3MMJA

Structure of the ptp-like phytase from selenomonas ruminantium in complex with myo-inositol hexakisphosphate
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
314
structure length
314
Chain Sequence
b'QTVTEPVGSYARAERPQDFEGFVWRLDNDGKEALPRNFRTSADALRAPEKKFHLDAAYVPSREGMDALHISGSSAFTPAQLKNVAAKLREKTAGPIYDVDLRQESHGYLDGIPVSWYGERDWANLGKSQHEALADERHRLHAALHKTVYIAPLGKHKLPEGGEVRRVQKVQTEQEVAEAAGMRYFRIAATDHVWPTPENIDRFLAFYRTLPQDAWLHFHSEAGVGRTTAFMVMTDMLKNPSVSLKDILYRQHEIGGFYYGEFPIKTKDKDSWKTKYYREKIVMIEQFYRYVQENRADGYQTPWSVWLKSHPAKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myo-inositol hexaphosphate phosphohydrolase
publication title Substrate binding in protein-tyrosine phosphatase-like inositol polyphosphatases.
pubmed doi rcsb
source organism Selenomonas ruminantium
molecule tags Hydrolase
total genus 111
structure length 314
sequence length 314
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14566 PTPlike_phytase Inositol hexakisphosphate
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1690 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3mmjA01
3.90.190.10 Alpha Beta Alpha-Beta Complex Protein-Tyrosine Phosphatase; Chain A Protein tyrosine phosphatase superfamily 3mmjA02
2BZLA 1YTNA 2QBPA 3U96A 1G1HA 3EAXA 2I3RA 3S3FA 1G1GA 1OEUA 3F9AA 4OHHA 3I7ZA 2PQ5A 1YGUA 3GXHA 3QCJA 3D1OA 4JMKA 3QCKA 4DGXA 4D3RA 3RGQA 1U26A 1BZJA 3ZM3A 1JLNA 1C86A 1GFYA 2PI7A 3ZM0A 3ZV2A 2HNQA 2YDUA 1OEOX 4OHEA 2F70A 3O4SA 4HJQA 4WOHA 4D3QA 3BLTA 2F6YA 2QCTA 2QBSA 4ICZA 3QCEA 5KADA 1G4US 1YWFA 3I36A 5IBSA 1U25A 1XXPA 2J16A 5K24A 3F41A 2PT0A 2OZ5A 2C7SA 4Y14A 3V0EA 4RHGA 5KA3A 3V0HA 1FPZA 5EHRA 1LQFA 4ZRTA 3D9CA 3I80A 1C83A 3QCIA 1T4JA 1OETA 2FH7A 1ZCKA 2CNIA 1G7GA 3AWGA 2CM7A 1YTSA 1BZCA 3QCBA 2Q05A 3S3EA 4TVVA 4ZI4A 2JJDA 3V0IA 4YR8B 1XM2A 4GRZA 1ONYA 2IMGA 2AZRA 2CM3A 2RF6A 5KA2A 1XRIA 1PTUA 1QZ0A 1C87A 4WU2A 4JBCA 5K9VA 2QDCA 2HXPA 2I5XA 1RXDA 3BLUA 1L8KA 5IBMA 4HJPA 2VEVA 2H03A 1I57A 2CNEA 3B7OA 4JMJA 1OEMX 1PH0A 1NO6A 2I6JA 5K9WA 1Q6JA 5BZXA 2I1YA 2QCJA 2B4OA 1I9TA 2QEPA 1C88A 2NV5A 3S3KA 1JF7A 2I4EA 3H2XA 4KI9A 2F6TA 2CNHA 2G59A 1LYVA 1OHEA 2G6ZA 2ESBA 4NX8A 3MMJA 4RI5A 2I4HA 5MMZB 4ZN5A 2M3VA 3O4UA 1ZZWA 3ZMQA 2CFVA 1G1FA 1YGRA 3EU0A 3ZMPA 3S4OA 1WAXA 2R0BA 1PTTA 3QCLA 5KABA 3CWEA 3QCCA 2GWOA 4NYHA 5EHPA 2CJZA 1X24A 4YAAA 3D1QA 2CMAA 5BX1A 4PVGA 1M3GA 2ZMMA 2B3OA 1ONZA 2HVLA 1LARA 2GP0A 5GTJA 1A5YA 1EEOA 1RPMA 1MKPA 5KA4A 3AWEA 2HC1A 4OHDA 2QBQA 2F71A 4RH9A 2BIJA 3QCNA 4S0GA 5KA0A 2H4GA 2H4KA 2I4GA 3M4UA 3QKQA 3MOZA 1BZHA 2FJMA 5KAAA 3AWFA 2FJNA 3S3HA 3S4EA 3V0DA 2NTAA 4JNBA 4GFVA 2J17A 4GRYA 4Y2EA 1OHDA 1XXVA 1PTVA 1EENA 1QXKA 3EZZA 1FPRA 2HCMA 3OLRA 2PSZA 3ZM2A 2NLKA 2CMCA 3QKPA 2GJTA 4KYQA 2WGPA 1Q6NA 2E0TA 4BJOA 5KACA 3A5KA 4OHLA 1L8GA 1KAVA 2F46A 2HNPA 2I75A 2C46A 2CMBA 1T48A 1NL9A 4QUNA 2B07A 3CM3A 2Y96A 3EMUA 2HB1A 4H1OA 5I6VA 2H4VA 3OMHA 4J51A 2HC2A 1Q6TA 2I6PA 4GWFA 3V0GA 2F6ZA 1GWZA 5M43A 3V0JA 4AZ1A 2BV5A 5AWXA 4ERCA 1YFOA 2A3KA 2I6IA 4IKCA 3QCFA 3SMEA 3A5JA 1YTWA 4R0TA 5BZZA 4GE5A 2CM2A 2F6WA 3BM8A 4GE2A 4RH5A 2PA5A 2ZN7A 2NT7A 4NWGA 3O5XA 2H04A 2H02A 2PBNA 3F9BA 4RKKA 2OUDA 5K25A 4QBWA 3D42A 4PYHA 2B4PA 3O4TA 1NWEA 5KA9A 1KAKA 4NWFA 1G7FA 3ZM1A 1I9SA 4R0SA 1YN9A 1Q1MA 1XBOA 4BPCA 2DXPA 2VEUA 1T49A 1NNYA 1WRMA 2F6FA 2CM8A 3MOWA 1ECVA 4KYRA 5J8RA 1NWLA 1Q6SA 3RO1A 1Q6PA 1WCHA 5HDEA 5KA1A 1Q6MA 3N0AA 1PA1A 3GXGA 2Q47A 1V3AA 1PXHA 1PTYA 4QBEA 2I6OA 3QCMA 4QUMA 4MBBA 2OC3A 2I3UA 5K22A 1U24A 1OEVA 2B4SA 1OHCA 1PYNA 1YZ4A 5BUGA 1YPTA 2QDMA 1P15A 4GE6A 2J16B 4GS0A 3LJ8A 5LXQB 4RI4A 1ZCLA 1C85A 3NMEA 4HRFA 3F81A 2SHPA 1AAXA 3F99A 3V0FA 4Z6BA 5KA7A 3D44A 4WU3A 3QCHA 2I42A 1C84A 2NZ6A 1ZC0A 4WTYA 4B04A 5KA8A 2I6MA 4DGPA 3PS5A 5K23A 4NNDA 2F6VA 1FQ1A 3RGOA 4H34A 2VEWA 3EB1A 1D5RA 2Y2FA 3QCDA 1J4XA 4D3PA 2OOQA 2B4UA 4R30A 2CNGA 2P4DA 3D1HA 2BGDA 3SR9A 2AHSA 2NT2A 1SUGA 4QAPA 1VHRA 2QDPA 2BGEA 3BRHA 4RDDA 1NZ7A 1G4WR 1OESA 1R6HA 2QBRA 3QCGA 4I8NA 4OHIA 4QAHA 4GFUA 1PA9A 3O3LA 2MBCA 2VEYA 2VEXA 2A8BA 3RZ2A 2B49A 2P6XA 2HY3A 2CNFA
chains in the Genus database with same CATH superfamily
1YTNA 3ZNJ1 5D3GA 5F8JA 2VKZG 4ZMMA 1ZOTA 2J7KA 4B3MJ 3AD7C 2BA9A 3GIIA 4LF7J 1NJYA 4MKBA 4I7FB 5IFMA 3OL7A 5KFUA 1YDLA 3F0NA 5HP1B 2YVSA 1GK8A 1NK8A 2L08A 4F0MA 1VQYA 4A8OA 4ZDNA 5EWFA 4ZVRB 2M4MA 3BQ1A 5DLFA 2QBSA 1HQEB 4NLGA 1U25A 1D9AA 3I5BA 2LQ9A 1GTHA 3GCWP 3R1HA 2PFDA 4M5KA 3IR7B 5DZ6A 4ZIVA 2GJFA 3FNNA 1FPZA 1RWVB 4QPTA 3E01A 3VGSA 2YPZA 2DXEA 4QF5A 2K7JA 5I42B 1S6OA 4DSLA 1BZCA 3S3EA 2Q05A 2CNLB 2BMBA 5IV3A 3Q22A 2DGQA 1XRIA 3FQLA 3DOLB 1W78A 2UUBJ 2PO4A 3MVNA 1A6LA 4TVAB 5DDRC 2HURA 4GVBB 3G87A 2EKYA 1B70B 2GQCA 2WTFA 2J9EA 2B4OA 1SL1A 2WONA 3HFZB 2YWHA 3DRRA 4N76A 3EZOA 1JB0C 5LJ5Y 1PCAA 4DQRA 5A6PA 3DLLQ 3CC7S 3KTQA 4YDDB 4ZN5A 5HMXA 2Y8WA 4NZ6A 4ZOSA 4PQUB 2BJ8A 1Q7LB 3W8GA 3TYTA 3QNWB 4DR1F 1U49A 1X24A 1REVB 1VLOA 2DNGA 3D1QA 1NH8A 2XMUA 5AJ3J 3MR7A 1F5BA 2M8HA 2O3DA 4CRJA 2LEPA 5CD4H 3MXHP 2GIFA 3OVSA 2JNJA 5C25B 4PUOB 5FDLB 5E3RA 4S0GA 3PTWA 4F4KA 1RABB 2R2RA 3ETOA 4N7TA 2OAUA 3MAAA 2BE2B 2XHWA 1K1SA 4M5IA 3D28A 1YG0A 