3MMJA

Structure of the ptp-like phytase from selenomonas ruminantium in complex with myo-inositol hexakisphosphate
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
314
structure length
314
Chain Sequence
QTVTEPVGSYARAERPQDFEGFVWRLDNDGKEALPRNFRTSADALRAPEKKFHLDAAYVPSREGMDALHISGSSAFTPAQLKNVAAKLREKTAGPIYDVDLRQESHGYLDGIPVSWYGERDWANLGKSQHEALADERHRLHAALHKTVYIAPLGKHKLPEGGEVRRVQKVQTEQEVAEAAGMRYFRIAATDHVWPTPENIDRFLAFYRTLPQDAWLHFHSEAGVGRTTAFMVMTDMLKNPSVSLKDILYRQHEIGGFYYGEFPIKTKDKDSWKTKYYREKIVMIEQFYRYVQENRADGYQTPWSVWLKSHPAKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Substrate binding in protein-tyrosine phosphatase-like inositol polyphosphatases.
pubmed doi rcsb
source organism Selenomonas ruminantium
molecule tags Hydrolase
molecule keywords Myo-inositol hexaphosphate phosphohydrolase
total genus 111
structure length 314
sequence length 314
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14566 PTPlike_phytase Inositol hexakisphosphate
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1690 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3mmjA01
3.90.190.10 Alpha Beta Alpha-Beta Complex Protein-Tyrosine Phosphatase; Chain A Protein tyrosine phosphatase superfamily 3mmjA02
2E0TA 4H34A 2VEVA 1G7GA 2HCMA 3RGOA 2PQ5A 4ICZA 1RXDA 3U96A 3S3HA 4QBEA 1U24A 1R6HA 4NWFA 4NWGA 2HXPA 3V0IA 4JNBA 4D3PA 1NL9A 3V0HA 2I42A 1PTUA 3RGQA 4R0SA 1U26A 4NYHA 1X24A 5KABA 2I4HA 5LXQB 2I6PA 1D5RA 3CM3A 2CNGA 3QCIA 1G1HA 2NZ6A 1G4US 1NNYA 1QZ0A 4OHIA 3F41A 1OETA 2CM2A 2JJDA 3ZM1A 4YAAA 4WU3A 1Q1MA 2H4VA 5KA2A 1L8KA 5BX1A 1C83A 1OHDA 4ERCA 2OOQA 4H1OA 2QDMA 1T49A 4ZI4A 2HY3A 2B4UA 3QCMA 1ECVA 2BGEA 2QBSA 3EAXA 2C7SA 3O4TA 3QKQA 2F6TA 1T4JA 1YN9A 2GJTA 1U25A 4ZN5A 2OUDA 1YPTA 2H03A 2HC1A 1AAXA 2Q47A 2R0BA 3BLTA 1NO6A 2QDCA 3MMJA 1KAVA 1YGUA 4GRYA 2PI7A 4HJQA 1Q6NA 2B3OA 2A8BA 3S3FA 2ZN7A 3O4SA 1QXKA 2WGPA 1OHEA 5K24A 4PYHA 5IBSA 2J16A 4JMJA 2QBPA 4D3RA 3F81A 1PH0A 1PYNA 1XRIA 1OEOX 2QBRA 2ZMMA 2VEYA 3A5JA 1A5YA 3F9BA 3O3LA 1YTSA 4QBWA 4RH5A 1PTYA 2F46A 1FPRA 1XXVA 4RI4A 2GP0A 2FJMA 2PSZA 2SHPA 3QCCA 1I57A 4R0TA 4GWFA 3AWFA 3F9AA 1LARA 3EMUA 1T48A 2P4DA 2OZ5A 3OLRA 2NT2A 2NV5A 3M4UA 2HNQA 1Q6TA 4HJPA 2VEUA 4QUNA 2CJZA 1XXPA 2AZRA 1C84A 3S4OA 3SMEA 4KI9A 2M3VA 4MBBA 4OHDA 1Q6SA 1LYVA 3D44A 1OHCA 2QEPA 5KA0A 2PA5A 4GS0A 4Z6BA 2P6XA 2H02A 2HNPA 5KA3A 3D1QA 1NWEA 3GXHA 1MKPA 2CM3A 2B49A 1ONZA 5K9WA 2MBCA 4WU2A 4Y14A 3S3KA 4GFUA 2B4OA 2FJNA 3S4EA 2I1YA 4BJOA 2CMBA 4S0GA 3PS5A 1YFOA 1PTVA 2I6MA 1PXHA 1C88A 3ZM2A 2RF6A 2PT0A 5EHRA 3V0DA 4GE2A 2BZLA 2FH7A 3RZ2A 1YTNA 3D1HA 2I4EA 3H2XA 3NMEA 1EENA 4AZ1A 4KYQA 3D9CA 3ZMPA 2J17A 1ONYA 3QCGA 1PTTA 2QCTA 1YTWA 3MOZA 2I5XA 3BLUA 5KA8A 5KACA 1LQFA 2YDUA 1I9SA 1J4XA 4ZRTA 2CNEA 3QCFA 1ZC0A 4Y2EA 2I75A 5MMZB 5KA9A 2DXPA 4BPCA 1PA1A 1I9TA 1OESA 3I36A 4NNDA 2NLKA 1SUGA 4RH9A 4J51A 3V0GA 3AWEA 3O5XA 3N0AA 1VHRA 3O4UA 3CWEA 5IBMA 2IMGA 2OC3A 3OMHA 4WOHA 2HB1A 4JBCA 1V3AA 1WCHA 1GWZA 5BUGA 4DGXA 2BGDA 2BV5A 3F99A 3QCDA 2A3KA 2H4KA 2I6OA 4OHLA 2NT7A 1XM2A 4RI5A 4D3QA 5EHPA 5K23A 1NZ7A 1JLNA 1JF7A 5AWXA 1WRMA 1EEOA 4RDDA 1G7FA 4GE5A 2H04A 4GFVA 2CMCA 1NWLA 1PA9A 4QAHA 4QUMA 1C86A 2ESBA 2Y2FA 3SR9A 2H4GA 3BM8A 1Q6MA 3I80A 3EU0A 1C87A 5BZZA 3GXGA 2F6FA 5KA4A 2I3UA 3RO1A 1WAXA 2J16B 1BZCA 2F6VA 4OHHA 4GE6A 1ZCKA 2HVLA 3ZMQA 2F71A 2F70A 2QBQA 5KAAA 5GTJA 1Q6PA 2Q05A 3V0JA 3I7ZA 3S3EA 3AWGA 3ZM0A 2B07A 2G59A 1C85A 1OEMX 4TVVA 5M43A 1YZ4A 4RKKA 5KA7A 1RPMA 2QDPA 3QCNA 2F6YA 2AHSA 5I6VA 4B04A 2CFVA 2I3RA 1FQ1A 3A5KA 4GRZA 4KYRA 3QCBA 4R30A 2I4GA 3QCHA 1GFYA 5K25A 2C46A 3LJ8A 2CNIA 2I6IA 2I6JA 5BZXA 1BZJA 3B7OA 1FPZA 1P15A 5J8RA 3V0EA 2F6ZA 2Y96A 3D1OA 2VEXA 3MOWA 1M3GA 1G4WR 4YR8B 3D42A 1Q6JA 1ZZWA 4PVGA 3QCLA 3EZZA 4WTYA 3QCKA 3QKPA 2B4PA 1YWFA 1G1GA 2BIJA 4OHEA 5K9VA 1OEVA 2PBNA 2CM7A 1OEUA 3EB1A 2GWOA 2VEWA 5KA1A 4JMKA 3V0FA 2G6ZA 1ZCLA 3BRHA 1YGRA 4QAPA 2HC2A 3ZV2A 2CNHA 1BZHA 4I8NA 3QCEA 4RHGA 5HDEA 2CNFA 2QCJA 2NTAA 1KAKA 2CMAA 4DGPA 1L8GA 5K22A 1XBOA 2B4SA 2CM8A 3QCJA 4IKCA 5KADA 3ZM3A 2F6WA 4NX8A 4HRFA 1G1FA
chains in the Genus database with same CATH superfamily
3LGNA 3W9IA 2G13A 3UVJA 2O01C 2E0TA 5C5JA 4DPOA 4ES3A 1VMBA 3C6TA 4JI1F 1FI4A 3C16A 4LVNP 3OVAA 2Q6CA 5CYMB 2E5LF 3EGNA 2KFNA 2HCMA 2PIIA 4AE5A 3I0SA 5CD4A 3I31A 1RXDA 1IXKA 3VR1A 4ZP6A 3QLHA 1KNZA 3U96A 5K14A 1I94J 4F4WA 1LW0A 1S6OA 3UNGC 4M5KA 1R6HA 2JHEA 4P7TA 3BS9A 5AJ3J 3BDEA 2GVDA 1REVA 2ZC4A 3EYZA 4NWGA 2RQMA 3M1VB 4DL7A 1IBLF 3M7VA 1S7IA 1T9UA 2BBEA 3GIMA 1TMMA 3IC1A 2IM1A 4RW4A 2ZJRQ 1JJCB 4KGXB 2Q43A 2I42A 1CLFA 2HQ3A 1S0OA 3CMQA 4MKYA 2ZZTA 3AHPA 2CPZA 2DGWA 3FSXA 1DQ9A 2CQBA 3A3OB 3EUNA 3IRXA 2XSFA 2YKOA 3LAMA 2HVIA 4CLTA 4RUBA 2RH3A 1YJWS 1R8AA 1FRXA 4KGKA 1T94A 2BM1A 4I6YA 2I4HA 5AE3A 1LW0B 1RDRA 4DV2J 4I1TA 5L1LA 2JEGA 4IOBA 1ZAVA 4RO0A 4AT1B 1RA6A 5E5NA 1RWUA 4FP9A 4M5LA 2Z2ZA 2A6OA 1SJ1A 3OR1A 3VAGA 1HHQA 2YKMB 2P6SA 1WI6A 1ZM3A 4I68A 3GCXP 5KG7A 1HR0J 3CCTA 1N8RT 3ZTRA 1UVIA 5KA0A 4DV1J 2E9RX 1F60B 3BPSP 5KTQA 3CCMS 2E9ZA 1KQKA 1M90T 1KVKA 1HLWA 1RP5A 4DPYA 2ACMA 4JV0A 3K5MA 5I3PA 2XPCA 2AGOA 2OEMA 4TQSA 1HI0P 2HLTA 3TZXA 