3MMJA

Structure of the ptp-like phytase from selenomonas ruminantium in complex with myo-inositol hexakisphosphate
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
314
structure length
314
Chain Sequence
QTVTEPVGSYARAERPQDFEGFVWRLDNDGKEALPRNFRTSADALRAPEKKFHLDAAYVPSREGMDALHISGSSAFTPAQLKNVAAKLREKTAGPIYDVDLRQESHGYLDGIPVSWYGERDWANLGKSQHEALADERHRLHAALHKTVYIAPLGKHKLPEGGEVRRVQKVQTEQEVAEAAGMRYFRIAATDHVWPTPENIDRFLAFYRTLPQDAWLHFHSEAGVGRTTAFMVMTDMLKNPSVSLKDILYRQHEIGGFYYGEFPIKTKDKDSWKTKYYREKIVMIEQFYRYVQENRADGYQTPWSVWLKSHPAKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Myo-inositol hexaphosphate phosphohydrolase
publication title Substrate binding in protein-tyrosine phosphatase-like inositol polyphosphatases.
pubmed doi rcsb
source organism Selenomonas ruminantium
total genus 111
structure length 314
sequence length 314
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14566 PTPlike_phytase Inositol hexakisphosphate
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1690 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3mmjA01
3.90.190.10 Alpha Beta Alpha-Beta Complex Protein-Tyrosine Phosphatase; Chain A Protein tyrosine phosphatase superfamily 3mmjA02
3AWEA 2H03A 3SR9A 1C85A 1ZCKA 3V0FA 4H34A 1OEVA 4Y2EA 4RDDA 3BLUA 2I1YA 2RF6A 2CM2A 4TVVA 2M3VA 1Q6SA 2H4GA 1AAXA 5LXQB 3LJ8A 2AZRA 4DGPA 2NT2A 2QBRA 2AHSA 3QCBA 4GE6A 2F6WA 2J16A 2HNQA 2F6VA 2BV5A 4D3RA 1WCHA 2PI7A 2I6MA 2I3RA 3F9AA 2I5XA 4NX8A 1Q6MA 2HCMA 3QCLA 1OESA 1YWFA 2H02A 3F9BA 4JNBA 2I6JA 2J17A 4ZRTA 1T48A 2Q47A 1LARA 4QBEA 2OZ5A 1C84A 2NZ6A 3U96A 2PA5A 5BUGA 2I4EA 4GFVA 3MOWA 2ZN7A 4HRFA 2B4SA 1SUGA 4IKCA 2QBPA 4GE2A 4RI5A 2HVLA 2NV5A 1T4JA 1ZCLA 2E0TA 1R6HA 3QCEA 1WRMA 4J51A 3D42A 4YAAA 3EMUA 3D1HA 4NWFA 5K9VA 2DXPA 5AWXA 4WOHA 3RO1A 5KA9A 1G4US 1QXKA 