3RTVA 3SV4A 2ADCA 1FWKA 2FIUA 4DLEA 2HQDA 2J7WA 3M2VB 2VU5A 5KACA 3A5KA 4OX9J 3M9NB 1RAIB 4ZVEA 2FJVA 4EMDA 4UZBA 3EWGA 3OJUA 3CM3A 1NPRA 3UN3A 3EGZA 3RG6A 5DG9A 2X1FA 3NRSA 3OTOF 2HHVA 4PAAA 3V0GA 1S99A 4CVMA 3NGRA 2JJ4D 2OIHA 2OP5A 1C0TA 5LSLA 5CYMB 1IJEB 3CDBA 1S1UA 2HAFA 1TV6B 3QBCA 1N5QA 1V3SA 3GR0A 4KH1B 2NUUG 4P52A 4RW9A 2ZNYA 3O5XA 2AM1A 4K2XA 2DPIA 2AHOB 2PBNA 2R4FA 2OUDA 2DVIA 5K25A 1P1TA 3PO5A 3B4DA 5KFZA 5M2PA 3LGHA 4B08A 1TK0A 5KA9A 4UUWA 4G65A 3PYZA 3HF5A 1RHJB 2CQPA 4DR7J 2VEUA 1FVSA 1BE4A 4L76A 2F6FA 4ZKAA 1Q6SA 2CPEA 1UMJA 4E0DA 5ETVA 3NOCA 3H90A 3RRGA 5K22A 2B3TB 2IBOA 2QO3A 3KLFB 2L48A 2BVZA 5KFXA 2J9CA 3KHHA 2MY7A 3D44A 1RWKB 1MMDA 5A5EA 4M8LA 5F3TA 2CPYA 3TRGA 1KQKA 2NLWA 3R6LB 3VAJA 3HD2A 4F3QA 4Z2XA 1M1KT 2O5DA 3EUNA 4B3SJ 5G4DA 5CCMA 2VDHA 3MM6A 2J0WA 2XULA 5K8NA 2B0GA 2KU7A 3OR1A 4BHQA 2HEKA 1HR0J 1CJKB 4UT4A 1P9QC 3I31A 1X4GA 4WJBA 3CDEA 4NLDA 5KFYA 1U1QA 2W7PA 1U1OA 1TELA 3H20A 5KG5A 1JLAA 4JI5F 2ROGA 2CWKA 2HY3A 2LVWA 4PABA 1AYEA 2BZLA 3CF5Q 3KUEA 4Y2AA 5IM0B 2VG7A 3OUYA 4TU9A 3HFVA 2X1AA 4USIA 2HQCA 3MMBB 2DISA 2FY1A 2AZ1A 1YGUA 3MM5B 4YB7A 3GXHA 3KJVB 4DZ6A 1FJGJ 2KO1A 2MLZA 3MF5A 4DG1B 4DPYA 3RGQA 2E66A 1KLMA 4LF8F 3EGWB 4DV7J 1C86A 3T5HA 1SIZA 4DZDA 3CJQA 3QCEA 4DV4F 1MLAA 2QT7A 2CNKB 1CLFA 4ZCKA 5KT3A 9ATCB 2CNNB 3FRYA 1WKLA 4QU6A 1X4CA 1J5OA 1GQEA 3E3XA 2YQ3A 1KD1T 2GCAA 4JI3J 4O4GB 3M8RA 3QT5A 5SZTA 3TANA 2JJDA 1XM2A 4JI1J 1HNVB 1DTTB 4J9SA 2QDCA 4O3OA 2W4CA 3JYTB 1RSCA 5GMEA 1H2TZ 4I6AA 2K2PA 2VKRA 4MKAA 2W1BA 3PR5B 1E6YA 4L6V3 1NRKA 2HIQA 3V6HA 4OI2A 5L1JA 2POKA 2BACA 2YNGB 1R8AA 3NGKA 3CCES 4K4WA 1PO6A 2JSXA 3M8PA 4DV6J 1VIXA 1XIQA 1ZZWA 2KFYA 2CFVA 1UCNA 3ZMPA 3CE8A 1XN9A 5HQ8A 3HVTB 4OYIA 4FYDA 4WE1A 1LARA 3KNGA 3DLKB 3U7JA 1FD2A 3AWEA 1EETA 4IH7A 2QLWA 1N8RT 3I4HX 2IA6A 1JKHA 1WTBA 1N0UA 5B0FA 1S12A 5F9NA 2UUTA 3BDEA 1OQ3A 3IFEA 4RPFA 4PWDA 2JH3A 3IR6B 1NK6A 1T9YA 1W7WA 1N32J 2QMUB 3R1LA 3BGLA 2KL8A 3AJ1A 3P45B 4CLZA 1RT2B 2ATLA 2AYGA 5IC6B 1OWXA 3BM7A 2LYVA 8AT1B 2F00A 1FXDA 3FEYB 1HNZF 4GWFA 3RB6A 1PBUA 2UUCJ 1M5KC 2IYIA 1LXJA 1VQ7S 5LMNJ 4DR2F 1D3WA 3V2UC 2HRYA 4DJBA 4USWA 1K47A 4OI1A 3UDVA 5A8KB 3A5JA 3CJTA 3VAFA 4ID8A 1YIJS 5BZZA 3TA1A 5L9NA 4GE2A 2V67A 1Q8IA 1U48A 2DXFA 3KKFA 4NWGA 1RP5A 3LAKA 4RWWA 1JXLA 4U8YA 4ILLA 2R8GA 5GAHU 4HT7A 1NPPA 2FLNA 2SXLA 4C11A 1IR0A 2P9CA 2BX6A 3MCNA 3OHBA 1SI9A 1RAJA 1N36J 2KT5A 3H7HB 3GFXA 2LEBA 1YN9A 2V4QA 4NLQA 2QN6B 1XK8A 3LANA 3M32A 3B54A 1PJ5A 3PYGA 1VQ8S 2AJFE 3A8KA 3NP5A 5HBMA 4G3IA 1IBKJ 1U6FA 3KXDA 3G8QA 2V8GA 5HROA 2YNFA 1BQXA 3CJ2A 1DQAA 3N0AA 1R89A 2XY6A 1EAYC 3KDOA 4C8YA 2RSQA 5E7OB 4BS2A 2GVZA 2B4SA 3C19A 4LRBA 2WZ1A 2AV5A 5KT6A 2HFVA 2QDMA 3LPEA 3DM2A 5LXQB 2JDJA 4XAKA 4CT9A 3T6JA 2R7OA 2KFNA 1AA1B 1AAXA 4Y2KA 4NLUA 1WSRA 1HI0P 2FPHX 2RU9A 3E01B 2AYBA 4J9KA 4X4NA 1WI6A 5KTQA 4OZJA 1X4EA 4F50A 3CB4A 3J7A1 4O4RA 4H34A 4W98A 2OEKA 2RNEA 1U02A 4FPIA 4ER8A 2HHUA 4P2FA 2ZH4A 1FNXH 3ILIA 3BRHA 3KLGA 2AEFA 1VC6A 3W61A 4K4UA 5D6GA 2K7KA 3WC2A 1YJRA 1VJWA 4AQYF 4DX7A 2WCXA 1FVQA 5AXKA 1XMQF 2FVCA 4CYUA 4URSA 3WC0A 3SQGA 3DRRB 3QWUA 3NBPA 4TNOA 1UEKA 2F8EX 3MCMA 2FDNA 1IR2A 1GXLA 1SJ3P 1YZ7A 2OHDA 3H5SA 3QJPA 1NHUA 5KFSA 2BJDA 5E3PA 4C97A 4ENOA 2FHMA 1PIEA 4U95A 2KXFA 2FJEB 2QCTA 4FF3A 3KDNA 3TZWA 2C2EA 2PT0A 4LIWA 7FD1A 5F8MA 2DGVA 1LNQA 2O66A 4HHHA 1RHUB 2ZBQA 3MAAB 4C9DA 4YR3A 2ZH5A 3HSJA 3MUTP 3T1AA 5DETA 1U0SA 2HNZA 1ONYA 4DPWA 1NHVA 3FCVA 4WFXA 3KLIA 3CTRA 1B7FA 4QWCA 3BV8A 4JI8J 4Q2LA 1RYSA 4WU2A 4QIFA 3K89A 3VVTA 1P9YA 2BE7D 3T3FA 1WELA 2F65A 5D4NA 5L1LA 4PRFA 4P9SA 4DSIA 1SQEA 1RB0A 4ED8A 4PYAA 3KOAA 4HHJA 3J7AN 2QCJA 1LV5A 1HYSA 3GIKA 2OEJA 1C0TB 5KFAA 3CT9A 1ZA2B 2LQ8A 3ZTRA 1S1UB 4M95A 4CH7A 1H3DA 3I82A 1S9GA 2GAGC 2B8PA 3M7VA 1IR1A 4RW9B 3R5DA 4DUYF 4DL5A 5KFCA 2H5JB 1EB0A 3CCTA 3PHTA 3BO2A 1RI7A 1HI1A 3PX0A 2GP0A 2MTLA 5H9EJ 2JVRA 5B0DA 1TFWA 4LFCJ 1GXUA 2MKYA 3US5A 4NLXA 3GV5B 4ZVQB 2JLGA 4DFPA 1U1MA 1KS2A 1SJFA 4ERDA 4RBTA 3DKDA 3HPOA 2C3OA 3LK7A 4IO9Q 1VJQA 3W60A 3MR3A 1RGVA 4JI4J 1PKUA 1HBOA 5GAGI 2CDQA 2MY8A 2MKSA 1VYAA 4IDKB 2YX1A 4ITSA 4GMKA 2HCMA 3B78A 2XYHB 2VPYB 3R5BA 4BJOA 1TUVA 4P74A 2UXCF 2V63A 2HNPA 3HCXA 3ENWA 2I75A 3OD2A 2B07A 5I3UA 2HK3A 1RA7A 3SSQA 1RWMB 4ECSA 2FUG9 1QDUB 4N56A 5IT9Y 4CI0B 4ECVA 2ZUGA 2G0JA 4YQWA 4Q43A 3POTA 4AZ1A 4ERCA 1MN7A 1T05A 3RB0A 3UFCX 3MM6B 2ZOMA 2YKOA 4HDGA 3JXOA 1T94A 1VQ9S 2YWWA 2DEIA 2QG9B 1RK8A 3OR1B 1AUDA 3BQ2A 2BM0A 2BKNA 2NT7A 3V6DA 2H02A 3QT7A 1J5EJ 3RBXA 1TVRA 4LSLA 4CNYA 1JLAB 1YJNS 4KPCA 3FMBA 2M3DA 5AT1B 3TA0A 2E9TA 2F4VF 3JSRA 1NAQA 4ZCIA 1K0VA 3R27A 5AE1A 2VG7B 3OUYB 4JYAF 1ZS6A 1R31A 5HATA 2FHOB 2CM8A 3J80Y 4EBEA 1BD6A 1U1LA 1N33F 1KLMB 3IWNC 3HULA 3GXGA 1RHKB 2PIIA 1OPIA 2EFOA 4HI1A 2CYYA 3DFEA 2MZQA 1R8CA 1OYDA 3EXYA 3PX4A 3C3LA 3OFEA 4C12A 4K4YA 3Q8UA 3NNAA 2R7RA 4RI4A 3AODA 3D3CJ 2LA4A 1NDCA 3BPDA 3F81A 4HACA 4C8KA 4RBVA 4OFZA 4ECZA 3H5UA 1J5OB 4WTYA 5HMWA 2ZH6A 4LRDA 5K23A 2HHSA 1SC1B 4TYBA 4QQBA 4L3NA 3CPWR 2XB2D 1FQ1A 3MM7A 2NSBA 3GZ7A 2VBWA 1OO0B 3EB1A 1KFDA 3GMGA 3CXCR 1XR7A 2XLKA 2HHWA 4DUTA 1FK9A 2B4UA 5I4MA 2P4DA 3BPSP 2N4CA 1VHRA 1KQSR 4RDDA 1T0TV 