1SBRA 4MK7A 1T05B 3OLBA 3CCQS 1JLGA 2QCJA 1IUJA 1HBNB 2F4FA 1O51A 2F9DA 4LVNP 1R89A 1VQ9S 4USTA 3N6NA 3SV3A 3RB6A 3MM7A 4P74A 4QUMA 1F1BB 4ZK7M 3LP2B 4HV4A 1GWZA 3EE3A 2KYZA 3N6LA 1ZZFA 4C11B 1OO0B 2ROPA 3CWJA 3P96A 1IR1A 1BD6A 2W25A 3I0SB 3TVZA 2XQCA 4NCBA 2QLJB 3OR2A 4LIRA 3PO5A 5LXQB 3LWLA 2ZOGA 3DYAA 2OI2A 3Q8YA 3HHLC 2JC1A 4L74A 5ETOA 1TKXB 4DCJB 7AT1B 1GMUA 5K8PA 1NSPA 1QUPA 2DJWA 5K9FA 4ELUA 3BS9A 1NK0A 1F5CA 1HARA 3SCKE 3DLEB 2I6WA 4CM2A 2R8GA 4BUBA 4HH0A 2AJFE 1Q79A 1U6ZA 5ETMA 1JLCA 3FVYA 4ECSA 2DGQA 3I0RB 1AUSL 4WXOA 5D4PA 3RBXA 1PAEX 2A6MA 3JAMU 2M3VA 2HHUA 2ZDPA 1FJ7A 2JWNA 3QNWB 3BDPA 2V6AA 4CLKA 4X66J 1KD1T 3S1TA 1UVLA 1WWHA 2XNRA 1HL6A 2IYIA 4Y28C 1M5HA 2QLXA 3NNHA 3U1LA 1KS2A 2HNDB 1OMSA 2X5OA 3AXKA 2K7JA 4PZVA 5HMYA 2RRNA 2MKHA 2VORA 5HJYA 1JLFB 3NAIA 3DU6A 4LQ3A 2VPWB 1S4FA 2MLZA 1S5ZA 2I8EA 2XYHB 1CJVB 5G0RA 4A4JA 5RUBA 3OUYB 1MLAA 4Q44A 4DPXA 2B8QA 4P7TA 5LSOA 5F8MA 2HVZA 2ILYA 1RYSA 4A8FA 1RTIB 1G4WR 3J7A1 5KG4A 3UD5A 2K1RB 1N4LA 1GEHA 2GHWA 5I3UA 5DLGA 3A8JA 5K5MA 2I1YA 1WC0A 3US5A 2RHQB 3EMTA 2KL8A 2X1BA 3NGUA 3ZTPA 3L7PA 1JJ4A 4Q0BA 2PFDA 1EQ0A 5BZXA 5HDEA 2VG7A 2E1AA 4H4OA 4HI2A 2PEBA 4JP8A 4DFKA 3I31A 1NNYA 4P2XA 4OX7A 4IUFA 5FDLB 1QVGR 3MTKA 2E7WA 1C0TA 1FCAA 2WBMA 5KG5A 2COLA 4U67Q 3KK3A 1KAVA 2B6AB 2U1AA 4L6V3 4IH5A 4C11A 5I42B 2IRYA 2XLJA 2EK6A 4BLGA 1Q8IA 1TAQA 3LGMA 4OYZA 4P6QA 1RT3A 2QSFA 1Y5IB 5K20B 2Y8YA 2CPFA 2NLWA 3A8IA 2XS7A 3CMAS 4EBDA 1TMMA 3DOKB 4MFBA 4DL4A 3EDRB 2YKNB 3W64A 1YJ9S 2CNIA 4DV3J 3N9UC 1RWXB 2GC8A 3EVWA 4KR0B 1K47A 5KFAA 2VICA 2JEIA 3ZZTA 1N8RT 2OZ5A 2NXNA 3FUYA 5HROB 3CNQP 1RLDA 3PRBA 2FZKB 2KB2A 2PEHA 2ZE2B 2VASA 4I4BA 2LDYA 2NPFA 4J9PA 1UVNA 2GJTA 1M0SA 5KT4A 2RDJA 3GJTB 3CCRS 3PVXA 3BM8A 2IA0A 2B0GA 1DQ9A 1BWVA 3HHEA 4RBVA 3B78A 4O3QA 2WONB 2I6OA 4ECUA 4KJIA 2DH9A 3QLHA 2C2ZB 5GAGI 4DSJA 3THVA 4ED2A 2XHWA 3Q2SC 4DJBA 5L1LA 1ITPA 1QTMA 1BWEA 2LKZA 5CYMA 1MMDA 3ZZZA 1T03A 3ZNUA 1U0SA 4ZN3A 3GYXB 4EBCA 4DFMA 4FNIA 2HBZB 4WOHA 1LOUA 1TVRA 2M5YA 4CO2A 2HWTA 2MQMA 4ZP8A 4EUVA 4K2JA 2UVWA 1N34F 2LXUA 2DHSA 4OZ5A 2HQFA 4ZCKA 3BZQA 2BOAA 4A8SA 1R0CB 3DOLB 1QE1A 4A8MP 2ZITA 2ZZTA 4ENOA 1U49A 3ZM5A 2X3GA 3N5BA 3VGVA 2DNPA 3EJMA 3T9ZA 3RBDA 3OL9A 2VPXB 4B9MA 3DRYA 5DJBA 2B4SA 4GWFA 4UAGA 4WTYA 4O0IA 4R0SA 2Q79A 2VL1A 4IG0A 3CJ5A 1JK9B 3PW7A 3OVSA 4OZ1A 1CULB 1RBAA 2YNHA 2BUNA 2XGPA 3FSIA 3BO2A 3CC7S 2JLEA 3M30B 2CZ9A 3QT8A 1U8WA 3R5JB 3E2EA 4PUOB 2HHTA 5J2NB 3IRXA 3EICA 3AJDA 3MEDA 3PJXA 1G1HA 1QVFR 3DMJA 4LBHA 1Q53A 2V8PA 4I6YA 4YB6A 5KG1A 4DPWA 1FX2A 4NA1A 2NSCA 4C3MA 2H9ZA 1NK5A 1LK5A 3BSAA 4FBUA 4OHXA 2DNGA 3FCHA 1RDRA 5BUGA 2HRYA 2HQDA 2IBKA 1E6VB 1H72C 1F3VA 2OPPB 2HNZB 1QY7A 3G6XA 5AXMA 1HKAA 1RLCL 1MN9A 1RWNB 1WCHA 1SC6A 4FP9A 4RJVA 5FDLA 1NSAA 2HFZA 2BJ7A 2GQCA 3MAAB 5B0FA 4ZJQA 4X4RA 4F02A 1OHEA 4NLTA 3BR9A 3S3FA 2BYCA 2AM2A 2HFOA 4W92B 1NU4A 4L75A 1IM6A 2DBBA 4E8UA 3CF5Q 3BPSP 2WRMA 1HD1A 5A0YA 4KKOB 2FGCA 3SDEB 5D0EA 3F9AA 4LUBA 1YX2A 4DOZA 4ZPCA 1G2EA 3POTB 4F0MA 1KLNA 1FXRA 1M5OC 3KK2B 3MGJA 