2QBSA 1L8KA 4GE5A 2I6OA 2CMBA 2B07A 4RH9A 3M4UA 4HJPA 3S3HA 1YTNA 5M43A 2CM8A 3V0JA 1OHCA 4R0SA 1NNYA 1U26A 3ZMPA 1XXVA 1JLNA 4Y14A 3QCCA 5K25A 3QCGA 3QCKA 2CMCA 1M3GA 2MBCA 1Q1MA 3V0DA 3QCDA 1YTWA 1RPMA 1BZCA 1ONZA 4D3PA 4JMKA 3F99A 4QUMA 1G1FA 1PXHA 2HB1A 2B3OA 2NTAA 4ERCA 2FH7A 2I4GA 2Y96A 3PS5A 1GWZA 3O4TA 2F46A 1JF7A 4R30A 1OHDA 3O4SA 1G1GA 4OHLA 3V0GA 5BZZA 3B7OA 3ZM2A 4PVGA 4HJQA 2CM3A 1YZ4A 4NNDA 4KI9A 1Q6JA 1YFOA 3ZM1A 2NT7A 1XRIA 2H4KA 4GRYA 2QCJA 4NYHA 2HXPA 5K24A 1FPRA 4RHGA 1NWEA 5KA1A 3AWFA 1T49A 5EHRA 1X24A 1G7FA 3EB1A 2OUDA 2VEUA 5KA8A 2GP0A 2VEVA 1Q6TA 4AZ1A 5MMZB 1U24A 2QDMA 5EHPA 4OHIA 1QZ0A 1VHRA 1YN9A 2IMGA 5IBMA 2PBNA 2F6YA 4RI4A 1PTYA 3V0HA 2CMAA 3D1QA 2OOQA 3O4UA 2QEPA 4GS0A 3S4OA 4YR8B 3D44A 1XM2A 2HY3A 3O3LA 3I80A 1FQ1A 2A3KA 1ZZWA 2HC1A 3I7ZA 3QCJA 5KA3A 4GFUA 4BPCA 2JJDA 2BGEA 3EU0A 2CNGA 3AWGA 4WU2A 5K9WA 2I6PA 4MBBA 1FPZA 4KYRA 3BLTA 4QAHA 2PT0A 3ZM3A 4GRZA 2B4UA 1ONYA 5HDEA 5BX1A 5GTJA 1G7GA 1LQFA 1A5YA 1OETA 1PTTA 1PA1A 2ESBA 1G1HA 5IBSA 3SMEA 2ZMMA 2VEXA 3H2XA 2B4PA 3QKQA 1P15A 5KA4A 1V3AA 5K22A 4JBCA 2Q05A 4WU3A 3D9CA 1D5RA 5KA2A 3V0IA 1EEOA 3F81A 2I3UA 3F41A 2H4VA 3S3FA 5BZXA 3CWEA 2QCTA 1J4XA 2FJMA 2VEYA 3A5KA 1KAVA 4QUNA 2I75A 4NWGA 3QCFA 1C86A 3QCHA 2Y2FA 2F6ZA 5KA0A 4DGXA 1PYNA 2I42A 2CNEA 3N0AA 3GXHA 1I9TA 4JMJA 1G4WR 2VEWA 3O5XA 1NZ7A 1WAXA 2F70A 3CM3A 4QBWA 1Q6NA 3D1OA 3MOZA 1GFYA 2CFVA 5KACA 1NWLA 2I4HA 2HC2A 4ZN5A 3I36A 5KA7A 2FJNA 2CNFA 2B4OA 3QCNA 4OHEA 1BZJA 2QBQA 1XXPA 2CJZA 2C7SA 2G6ZA 3GXGA 3RZ2A 4OHDA 4WTYA 4PYHA 4RKKA 3EAXA 1L8GA 3EZZA 2QDPA 1NO6A 2R0BA 2J16B 1YTSA 2PQ5A 4B04A 1I57A 2BIJA 3ZV2A 2QDCA 1PTVA 4I8NA 5KAAA 4ZI4A 1OEOX 4ICZA 2G59A 2B49A 2YDUA 3BRHA 5KADA 2BZLA 4OHHA 1C83A 4QAPA 1U25A 1KAKA 3OLRA 4BJOA 1I9SA 2NLKA 1BZHA 4H1OA 1NL9A 1C87A 3RGQA 4RH5A 4GWFA 2GJTA 