3L7PA 1XNRJ 3QCEA 1JJ4A 3S1TA 1FHTA 1QZ0A 4UOHA 3F41A 3IRXB 1MROA 3TR5A 1OETA 2JJDA 1REGX 1RHMB 1N6QA 3GLJA 3D28A 2D7SA 2XC9A 1H7XA 3UQSA 3QSYB 3DLGB 2C2KB 3JSBA 2BV3A 4ZLPA 4FF1A 2DNRA 1UEKA 3LW5C 4C48A 3IXQA 4WFBQ 5KFBA 4J9NA 3UW1A 3UCUP 4ERCA 1JJHA 5L1IA 2OOQA 3UDCA 3HM9A 4H1OA 1EARA 4RL1A 4KY3A 4O4GA 4ILMA 4LSNB 1WHVA 1QTNB 1H72C 4OYZA 3SV4A 4LF9J 2AM2A 2CJQA 4F25A 5F9LA 2HY3A 2YNHB 3OXGA 4JUZA 3W2WA 5KFHA 3ZTSA 3RZ2A 5B0FA 4ZJQA 4HACB 2H5IB 3AB2B 3ZTQA 1QAXA 1HBMA 3AXMA 2PFDA 2BGEA 1TL1A 2VKZG 1IUJA 1FKOB 1XR6A 4Z2XA 1GQEA 4ZLJA 5M2PA 5F8MA 1P27B 4F4XA 2DT9A 5A8WB 2MY7A 2XCPA 1CJVB 4ZK7M 1U4BA 4ITSA 1FE4A 1N6QB 2VL1A 1UAWA 2CQDA 2JVRA 2FVCA 3IG1A 4LQ9A 4DV0F 2YKQA 1VBXA 4JI3F 1EZZB 2VFSA 3CCUS 1SUQA 2HS4A 3CF5Q 4YOEA 9RUBA 4GO7X 3HHEA 2PMHA 4F4AA 1T9XA 3W66A 3ETMA 3IS9A 1N48A 2KHDA 1YITS 1B7YB 3FBEA 3FQLA 4ED2A 3PX0A 2MKYA 1IVZA 1AAXA 2HC1A 2Q47A 2RDDA 1Y9OA 3TWZA 1LXNA 3DMJA 3ENWA 4X84A 3JAMU 3T5JA 4KJIA 2HWTA 3GTYX 4K4ZA 1NO6A 3WDOA 3MMJA 2Z56B 2DNPA 4M5IA 1K9MT 5GAEU 5HQLA 4JI4J 3L7UA 3IP0A 2B43A 3K17A 2NS1B 4FN5A 4Q2MA 1S1VA 4ED4A 5A76A 3RG6A 4KV8B 2W8KA 2H5EA 4PXEA 5D78A 2R2RA 4F4KA 3WBZA 1N5TA 3VHQA 4Q2LA 5HAOA 3TZZA 4CH1A 3HFZB 3E01B 3ETOA 4P75A 2YKAA 5DM7Q 3N5FA 4A8OA 3O4SA 3BKTA 2NCKL 1QXKA 2WGPA 3US5A 3DLHA 1H2TZ 4LF6F 2B4VA 2ZHOA 1OHEA 4ANEA 3KHGA 4PYHA 1RAIB 1U6FA 3FBCA 2ZM6F 3M8PB 2PI5A 4JMJA 2RRNA 3DLKB 2C2DA 5U47A 3OFFA 2BW2A 4F02A 3D7SB 2QBRA 4CLUA 3A5JA 3RW7A 1NKEA 3DOMA 3NNHA 1U49A 1A5YA 4C7QA 1GAOA 4HI2A 4I69A 2DISA 4Y00A 3VGUA 3G6VA 4P52A 3N9UC 4IQMA 1YTSA 4EK2A 3GPAA 3V6DB 2DR7A 1HQUB 1S1VB 2DGTA 3W2VA 3QIDA 4UT4A 4DXLA 2FVSA 4PUOB 2B0GA 1XMQJ 2QMUB 3MECB 1QSSA 1RU1A 4BC7A 4DFMA 8RUCA 3E01A 1YIJS 4OL8A 2FJMA 1MMLA 3MUVP 3VAJA 4EO8A 7FDRA 4C8ZA 3H5SA 4HDHA 2BJ7A 1CC8A 4Y14A 4R0TA 2BDPA 2JFFA 2UAGA 2UXCF 3I32A 4HT5A 4DS5A 2C1EB 3J81Y 5F8NA 3M8PA 1TL7A 1FKPA 4ZJOA 5F8JA 3I6PA 5E3QA 1TK5A 2F7VA 2P4DA 5THWA 4KFBA 3DOMB 2OZ5A 2NT2A 1FK9B 2FY8A 2EWHA 2MKIA 2DNOA 4OZ1A 4USWA 1NK8A 1Z2ZA 3ZZZA 2HHHF 2AWZA 4PZVA 2RQ4A 4DR1F 1NZ8A 2DXFA 5LMUJ 3V6DA 1WG4A 2CWKA 2LVWA 3LP0B 3ILOA 4DDFA 5B0AA 3MM8A 2LEAA 4OZLA 4AYBD 2W8LA 1UVJA 2K7KA 2QV6A 3OSNA 3D6HB 4Z7YA 4QUNA 5A6PA 2FGCA 4L75A 4UUWA 3L9ZA 2KO1A 1KEKA 1XXPA 2VOPA 4WYLA 2KFYA 3GV8B 3GFHA 3CMES 2AZRA 3EVOA 2VDHA 3JB9k 3SMEA 1FJEB 1RISA 2CPFA 3M2UB 1TL7B 2AZ3A 3NNAA 3CJ8A 3KLFA 2UU9J 2LQ5A 3W9JA 2HW3A 4BCAA 1LYVA 2J7UA 4QR1A 4ZP8A 2QSFA 4TXSA 4HVZA 3RZAA 3C14B 4Y6IA 1Q6SA 3ZTPA 2GJ2A 1JK9B 5HK4A 2MDAA 3Q23A 4F2RA 4NLTA 1DBDA 2K2PA 2P9EA 1UMJA 2W2PP 2P6XA 1N36F 4WF9Q 4LF4F 2H02A 1OQ6A 1LK7A 2XO7A 1U1NA 2DHXA 3G6XA 1I1GA 4ES2A 4W92B 2OPRB 3UD5A 2BJDA 2IPOB 1VBKA 3VZIA 1ZPWX 5J2MB 2XGQA 2KTQA 2X1BA 2FQQB 4XAKA 1DLOB 5K9WA 3PV8A 4JV5J 5FD1A 2FLPA 3C16B 3NAHA 4LVOP 2B5JB 2ZBRA 3Q83A 2FJNA 5DQIA 2VJUA 2WJPA 3M2UA 1T3NA 2CJAA 1Q79A 1QUPA 5HP1B 3B6BA 2I1YA 4BJOA 5IM0A 2D41A 3QT8A 2QRRA 1BWEA 1W2IA 4S0GA 1S57A 1NAQA 2YH1A 4FF2A 5IS2A 2GVDB 3PX6A 1PTVA 2DO4A 1T9VA 4LRAA 1EKRA 2W25A 3OR2B 3QQCD 4OHVA 1JJ2R 1EETA 1FDAA 1VISA 2DKOB 3MHYA 1SCJB 4G1QA 4HL9A 4WXWA 5T7LB 5GMEA 1M5OC 4QU7A 1Q53A 2PE8A 4OJGA 1HA1A 1UWAA 3K7RA 4USIA 2DO0A 1RTHA 3V2UC 3ZXWA 2DJWA 4CNZA 5EDWA 3M2VA 2UU9F 2JC1A 2VZ9A 4I0WA 3FEZA 1PC5A 2CVIA 5LJ3Y 3HHLD 1ICEB 2N4DA 3DOKB 1RTDA 4OI4A 4Q8FA 3D6TB 3JSRA 3N28A 3L7OA 4IH6A 4ZPCA 5L8RC 5BYQA 6AT1B 3DLBA 2DNHA 4LF5F 3V6JA 1EENA 2M5YA 1GX6A 4AZ1A 4QJVA 2R7VA 2I5JA 1J5EF 1FXDA 4OHXA 1KVJA 2H4WB 4KYQA 1Y3KA 1RBOB 4ECTA 2CNNB 2B9WA 3IWNC 5GADI 1PJ5A 4FDFA 3PJWA 4JB8B 1D0EA 2Y68A 2HQIA 3BM7A 1TK8A 1FO1A 1DJ0A 1H73A 2P9CA 1RT7A 4QBUA 3MOZA 3RB0A 1SL2A 3BLUA 1LQFA 5B08A 2JLEA 4K0KF 2UUTA 5EGYA 2EC2A 3EMTA 3MPWA 3MURP 4K4TA 1U48A 2DIVA 2I75A 4K4YA 5MMZB 1L3KA 1NMEB 3CCWA 4C9DA 3ET6B 3PXGa 2YNIA 2GZOA 2LECA 4XK8C 2DXPA 1U1LA 3M2RB 3RRHA 1OESA 3I36A 4ED3A 4ENOA 3EGZA 4N8NA 3MR5A 4NNDA 2BX6A 4ZIYA 5IC6B 2CQ4A 1BLUA 3V4MA 3FSIA 2H3EB 5HJYA 4UTGA 3GQCA 4JI8J 2QL5B 3RAQA 2ILZA 1L5UA 1EIYB 3AWEA 3V0GA 1X5PA 2C2EA 2IRUA 5DG7A 3LO3A 3BBCA 4LR7A 4NLXA 2MLXA 5KAKA 4J9PA 4JI2J 3O4UA 1LQ9A 3A12A 1Y11A 3MEDB 3PYEA 4DPWA 4DZDA 3SI8A 1IWAA 1TUGB 2HQCA 2F4VJ 3OMHA 1WOOA 4Y2KA 2DH7A 2QE5A 1GWZA 3VAIA 2AP6A 3OHBA 2GC5A 1A0OB 1Z2LA 4C11B 3UE2A 4DOZA 3BQ2A 1PJ6A 2LQ8A 4TY9A 4YHHF 3QCDA 4ECZA 1W2BR 1HNVB 3TUPA 5HMWA 2H4KA 2EBGA 3HVRA 1N33J 1RWKB 2DHGA 1BY9A 1ZTTA 2MPUA 3IM8A 1FRHA 3TAMA 5BYSA 4A48A 4DV3F 1Q8BA 1Q5VA 2HBQB 3IG1B 5E0OA 3PO5A 2R7WA 1FWPA 4DFJA 2EG1A 3BH6B 1G7CB 2KT2A 1OPIA 2G0JA 2XZTB 1G3OA 3IGVA 3JQMA 3Q2SC 4FYXB 5CH7B 1UEUA 5AWXA 2BRLA 4RDDA 3MEDA 2AX0A 4KHMA 3TEGA 1Y3JA 1WEXA 5IOLA 3U1NA 1G7FA 3PIPQ 4J5OA 4TY8B 3DMJB 1J6UA 4DHVA 4C97A 4O3PA 2J9EA 1R0BG 4O4RA 3UN2A 1C86A 2ESBA 1H2UX 1RBLA 1RK8A 2LFVA 3CD7A 4OYOA 3QPIA 4OZJA 4JI2F 2FJBB 2J8SA 3SIPB 4CP5A 3N6MA 1NK5A 2EPIA 2DVIA 5D3GA 1LWEB 2C3UA 3LAKA 4H4KA 4LFBF 3M8ZA 4I2QA 2D9PA 1CJTA 3VTIA 3JYTA 1N0UA 1YVFA 3ILLA 1M5HA 2JRSA 5A6WA 3SDEB 3HPOA 3EU0A 2HBZB 3NOCA 1PCAA 3M6VA 3V0EA 1MN9A 1WKJA 4M5DA 2W24A 1RTJB 3BBBA 4YN3B 2X1GA 4DR2J 3RO1A 2FZCB 4LF7J 2W2NP 3ILJA 4YB6A 5KG2A 2HQDA 2BQUA 2R8JA 2E9TA 4FYVB 4ILLA 