1IKVA 1P3DA 4B9UA 2Z56B 4K2JA 2A8BA 4FKXA 1SL0A 2B56A 2CNFA 5MAOA 7AT1B 1JJ4A 3M8PB 5AXNA 5G0RB 2DEJA 4B9SA 3CGIA 3VZIA 4IG0A 2HBRB 2OH2A 3QCJA 4D3RA 1X0PA 1RKJA 1YJ7A 1B64A 1JXVA 2L9NA 5D78A 2N4DA 2UUWA 1SL2A 4WOHA 3CSKA 2Z57B 4KT0C 1EETB 2RD5C 2IFXA 2VV5A 2ILZA 1JKHB 3KLVA 4JI2J 3D9CA 4WBFA 5F8HA 1J2VA 5D0GA 5MLCV 1OETA 2XMMA 1G7GA 5H1SV 3QCBA 4TVVA 4ZI4A 3W62A 1URNA 4LRAA 2XSFA 4YR8B 4PWDB 3MM8A 2Y0BB 1S7HA 3O5TB 3IGVA 1M5SA 5HMZA 3DRYA 3UR0A 2FJWA 1C87A 4F4WA 1RU2A 2G13A 2D9OA 5KFGA 4CT8A 1GX5A 1L8KA 4KC5A 4P2XA 4NXMJ 3I6PA 2E1MC 2CQ4A 2HFSA 4ICLA 4Q7AA 3CDWA 2CQIA 2HMIA 4LF4F 3NCPA 3PRDA 3HSDA 4QU7A 5BZXA 3A8JA 5GMKa 1C88A 2HZCA 4LR7A 5KG6A 3H2XA 1FA0A 1Q5YA 4F7VA 2HIYA 1DY3A 4F3MA 1SQFA 1OHEA 4DI6A 4RI5A 2KXHA 4Y0FA 3J7YI 2LU1A 1FDBA 1D09B 2FD2A 3FZBA 5CQGA 3EMTA 3NRBA 2GIRA 1WAXA 2R0BA 4NX9A 2ZH3A 5HN0A 2JVOA 3AOAA 2RRAA 1BLUA 2KT3A 4C11B 2XTJP 3CJKA 1RISA 5KA4A 1WC3A 2A1BA 1K8AT 5L1IA 2YQ0A 2YNIA 1U2CA 3M32B 2VC1A 2H4GA 1ZPWX 3DNCA 1S9EA 4DLGA 5HBMB 4LSZB 4ZVOB 5HROB 2YNFB 3W2VA 3D5MA 1EENA 1QXKA 1FI4A 5DO2A 2YPYA 2A6OA 2LECA 3G8SA 2GVZB 3QGPA 3IRWP 3UNYA 1KVIA 5ITHA 4R8UA 3DM2B 1L8GA 1JX4A 1V3RA 2FZCB 5K8OA 4KGZB 2C46A 1ACMB 4ILRA 3PW4A 5E3CA 4D3GA 2J6UA 2V8VA 3CMAS 3EMUA 1BWEA 2H4VA 2FJAB 2F8HA 4DSJA 3MOJB 1WF1A 3NAHA 5IT4A 2DR7A 4CH0S 4KHRA 4ZHRA 2ZHBA 1F0XA 1KBRA 3OL8A 2KVQE 2F9JA 2CM2A 2CQ1A 2ACMA 2OPQA 4CTAA 1OY6A 2L9WA 1RT5A 4K4XA 1X5PA 5A8RA 3R5GA 1S0VA 1EQMA 2P9EA 1O8BA 5LSRA 1RUSA 1N34F 4CYUB 3SQGB 1RXOB 3FKBA 3NBPB 1WEYA 1Q1MA 3UCZP 3W63A 3ZTQA 2F3JA 4DX8H 3DHXA 3Q23A 4QWBA 1Q79A 2HFNA 1GMWD 4HDHA 3ZFVA 4KO0A 1RBAA 4Q8EA 3IGNA 5KA1A 5DQGA 2VQEJ 3BF4A 3X1LB 1XC9A 2HLTA 1R27B 1U24A 4RU9A 5B0EA 2BW2A 3KG4A 2IYGA 3TAPA 1MMNA 4GS0A 2DGSA 4X4TA 4ZPAA 3BGRA 1CVJA 1HQ2A 3D0IE 3FSXA 4WKRA 4PR6A 3PW7A 5K9FA 5KA8A 2GS8A 1HWIA 3NS7B 4C0OC 3KJQB 2LDYA 1VDHA 2GJ2A 4DN0A 4CM0A 1X5OA 1GAOA 3CEDA 2HNZB 4J90A 1R43A 3KLIB 1N5SA 2G0CA 2PDAA 4R30A 4RLEA 3K2YA 3DRPA 1WC0A 1NEEA 3QT8A 4ED4A 2IAJA 3CD5A 3DLEA 2ADBA 4DR6J 4I8NA 2UUBF 4QAHA 9RUBA 4F02A 2BJ3A 4UQGA 3VR1A 4GKKJ 1TKXA 4C8OA 1ZBTA 2KM8B 1HYSB 4UUXA 2A0FB 4K5SA 4NI2A 2HGLA 5KFFA 1BHNA 2C2RA 3WX4A 4G1QA 3S3FA 2R3VA 1S9GB 2J8SA 4ZLJA 2XZTB 1FKOA 3N4WA 2YKPA 1YQHA 4QZVB 1SC3B 2VDIA 1AZSA 3AB4B 3TEGA 4ZP6A 2BKOA 2VBZA 1FTRA 2R8IA 4C3LA 5KFPA 3I36A 3W9IA 5K24A 3DGVA 5AJ3F 2VL1A 1YZ6A 1HNIA 4RW8A 4O44A 4ETZA 5HJYA 4O0IA 1KQFB 3AA8A 3Q8RB 3MMAA 3RAMA 1RHRB 1WC5A 5D77A 4M94A 4QPXA 1HL6A 4DSEA 1Z2ZA 3TVZA 2MLXA 4RNOA 2DNQA 1E6VA 1HBOB 1YTSA 1JXEA 1YHQS 3PIPQ 2JEFA 2AM2A 4AUKA 3I56S 5F8NA 2W01A 3DU6A 2NZCA 2IHR1 2IMGA 3NMAA 1U09A 4A8XA 2AD9A 4FYVB 5I3QA 2DNMA 1FESA 4IFYB 4J91A 1F6TA 2HK2A 4OX9F 4KE5A 4A46A 1QE1A 1CS4A 5K9WA 2VH7A 1I9TA 3J81Y 1JF7A 3POTB 2YXLA 1JLCA 3FZ2A 3MM9A 3MURP 1V9OA 1T05B 4EU0A 2G59A 2ZE2B 1CULA 3MMJA 1TUWA 1IXKA 3QZ7A 3EU0A 3TNVA 3V6DB 2I8EA 4IR9A 2Q66A 1TVRB 4LSLB 1HW9A 4DL3A 5IV4A 4Q8FA 5A8WA 1ONZA 3LP0A 2VPZB 1H7WA 4C2MA 5KFDA 2QFJA 1RTZA 5ETLA 3LALA 1YI2S 3EVMA 2GCFA 2ZEJA 1NJXA 1VRQC 2I4GA 2UZAA 2D3ZA 1NK0A 4DR7F 1CBKA 1E8CA 5CHCB 5DGBA 1RBLA 1XXVA 3FCHA 4B9TA 2HS3A 2EWHA 3DXSX 2OPPA 3I0RA 2CQBA 3PIOQ 5FLXY 4PPDA 3SDEA 4WK3A 4X2BA 2IRUA 1LWEA 2B7BB 2DNYA 3MD1A 2CWXA 5L8RC 4F4ZA 1V6HA 4YP3A 4HACB 3QRRA 1EP4A 1ZTWA 1FGSA 4EYIB 4IKAA 2L9DA 1P8GA 3OL9A 4HV4A 2GQ2A 3OMHA 2MKIA 1U8SA 2HGNA 1YJVA 4TN2A 4XDDA 1EEHA 5M43A 3V81A 4J9NA 1UKUA 3ZZZA 3MM7B 1HHSA 2MQQA 4FBUA 3CDUA 3B6BA 3IR5B 4JV1A 5BYRA 1RHMB 1FK9B 4B3SF 2HW3A 2VQFF 4ES2A 5KFOA 3UR3C 4EBCA 1IKVB 2HHHF 1B0VA 1HR0F 4RUCA 1GH8A 1RWPB 2M0GB 3V6KA 5J2QB 4UAGA 2CQ2A 4PYHA 3DYAA 1VQLS 4R5PA 3ZM1A 4WFZA 4OYOA 1OSDA 3A13A 2FZGB 3MTJA 4A8QA 4IG0B 3U27A 2IRXA 1NNYA 1VQ4S 1M1GA 3CULA 5J2MA 1ECVA 3OXLA 2OD4A 3IP0A 1OPZA 2VD3A 3MHYA 2I6OA 1FJGF 2HHQA 3UDLA 2RAQA 4MBBA 1C1BA 3LUYA 3QGGA 1S57A 4JOUA 4DV7F 1YZ4A 2VJVA 2QJ3A 1S1XA 4LBIA 4M1KA 2K3IA 4EFAC 5ETPA 2Y1RI 1YJTA 1REGX 2XMJA 4C0HA 3EYZA 4OYAA 1U0HA 4OLOA 4AXJA 1Q78A 4Y00A 5GAGU 4RW4A 3DLGA 3IS9A 1QM9A 4NNDA 4XO0A 1GG4A 2G2OA 1F2GA 4ELUA 1MWQA 2DNPA 2ZH1A 4JI3F 3MM8B 3K5OA 2CJAA 4DL0C 2XZDB 2DO0A 3W3SA 4DCOB 2BGDA 4R0EA 4Y65A 4JI1F 4ELVA 2B4VA 5IS2A 2RF2A 2GZOA 4ICLB 3EGVA 2HMIB 3M6UA 3CNQP 3KHGA 2KH9A 1YBAA 4F8RA 3KK3A 5EX3A 3JAMY 2KYZA 3TAMA 2QBPA 1S0OA 5C7PA 3K17A 3MCSA 1Q7YT 1UVJA 4CLLA 3HKZD 1H6KX 4DPTA 4DV6F 4ZP9A 1U26A 4KR0B 4TY9A 4X84A 5EDWA 3ZXWA 4NCGA 3D6TB 1JBWA 3QO9A 3AA9A 3CJKB 3BLTA 1L5UA 4ICZA 1G4US 4K5RA 1PYOB 4YN3B 2YNIB 2A18A 1DBDA 2JLFA 5KA3A 1Y10A 1S9EB 1RAEB 3BEGB 4A8FA 1FO1A 3HMJG 2I1RA 3W2VB 1T4JA 2LKZA 3QJJA 1JLFA 3CDAA 4QOTA 3PFOA 4USTA 1RCXB 4QIEA 2RF6A 2DR6A 4P71A 2JWNA 1K1QA 3PVXA 1PAUB 4R8UB 2OSQA 4JBCA 3UDCA 2HVHA 2EG1A 2QSWA 3M2UA 1S6PA 1N32F 5ETNA 3M4XA 1TKZA 4OI6A 3C14A 2BE9B 3SCJE 3MR5A 2NV5A 4LRCA 3IBWA 2HVZA 5K14A 2MHNA 3ISND 4ZHRB 4NX8A 2UUCF 1N5YA 1Y7PA 2GMLA 3M6WA 3N6MA 5LMNF 3E2EA 3O4UA 3CD7A 4OYZA 2OPQB 1G1FA 2NYIA 4CTAB 4Q44A 4WPAA 1RT5B 5A8RB 2BUNA 2CJZA 2B3OA 1ZAXA 2CJBA 3RUBL 2XS5A 3KHLA 3T5LA 4F0HA 1JMTA 1NU4A 5KFIA 2QBQA 4RH9A 3RZAA 1FEHA 2HRUA 2Y68A 3QSYB 1VQPS 1BUXA 1N36F 5AXLA 4OHYA 3HHLC 5KAAA 