1DFDA 2EKYA 3MI7X 5T14A 2OUDA 3ONQA 4UUWA 3B4DA 1IJEB 1XMBA 4DR6F 1XMOF 4C98A 5ETVA 1Q0NA 3E01A 4P2FA 1FPZA 2NTAA 2ZH8A 1H98A 1U25A 1X8DA 2KZMA 4LF5F 2I2YA 4NYPA 4FXWA 3GV8B 3DI6B 2K06A 2ZUGA 2H5JB 2FLNA 5DM6Q 2FJAB 4H4MA 2CAJA 4NYOA 3FSYA 2B51A 2H5IB 5LMUF 3T1YJ 2E9TA 1NLKL 2V50A 4QR2A 3LF0A 3T41A 4DR6J 4BPCA 2VFRA 1FRJA 3JSMB 4B9LA 1FXDA 1QSLA 3M6WA 5SZTA 2BJ9A 1AFIA 1H2TZ 2J9DE 4U6PA 4XIUA 4HT7A 4C0BA 3ISZA 2HNYA 1RISA 1ULRA 1C88A 1E6YB 1FKAF 4TVVA 4KHMA 1LFPA 1NK7A 4J90A 2HFSA 5AE1A 3DM2A 5A8RB 5F9LA 3LP1A 4FF1A 1ZA2B 2ATLA 2MQQA 2E7XA 3M8PA 2KVIA 4OYXA 4OJGA 2VOSA 1WHYA 3MM8A 2JFKA 1U1NA 1N32J 3FQLA 2WW4A 1Q78A 3SFUA 2IM1A 2VF3A 2DHAA 3G71S 5KA2A 4QIEA 2JDJA 2PI4A 3KK1B 2DO0A 3V2UC 2HFNA 2PGCA 3CCJS 4RL1A 4QAHA 2Z30B 1ZZNA 2HHSA 5HQ8A 2HEKA 2X1AA 1WEYA 1NCLA 3P5TL 3HMJG 4X4SA 2C2DA 2Q6CA 3MR2A 2M8DB 5AJ3J 2ZZMA 1DQ8A 1TELA 3AA9A 5DG9A 2D41A 1TL1A 1UA1A 3D3BJ 3KJFB 4KI9A 3MM9B 1FFWB 1PJ5A 3H5SA 2BIJA 2L9WA 1X7VA 4JOUA 2IAJB 5DG7A 3NBPB 1YRXA 1Q95G 2ZC4A 3S8SA 5C42B 2E5LJ 2QO3A 1NWEA 3NMEA 2C3UA 3FK4A 4TQRA 3OSNA 2FVQA 2QDPA 3MR5A 3QCDA 2FH7A 1FGSA 2HBYB 4M63A 2YKMA 3LGNA 2W7OA 1J5EJ 4U7UK 5HROA 4ERCA 2LCWA 1OHCA 4GKJJ 2HVIA 3EUNA 2ZH1A 3MWBA 1VMBA 1U0HA 4HJQA 1WG5A 3O1LA 5F41A 4UUXA 3MM5B 3PACA 4OL8A 1QAYA 1M90T 1T7PA 2CQGA 2XNQA 1N88A 4X62F 1PH0A 3M4UA 2Y2FA 3A8EA 1RTZA 4WPAA 2VU5A 3CCTA 4BUCA 4Y6IA 2MJNA 4HI1A 2Q1LA 2ZFHA 4DN0A 3BO4A 3L9ZA 2ZBQA 3MEGA 4UZCA 2DR7A 5HQMA 1BLUA 3KHHA 2XBPA 1HPZA 2OAUA 2XTJP 4LJMA 1RT2A 3BKFA 1GX6A 4FZVA 4P71A 4USKA 4EGLA 5HSPA 5JMNA 3PW4A 4V19J 2UXBF 3UN2A 3OFHA 1CJUB 2HSEB 2EFPA 1HNZJ 3GFXA 5LL6d 3EXYA 2FJWA 2JEGA 2A3JA 1D9DA 3FRZA 5KOXA 5E3QA 3AD9C 3U27A 3DC2A 4J9OA 3R5BA 4KTQA 1KQKA 3LP0A 4LF4J 4O4GB 4LF9F 1CSJA 3IBFB 4OYBA 4CO3A 2WK4A 2CMBA 5DM7Q 1KONA 2DIUA 3DN9A 4RKUC 2VQEJ 3F41A 1WSRA 1J5OB 2I4GA 2VTEA 5KFEA 4TXSA 1HPZB 1G1FA 3D9CA 1IR2A 4CO1A 1T9YA 4YP3A 2OJ3A 1PILA 2U2FA 2QLWA 2E0TA 4JV0A 2MLXA 3SMZA 3BJYA 3DGPB 1U09A 2RJZA 3QCZA 4ANDA 3I96A 1JXEA 3T1HJ 2C2RA 2DITA 1S99A 3NS6A 4AUKA 1RTIA 2MHNA 1V3ZA 2V9KA 1G6BA 3MF5A 3SYZA 2R2SA 4GVBA 2BW2A 2H1YA 1KQGB 1TL3A 2XPCA 4R0EA 4X65J 3KLGB 3QZ8A 5KFFA 1S0OA 4DQRA 3K5NA 1TKTA 1LNQA 2KM8B 1NEEA 4I6AA 1LFWA 2BA9A 1PJ6A 1M5SA 1UEKA 2NUUG 2V4JB 5IC4B 3L3CA 4ECXA 3EAXA 3ZZ0A 3AWGA 4DSKA 4PXBA 2IM0A 4EMDA 3G8TA 3PRDA 3I87A 3G6YA 3T5LA 1Q16B 1VBKA 1H6KX 2CPEA 2QYGA 5CYQA 4CT8A 3I0RA 4DN9A 3EPGA 4IOCQ 2WAQD 4Y2MA 2O5DA 5B0GA 4QWDA 3RAXA 1YLXA 1QJHA 1ZTTA 3EGZA 4QYZK 2CPZA 1FKPB 1LQFA 1QZ0A 1D5RA 3R1LA 4J9NA 3I82A 4MKYA 4WKRA 2AJ4A 2HURA 4DG1B 4JI3J 4NYHA 3D28A 3H5UA 3UO0A 2M52A 3OPKA 4QBUA 2VG5B 5A8KB 4JI2F 6FDRA 4NXMF 1OHDA 1SJFA 4GKKF 3TARA 5HATA 5KFHA 3CCWA 2DR6A 3AD8C 4ICLB 4DPOA 1RACB 5EN1A 3HKZD 3OR2B 1C87A 3DRRB 3ITHB 1AROP 2ZOMA 4YS2A 3PZPA 2W1BA 3J7YI 3ZM3A 2ZBIA 3GR1A 1U4BA 2IJRA 1OJ4A 3H59A 3NCQA 2ASLA 2ZJQQ 4K59A 1FKPA 2DH7A 4C0OC 3NWGA 1G1XA 3C46A 1N5VA 4I8NA 2QYCA 4OZ0A 4Y2EA 2MQLA 1BQNB 1R0AB 1FJEB 1T94A 2KVQE 2MB0B 1HLWA 3KOAA 2LECA 2GCBA 2FLOA 3CDBA 3DCAA 