5A0YB 2HYIB 4DFPA 2R2UA 3PYFA 1ZCKA 2F71A 1CS4A 4H4MA 1Q1KA 1SBRA 2MZTA 5ETOA 2NXEA 2UUBJ 1LFWA 4X4RA 2WBRA 3AD7C 2QBQA 4CVKA 4NL5A 1Q7YT 2WSCC 2GO8A 5L9XA 3BN4A 2P2CB 4ETXA 3BGUA 5KFPA 5I3UA 1F5CA 2YWFA 1HQUA 3O44A 2CFXA 2XJAA 3NWGA 3KLIA 2LA6A 5H9FJ 2MB0B 4PUOA 2ZUAA 4NMXA 3TUIC 3BQ0A 4CH0S 1YGYA 3NMAA 3AWGA 1T02A 3CPWR 2DH9A 1R8CA 1VK8A 1S49A 2FD2A 2VG5A 2QLWA 2Z2MA 3MM6B 5HQMA 1F5BA 5KFDA 4RW7B 4UY85 2AQ4A 1WOSA 2RU3A 4TU9A 2OPSB 1SVDA 3AH6A 3SDEA 2GVZA 4OZ0A 3DCAA 5EX0A 3R7NB 3RBZA 2XY7A 2G9OA 2CQPA 2K3IA 1EP4B 3CDUA 5DG9A 1HD0A 3GIJA 4JV1A 2V8DA 1U1OA 1S77D 2QA4G 3EDQB 4KHRA 3LGMA 3N01A 1HWJA 1RTIA 3MPUB 3EVMA 3ISZA 2ABYA 3AJ2A 3IMQJ 4IG3A 5LJ5Y 1X7VA 3UO0A 2DNMA 2BR0A 4JI0J 4KFBB 2C2ZB 1V5IB 2XMUA 1W25A 1HNIA 1FK9A 3SMZA 3KK3B 4AQYF 4AUKA 3J7YU 3H25A 2XY5A 2AHSA 4B04A 4MKAA 1DQAA 2UXDF 5B09A 2FYXA 5FJ4A 3N79A 5KFAA 2KH9A 2F3JA 4LF7F 1JLBB 1OMSA 1TV6B 1UCNA 2RU9A 4CWBA 3A5KA 4USVA 3D5MA 3KJVB 3BSAA 4GRZA 1GQQA 1S6QA 1GMWA 2C2MB 3TZWA 5KFQA 4A8WA 4EBEA 4ZITA 2LCWA 3H2VE 1ZS6A 1R31A 3JSYA 1GFYA 2C46A 3HP6A 4JYAJ 3TA0A 2M9KA 2VB6A 2I6IA 1RZMA 3KWMA 2V67A 2OLWA 3HKZD 2J6SA 2RILA 5MLCV 2X5OA 4IR1A 2BE2A 3B7OA 4I7FA 3RB3A 3AJDA 2KG0A 1HNIB 5CD4H 2AGPA 4NCBA 5J8RA 4DQQA 2WB1D 4Y3CA 4K4WA 4LFCF 2IA0A 2E1PA 3M8SA 2KZMA 3GYXB 3I9ZA 2EBEA 2YDUA 5F3TA 1AYEA 2MSSA 1CJUB 1WSRA 4KRWA 5ETKA 2OPRA 2LDIA 2Z2LA 3H5UA 4H4KC 4PEOA 1NSQA 3BO2A 1G4WR 2E1CA 2ZFHA 2F1FA 1VQSA 4F3OA 1V3RA 3DI6A 2CNKB 3Q89A 2IVFB 4PVGA 1U8SA 2DB1A 3LOUA 3A13A 5B0DA 3EZZA 1SQFA 3Q8QB 3RB6A 2B4PA 1CC7A 2R8KA 5KAAA 1VQPS 3D6MB 1YWFA 1GH8A 2CPHA 4RWXA 1G1GA 1R8HA 2BIJA 3IBCB 4OHEA 5K9VA 2R7QA 6FDRA 3OLBA 1T9TA 4QYZK 2AM1A 5D4LA 4ID5A 2Y1IA 2X7IA 1HPZB 1Y0HA 2RB7A 1FJCA 3K8WA 3H4BA 2OMLA 1H6KX 4LSLB 3ZZYA 2HRTA 3OJUA 2R9LA 1URNA 3MOWA 1NZAA 4ALZA 2KM8B 4LBHA 2RQCA 3QRQA 1UTAA 3MPYA 3P5TL 1NPPA 1IKVB 1JLCA 2G1DA 2ZDOA 3CO9A 1Y00A 3ZZTA 4DCOB 4CZCA 2D3UA 5AXNA 1IBKF 3H90A 3FUYA 2JFKA 3C66A 3IFEA 4LSZB 5DZ6A 4WYWA 1DAXA 2B9XA 2ZBIA 4GVLA 4DV7F 1SH3A 2Y96A 2LQJA 2K7JA 3DOKA 3CXCR 4I4BA 1RTDB 3HZEA 4PPZA 4ZCLA 5HLFB 3PW5A 1RHQB 1F1BB 2QBPA 3RYLA 1FESA 2MHEA 3D66A 1S9GA 1XTZA 3S01A 4RBVA 2ASDA 1IR2A 3P4UB 3I4PA 2ZD1B 5K20B 4DV6F 1HW8A 4LFBJ 1AROP 4DGPA 1SC6A 2H48B 4WK1A 1B70B 3PEJA 4USJC 4CH7A 1WEYA 2B4SA 1JX4A 3AA9A 4LSLA 5K8OA 4ZVHA 2V50A 3ELHA 1NU4A 4K7QA 2FJWA 3PFOA 2F5GA 3RGIA 1ZBTA 1TTHB 3RW6A 4UOGA 3JTNA 3MAQA 5F8IA 3W9HA 1GQYA 2RRBA 4P6QA 4W98A 1GMUA 3PW2A 2NZ4A 5KADA 4NLQA 4Y2CA 1CULB 1OY9A 3MAAB 1U45A 4NX8A 1W78A 2IAJA 2DTJA 3X1LB 2OTJS 2LP4A 2HMIB 4F50A 1G1FA 4CLLA 1TU0B 3ET6A 3KG1A 4O0NA 3DXBA 2KYXA 4NLGA 3N0VA 5HLFA 2BKPA 4NRTA 4RNHA 4Z7CA 2ZHBA 2PMWA 2BJEA 3TO8A 4D3HA 2ASJA 4IO1A 2BEFA 1KFDA 2OSQA 1XC9A 2PQ5A 1FDBA 2ZD1A 1YJRA 3MF5A 1NK4A 2J0QD 4ICZA 5G0RB 4QBEA 4ZMMA 2ZDPA 1WD6A 2CPYA 4ZHRB 1M5SA 4EWTA 1XNQJ 5ADZA 3NS6A 4CO5A 2HK3A 3A4TA 2G0CA 3IR5B 1KHWA 3UFCX 3KK1A 2HHSA 2QFJA 3ZZUA 4K4VA 3V0IA 2JDJA 4YB5A 4HHJA 4D3PA 2HNYA 4IO9Q 4C11A 3I5BA 1NL9A 3MAAA 1RAHB 2RNEA 3D9BA 1S1UB 1KN6A 2NZCA 3V0HA 3EXCX 3AT1B 4O44B 2E1AA 4YR3A 1VQKS 1HBNB 1PTUA 3CCSS 2ZBQA 2DHSA 3DOLA 3PRDA 4FXWA 4HHHA 4OX9J 4NLSA 3GV7B 4DR6F 2FHMA 2NYIA 4NYOA 3VVUA 1WC1A 4R0SA 2DK2A 4NE9C 2IMOA 3MMBA 3PACA 3W7BA 4X65J 4J9OA 3HULA 2MZSA 3GJSB 2IM0A 3CD5A 4OYBA 4ZHRA 4ZVPB 3R7BB 3TEHB 1KTVA 2ZH8A 1N36J 3CULA 4K0KJ 3THTA 2I6PA 5GVQA 1BWVA 4CLKA 2MZRA 2CG8A 2MLZA 1D5RA 1VI7A 2RHSB 4GRSA 2CQCA 4RPFA 2FJEB 2QGFB 4CM0A 2CNGA 2J9DE 1DTTA 1Q8LA 4DV5F 4Q7AA 4JI0F 3MR2A 1YLXA 4IOAQ 4PWWA 3U1MA 1IR1A 4DV4F 2N4CA 3AJ1A 1NNDA 5CYJA 1CJTB 1MW7A 4CIOA 3K58A 2AEMA 4OI0A 1SIZA 3C15B 1G4US 1NNYA 1UETA 4F3MA 2B6AB 2CM2A 3THPA 2E5IA 4C8MA 1N5YA 4M5DB 4YAAA 3CCLS 4WU3A 3MMBB 2D3ZA 4YS2A 1Q1MA 2Z57B 1E8CA 3G82B 1ZZFA 2F9JA 2GIRA 3Q24A 1S76D 2FUG9 5A0YA 1ZM2A 2PFFB 5CABA 5BX1A 3WHIA 2K8GA 2UVRA 3GE9A 4RBUA 4RH9A 2LXUA 1S10A 2FHKA 2RRAA 2QTWA 3GONA 4F4YA 4O3QA 2WOMA 2XZDB 3NBPB 2WSEC 1M5PC 4FYDA 3AB4B 4UF4A 5D4NA 1VS3A 4LRDA 5K8NA 3UDEA 5EWGA 3FEYB 1WDDA 1ECVA 3MCSA 4KE5A 2JSXA 4M5JA 2A18A 2OPQA 4BDPA 2VC1A 4USHA 3CGIA 1BQNA 4CM2A 5DDOC 2B7BB 2QBSA 2G2ZA 4X4NA 1LFPA 2IM2A 3FEXB 4OX9F 4LBPA 5K5MA 5KFFA 2GVZB 2RQKA 2RKIA 2LYVA 3QKQA 4M1KA 2NR0A 3E2EA 2OD4A 4CYUB 2F6TA 1U02A 1K8AT 4QIWD 4NWBA 2MKKA 1RT5B 1Q0NA 4HI1A 4YR0A 3BKUA 2IJNA 1T4JA 2GJTA 2R3VA 3CTRA 5H1SV 4HV4A 3TW0A 3NNCA 1YHQS 5J2PB 4DMZA 3X3UA 3W64A 1FFGB 2MKHA 5KT3A 2ZH6A 1BD6A 5CZVA 1VQ7S 5KA9A 5LT5A 2JEFA 4WPAA 1C0TB 1N54B 2OTLS 2EI5A 3JQKA 4KAIA 1R89A 3B4DA 1KSPA 2IHR1 4DEZA 5KG5A 2XY6A 3EVWA 1KAVA 1T9WA 2DNQA 2YNFA 3MMAA 5CHCB 3ZZ0A 1XR7A 2ZOGA 4Q43A 2PI7A 3GFYA 1F3VA 1HNWF 4QIGA 2Y1OA 2F63A 3D54A 3QT6A 1Q6NA 1PYSB 1FWKA 2G0IA 2ZOMA 4MK8A 4C0HA 1QSLA 2KXHA 1OY8A 3MEEB 5DS7A 2BOAA 2AGQA 3K0JA 3PCOB 3TAQA 3UAGA 4P2MA 1CVJA 1NK7A 2B9EA 5A5FA 2BE2B 2J16A 1NPKA 3A8JA 2O66A 4OMFG 4KIAA 4A47A 2MQPA 3F81A 1S7HA 1FJGJ 1PYNA 2ZC3A 5E3RA 4WP3A 2VH7A 3PTWA 2VEYA 4BC9A 3NGUA 1V9OA 5HVHA 3F9BA 1FNOA 3I5AA 2DR8A 1TVRA 3O3LA 3W3SA 3RRKA 4FNIA 4C0OC 2HS3A 3FGVA 4O3SA 3KLVA 1MNEA 3IWXA 3D3BJ 4KC5A 1FNMA 3HO1A 1S9EB 3DI6B 3VQTA 4YQWA 4IH5A 4RI4A 2LEPA 1RE1B 