4Z6BA 1ECVA 3S3EA 1PH0A 2C46A 1YGRA 3RGOA 1XBOA 1Q6PA 2CNHA 2HNPA 1PTUA 3ZMQA 3S3KA 3NMEA 2H04A 2WGPA 1YPTA 1PA9A 1OEUA 2I6IA 2PSZA 3S4EA 1C88A 1YGUA 5K23A 1RXDA 4KYQA 2CNIA 2BGDA 2SHPA 3QCIA 1OEMX 3OMHA 5J8RA 3QCMA 1EENA 3A5JA 4D3QA 3MMJA 3QKPA 1LYVA 2A8BA 2F71A 2F6TA 2P6XA 2P4DA 5KABA 4R0TA 1MKPA 1OHEA 3V0EA 3ZM0A 3BM8A 2CM7A 2GWOA 4S0GA 2OC3A 2F6FA 5I6VA 1ZC0A
chains in the Genus database with same CATH superfamily
3M8PB 1HBOA 5DETA 3JTNA 3G96A 1ZCKA 4P2FA 1V3ZA 4H34A 3CCUS 4NX9A 2AYMA 2KXFA 2KT5A 1LK5A 4AUKA 4JYAF 2I5JA 4MKBA 3ULHA 1RADB 4DGPA 1WORA 3QCBA 2GCAA 4QCLA 1UWAA 2MLZA 1WSVA 1RHJB 1E6VA 2B4VA 4USHA 2MKSA 2GVDB 2A6OA 2I6MA 1X4CA 3BSAA 2JEGA 2CQ3A 5D3GB 2I3RA 2DNHA 3A1YG 5CZXA 3ISNC 1DZ5A 1L3TA 9ATCB 2HCMA 3QCLA 5A5FA 4ZIVA 3EICA 2W7OA 4LBHA 3TYTA 4S0MA 2FJBB 4OHZA 1SUQA 4QBEA 2BX6A 2A6MA 3WC0A 1VLOA 2Z30B 2F65A 3GG1A 3Q24A 3N6LA 3TNVA 3NMAA 1JJCB 2IRXA 5KOXA 2HNYA 3VALA 1PAEX 1R6HA 4CH0S 4BUCA 4DV3J 3EVOA 3D42A 1NSQA 4ZP8A 2B6AA 3P5TL 3CO0P 3VZIA 2DXPA 1HR0F 4DQPA 4CO2A 3MTKA 1NK8A 1WTBA 2DPJA 2OUGA 1PILA 1LWEA 1YTNA 3MEGA 1Q8KA 2M0GB 1UW4A 5CYMA 2EBEA 3ZZTA 4WP9A 1M3GA 1IKVB 2HZVA 2FGOA 3V6DB 4N76A 3P96A 4KR0B 4IH6A 2EFVA 5DDRC 2VPZB 3G8QA 1LWCB 5AT1B 1PXHA 5J2PA 3FEZA 4NCAA 1M5SA 4DL4A 1RTDA 3HVTA 3H90A 2HG4A 4OI6A 4X4RA 1CBKA 1JF7A 2KO1A 5GADU 3Q8YA 3J80Y 4HJQA 4URSA 1M5KC 3MXHP 3PFEA 5GAGI 2HQ3A 1UJ5A 2IAJB 4KT0C 2ZH8A 1XRIA 1XERA 2OAUA 2DO0A 2QCJA 1FD2A 3OD2A 2HFVA 4GRSA 1CULB 1UWBA 2G2OA 4M5JA 3H5UA 2RF2B 1F5BA 5A6PA 4L75A 3PW2A 1FE0A 2VDIA 1XK8A 2Y67A 2HS3A 2ZVSA 2EKNA 3TAQA 4HI2A 3D44A 3T9NA 1HBNB 3DNCA 3UCGA 4P75A 4CM0A 3AT1B 5HROA 2PIIA 2BGEA 3KMQA 2CNGA 2VPWB 1W26A 3JSRA 4TQSA 4MBBA 3PRDA 3ZZPA 4QAHA 2ZH5A 2CJAA 1MMDA 2PA3A 4NLPA 2RRBA 3VAHA 4PXEA 2R7XA 2BUNA 1OSCA 3SMEA 3ENAA 2NYHA 3QFHA 3V6KA 3D54A 