4AL5A 4DV3F 3V81B 2NREA 2HS3A 4QIWD 5LJ3Y 1LW0B 4ILMA 4FKYA 5KA4A 1RAAB 2E1RA 1IM4A 3BBCA 2NXJA 3OFFA 5T7LA 1TKTB 2DK2A 1H2VZ 2WSCC 2BM1A 1OWXA 5IV4A 4H4MB 4DSEA 4DV1F 3IBWA 2XMVA 1RJJA 4OHZA 1FPRA 1U1LA 1TR0A 1O6XA 5DETA 1PXHA 3GG0A 4J5OA 4FVCA 2ZN7A 4HR2A 2L9NA 1EARA 2L48A 3KMSA 3SZ2A 3NGKA 4GKJF 2BX6A 4IFVB 1LARA 3EMUA 4CLUA 1FFGB 2POKA 3EXCX 4TN2A 2KRRA 2K3IA 5BYQA 2YNGA 5A0YB 1JLAB 1Q7LB 5CCMA 4YB5A 3GIKA 4DLGA 3D66A 3LQVA 4AXJA 2E1CA 3J7AN 1NL9A 3G87A 2CVIA 4HHHA 2AJ2A 2HRUA 3HFZB 4WFZA 5D3GB 4M94A 3EU0A 3HXMA 2IMWP 4M8LA 2D3UA 2AGOA 2Z58B 1MN7A 3ZNJ1 2AV5A 3CDUA 3H0PA 4URGA 4F2RA 4CQ1A 2L9DA 3Q8SB 1T4JA 2D9OA 2V0NA 5KFMA 3FZBA 3HJFA 5AWXA 3OSPA 5KFRA 1T3NA 4JI7F 1WSVA 2Q6BA 3AOAA 3QO9B 2GQQA 5K8NA 1N36J 3M05A 2B5JA 2JFFA 4C3KA 2O67A 5L1IA 4I7FA 4ELTA 2OD6A 2BV5A 1Q7YT 2AP6A 2MKSA 2VKZG 4F8RA 2CFVA 2G2OA 2HQGA 4DQQA 2UUAJ 1S6OA 2FIUA 4OFZA 2UZAA 2ADBA 1RWMB 1RTHA 2V94A 2Y0SD 5A6WA 3M6UA 1IKYA 3RR7A 3M1VB 4QPTA 2ESBA 1F9FA 2F6TA 3LP2A 4RI4A 1RA6A 2W2NP 4G1QA 3VGSA 3KNAA 3R27A 1N6QB 2B7BB 2CNGA 2YX1A 5M2RA 4WKYA 1UA0A 2J0WA 3GQCA 4MKBA 3D1QA 1VK8A 1TV6B 4U8VA 1IKYB 3N6MA 1RWKB 5KFLA 4A46A 4N76A 1K0VA 1I1GA 4OYOA 2MHEA 4YOEA 2YNHB 1FFSB 1FRXA 1U0HB 1PA9A 1OY6A 3CJ4A 4GO5X 4FPIA 1CS4A 4OI0A 2CWXA 3KLHA 4NI2B 2H03A 1U47A 3Q8QB 4KE5A 3IFEA 1YK9A 2EC2A 2W9BA 1UVJA 2K3KA 3W2WB 1Q5YA 4QIVA 4CZCA 3PO4A 4PRFA 4GE5A 4JI2J 5K8OA 4NXMJ 1YQHA 3HHLB 1ONZA 3KJNB 3EYZA 4C13A 3K8VA 4PVGA 5BXIA 4ZN5A 2RD5C 4I6WA 2BW7A 3H4DA 2ZBRA 2C28A 1KR4A 1G7CB 4PR6A 2MZRA 1WEZA 3DRSB 3EGVA 3RBZA 1MMLA 2AX0A 2IA6A 3OJSA 1D8ZA 2QRRA 3CGIA 2P6SA 3K5PA 4USUA 2XS5A 2HC2A 1T3OA 1T02A 3NEKA 2YKMB 2YQ0A 4HACB 2CQ2A 2OKQA 4CYUB 1JMTA 2CPXA 3R3TA 4R8UA 2K8GA 1FTCA 2MYFA 2NZCA 3D6MB 3MECA 3OLAA 3Q23A 2DR5A 1CLFA 1GMVA 3CIMA 4X65F 4GRYA 4QR0A 7FD1A 4K4WA 3DOKA 3T6BA 3TAPA 3FBCA 3UNGC 2CNKB 2UUWA 4IOBA 4L73A 4DHVA 2CDRB 2HIYA 1X4CA 3EVOA 3PHEA 4Z37A 3JTNA 1LW0A 2HLTA 3JAMY 5BJRA 3VAHA 1TK8A 1EJ7L 4ZPDA 4DU8A 5HVGA 3TZXA 3BEGB 3ZM0A 2V8VA 4B9TA 1VQKS 1HWIA 5GAHU 4LFBJ 1QAJA 3O2IA 3HK2A 2RRAA 2VV5A 3AHPA 3CJSA 3NGTA 2UVVA 1JLNA 2EG2A 3R5DA 2VA3A 1X5OA 2PA3A 1RT3B 3N4WA 4ED1A 4PYHA 2M3DA 3NWRA 4MAKA 3QIPB 3M8PB 4KYQA 4CP5A 1UEUA 1RAFB 3JYTB 3BYPA 1K1QA 3CJKB 4IO9Q 1WC6A 4LSNA 4MKAA 1DBDA 1SQFA 4DR2J 2ZNZA 4DL5A 4ICLA 1P8GA 1LQ9A 2C46A 3HT3A 3TVYA 1HFEL 2CXEA 5KFZA 4LF6F 2ADCA 3TUPA 3QT5A 1GX5A 3BO3A 3Q8UA 4X64J 4DL0C 4XDDA 3JS9A 3PR5B 2BE2B 2CQBA 3M8ZA 4J9KA 2F8EX 1FE0A 2HC1A 1T9UA 2C1EB 1R6YA 2KKHA 2SXLA 1QAXA 2VB6A 2W2MP 3TAMA 1NJYA 2CM8A 3ZMPA 1VISA 2VBXA 2YBVA 3DKDA 2YWFA 4AYBD 3J81U 4GKKJ 4IH7A 4P2MA 3JQJA 2ROGA 4MTPA 4DL2A 1JLEA 3EPIA 1RAEB 2BE2A 2JZ5A 2KU7A 1ZYQA 3SQOP 1X4AA 3CSKA 5ETQA 2BRKA 3V6DA 4JI8F 2HVHA 4S0MA 1OQ3A 1FDAA 1HNIB 2EPIA 4EYIB 1U1OA 3CVKA 3GE9A 1RT6A 2GMLA 2QLFB 3BYRA 3W62A 2YH1A 2J7UA 2HNZA 1RT1B 1KC8T 4GVBB 4BJOA 4O0NA 3L4BC 3QQCD 1B0PA 2HMIA 3ET6A 4HJPA 1Q82T 1VQLS 4F3OA 2E9ZA 3DLKB 4TY8A 1S9GB 3W9HA 2RKIA 3HVAA 4N7TA 4ZHRB 3G96A 4NEZA 4A8WA 1GXLA 4YR2A 4F4WA 