2AKWB 4PXBA 4IYQA 2EFPA 1IBKF 2EC2A 2V6AA 2Z30B 2NREA 1IN0A 3UN2A 2GJTA 2DHGA 2QE5A 2PI5A 2CIMA 3NKYA 3ETMA 5F8IA 1NJWA 3BGRB 2BQRA 4KIAA 4PWWA 2JZ5A 3FUYA 1UFKA 2QL5B 1PSDA 4OJGA 5DM6Q 4OZ2A 3MAHA 5HO4A 1I1GA 2P2CB 2XQCA 1Q6TA 1DHMA 2GV1A 3VV2B 1MWZA 4ZIWA 1U1PA 1HNXJ 1M0SA 2I6IA 4JI7J 2HQFA 2GMHA 3Q24A 3ZZOA 3FBCA 4RU2A 3DRPB 4MT1A 2A6MA 1NMEB 2EBEA 2IAJB 5HI7A 3DLEB 2F4VJ 4HTJA 3CO9A 2HZAA 4DQPA 4QBWA 3CVKA 1CC8A 4I4BA 1TKXB 2BW7A 3SCLE 2QL9B 4OX6A 2OMOA 4OI4A 4R0SA 3WHIA 4KY3A 3H2VE 3J7YU 4G1QB 3K58A 3QYYA 1HBMA 1KHWA 1WRMA 2QA2A 4PG7A 2V9WA 3HSZA 1VQMS 2C2KB 3QIPA 1VFJA 1FKOB 1PGZA 2AJ4A 4XDCA 1PA1A 2ILYA 1IQTA 4FXDA 3W64A 3QCMA 3L7PA 4DV3J 1AZSB 2NXCA 1S6QA 4U96A 4WFYA 2W7AA 1NUEA 1ZCLA 1SJ4P 4LF6J 3WZ0A 3PFEA 5J1EA 1HNIB 4RW8B 4PG5A 1B0TA 1RLDA 4O44B 4Z6BA 3A3OB 2JFFA 3QCHA 3D67A 2VUGA 3N9UC 1O6XA 1RT3A 3MGJA 3MMAB 2I6MA 1UA1A 2E1RA 3Q89A 3ENQA 1FT8A 3OR2A 1E6VB 4ZN3A 3DOMA 2GVDB 3QIDA 1CC7A 4PPZA 4USUA 4M5DA 4JI0J 1CJKA 3QCDA 3GJTB 2Z2LA 2AT1B 3D1HA 3K0JA 4OLPA 2H4WB 1SUGA 1WHVA 1SXLA 3OTDA 4JI8F 2DYAA 2DNKA 5CA5A 2HS4A 1PG5B 4X4RA 1R6VA 2QLBB 4OJ3A 4Z7CA 5FJ4A 3TJ8A 1QE1B 1CS4B 5THWA 4DF4A 1X4DA 3TJAA 1NM2A 3RZ2A 4FXVA 4P73A 5IM0A 4LFBF 2JRSA 1JLCB 1VQOS 2Z4PA 3N28A 3FJ2A 4CLYA 2QA4S 2RQ4A 2AU0A 4IFVA 1CULB 3D6MB 1U2RA 1JLBA 1XERA 1CJVA 3AQPA 4IQMA 2V2KA 4CLUA 1RT4A 1IVZA 3LW5C 4RUHA 3CWJA 1JLNA 4ETXA 2RUGA 4OHEA 3VAKA 5A8WB 3LP0B 1HKAA 1Y9OA 4Y34A 3W9JA 2RHSB 1RZMA 3R3TA 2DGTA 5L38A 2DCLA 2HRTA 2GIQA 2OZ5A 2DRAA 3KLEB 3R5CA 1EKRA 2VG6A 3EJMA 2BM1A 2DNZA 3MECA 3W66A 3HSGA 1SJQA 3Q86A 1YRUA 4A8SA 2OPPB 3I0RB 2YNHB 4JI4F 4WP3A 2XO7A 1QAJA 4GRZA 2CM3A 3MDFA 2D69A 3D68A 4JV2A 2NUHA 5JMNA 1JNZB 3SDEB 1LWEB 3M2RB 2ZBIA 3PXGa 4O3QA 2MDAA 2W8LA 2HXPA 1QSLA 4NCAA 1F9HA 4LUBA 2IMWP 3EE3A 1EP4B 2XPCA 2VEVA 1QLNA 1OEMX 2J5AA 2W7OA 2Q1LA 3SSRA 2DR8A 2V8DA 4WP8A 3QCZA 1C1CA 2QEPA 3Q8YA 1ZPVA 2BDPA 4USHA 8ATCB 2EI5A 3A12A 1LYVA 4GRSA 2X1GA 5E41A 4X4VA 4I64A 3ZZ0A 3HVRA 3DRXA 2H4YB 3HM9A 4WFNQ 2MPUA 3S4OA 1WUUA 1S10A 1RQ0A 5GADI 4H4MA 4DR4J 1U4BA 1FRJA 3MEEA 5EWEA 4WCEQ 2DD8S 3MEKA 1B0PA 3DYAB 2R7XA 1WHXA 2PEBA 1EEOA 2J0QD 2LFVA 4R5PB 3R97A 2XMKA 1NLKL 4NASA 1SPBP 3IO1A 4TY8A 2W25A 4ED5A 3OJSA 2HPUA 4IRKA 2IMOA 3TZZA 2EVZA 1S49A 5EHHA 5J2MB 2EPIA 3S4EA 2ZH8A 5IQ6A 2OI2A 3NGTA 1KHVA 2V4JA 2BXJA 2PSZA 1DTQA 1C1BB 3QKPA 2JEGA 5F3ZA 3KMQA 3F44A 3OL6A 5AXMA 4X4UA 1S1XB 1UPPA 2RJZA 4BC9A 5H9EK 3GP9A 3M8QA 3F73A 5B0GA 3RB4A 1H72C 2IJFA 2IM3A 1U0HB 4MK8A 2KHCA 4RW4B 3DLGB 3IS9B 3ILOA 1SC4B 1FEEA 5CZXA 1ZM3A 4YY3F 4BCAA 2MZSA 2ZKUA 3W65A 2HVDA 5H9FJ 3KJNB 1LW0A 4J9QA 3PJ9A 3DDKA 4QW9A 1R8PA 1N34J 2CPDA 4DL2A 3BO4A 1HQUA 4DR5J 1HLWA 1RCOB 1S1WA 2RF2B 4RKKA 1F9FA 4EWTA 3NEKA 2VOSA 1B4SA 2PA8D 1HBNA 5HJXA 1X60A 3KK3B 5IC4B 1MW7A 2CADA 1I9SA 4UQTA 3TAMB 2J9DA 2VOPA 5T7LA 2DXPA 2VG5A 4ZLPA 4C8ZA 1L3VA 2W8KA 3MOWA 1PJ6A 3H4DA 4A48A 4KYRA 4B3RJ 3RO1A 4FDFA 3M8YA 5IQQA 1S79A 1LWXA 1Z2LA 4BWJA 4NCGB 3R9LA 4TU8A 2I3UA 3GE9A 3GFHA 4PXCA 3EICA 3QO9B 1PYNA 3QAEA 1YPTA 5A0YA 1R0AA 2HHXA 4BBYA 2WVCA 4FKYA 5ETRA 2NZ6A 1ZC0A 1IKYA 2MXYA 1RT7A 2OD6A 3HJVA 2QTWA 1Z4UA 3PNIA 4ED1A 1G3OA 3TP2A 4JI2F 4NLRA 1JJCB 2B9WA 3R2DJ 1NPKA 1JLFB 2GGPA 1WNEA 1TTHB 1RAAB 3DLHA 3PYEA 2VEWA 3QLHA 4DHVA 1UPMB 2CA9A 4ANDA 2HS0A 4ZK7M 1M5PC 5LMUJ 2NT2A 3CO0P 3M2UB 5HK4A 4X66J 1S6PB 3QSIA 2PE8A 2J0SD 2QBRA 1TKZB 2GAHC 3GIMA 2VBXA 3C14B 4NLPA 1WOOA 4NXMF 2V2QA 5LJ3Y 1HWJA 4P7VA 1Y4ZB 4J9VA 4FF1A 2VA2A 5HQLA 4U7UK 5K14B 3PJWA 2XMTA 3DDIA 1N5YB 4ECWA 1OEUA 3BN4A 1H0HB 1KP6A 3AD8C 2LQBA 1RLCL 4GKJF 2FC8A 2BJ9A 3EVWA 4C3MA 3JSBA 5KG7A 2GQQA 3QGHA 2Z2YB 1TK8A 4D3QA 4DQQA 2F6YA 4CO3A 5KADA 3FDSA 3H0PA 4PEOA 3PG9A 2VONA 1UVNA 3IN5A 4X62F 1Q0NA 2JC1A 4KHPJ 1NB7A 1KLNA 1C83A 5C24A 1NK9A 3JS9A 3CMES 2CQDA 4DMZA 4JUZA 2EK6A 3VQTA 4KAIA 3V0IA 3BBCA 2GHWA 2ZVIA 2MLYA 4DX6A 4RW6A 4KGMA 3IMQJ 5K9VA 3GJRB 1KN6A 2I5XA 1HW8A 2UV8A 1T9XA 3QPIA 3GV8B 3MEDA 1Y5NB 4B02A 3ENAA 3B7OA 2MKHA 1MG7A 1RACB 4B3TJ 4WIQA 3M6VA 4NLTA 5JVGQ 3R7BB 3BR8A 1D8ZA 1FKPA 4CO2A 3B8HA 4ECUA 3OFHA 3LTOA 2EFNA 3IAS9 1LEOA 3C66A 2OSRA 5MMZB 2GCBA 4YEAA 4JV5F 1YGRA 1T8EA 2QX0A 3KUHA 1C4CA 3ZNUA 1VQ6S 2HVLA 1XNQJ 1T3OA 3UD5A 3LWLA 2E5GA 1MKPA 4QDIA 1ELOA 1HBMB 3T9ZA 2Y66A 3U1MA 4MTPA 3QKQA 2RS8A 4K59A 3H2UB 2ALZA 1Q53A 2VFUA 3QIPB 4RO0A 2OELA 4GRYA 2HLUA 4IDKA 1PTVA 4WF9Q 3F56A 4RW7A 3HVAA 4JI6J 4P7TA 1HWUA 1S6QB 3NY0A 3PHEA 2DKOB 3MEGA 5E33A 4TXSA 3G96A 4ZA1A 1C0UA 2E29A 1QD1A 2WGPA 1RWWB 1S0NA 1TAUA 2VQEF 2E0TA 2MZ1A 1RWXB 2RRNA 1FFWB 5J1EB 1NNDA 2F4FA 2H65B 2CUYA 1T9TA 4M5LA 2XEXA 2O01C 2ZC3A 4LREA 1RT3B 3FBFA 1XWLA 2AYEA 3VGVA 4A4JA 1DLOA 4UY85 3MPDA 3OR2B 4CO1A 2VQFJ 3UVJA 3DOMB 2APOA 2B8QA 2A3KA 2GMJA 2HHHJ 2I2YA 3QCFA 1I6JA 4M5DB 1S48A 2C3YA 1QAXA 1GMVA 1WDDA 2KG1A 5L39A 2JX2A 1AFJA 2G2YA 3K7RA 3Q0AA 3SIPB 3VGUA 1R3NA 2B4PA 2IA0A 2HBYB 1FCAA 2IPOB 2MZTA 4DR6F 1FX4A 3BS9A 1TUGB 1XBWA 4GKKF 4IFVB 4K0KJ 3AH6A 2C3UA 1BXNA 1JLBB 4M5MA 3CCQS 2RH3A 4ZVTB 1CJVB 4ZVUB 1HD0A 1RT4B 4MJKA 2MMYA 4ZVGA 2C2OB 4MMOA 1H74A 1BQNA 1CG2A 1OEVA 2UXDJ 1Y0HA 1UVLA 4W92B 2R8HA 3SMZA 1FRXA 1N88A 2J9DE 3A8IA 2L3MA 3OW2R 4HRFA 3TUZC 