1VDHA 2AT1B 2GHWA 2PSZA 5DM6Q 2SHPA 5A8RB 1B0TA 3C3LA 1SKUB 2UUAJ 2COLA 1WF0A 2BVZA 2GCFA 2XS7A 4WFZA 5M43A 3H2UB 2RS2A 1LWCB 2IYIA 1U0SA 1T05A 2GO9A 2AJ0A 4GWFA 3R6GB 1S6UA 2KM8C 4LFAF 1MG7A 1C0UB 1L3TA 1LWFB 3EZUA 3Q8YA 4DSLA 2OFHX 4URQU 2Z30B 3BSNA 1RACB 1UWBA 2CIMA 1I6JA 1X0FA 2QLJB 4DQIA 4FPIA 4I67A 4MFBB 3T1HF 3EE3A 1FXRA 2XYPB 4JOUA 4ZPDA 3BJYA 3CCES 1H3DA 1NSKL 3EX7B 2ASLA 1YG0A 1HQ2A 1YZ6A 5L39A 1GK8A 3OL7A 2CDRB 1NK9A 4HJPA 2VEUA 3IRWP 2DD8S 4F8RA 3R9LA 2V4JA 3VF0B 4C6AA 2OAUA 2UUAF 2DRAA 3KLEA 3HX9A 1P9QC 1S9GB 4LIWA 3VAHA 2E1RA 4CLZA 2N3LA 4ZVFA 1TAQA 4KI9A 3LANA 3M32B 3P96A 1C0UA 3PJ9A 2Y1JA 2IMWP 1RWOB 1KLMA 1VHFA 2VASA 2M4MA 4FKYA 4ZS6A 3CCZA 2V9WA 2RF2B 4YHHJ 1AW0A 1OO0B 2GCBA 1M1GA 3AAWB 3MM9B 3HSJA 2JLFA 4OI6A 4XO0A 3AD8C 2GHPA 4C3MA 4IRCA 1OHCA 2QEPA 5KT2A 3RTVA 3CO0P 2PA5A 2OSRA 4N7TA 4R8UA 1B99A 4DX8H 1T0TV 2ZVSA 4K2JA 4CDIA 1T05B 5IT9Y 2W1BA 4ZPVR 1KQGB 4X4SA 1VRTB 4TNOA 3B8HA 4NCGA 2ZNZA 1M5KC 1AT1B 1F9EB 1OYDA 1VFJA 3E3XA 3HF5A 3ZNJ1 3F73A 1KVIA 3FVYA 1U1QA 2B49A 5KFOA 1YSJA 2IDLA 4NX9A 2V4JB 3TVKA 5DDPC 3OL6A 5DLFA 1FFWB 2G1HA 3O8WA 2VG6A 2HWHA 3GR1A 1TL3A 3R5JB 2P6TA 1WTBA 1QVGR 2AJ2A 2ROGA 1R7IA 2B4OA 5F8LA 1X5TA 2BJ1A 2H51B 2MTLA 3IR7B 1NSPA 3NRBA 3UCZP 4BWMA 1RB0A 3MMCB 5E7OB 5G0RA 1S79A 4OX8A 4XIUA 3S4EA 3T6JA 3O6QA 3QGPA 2RF2A 1SB6A 3I87A 3PS5A 2J5AA 1VHIA 1HARA 2QZ8A 1JB0C 2VFRA 3GZ7A 2RVJA 3EPIA 4WFXA 3IN5A 3J7AN 4DR7F 3CDAA 2I6MA 2FC9A 3AQOA 5J2QA 3PRBA 2YVSA 4H4OB 4DQRA 4W90B 1PXHA 2PT0A 4MMOA 2L9DA 3SSSA 4RU9A 1I3OB 1S1UA 3SXLA 3KJNB 1HKAA 4WCEQ 3PX4A 2BZLA 2W2MP 2UVUA 2JC0A 2ZKUA 3DRYA 3M8QB 1YTNA 1WF2A 4P2SA 4RU2A 2KJWA 1E6YA 2F65A 3BR9A 2UV8G 4QR0A 4GVBB 1X4BA 1K1QA 3RJMB 4X4PA 1HNXJ 1PBUA 3TA2A 2W9BB 3H2XA 3KK2A 3SQGB 2PDAA 5J1EB 2KN4A 2QMXA 3SCJE 5KFEA 3PY8A 1A9NB 4DR1J 2ZE2B 1RXOB 4U7UK 3L95X 2GIQA 3G2XA 3KNGA 3OD2A 2WBMA 4A8QA 3HZGA 1IKXA 4A8XA 1JWWA 4PYAA 1BGXT 3T9ZA 4AFFA 3GG1A 4EO6A 2ZH7A 1HW9A 2LQBA 2JH3A 1VJQA 1RT2B 1YTWA 3TI0A 3CE8A 3HHLC 5LSRA 3N5BA 2MGZB 4HR2A 4BBYA 4C0BA 2AYGA 5AXKA 2ERRA 4ZRTA 1WG5A 3NCRA 2J0WA 2DNNA 2QL9B 1T03A 1ZC0A 3W60A 1J5OA 2HNDB 1E6YB 2OFGX 2XWXA 4USMA 1EKSA 4G6VB 1IR0A 4E0DA 3OV7A 1KP6A 2L41A 5DRKA 3SQGA 4CO2A 2VA3A 3VVTA 2AYEA 5J1EA 2FVQA 5JVGQ 4J51A 3G82A 1WC6A 4LJMA 2XNRA 1PIEA 2H54B 4WKRA 2CQGA 2ZE2A 2VA2A 2A3JA 3P8BB 5KG3A 2I2YA 3ZM6A 1RAEB 1FX4A 2QX0A 5GADU 2IMGA 3M8YA 1QE1B 2Y1RI 1IBLJ 2DR9A 4WOHA 4R0EA 2GV1A 3SFUA 2GQCA 4EMDA 1V3AA 1WCHA 3KHRA 1YJTA 1H98A 1QDUB 5D6GA 2ZM6J 1TR0A 2MGZA 3CUNA 4DL6A 2BV5A 1WAXA 5KFGA 3D0IE 1N5VA 5G4DA 1MLAA 3R7SB 4FBUA 3F99A 1O0PA 1HL6A 1RT1A 4UOFA 5L1JA 3N2AA 4DV3J 3NEKA 1IKWA 4X65F 4OHLA 2ATCB 2NXUA 1JLAA 1XM2A 3PYDA 1VRUA 3JSMA 3A1YG 1NK6A 1RT5A 2KZZA 1FE0A 2BXJA 3CCQS 4OZ5A 3ITHA 2YY3A 1JLFA 1XERA 3K5PA 3A3PB 3HKWA 4KPCA 5D0EA 2MZ1A 5EHPA 5K23A 4M94A 3TP2A 3A3NB 3OXLA 4M95A 1UZDA 2R7UA 2WVDA 1APSA 4GE5A 1PJ7A 4MAKA 2H04A 3BN7A 1VQ6S 4GFVA 2CMCA 3FMWA 4FVMA 2V2KA 1UPMB 5IT4A 4KPYA 5FLXY 1R0AB 3RRGA 3O2IA 1MU2B 1WUUA 4K8RA 1HWKA 3SQOP 1PA9A 1YX2A 3R97A 3BGRB 2D3OR 1TKZB 3GV5B 1DTQA 3MPVA 5C25B 4OYAA 1FTRA 1RT1B 3GFZA 2PN6A 4PYDA 1Q7LB 3R6LB 4WIIA 1SH0A 4ED7A 3MD1A 3K2YA 4IG0B 1D1UA 3UR0A 4F0HA 2XI2A 5GAGI 3EJMA 4NA3A 2XO6A 3I80A 3EPGA 2KT5A 4MIWA 2KHCA 3CSKA 3ITHB 3QT5A 2OO4A 3TA1A 1JLFB 2F6FA 4ZLNA 5BZZA 3T3FA 1WSVA 4X64J 2ZZMA 2J16B 1S12A 2BANB 2EXUA 2X1AA 4J9SA 4DS4A 4DCPB 3SCIE 4GE6A 1N34J 1X60A 4AL5A 2LXIA 4N8OA 1S1WB 2V68A 3CC2S 5KFIA 4CLYA 5D0RA 3T1HJ 3UWTA 5EHHA 1FEEA 2RDJA 4DUZF 1AZSA 3H0PA 4ZPAA 2C3OA 1AUSL 3O1LA 2DXEA 2DRDA 2Q79A 5DZ7A 3CD0A 3B82A 3DN9A 5BYRA 2BJ3A 2POKA 4HT7A 4FS1A 2C28A 1UAGA 3S3EA 2CNLB 4OYPA 3ENQA 3Q8VA 4A46A 3OSPA 2D3O1 4LFAJ 4P71A 3H5YA 5EX3A 2HBRB 4MK7A 5HVGA 2XB2D 4QYRA 2ZOFA 4ELVA 3BGLA 5IC4B 5KFWA 2CWXA 3VWSA 4WIQA 1FERA 1LWCA 1RJJA 3AY0A 4LF1A 1SH2A 4C8YA 3FZBA 1OWXA 3TYTA 4OI1A 2V2ZA 2KFZA 1HBUA 1PYOB 1F6TA 4CRJA 1Q5YA 1JXLA 2VOSA 4ECYA 4FYWB 4KH1B 2IJRA 5K14B 3SSQA 3MM7B 4NOHA 1S1WA 4EU0A 1HYSB 1UVLA 2E5GA 1X4GA 2NREA 3DKDA 2F6YA 3ISND 1FRJA 4M63A 5I6VA 3NLCA 1VIXA 4QAPA 2CQ3A 2DGOA 2I8EA 1YJVA 4ILRA 2F8MA 1S5ZA 4NLDA 3BQ1A 1FQ1A 2BE9B 4EEYA 3GR0A 2FDNA 4U9RA 2GFFA 1VQ5S 1V3ZA 3W8PA 2M8HA 1S97A 3V5RA 1FXLA 4KYRA 1J27A 2R4FA 5E41A 3BO3A 2ACYA 4LRBA 3RR8A 1R3NA 2BQRA 3QCHA 3MEGA 2OD6A 4X66J 2XM3A 4K5SA 2A0FB 2HIYA 4DR5J 1OQ3A 3T19A 2WRMA 3HI9A 1HI8A 1NRKA 5RUBA 1RKIA 2VKRA 4B3SF 3ISNC 1KLMB 2UP1A 1UVMA 4DU7A 3LTOA 3UNYA 4LRCA 3QYYA 3G8SA 1HYSA 1ZETA 5BZXA 2N82B 5EWEA 2CZ4A 2XQCA 2KYZA 4CCHA 2DRBA 2EFGA 4RR5A 2ZUGA 4IKAA 4RW6B 1F9FA 3EZOA 3FK4A 4DPXA 4R8UB 3KJFB 3OR1B 4UZBA 5AJ3F 2YKMA 3M05A 4QWBA 5CAAA 5IWAF 4DL3A 2W4DA 5HANA 4JI5F 4Q0BB 1RABB 4CLWA 4OHYA 1A6LA 3CWJA 3PJXA 4ER8A 4OX7A 3OL9A 1VQMS 1U1PA 4KHPF 3D0GE 2AYBA 1GX5A 2HPUA 2V69A 4B9MA 1EEHA 2ZNYA 2KJVA 5EN1A 1ZZWA 3BR8A 3C6TB 3KJQB 1GG4A 3MEGB 4L76A 3PYGA 3FBBA 3VGVA 4B3OA 4WTYA 3OUYA 5CCLA 4Y0FA 3NS5A 1SL0A 1MROB 2PEHA 4NLWA 4F67A 3M8RA 1P1LA 3QKPA 2CNOB 3JTOA 2EC0A 1IM4A 4ECVA 2Y2FA 4YY3F 2OEKA 2W2OP 2A2CA 3TJ9A 2GMHA 4F36A 3PW7A 5CXTA 4FF4A 1S99A 1OEVA 2RT3A 1FVSA 2LLZA 3W65A 1OEUA 1U8WA 1H2VZ 