3MMJA

Structure of the ptp-like phytase from selenomonas ruminantium in complex with myo-inositol hexakisphosphate
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
314
structure length
314
Chain Sequence
QTVTEPVGSYARAERPQDFEGFVWRLDNDGKEALPRNFRTSADALRAPEKKFHLDAAYVPSREGMDALHISGSSAFTPAQLKNVAAKLREKTAGPIYDVDLRQESHGYLDGIPVSWYGERDWANLGKSQHEALADERHRLHAALHKTVYIAPLGKHKLPEGGEVRRVQKVQTEQEVAEAAGMRYFRIAATDHVWPTPENIDRFLAFYRTLPQDAWLHFHSEAGVGRTTAFMVMTDMLKNPSVSLKDILYRQHEIGGFYYGEFPIKTKDKDSWKTKYYREKIVMIEQFYRYVQENRADGYQTPWSVWLKSHPAKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Substrate binding in protein-tyrosine phosphatase-like inositol polyphosphatases.
pubmed doi rcsb
source organism Selenomonas ruminantium
molecule tags Hydrolase
molecule keywords Myo-inositol hexaphosphate phosphohydrolase
total genus 111
structure length 314
sequence length 314
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14566 PTPlike_phytase Inositol hexakisphosphate
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1690 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3mmjA01
3.90.190.10 Alpha Beta Alpha-Beta Complex Protein-Tyrosine Phosphatase; Chain A Protein tyrosine phosphatase superfamily 3mmjA02
1QZ0A 3V0HA 4WOHA 1BZCA 5AWXA 4JMJA 2I6MA 5M43A 1FQ1A 2E0TA 2I42A 2QDMA 1RXDA 2HY3A 2B49A 1OEVA 1U25A 3V0EA 4KYQA 1Q6NA 1NNYA 2I6JA 4OHHA 3OMHA 1C88A 2I4EA 3V0GA 2PSZA 1PA1A 3RGQA 4S0GA 1ZCLA 2GJTA 1GWZA 2VEYA 5K9WA 4GE5A 3I80A 3I7ZA 1Q6MA 1X24A 2J16A 2GWOA 1LARA 3QCFA 3AWEA 3V0FA 2F71A 3O3LA 4JBCA 2G6ZA 3CM3A 2I1YA 4OHDA 1T49A 3ZM0A 4GRYA 3F9AA 1SUGA 2B4SA 4I8NA 2I3UA 1LYVA 2HVLA 2M3VA 2QBRA 2A3KA 1GFYA 3S3HA 1PH0A 4RI4A 5BZXA 3RZ2A 4Y2EA 1C86A 4NNDA 2CM2A 2QCTA 3QCDA 2F6FA 1OETA 3S4EA 4QBWA 2CMCA 2Q05A 3SR9A 1V3AA 1P15A 1NL9A 4J51A 3V0IA 1BZJA 1C84A 1G7FA 2BGDA 1G1GA 2BV5A 1WCHA 5KADA 1YTWA 2CMAA 2QBSA 3F9BA 1ECVA 4GFVA 1C87A 1M3GA 2HCMA 2VEXA 3D44A 3O4SA 2H02A 3RO1A 2C7SA 3D42A 1Q6SA 2C46A 1MKPA 3H2XA 4IKCA 2GP0A 4ZI4A 2P6XA 3BRHA 5BZZA 1L8KA 1FPRA 2H4KA 4RH5A 1R6HA 1WRMA 1D5RA 3EMUA 5GTJA 5KA9A 5BUGA 1G1HA 3ZM3A 2H04A 1LQFA 3MOWA 3QCBA 2QBPA 1YFOA 2ZMMA 3QCNA 3B7OA 4HJQA 3MMJA 4D3QA 3QCMA 2F6YA 4MBBA 4PYHA 4ZN5A 3D1HA 4RHGA 2VEVA 4NYHA 3PS5A 2CJZA 2JJDA 2CNGA 1L8GA 1T48A 2BZLA 4ICZA 2NT2A 2NT7A 2F46A 1XBOA 2J16B 4BJOA 3QCHA 4GE6A 1U26A 1ZC0A 2Q47A 4NWGA 1YGUA 1YTSA 2DXPA 4GWFA 2B3OA 1PXHA 2B4OA 4H1OA 4RI5A 2G59A 5KA7A 1OHDA 1ONYA 4QUMA 3ZM2A 4NWFA 1NWLA 1C83A 4QAPA 2FJNA 4GE2A 4NX8A 3AWGA 3EAXA 3F81A 3F99A 5K22A 4OHLA 1QXKA 4KYRA 5KAAA 2I4HA 5EHRA 3V0JA 3QCEA 1G1FA 4WTYA 3BLTA 2PT0A 2FH7A 2BIJA 2I4GA 2F6WA 1OEMX 2VEUA 4OHIA 1OEUA 3EU0A 2PI7A 4TVVA 1ONZA 1U24A 3A5JA 2CNEA 1YN9A 2F6VA 2CM8A 1JLNA 1KAKA 1XXPA 2NZ6A 2PBNA 3A5KA 5K24A 4GS0A 2NLKA 2I6PA 4D3PA 4R0SA 4JNBA 4QBEA 5KA4A 2PQ5A 3I36A 5IBMA 3ZMQA 1OEOX 5I6VA 5KA8A 2OUDA 3S3FA 5BX1A 1PTTA 4H34A 2ESBA 4D3RA 3O4TA 2B07A 2I5XA 3QCCA 4QUNA 2H03A 3SMEA 4DGPA 4ERCA 2FJMA 2HXPA 3S4OA 5K9VA 3GXHA 2B4PA 3QCIA 5IBSA 3ZM1A 2OC3A 1PYNA 2QCJA 2F6TA 3QCJA 2B4UA 1NWEA 1BZHA 1OHCA 3S3EA 2HC2A 4AZ1A 2IMGA 2YDUA 2CNIA 2BGEA 4GFUA 1PTUA 1I9SA 2NV5A 2HNQA 3D1QA 4WU3A 5MMZB 1Q6JA 3AWFA 2QDPA 2CFVA 1XRIA 5KA3A 2RF6A 1YZ4A 1EEOA 1YWFA 2OZ5A 1ZCKA 1XM2A 5HDEA 3O5XA 2J17A 2OOQA 3EB1A 2CM3A 2I3RA 3RGOA 3N0AA 1JF7A 5EHPA 1J4XA 2I6IA 2Y2FA 2H4VA 3QCLA 2I6OA 3NMEA 2HB1A 4RH9A 1AAXA 2QBQA 4QAHA 1A5YA 2CMBA 1C85A 2F70A 2WGPA 4Y14A 4R0TA 2Y96A 5KABA 2AZRA 1G4WR 2MBCA 5KACA 3QKPA 1RPMA 2SHPA 3U96A 3QCKA 2A8BA 2P4DA 5K23A 2F6ZA 1Q6TA 2CM7A 1PTYA 2CNFA 2VEWA 3GXGA 3M4UA 1I57A 2H4GA 1I9TA 1KAVA 4PVGA 4GRZA 3QCGA 4HRFA 4RKKA 4HJPA 3ZMPA 4RDDA 3F41A 2CNHA 4KI9A 1VHRA 1PTVA 1FPZA 3EZZA 1OHEA 3OLRA 1PA9A 2NTAA 5KA1A 2QEPA 3V0DA 1G7GA 3D9CA 1NO6A 4B04A 3ZV2A 4ZRTA 3CWEA 4BPCA 1G4US 4WU2A 5KA0A 2QDCA 2ZN7A 3BLUA 3BM8A 4JMKA 4YAAA 1YTNA 1NZ7A 1T4JA 3D1OA 2HNPA 3MOZA 2HC1A 5LXQB 5K25A 1EENA 3S3KA 4R30A 3QKQA 4OHEA 1ZZWA 2PA5A 1OESA 1WAXA 2R0BA 3O4UA 2I75A 5J8RA 4Z6BA 3LJ8A 4DGXA 1Q1MA 1YGRA 1Q6PA 5KA2A 2AHSA 1XXVA 4YR8B 1YPTA
chains in the Genus database with same CATH superfamily
4LFBJ 4FVCA 2VZ9A 3V6DB 4DUZJ 4CLSA 3EX7B 4O3SA 1RT2A 2FJAB 1S6QA 4FYXB 5A8RA 5F8MA 1XNQF 4DV3F 2J76E 3OR1A 4JMJA 2E9TA 4WE1A 4MK9A 1FNXH 2X5OA 3QO9A 1A6LA 2LEAA 2C2OB 2HNDB 4GS0A 1OEVA 2I5JB 4JI0F 4NLYA 3RB3A 2UVVA 3MF5A 2VODA 1U25A 3DRSB 4A8KA 1HHTP 5M2RA 2RT3A 2A3JA 1KQKA 2EKNA 4X66J 3NL0A 3D4JA 2QLBB 3BH6B 1ICEB 1CULB 1I1GA 3VGVA 2I6JA 4WPAA 4FPIA 1W25A 4CH1A 4ECTA 1C88A 2AT1B 1SQFA 4P2XA 4ZP6A 2UVWA 2K1RA 3FCHA 2I4EA 1RTDB 1X5TA 2DY9A 4JV0A 1S9GA 1TELA 5LT5A 2AGPA 2QA1A 4F0KA 3A13A 2BA9A 4DSEA 4V19J 3GIIA 4OHZA 2G1DA 4I69A 5SUHA 1HWKA 2VG5B 3IAS9 3G86A 2DGSA 3NS6A 3IR7B 2V4JB 1T9WA 2MKCA 3SFUA 3SXLA 3W5XA 4U67Q 1R31A 2O1PA 1QAYA 2CDRB 3LP2A 4JI7F 1JNZB 3ZC4A 3KLHA 5CQGA 2ADBA 1RCOB 4OI0A 3NLCA 5KT4A 3WC2A 4B3SF 1Q6MA 4ZVPB 1RT4B 2J0QD 1X24A 1EP4A 4H4MB 2R8IA 3Q24A 4DR2F 4DR1J 2AGQA 1DZ5A 2HAIA 3FRYA 4JI5F 1UAGA 1N0VC 1L3SA 1FKAF 1Z2LA 2GO8A 3IRXA 3HVRA 2YH0A 3I5CA 3V6KA 5EN1A 1N5TA 5KFXA 2B8PA 2DEIA 2HWTA 1N5QA 1RSCA 1VRQC 2H3EB 2JLFA 