2XG8A 5JVHQ 2VG6B 2C2ZB 4KSEB 4P10A 2I42A 3MECB 1IM4A 2V69A 5LSOA 4F3OA 4FXWA 1KKHA 2ZFHA 5DZ7A 2F6VA 3C16B 2A3JA 3M30A 3T1HJ 4FVCA 5KFHA 1MU2A 2BABA 2H3EB 5KG4A 4NOHA 4K50A 2QDPA 1VQKS 2DHAA 3RRKA 5BR8F 2RVJA 3DOKA 3FQKA 4NL5A 1OS5A 1FFGB 2KI2A 3EZUA 1FJEB 1C1CB 1UJ6A 4I2PA 5KFKA 3NS6A 3R2CJ 3PKMA 3ZTSA 5G0RA 4YUDA 5KAKA 3OV7A 2KB2A 1YTYA 3HDSA 1AROP 2I3RA 4OHHA 1VHFA 3CJ8A 1HHTP 3MMCA 5D4OA 3BQ0A 4H4MB 3FMWA 1QSYA 2Q79A 3PYDA 3GIRA 4DDFA 3MEEB 2RHQB 2CDRB 2YDUA 2YY3A 2RT3A 4L75A 3NOGA 3HXMA 3CW2C 4W4MA 2XY7A 4KHMA 3LWMA 4TY8B 3NWGA 5KT7A 5KFMA 2MJUA 1JK9B 2MGZB 4K4SA 2JFHA 3CD6S 4P2MA 1N52B 4WFAQ 1CJUA 3GYGA 2M70A 5D15A 1RAHB 3WIUA 2NSCA 3ICLA 4OV6A 5T14A 2F8MA 5LT5A 4HT5A 2ATCB 2V4JB 4QWAA 5KFEA 1DTQB 1LKZA 2FVQA 3BYPA 4Q5VA 1QZ0A 2BANB 4WYWA 3C6TB 2R7WA 3RB3A 3UCUP 4USMA 3M8QB 4LMZA 1LOUA 1RAGB 4I6WA 2OPSA 2QFIA 2H03A 3KG0A 4J5OA 4OV1A 2R7QA 1V5IB 5A6WA 4H4KC 4MK7A 4O23A 2CPHA 2OLWA 4WIIA 1R8HA 1T7PA 3DLBA 2G6ZA 1LW0B 1D8YA 2OFGX 2F5GA 5DGAA 2GJIA 1L3UA 3OXFA 3PM9A 2JLEA 1HQUB 2V8HA 1K73T 5KABA 1XJWB 1S1WB 5CABA 2ZH9A 3CC2S 2FVSA 5HLFA 3PW5A 1PC5A 1HBNB 5EWGA 2KYXA 5M2RA 4MYUA 1ZETA 3CUNA 4UW2A 5T7LB 5EGYA 1U2FA 2VG5B 2VB6A 2E1CA 5B0CA 2DY9A 1QUPA 2CNOB 4B3OA 2QGFB 4IRCA 2PMHA 2XGPA 4JNBA 2B5JA 4DUZF 4B17A 3HJFA 1U6BA 4KGVB 3FEZA 1F2HA 3E51A 2KJVA 1HPZA 3EDQB 1UETA 2QEXS 2VHGA 4PG4A 2CMCA 1ULRA 4KYQA 4PXDA 2UU9J 5A0YB 4DBQA 1R0AB 3QJLA 4PZVA 1M5HA 2QLFB 4W90B 2A2CA 3TWZA 1IKYB 2DGXA 2Y96A 1FWLA 1RT7B 1S76D 4YB1P 2BOPA 1HIYA 2D1CA 2LQ5A 2GGPB 4G1IA 3MWBA 4O0NA 2R7VA 1I3OB 5HMYA 4N41A 3QLHB 3SMEA 3PW0A 4GE5A 3MR6A 2YQ1A 4FZVA 1S1VA 1IBLF 3K8VA 2LXUA 4RH5A 4KJIA 2I38A 4KV8B 3BR9A 3NS5A 5ETQA 3HHNB 2CQ3A 2WOMB 3CMQA 1A9NB 4NEZA 1S59A 1SKUB 4DSFA 1HWKA 1M5VC 1ZM4A 3TQEA 4KB7A 2O67A 4OYWA 1TR0A 4D3HA 3O6QA 2H54B 4MKYA 2GO8A 2UVRA 1MROA 4QWEA 1OYEA 3LA0A 5A5FA 4CP5A 2K1RA 2GFFA 1NWLA 5GADU 4JP8A 2X3DA 3EGNA 1N48A 4O3RA 1Q6MA 2ZD1A 3PRVA 3FEXB 1JLGA 3DI6A 4KKOA 3V6JA 3KJFB 5B09A 3RAQA 3IBFB 1VBZA 2RIJA 2J6SA 2ZBCA 4IG3A 3P5TL 4DGPA 4EGLA 5C24B 4RX6A 2AJ2A 1C4AA 3D6FB 3UN5A 4ECYA 3LP1A 5HSPA 4HEA9 4RW6B 5J2PA 1D5RA 2Y2FA 3V5RA 2M8DB 4NA3A 1J4XA 4NWBA 1FD8A 1U8WA 2Y1OA 4EK2A 4LFBJ 4NZ0A 4QR1A 4MFBA 1O0PA 3MEDB 1H38A 4CO5A 1UWAA 1TP7A 3IWXA 5U47A 4AT1B 1UAWA 5HQMA 4YMEA 2PD1A 1N54B 3TARA 2BV3A 5ETTA 2QMWA 3AJ2A 4ATNA 1VBXA 1FKPB 3FBBA 3JTNA 1VQNS 1G1HA 1NZ8A 2DIUA 2QA4G 3TX8A 1Y3JA 3I9ZA 2ROPA 2G1HA 3KHRA 1BZJA 4BWMA 4X4OA 3RBEA 4L73A 2D3UA 2V34A 4K4ZA 2ALYB 3LP2A 1WC1A 1T03A 3GG0A 1Q1KA 1FJ7A 4GO7X 1GFWB 4HI2A 1F9EB 4AL7A 3CCVS 3IC1A 3I96A 3L7OA 2M7SA 4DR3J 2C7SA 3A3PB 3I5CA 4FBTA 4C48A 2HSEB 3V0HA 3SEOA 2RDJA 5A2QU 4RW7B 1P31A 2D3OR 1SH3A 5EUHA 4CO4A 1U45A 3MEGB 1D1UA 2CFXA 4YFUA 1C0UB 1YVFA 1RTHA 2HNDA 3G6YA 4CH1A 4IFYA 1Z1ZA 3SCKE 5FIIA 4MIBA 1C2PA 2B9EA 3CIMA 1QUVA 1JIHA 3VTIA 5IBMA 2BOAA 2CJQA 3OLBA 3IM9A 2YKNA 3QFHA 2C3MA 5KFWA 1MSWD 2CNEA 1KONA 3G82B 2VFTA 4I67A 1DLOB 2DCUB 3J7Z5 2AQ4A 4OZLA 2C22A 3S3KA 3UVJB 2ZE2A 1SH0A 4YHHJ 5CZVA 4ZJQA 2VOOA 5KG0A 3Q2SC 1OY8A 4RNFA 4LF9J 3M8WA 2C42A 2B9XA 3D4JA 1HNXF 1X4AA 4JI7F 4WP9A 1KNZA 1VRTA 2WRMA 3H5XA 4DX5A 3H25A 2GWOA 4ID5A 2E5IA 3VAMA 1X5TA 2KHDA 3AAWB 5GTJA 2U1AA 4A8KA 3N5BA 1RPMA 5HAOA 3A4TA 2JEIA 3K5LA 2C2DA 3NMRA 2JHEA 4XPCA 2F71A 1YWXA 2GC8A 1TL1B 4ECXA 2MQ8A 2HFOA 2KKHA 3SSSA 4FYYB 2G1DA 3ENVA 4USVA 2E5HA 1T02A 3TUIC 3TW0A 2DY1A 4U67Q 4ZLNA 4X4QA 2DTJA 1KR4A 4ZS6A 2VORA 2VZ9A 2Q6BA 1FKAF 1TKTA 3J81j 2M5YA 4OHVA 3GLJA 5F8GA 3DN9A 1BQNB 4CLFA 2NLKA 4XIUA 2CQGA 4FF2A 2PA3A 2WB1D 4Y28C 1V5VA 4DV3F 1JJHA 1T9UA 1KAVA 4ZJLA 1FDDA 1DFDA 2NZ4A 2CJKA 3H42A 4LF6F 4YY3J 1EJ7L 2RKIA 4R25A 3H40A 4H1OA 4WYLA 1RHQB 2KJWA 2AEJA 2DGWA 4UF4A 4Y2IA 1R0BG 1XR6A 3Q2TC 2HBQB 2IJRA 2RB7A 1JJ2R 1WHYA 3M30B 4IKCA 1YTWA 4F2RA 2DB1A 1MU2B 4I56A 4LF5J 2PA5A 1IUJA 5F9LA 4DU7A 1ZAWA 2ZN7A 4JI0F 1XNRJ 5KFTA 4I0WA 3D66A 5J2QA 3DOKB 4OIXA 2YKMA 3N2AA 2D74B 2IVYA 3D42A 4DV1F 3NG8A 1DZ5A 1SH2A 4I2PB 4URGA 5CYQB 1Q81T 2W9CA 1FE0A 4UOFA 3O44A 3S1TA 3HI9A 3K57A 1X4FA 5DG7A 3Q8QB 2PFFB 4LJMA 4V19J 3W5ZA 4N5SA 2VTEA 1Q6PA 3MMCB 3ET6A 1JBVA 4N47A 2BRKA 3VVUA 5CAAA 4EZ9A 1I94J 5E3AA 3OBIA 3QAUA 1NSQA 1OHCA 3JSMA 1L3TA 4ED2A 1SJ1A 4ES3A 3Q8SB 2ZOFA 3NXZA 2X3GA 4MK9A 1D0EA 1CJUB 2YWFA 2Z2MA 4PKDB 4B04A 3S01A 3HO1A 3DHWC 3PR4A 4IH6A 1PYSB 1UW9A 4TLRA 5K8MA 3RGOA 2KRRA 1JQGA 2IY5B 3IBCB 3KG1A 4NA2A 2CQCA 2MYFA 2ASLA 5M2UA 5KT2A 5HL7Q 2BZ2A 2W2OP 1XMOF 4Y3CA 1X9MA 2OPSB 3GTYX 2MQOA 4IO1A 3AY0A 5F0UA 1CQNA 3ZZTA 2B49A 4QW8A 4NYOA 1S6UA 2ASJA 3GQCA 4GKJJ 4URQU 3ZTPA 1NJZA 3D0HE 5DG8A 3OFFA 5L1KA 2XGQA 4DV2J 3I7ZA 2RDIA 3RW7A 4JMKA 3QCKA 4IQXA 3ZM3A 4O3NA 2AW0A 5HLFB 2YX7A 2YH1A 1N56A 2WB4A 3L4BC 6AT1B 2PI7A 3ZM0A 2ZITA 4X62J 3OPKA 2R9LA 2X51A 4DR4F 2MQLA 1NJIT 3WBZA 1WOPA 3GSIA 3HD1A 3TUJC 2P6TA 1FNOA 3KK2A 3CCJS 4UY8T 3DMJA 2IM1A 1M5OC 4B3OB 4QJVA 3G71S 2HAIA 1U1RA 1VK3A 2B5JB 3QCIA 1PILA 3I4PA 5J1PA 1O5JA 4ZPVR 1ZCKA 5B0AA 2DNLA 3CD0A 4J7CA 1HPZB 4ZCMA 1FF2A 2OEMA 2DJWA 2V2VA 3W8PA 3K5NA 4C8NA 1YJUA 4OHXA 4PYDA 8RUCA 2BQ3A 2E5LJ 3CC4S 2XMVA 1WG5A 5E5NA 1OJ4A 2WVFA 2IC3A 5J2NB 1NK4A 4QYZJ 4V1Ak 1X4BA 1I57A 