4NLYA 2VEWA 4ETZA 2V2VA 1GT8A 3NGTA 5E3AA 2IFXA 1I5OB 2J7KA 2O5DA 5EUHA 4RBTA 2QLFB 4C8NA 5C24B 3BGFA 3ZFVA 5BR8F 3DFEA 2HRUA 4PWUA 4Q44A 3PW4A 1YJ7A 5JMNA 2IBKA 4X4UA 1JLQA 1N32J 1XIQA 1YBTA 2XMMA 2M88A 1HBMB 2KG1A 5IQQA 2HVDA 1WC0A 3POTB 1VC6A 3DU6A 1S4EA 2CNFA 1LV5A 4PQAA 1XMQF 1ZA2B 2AEFA 1EAYC 1TUWA 2IBOA 4TLRA 2YQ3A 4M5GA 1P1TA 2XHCA 2ZITA 4ZVUB 3ULHA 4CTAA 1YRXA 2EFQA 1WHYA 3K8VA 4YDXA 5KT5A 1R8BA 2VODA 5K22A 3J81U 1IKXB 2C3PA 1ZYQA 1LEOA 1AXQA 5A8KB 9ATCB 4HHUA 1O8BA 4WE1A 5KT4A 2OGUA 2QA1A 5IWAJ 3LQVA 1FF2A 2MEWA 1FA0A 2E44A 1VQYA 3MWBA 3GJRB 3LF0A 1XEZA 2RIJA 3Q86A 2E7XA 1NBEB 3ZM3A 2AU0A 4UW2A 4WJBA 4MKBA 3ZC4A 2QSWA 5E3PA 4ZVRB 4BHQA 5DQGA 2JEIA 3POTA 1RAJA 2YNGA 4RWWA 4TQRA 4LF8F 1TFYA 4IR9A 2EKNA 1TQLA 4H34A 4S0MA 4EGLA 2VPYB 3FRZA 4Y2MA 4X66F 1NKBA 2LU1A 3QJLA 3QRRA 1G7GA 3DU5A 2WB4A 3DLGA 4XTTA 3TUZC 2R2TA 3PIOQ 4CO0A 4G1PA 4WKYA 3BPDA 2VTDA 3S3HA 1C2PA 2M7SA 1IJEB 2ZHAA 3EDRB 3W5YA 5CQGA 2APOA 3FFIB 3MCMA 1L3SA 1K1SA 4NWFA 1ULRA 2HXPA 1QE1A 1AB8A 1H7WA 2GMLA 4PRFA 3VCDA 5F9NA 2PD1A 1FJGF 2OUGA 3HSGA 1OJ4A 1N5QA 1Z4UA 3QIPA 3BZQA 5CYQA 4JNBA 1NDLA 2GCAA 3NG8A 5KOWA 2NLWA 2DY9A 4HACA 2HHWA 2RD5C 1Q8KA 2A6MA 3H42A 4WFNQ 5GAHU 1M0SA 1R43A 1RU2A 2CZVC 2YXLA 2XLKA 2QO3A 2W7OA 2AJQA 2C42A 5KOXA 1JLAB 1SJRA 3CCVS 4WZQA 3K5OA 3CJSA 4MYTA 1S0MA 4Q8EA 1OYEA 5IV3A 4OYXA 1N5SA 1ROFA 5KG4A 3RGQA 3H8YA 4PKDB 4MYUA 5ITHA 3DRRB 2AJ4A 4X62F 2AD9A 1N33F 4NYHA 1GTHA 2HVZA 1H74A 2M2BA 2WONA 3T6BA 4ES1A 4YP3A 4F04B 5LXQB 4DL5A 1W7KA 1FKPB 1IKYA 2EVZA 4EFAC 1K73T 4DSEA 2VJVA 4XPCA 4EBDA 3CM3A 2E7WA 3TX0A 3LH2S 3JQJA 3J80U 2YQ0A 1R0AA 2IA6A 3FDSA 1MU2A 4DQPA 3TJAA 4HTIA 1B3TA 1J5EJ 4A8MP 3EGWB 2KVQE 4AXJA 1WORA 2UV8A 4ZVGA 2IRYA 3QCIA 2V94A 4J37A 1QY7A 2MJNA 4KV8A 2DGXA 3KTQA 4DV6J 1R6YA 4QW9A 3NXZA 3EM1A 4UOCA 5FLXU 1G1HA 2NZ6A 3UVJB 4EYIB 1HHSA 3ZM1A 3HLUA 3BF4A 1RHRB 3MD3A 4ID8A 1EX8A 1TKTB 5CYMA 1P31A 3GILA 2CUYA 2WONB 5KA2A 3JS9A 1NJWA 1L8KA 2DCUB 3W61A 3OFEA 5BR8J 1FJ7A 3AFGA 3DLKA 1NHVA 3BSOA 2FHJD 2NV5A 3MDFA 1ACMB 1MSWD 1LNQA 1XMBA 2DNKA 2K1RB 2XHWA 2QC3A 4OQJA 4NLPA 1KOHA 4P72A 4B9UA 3MEKA 5AE2A 1HNZF 4FBTA 1T49A 2AJ1A 3EGVA 5M2RA 3KOAA 3M1VA 1RT3A 1DQ8A 1WKKA 2B4UA 4KH0B 3QCMA 2F9DA 3KXDA 2HFNA 1XR5A 3IR6B 2V2QA 3W2VB 4RNNA 4NXNF 3IGNA 2K3KA 3NMRA 1RAFB 2WVBA 1YJUA 2BYCA 3BYPA 2DY1A 2C7SA 4ZCKA 4EZ6A 2FC8A 4DUYF 1TKTA 3OTEA 2W9AA 2AV5A 5HSPA 4DLGA 5J1NA 1HBUB 1YN9A 2ROPA 4P2FA 4NMLA 2NYHA 3TJ8A 4LF4J 2FB0A 4KB7A 3QFHA 4JV2A 4ZN5A 2OUDA 2H03A 1E6VA 1NWEA 3QZ8A 2R0BA 4EUVA 2ASYA 2MZQA 3GYGA 1SKSA 1RWNB 3BLTA 2GAGC 3OR2A 1VC0A 3OW2R 2BUNA 2JJ4D 3VALA 1ZOTA 5D4OA 4GO5X 3LALA 3MR3A 2BQ3A 1K0TA 3J7Z5 3G6ES 2QDCA 2JOQA 2HFVA 5D77A 3CJRA 4OLOA 2AZ1A 3DRXA 5D4PA 3K5NA 4B9NA 3R2CJ 4PQUB 4ED5A 5SUHA 3DDIA 4JI1J 2B3OA 2M0GB 2NUHA 2A2DA 2YH0A 5KFJA 1VQ4S 1WHXA 2A1BA 2NUUG 2QLXA 2J0XA 3KHHA 4FS2A 3QZ7A 2ZN7A 2ADCA 1EQ0A 2HEKA 2J8AA 2WAQD 3DHXA 2W7PA 4O3RA 4ZOSA 4RW9A 5K24A 1NJZA 2UUPA 5IBSA 2IVYA 3RBXA 2OH2A 2I5JB 1HMVA 2C2OB 1QTMA 2H1YA 3R27A 4NLRA 1E6VB 3O5TB 4DSKA 2Y9HA 1REVB 1XRIA 1OEOX 4K50A 2ZMMA 1IBCB 2FZGB 1X4HA 5I4MA 4O4GB 1KQFB 1ZH5A 4LSNA 3CJKA 1RAAB 3CJ2A 1VQ8S 1T9YA 4OLPA 2RJZA 1YQHA 3T41A 4QBWA 2YNHA 1K47A 2CPXA 3UCGA 3W2WB 1R0CB 4A4JA 4ZDNA 5F8HA 2B8QA 2F46A 1FPRA 2Y67A 1DLOA 1A7GE 2FHOB 3KKFA 4LRFA 1BHNA 1FKOA 4Q5VA 2GP0A 3W63A 2W01A 5CCMA 3BREA 3FNNA 4DF4A 2YNIB 1X9WA 4B3OB 4OV1A 4HRFA 1V3SA 3CJ3A 3C19A 3GIIA 3NP5A 2HQGA 4RW9B 4M5HA 5JJBA 1ZAXA 1G4CA 2DGUA 3PHEA 3AWFA 5L46A 1U7LA 1HMVB 1PAEX 4ZJLA 1VIOA 1LARA 2JWNA 3KG4A 1U2CA 1AUDA 2DBBA 2QT7A 4ICLA 3H59A 4DR3J 2BACA 1FCAA 2C3YA 1RGVA 4NZ7A 4QPTA 2D9OA 3VQSA 3OLAA 5LMUF 4DL2A 4MJKA 1G2EA 1B0PA 3CT9A 3OLRA 2DCLA 2YBVA 5HBMA 3HJFA 1N34F 2LU2A 1RYRA 3RB4A 1UP1A 2HNQA 1UW9A 1JLQB 2XTJP 4ZP7A 1Q6TA 2GJFA 2QJ3A 2X3GA 3Q8UA 3M2VB 2MBCA 1PKUA 4F0MA 2NLKA 2FPHX 2ROEA 4UZCA 3FC9A 1K44A 4X4TA 4CI0B 2UXCJ 3HMJG 1X9SA 1TFWA 2XLJA 2CJZA 1Q4RA 2BJ9A 2C22A 2JZ5A 2QLBB 4LT6A 2ZZNA 1V5VA 1HWLA 3CIMA 4ZVTB 4DX5A 2W2QP 4PG5A 4Q0BA 1FD8A 2Y66A 2N7CA 4MBBA 3D6FB 5CA5A 2YQ1A 4CLSA 2FLNA 4KGVB 1FTCA 1Q8IA 2VQFJ 3D44A 4NXMF 3J7A1 2J9DA 3D68A 2CG4A 4WE1B 3HHNB 5HMYA 2MYFA 4TY8A 2YKPA 4GS0A 4QR2A 1U0HB 2CQ0A 2DEJA 1D8ZA 2X3DA 2Y0BB 5LSOA 3UN3A 3EXYA 1S0VA 3BKFA 4AL7A 4I6WA 2KKHA 3PEHA 2HNPA 1WG1A 3NY0A 3GIKA 3RBEA 5KA3A 1FKAF 1C1BB 2WVEA 3D1QA 2Z0GA 1TL1B 1MKPA 1FDNA 4OJ1A 2CM3A 3HJVA 3PHTA 3MECA 2MZJA 2MQLA 5KFRA 5A8WA 1CJVA 3JYTB 1URRA 3VAKA 4GFUA 4KKOA 3S3KA 1X4CA 1U47A 2EW9A 2ZH2A 3H20A 1X4AA 2EFOA 1RTJA 2P5VA 1GMVA 4QPXA 5F3ZA 3K89A 1RQ0A 3CCRS 4CT8A 4YMEA 1VGYA 1YFOA 1UZHA 3J7YI 3CIZA 1VOMA 2XWYA 1MN7A 2HK2A 1U0HA 1RWMB 2HGMA 3UDVA 4MTPA 5E2QA 3PZPA 3HD1A 4J9MA 1C1CA 2F4VF 1C88A 1X8DA 2RF6A 3R1LA 1LXJA 1Q78A 4NA2A 3TX8A 5C2GA 5I3UB 5LMNF 4P7VA 1MWYA 4C2MA 3V0DA 4GE2A 1HNVA 2FJDB 1O51A 3AOCA 3KDNA 3MTJA 3QT7A 3V81B 1QAJA 4DSIA 5KFMA 3SYZA 2Z4PA 4DR4J 2BA9A 2VG5B 3I96A 1B0VA 5ETVA 3GSIA 3TAMB 4KKOB 4U7CA 2WCXA 3KG0A 4FZVA 4ZLLA 2OJ3A 1MWQA 4X4VA 2I4EA 3VV2B 2V34A 1B4SA 3DRRA 2GNKA 2HZCA 4NLVA 1NH7A 1OSDA 3CW2C 4PWDA 3OT9A 1LOUA 4FVCA 4DV7J 4B9VA 2UXDJ 3I9V9 2YX7A 4J9QA 1IKYB 