2OMOA 3MM6B 4Y2CA 2VJUA 2KFNA 2V8PA 3O3LA 1WC6A 4XAKA 2OJ3A 2G6ZA 1URRA 4PWDA 2FHOB 4Q2LA 4F3MA 3EUNA 1RKIA 1XN9A 2QJ3A 4JV2A 4AL5A 2B4SA 2IPOB 1KKHA 3MR3A 1Q8BA 4HDHA 5KG5A 3MM8B 2DGQA 4YY3J 3H0PA 1HWIA 1SVDA 1RABB 2AEJA 4C8LA 4DR3F 1I94J 2WVBA 4BC7A 2CQCA 2C42A 1SQEA 3RB6A 4LF1A 4KT0C 2CPEA 3C15A 4U96A 4RI4A 2CPXA 1DURA 2V69A 4UT4A 3W5YA 4Y2EA 2Y3YA 3P5TL 3QIPA 4LVNP 3DDIA 1N8RT 1TV6B 1WF1A 3I0RB 4HDGA 4Q44A 3Q8YA 5A8KB 2QCTA 1Y11A 2MZQA 2QEXS 2RUGA 1LXJA 1KR4A 1SJRA 3R5CA 4M8LA 3RAXA 1J5EJ 4FYVB 4ZPTR 2BQUA 3TX8A 3S4EA 3FMBA 4F3OA 1RTJA 1CJUB 1NBEB 3HJVA 2NSBA 2CQGA 5LL6d 2IJNA 1FJCA 1R43A 1QE1B 2LEPA 4YB1P 3MM6A 1V3AA 4FDFA 4NXMF 1FK9A 1B7YB 4A8MP 2ASDA 3GLJA 3MMCB 5HVHA 1HNWF 4AZ1A 4ZVQB 4J51A 1RWPB 2DJWA 2YXLA 3E01A 3K89A 3Q2SC 2J6TA 1TMMA 4NWBA 1DAXA 3DFEA 3NG8A 2DR6A 1GT8A 1OPIA 4KO0B 1CG2A 4TY8B 4E8UA 3LPEA 5A8WB 3E2EA 1G1GA 2BV5A 2QMUB 2AYEA 4HLBA 3D67A 1UCNA 2POKA 2OELA 4NLWA 5F41A 3PW7A 5HQ8A 3LAKA 2F8HA 2KKHA 2ZJQQ 1UVJA 4K0KJ 2C2NA 2CMAA 2HFSA 4I7FB 3KG1A 1WF2A 4JUZA 5JUMA 2HCMA 2DNNA 3AXMA 1IM6A 3HVTA 2HHHJ 4KFBB 2XZTB 5FLXU 3OTOF 2K1RB 1BWEA 2XTJP 3D42A 1TMJA 2XLIA 3MEGB 4EU0A 1E6VB 1V3ZA 2C46A 1VGYA 4IKCA 2GP0A 2ZEJA 2Z58B 1T3OA 1JLGA 2QLJB 3NEKA 4QIGA 1CVJA 3KJVB 1FPRA 3LW5C 4K8RA 2GIRA 2H5EA 4GKJJ 1VQ5S 1GTHA 1J5OA 1AW0A 2J16A 2M9KA 2Y9HA 2OGUA 3TAMB 2YNGB 1UWBA 3NNCA 2IAJA 4C0BA 5KA9A 1FWPA 1X5SA 2PA3A 3OXLA 1FXLA 5L9NA 1G1HA 3QSYB 1LEOA 1M5SA 2GMJA 4KRWA 1TV6A 1U2FA 3DOMA 1PKUA 4JV1A 5DDQC 4DOZA 3K0JA 3EVWA 4K4ZA 4IG0B 4JV5J 4HT7A 1YFOA 3H2VE 4N77A 5KFGA 3PX0A 1Z1ZA 4F4ZA 3LA0A 1HMVB 2MTLA 4C13A 2XMAA 1Q0NA 3NRSA 4ZN5A 2B3TB 4ED6A 3HO1A 5CCMA 4ECYA 4JI7J 1VRUB 5CZXA 1S1TB 5A5EA 3TJ8A 2YX7A 1TTHB 4A8YA 1SKWA 1R8CA 2LECA 4NXNF 2VU5A 5H9FK 2CZ9A 1TL3A 2JSXA 5KFYA 2JJDA 2R2RA 4N47A 1V5VA 2FZCB 2WW4A 3PR4A 2F4VJ 2GHVC 4NLSA 2KM8B 2DHAA 3US5A 1VOMA 3HVWA 4Q8FA 2HKEA 2YNIA 1HW8A 5GAGI 1KS2A 5LJ3Y 1SJ3P 2H4WB 2OD4A 2GHWA 1OY9A 3Q83A 4BJOA 1T02A 2MZTA 5DG7A 1S1VB 4G1QA 4X4OA 2C3UA 4YB7A 3CB4A 2OUGA 2V50A 3TVZA 2VC0A 2VH7A 3KLEB 2YNFB 3DHXA 4WFYA 1YITS 2P6TA 2VKRA 3KLIA 4WFXA 4R5PB 3GR1A 1T9TA 4I6WA 2G13A 4ENOA 2W9CA 3RW6A 1HBOA 2B9WA 3GFYA 4WK3A 1WG1A 3T1HJ 1SJ4P 1B0PA 4U7CA 2MLXA 2V2ZA 4NX9A 1LV5A 3BSCA 1K44A 3IBFB 4I2PA 4O0NA 5HVGA 2LMIA 2WAQD 2ZWPA 5EX0A 5KT5A 3EGVA 1Q6NA 2RNEA 4K4TA 2FJDB 1RT1B 3EWGA 5IWAJ 3TUZC 4B9UA 3QJPA 2DITA 2AU0A 2YNGA 4U6PA 1K1QA 1KBRA 2B7BB 3I9V9 4KY3A 3O44A 2LU1A 2M2BA 4IKAA 4TVAB 5AXMA 3UD4P 4NRTA 3U1LA 3NGSA 3C66A 5F8GA 2RRAA 1OHDA 3TJAA 3HZGA 2RS8A 1S72S 3M6VA 2EFQA 1HNXF 5T14A 2C1EB 4P2FA 5D4OA 4AQYJ 4IDKB 1IKVB 1RHMB 1RJJA 3TZXA 1VYAA 2JOQA 4QIVA 4UY8T 2PI5A 4DSJA 1NWLA 1EJ7L 1JBWA 1HBNB 1RWOB 2CWXA 4UTGA 2QL7B 1JLEA 2IJFA 4K50A 4NEYA 4GE2A 4PQUA 5KFKA 4PG7A 1U49A 2YWWA 1PGZA 2YBVA 1HYSB 2XHWA 1T9XA 2EFPA 2ZVSA 4ATNA 1IN0A 4I7FA 3M2VA 1BHNA 5BR8J 3K2YA 2JEJA 2UUAF 3MOJB 4NYZA 3F99A 1NK5A 4OHLA 4K4YA 4DR6F 1T9VA 1VRUA 4U8VA 2ZH7A 5F8JA 3KK2B 1PG5B 1YBUA 2YKAA 2DKOB 3UN3A 5DRKA 4HEA9 1GTEA 3I87A 5HP1A 3MM9A 1VFJA 5KFOA 4J5OA 4CLYA 5BYQA 4AL6A 3DLLQ 1I6JA 5EHRA 2DEJA 3V0JA 1SIWB 1OJ4A 4O4RA 1L3UA 4QU7A 2UZAA 3GJRB 3HI9A 4LSLB 1K8AT 3KUEA 3GJSB 5C42A 2HHTA 2QN6B 1QDUB 2PT0A 3W2WA 1HWUA 1NH7A 2DISA 4AXJA 9ATCB 1UWBB 2IDLA 2DRDA 4ANDA 5C25A 1MLAA 2A18A 5K8MA 2ZHAA 4GC6A 1RAFB 3GJQB 3N01A 3RBZA 5KFFA 2DNMA 1SL2A 2G1HA 2DXFA 2R42A 3I55S 2IBOA 1N36J 2HMIA 2V4JA 2DH8A 1FF2A 3BPSP 2B43A 3KDOA 1KLMA 2HWIA 2R2UA 4J9LA 1K73T 5J1EA 4LF4F 3MECB 1NSQA 5A0YB 1NKEA 1YZ6A 3RU0A 4CVKA 3NWRA 1M5PC 3HHEA 3GMGA 4KH0B 4NLPA 4EBDA 4LRFA 2V2KA 5D8HB 2V8DA 2R7QA 1F2HA 4ZVUB 5EDWA 3G6YA 1JJ2R 1GXUA 2NXJA 5EX3A 2R7XA 4HACA 3KK2A 4GVBA 4MJKA 3GV5B 4C3MA 2MZSA 3EZZA 3IMQJ 1RAAB 4RW4A 2HWHA 4FPRA 1SXLA 4LF9J 1FESA 1JLNA 2NZ6A 3N0VA 2CRLA 4DS4A 1HHSA 2N4CA 4DL2A 3RBEA 2PO4A 3QAEA 1ROFA 2HHPA 1R0AB 1N33J 4D3PA 1H2TZ 1RAGB 3UR0A 4X65F 4BHQA 2VA3A 2CJYB 2N82B 4C97A 2JC0A 5DDPC 4PPZA 1JJHA 2CNKB 2RF2B 3MMAA 5D0RA 2FUG9 3VGSA 4X4PA 4L6V3 2ZKUA 1S99A 3I36A 4PRFA 3CJ4A 1RE1B 1OEOX 2C3OA 2VFRA 3W5ZA 4OMFG 3S3FA 5BX1A 2EK6A 3C6UA 3DN9A 3BEGB 4QIFA 2XM3A 3TI0A 3IG1B 5LSRA 4LFCJ 3C46A 1X4FA 3A12A 1P31A 3C14B 2M8HA 4ANCA 1VI7A 3D28A 5HO4A 4A48A 5LMNJ 2AJ4A 1QSYA 4GC7A 4D3RA 3K5OA 2HNYA 2C2EA 3M2UA 2B07A 4HV4A 2CPJA 3CDBA 3GR0A 3QCCA 4QIWD 4QUNA 2UU9F 2CUYA 2I38A 2VD3A 5IS2A 5H1SV 2H03A 3H4DA 4HH0A 4DV7J 1FRMA 4MK7A 1VMBA 2GFFA 4MKVA 2F00A 4ZP8A 3BGLA 3R8YA 4X4QA 3A3OB 1RT3B 2H4YB 4QW9A 2ZH5A 3THVA 4IOAQ 1PIEA 4CH0S 4QU6A 2YKNB 3M8PA 2W9AA 4RBVA 1D9AA 4RNOA 1U0HA 5KT7A 3NKYA 3UD3P 3KNGA 4R25A 1IR2A 1LOUA 2WVDA 1VQKS 4LF8F 2K2PA 2OSRA 3TUPA 1RI7A 4Y14A 3EGWB 3QCJA 2M70A 4ETXA 1OHCA 2CADA 2DNGA 1Y0HA 1BGXT 1P1LA 3GSDA 1TKTA 3R7SB 4D3GA 1O51A 1U8WA 4DQPA 3VVUA 2GA7A 1KOHA 1UWAA 4OZJA 3SBMA 4X4SA 1HNVA 3RG6A 5CD4A 2CYYA 3DRRA 3HKZD 4JI1F 2BGEA 1TUWA 2HSEB 1LK7A 4WP9A 4N41A 4LJMA 4V19X 2B3OA 1LQ9A 3MAAA 4Y2IA 1HWJA 5D3GA 1GEHA 3AWFA 1XRIA 1CBKA 5KA3A 1XQIA 3VTIA 4P9SA 4WP3A 1QAJA 2VPWB 1YZ4A 3CWJA 1EEOA 1FXRA 2J5AA 2DHGA 3TVKA 4J9PA 5HATA 2W9CB 3LUYA 1S57A 2OZ5A 4JP8A 1JLQB 3TO8A 2IAJB 4C3KA 1AROP 1ZCKA 3D66A 1MW7A 