3N2AA 4K4XA 4ITSA 3CJQA 3MAAA 3M7VA 4LVOP 5AJ3F 2OGUA 4JI3F 4RBUA 2MQOA 3KG4A 1R8HA 2GHPA 2A2CA 2EC0A 3UAGA 3C6TA 1HNWF 1W26A 1GNKA 4TLQA 5HJXA 4JMKA 1NBEB 5KAAA 2ZZNA 1Q1MA 1H74A 2QC3A 2Z56B 1HA1A 1XR7A 2VIHA 4ATNA 1Y3JA 1FX4A 2KT2A 4DV0J 4AQYJ 2IC3B 5L39A 3H2XA 4NX9A 3EGNA 2QCTA 2GAHC 4RUHA 1O5JA 2DGUA 3ZTSA 1IBKJ 2M8HA 4GE2A 3V4IB 1JWWA 3G6VA 1MROA 1N0VC 1TQLA 3IS9B 2CJ9A 3VQTA 4USMA 1B64A 4YAAA 3FJ2A 1UTAA 3C8YA 4DI6A 4J9UE 2ZH2A 1SJ3P 2CQPA 4WZQA 2NXUA 2DISA 3B6BA 2HZCA 1C0UA 2CVEA 3C14B 2IRXA 1Q86T 4UOGA 4QWCA 2J9CA 3VVTA 5CD4H 5H9EJ 4QCLA 2OELA 4NRTA 5L9NA 2BQ3A 3TA2A 1NJXA 4K4ZA 2W7AA 3BGOP 1HBMB 1RWVB 3NL0A 1HMVA 2Y3YA 2HGMA 4JMJA 3GILA 5K24A 2J5AA 3OBIA 5L1KA 2AWZA 3TEHB 3M2VB 4R0JA 2UVRA 1MROB 2G4BA 2W9BB 2QEPA 4IG3B 4C9DA 3A3NB 1U26A 1VRUB 2RS8A 1EEHA 3HD1A 2HVLA 1NB2A 2ZD1A 3IO1A 4OX8A 1SC1B 1VLYA 4ZPAA 4J9SA 1EQMA 5J1PA 1ZPWX 4ZVHA 1RU1A 1FRMA 3IGVA 1X4GA 4XTTA 5CD4A 2QBSA 4O4GA 4NLSA 2W9CB 1QM9A 2AIRB 1YBUA 3JSBA 2E5LF 2VFSA 1KFSA 4IQXA 2K2PA 3I5CA 3W5XA 2E5HA 3ENVA 3V4IA 5IBSA 1HWKA 1WI6A 2OD4A 5GAHI 4PXDA 2R7TA 5IWAJ 1YGRA 1YZ4A 2JFHA 4ECZA 4ED3A 4LR8A 1TKZA 1HBOA 1X5TA 4ES3A 2RQCA 3C16B 3VAJA 1Q1KA 2NPIA 1Q6JA 2XYGB 1Y5NB 4NLWA 4OJ3A 3OFGA 2NT2A 1UVIA 2I4EA 1SVDA 3MEGB 4B9SA 3QWPA 3DGVA 2HCMA 3QCJA 3MAHA 4KGVB 5I3UB 1TKDA 2OPSB 3X1LB 3I5AA 2CQ0A 1Q81T 1F5AA 2HNYB 4NYZA 4CH0S 1NZ8A 4F3MA 3PIOQ 2R7VA 2VFUA 3QCFA 1JLBA 2V69A 3VAFA 1RGVA 2XSJA 4GE6A 2NQPA 5LMNF 4DR7F 1RYRA 2CJXB 2GO9A 4YDDB 4NMLA 3TW0A 4QYZJ 4KFBB 2LYVA 1V5VA 3GSIA 4C0HA 4K4YA 1SH0A 3QJLA 2CA9A 4FYYB 5ETTA 2YKQA 1ZZWA 3CJ2A 2A0FB 3OTBA 4JBCA 3R5CA 4RNNA 1F2GA 3RRHA 3HZEA 1SV5A 2DY1A 3BKTA 4WYLA 5A8RA 2DT9A 4ZIYA 2H4VA 1URRA 2FJEB 3UNYA 5FLXU 2H4YB 3T1YF 1JLFA 4KQZA 1TUVA 4WWSA 3WC0A 1ZA1B 2OIHA 4JI8J 1QLNA 3QCCA 2W4CA 4KYRA 2YY3A 3ISND 2MSTA 1ACMB 5B08A 1YKWA 1ELOA 2BJ1A 2OC3A 2PA5A 3R2CJ 4ZKAA 3LW5C 4KB7A 4QIFA 3LOUA 5KFQA 1HW9A 8ATCB 2F6YA 1QDUB 1RHRB 2F7VA 1YWXA 3W65A 3M2RA 2Z8QA 4B3RJ 1BZCA 5IOLA 5BR8J 3W8GA 2RAQA 3QGPA 1AFJA 2GVZB 4ZRTA 2IHR1 5EWGA 1HHQA 3CJTA 4ZVTB 1IWAA 3GZ7A 2WJPA 5J2QB 2J16A 2EW9A 4TKTA 4ZVPB 2Z0GA 4JUZA 4DV6F 2MGZA 2D69A 1EX8A 2OFHX 3L95X 4LSNB 4UF4A 3GYNA 5KFSA 3M32A 5IQQA 3V81A 2ZUAA 4JI6F 4NLXA 5LXYA 4B3OB 2HXPA 3QCLA 5K23A 2BACA 2R4FA 4DG1A 2ZWPA 3KKFA 4R0TA 1JLCB 3CJRA 3LGHA 4DMZA 1TKXA 3M8YA 1T48A 2YNFA 2HW3A 3V0IA 4OZJA 3WX8A 3QPIA 4PUOA 1OYEA 4M1KA 5CQGA 3DI6A 2WVFA 4H4KA 2ATCB 5A8WA 2VG6A 4L76A 1WEXA 3U1MA 4JNBA 4R8UB 2E1MC 4OJHA 2DNRA 2PN6A 3A4TA 4CO5A 1J5EF 4A8KA 3T9NA 3KUEA 3QFWA 4CTAB 1YWFA 3PYFA 4USWA 1TP7A 2KG1A 2UUBJ 4K0KJ 1XM2A 3FQKA 2KM8C 1SC3B 4IR1A 1BGXT 4LFCF 2AEFA 2GGPA 3FNNA 2GJIA 5E3RA 3GIJA 4DR7J 4QOTA 3HSGA 1Q4RA 2MQNA 4ZS6A 4D3PA 1WC3A 4OYWA 3TEGA 1WOPA 3SSRA 3UN3A 5G4DA 1MWYA 2ZD1B 3K57A 4CLWA 3VV2B 4QBEA 1FNMA 1RCXB 3FC9A 3K5OA 4HL9A 4NLGA 5LSLA 4MT1A 2R8HA 3ENWA 4Y65A 2RDDA 1RT4B 4LSLA 2H51B 1PKUA 5D4OA 1WF2A 5GAEU 3T5HA 3R1HA 2AJ0A 2V4JA 1NSQA 4QBWA 4I2PB 1R31A 4NLYA 2N7CA 2GS8A 2BM0A 5KFDA 1J5OA 2RE1A 1F2HA 1G4US 