1H38A 4ZP9A 4B3MF 3C46A 3EMUA 3D9CA 3G8TA 3QAUA 3QWPA 2J17A 3D2WA 2QYCA 2YWWA 2XLIA 2BM0A 2V9KA 3EZ5A 2M8DB 1C1CB 4U95A 2VORA 3V0FA 4QU6A 3L4BC 1PTTA 4J9KA 5DDQC 5JXSA 3WX4A 2CRLA 2I5XA 1SPBP 1QAIA 5KACA 5D3GB 3V81A 1J4XA 1JLBA 2GIFA 3MUTP 4GKJJ 1RWWB 1VRQC 3U27A 4I2QB 3KJVA 4Y2EA 1P9YA 1VYAA 3Q22A 4NI2B 5B7WA 3G87A 1PC4A 3AA8A 1I9TA 1Q95G 1PA1A 4Y34A 2DXDA 3DDNA 3BYRA 2B5JA 4PG4A 5BJRA 4DV4J 3F44A 3UD4P 3ZM5A 4IRDA 2OPPB 2VDIA 4QYZJ 5DGAA 3UI3A 3SV3A 4JI5J 5IM0B 4U96A 4XPEA 1FX2A 1FWLA 3TVYA 1VQLS 1BMQB 1F0XA 4I7FB 4AD6A 3CWEA 5IBMA 3AODA 4DV1F 4DLEA 2WW8A 1FNXH 5F8GA 1L3VA 2R7TA 4UQTA 4DR7J 1TMJA 4ZPWR 3TNVA 5K8PA 2MHNA 2VICA 2HB1A 2VTEA 4G1QB 5T7LA 5BUGA 1JLGB 5HMZA 2UVVA 3MM8B 1VJWA 1FVQA 4B3SJ 4ED6A 4K4SA 1CJUA 3BV8A 4Z37A 2FJXA 4N41A 4ECSA 4DV2F 1RTHB 4MH8A 2ADBA 1SKWA 2L48A 4CQ1A 4PABA 4ZIWA 5DG8A 1RHKB 2L9NA 2OPSA 1X9MA 1OPZA 1UVNA 2HGNA 2GC6A 1IWGA 1SI9A 2NT7A 4R5PA 4PG6A 1NB2A 4O3OA 2OPPA 2ZWPA 3MCOA 4L74A 4C4WA 4P73A 1JKHA 1GFWB 2DYAA 4LF9F 1NZ7A 1JLNA 2E66A 4U7UD 1JF7A 5BXIA 3MVNA 3HHKA 3G6YA 1EEOA 2XMJA 2XGPA 3Q8PB 3T1AA 2E1MC 5IFMA 1NHUA 2JL9A 3FQKA 3LGHA 3M6UA 4B3RJ 3KLHA 3LK7A 5ETPA 2O67A 4RX6A 4J9LA 4X4QA 4ECQA 2CDQA 1NWLA 3MR7A 3BDPA 4QAHA 2I38A 4QUMA 7AT1B 1TV6A 4DUTA 3PDNA 5DO2A 3SR9A 5J2MA 1CQNA 1S1XA 3U1LA 2DR5A 1RI7A 1XWLA 5ETSA 3BM8A 2CPIA 1HQEB 4PG8A 3I4HX 5IXUA 2E5LJ 2OEJA 2KRRA 1C87A 5ETTA 1WF1A 3T5KA 5HP1A 3GXGA 4USKA 1G6BA 2DGQA 2EKYA 2GS8A 3HVAA 2DNZA 4F7VA 3W5XA 3LWMA 1YJNS 2V4QA 1KQSR 4OHHA 2CPEA 2RUSA 3K57A 2HVLA 4EBCA 3ZMQA 2G2YA 2GA7A 2B56A 3FCVA 4LR9A 3KLHB 1XMOF 1EETB 2HAFA 2NXJA 3W1YC 2QYGA 3CJKB 1D9AA 1DARA 3IA0A 2CA9A 4OYWA 1NK0A 5HROB 5GTJA 2FIUA 4KGMA 1IJFB 1Q6PA 1RLCL 3V0JA 1D09B 4FYYB 4UQGA 3I7ZA 2CVEA 2JFDA 2Y0SD 1S1XB 3I5CA 4J90A 4JI8F 1EQMA 3UN5A 2R7SA 1ZZNA 3QRPA 2BKOA 3WC0A 2B07A 2G59A 3KUGA 3GXHA 1FRLA 4ECUA 4TVVA 1TL5A 3T9NA 1FRKA 1NHKL 2Q66A 4DR6J 3EICA 4QWEA 1R27B 1HD1A 3PG9A 4NYZA 3PKMA 3QO9B 3ZL8A 1YZ4A 1FT8A 1Y7PA 3FJ2A 2VIHA 1KC8T 1KOOA 3T1YF 1RPMA 4ICLB 5LM7E 5KFXA 3DM2A 4YFUA 1HI1A 1U6BA 1OIAA 2WK4A 1T7PA 5IT9U 2RAQA 1ITPA 3QBCA 5HROA 1WOPA 1RT7B 1FD2A 2JVOA 2O3DA 3HD2A 4KT0C 2CFVA 2WTZA 3KHLA 3ZZRA 5JVHQ 2C2NA 2AHOB 4KO0B 2D74B 5IV4A 2ZJPQ 5KT6A 3ZTOA 3AOBA 4IOCQ 4FPRA 3D4JA 4OZ3A 1R6VA 3MUMP 3M2RA 4KSEB 2AF6A 2CXEA 5K25A 1VBZA 1N88A 3D67A 3DLJA 3HFVA 4NZ0A 2CNIA 2QMWA 2VBYA 3QNWB 1FRMA 3WC2A 3QO9A 1F2GA 2I6JA 4K5RA 2DNLA 2FHJA 2RE1A 4R0JA 5KFSA 3PO4A 1CBKA 4G65A 2HG4A 4G1IA 3DYAA 3AOAA 4LIRA 3TQ1A 5IZHA 4F2SA 1FPZA 1P15A 3DLEA 1UW4A 2R8HA 4E8UA 1CS4B 2GC8A 2FVRA 4JI4F 2HS0A 1X4DA 2AJFE 3QATA 4J9VA 2KRBA 2GJIA 5DGBA 3D0HE 3V6HA 3D1OA 1SJFA 3S6EA 3S8SA 3G71S 4OJ3A 3W62A 1V6HA 1C1BA 2DIUA 5LL6d 1DTTB 4M8LA 2R7OA 5B0GA 1RLDA 2VQFF 4G3IA 3T1YJ 2HMIA 3M4XA 1GEHA 4BLGA 5LOQA 4EZ9A 1VLOA 2B9YA 2PA3A 2VF3A 3OQ2A 4IFVB 4L3KA 5IQ6A 2OP5A 4ED1A 4RW7A 2XEXA 4KGZB 1RKJA 2QDPA 3IO1A 3QCKA 4ED0A 2B6AA 2NSBA 2DNYA 1N5YB 1EP4A 4X4OA 3I0RB 4Y28C 2W7AA 3BEGB 1NB7A 4ELTA 1CJKA 2VQEF 1RTIB 4QWDA 3DLEB 2CM7A 3IBFB 1KWMA 1SJQA 5D0HA 3OTCA 4AQYJ 1Q86T 3G8QA 4OZ2A 4CO3A 2AKWB 1OY6A 4GC7A 3EB1A 1KKHA 2H4YB 2XMVA 3SCLE 4NPOA 3WIVA 3KK3A 3L3CA 1M5VC 1M3GA 5KA1A 1SC4B 2XZWA 2ZEJA 4M5NA 1U09A 2MKSA 5C42B 2IIHA 2C2RA 4RNFA 1RT6B 5KFCA 2PGCA 2DH8A 1YGRA 1ZCLA 2QA4S 1NJYA 5KFNA 2Q6BA 1LWEA 3DGPA 1TL4A 2OPQB 3AXKA 3HHLA 4RKUC 1UL3A 3B4MA 2VHGA 2ALZA 3DOLB 3PNIA 1U1MA 5A2QU 4IFVA 1YBAA 4LQ3A 2AMCB 3ZV2A 1R8PA 2BE7D 3R3TA 3H7HB 2Z8QA 3KMSA 1WELA 1Q81T 2J0SD 4DSFA 3OXFA 4GKJF 2QCJA 3I0RA 4PWDB 3G4SS 2CMAA 2H4GA 4TYBA 3J81j 1KONA 4WFYA 2FLOA 4P2XA 1IQTA 2CQIA 1KBRA 2VPZB 3LPEA 2X51A 2V8PA 3QAEA 4OHWA 3SSRA 4H4MB 5J2PA 1L8GA 5KFYA 3V6KA 2CM8A 3M9OB 4YB7A 3PYZA 2OIHA 2PMZD 2AYMA 3QCJA 4NLUA 2KDOA 1C0TA 5CZXA 4B3MJ 3OFGA 2YWGA 5C42A 4U6PA 1RT6A 1PSDA 4A8SA 2D69A 3KLIB 4KQZA 4QQBA 4W4MA 4DR2F 1O5JA 2AEJA 2CZ9A 2V6AA 4U8YA 4V19J 1AFJA 1RAGB 3FRYA 3MM6A 3OTOF 4ZPTR 5DETA 4NI2A 3HDSA 1S0NA 3C15A 1QAYA 2IC3A 1MMNA 5EWFA 2XNQA 2VEVA 2BKNA 3CNQP 1WDTA 1JNRB 1GXTA 2BZ2A 2E5JA 4IDKB 3MEEA 1W26A 2B7CB 4Q45A 2FLLA 4NZ6A 1GXLA 1HNXF 3RGOA 3LP2A 2EFVA 1YZ7A 1EB0A 1TUVA 3WZ0A 4ECRA 1PG5B 1U24A 4IG3B 3ZNUA 3CDWA 2CAJA 4PXBA 3NRSA 3QGGA 4K4XA 2PC6A 3MOJB 3H98A 4ID5B 1U1KA 2RDIA 3PM9A 3UR3C 4DX6A 3MFHA 1TKDA 2GHVC 1WC5A 2GGPB 4FKXA 5IT0A 4H54A 1VLYA 1X4FA 4DCJB 4JYAF 4X2BA 2IRXA 2F40A 1JLGA 3HXMA 4R25A 4DQSA 2LA4A 1CSJA 3MM5B 3CD6S 1IKVA 1SJ4P 1QJHA 2HNZA 3MI7X 1S6QB 2H65B 5FDLB 4RZRA 3MFIA 1U1RA 1S9EA 2XYGB 3QJJA 1Z1ZA 2IC3B 3AQPA 2XMWA 3BO4A 1WNEA 3OFHA 4NASA 5AXLA 2R7XA 4CYUA 2ATLA 1U2RA 4R5PB 4ELUA 2UXBJ 4JMKA 1C4CA 5D0GA 3LP2B 4LBIA 2MY8A 4NEYA 5HI7A 1JKHB 5L38A 5M2UA 1U26A 4O0IA 3OJSA 1U6ZA 1WKLA 1X24A 5KABA 3DHWC 3H2LA 1X0PA 4DX7A 2FZKB 2QN6B 2BABA 4MT1A 5ETNA 1LWFA 1S72S 1RYSA 2C3MA 2MMYA 4DFKA 1Q82T 1F9HA 3WX8A 3QCZA 2GGPA 2DEIA 3AD9C 4IQXA 4JI7J 2DGVA 4KBIA 2KL8A 3HT3A 1KTQA 1EHWA 1HNZJ 3MM5A 3RU0A 2DHHA 3KDOA 4I56A 5C7PA 1FGSA 2JFHA 2HBYB 2UUBF 2HURA 2MSTA 1I51B 3A8EA 2HVHA 2KXNB 1WTFA 1UFKA 1VCTA 3C8YA 2IYGA 2YWKA 4MIAA 1UA0A 1FRIA 2IAJB 2V0NA 1KHVA 1HQEA 2B3TB 3C6UA 3CC4S 1IM6A 3P45B 4HKQA 1NDKA 