2W4PA 5KFQA 1NO6A 1Q6JA 2HYIB 2XO6A 4JV5J 3OSPA 4OZNA 2DNRA 1VLYA 1YGYA 4UZCA 1S1VB 2VC0A 1V3ZA 1S97A 1H7XA 2ZZNA 1SVDA 4O3PA 3WIVA 2VFRA 4UOGA 3UNGC 1UW4A 3W2WA 3QCCA 4NYHA 3NAIA 1WEXA 3MFHA 4LSNA 3W5XA 4QWDA 2C2NA 2IDEA 1LW2A 4DR5F 2WW8A 1W7KA 1FRIA 1VI7A 1L3KA 1RAFB 5D8HB 2BIJA 1UWBA 4J9LA 1MROB 4NPOA 2W2MP 3Q83A 1BZHA 1FWPA 2K1RB 4C8LA 5GVQA 2DNHA 2VA3A 2ZD1B 1W25A 3PY8A 3L95X 4HL9A 4I2QA 2AYMA 2HZVA 2KN4A 4B3RF 1NKBA 2R7SA 4RUAA 4DV0J 3OLRA 3ZM2A 1JLGB 3MZIA 2CZ4A 3DI6B 4KKOB 2FTRA 4NLYA 4LIRA 1B99A 1Y3KA 3PKYA 3R8YA 1UFLA 2ABYA 2HHTA 4NXNJ 2CMBA 4NLWA 2V50A 4IG3B 2CQHA 5KOXA 4DQSA 3C2PA 2QYCA 2FJDB 2GC6A 2HB1A 4C8MA 2I6PA 3HKWA 1GWZA 3LP1B 3CJSA 5AWXA 3THVA 4P72A 1TL7A 2GNKA 1GMUA 5J2PB 1K0TA 1SC6A 4WTOB 2VFVA 2MSSA 2FVPA 4OYBA 4WXOA 4XK8C 2IDLA 2RE1A 2DRBA 4MFBB 2LA6A 2QA1A 3F9BA 5LMUF 2XSJA 1VIOA 1TAQA 2CPJA 4OYPA 4X66F 3AD9C 2BBEA 5IXUA 4F0KA 2QRRA 4OX8A 2RILA 4CO0A 4DU8A 1PBAA 2FZKB 4DQIA 3ILLA 2XCAA 4IOAQ 3DRSA 1NDPA 3M8ZA 1XTZA 1ICEB 3ISZA 5H9FK 1UEVA 3C46A 1WCHA 3TVYA 4N77A 4F26A 2RQCA 4QBUA 3D3BJ 2RS2A 4YB6A 4QBEA 2W2NP 1WHWA 1FTCA 2LXIA 1H73A 2VF3A 4DCJB 1JLEA 1BQMA 3LP2B 1T03B 5BUGA 3PDNA 3HHLA 1T9WA 4LF2A 2ZM6J 1IQZA 4DPUA 3N01A 1N6QA 3P5BP 4RBUA 2VPWB 1UAGA 2XHCA 2GVDA 1SUQA 4KHPF 4E2FB 1S4FA 3FFIA 2UUAF 1LFPA 3VAGA 2XYPB 3SZ2A 2VPXB 1FRHA 5BR8J 4PQAA 1RTHB 2HNDB 7FDRA 4CLWA 2HHPA 2OOQA 1JNRB 2AEMA 1NK7A 1CJTA 3NCRA 4OI3A 4EEYA 4OMFG 2BGEA 1XEZA 2YKNB 2FHJA 3CJRA 2ZOGA 3ZZYA 1NZ7A 1UP1A 5IOLA 4LVOP 3QCGA 3AXMA 3AQOA 4GFUA 1QAIA 3DCAA 3GCXP 2VEYA 3C6UA 4RL1A 1A0OB 3GIJA 4LRFA 2GHPA 1GX6A 1OIAA 1VQ5S 3RU0A 4B3TF 3GYNA 1IKWA 5K20B 3CIZA 3DXBA 3BB5A 3K59A 5D3GB 3A3NB 1U47A 4ED6A 4QR0A 1WACA 2PQ5A 1RU1A 3D1OA 3PEHA 4HTIA 3P49B 1VRTB 1PC4A 3HX9A 2DIVA 2V5HG 4ID5B 1M1HA 1SBRA 3O4SA 1X5SA 3HZEA 2R2UA 2AX1A 4MKVA 4AFFA 3KLEA 3T1YJ 1XXPA 2J16A 1XNQF 1WEZA 2B7CB 2FJXA 3O1LA 1HD1A 1S9FA 4IUFA 3QMQA 4H4OA 3P96A 1J6UA 3U1LA 1PYTA 2Y1JA 1FRLA 3UAGA 1RTJA 4F4AA 2R8JA 1FHTA 1LK5A 2DXDA 3PO4A 1W26A 3HHEA 2FH7A 4FS2A 4ED0A 3IG1A 4NE9C 2YNHA 2CNIA 3TO8A 2CVIA 2MZJA 1TKTB 3AOCA 2M2BA 1NKCA 3M6XA 4DF8A 4BUBA 2ZH2A 3M2RA 3KWMA 2OFHX 5E0OA 4JI6F 3AT1B 1LWCA 1Q8KA 3CJ5A 3ZL8A 2UXBF 1RXDA 4CWBA 3MUVP 1AFIA 2RKIB 1DJ0A 3BGFA 3IM8A 3KLHA 3GJSB 5GAEI 4JV0A 2XC9A 1YX2A 2I4EA 2BQUA 2B51A 1WDTA 2WONB 2OO4A 2BJ1A 4BUCA 3P8BB 3FK4A 3RYLA 2DH8A 2IRYA 4DWIA 3CWEA 3M05A 3FRZA 4ZVFA 2YKMB 4WKYA 4JB8B 1MWYA 4OYXA 4NLVA 2LP4A 4OL8A 2CG4A 4GVLA 4OHDA 2W9CB 4AL6A 4DUZJ 3PJXA 3G2XA 4U7CA 4B9LA 2P9GA 2ZVSA 4AXIA 1S77D 3K8WA 3MOZA 3AWFA 4LT6A 2NTAA 5KFNA 4K0KF 1CQMA 2KVIA 3B4MA 1NHKL 4ZVSB 2H5EA 3ET6B 4NCBA 2YWKA 4S0MA 3VAHA 1IBMJ 1KOHA 1YBUA 1BMQB 1FPRA 3S6EA 2BR0A 4Q2MA 2J0XA 5CH7B 3JSMB 3Q8VA 2AF6A 2D9PA 1LWFA 2V4RA 2F46A 2UXDF 2H1YA 2E1PA 2P6SA 2ZJPQ 1KSPA 3QGIA 2BEFA 2E9ZA 3V4IA 1NL9A 3ISNC 4CLPA 1IBCB 1IBLJ 4G1PA 3THTA 2C3PA 2FLOA 2NXEA 4X64J 4M5NA 1HNWF 3RR8A 3R5JB 3RW6A 3ZTOA 3OVBA 4IR1A 2VFSA 3BM8A 1AW0A 3T1HF 1VBKA 2AIRB 2XY5A 3L7UA 2QLJB 2QZ8A 3BYRA 5IWAJ 4DOZA 4X4PA 3O4TA 1VMBA 3IWLA 1G7FA 3ONQA 4ZITA 3SQOP 1X9SA 1BC6A 2MEWA 2HFZA 3T9NA 1H2UX 2DO4A 1D9DA 3ZZRA 5KFVA 4ANEA 2YH0A 5HDEA 4DFMA 1JLQA 4DV5J 1FE4A 2AGOA 1W2BR 1L3SA 3BDPA 1E0DA 5DQHA 1RJJA 2XS2A 4C98A 3KK2B 4M5GA 4OZ3A 2XLJA 5AE2A 1Q86T 2F63A 2Z2ZA 2I6WA 3J7ZT 3DMJB 1DRZA 1NO8A 3OTEA 3FC9A 1RT6A 4DL6A 5D0HA 3VCDA 1EHWA 3BGUA 2E7VA 1JWWA 2O1PA 3O8WA 4NLOA 4MIWA 4WZQA 4NLSA 1QVGR 1KTVA 1YJWS 3R5AA 5F0WA 4D3PA 4MIAA 4ZVHA 2OGUA 4M5HA 2RUSA 4YR0A 2XM3A 4OZ1A 2QC3A 3LGMA 4DL4A 5KFJA 3UD4P 2J8AA 3DLJA 2K8GA 1I5OB 1QAYA 1G2EA 2IC3B 3I32A 1R6HA 1QTNB 1IKXA 1XQIA 2B6AA 1YRXA 2P5VA 4NA1A 2IVFB 1G7CB 3TI0A 1ZM9A 4AYBD 1AT1B 3UDEA 2P6XA 5KG1A 2QLXA 4ZPCA 2CKWA 1DQ9A 3G4SS 5IZHA 5HVFA 4GO5X 3EAXA 2OPRA 2J7UA 4LVNP 1SQGA 2UVWA 2OKQA 4E8UA 5DQIA 3IAM9 2VICA 4X65J 2XNRA 1AUSL 3W2WB 2G0IA 2XWXA 1RA6A 5KFBA 1SCJB 2V68A 2KDOA 2EEYA 4LSNB 1OEOX 1RE1B 4DFJA 1X31C 1LW2B 3Q8PB 2CZ9A 2J6TA 2XZWA 4OX7A 1YWFA 3FVYA 2UUOA 3LGNA 1UWBB 3T5JA 3BO3A 2JOQA 1BY9A 1F3FA 5DLGA 4RHGA 5B08A 4I1TA 3WX8A 3G6XA 3L9ZA 2NPFA 3AWGA 3AJDA 1ZH5A 1N0VC 4I2QB 3SFGA 4LFAF 1VHIA 3D9BA 4ZLLA 1WORA 4F36A 4LQ3A 4HYKA 4NZ7A 3VQSA 2UU9F 5I3PA 1CSJA 4A8WA 4B9VA 1WKJA 1HI8A 4U9RA 4C4WA 3MR2A 4TYAA 4ED3A 3P4UB 2QV6A 2I1YA 1RDRA 4UTGA 4B9NA 4K8RA 3N0VA 1E6YB 1WC4A 3ILJA 3CJ0A 3GPAA 1TL7B 4FN5A 2XS7A 4RKUC 5DJBA 2YKQA 3AFGA 3JQJA 3I5AA 3GFZA 1TL5A 2XMWA 3SBMA 3OTCA 5LOQA 1G6BA 3HT0A 1OMSA 3GWCA 1UVMA 3D54A 2XSJB 5BX1A 4PVGA 4FNIA 3PACA 1RWNB 1APSA 1B3TA 3UD3P 2CJYB 4WE1B 2CAJA 3JSYA 2UUPA 1PJ7A 2E9RX 3I0SA 4ALZA 2AJ1A 5D4LA 2ZZMA 3M4UA 3DRSB 2WVBA 4XTTA 5D4PA 2W9BA 4L3KA 2RRBA 3KYLA 3QZ8A 3UCGA 1ROFA 3EM1A 4OHZA 3BSCA 1WI8A 3NGDA 3VALA 2MHEA 5IT9U 3NNCA 3RGIA 4C3KA 2H51B 1JLEB 2EFVA 1BQMB 4OI0A 3ELHA 1TMJA 4CVKA 3H2LA 3HHLB 3MPWA 3TUPA 1RADB 2K3KA 5KFRA 1IWAA 1N6QB 1Q8BA 3NLCA 5ADZA 3UI3A 5I6VA 4HHUA 1SKSA 1S72S 3A1YG 1SUQB 3FFIB 4FNHA 4CNZA 1QY7A 1RWUA 2ZZTA 1FERA 4A47A 2MKKA 3N5FA 5T41A 1FXLA 2MQNA 1WC6A 1H2VZ 4DV1J 4DR1J 4IOBA 1CJTB 1HFEL 5BYQA 2ERRA 3J80U 2G2ZA 2BKPA 3JQMA 1Q5VA 1GTEA 4L74A 3BBFA 1KWMA 4OZ0A 5F41A 2Z0GA 