2CIMA 2V63A 3HPOA 1VOMA 4BC9A 4WYWA 1N32F 3HKWA 2PDAA 1KNZA 3B4MA 3M9OB 2FVRA 2B49A 2F5GA 3I9V9 3EZ5A 2MQ8A 1E6VA 2MKCA 1U48A 2BMBA 1QXKA 2MKJA 1NHKL 2UV8G 4ZA1A 1LKZA 4J9QA 4NXNJ 2CZ4A 2H4KA 4X4NA 2QFIA 3BH6B 5L9XA 3G82A 1VIXA 2OMOA 1RHMB 4NX8A 5H9EK 4E98A 3OXFA 4EZ9A 3KLIA 3V6KA 1U1MA 3ULHA 2XLIA 2YNIB 2ZH6A 2D1CA 3NP5A 5J1NA 1VR6A 3FEXB 2MY8A 4TU8A 4F7VA 4B3MF 3DLHA 2IVFB 5DLFA 5KADA 1R8PA 3D6FB 1JNZB 1N5YB 1RT2B 3D68A 1S9EA 4G6VB 3LP0B 4FN5A 3R8YA 5GADU 2VEUA 2DGXA 2RF2A 4CVMA 3F56A 3T3FA 2YWEA 3PFEA 4Y2KA 3S6EA 4CO4A 3QT7A 3R7NB 1AT1B 3HI9A 1LXNA 2HZAA 1KAKA 2HZVA 3NY0A 1TKZB 2HVEA 2JFDA 2V34A 3FFIA 4LREA 3ZXWA 3TJ8A 4W90B 4J51A 4P75A 2B5JB 4OIXA 3HVRA 3PYGA 2OPQB 3LAKA 3W9JA 4B9UA 2LA6A 2VODA 1RAGB 2W9CA 1DTQB 5IC6B 1OSCA 3IC1A 2N3OA 2ZKUA 3IWNC 1IWGA 1VHIA 1S6QB 1KLMA 1HQ2A 3NGSA 4DR5J 2VC0A 3VQSA 2LDIA 1KHVA 1UJ4A 2ZDOA 1P9YA 2KHDA 2MTLA 2BBEA 3D5MA 2APOA 4FNHA 4IDKA 4O3OA 4AQYF 5A76A 1G7FA 3TZWA 4CLYA 1X4BA 4O3PA 1W7WA 3GG1A 4PCQA 4NWGA 1GMWD 2CRLA 3UVJA 3HHNB 3V0DA 1S1TA 2WVCA 3PRVA 4LFBF 2ZH9A 4KHPJ 5K9WA 3KNGA 4I2QA 4FYWB 1UVKA 4RO0A 1TU0B 5KFOA 4DS5A 2DGVA 4IR9A 2M4MA 2QX0A 3OXGA 3MCSA 3P3DA 4NCGA 1EAYC 1Y4ZB 5DDQC 4Z7CA 5KFWA 2XCPA 1B7FA 4DR3J 1W78A 3ZFVA 2CMCA 4F3QA 2G6ZA 4NWFA 1X9WA 2MXYA 2QN6B 4OZLA 1BUXA 1EENA 1UZDA 2KFNA 3GXHA 4HT5A 4CT9A 3N01A 3K0JA 3QJPA 3HVTA 2M70A 3ISNC 1BQXA 1I5OB 2BEFA 2J7KA 2Y96A 1S1WA 2P9GA 5HI7A 3QCMA 2BV3A 2WSEC 3DRRA 1WHWA 2D3OR 4FF2A 1GFYA 1PBAA 4M5DB 2WHOA 3BSNA 5J2QA 2J16B 1R8CA 2WTZA 4KV8B 1C0UB 1L8KA 2XMMA 1RQ0A 2Y0BB 5KFIA 2BGDA 2DEJA 4O3RA 1FESA 3F9BA 4RDDA 1VQ8S 1VQ7S 5K25A 2CDQA 4IQMA 4NZ7A 3M8WA 3C6TB 2EFNA 3LP1B 4RNFA 2GV1A 5LT5A 3S7RA 3T1AA 3ZMQA 3NGRA 2NZ4A 5BZZA 2K1RA 4J9MA 4DZDA 1S4EA 4PABA 4DV5F 4C8ZA 2RUSA 3IM9A 3GJRB 1NO6A 4CNZA 4KPYA 3D44A 2MJUA 1SIWB 2LLZA 3C6UB 4M5NA 5LSRA 1VC6A 2I75A 3KLFA 4C4WA 3S3KA 1IQZA 4WFXA 3MD3A 2WBRA 2Y66A 2JH3A 3SV4A 1AW0A 1LV5A 1EHWA 1WOSA 4WXWA 3JXOA 5E41A 2KH9A 2KZZA 3V0JA 3AJ2A 5KFNA 2R3VA 3HF5A 2LEAA 3MFIA 2I4HA 5C7PA 1OY9A 3R97A 2ZVSA 3RRKA 3TRGA 1XNQF 3BBFA 3MMCB 3AAWB 2GHVC 2XWXA 1NNDA 3G86A 4UOFA 4WBFA 4JI0F 1HNIA 2DB1A 3BB5A 3KWMA 1TK5A 3HO1A 1LWFA 2I5JA 2RH3A 2HHWA 4ZVOB 2G2ZA 1XMQF 2PI5A 3IR6B 3LPYA 1RABB 3QMQA 2FUG9 2DR9A 1D9AA 2J0QD 1LW2A 1GTEA 2VEVA 1QUVA 3SCJE 4B3SJ 1YJNS 2KT3A 3A3OB 3HLUA 3IR5B 4KKOA 3H2LA 5D78A 3SDEA 3TJAA 4ECVA 1HQEB 3JSYA 2M2BA 1F9EB 3MMAA 2RU3A 1VC0A 1M5VC 4OHLA 2XMTA 4RW6B 4LRDA 2PA8D 4OYIA 1N56A 3FKBA 1ONYA 2BKOA 2ZH4A 4K4SA 1FI4A 2PBNA 1FEHA 4TYAA 5CCLA 4WU3A 5F3TA 5I3PA 4IG0B 3TP2A 1WDTA 4LF1A 4OJ1A 3W63A 2XY7A 2C22A 5D8HB 2CM2A 4EFAC 3DLLQ 3T6JA 1N54B 2C2KB 1YG0A 2JVRA 5KT7A 3RJMB 2P5VA 4XPEA 2GC5A 3NLCA 3HT0A 2ZHOA 3F73A 1X5PA 2CKWA 1RE1B 4KGKA 5ETLA 4M95A 3B7OA 2CPJA 1ZS6A 4DQSA 2E5JA 2IFXA 1H7XA 1OPZA 2D9PA 4NOHA 1HBNA 4D3HA 5D0GA 5D77A 2F70A 1KOOA 4WZMA 3VWSA 5DQIA 2H54B 1FT8A 3MM5A 3KLVA 2MZTA 2AX1A 1CULA 4OX9F 4YHHF 2IRUA 1RPMA 3PDNA 1DTTA 5F0WA 2J6SA 1DURA 4CYUA 1ZBTA 2FDNA 2QT7A 2CQHA 3CIZA 4WFNQ 5DGBA 4WFBQ 