3GG0A 3HHDA 1TAUA 3TRGA 3GCWP 2W9CB 2HHVA 3P6YC 3DRSB 4B17A 4OHIA 4ZI4A 3QFWA 3KLEB 1DFDA 3JAMY 4J9UE 2H4VA 3HK2A 1D9DA 4DL0C 4NA1A 4WK3A 1C83A 4N77A 3WIUA 5KFVA 4URGA 2X1FA 2RHQB 1B7FA 1OHDA 2WHOA 1HPZA 2CJ9A 3CC7S 2H5JB 3SFGA 2QIFA 2EG2A 4K2XA 2HGLA 2FY1A 1JLEA 3G86A 2QDMA 1NPRA 1UFWA 4PAAA 3KK1B 1W7WA 2XBPA 4ZVQB 3TVZA 4I2PA 1JLCB 1YDLA 1LKZA 2F4FA 5K9FA 2XI3A 4YUDA 2NSCA 1HIYA 2R42A 4ED8A 3ILIA 4B9LA 3GWCA 2CPJA 4LF5J 4C8LA 2MKCA 3ADAC 1PGZA 3HN7A 2EFPA 3LUYA 3LPYA 3ICLA 1RWVB 2I9SA 2PO4A 2FVPA 3EAXA 2H9ZA 2VG6B 3O4TA 2YWHA 1TL3B 1ZA1B 2CPDA 4HLBA 2CJKA 2OI2A 2SXLA 2XULA 3U02A 1U25A 2XMAA 3MR6A 3MMCA 4QIVA 4DN9A 1D9FA 2VUGA 4DPTA 3ENVA 3W5ZA 2E29A 1CQMA 3DM2B 1YPTA 5AE1A 2R8GA 3GB0A 3TZYA 4YEAA 4CT9A 1JLEB 3LA0A 3VGTA 3QWUA 2UUOA 1XK8A 2JFGA 4CO4A 4HEA9 1LW2B 1Y5NB 1IBMJ 5AT1B 4OYIA 5HN0A 1CULA 4KO0A 1GMWD 4GRYA 4LUBA 3UPFA 4HJQA 4ZCMA 2VBXA 4F26A 3B54A 3RBDA 3FSYA 1S9FA 3R5CA 2DR6A 1S1TA 3PR4A 4A8KA 4JV5F 2A8BA 2IVMA 4KYZA 3TUJC 3KYLA 1GNKA 2PI4A 3G96A 3S3FA 4DN0A 1ZM4A 4OFZA 4IFYB 4QW8A 5I42B 3M32A 4F3QA 1YWXA 2M70A 2VBZA 3S7RA 5KT7A 3IWLA 2V4RA 5J2NB 2ZBPA 3VAFA 4ECWA 1NM2A 3DYAB 5HBMB 1UPPA 2VFTA 4C8KA 4D3RA 3MM9A 3NWRA 4RW8A 1PH0A 2NXCA 1D8YA 2KXFA 4OI3A 4BS2A 2ILYA 1Y5IB 3U7JA 4ANCA 2HAIA 1LWXA 2RMLA 1WACA 1LW2A 2HNYB 4OIXA 2VFUA 3CMAS 3LP1A 1IQZA 4C3LA 1RT2A 4B3TF 1NO8A 4RH5A 5KFUA 4O44A 3UD3P 1PTYA 2ZH9A 1HBNA 1P6TA 2R2SA 4L72B 4ZVOB 2DHAA 2YTCA 4GMKA 4OJHA 1YI2S 1QVFR 1S1TB 1XXVA 3RAXA 2CADA 4MKVA 5T14A 4NRUA 3QCCA 2G2OA 4V19X 5KFZA 1SQGA 3CJTA 4TLQA 3SZ2A 4IFYA 4GKKJ 5I42A 1I57A 3T5LA 1O6XA 2HRYA 3NMEA 1SIWB 5HO4A 1SL1A 4YDDB 1CJKB 4WXOA 3F9AA 2I0XA 3DRPB 2Y8YA 2HZAA 3RR7A 2MQ8A 3IAS9 1X5SA 3QSIA 4WP9A 5KFLA 5J1PA 5GAEI 2YPZA 1HHTP 1T48A 3MPDA 4PXDA 2JNJA 4QDIA 3A8IA 1NJIT 4IH7A 2XSJA 4B02A 3LP1B 1WHWA 4DSJA 5LSLA 4B9SA 5F41A 2NQPA 3M4UA 2W4CA 2ZKTA 1X5OA 3NGSA 1NJXA 1F3FA 3DGPB 3HHLB 5GMKa 4FF3A 2VPXB 2E7VA 3ONQA 1S48A 3QGHA 3KUEA 2CQHA 4K59A 2LEBA 4RHGA 1JMTA 4OYMA 5DLGA 4GKKF 4Y2IA 4ZKAA 3IM9A 1C84A 1X31C 1XBWA 4HDGA 3S4OA 2HLUA 1VRUB 5H9EJ 3V4IA 2M3VA 2HFUA 2LKZA 3L09A 4QWAA 3KUHA 2QEXS 3N4WA 4TVAB 3DRPA 5LXYA 4OHDA 4N5SA 1IBMF 4RUHA 4ZCIA 2HVEA 2DPJA 3KMQA 4KHPJ 1SXLA 1SC3B 2OELA 5B0EA 4UY8T 4WTOB 5DDRC 1C4AA 1T11A 2WOMB 3NBPA 1PAUB 3SCKE 3KLGB 2HHXA 3OVSA 4P74A 4A8FA 3DLLQ 2XSJB 4Z6BA 4LREA 2ZH3A 2KU7A 2N3OA 2BJ8A 1KLNA 1XNQF 3CDBA 3ZO7A 2CJYB 1NCLA 1TVRB 1F5AA 2QL7B 2VV5A 8AT1B 5HL7Q 1GXUA 3R1HA 4TU7A 5F0UA 1UEVA 5C25A 1BQNB 2L9WA 3GU0A 2WZ1A 4J7CA 1NXIA 2XCAA 1J5OB 1I94F 1VQNS 2HHPA 2QA2A 3M6WA 3D3CJ 1ONZA 4LMZA 2RKIB 4WU2A 5HQ8A 4WBFA 4OHZA 2OMOA 4RNOA 4IDKA 5E33A 1UJ6A 2L3MA 3TAPA 1VBYA 1UFLA 5A8RA 2HHTA 3V4IB 2RSQA 2IY5B 3HVTB 4QZVB 2MKJA 1MMDA 1GTEA 3JTPA 1DURA 2LDYA 1CG2A 2ALYB 3NCPA 5D15A 7FD1A 1N56A 2N7YA 1CEZA 2CMBA 2KVIA 1YGUA 4NXNJ 3H40A 3FMBA 1SV5B 1PILA 2CJXB 4E98A 3CCJS 1QSYA 3KLGA 4RNMA 2QFIA 3BRHA 4HH1A 1UWBB 2RS8A 4UUXA 3CB4A 5KG1A 2DGSA 2GX8A 4ATNA 4U67Q 3C2PA 3NKYA 3H4DA 2Z2YB 3HT0A 1UJ5A 4MFBA 2YNFB 3MMAB 4HTJA 4CLPA 1FEHA 3B78A 3MXHP 3ZM2A 5EHRA 4UAGA 2WW4A 5JUMA 4EYHB 2HNZB 5FDLA 2KT3A 4JI3J 2FH7A 4ZN1A 3CVKA 3NCQA 3FBFA 1OSCA 3BSCA 3D1HA 2PEBA 1TP7A 1UVKA 4BUCA 3A8KA 2V5HG 3PFEA 4AL6A 1O5ZA 2AW0A 3PRVA 4MIBA 1NUEA 2M3DA 2YX4A 2VFVA 4PXCA 2V63A 1HBOA 4TU8A 1IBKJ 1SKRA 1NDPA 2ZBCA 3R8YA 2YKNB 3OL8A 3H5XA 1U2FA 2I6WA 1SV5A 1BUXA 2MQNA 3N6NA 3QJPA 1KS2A 2K06A 3M6XA 3E8OA 3GFXA 5LMNJ 6FD1A 3ZMPA 3F0NA 2QG9B 1ONYA 3LWLA 3VAMA 4DL4A 3QCGA 2MQOA 3E51A 3TOQA 1KR4A 4FXDA 1KDNA 4QF5A 4ERDA 1RCXB 3I55S 2KB2A 2HKEA 2NXNA 3G9CA 2QCTA 2EK1A 1DTQB 2Y1LB 5KA8A 1VR6A 1S6PB 1VRTA 1Y4ZB 2DPIA 4NCGB 4JI6J 4PPDA 3RUBL 4DF8A 2CQ1A 2LQ9A 1I9SA 4LF2A 2CNEA 3BGOP 3QCFA 1QM9A 1S59A 3C6UB 4ZA1A 5KG6A 2HWIA 1KD1T 4N76A 2G4BA 2P8IA 1RBAA 5KFTA 2GAHC 4X62J 2W9CA 3DRSA 1FDDA 1T95A 1WEZA 2NPIA 2HFZA 2Y8WA 3R2DJ 4RLEA 2JX2A 4V1Ak 4LF8J 3BBFA 2M52A 2E5HA 1UJ4A 2YKNA 3PR5B 1PO6A 4PR6A 4E2FB 1B64A 1NSAA 5HVFA 4B3RF 5HMXA 3N0AA 3O5XA 2UUCJ 2J6TA 1VHRA 4LFCJ 2IDEA 3DC2A 1ELOA 3NGRA 2NPFA 4J9RA 4RUAA 2OC3A 3HFKA 3R5DA 4RW6A 3W8GA 4CNYA 1M1KT 4I2PB 4JBCA 4DGXA 2BGDA 3SBMA 1S6PA 1YBUA 4B08A 3Q8RB 3Q0AA 2I1RA 1TZ0A 2L08A 4NXMJ 2B8PA 4HYKA 3OHAA 2A3KA 4CVMA 1VQ9S 3GSDA 3NGKA 4C98A 3VZHA 2I6OA 4RUCA 4QWCA 3PVXA 3P3DA 1WJ9A 5KG0A 1JXEA 2EEYA 1KRPA 3BB5A 2GQ2A 3CJQA 4GVBA 1NLKL 2UXBF 4RI5A 4QIEA 4ZVSB 3OUYB 1QD1A 3QMQA 1TELA 3EWGA 1RAOA 1RA7A 5HJXA 2HHUA 4D3QA 2BOPA 3MGJA 1N0VC 5GAHI 2Y3YA 3CJ5A 5H9FK 3MM7A 1HNWJ 2UVWA 4O23A 1WRMA 4IUFA 3GYNA 4WZMA 1G1XA 1IN0A 2J7WA 5E3CA 2U1AA 2WTFA 2HQFA 2PA8D 2ZWOA 2WVFA 4O3NA 2VONA 3HSZA 4NEZA 5C24A 4DR3F 1RHUB 3I82A 1BE4A 1HWIA 2F8HA 4IRKA 1RUSA 3K59A 4DR5F 2CQ2A 4C13A 5I3QA 3OBIA 4AXIA 5L1KA 4F4ZA 2HNDA 2YWEA 1Q6MA 4NLOA 2MLYA 2O1PA 1UA1A 4NYPA 2BRKA 5T41A 5DQHA 2JEJA 3DNCA 1YRTA 1MWZA 5KA4A 4CVLA 2YPYA 3GJTB 2I3UA 1Q16B 5J2NA 1ZAWA 4CTAB 1JBWA 1BZCA 3OTOJ 4DPUA 2F6VA 3BH7B 1N4LA 4LR8A 3MZIA 4XDCA 1UKUA 4RW8B 2HHHJ 1WI8A 1N32F 3GIRA 4M5MA 1PBAA 1BXNA 3J7ZT 1VC5A 5J2QB 1HR0F 3CJ0A 4H4OA 2RUGA 2OKQA 4DG1A 3PKYA 1D3WA 4OZNA 4QOTA 1SJ3P 2UUCF 2VQEJ 2DNGA 3J80Y 3HSDA 4BPCA 1Y5LB 2Z58B 