3I31A 4GKKJ 1MWZA 2GVZA 1M5HA 2P9EA 3C6TA 3CDUA 4ZN3A 3IG1A 2AGOA 4ZVSB 2HFOA 2FLLA 2KVIA 2J17A 4GO7X 3W60A 2Z56B 3RGOA 5CAAA 4RW7B 4IFVA 3S8SA 4B3MJ 2E1RA 2Z30B 1QTMA 1J4XA 2CFXA 1ZAWA 2QV6A 1E8CA 5D77A 4RW4B 3UPFA 1W78A 3KJVA 3T5HA 3RR8A 4ELUA 2B6AB 3IM8A 3QCLA 2HVDA 4P2SA 3CJSA 3K17A 2CG4A 2MY7A 2WSFC 4YHHJ 4DL3A 2DGUA 4C7QA 1NK4A 1S6PB 4UF4A 2XC9A 1BD6A 2CQIA 3N6LA 4ICLB 4DV6F 5HBMA 3DKDA 3BN7A 4CO4A 4K4VA 3OVSA 3P49B 1U2CA 3TA0A 2V63A 2C3YA 3Q89A 4M5LA 4DHVA 4DV1J 3GFXA 1HI1A 3WIVA 2UXCF 3RTVA 2VICA 5A5FA 3RGQA 2NREA 5ETLA 2HEKA 2MZRA 1SC1B 2ERRA 5KABA 2QE5A 5KFPA 2IFXA 1S1VA 4DL0C 2RF2A 3MMAB 3RB4A 1BC6A 2AZRA 2HBZB 1EETB 4Y65A 2UVUA 2X1AA 2W01A 2A2DA 3BQ1A 2MBCA 1Q16B 5F9NA 2C2DA 1BWVA 3QKPA 5F0WA 3M8QA 4ZVRB 2HC2A 1YJUA 1X9SA 4ZVEA 5LOQA 5DQIA 2DYAA 3F9BA 2R2TA 4KV8B 3DRYA 2R7OA 3NCPA 4USWA 1KOOA 4NI2B 2HHSA 3QWUA 1F5BA 3G71S 4KGKA 2XPCA 2CNFA 2ROGA 1MU2A 3DRPB 4DG1A 4DFKA 3GXGA 3EE3A 4OX7A 3W2VB 1P3DA 1WF0A 2JHEA 1D3WA 5EUHA 1SJ1A 4ICLA 1VQOS 2E44A 2XS5A 4NMXA 3U27A 4GRZA 5J1NA 1D9DA 7FDRA 3ZTRA 2GC8A 4NLXA 4UOHA 3OW2R 2F6FA 3QCGA 3NCRA 1D09B 1TVRB 1UPMB 2KU7A 3J7AN 2PEBA 2Q3PA 1RT6A 2HVHA 3J81U 3BS9A 3ZMPA 3Q8VA 2W2QP 1XMOJ 1SQGA 1ITPA 3M2RB 2G9OA 4DL7A 4RJVA 2RH3A 4O4GB 3M05A 1YHQS 3M32B 4KHRA 5M2PA 1FPZA 3CC7S 5DLGA 5F3TA 1D8YA 1N0UA 1SV5B 1WC1A 3R7BB 4DCOB 5HQMA 3ZFVA 3PKYA 3CCQS 5EHHA 2GAGC 1J5OB 2HZVA 4K4SA 1PO6A 2NTAA 2OPPB 4NLVA 1S7HA 2M52A 1YJ7A 5E3CA 2DPJA 1JJ4A 4ECXA 1G7GA 1VBKA 3OUYA 2G0CA 5GVQA 4U7UK 1NNYA 2AM2A 1FX4A 4LFAF 3NMRA 3DGPB 3N4WA 2IM0A 4EO6A 1G3OA 3BO3A 1UAWA 1M0SA 3MPYA 6AT1B 3KLFA 4DF4A 3K5MA 3MXHP 3HD1A 1UEVA 2LVWA 3LP2B 3FC9A 5KA0A 4LF7J 1H6KX 2JNJA 4FKYA 3HM9A 5E5NA 2QDCA 3FQKA 1UFWA 3NS7B 3OFEA 4ZPWR 1TKZA 3FRZA 1Y10A 4I0WA 4ZA1A 5C24A 1Y7PA 3VAGA 4LMZA 3BM8A 4YAAA 1IBLF 3Q8UA 1SL0A 3M8WA 2Y68A 3QGIA 3GV7B 4PXDA 3JXOA 1QVFR 1T4JA 2BE9B 3UO0A 2HC1A 3S1TA 1MWYA 3IWNC 1U7LA 4KGXB 4KH1B 3V4IA 1EEHA 3MPWA 3H7HB 1PC5A 5D0GA 5D0HA 3R97A 4PWDB 3S3KA 2IBKA 2YNIB 4HVZA 1B0TA 3QKQA 1T0TV 5L8RC 2W2NP 3KYLA 3BO2A 4K5RA 3BSOA 2AJQA 1ZZWA 3HF5A 2QGFB 3SFGA 1XEZA 2CJAA 2R0BA 3O4UA 5J8RA 1HWLA 2QO3A 1Q8IA 2WB1D 3CJ2A 4DI6A 3Q23A 4ERDA 2OEMA 4NL5A 4DGXA 4ZCIA 5GMKa 1TL1A 3PNIA 3POTA 2ZHBA 4ED1A 2PC6A 4IRKA 1DQAA 2NXUA 4O44A 3BR8A 2W1BA 3HSGA 2DT9A 4QOTA 3GYNA 3PRBA 5HK4A 2I6WA 3EZ5A 4MIAA 3BN4A 5KFZA 4ZLLA 3JYTA 2AYBA 1XXVA 4F2RA 1H2UX 1O6XA 3BF4A 2AZ1A 3X3UA 4OJGA 1YPTA 4K4XA 1IKWB 2NPFA 2KH9A 1Q95G 5KG2A 4L3NA 1QZ0A 5KFQA 3FDSA 5KFBA 5ETTA 3V0HA 2LCWA 3H2LA 5K8NA 4ETZA 5KTQA 3H40A 1NZAA 4B3TF 5AWXA 1WI6A 1IBCB 2ADCA 5M43A 3KKFA 2OFHX 2E0TA 2LXFA 1RXDA 1T05A 3M30B 1OYDA 4UOFA 2KRRA 1GMWD 3CC2S 1P9QC 1C0UB 1WEXA 3LF0A 2KVQE 3RAMA 2EXUA 1FXDA 2PEHA 3D7SB 2ZJRQ 3NS5A 1QUPA 3M7VA 4F4KA 4KYQA 2V6AA 4L72B 2D7SA 2AZ3A 3CGIA 4RW7A 3ILIA 4L74A 2M5YA 3NGUA 5KG4A 2JDJA 4CO3A 3OMHA 4OHHA 3PDNA 4KB7A 3ZTOA 3MUTP 3UCUP 2JEGA 3VZHA 4LF8J 4B3RJ 3WX8A 2VPXB 3QMQA 1G7CB 3V0GA 3PVXA 3I32A 2IRUA 4P7VA 1YGYA 2HQDA 2J9CA 1S6OA 3GB0A 2GQ2A 4A8OA 5HROB 5J1EB 4DV5F 1GWZA 1VQNS 1ZCLA 1EQ0A 3P45B 2R8JA 2ZC3A 4ZP7A 5AE1A 3QRPA 2X51A 1GXLA 1BUXA 2OAUA 3CCZA 2ZOGA 1Q8LA 3DGPA 3CO9A 2UV8G 3NP5A 4OV6A 3W9HA 4UUXA 5LJ5Y 3KK3B 3PTWA 2WSEC 3M6XA 3UW1A 4XIUA 3I7ZA 3TRGA 4RWXA 3W2WB 4ZLPA 3AJ1A 5F0UA 3J7YU 4LUBA 1U1KA 1VLYA 2P9CA 1FDBA 1RGVA 4DX7A 3W61A 3G6ES 2GQQA 1EX8A 3GYGA 3DC2A 4YQWA 2UUCJ 1B7FA 3QCFA 3QJJA 3N2AA 3V0FA 3DRSA 2VORA 4H4OB 2AX0A 1RWXB 1FFSB 1YG0A 3BV8A 3HHDA 2F71A 2UAGA 2EBEA 4JBCA 3IR5B 3IGNA 1RHUB 3SV4A 1R0AA 3G82B 3HFVA 3W9IA 4O3PA 4GO5X 4YP3A 4YR2A 1V6HA 3QLHA 3ZM0A 3AOCA 3T5JA 3CEDA 1G6BA 3V4IB 2DHHA 4C6AA 2PFDA 2J9DA 4KHMA 5LXYA 5DG8A 2KFYA 2DH7A 4JI4J 2QC3A 2XSFA 2ZITA 3FK4A 1LYVA 3W64A 2QBRA 3QGHA 3DLKB 4KGMA 1C1CB 2XEXA 3C16A 3FCWA 5HLFA 4RU2A 4QYZK 1GFYA 2A3KA 1HD1A 2CQPA 2XMMA 2FHJD 4TU8A 3RZ2A 2DGOA 3S01A 4XPEA 1ZPWX 2W8KA 1IKVA 2IMWP 1LW0B 2ILYA 2Q6BA 3DOMB 4Y2AA 2EFVA 2KG0A 4IUFA 1QY7A 2OTJS 2IA6A 1U47A 1OSCA 2FZKB 1VDHA 4IFYA 1C0UA 3OLBA 1FWKA 1DQ8A 1X0PA 3P96A 3F73A 1KQGB 1JMTA 4DPUA 1U0SA 2IA0A 3CCWA 5J1PA 2CMCA 2Q05A 4OLOA 4O4GA 1TZ0A 2HVZA 3SR9A 2A2CA 2QX0A 1RTJB 4H4OA 1ZBTA 1JLGB 3OL6A 3PZPA 1Y5LB 4MH8A 5IQ6A 4ZKAA 3P3DA 3QATA 4PEOA 1NM2A 1FRIA 4UOCA 1HBOB 2XY5A 1C84A 3V0IA 2YX4A 5DDRC 4C2MA 4WFBQ 3MWBA 5F8LA 2MEWA 2OHDA 5DG9A 4OYOA 2V4QA 1TL5A 1JNRB 1FFWB 4C11A 3T5LA 2RS2A 4Y00A 5DGBA 1NJWA 1DQ9A 2DXDA 3MI7X 5EWGA 1CJVB 2MDAA 2YPYA 3QYYA 1IKYA 1OMSA 5AJ3J 3MFHA 2UXBF 2ZDPA 3DMJA 4ZIYA 5KADA 1KWMA 2FVQA 1JXEA 1W26A 3PEJA 2RIJA 2YKOA 4J9KA 1SUQA 1ECVA 3WX4A 3BJYA 3IWLA 1T03B 1C87A 5E41A 3D44A 4NI2A 5GAGU 3AA9A 1AA1B 5D6GA 3RO1A 2EKYA 2DR5A 3QJLA 2DVIA 1KQSR 2KB2A 1N52B 2XMWA 4GMKA 4XTTA 3VALA 2Y1IA 5HANA 1RKJA 1MKPA 3NXZA 3H2XA 2P6XA 5BZZA 3A1YG 4KR0B 1L8KA 5B0FA 1KN6A 3QNWB 3B4MA 1VK8A 1EETA 4RLEA 1FWLA 1PILA 4LBHA 4PYDA 1QM9A 1R6HA 1N5YA 3DYAA 1IQZA 2GVZB 4AXIA 1WHYA 2X7IA 3BBCA 3LP0A 3L7OA 4USVA 1UJ5A 3FZBA 2NYHA 1L3TA 5BUGA 3H5YA 1BQNA 2LU2A 5L38A 5HROA 3BPDA 1YLXA 4ZPAA 3SZ2A 1RT2B 2HGMA 5A8RB 1BQMA 3MOWA 3CCUS 3FSYA 2OPRB 2ZMMA 4KTQA 1S6UA 4DXLA 4DX5A 1WHVA 3JTNA 4MIWA 3WIUA 3VQSA 