5CZXA 2L3MA 3NXZA 4OI4A 4HKQA 2KN4A 1VCTA 5M2UA 1K73T 2AYBA 5K9VA 2EWHA 2FHJA 3GCWP 1T03B 2CQIA 1KTQA 1N5TA 4NLQA 4BWMA 3EB1A 2PFFB 1BHNA 5DZ7A 3ZZRA 1OS5A 2A6OA 4MIBA 3N0AA 5CAAA 2B9WA 1KLMB 1RKIA 1S6QA 3ICLA 3MVNA 2D3ZA 1WOOA 1JJ2R 3OL6A 5KOWA 1QAIA 4NNDA 5ETNA 2OPQA 4Y00A 3W7BA 1D3WA 4N8NA 1LWCB 3H90A 4MFBB 2A10A 2QFJA 3CPWR 3MM6A 4ED7A 4ED0A 1UVMA 3THPA 1DQAA 4M5KA 4NI2A 4JI5F 4RZRA 5HBMB 3KJQB 3KK1A 1L3VA 3IMQJ 1IQTA 5T41A 2VBZA 2J8AA 3RU0A 1S76D 4Z6BA 5GADI 4M5GA 1UW9A 5HLFB 4ALZA 2IY5B 2HQCA 1HQUA 1MG7A 4YDXA 5ETKA 4OX9J 2C3MA 2PSZA 2MZJA 5A2QY 2WGPA 2I9SA 4C8NA 1R7IA 4CH7A 3UCUP 3LJ8A 1LEOA 4ETZA 4NA3A 2QA4S 1W25A 2C2EA 1XBOA 5MAOA 4ZCLA 3RW7A 3RTVA 2ACYA 3PYDA 4DL6A 2V2QA 5C5JA 3M1VA 4FBTA 4IRDA 4QF5A 5HANA 1IR0A 1YN9A 2P4DA 3OTEA 4P52A 1SH3A 1Q8BA 1XN9A 1S72S 4K4UA 3F0NA 1YFOA 4ID5A 5KA3A 3DM2B 2LP4A 3OR1A 4JV2A 3AWFA 4ILLA 2JLFA 4AE5A 3BLUA 4K8RA 2QIFA 4JI4F 2GMHA 2AF6A 2E66A 2JNJA 3Q86A 3TX0A 3QO9A 3KLEA 4KC5A 2XS2A 3M32B 2KTQA 4IRKA 2FJDB 5IS2A 4YR3A 2DYAA 1WJ9A 3S4EA 4GS0A 5JXSA 5DDRC 3FBFA 1NZAA 2ABYA 3HHLD 4KHRA 2CYYA 1YGYA 4G1IA 4B3TJ 1AAXA 3Q83A 4J91A 1NHVA 4ZVUB 4F4AA 2FQQB 2JVOA 3PKMA 4RPFA 2RF6A 5L8RC 4PXCA 2HHQA 3ZV2A 4DUYJ 2EBEA 1SC4B 2DCLA 3FMWA 3DLKA 3M2RB 3D4JA 4XPCA 1CJKA 2RQKA 4KGXB 4LF9J 3QRPA 5M43A 3FEYB 4CLSA 1WC5A 5I6VA 4EZ6A 2ZOFA 2GVDB 1M1GA 3VAKA 4NCAA 3SIPB 2VONA 2GMJA 2R7OA 2BQRA 3M4XA 3N0VA 1VIOA 2KYXA 3BREA 2HAIA 2NUHA 2QL9B 2QSWA 4OI1A 4ERDA 1B4SA 3FCVA 4USJC 1JLAA 1PO6A 4OHEA 2C42A 1CG2A 2PD1A 4QJVA 3MPUB 1RWUA 2CNLB 2XB2D 4K50A 1AYEA 2C3PA 2E44A 2XSJB 2E5IA 2ZH5A 1FRKA 2ZM6F 5DS7A 1HI8A 4PYAA 3I56S 1YTWA 1FE4A 4GO7X 2V8GA 2HHVA 4GRZA 3BN7A 3HFKA 2EFVA 4IYQA 3OFEA 2D3O1 2MSSA 3VVUA 1GAOA 1WACA 3MEDB 4F04B 4DV7J 3ILIA 4B3MJ 1C1CA 1Q8LA 2H4GA 2FYXA 4OZ2A 1KOHA 3OHAA 3EZOA 2DPJA 2J6UA 3P6YC 1H73A 1HNVB 1VI7A 1UJ5A 3UDLA 2UU9J 5EHRA 2FLLA 3RGQA 5H9FK 4UTGA 4ECRA 2BKNA 1KBRA 2EI5A 2VBWA 3TANA 2HHHJ 3NNAA 5CHCB 4WFAQ 3KHGA 3I0SA 4XAKA 2M7SA 4FVMA 4HH1A 1JLGB 3W1YC 5CA5A 1VQ5S 3M9MB 4D3QA 4B9NA 1WI8A 1QE1B 2XMUA 4L72B 5D0RA 5KG6A 2VJVA 4V19X 4PEOA 2PC6A 2I6PA 2EXUA 2WVBA 1RHUB 3IG1B 3OL7A 3V6HA 4PXEA 2GIRA 1YDLA 2ZVIA 3R5AA 3UR3C 1K0TA 1YGUA 3H42A 3TUZC 2GC6A 3NMRA 3M8QA 5CYMB 2RIJA 3GYGA 5K14A 4LSZB 5HLFA 4DV7F 1HD0A 1I94F 1GH8A 2F4VF 4Q8FA 4O44B 2UVUA 3QLHB 2HGLA 3MTJA 2DIVA 5HP1B 1HBMA 5KFJA 3RW6A 1I51B 2YXLA 2RT3A 2R9LA 4QIGA 3TQ1A 1NJWA 2DGSA 1S0MA 4IDKB 4DV6J 2FC9A 3C14A 4HTIA 5BYSA 3M2VA 4Y2CA 2DXEA 4HACA 3J80U 2HS4A 1UEVA 4RW4B 1IBLF 1KN6A 3V0EA 3UVJB 2MEWA 1HNZF 3HP6A 2VOOA 1HMVB 2YDUA 2VBYA 1CC7A 2MPUA 2OEKA 1NUEA 2G1HA 2FVPA 1BZJA 2A2DA 4DFPA 3NBPA 1SI9A 3BV8A 3FFIB 1A5YA 2IC3A 4O44A 1Q6NA 4LF7J 2E5GA 2UAGA 2XMWA 6AT1B 3K5MA 1NKCA 3F99A 2V9WA 3D7SB 1L3KA 2AMCB 3V0FA 4ZPWR 4PKDB 6FD1A 4WK1A 4PG6A 2ZH7A 3BQ0A 3WIVA 4QWEA 1RWOB 2QMUB 3S01A 2R7XA 2VPZB 3CDWA 2GO8A 2IDLA 4FYXB 4MIWA 3UDEA 4RH9A 3AJ1A 4KT0C 4CLPA 1CJUA 5KFTA 4HHUA 2RUGA 2NXCA 2VFTA 3CT9A 1M3GA 1RU2A 2O01C 2AJQA 5F0UA 2VG7B 2Z2ZA 4DX7A 1NH8A 5DQGA 