1R7IA 2CQ0A 3C6UB 1OY9A 4L72B 2MZRA 1Q82T 4CLKA 4BLGA 4U8VA 4ZPTR 2WAQD 5KT4A 2ZDPA 4BPCA 1IKWB 2CPIA 5KT5A 1HBUA 1CPZA 3B82A 2LXFA 2LMIA 4EI2A 3EXCX 1G1XA 3QT6A 2HKEA 1KVJA 4TKTA 2W4DA 2Q47A 4FF4A 1WTFA 1YBTA 4CZCA 3R7NB 1H98A 2Z8QA 3OQ2A 1HHQA 3DGPA 2MB0B 5BYSA 1TZ0A 1U1NA 2KTQA 1P15A 3W1YC 2ZKTA 2J16B 1ZM2A 1KQGB 4DL7A 2DITA 4KH0B 3C15A 3MAQA 4DN9A 4DFKA 3NMEA 2FGOA 2MJNA 4H4OB 3BZQA 3OTOJ 1UTAA 2BYCA 3EDRB 1RTJB 4FYWB 2AZ3A 4DR3F 2HWIA 3OFGA 3PS5A 3C16A 5BJRA 2Y3YA 1U7LA 2B43A 3IG1B 1TFYA 3M1VA 3TZYA 3GYXB 3JTPA 4QYRA 1XMOJ 5CD4A 2DR5A 4RWXA 1LK7A 2EBGA 3KNAA 5K8PA 3GB0A 2KM8C 2DGUA 1LWCB 2X7IA 2CNGA 3UE2A 2MQPA 3SR9A 4CCHA 4QAPA 1TU0B 4KBIA 3PYFA 3MD3A 3TOQA 1NDLA 3U02A 3L3CA 3BGOP 1KTQA 4ZPWR 5D0RA 3DC2A 1ZAVA 3KLHB 3LO3A 2WBRA 3KLGB 4YB5A 3G9CA 3KK1A 3ITHA 1VRUA 2I0XA 5J1NA 2R7UA 4CLSA 4NRTA 3KFWX 2M88A 5GMDA 4NEYA 2GW8A 1SB6A 1O5ZA 3QRQA 2HVEA 2YBVA 2ROEA 4YHHF 1VS3A 1TL3A 4KFBA 4LF9F 3G8TA 4CM2A 1EARA 1WJ9A 2FLLA 4B3MF 3OHAA 1WF2A 1X4HA 4ZPDA 3UQSA 4ECQA 3ZV2A 2HNQA 3OXGA 2ZC4A 4LF7F 2WSCC 1ITPA 1VC0A 4RJVA 4HJQA 4IOCQ 4BDPA 2D41A 2L41A 2UAGA 5KFLA 2AMCB 2WHOA 2MGZA 2RMLA 1S1TA 4DSKA 1GNKA 5DS7A 4Y14A 3V0EA 4ILMA 5EHRA 1LQFA 1NSKL 3WQPA 2LDIA 3W5YA 3G6ES 2CM7A 1DURA 4U6PA 4Q0BA 1ZZFA 2BANA 1VBYA 3HP6A 3RBZA 2COLA 2NCKL 5JJBA 3C6TA 4A8YA 5BXIA 1Q4RA 1UZHA 1LWFB 4KYZA 4M63A 3BLUA 4TQSA 3EPIA 4HJPA 4JI5J 3V4IB 5C2CA 1F60B 2EC0A 1VISA 2A10A 4DCPB 1WWHA 1RT1A 5HANA 3ZZUA 4F67A 4KI9A 2F6TA 3NWRA 2UP1A 1VCTA 2QYGA 2HNYA 3BH7B 1R0CB 3EPGA 4LF8J 3I87A 5AE3A 1GQQA 2RDDA 3MPYA 3QCLA 2NQPA 3GILA 4LF5F 4NRUA 4YAAA 1GXTA 3CCZA 4DV4J 1XNRF 2ZMMA 1X8DA 2E7XA 1WG4A 1ZZNA 4NMLA 1RYRA 1YLXA 3GG1A 1KC8T 4ZJOA 2HC1A 3SCIE 1RTIA 4F4XA 3HFKA 3HHKA 4MAKA 2NR0A 2RU3A 2H4KA 3GR1A 4C0BA 2H5IB 4C7QA 2E5JA 4KGKA 3S3HA 3V0DA 3MI7X 3N79A 1U6ZA 2NS1B 4Y2EA 1JLQB 1WG1A 4UOCA 2CXEA 3RRHA 2YKAA 3SYZA 2Y67A 2ASDA 5HVHA 4LBHA 1I94F 4CLTA 5LM7E 3W7BA 2VTDA 1WF0A 5KOWA 1OQ6A 3PCOB 1IWGA 1T48A 2FYXA 4QUNA 4IRDA 2EW9A 3AXKA 1RT6B 2UVVA 2F7VA 3FGVA 4LBPA 2OJ3A 2YWGA 2HC2A 1UJ5A 5I3UB 1TQLA 3T41A 2F6ZA 4TU7A 2XJAA 3RR7A 2B9YA 2E1AA 2I5JA 5CYJA 5C42A 1S0MA 3X3UA 1K44A 4KV8A 1GT8A 2XWYA 1KRPA 2EK1A 2WTZA 1X0FA 1WD6A 2NPIA 2WOMA 4H4KA 2WJPA 3IRXA 2NXNA 2BJEA 2WK4A 1IKXB 2M9KA 2B6AB 1DAXA 2PEHA 5CCLA 5GAEU 3W9HA 4I69A 1HA1A 4TQRA 4ECTA 4NYZA 1HMVA 4NWFA 2OTJS 1NK5A 2FQQB 3U1NA 1QTMA 2R42A 2KZMA 4PG8A 4P6QA 2IM0A 2OPRB 1VR6A 1VOMA 2NYHA 3MTKA 3ZM6A 1MNEA 2F9DA 4U7UD 2UV8G 5J8RA 4BC7A 2CJ9A 2WSEC 2JL9A 4K7QA 4DV2F 3VWSA 5B0BA 2CPFA 1MN9A 1V3AA 2VODA 2N3LA 2KXNB 3I55S 2ZBPA 2ZWPA 4HLBA 4EZ6A 5LXRA 3K5PA 3TVKA 4C13A 4FVMA 3NCQA 3LJ8A 3SXLA 4USKA 3EZ5A 2UUAJ 3MUMP 4DS5A 5KA7A 1HNZJ 4ED7A 2AJQA 4KQZA 1YSJA 2FB0A 3BBBA 2KT2A 3H5YA 3SV3A 5ETOA 5EX0A 4DR2J 1QJHA 1K9MT 2RQMA 4ANCA 2W2QP 1U1KA 2FC9A 3ZZPA 4V19X 3VZHA 3JB9k 3GU0A 1R8BA 2OMLA 3FSIA 2E44A 4PWUA 2ZJRQ 1NBEB 3D0GE 1EIYB 2XYGB 2E5LF 2Y9HA 4EO8A 1VGYA 1UZDA 1PA9A 2HBZB 2MBCA 1SV5A 2IVMA 4ZVPB 2VEXA 2DHHA 3MCOA 1LXNA 3WDOA 2R8KA 3ULHA 1UFWA 5SUHA 1Y5IB 5RUBA 2RQKA 4FP9A 2D7SA 3U96A 2HG4A 2AP6A 2GO9A 2FLPA 2ZDOA 3CCRS 3CJ3A 2DRDA 4HKQA 3BREA 3M9OB 4DPXA 1GFYA 4P75A 3L09A 5DDOC 2Y1LB 3ADAC 2R2SA 3LQVA 1RTDA 5E3QA 3LAMA 4USJC 2DH9A 5IBSA 3I0SB 1DARA 3F41A 5B7WA 1NZAA 3VAIA 4F04B 1W2IA 2CPZA 2W9BB 3BSNA 3N6NA 1OSCA 4ZRTA 2ZH7A 1UJ4A 3M9MB 1Y00A 4Y2MA 2CG8A 2JFDA 2UXBJ 2N7YA 1T11A 4WWSA 3J81U 2OTLS 1G4CA 3PW2A 2HVIA 2LCWA 5KA2A 4C6AA 3BKTA 2H9ZA 4DV0F 3R6GB 4YR2A 3BN7A 4OHWA 4X4SA 4AE5A 2W2PP 4Y6IA 3G82A 3SFUA 4AQYJ 2F1FA 1XMQJ 5DM7Q 3PX6A 2V9KA 5JXSA 1PH0A 3OLAA 4NXNF 3N6LA 1EX8A 1F1BB 4PG6A 1FFSB 4IH5A 3JQKA 4QR2A 2HQIA 3NGSA 3SI8A 4AL5A 2KRBA 2FHKA 2WSFC 2WVEA 3TZXA 2M3VA 3PV8A 1Q95G 4MH8A 4I7FA 3HLUA 3K5MA 4J9OA 2AWZA 3ZMQA 1NH7A 5HP1A 2J76E 2DGOA 2LU2A 5K5MA 4YS2A 1M3GA 1P1LA 2LQJA 3PRBA 1TMMA 4ELTA 2XNQA 4QYZK 2ZJQQ 1F5CA 2FGCA 1TL1A 2K06A 2XLIA 3D2WA 5FLXU 1HQEA 2PI4A 1AB8A 2DT9A 2X1BA 2X5OA 2G4BA 2XI3A 5KA0A 4QIVA 4M5JA 2HQGA 1IJFB 3TEHB 1HBUB 2HQ3A 2FJMA 4P2SA 3VGTA 4GFVA 1SJRA 4EUVA 3G6VA 2N7CA 1OHDA 1EKSA 5I42A 2I9SA 2W9AA 2DPJA 4Z37A 2M52A 1FX2A 2N82B 4HH0A 4F25A 3DGPB 1Q6NA 3DOLA 2Q43A 1N5VA 3CCMS 2GC5A 4EO6A 3C15B 3CCUS 1WSVA 1Q16B 2FJBB 4QIWD 2XBPA 3QWPA 2DNOA 4GVBA 2ZM6F 4ZP8A 2W24A 3GJQB 1HNWJ 4J51A 3AHPA 1YRTA 4F4YA 4RNMA 4OZ5A 3V0JA 3M1VB 3GFYA 2R2TA 3TR5A 3DDNA 2XCPA 2ASYA 4GC7A 3HK2A 3PZPA 3S8SA 4DUYJ 1NKEA 4LQ9A 1YKWA 3FSYA 4B9MA 3UPFA 3RAXA 2VJUA 2R7TA 4PQUA 2KG0A 1B7YB 1REVA 1N4LA 3A8EA 1KFSA 1S5ZA 5ETKA 1HWLA 5CYQA 3KK1B 3ITHB 3E8OA 1NDKA 1VRUB 1GQYA 2IIHA 3G86A 5C25A 4PUOA 4ZN1A 1FDAA 4QCLA 5HVGA 5DDPC 5FDLA 1AXQA 4J37A 3TQ1A 2YWEA 1X9WA 1EQ0A 2CZVC 4Z7YA 2AGQA 3QATA 3T6BA 1TL3B 4KFBB 2UVUA 5F8LA 3R7SB 4KO0B 2EFGA 1UL3A 2BE2A 1PTYA 4QUMA 1T3NA 2UXCJ 1QVFR 1Y11A 3H98A 4HH1A 3EX7B 3M2VA 4GE6A 2NXJA 2NXUA 1S1TB 1C85A 3RJMB 5IT0A 5L9XA 2CVEA 3AOBA 5JUMA 2SHPA 3F99A 4DXLA 2MSTA 1RBOB 3T1YF 1C84A 2AJ0A 3TJ9A 2V2ZA 3NL0A 4K4VA 2OUGA 4TLQA 2AX0A 2CRLA 3HZGA 3TX0A 1BWVA 4Q0BB 5CYMA 3VHQA 3JAMU 1VK8A 1TV6A 4DS4A 1N5TA 3P3DA 3FCWA 2HWHA 2ZHOA 4O3SA 3QFWA 2Y8YA 1F5AA 2PN6A 2EKNA 4YOEA 4RR5A 