2CXEA 3O8WA 3B7OA 1AB8A 4D3QA 5KFAA 4ZK7M 4QR1A 3AB2B 3KLIB 3VAKA 1AZSA 4PYHA 3D1HA 4DUTA 2GC6A 4DEZA 1MROA 2C2MB 3PS5A 1VQ8S 3ZO7A 4UUWA 4OIXA 1XR6A 4ECZA 2KJWA 2F8EX 3M2VB 4QQBA 4QWAA 1AUDA 1G1XA 3RRGA 1CQMA 5DJBA 1R8AA 2H65B 2VFVA 3NGTA 4KJIA 1K9MT 2CJZA 1A0OB 3J81Y 2IM2A 1RYSA 3NGRA 1NJZA 5J2NA 1S49A 2JC1A 5J2PB 4CNYA 1RU2A 1Q7YT 1ZZNA 1M1KT 5DZ7A 2BJ9A 2ZKTA 4F04B 3MDFA 3ZZYA 3DRXA 4AUKA 2AYGA 3PIOQ 4A8SA 3SQOP 1QLNA 1U1MA 5KG7A 2BE7D 3GP9A 1WNEA 1XBOA 2J16B 2UXCJ 3EMTA 2IYGA 4B02A 4JI2J 3UAGA 3NAHA 2FH7A 4NCGA 3QCHA 4HACB 1N32J 1RT3A 4BUCA 3FEZA 2PDAA 5FIIA 1JKHB 3PX4A 4ECWA 3PKMA 3FSXA 3IRWP 4GE5A 3V6HA 2Q47A 6FDRA 2OH2A 4A8FA 4ZPBA 4CTAB 3D0HE 1NK6A 5BYRA 4YR3A 2GJ2A 1S79A 4JYAF 4LQ3A 2IY5B 3FNNA 2HRYA 5FJ4A 3A8EA 1Y5IB 5E3QA 4ZPVR 5G0RA 4JI2F 2OPQA 4ZCMA 1FEEA 2XO6A 1F3FA 1RT5B 2YQ3A 1R3NA 4DBQA 4LQ9A 3GIMA 1WHXA 1PYTA 3LP0B 3UFCX 1CJUA 3PW4A 4P6QA 3PHTA 4Y2MA 2WRMA 2B4OA 4ID5A 2XZWA 1WSRA 1RBAA 4HH1A 5KAKA 1VQ7S 4H1OA 3J80Y 4B9SA 4DU8A 2ASJA 1S4EA 1V5IB 3T6BA 4PABA 1EKRA 4NLTA 4QUMA 5C42B 1F6TA 1U6BA 4J7CA 4NWFA 1S48A 4WZMA 4AQYF 3W63A 3IBCB 4FXVA 1C83A 4RUCA 2LDIA 3R3TA 2A1BA 1N4LA 2FJWA 1WD6A 4QAPA 4FNHA 4Q5VA 2VASA 2G2YA 5HJYA 3LK7A 1UW9A 4CLUA 4LFBF 1YJVA 3DLGB 2PE8A 2ZH4A 2RDJA 4O23A 2CQ4A 3ISZA 4X62F 2KXHA 3L9ZA 3FFIB 1PCAA 1SCJB 4OHVA 3RBXA 3VQTA 1WTFA 2W2PP 3CJ8A 1B4SA 1UMJA 3AFGA 3L7PA 3M1VA 2CQ3A 2KHDA 4LRAA 3RB0A 2HHWA 2KYZA 2FLNA 4NRUA 4WFNQ 3I56S 4KYRA 5KAAA 1FDNA 1X4CA 1ZPVA 4OHXA 2Z8QA 1Q4RA 4C8OA 2VTDA 4ECVA 3MECA 1TUVA 4RU9A 3BLTA 3M4XA 2H5IB 3OJSA 3KK1A 1Q5YA 1RADB 1GX5A 2OPPA 4EUVA 1WOPA 3KJFB 3JAMU 3TQ1A 1IUJA 4XK8C 3CUNA 1FT8A 1Q5VA 3MM7A 1IM4A 1H0HB 4ZPDA 1KHVA 3I82A 4RUBA 1KD1T 4DCPB 2XMTA 2OIHA 2VF3A 4B9VA 2LQ9A 1XTZA 3MPUB 3UCGA 1S9FA 1KLNA 1YSJA 2ASYA 2MZ1A 2VOPA 4IH6A 2HHVA 1K0VA 2VEUA 2VFTA 3MMBA 2X1GA 3CCJS 1ZYQA 4PAAA 1TAQA 2XCPA 2PI7A 4NXNJ 2HS3A 2OPSB 3EU0A 4DV5J 4TVVA 1LARA 1MN7A 3N79A 2QEPA 5AJ3F 3HVAA 1DLOB 4KKOA 3PFEA 1C4AA 1CULA 2CWKA 1F1BB 3E3XA 1Q78A 3T6JA 2W8LA 2FZGB 3MAQA 3R5DA 3IAM9 5ETVA 3DRRB 4URGA 3BSNA 1KNZA 5IQQA 2GV1A 2CJ9A 1J2VA 2F6VA 1CJVA 3GV8B 1HA1A 2IVFB 2D9PA 1LNQA 1OO0B 1OY6A 3QLHB 3GIRA 4LVOP 2Y1RI 3CMAS 2XYHB 2HAFA 4FXWA 3CCSS 4J9RA 3FBBA 3KDNA 5DLFA 4OHYA 5IFMA 3HXMA 3CD5A 4R0SA 1FKPA 4JNBA 2LP4A 3VHQA 3MPDA 4C0HA 4ZIVA 3G8QA 2QG9B 2H48B 3KWMA 4QBEA 4URQU 3MEEB 3GFHA 5EGYA 4J9MA 4X4NA 5KA4A 3CDWA 1U09A 4PR6A 4HT5A 1Z2ZA 3MM7B 3IWXA 5K9VA 3ET6A 3SCKE 1VHFA 1HD0A 2W4PA 3EXYA 4ZHRB 4GKJF 1O8BA 4XDCA 4B3TJ 2QMXA 2NUUG 2Y0SD 3CT9A 4QZVB 1VCTA 1MG7A 1HNZF 2FVPA 1XERA 2Z0GA 4USTA 1RAHB 1AFJA 2W7PA 3TZZA 4NE9C 3P4UB 2KG1A 3OTOJ 3MAHA 2MGZB 3ZZRA 2RE1A 9RUBA 1UPPA 3OR2B 1DLOA 3QT8A 4OI3A 3C8YA 1L3VA 4ED2A 3ETMA 2HQGA 2QZ8A 4FNIA 2CPFA 1QVGR 2HG4A 1NLKL 3W62A 3KHHA 2DRAA 3K59A 2L9WA 3SMEA 4DGPA 1RWKB 2M88A 3PG9A 3R9LA 2I8EA 4CLKA 4KGVB 3G8SA 3K5NA 4DF8A 3PR5B 4CLFA 2FJMA 3S4OA 4BBYA 4I64A 4ZOSA 1FD2A 3KUHA 2GIFA 1FNMA 1IQTA 3PFOA 4FZVA 4XDDA 3SDEA 5DZ6A 5IBSA 3QRQA 1OY8A 2QCJA 2HBQB 3MEDB 4AE5A 2F6TA 2L3MA 2MQQA 3DM2A 2B4UA 3C6TB 1SI9A 5KA7A 3QGGA 2HNDA 1XK8A 3PYGA 3GCWP 2AP6A 2YQ1A 3LTOA 1FEHA 4WBFA 5MLCV 1X9MA 4NXMJ 1D5RA 2BOAA 2LXIA 4RNFA 1U1QA 4K59A 3MR5A 5C24B 3TUIC 3M8RA 5J2PA 1TK8A 2YNHB 2YDUA 3BQ2A 4I4BA 1R6VA 2MQOA 1JLQA 1SJQA 2DNOA 3GZ7A 2KTQA 1PTUA 2KJVA 1I9SA 4WFAQ 3THTA 4KKOB 1S1XB 1IXKA 2GJIA 4EFAC 2Q66A 3TVYA 2EFGA 2DK2A 4P52A 2JWNA 2FHJA 2W9BA 4LF7F 1S59A 2NXEA 4A8XA 1EHWA 4ZCKA 3J7Z5 2DIUA 2CG8A 2ZDOA 3LQVA 4OZ5A 5A0YA 4TN2A 1JXVA 2K8GA 3DOLB 1TKDA 2QSFA 4HHUA 4XO0A 4DL6A 1ZH5A 2XLKA 1JQGA 2HZCA 2UVRA 4LFAJ 1VQYA 2JFHA 2F9JA 2FJEB 4ANEA 5GAEI 2ZD1A 1U48A 5IZHA 4YY3F 3VAFA 2A6OA 2MB0B 1Q86T 2OKQA 4CYUB 2DHSA 4USUA 2B7CB 2J8AA 4QYZJ 2IM3A 1RAEB 3PRVA 2FHKA 2V2QA 5A6PA 1ZOTA 2OI2A 1FRHA 2ZHOA 1EARA 3RZAA 2H4VA 2Y2FA 3AQOA 3B4DA 3CNQP 2MKHA 3M8ZA 3PACA 4NLGA 1I5OB 1YRXA 3NMEA 1R27B 3QQCD 1VQ6S 1U8SA 1VQ4S 3T1AA 3P8BB 3VGUA 4DPTA 2XWYA 3MCNA 4CIOA 3BGRB 1AAXA 2MGZA 1SH2A 2BOPA 1RUSA 2D3OR 1R8BA 3K8VA 4MKYA 2GCBA 2QBQA 4DR2J 1A5YA 2CMBA 3DLKA 4X2BA 1H7XA 3BBBA 3DOKB 2WJPA 1ZTWA 3ZM5A 1RBOB 1LKZA 4TKTA 4DG1B 5DS7A 4S0GA 3HHKA 3UE2A 1VJQA 1TKXA 2ABYA 2WVCA 3CJKA 3SEOA 4Z37A 3EGNA 3PYDA 5IM0A 4KV8A 5FLXY 2VONA 2WTZA 5L46A 2COLA 2AJFE 3R5GA 3NOGA 2CQHA 2BKNA 1WC3A 3VR1A 4FYDA 2ZH9A 2Y96A 2AW0A 1PJ6A 4KO0A 2YNHA 3N5FA 1G4WR 2M4MA 4DQSA 4ILMA 2O66A 2ZWOA 3OXFA 3SYZA 1E6YB 2B0GA 2V67A 2KXNB 4K2JA 2RJZA 2AYMA 2FGCA 2OFGX 2YY3A 3D5MA 3IA0A 3QCZA 2A6MA 2GJFA 3NGDA 2A8BA 2P4DA 5K23A 2NPIA 5GAHU 5MAOA 1GG4A 3BDEA 2CPHA 1QAXA 2NZCA 3DLJA 3H59A 3LPYA 3E8OA 3M2RA 2O67A 5GAEU 4FS1A 4WCEQ 3IS9B 2CJQA 1I57A 1NKCA 3MEGA 1JX4A 1U1LA 1IBLJ 3PO4A 1I9TA 1RXOB 3JSYA 2FJXA 4DV1F 1YTYA 2OSQA 4HR2A 1OQ3A 1UVMA 1MN9A 2BJ1A 4HRFA 3UDEA 1SUQB 2QLXA 4IO9Q 2HNQA 3NOCA 3W66A 2FJVA 3H5SA 3JSRA 1JB0C 3R5AA 4RW8B 1BMQB 4MK8A 4MFBB 4YHHF 3F41A 2RHQB 3MFIA 3OTEA 4RW9B 4BWJA 3BGOP 3G82A 3CDAA 3MZIA 4ZVTB 5HAOA 3PXGa 2DY1A 1FD8A 3D0IE 4FN5A 4CWBA 4UQGA 1NPRA 1R89A 3OLRA 1HL6A 2ACMA 4OLPA 3K5LA 2R7VA 3M8QB 3HP6A 4YUDA 2GS8A 3GILA 1VRTA 5KA1A 5A8KA 3MURP 2DR7A 1PYSB 3KNAA 1FKPB 4M5GA 