2J9DA 2V5HG 4TYBA 3D2WA 3HDSA 3TQEA 1FK9A 3W66A 5ETPA 5KFKA 1X0FA 1SJRA 3AXMA 4HDGA 5BR8F 3H40A 4ECQA 1C0TB 3UFCX 4B3RF 1GQYA 4ZOSA 1F9HA 5LMNJ 2QBQA 5F8LA 3DFEA 4H4OB 2YTCA 2FD2A 5GMEA 1RT1A 3T5KA 1VRUA 2WOMA 1RTHB 1BQMA 1HYSA 2VDHA 3LK7A 1EKSA 1RTJB 3C19A 2G9OA 1TFWA 1AZSB 4PWDB 4X2BA 2OSQA 4RUAA 2QL7B 1XR5A 2FC8A 5EWEA 2VHGA 4F26A 5U47A 2JFGA 1HWUA 3NAHA 3MZIA 4IFYB 4BS2A 2QA4G 2VZ9A 2H4WB 3NOGA 1YBAA 2KG0A 3IA0A 5G0RB 1RADB 3GMGA 2RB7A 2B4UA 3R6GB 4JI4J 3SSQA 3C3LA 1CVJA 1REVB 1SPBP 3KLFB 2HHPA 3I9ZA 2HNDA 4CRJA 4ED6A 2Z57B 2JEFA 1Q8KA 3IS9A 4Q45A 3MDFA 2CPYA 2FHKA 2P9CA 2CNHA 1EEOA 1RAOA 3R7SB 1AA1B 1K8AT 1Z1ZA 1YITS 2LXFA 3KJVB 1KRPA 3Q24A 3BN4A 2I6JA 1ZCLA 3DLEA 1Y5LB 1ZOTA 3D42A 2VG6B 1XNRF 4RW9B 1UL3A 3AOBA 1B3TA 4X4VA 2DNZA 4RR5A 1KTVA 2CJZA 3TZZA 1U2FA 1U8SA 2HLUA 2OEJA 3GCXP 3A13A 4KY3A 1N34J 2P8IA 3EZUA 4CTAA 2XO6A 1YJRA 4DWIA 3S3HA 3TUJC 4D3RA 1TL7B 1C84A 1DLOA 1M5PC 1PG5B 5KA8A 2AU0A 1V9OA 4FF4A 3QIPA 2QEXS 4GFVA 1DAXA 2CQ3A 4WP8A 1GK8A 3MM8B 3WBZA 3PW5A 1XC9A 2MGZB 1PYTA 3JSMA 2ERRA 3MXHP 2AHSA 4RI5A 1VRQC 3UE2A 3G4SS 1D0EA 4Y2IA 2Z4PA 4ZMMA 4ID5B 1P1TA 3WX4A 3WZ0A 3GPAA 4U95A 3ZZYA 1FWLA 1SCJB 2DXPA 1FWKA 3CC2S 5KG7A 3PV8A 4DR2F 3MECB 3CEDA 2HAFA 4LR9A 5B0BA 3G8SA 5KTQA 3ZC4A 2XEXA 4RW8A 1U1QA 1HI1A 2WZ1A 2EFGA 1FRIA 4ZIVA 4BC7A 4DX8H 5KT6A 4DV0F 1G4CA 2XLKA 2Y8WA 2RRBA 2CNNB 2X51A 3L09A 4O23A 3ETOA 1GFWB 1BY9A 2XY6A 1PYNA 2R7QA 3V6DB 3DRPA 4YHHJ 1FO1A 2F71A 2R42A 4NE9C 2M88A 3DOLA 4OLPA 2XSFA 3N28A 1C85A 3DNCA 1Q6PA 3O4UA 5BYRA 4ZJOA 5IV3A 1PJ7A 3JQMA 3I5BA 1EZZB 3S4OA 2XI2A 1WKJA 5ETRA 1CJKB 1NDLA 2C2NA 3ZZPA 2KO1A 1DTQA 1VK3A 1PTTA 3I7ZA 5KFCA 4YN3B 3RRGA 2GAGC 1XMQJ 4S0GA 3DRSA 1T9WA 3N5FA 1IKVB 3IAM9 1NB7A 1X4FA 1W2BR 3CJ8A 1QTNB 1FVSA 1U24A 5EGYA 2AKWB 1IBKF 4NPOA 3CDAA 3WHIA 2LQJA 4U7UD 2DD8S 3KLGA 5AE3A 4Z2XA 3K59A 2XM3A 4ZLJA 3MR6A 3DRXA 4HTJA 3TOQA 2C2MB 2DGWA 2Z2YB 4QW8A 3QAEA 1VJQA 5CABA 2ZHBA 1D09B 1S97A 1NH7A 4NEYA 4KFBA 1O5ZA 2OMLA 4C8OA 3R7BB 4IO1A 3IRXB 2LU1A 1RXOB 1X5SA 2N4DA 4RNHA 2KFYA 1ROFA 4B3SF 3TI0A 2AT1B 5D15A 1OEUA 1SUQA 3O4TA 1LWXA 3PM9A 1EIYB 1URNA 4C2MA 4HRFA 1FVQA 1TUWA 5HQLA 2M9KA 3CDEA 2DNQA 5B0CA 5DDPC 3O8WA 4JI0J 4C7QA 3AB4B 1L3SA 1WELA 1KVKA 2IBOA 4ZVSB 4F4ZA 5I42A 4N77A 3K17A 3CJ3A 2B4OA 4CVLA 3JTPA 2Y68A 5E0OA 3VCDA 3FGVA 2AJ1A 4EO6A 1NK9A 4RWWA 4ZN1A 3Q2TC 4PQUA 5JVHQ 2PMWA 5KFGA 3TYTA 1YPTA 1KQSR 5F8IA 2AM1A 2ILZA 4F4YA 3W61A 5IM0B 5IT9U 1YJVA 1YHQS 4ZVGA 2O3DA 1SUGA 1GQQA 1WORA 5C42A 2F1FA 2WVDA 2I0XA 4Y0FA 2MKKA 2BJ3A 2KT5A 2LMIA 4TU9A 4DV5J 2BQUA 4IFVA 3TVKA 2P9EA 1XXVA 4MKVA 1QSSA 3MCOA 5GTJA 5IFMA 5KA0A 2FVCA 1RT5A 2HVDA 4ZVFA 1LWEA 1TL1B 2N4CA 2W2QP 4OX6A 3GIRA 2QLBB 4I69A 1G3OA 3H98A 3R6LB 1R6HA 3HD2A 4P10A 1C4AA 2BKPA 3FCWA 3KHRA 1N36F 3MEEA 1W7KA 2RILA 3F44A 2CWKA 3SCIE 2NT7A 1GG4A 4RW4A 3UD4P 4YMEA 1F3FA 1MNEA 1S7HA 2FJVA 4DR1J 1T8EA 2RQMA 1RWPB 2GGPB 3I6PA 4OYAA 1Y9OA 3EDQB 4MMOA 2IAJA 2CJBA 4CWBA 4ICZA 2OOQA 1BXNA 1NXIA 2OO4A 3QCNA 1FDDA 4Q7AA 1N6QA 1UKUA 3OD2A 3KMQA 4HDHA 1E6YA 2LVWA 5C24B 3WIUA 4N41A 4X4UA 2G59A 5HN0A 5J2PB 4AXIA 3M9NB 1RWWB 3QSYB 3JB9k 1XJWB 3D6TB 4V1Ak 1SJQA 1NPKA 1S12A 2FZCB 3Q8RB 1ZPVA 3TA0A 1YSJA 1NJZA 1PGZA 4ZPVR 3D3CJ 2IMOA 5FIIA 2JLGA 4I7FB 4CH1A 2GZOA 3PEJA 3IN5A 1WF1A 4GC7A 1NJIT 2JJ4D 3CCLS 5GVQA 3W5ZA 2G0JA 4ZHRA 4EYHB 1X9MA 3GSDA 1ZM2A 1ZAWA 3ITHA 2BOPA 1UPMB