3FCHA 2Q05A 2R7RA 4PQUA 2A10A 2IM3A 4OV6A 4URSA 1NH8A 2XMTA 1RTZA 3CJ4A 3M8QA 3PW0A 1T3OA 3TANA 2CYYA 1RWXB 4NCAA 2YNGB 3ZM0A 2B51A 3GMGA 1NKCA 3M9NB 1IKWB 1LK5A 1ZTWA 2J6UA 1C85A 1OEMX 2W9BA 2F00A 2LXFA 2VPWB 2J76E 3DGVA 2P9GA 3ENAA 3MAHA 3N6LA 3KK2B 1QLNA 4DR4F 1S4FA 4TYAA 1VQOS 2DITA 2UZAA 4JI6F 4RKKA 4A8YA 3CEDA 5ETRA 1YKWA 1SUQB 5KA7A 4DBQA 4DUZJ 5AXMA 4I6AA 3R5BA 4FXVA 2VG7A 3IS9B 4P10A 4USTA 3M8WA 4DV5J 1TK0A 1SUGA 1CPZA 3QCNA 4B3TJ 4TN2A 1N52B 4DG1B 3R5GA 3KFWX 4PG7A 4WFAQ 1YJ9S 2VC0A 4CLFA 1RCOB 3CDEA 3QIPB 5CYQB 2EK6A 5KFKA 1RT4B 4Y2AA 2I3RA 1DRZA 2HSEB 2WVCA 4MK9A 4X64F 4OX6A 1TKZA 2W4PA 1L3UA 2XMKA 3ZZOA 4LF6J 1WC3A 1T03B 3OTBA 2ZH5A 4I64A 4ZPBA 2XS2A 2HHQA 4DV0J 2UUWA 4N56A 2JLGA 3QCBA 1H0HB 3IBWA 4EI2A 4R30A 2I4GA 2KI2A 3OVBA 4DUYJ 3GP9A 1JNZB 3LJ8A 5HATA 1RSCA 2F70A 1WWHA 1NDCA 2XYHB 2MQQA 3THVA 5B0BA 2HC2A 3MTKA 4YB1P 1FFSB 4PCQA 5ETQA 2EFNA 3JXOA 1AA1B 1NEEA 2BANA 1XJWB 2VG7B 3M30B 2XS5A 1BZJA 2ZVIA 2R8IA 1BC6A 5A5EA 1K0VA 5A8KA 4QCLA 2U2FA 2VU5A 1SC1B 4YR2A 3IAM9 1P3DA 2F6ZA 2Q1LA 3NGDA 3GJQB 5C2CA 2CJBA 1RHJB 1TKXB 2VEXA 1RT4A 5LXRA 2FJVA 3WQPA 1AZSB 4K4UA 1ZM9A 4ZVEA 2VBWA 3NS7B 4F0KA 2FGOA 1M1HA 5GMDA 4ZN3A 3Q8SB 3NAIA 2HFSA 5K8MA 3KNAA 3HVWA 1Q6JA 3D42A 4YR8B 2XG8A 4JP8A 4P9SA 4DU8A 3R5AA 2MQMA 3UDLA 3OTDA 2V8HA 4C8OA 4CO1A 4HH0A 4N47A 2AIRB 2IJFA 1HFEL 8ATCB 3JSMB 3QCLA 5L9NA 1RWPB 1JIHA 3HVTA 2V8GA 4GC6A 4OI2A 1VK3A 5GAGU 3HCXA 5B0CA 1YTYA 3P49B 1YRUA 1JXVA 3DDKA 2OHDA 3M30A 4ANDA 1AFIA 5MAOA 1RADB 4C3KA 3M9MB 3QGIA 4KR0B 3NL0A 2FJAB 2PBNA 4DI6A 4D3GA 3FFIA 1PYTA 4ECXA 2GQQA 3DXSX 3OPKA 1EJ7L 4U8VA 1ZPVA 3FZ2A 4L6V3 3K5LA 1YK9A 1T8EA 2FTRA 2VOOA 2K1RA 4BWJA 2GWOA 1TKXA 3I56S 1XN9A 5FIIA 4DZ6A 3BGRA 1DY3A 1RT3B 4XDDA 2J9CA 5F0WA 1E0DA 4IYQA 4KTQA 2G6ZA 3TQEA 1KFSA 3LP0A 1J2VA 1WC4A 3NOGA 4IG0A 5A2QY 1BQMB 2GW8A 2D1CA 2HIQA 4L73A 1HWUA 2WSFC 3F56A 4J91A 4WP8A 5DJBA 4DJBA 1BZHA 1XQIA 2CNHA 2ZJQQ 1XNRF 2F8EX 1JBVA 1X4EA 2CKWA 1SQEA 3MCNA 3VGSA 4I8NA 5HDEA 5H9EK 4RJVA 4FNHA 1BQXA 4L3NA 5ETMA 1F2HA 1KAKA 1HBOB 2NTAA 2AX1A 2ZH1A 2V8VA 3I0SB 4TKTA 2BW7A 3QLHB 2ZH4A 2GMJA 4BUBA 5D8HB 4C12A 2LMIA 3KLFB 3Q2TC 4WWSA 1XBOA 3ZZPA 3T5HA 4QIFA 5ETLA 1JQGA 1DZ5A 3C14A 3FKBA 4B9TA 4ZIVA 4IKCA 1Y10A 2Q3PA 3SEOA 4JI7F 4USUA 1OS5A 1XMOJ 2MXYA 4YY3J 3FCWA 1P8GA 2YX1A 5SZTA 3TARA 4DWIA 2MJUA 2F6WA 4RW4B 1QUVA 2VD3A 2BMBA 1BQMA 3P5BP 2HZVA 2HFOA 4Y65A 3RAMA 1DHMA
chains in the Genus database with same CATH topology
3LGNA 2G13A 2O01C 2E0TA 5C5JA 4DPOA 4ES3A 1VMBA 3C6TA 4JI1F 4LVNP 3OVAA 2Q6CA 5CYMB 2E5LF 3EGNA 2KFNA 2HCMA 2PIIA 4AE5A 3I0SA 1RXDA 3I31A 3U96A 1IXKA 3VR1A 4ZP6A 3QLHA 1KNZA 5K14A 4F4WA 1LW0A 1S6OA 3UNGC 1R6HA 2JHEA 4P7TA 3BS9A 3BDEA 1REVA 2ZC4A 3EYZA 4NWGA 2RQMA 3M1VB 4DL7A 1IBLF 2BBEA 3GIMA 3IC1A 2IM1A 4RW4A 2ZJRQ 2Q43A 2I42A 1CLFA 2HQ3A 1S0OA 4MKYA 3AHPA 2CPZA 2DGWA 3FSXA 1DQ9A 2CQBA 3EUNA 4HEA9 3IRXA 2XSFA 2YKOA 3LAMA 2HVIA 2RH3A 1YJWS 1R8AA 1FRXA 4KGKA 1T94A 2BM1A 4I6YA 2I4HA 5AE3A 1LW0B 1RDRA 2JEGA 4I1TA 5L1LA 4IOBA 1ZAVA 1RA6A 5E5NA 1RWUA 4FP9A 1SJ1A 3OR1A 3VAGA 2YKMB 2P6SA 1WI6A 1ZM3A 4I68A 5KG7A 3CCTA 1N8RT 1UVIA 2E9RX 1F60B 5KTQA 3CCMS 2E9ZA 1KQKA 1M90T 1RP5A 3K5MA 4JV0A 5I3PA 2AGOA 4TQSA 1HI0P 2HLTA 3L7PA 1JJ4A 3S1TA 1FHTA 1QZ0A 3F41A 3IRXB 1MROA 3TR5A 1OETA 2JJDA 1N6QA 3D28A 2D7SA 2XC9A 1H7XA 3UQSA 4FF1A 3DLGB 3JSBA 2BV3A 4ZLPA 2DNRA 3LW5C 3IXQA 4WFBQ 5KFBA 4J9NA 3UW1A 3UCUP 4ERCA 1JJHA 5L1IA 2OOQA 3UDCA 3HM9A 4H1OA 4ILMA 4O4GA 4LSNB 1WHVA 3SV4A 2CJQA 4F25A 5F9LA 2HY3A 2YNHB 3OXGA 4JUZA 3W2WA 5KFHA 5B0FA 3AB2B 1QAXA 1HBMA 2BGEA 1TL1A 2VKZG 1IUJA 1FKOB 1XR6A 4Z2XA 1GQEA 5M2PA 5F8MA 4F4XA 1P27B 2DT9A 5A8WB 2MY7A 2XCPA 4ZK7M 1U4BA 4ITSA 1FE4A 1N6QB 2VL1A 1UAWA 2CQDA 2JVRA 2FVCA 3IG1A 4LQ9A 2YKQA 1VBXA 4JI3F 2VFSA 3CCUS 1SUQA 2HS4A 3CF5Q 4YOEA 4GO7X 3HHEA 2PMHA 1N48A 3IS9A 2KHDA 1YITS 3FQLA 4ED2A 3PX0A 2HC1A 1AAXA 2Q47A 1Y9OA 1LXNA 3DMJA 3ENWA 4X84A 3T5JA 4KJIA 4K4ZA 2HWTA 1NO6A 3WDOA 3MMJA 2DNPA 1K9MT 5GAEU 2B43A 4FN5A 2NS1B 4Q2MA 1S1VA 2IA6A 4KV8B 2W8KA 2H5EA 4PXEA 5D78A 2R2RA 4F4KA 3WBZA 1N5TA 4Q2LA 4CH1A 3E01B 3ETOA 2YKAA 5DM7Q 3N5FA 4A8OA 3O4SA 1QXKA 2WGPA 3US5A 3DLHA 1H2TZ 4LF6F 2B4VA 2ZHOA 1OHEA 3KHGA 4PYHA 1U6FA 2ZM6F 4JMJA 3M8PB 2PI5A 2RRNA 3DLKB 2C2DA 5U47A 3OFFA 2BW2A 4F02A 2QBRA 3A5JA 3RW7A 1NKEA 3DOMA 3NNHA 1U49A 1A5YA 4C7QA 1GAOA 4HI2A 4I69A 2DISA 4Y00A 3G6VA 3N9UC 4IQMA 1YTSA 3V6DB 2DR7A 1HQUB 1S1VB 2DGTA 3W2VA 3QIDA 2FVSA 4PUOB 2B0GA 1QSSA 3MECB 4BC7A 4DFMA 3E01A 1YIJS 4OL8A 2FJMA 1MMLA 3MUVP 3VAJA 4EO8A 7FDRA 4C8ZA 3H5SA 4HDHA 1CC8A 4R0TA 2BDPA 2UXCF 3I32A 4HT5A 4DS5A 3J81Y 5F8NA 3M8PA 1FKPA 5F8JA 3I6PA 5E3QA 1TK5A 2F7VA 2P4DA 5THWA 4KFBA 2OZ5A 2NT2A 1FK9B 2MKIA 2EWHA 2DNOA 4OZ1A 1NK8A 2HHHF 1Z2ZA 3ZZZA 2NV5A 2AWZA 2RQ4A 4DR1F 3V6DA 1WG4A 2LVWA 3LP0B 4DDFA 5B0AA 3MM8A 2LEAA 4OZLA 4AYBD 2W8LA 1UVJA 2K7KA 2QV6A 3OSNA 4QUNA 5A6PA 2FGCA 4UUWA 2KO1A 1KEKA 1XXPA 2VOPA 4WYLA 2KFYA 3GV8B 3GFHA 3CMES 2AZRA 3SMEA 3JB9k 1FJEB 1RISA 2CPFA 3M2UB 3NNAA 3KLFA 2HW3A 2LQ5A 1LYVA 4BCAA 2J7UA 4QR1A 4ZP8A 2QSFA 4TXSA 4HVZA 3RZAA 4Y6IA 2GJ2A 1JK9B 2MDAA 3Q23A 4F2RA 4NLTA 1DBDA 2K2PA 2P9EA 1UMJA