3CCMS 3I96A 4GKKF 4USKA 4KSEB 1NEEA 1S1TA 1VIXA 2FYXA 4K7QA 1EKSA 3M9NB 4MKAA 1TU0B 2F7VA 2IHR1 4ZMMA 1F5CA 3LANA 3QT5A 1XMOF 1HQUA 2I2YA 2R3VA 3N6MA 4HYKA 1JKHA 2PA8D 2Q79A 3CE8A 3EPIA 3GG0A 3GU0A 5ETKA 1F60B 4BPCA 2DPIA 5EWFA 1P8GA 2ASLA 4Q2MA 1B70B 4WU2A 4ZVGA 3ITHB 5JMNA 1HNZJ 2HHQA 3LWMA 3WHIA 4BUBA 3POTB 4DN0A 2VPYB 2YWHA 2PD1A 3DLGA 5KFRA 3CCES 3BLUA 3IGVA 1KQFB 2RVJA 2L9DA 4OI1A 1HYSA 2DR9A 1NZ7A 2Z2MA 3PRDA 4X4RA 3T3FA 3D1OA 1Y3KA 4ED4A 3M9OB 1UVIA 2HNPA 3W8PA 1T9UA 2QT7A 4F26A 1DTQA 5U47A 4YR0A 4QWDA 2X1FA 2K06A 2K7JA 4PWUA 5K25A 1F3VA 1GAOA 4PXBA 2B4VA 3UVJB 2OP5A 3CPWR 1TFWA 4DSIA 4RL1A 4AL7A 2EFOA 3JQMA 3TNVA 1RT5A 4QPTA 5IT4A 4YFUA 3ADAC 1HHQA 3T5KA 2PA5A 3D0GE 2C2RA 1XIQA 2MY8A 2I75A 2XGPA 4M5HA 1GFWB 3CJRA 5LSLA 1RT1A 4YMEA 3PYEA 2C28A 2V9WA 1HQEA 3TARA 1RT4A 4NMLA 1WKJA 4M5NA 4J9UE 4CO0A 3LOUA 1Q6PA 1RBLA 2H5JB 3DLEB 4CTAA 4MMOA 1FCAA 2YNFA 5K22A 3BKUA 1ZAXA 4CO2A 2HQFA 3TUJC 1JIHA 2HNZA 2FB0A 1S1XA 7FD1A 4DUYF 3WZ0A 4WYLA 3DYAB 1VQLS 2MJUA 5L1LA 3CMES 1C1BB 1TUGB 5A6WA 4NLOA 1GMVA 1IJEB 3OTBA 5RUBA 1UVLA 2KM8C 1Q8KA 3F44A 4O3OA 4CLZA 2I6MA 3OHAA 2QDMA 2B49A 1HNIB 2HQIA 2P2CB 4B3MF 1NHKL 2R7SA 4X65J 2UXDJ 2CM7A 1S0NA 4RKKA 1BQXA 1P1TA 2VL1A 2U1AA 3UDVA 1NJYA 1N33F 2VG7A 1MMNA 2NQPA 4RW9A 1CJKA 3PCOB 4DDFA 1AUSL 3V2UC 4QPXA 4YDXA 2PGCA 1KDNA 4X62J 4Q43A 1ZS6A 1S77D 3QO9B 1Q1MA 1IKYB 3KK3A 1IKXA 1G4CA 4RNHA 2UUWA 4IRCA 2Q43A 5BXIA 1AT1B 3A8IA 3Q86A 3TAPA 1F0XA 1KTVA 4F4XA 2F1FA 2RMLA 3QGPA 1U02A 1LWFB 1QAIA 2Z2YB 2DD8S 2RQCA 1JLCA 2GJTA 3BM7A 2PFFB 2Z57B 3S7RA 2HNZB 1NHVA 2WTFA 2FC8A 1B3TA 2BJ3A 1YZ7A 3HSDA 4LF4J 3H98A 4OYPA 1SH3A 2AHOB 2APOA 2EG2A 2W24A 4PCQA 3RGIA 5K14A 2RQMA 4JI1J 1CJTA 1CLFA 3CCLS 5KT3A 4YB5A 2BXJA 3VZIA 4CP5A 2F5GA 1FJ7A 1TK0A 2ZOFA 3HHLC 2GWOA 2VHGA 1FJEB 2CPZA 4P10A 2DNQA 3TA2A 2PI4A 1FERA 4QWCA 3H4BA 5LMUF 3R6GB 1S1UB 1RU1A 2MQPA 2XQCA 4JYAJ 2I1YA 1T49A 2RAQA 5T7LA 4OHDA 1NMEB 2J9DE 4H4KC 1KONA 4Q45A 1SKSA 5EWEA 1UETA 2AEMA 5E7OB 1UVNA 2BKOA 2GNKA 4EI2A 3F9AA 4GRYA 3AH6A 1H3DA 3UNGC 4UQTA 3N5BA 3G6XA 2YKMA 2E5HA 1N32F 4YOEA 4F0HA 1OETA 2UU9J 3VAMA 2DNRA 2I3UA 3N9UC 2BEFA 2KXFA 2MZJA 4IH5A 2CZ4A 3D6MB 3UQSA 4LRCA 5E3AA 4EYHB 4F4YA 4DR6J 1JLEB 2GC5A 4NLQA 4DL5A 2Y66A 3S3HA 1ELOA 1SC6A 5H9FJ 4QWEA 2BW2A 1RHQB 3I0SA 2K3KA 1KEKA 4E0DA 3EYZA 1MNEA 3DLHA 1C86A 3EXCX 1FK9B 5B09A 3LO3A 4LFCF 5KT2A 4ID8A 4NNDA 4N7TA 3QCDA 1REVA 2RRBA 4GVLA 4PXEA 3E01B 2MKKA 1D1UA 4WWSA 2HMIB 4QBWA 2GCFA 3D6TB 1WELA 1S5ZA 3A8JA 4PG4A 4W98A 4TYBA 5C25B 3KHGA 1F9HA 3BQ0A 1JLAA 4DLEA 1PSDA 1N5SA 2CVEA 1NCLA 1UL3A 3OL9A 3ZTSA 4LSLA 1NL9A 3PIPQ 4OJHA 3CTRA 1WKLA 1Y4ZB 2J6UA 3FMWA 2JH3A 1ZTTA 4CH7A 1BZJA 4OYZA 2M8DB 3GSIA 3W8GA 3K8WA 2BJ7A 5KFHA 3T9ZA 1UZHA 3OPKA 2HHXA 3GJTB 2UP1A 2LQ8A 1WCHA 1T95A 3EJMA 4USJC 5AXKA 3BYPA 3SSSA 1C1CA 3C16B 3T1HF 5HLFB 1RAIB 2VFSA 3M9MB 4A8WA 2MQLA 2B9EA 2QBSA 3D2WA 1W2IA 3R5JB 1M3GA 2ZVIA 1SIZA 2VBYA 1KTQA 4EGLA 2CNOB 3C19A 2VKZG 4A46A 5HBMB 2C7SA 2CQ2A 2XNRA 2DO0A 3G2XA 2N7CA 4ZI4A 2IC3A 3O6QA 3T41A 3FVYA 4X4VA 1LWEB 2VG7B 1CS4A 3RYLA 5K5MA 3OVBA 3V5RA 1OPZA 2MHNA 3CVKA 5ETPA 4RH5A 5KFSA 1RCXB 4PUOB 3CULA 1RP5A 2FD2A 6FD1A 2ZD1B 4L75A 3TOQA 2BANA 2ALYB 1AZSB 7AT1B 4JOUA 5IV3A 4LSNB 2VQFF 1JWWA 1HMVA 2UXBJ 3EMUA 5GTJA 1ULRA 4C12A 2P5VA 4FBTA 1PJ5A 5DDOC 4R0EA 2RHSB 3AD8C 5I3QA 1KC8T 1RTHA 4CM0A 1QJHA 1KAKA 3EVMA 1HIYA 2IMOA 4QW8A 4DR5J 3QRRA 5J2MA 2Y0BB 3QCNA 2VUGA 4GRSA 4CCHA 3MMJA 4JB8B 4HJQA 3QCMA 1I3OB 3ICLA 4MBBA 3CJTA 1X8DA 3QBCA 3RRKA 5D3GB 1X7VA 3MM5A 3GIKA 4NYHA 3DLEA 2B6AA 2HIYA 2MHEA 1JK9B 2LQBA 1R0BG 1WOSA 2RD5C 3M8YA 3OFHA 5CXTA 2OTLS 2FDNA 1DBDA 5KFVA 2HHUA 4I6YA 3EDRB 2ZUAA 5CYMA 1P15A 1M5VC 3EICA 5ETRA 4CYUA 2J6SA 4PQUB 2YKQA 3BH7B 1S1UA 2CNGA 1M90T 2OD6A 1HNXJ 1L8GA 4LIRA 1RWNB 2XULA 3H2UB 1N56A 3JSBA 4NCBA 1RQ0A 1H2VZ 1EB0A 1S9EA 4WFZA 2BZLA 2MJNA 2WBMA 2YKNA 3AODA 4LREA 4WE1B 3QIDA 2F40A 4EZ6A 2F46A 4OYXA 5D0EA 5IWAF 2VG6A 2B5JB 4TQSA 4DJBA 3UN5A 1YRUA 3UI3A 4M1KA 2Z4PA 1TP7A 2AX1A 3BSAA 1U26A 1YQHA 2D1CA 2KRBA 2QA4S 4ER8A 4DWIA 2DNYA 3U1MA 4L76A 2DB1A 5J2MB 2FJBB 3EVOA 2M0GB 1RK8A 3I4HX 2AJ0A 2HQCA 2IVMA 4L73A 1YTSA 3ITHA 1Y3JA 2DR8A 1NUEA 1RACB 4GWFA 4EWTA 5DQHA 1HLWA 1X4AA 2NUHA 5B0DA 1NZ8A 1VC0A 2VDHA 2KFZA 3IO1A 2J0WA 4R5PA 4LSNA 2NCKL 3V81B 3R1HA 2UUCF 1FGSA 3DXBA 3F0NA 1KVKA 4RI5A 1FTRA 1DTTA 1FKOA 5ETQA 3EDQB 4LF2A 4OV1A 2FVCA 4QF5A 4QR2A 3FZ2A 2GGPB 3KG0A 1JXLA 1WI8A 3OT9A 3QZ7A 1YJTA 3UVJA 2QA4G 1T7PA 5GADI 4OX9J 1S9EB 4JI8J 4RO0A 3ZM2A 2LXUA 1DARA 1UFKA 3JAMY 3NWGA 3QCIA 4P73A 1NAQA 4USHA 3D6FB 3MM9B 4L3KA 3OR2A 3NBPA 3JSMB 1WEYA 2KT5A 4B3RF 2SXLA 1FA0A 4FXDA 3LALA 3DMJB 1ZAVA 4OJ3A 3EAXA 4OFZA 1I94F 3OTDA 2QRRA 2AIRB 1HPZB 5SZTA 3CC4S 3S6EA 3I9ZA 3MD1A 8RUCA 1NSKL 1TL1B 2WVFA 2I4HA 2AKWB 3QCEA 1ZA1B 2QIFA 2RU9A 4C48A 1O5JA 1YIJS 4WTYA 5B0EA 1NHUA 2XCAA 1PJ7A 3LP1B 3C14A 2KDOA 1Q7LB 2R9LA 4IFVB 2RILA 2Y67A 5KFIA 2X1BA 1RTIA 1H7WA 2VBWA 3KOAA 1IWAA 3AOBA 3M32A 3AT1B 4R8UB 2X3DA 3D3BJ 2V68A 3R2CJ 2BIJA 4OL8A 1G2EA 3PW2A 2HS0A 4WKRA 4DR1F 2MLYA 2YPZA 1XR5A 3MHYA 2F6WA 3CJKB 3AAWB 1TAUA 2D74B 1VBXA 1NB7A 2R7TA 2CPIA 2PMWA 3AQPA 4HTIA 2RU3A 4IG3B 