chains in the Genus database with same CATH topology
3CM3A 2ASYA 2LQ9A 1UMJA 4F50A 1JXLA 4K5SA 1YTYA 1GTHA 2XC9A 4MJKA 3O44A 1EETA 3F81A 4HLBA 3QCGA 2IM3A 3M2UA 1YJTA 2PQ5A 4Y3CA 5F8GA 1TK0A 3AQPA 3BGLA 2HWHA 4A47A 2DRAA 5KT3A 2Z2LA 4FXDA 3D0HE 3LWMA 1APSA 3DRPB 3BGUA 2UUTA 4ECWA 4I2QB 3K7RA 3DLGB 4CO0A 5HMXA 5KFPA 1W2IA 4C8YA 1D8YA 2RNEA 4CNYA 2NYIA 5HL7Q 4ECYA 3RGOA 2YH0A 1D1UA 1ZC0A 4IFYA 4RDDA 2DNOA 4GFUA 1ZETA 2Q3PA 4IOAQ 3QCHA 1XERA 4C8MA 2X1FA 2D74B 5B09A 4YUDA 1L3UA 4DGXA 1IBMF 4AZ1A 4TNOA 1S0VA 5J2NA 4C3LA 4RW7A 1G7GA 4EBEA 5IT0A 2MDAA 4CI0B 4O3NA 2V4RA 3BQ1A 1WHXA 5FLXY 4DL7A 1FKOB 2H02A 4DR3F 2FHOB 4ES1A 4KO0B 3PW2A 4FPRA 5MMZB 3CB4A 1S10A 1S49A 1N48A 2JEJA 4RBTA 4NLRA 4OHIA 4FYDA 4NZ6A 3VZHA 1RT7B 2LA4A 1I9TA 1HBUA 3DMJB 1GXUA 3H4BA 1HW8A 3DYAB 2F46A 2ZC3A 3BGFA 3J7ZT 4DFJA 3NG8A 2L08A 2PO4A 4ELVA 3M30A 1LWCA 4QU6A 3KLIB 3PY8A 2VFVA 1S1WB 4Q5VA 1S1XA 4DR5F 2JJDA 2ZBCA 1O0PA 4K0KF 1JLQB 4YEAA 1C2PA 2XZWA 3MEEB 2B4VA 2FJMA 1F0XA 1T05A 3TUIC 1GT8A 4IG3A 5KFVA 1OEOX 3GIIA 2UV8A 3AA8A 4NZ0A 4LF8F 2QDMA 2CMAA 1YTSA 5EUHA 1WG1A 1ZM9A 4PPZA 4YB1P 2W8KA 3WC2A 2DNYA 4PPDA 3CULA 3T5JA 3BDEA 1LK7A 1VBYA 2R0BA 1MWZA 2MZ1A 5J2MB 1P15A 2HNQA 2DGTA 3QCBA 1HWJA 1UJ6A 3VZIA 1VHRA 2DH8A 1HBUB 3O4SA 1VQ6S 2JHEA 3HHLA 3TNVA 3IXQA 3MR3A 5K14B 1ZAXA 2BJEA 5KT5A 4WF9Q 5EHHA 4RU9A 1IXKA 4KRWA 2W4DA 5B0EA 3SQGB 2L41A 2ZE2A 4NWBA 2JL9A 1FXLA 2F8HA 2KXHA 3CTRA 2M0GB 4NXNF 3MPWA 4NRUA 1VBZA 1NZ7A 3PR4A 2LEPA 2IVMA 5DO2A 5C25A 4F4KA 2B3OA 1C1CB 2XMKA 3LAMA 2NR0A 3VAGA 3C66A 1DHMA 1SXLA 1U7LA 2VD3A 4Q2MA 2LEBA 3UD3P 1R8BA 2HHXA 2KJVA 2DO4A 1RTDA 4WIIA 5DDOC 5D4LA 1KEKA 2CPHA 1PTYA 1KVIA 5K22A 2IVYA 3D54A 1S77D 2LU2A 1FKOA 3PX4A 4JI1F 3DLGA 4OHVA 3HHKA 4EO8A 3M8SA 2H5EA 1X24A 4RW6A 3RAMA 4LFAF 1S1VA 1FDNA 1YIJS 2HHHF 3TO8A 3LO3A 4QAPA 4PQAA 3DXSX 1ZAVA 2FPHX 3U02A 3NRBA 2EFQA 4N47A 3D1OA 4L3NA 4I1TA 4I56A 4KGMA 4MK9A 5ITHA 3SI8A 3VALA 3G9CA 4YFUA 5B0DA 3EX7B 2ZHAA 2AYMA 3GR0A 5C24A 1L3TA 2YNGB 1NK8A 1ZH5A 2YKOA 4UW2A 4EWTA 1SQEA 2FHMA 2Y1JA 3THTA 3VF0B 1YJUA 5CZVA 1NAQA 3QCEA 3KLEB 3RO1A 4KBIA 2DHGA 2R2TA 4RH5A 2DTJA 4HEA9 3PJWA 5IZHA 3OLRA 2GNKA 3FZ2A 4HVZA 2PT0A 1NKBA 1PA1A 1YVFA 2OPPA 3MUMP 4WJBA 2VUGA 2OFGX 4X4QA 2CJAA 5A8WB 1DLOB 1WF0A 5AXNA 1U45A 4DUYF 2R8KA 3L7OA 2R7RA 2VG5A 3MUVP 1OEVA 1Y3KA 5C25B 2ZH3A 4UY85 2C7SA 2FJBB 3MHYA 2BJDA 1VRTB 4WU2A 3CXCR 5HBMA 1XBWA 3CC4S 2FVSA 1FNOA 1PC4A 4B04A 5CYQB 3BGRB 2UUCF 2QA2A 3ZM1A 2EFOA 1FERA 2MY7A 4ZPBA 2WTFA 1HQUB 2HG4A 3E3XA 3HVTB 7FDRA 2NS1B 2BDPA 2NQPA 3KFWX 2NSBA 4XK8C 1UW4A 1K1SA 1SKRA 3QCIA 3AY0A 2H04A 3IAS9 1PC5A 4ZLPA 2V8HA 3JTOA 1L8GA 2CM3A 1FA0A 1U1RA 1S1VB 3UQSA 1I57A 3RZ2A 4JV5F 3PX6A 3QYYA 3O6QA 1QSYA