2EXUA 4QIGA 4WK1A 1OESA 4KRWA 3ZM5A 3CJ4A 5LL6d 3BKUA 1RWOB 4OHIA 1UA0A 5LXYA 4RZRA 4RUBA 4UOHA 1XR5A 4GC6A 1SIWB 4H54A 1RT1B 4JYAJ 1WOSA 4Y2CA 1ZYQA 3BJYA 3THPA 2EFQA 3UW1A 2D3O1 3QQCD 3HVWA 5C5JA 1N33J 4NI2B 2HNYB 2DH7A 2JFGA 1G1GA 3F9AA 1WKKA 1SKWA 4DGXA 3CCLS 4E98A 5KG3A 5C2GA 4NYPA 2EG2A 2F70A 3MFIA 4DPOA 3TAQA 3KLFA 3EVOA 4N8OA 2ZNZA 2AGPA 4G6VB 3ZC4A 2PGCA 4LR9A 4EYHB 1VC5A 1RTIB 5FD1A 4AD6A 2ZHAA 4LFAJ 2LLZA 1GEHA 3I9V9 4ECRA 4N8NA 1J27A 3I80A 3OTBA 2Q6CA 1KOOA 2VBYA 4J9MA 4F2SA 3ZO7A 3HHDA 1KVKA 4PXEA 3LPYA 2QL7B 1S7IA 2AZRA 3HHLD 1PTUA 1IBMF 4HR2A 1RAOA 4RNHA 3T5KA 5J2NA 2MKJA 2IM2A 2Y1IA 2IBKA 4ES1A 4CDIA 5A2QY 1F3VA 4JMJA 2I6JA 2DHXA 1O51A 3AB2B 5GAHI 4I68A 1T9VA 4FS1A 5E2QA 4ZP7A 3KUGA 1SKRA 2F40A 2WW4A 2CNHA 4XPEA 2I5JB 3MM9B 2ESBA 3DU5A 1IM6A 5ETMA 5C42B 1UVIA 3GONA 3MMBA 2I4HA 5DRKA 3MM5A 4WZMA 3KJVA 2FHJD 2KFZA 4X64F 4DG1A 2C28A 2CJXB 1GMWA 3BSOA 3IRXB 1PTTA 2V8PA 2HFUA 1P27B 2C2MB 5EHPA 2CMAA 1LFWA 2P8IA 2MQMA 1A5YA 2HWTA 1HMVB 1NSAA 3OSNA 3M8SA 1Y5LB 5D0EA 5IWAF 2A2DA 4LR8A 3QCNA 1NXIA 2YX4A 1TK5A 5CXTA 2DHSA 3PEJA 3LH2S 2JC0A 1FJCA 2VASA 4LFCF 2FJNA 4WFBQ 4CVLA 1XMBA 2BRLA 2J17A 3GV7B 4DEZA 4O4GA 2YTCA 3EZZA 1BGXT 1PAEX 2DBBA 2V94A 1ZTTA 4J9RA 2MKCA 1HNVA 3UWTA 4DV5F 4HVZA 1RKIA 4OYMA 4CQ1A 1DTTA 3H4BA 3IA0A 3BSAA 5L46A 4R0JA 4OHLA 4J9UE 3KMSA 3JYTA 2E7WA 1KEKA 4LF4J 3GSDA 2XMAA 1URRA 4MYTA 4FPRA 1KDNA 2ZUAA 2N3OA 4YDXA 1S4EA 2ZWOA 1Q8LA 3LF0A 3S7RA 1D9FA 3H8YA 4K4TA 3P6YC 3TA2A 2YNGA 2G9OA 4KPYA 2BV5A 1YFOA 3BKFA 4OQJA 4ZPBA 2QSFA 3FBEA 4J9PA 2JFKA 2GHVC 3V81B 2CPXA 1QSSA 4R0TA 1A7GE 3LOUA 1DQ8A 3OT9A 2F6WA 4KTQA 2BJ7A 4OJHA 1NB2A 3MPUB 2VIHA 2H04A 1YITS 4WXWA 1FRMA 2V0NA 2GA7A 2FY8A 3HVTA 1T95A 1VQSA 4I6YA 1SV5B 1R6YA 2QMXA 4ZCLA 4CIOA 1NWEA 1KAKA 3DLKA 3T19A 4RNNA 1NCLA 1J5EF 1I51B 1XBOA 2U2FA 1T49A 2C1EB 3H59A 5EN1A 3BH6B 4KGXB 1FRKA 3UO0A 2WVDA 2JEJA 2FVRA 3CCWA 1PXHA 2PC6A 1YJ9S 2XI2A 2ZBRA 2OC3A 2PMZD 4X65F 3HN7A 1RTDB 4ZIYA 2DR9A 3D7SB 2Y0SD 3NGUA 1UVKA 4EBDA 6FDRA 1X7VA 2ACYA 1YK9A 2HGMA 3V0FA 5KG2A 3V4MA 1RT2A 4WU3A 2LEAA 1UEUA 2DK2A 1TL4A 2KZZA 4A8MP 3D6HB 6FD1A 5DDQC 2WBMA 2Z58B 4LF1A 3JTOA 1FDNA 4Q45A 3RBDA 3IXQA 3C8YA 3VF0B 1FXRA 2DNNA 3HT3A 5A76A 3CCSS 4PCQA 5A8KA 5ETSA 2GX8A 2PMWA 2H48B 1ZA1B 1LQ9A 2AHSA 1MMLA 3NNHA 1CEZA 3OVAA 1G4WR 1EZZB 1TKDA 4NMXA 2IJNA 3O3LA 1M90T 1P6TA 4FYXB 3O2IA 2Q3PA 1FNMA 3QRPA 1HARA 2QIFA 1NSPA 4OJ1A 3MPVA
chains in the Genus database with same CATH topology
1DQ9A 1YTNA 2HGLA 5D3GA 5KFFA 2C2RA 3G4SS 3WX4A 5KAKA 5IZHA 2KB2A 3OV7A 5F8JA 2VKZG 4G1QA 1ZOTA 2J7KA 4ZMMA 1YTYA 3HDSA 4GO5X 3EAXA 2OPRA 1AROP 2BA9A 2I3RA 3S3FA 2J7UA 3GIIA 4OHHA 4LVNP 1NJYA 2UVWA 2OKQA 1VHFA 4MKBA 1S9GB 4I7FB 5IFMA 4E8UA 5DQIA 3IAM9 3OL7A 5KFUA 1HHTP 3MMCA 5HP1B 5D4OA 2XNRA 1FKOA 2YVSA 3N4WA 3BQ0A 2YKPA 4H4MB 1YQHA 2L08A 3FMWA 3W2WB 1NK8A 1QSYA 1VQYA 4A8OA 2XWXA 4ZDNA 1RA6A 2Q79A 5EWFA 5KFBA 4DDFA 3MEEB 4QZVB 2KDOA 4LSNB 3AB4B 2YDUA 1OEOX 4DFJA 4ZP6A 2M4MA 2YY3A 2RT3A 2VBZA 3HXMA 3BQ1A 1LW2B 2XY7A 3Q8PB 1FTRA 4KHMA 2R8IA 5DLFA 2J6TA 2XZWA 4C3LA 1HQEB 4OX7A 3LWMA 2QBSA 5KFPA 1YWFA 3I36A 4NLGA 1U25A 1D9AA 3I5BA 3FVYA 2LQ9A 5AJ3F 5K24A 2VL1A 4TY8B 1GTHA 3NWGA 3LGNA 1UWBB 3T5JA 3BO3A 2JOQA 3R1HA 1HNIA 5KT7A 5KFMA 4RW8A 2MJUA 1JK9B 2MGZB 4K4SA 1BY9A 4O44A 3CD6S 3IR7B 5DLGA 4ETZA 1N52B 4WFAQ 4RHGA 5B08A 4I1TA 3FNNA 3G6XA 2M70A 4O0IA 1KQFB 1FPZA 4QPTA 3AA8A 3Q8RB 3MMAA 2NPFA 3RAMA 3E01A 5D77A 2NSCA 3ICLA 4M94A 2K7JA 4QPXA 1HL6A 4DSEA 5T14A 2F8MA 5LT5A 1Z2ZA 3TVZA 4HT5A 4RNOA 2DNQA 3AWGA 1E6VA 5I42B 1HBOB 1S6OA 1YTSA 2V4JB 1ZH5A 1N0VC 4I2QB 1JXEA 4DSLA 1BZCA 3SFGA 4LFAF 1YHQS 4QWAA 2Q05A 3S3EA 3PIPQ 2JEFA 4AUKA 3I56S 3Q22A 2DGQA 5KFEA 5F8NA 3DU6A 1DTQB 1LKZA 2IHR1 2IMGA 3NMAA 2FVQA 1XRIA 1U09A 3FQLA 4A8XA 2AD9A 4LQ3A 4HYKA 3DOLB 4Q5VA 1QZ0A 2BANB 5I3QA 2DNMA 4WYWA 1FESA 3C6TB 4NZ7A 3VQSA 2R7WA 4IFYB 3RB3A 3UCUP 2UU9F 3M8QB 2PO4A 5I3PA 4LMZA 1LOUA 4I6WA 1A6LA 1CSJA 5DDRC 4A8WA 4B9VA 2OPSA 1HI8A 4U9RA 4C4WA 4OX9F 3MR2A 2H03A 3KG0A 4J5OA 4TYAA 2EKYA 4KE5A 4A46A 1QE1A 2GQCA 4ED3A 4OV1A 2R7QA 2WTFA 5K9WA 5A6WA 2VH7A 2QV6A 4H4KC 2HC2A 2I1YA 1RDRA 2J9EA 2B4OA 4MK7A 1SL1A 4B9NA 3N0VA 1I9TA 1E6YB 3J81Y 1JF7A 4O23A 3POTB 2WONA 2CPHA 3CJ0A 1JLCA 3FZ2A 3MM9A 3MURP 2YWHA 2OLWA 3DRRA 4WIIA 4N76A 1V9OA 1R8HA 1T7PA 1T05B 1JB0C 4FN5A 3DLBA 2XS7A 4EU0A 2G59A 4RKUC 5LJ5Y 2G6ZA 2ZE2B 5DJBA 3MMJA 2YKQA 1LW0B 4DQRA 1D8YA 3I5AA 5A6PA 3CC7S 3DLLQ 3GFZA 3KTQA 4YDDB 1TL5A 4ZN5A 1IXKA 2XMWA 3QZ7A 2OFGX 5DGAA 2GJIA 3EU0A 1L3UA 3OXFA 3OTCA 3PM9A 3TNVA 5HMXA 4NZ6A 1G6BA 4ZOSA 3V6DB 4PQUB 2I8EA 1HQUB 2JLEA 4IR9A 2V8HA 1K73T 3N0AA 5KABA 1Q7LB 3TYTA 1S1WB 2ZH9A 3GWCA 3CC2S 4DR1F 1U49A 1X24A 1REVB 1UVMA 3D54A 2Q66A 1TVRB 2DNGA 2XSJB 3D1QA 4LSLB 1NH8A 5HLFA 3PW5A 1HW9A 4FNIA 4PVGA 5BX1A 3PACA 4DL3A 2XMUA 4Q8FA 5A8WA 1ONZA 3LP0A 1F5BA 2VPZB 1APSA 2M8HA 2O3DA 3UD3P 1PC5A 1H7WA 1HBNB 2LEPA 4C2MA 5KFDA 5CD4H 3MXHP 2QFJA 4WE1B 3OVSA 5EWGA 3JSYA 2KYXA 5C25B 4PUOB 5M2RA 3I0SA 4ALZA 2E9RX 4MYUA 1ZETA 3LALA 1YI2S 3CUNA 4UW2A 5T7LB 2AJ1A 5FDLB 5EGYA 1U2FA 2VG5B 5D4LA 2VB6A 2E1CA 5E3RA 2ZZMA 4S0GA 2GCFA 5B0CA 1NJXA 2I4GA 3M4UA 2UZAA