4IO1A 4PG8A 1NO8A 1VK3A 2AJ2A 2J9EA 3FCVA 3HSZA 5KFNA 3QT7A 1NDCA 4DCJB 1WACA 4DX8H 4ECUA 1KSPA 3EZOA 3K7RA 2CDQA 4RWWA 3P6YC 4K0KF 3PYZA 1NDPA 3EZUA 4ZJQA 1C0TA 2CA9A 5K8PA 4OYWA 5CABA 2BVZA 4DPWA 4J91A 1R8HA 3MUVP 2FPHX 2M7SA 4PG6A 2W7OA 4NCGB 4W4MA 1X4GA 2QYGA 1NJIT 1X4BA 1GXTA 2AV5A 1N54B 2GMLA 3MCMA 2CM8A 3JB9k 4NYPA 3ZZZA 3V81A 2C22A 4J90A 3ENQA 5BJRA 3SV3A 2VFUA 2PBNA 5K24A 4ED3A 1F5AA 2I6PA 2AM1A 1FO1A 2NLKA 4LRBA 1PAUB 1LWCB 2EI5A 2HFNA 3AD7C 5KFTA 3ZZ0A 4NZ6A 1I51B 1SL1A 1RLDA 4DZDA 2W25A 1FFGB 4OZ2A 1VJWA 1JLFA 2ROPA 1WC4A 4RW6B 2D3ZA 2KT3A 3M6UA 5AT1B 1C1BA 1OQ6A 1WG5A 2IRXA 4LSZB 4CT9A 4N5SA 5E3PA 1X4HA 1MMLA 3DGVA 4ITSA 4CLTA 3HSJA 4RUAA 4DV3J 4TXSA 1S12A 1XNQJ 5HMZA 1UEKA 3SQGB 2R8GA 4PQAA 1PTTA 1TK5A 1HI8A 1RHKB 2JJ4D 3R7NB 4BC9A 4FP9A 5HQLA 4DFPA 1UA1A 2B8QA 5IM0B 2J0XA 1NPKA 1UW4A 3L09A 3LGMA 3O1LA 4KC5A 8ATCB 3DDKA 1IJFB 2KHCA 4M5KA 3O4TA 1W7WA 3K5PA 2I5XA 5G4DA 4OX8A 4LRDA 3SI8A 4U7UD 4Y2KA 1SJFA 4QIEA 3BGRA 2E5JA 4N8NA 2XI3A 5CYJA 4EBEA 2EFNA 4F7VA 2HXPA 2XNQA 2LA6A 2B4PA 4X4TA 3UNYA 3IM9A 4K5SA 5C7PA 1HNVB 2LFVA 3ZZOA 1NK9A 2DGTA 4DPOA 2BE2B 2VPZB 3A3NB 1VHIA 2WZ1A 3QSIA 4RKUC 5KFLA 3M30A 4CQ1A 1T05B 4X64F 1NK0A 3S3EA 4ECSA 4I67A 1LXNA 3OR1B 3NGKA 1IWGA 3P5BP 2VDIA 4KFBA 5JVHQ 2WW8A 4B3SJ 2CNIA 3CO0P 3M6WA 5K9FA 4GFUA 2CNNB 2V0NA 4XPCA 1C4CA 4FYWB 5I3UB 1U4BA 2DTJA 2FC9A 2JZ5A 3A3PB 1RAOA 5D15A 3DNCA 5B0AA 2WVEA 4YDDB 1Q6JA 2QDPA 2CFVA 2P6SA 3WBZA 2KO1A 1J27A 2V8VA 3ILLA 1RTZA 3MMBB 3SSQA 3PV8A 1GNKA 1M1HA 4WP8A 4WIQA 1PBAA 3JTOA 5T41A 2WONA 5B0GA 1R6YA 2R4FA 4ED7A 4TLQA 1XM2A 3MVNA 1X60A 2RDIA 2DNHA 5H9EK 5HDEA 1RAJA 1HBNA 3NNAA 4DV4J 3O5XA 3CD7A 4OZNA 5CCLA 2HQ3A 4X84A 2KZZA 2C3PA 2DNLA 2LQJA 2CJKA 2BE2A 1JF7A 1W2BR 4CO1A 2HGNA 5L9XA 4QBUA 2J0SD 2HPUA 2I6IA 3AXKA 4C8YA 3DLBA 3AWEA 1DTTB 1FKOB 4OZ3A 2AF6A 1R0CB 2ZH3A 1LW0A 2C2ZB 2NXNA 3B78A 3NRBA 3B6BA 2VC1A 4G6VB 4DUZF 2HB1A 4JI3F 1H74A 1C0TB 2JFGA 4RH9A 1QXKA 1TL3B 2B9YA 2WHOA 5DM6Q 1CPZA 1XR7A 4FF2A 2J7WA 3CMQA 3CF5Q 2QSWA 2A0FB 4G1IA 5K8OA 4DV6J 5I42B 2Q6CA 3LWLA 1VQMS 2FY8A 4TQRA 3EGZA 5LXRA 4WYWA 4DV0J 3OBIA 3MEKA 5HN0A 3NBPB 1ZM3A 3I5AA 3HHLA 3VAJA 3N6NA 4QYRA 2F70A 1EAYC 3RJMB 5D78A 5DGAA 4Z2XA 3Q0AA 2E9RX 5CYQA 5AXNA 2BJDA 3KXDA 4R0TA 2XI2A 3TA1A 3J81j 2OPRA 1XC9A 1S7IA 3BDPA 2B5JA 2JVRA 1RT7A 3OXGA 4CZCA 3ZTPA 4HI2A 1QSSA 1N48A 3WQPA 3J7A1 1LWEA 2MYFA 2FTRA 1HR0F 4HHHA 1RPMA 3DCAA 3MTJA 1HBMA 3PM9A 4I1TA 3UN2A 1EZZB 3VCDA 2Y8WA 2F3JA 2SHPA 3U96A 4IR1A 3EPGA 2W2OP 1IBKJ 3QCKA 1UP1A 3SDEB 1VC5A 2F6ZA 3BREA 1GMUA 2DCLA 2HVEA 2IM1A 2ZUGA 3FFIA 4LR7A 3ZNJ1 2VA2A 4IRDA 3AD9C 3HT0A 2VEWA 2J8SA 3PY8A 3M4UA 3CJQA 1RISA 4OYIA 2ZJPQ 1D0EA 1B0VA 3O5TB 3KTQA 2H4GA 3OHBA 4PVGA 2V8HA 2GX8A 5HP1B 1S9GB 1YK9A 2J7UA 5IC6B 2XS2A 1CEZA 2MQNA 3Q8RB 1GQEA 2E66A 2GHPA 2HNYB 2V8GA 4ZVHA 3FUYA 3TQEA 5IT0A 4KPCA 3ZL8A 1KFDA 2MSSA 3PEHA 3WDOA 4CLLA 4BDPA 2DNKA 2JL9A 2WOMA 1SC3B 3CW2C 3H42A 3MM8A 5E33A 3TX0A 1RA6A 4UZBA 2L08A 4EYIB 2YKPA 4FBUA 1VHRA 3B82A 3ISNC 1F2GA 1HQUB 1LFPA 3LGHA 3HDSA 1EQMA 4PZVA 1FRJA 2Y1JA 2DGWA 5KFCA 2E7XA 1PA9A 1E6YA 1N5VA 2DNZA 2YWGA 2LEBA 4AYBD 3DHWC 4ZPCA 3TJ9A 5BYSA 2GMHA 2UUOA 5G0RB 1ZM4A 2KZMA 4DV7F 3ZXWA 5F3ZA 5F8IA 1NXIA 2B51A 4TNOA 4DR4F 1Q82T 1N34F 3D9CA 4RUHA 3G87A 2GCAA 1S4FA 3GQCA 4U95A 2MKJA 3KMQA 1NO6A 1FE0A 3PYFA 5E0OA 4B04A 5LMNF 2E1CA 2VB6A 4ZRTA 1YRTA 4F8RA 3CWEA 3HHLB 1S0VA 8AT1B 1OSDA 2E5IA 4GVBB 4P74A 3FJ2A 4M5MA 5IC4B 2BQ3A 1BQMB 3ZZPA 1OIAA 2IVYA 4U8YA 3SCIE 2ZM6F 2R7RA 2ZN7A 5C5JA 5FD1A 2UUBF 3IBWA 1S1WA 3Q8SB 2CAJA 2IRYA 1H73A 2BV3A 3T1YJ 3H5XA 2XJAA 1YDLA 2LLZA 3E51A 2RUSA 1X9WA 2IIHA 4WF9Q 4CDIA 1IVZA 3MOZA 3W65A 4ES2A 2DRBA 5LXQB 2DIVA 2NXCA 5A2QU 4UAGA 4R0JA 2YWKA 3OTCA 3TYTA 1EENA 3SCLE 4F50A 2GGPA 2BX6A 4R30A 4KIAA 3CCTA 4WTOB 2FHMA 4ZLJA 2E5LF 4LF9F 3NNHA 4DR4J 1APSA 3AB4B 2WCXA 3IC1A 1WUUA 1RTIB 2ZFHA 2H9ZA 3EM1A 1ZM9A 1RHRB 1RDRA 2NR0A 3MPVA 4M94A 4CM2A 2V5HG 1OESA 1WAXA 1K47A 3K57A 4Z6BA 5L39A 1R7IA 4DV2J 1WTBA 4YEAA 4BCAA 1WEZA 1IKWA 1VQSA 1HBUB 1SBRA 4B17A 1U1PA 4LR9A 1M1GA 3UWTA 2XMJA 3G8TA 1N6QB 2EVZA 1BXNA 2CVIA 4CI0B 1MROB 3J80U 3BZQA 2V4RA 2RQ4A 2VOOA 5KA2A 4KAIA 5CYQB 4UOGA 4DS5A 1IKXB 1KVJA 3UR3C 5I3UA 3RW7A 5GMDA 5L1JA 4UW2A 1N36F 4Q7AA 3NY0A 1VC6A 2VTEA 4PUOA 2UUPA 1K1SA 3MCOA 1H98A 2ZZNA 2LA4A 1BZCA 4LF6J 2GVDA 2CQBA 1A7GE 2N7YA 4D3HA 2MSTA 2R8HA 2DH9A 4NLDA 2VIHA 5H9EJ 5ADZA 3OVAA 3OSPA 2G4BA 4ZVOB 2HW3A 1FHTA 2ROEA 2HY3A 1F9EB 1L5UA 3VGTA 1E6VA 2D3O1 1O5ZA 4NCAA 1NSAA 2DXEA 2PMZD 2V2VA 3ISND 4C0OC 2FVSA 3T19A 4JI0J 1IBKF 3V0EA 1VQ9S 1SB6A 1UZDA 2CIMA 1V3RA 1RWMB 2D69A 2DCUB 4FF3A 3DXSX 1RB0A 2Z2ZA 4MYTA 1W7KA 3D54A 4MT1A 3W7BA 1WORA 5BR8F 2XSJB 2KL8A 3AJDA 1KHWA 3B54A 4WIIA 2PSZA 2UUAJ 3RUBL 1PA1A 2U2FA 3HVTB 4ILLA 1LW2A 1PAEX 2W4DA 4DX6A 2XY7A 2ILZA 3Q22A 3HCXA 2JFFA 2Y1LB 2D3UA 1Q81T 3V0DA 4JI4F 2VEYA 5K9WA 2KYXA 4O3NA 5KFUA 4TU9A 3TEGA 1D9FA 2DNPA 1BY9A 4CVMA 4C8MA 1DY3A 2XHCA 3FEXB 4DQQA 1Y5NB 1FVSA 4P2MA 3I80A 5T7LB 2AQ4A 1MMDA 4Y6IA 3ENAA 4NOHA 1Y9OA 3KG4A 3VWSA 5ETOA 5AE3A 1J6UA 1ONZA 2VOSA 4TLRA 3MD3A 3KUGA 4ZIWA 2Q1LA 2X3GA 1IR1A 2CQ0A 3BGUA 1WHWA 4DPYA 3OL7A 1REVB 1YJRA 4BLGA 3U1NA 2ZH6A 1SV5A 4I6AA 3IR6B 4NASA 3OL8A 1ACMB 4N76A 1NRKA 5D4PA 3Q8QB 2ZBIA 4DLGA 2GZOA 3CM3A 3BYRA 3CJ0A 2VBXA 3ZZUA 3MTKA 5KOWA 3KLHB 5FDLB 3NMAA 4X4UA 1KFSA 2KI2A 4DR7F 2OLWA 2ALZA 2N3OA 4MFBA 1S0MA 4USMA 4DV4F 3O2IA 1SUGA 1RT6B 2Z2LA 4LIWA 4B08A 4IQXA 1FX2A 4I8NA 3HJFA 1LW2B 2HVLA 2M3VA 5CH7B 3TZWA 4YB6A 4URSA 3GFZA 4PPDA 2HRTA 1PBUA 4F4WA 2OPSA 1PH0A 5BZXA 2E7VA 4IQMA 4BWMA 1YJWS 1VIOA 5KT6A 1FI4A 3DU5A 2HIQA 1FTCA 3HFZB 1RTHB 2EEYA 3PJ9A 4TYAA 1HBUA 4MAKA 5D4NA 1X5OA 3MR6A 3L3CA 2QFJA 2F4VF 2CM2A 5I4MA 5J2QA 1RLCL 1XMQF 3OFFA 1B64A 3V6DA 1UEUA 3KFWX 1TFYA 2I9SA 3IXQA 2XYGB 3JQKA 3NAIA 1XNRF 2HFVA 4RBUA 2NZ4A 1FDDA 2CPDA 3HX9A 3QAUA 3QIPB 3GPAA 1V3SA 4X64J 2OEJA 1F9FA 3D68A 1T8EA 2VG5A 2YX1A 2E1MC 5DO2A 2H51B 3V6JA 1U45A 4F2SA 3HK2A 5HL7Q 3J7YI 1G7FA 2BGDA 3CCVS 4W90B 4A47A 3G6VA 2F4FA 5KFDA 3DU6A 2CPYA 1YBAA 3A4TA 3QFWA 4QWBA 4DPXA 4ZITA 4CLPA 2CNLB 4JV5F 1A9NB 1YKWA 2CJXB 2HFUA 2JVOA 2P8IA 4N8OA 4O44B 2Y8YA 4WXOA 1Z4UA 3BR9A 1YJ9S 4ZS6A 1YTWA 1VBYA 4GFVA 1WOOA 2HLUA 3NCQA 2W7AA 3R6LB 3THPA 4ED8A 5GAHI 2VEXA 1TR0A 1S97A 1CQNA 2RDDA 4MKBA 1HI0P 2H02A 2RKIB 3O4SA 1T9YA 1HARA 3PJXA 2O01C 5FDLA 4EZ9A 1AFIA 2I1RA 1Q6SA 2WSCC 1TL7A 1TQLA 2BZ2A 4IG3A 3V4MA 2JLEA 2ZZMA 3BRHA 3MMCA 2XBPA 4B3OB 4RZRA 3HD2A 5KG6A 2HVIA 2CQDA 5CYMB 4ZVFA 1JLAB 3ILOA 2ZBQA 4KGZB 2B56A 2H4KA 3GTYX 3DDNA 2BUNA 2AMCB 2HK3A 1JJCB 4NA1A 4PKDB 2HHHF 1WRMA 2VJVA 1DHMA 2RB7A 1L3KA 3FGVA 2C3MA 3AA8A 2NYIA 2VQEF 3BBFA 1DRZA 2QFIA 2YTCA 3Q8PB 2MKYA 1LK5A 1GK8A 2FGOA 2HBRB 2JFDA 2ZE2A 3U02A 3BKFA 3ZM3A 2H04A 4F25A 1LQFA 4Z7YA 4Z7CA 2YWFA 3FQLA 4B9LA 1NSPA 2QBPA 3QCBA 3BB5A 1CC7A 3N28A 2JX2A 4Y34A 5HI7A 3SMZA 2XLJA 3RRHA 1S10A 4I2QB 4EO8A 4KHPJ 1NH8A 4CRJA 5I3PA 2XMKA 1WWHA 2BKPA 2F6YA 3TAMA 4RHGA 3SCJE 3CD0A 3R27A 1IR0A 1YVFA 3CJ3A 4HHJA 4ZJOA 1HNWJ 2VEVA 2EG1A 2OO4A 5HMWA 5I42A 4ELTA 4N56A 3HHLD 2JEFA 4QCLA 1HKAA 3AY0A 2VQEJ 2BW7A 2FQQB 4RR5A 2FY1A 1WSVA 3HHNB 2IC3B 1TL7B 3MEEA 1J5EF 4OZLA 5HJXA 1U1OA 3DM2B 2XS7A 4WJBA 2O3DA 3KJQB 4O0IA 3VAIA 4DFMA 2QTWA 2GVDB 1T48A 2HYIB 2XMVA 4JI6F 2QYCA 5L1IA 4ICZA 2AD9A 2XB2D 4IDKA 2FVRA 2NT2A 5B0BA 1R8PA 1CSJA 1NK7A 3ENWA 2NT7A 5C2CA 1EP4B 4H4MA 2N3LA 3IP0A 4G3IA 1U6FA 1V9OA 2D41A 3HKWA 4ECRA 1H38A 4KYZA 2R2SA 4M95A 2EWHA 2XZDB 5LM7E 3TWZA 4WKYA 3OJUA 2LQ5A 1RHJB 2W9BB 3M8SA 4GE6A 5KG0A 1N88A 3JYTB 4LF5J 1ZC0A 3WC0A 4NZ7A 4NWGA 1QD1A 4H54A 4ED5A 4O3QA 2MQ8A 2RRNA 4NLUA 4E98A 4LF5F 1YGUA 2ATLA 5IOLA 1WG4A 3QPIA 1RYRA 4Y3CA 3I6PA 2DXPA 1BQNB 2WK4A 3KJNB 4QJVA 4NZ0A 3JQJA 5KG3A 5JJBA 2G59A 1P27B 1QTNB 2IYIA 4OJ1A 4OHWA 4U9RA 3MEDA 4ZP9A 2HK2A 4JI5J 1PXHA 1OYEA 1UFLA 1NK8A 3C6UB 1PYOB 4LT6A 4ZJLA 4C8NA 1T94A 4F3QA 1S0OA 1U0HB 2M3DA 1JLBA 2F65A 3GCXP 1ZA2B 3L7UA 4ZN1A 2FLOA 4I56A 1ONYA 3LP1A 3DI6A 2VV5A 1M5KC 2EC2A 4JI8F 4FF4A 2K3IA 4PYAA 1HW9A 4RW8A 4OX9F 1LFWA 1DTQB 1U1NA 1VISA 4ELVA 4QAHA 2RKIA 4YS2A 2W2MP 3HZEA 1TKZB 1LWCA 1NDKA 3TW0A 3IN5A 2HBYB 4S0MA 4C8KA 2FJNA 4NX8A 3ONQA 4WK1A 1WKKA 3SSRA 3F81A 2NS1B 4QDIA 4ZCLA 4LBPA 1U1RA 4DQIA 2F63A 2EPIA 4DMZA 4FS2A 4KHPF 2F8MA 2HGLA 3GWCA 3QT6A 3MAAB 4P72A 3FSIA 3SQGA 4X66F 1KP6A 1X5PA 2QL5B 4FKXA 2UUTA 4NA3A 4V1Ak 1P9YA 2PN6A 3BKTA 3UD5A 3ET6B 4CLWA 1QSLA 4DR7J 2W4CA 5JVGQ 2A10A 4ED0A 3AWGA 2DGVA 1FE4A 3GYXB 4OZ0A 1G1FA 3HPOA 4LBIA 1MWQA 3OV7A 2YH1A 1WDDA 2GO9A 4ES1A 4NEZA 2BANB 3UCZP 4WZQA 4AT1B 3H25A 4DL4A 4CNZA 4IOBA 1X0FA 1CC8A 5M2UA 4IFYB 4F4AA 1SKRA 2I4GA 4OI6A 2IJRA 4C9DA 1JLFB 4RW6A 1OEMX 1GX6A 4RNNA 4TY9A 2DO4A 1Q53A 3MR7A 3KK1B 5J2QB 2EC0A 1UKUA 3PW5A 3I0SB 4OHIA 3SIPB 2G0JA 1OWXA 3DOKA 5B08A 3HMJG 1OEUA 2NLWA 1H72C 4F36A 4WXWA 4HTJA 4B9MA 1S6PA 1P6TA 2JRSA 4P7TA 4A4JA 1M5OC 4F02A 3VVTA 3RR7A 1TKXB 1U24A 1GQYA 2HZAA 2CNEA 3OFGA 4OYMA 2UV8A 3UDCA 4DU7A 3KLEA 3A5JA 5D4LA 3K58A 5GADU 1RA7A 1D8ZA 1ZM2A 1KLMB 2BRLA 2KN4A 3F56A 3OD2A 3MGJA 2QL9B 4MIBA 3TP2A 3W2VA 4EK2A 2RQKA 5KG1A 5IV4A 3KLFB 3A8KA 3AHPA 3CSKA 4HL9A 4DR5F 1NJXA 1X31C 3OSNA 1XXPA 3A5KA 1EIYB 2I5JA 1NNDA 1YJNS 3DI6B 4MTPA 4F0MA 5B7WA 4DSFA 2R7UA 4C3LA 1WC0A 1YN9A 1YWXA 4DSLA 1XNRJ 1VRTB 1PC4A 2KT2A 5F8NA 4DN9A 5DQGA 1FRXA 2PQ5A 5AE2A 2VQFJ 4ECQA 2WONB 2H1YA 2HS4A 2XMUA 4J37A 1WJ9A 1E0DA 1PTYA 3ZMQA 5IBMA 5I6VA 4J9SA 1XMQJ 5KA8A 1CJTB 4LF6F 2OUDA 1XBWA 3ZM6A 5THWA 3CXCR 2BACA 1NPPA 5HVFA 1NKBA 1XMBA 4AFFA 4B9NA 3GIJA 4EBCA 5E2QA 5B0CA 4PXCA 1Y00A 4EEYA 2G0IA 4C4WA 5IT9Y 2BBEA 2ZBRA 2BQRA 2Y1OA 4H34A 5JXSA 1FRKA 4Y28C 2ESBA 5HMXA 1FRLA 3D6HB 2PIIA 4B9TA 2JEIA 5ETMA 4CT8A 3C15B 2AEFA 2V34A 2XSJA 1YX2A 3CDEA 4AD6A 4G1QB 2GAHC 3ETOA 2CZVC 4K2XA 4EMDA 4DV2F 4UY85 4ERCA 4IOCQ 4E2FB 2VBZA 3GG1A 4J9VA 1XJWB 5LSOA 2VG6B 2GQCA 3Q2TC 3ZM1A 1SC4B 1IBMJ 4YN3B 1FJGJ 4OZ1A 2OC3A 1UJ6A 2XY6A 1PYNA 4NLRA 4ID5B 3HT3A 5KFEA 4UZCA 3G96A 3HFKA 5J2NB 1SKUB 3RBDA 1VS3A 1NWEA 1BZHA 1HNIA 2ZNZA 3AOAA 3I4PA 4CVLA 3H8YA 2BJEA 2ZNYA 5GMEA 1Q6TA 3BGFA 1VBZA 4WOHA 2V94A 2JLGA 5IT9U 2IMGA 1FNOA 4Q8EA 1FVQA 1OS5A 3M8PB 2ZOMA 3M2UB 3MM5B 3ZZTA 2XGQA 2NV5A 2FLPA 5E3RA 3KMSA 1URNA 5CA5A 1REGX 3D1QA 4M5DA 3HLUA 3HULA 4WU3A 3KLVA 5AXLA 1QUVA 2UUBJ 2OPQB 2R8KA 5MMZB 1FQ1A 3CJ5A 3TZYA 4ES3A 4J9QA 2ZH2A 3TAQA 2E7WA 2L48A 3H20A 2I42A 2RF6A 4HKQA 3OQ2A 1HFEL 1HQEB 1JLCB 3GONA 2E9ZA 1YWFA 2YVSA 5K20B 3PW0A 1C2PA 1SH0A 3KHLA 3QZ8A 1Q1KA 1ZETA 1KRPA 3G9CA 4BS2A 3W3SA 2WB4A 3ELHA 2ZE2B 1NB2A 2ZC4A 5KFMA 2YQ0A 1QE1A 3I5BA 4NPOA 1TKTB 4QR0A 4R8UA 4KPYA 2OOQA 3EB1A 2CM3A 2I3RA 4OI2A 3KLGB 3N0AA 2DBBA 1UVKA 4G65A 5F9LA 5EHPA 2ATCB 2C2KB 5CHCB 2F9DA 2XO7A 3JSMA 2D9OA 5LMUJ 2I6OA 2ZZTA 2ZBPA 3PJWA 4NA2A 2GIQA 3I0RA 5DETA 4LR8A 2P9GA 3CCRS 4W92B 4RNMA 1T03A 2RSQA 3QWPA 3JTPA 2QMWA 5KFWA 4J9OA 3H90A 1S1WB 3ZTQA 4K4UA 1C85A 4IG0A 4USIA 5C2GA 4FYYB 2XG8A 1T3NA 1UTAA 2YKMB 3FBCA 2E29A 2MXYA 2PMHA 4JI6J 2G2ZA 2O5DA 2MKIA 2WGPA 2AJ1A 2V9KA 1YI2S 1LWXA 3B8HA 2I0XA 4DFJA 4RBTA 2HURA 2JFKA 1N5YB 2AWZA 2CQ1A 4TY8A 2BDPA 2L9NA 4NYOA 3GXHA 2N4DA 2WBRA 5L1KA 5KACA 2LYVA 1RT7B 4Q0BB 2E5LJ 3KHRA 1HR0J 1X4DA 4OX6A 2BYCA 2MKSA 2OEKA 1T11A 4M5JA 1GMWA 5K14B 4TU7A 4O3RA 1WDTA 4FF1A 1AXQA 2UXDF 4OI4A 5HSPA 3R1LA 1HPZA 2NSCA 3JS9A 2HRUA 4KE5A 4ZLNA 5ITHA 2WOMB 4DQRA 3CD6S 4KBIA 4B3OA 3CIZA 3T1YF 2BJ8A 3GE9A 3W9JA 2E5GA 2EBGA 1VQPS 3ILJA 1LWFA 1TVRA 2ACYA 4C98A 1KAVA 4DV0F 2HLTA 5KOXA 2DGXA 2ZM6J 1TL4A 3M1VB 5KFJA 3VAHA 2E1PA 1RTDA 4DUYJ 1BLUA 4Y0FA 4I68A 4MYUA 3FKBA 3HN7A 2CKWA 4OYBA 4P71A 4HJPA 3D3CJ 4RDDA 3R5BA 3IS9A 4JI3J 3LGNA 2L41A 1S76D 3ZNUA 2CNHA 2H54B 1K0TA 4KI9A 4RPFA 3KLGA 1N34J 1B99A 1VLOA 1JBVA 1IBMF 1FJGF 1PTVA 4ZHRA 1OHEA 5ETSA 3UDLA 2IDEA 3TR5A 3R2DJ 1HBMB 1BE4A 4Q0BA 1RZMA 3OUYB 2DHXA 1NU4A 4ZDNA 4HI1A 4CO5A 1NDLA 1CS4B 1VR6A 2XWXA 2QA2A 4PG5A 1JLBB 3CIMA 3FBFA 1S6QB 2G2OA 3LH2S 3ENVA 3IRXB 4M63A 1XWLA 2MMYA 1RWUA 2QLWA 3PX6A 4FVMA 2ZH8A 3W1YC 3IFEA 5A2QY 5DM7Q 3C2PA 1ZZFA 3D9BA 1RWWB 3H5UA 1DJ0A 3ZV2A 2GW8A 2ZBCA 2FIUA 3T9NA 2CJBA 4I2QA 4M5IA 4DSKA 2K7KA 4IH7A 4KQZA 4OYAA 1G4US 2BM0A 4I2PB 4IR9A 2MPUA 4G1PA 4H4KA 4P75A 4J9NA 4DZ6A 1KVIA 5A76A 1N6QA 4C8ZA 1GQQA 2EK1A 2B9XA 1SPBP 3FBEA 3ULHA 4JMKA 1YTNA 2BR0A 3J7ZT 3MCSA 4A8QA 2BABA 3LAMA 1GH8A 5CZVA 2ZH1A 1CJKB 4OQJA 1UJ4A 4F67A 5HMYA 5IXUA 1U2RA 2XYPB 3L4BC 3FEYB 5ETNA 3VV2B 1UA0A 1X4EA 4K4WA 1DFDA 1O0PA 1MU2B 3DRPA 3TANA 2YWEA 3AJ2A 1RWVB 4DR3J 2LDYA 3L95X 4ILRA 3U7JA 3VF0B 4OHEA 1WC5A 2QLFB 2R7WA 2J7KA 2MQMA 3PO5A 3X1LB 2OMLA 3MR2A 5CD4H 1MSWD 3LJ8A 3G4SS 5F8HA 3DOLA 2MLZA 3QFHA 2HFZA 3TEHB 4ALZA 3BO4A 1YGRA 3OLAA 1Q79A 2BM1A 3MUMP 1YBTA 3RAQA 1U6ZA 2BRKA 2LKZA 2AHSA 4C11B 3C3LA 2BMBA 4IYQA 5A8WA 1AYEA 2E1AA 3PHEA 4RX6A 4M5DB 4YR8B 2EW9A 1HQ2A 4PWWA 1FDAA
chains in the Genus database with same CATH topology
4FVCA 2VZ9A 3V6DB 4WOHA 3EX7B 1RT2A 2FJAB 1S6QA 5A8RA 5F8MA 1XNQF 4DV3F 2J76E 3OR1A 4JMJA 2E9TA 4WE1A 4MK9A 1FNXH 3QO9A 1A6LA 2LEAA 4GS0A 2HNDB 1OEVA 2I5JB 4JI0F 4NLYA 3RB3A 2UVVA 3MF5A 2VODA 1U25A 3DRSB 4A8KA 1HHTP 5M2RA 2RT3A 2A3JA 1KQKA 2I6JA 1I1GA 1W25A 4CH1A 4ECTA 1C88A 2I4EA 4ZP6A 2UVWA 2K1RA 3FCHA 1RTDB 1X5TA 4JV0A 1S9GA 5LT5A 2AGPA 2QA1A 4DSEA 2BA9A 4V19J 3GIIA 4OHZA 2G1DA 4I69A 5SUHA 1HWKA 2VG5B 3IAS9 3G86A 2DGSA 3NS6A 3IR7B 2V4JB 3SFUA 2MKCA 3SXLA 4U67Q 4A8FA 4GE5A 1R31A 2O1PA 1QAYA 3LP2A 1JNZB 3ZC4A 3KLHA 5CQGA 2ADBA 4OI0A 3NLCA 5KT4A 4B3SF 1Q6MA 1X24A 1RT4B 2J0QD 1EP4A 4H4MB 2R8IA 3Q24A 4DR2F 2AGQA 1DZ5A 2HAIA 3FRYA 4JI5F 1N0VC 1L3SA 1FKAF 1Z2LA 2GO8A 3IRXA 3HVRA 2YH0A 3I5CA 3V6KA 5EN1A 1N5TA 5KFXA 2HWTA 2JLFA 1N5QA 2OMOA 3MM6B 2KFNA 4Y2CA 3O3LA 2G6ZA 4XAKA 2OJ3A 1URRA 4PWDA 2FHOB 4Q2LA 4F3MA 3EUNA 1RKIA 1XN9A 4JV2A 4AL5A 2B4SA 3MR3A 1Q8BA 4HDHA 5KG5A 3MM8B 2DGQA 1HWIA 4C8LA 4BC7A 2CQCA 2C42A 1SQEA 3RB6A 4KT0C 2CPEA 4RI4A 2CPXA 1DURA 4Y2EA 3P5TL 4LVNP 3QIPA 1N8RT 1TV6B 1WF1A 3I0RB 4HDGA 5A8KB 2QCTA 2QEXS 2MZQA 1UVMA 2RUGA 1LXJA 1KR4A 1SJRA 3R5CA 4M8LA 3RAXA 2HHXA 2F6FA 4ZPTR 2BQUA 3TX8A 3S4EA 3FMBA 4F3OA 1RTJA 5LL6d 2NSBA 2CQGA 1FJCA 2IJNA 1R43A 1QE1B 2LEPA 4YB1P 3MM6A 1V3AA 4NXMF 1HNWF 1FK9A 1P15A 4A8MP 2ASDA 3MMCB 4J51A 2DJWA 3E01A 3Q2SC 2J6TA 4NWBA 1DAXA 3DFEA 3NG8A 1GT8A 1OPIA 4KO0B 1CG2A 4TY8B 4E8UA 3E2EA 5A8WB 1G1GA 2BV5A 2AYEA 4HLBA 4NLWA 5F41A 2POKA 3PW7A 5HQ8A 3LAKA 2F8HA 2KKHA 2ZJQQ 1UVJA 2CMAA 4I7FB 3KG1A 1WF2A 4JUZA 5JUMA 2HCMA 2DNNA 3HVTA 4KFBB 3OTOF 2K1RB 1BWEA 3D42A 2XLIA 3MEGB 4EU0A 1E6VB 1V3ZA 2C46A 1VGYA 4IKCA 2GP0A 1T3OA 1JLGA 4QIGA 1CVJA 3KJVB 1FPRA 3LW5C 2GIRA 2H5EA 1VQ5S 1GTHA 1J5OA 1AW0A 2M9KA 3TAMB 2YNGB 1UWBA 3NNCA 2IAJA 4C0BA 5KA9A 1X5SA 2PA3A 3OXLA 5L9NA 1G1HA 1M5SA 2GMJA 4KRWA 1TV6A 1U2FA 3DOMA 4JV1A 3K0JA 5DDQC 4DOZA 4K4ZA 4IG0B 4HT7A 1YFOA 3H2VE 4N77A 5KFGA 3PX0A 1Z1ZA 4F4ZA 1HMVB 4ZN5A 2B3TB 4ED6A 3HO1A 5CCMA 4ECYA 1VRUB 5CZXA 1S1TB 2YX7A 4A8YA 1SKWA 1R8CA 2LECA 4NXNF 1TL3A 2JSXA 5KFYA 2JJDA 2R2RA 4N47A 3PR4A 2GHVC 4NLSA 2KM8B 2DHAA 3US5A 1VOMA 3HVWA 4Q8FA 2YNIA 1HW8A 5GAGI 1KS2A 5LJ3Y 1SJ3P 2OD4A 2GHWA 4BJOA 1T02A 2MZTA 5DG7A 1S1VB 4G1QA 4X4OA 2C3UA 4YB7A 3CB4A 3TVZA 2VC0A 2VH7A 3KLEB 2YNFB 3DHXA 4WFYA 1YITS 2P6TA 2VKRA 3KLIA 4WFXA 4R5PB 3GR1A 4I6WA 2G13A 2W9CA 3RW6A 1HBOA 2B9WA 3GFYA 4WK3A 1WG1A 1SJ4P 1B0PA 4U7CA 4NX9A 1LV5A 3BSCA 4I2PA 2LMIA 2WAQD 5EX0A 5KT5A 2RNEA 4K4TA 2FJDB 1RT1B 4B9UA 3TUZC 3QJPA 2DITA 2AU0A 2YNGA 4U6PA 1K1QA 2B7BB 3I9V9 3O44A 2LU1A 2M2BA 4IKAA 5AXMA 3UD4P 4NRTA 3U1LA 5F8GA 3C66A 2RRAA 1OHDA 3HZGA 2RS8A 1S72S 3M6VA 2EFQA 1HNXF 5T14A