2F9DA 1WG4A 5KFEA 1HNIA 2UV8G 2DH7A 2QCTA 4LSLB 4AFFA 3SV3A 1VRUB 4HACB 1HWLA 1NDPA 1PYNA 3TANA 4WXOA 3R6LB 2I38A 2BQUA 4OJGA 3ZL8A 2KI2A 2VFVA 4DFKA 3CNQP 2ZC4A 3HT3A 3FNNA 3ZZ0A 2HRUA 3KLIB 4ZPWR 5KFDA 2C2RA 3EGWB 5ETNA 4WIQA 4R8UB 2ZHOA 3T1YJ 4X4QA 1UVNA 5D4NA 2HQCA 5DGAA 3K17A 3QT5A 2F4FA 2JEIA 4P52A 3FSIA 2CPYA 1WEXA 2CNKB 2DHHA 2G6ZA 4DV0F 1I5OB 4JI6F 1RT1B 4DV0J 5B0CA 4I2QB 4CNZA 2DRAA 1S1XB 3FQLA 4XK8C 4Z37A 1N54B 1IQTA 3MM8A 4H54A 3W62A 1S72S 4C0OC 4Y2CA 3GE9A 5J1PA 2FJDB 4TYAA 2J7WA 2M52A 4EI2A 2VKRA 1D8ZA 1Q1KA 3ZC4A 1JLCA 3A12A 4ZLPA 2G1DA 1YIJS 3QWPA 3P6YC 2DITA 2FY1A 2HNPA 2HQFA 1CJUA 3RB0A 1C88A 3NL0A 1UZDA 3LAMA 5F8IA 2JDJA 3VHQA 3UW1A 2CQ0A 3C14A 1NSPA 5KFJA 3B6BA 1JLBA 3FUYA 5GMEA 4H4KA 2AEJA 3KMSA 3J81j 3OTOF 1GH8A 2ADBA 3OTOJ 2MZTA 5JMNA 3OUYB 1FESA 4DUTA 1WEZA 1MNEA 3BKFA 4ECYA 3H5XA 1R8PA 2PO4A 2N4CA 5I6VA 1YJVA 3W9IA 3ICLA 3B78A 4B3TF 1FJCA 4CT8A 4B9MA 2ZHAA 3HN7A 1ELOA 1Q5YA 4B3TJ 2YY3A 2CPFA 3H42A 2XWXA 1J27A 2M5YA 4LFCF 4JV0A 4X2BA 2RS8A 2F6VA 4X64J 2YNIA 2BE7D 2Z4PA 2J0SD 4A46A 3BM7A 1HARA 3FKBA 1JJ2R 2AJQA 3K5LA 1RTIA 3EGZA 1SV5A 3MF5A 2PDAA 4ZRTA 2V2ZA 3JXOA 3Q2SC 3DHXA 2GCBA 2BACA 3RAXA 4CLPA 2MQOA 1W7KA 1P3DA 2DGOA 2ACYA 5E33A 2MY8A 3I82A 3QCEA 2HZAA 2MSTA 5B09A 3BYPA 5DG7A 1VHFA 4Y3CA 1G4US 3GWCA 2W7AA 2IDLA 2MSSA 3M30B 2MJNA 3IR6B 2CM8A 2OPSA 2FLLA 2X1GA 3KJVA 5IM0B 1XXVA 1JXEA 1VBXA 4DCPB 5I4MA 2FVCA 2GGPA 4FF4A 1REVB 2XMWA 2XMMA 2L08A 4ZPTR 1FJGF 2ZOGA 1ACMB 4ECQA 2IMWP 5LMUJ 2VG7A 4QUMA 1QAJA 3CT9A 3TARA 4LF2A 1AZSB 3POTB 4ZPCA 2Q79A 4R25A 2PMZD 4CRJA 3M8SA 2V8HA 4LIRA 5K8PA 1ZH5A 4WE1A 3AJDA 3SCKE 1WG5A 4DV6J 3KJNB 4MIWA 5GAGU 1PAUB 2VUGA 2GS8A 4YFUA 3B54A 1NK9A 4KI9A 1EQMA 3BGUA 1RAJA 2HGNA 4CLUA 2CJBA 5EUHA 1XR6A 4EU0A 4OX6A 1P31A 3WC2A 3KK1B 1EETB 4C8YA 5LXRA 5BJRA 4ZCLA 1NK0A 4HT5A 2J7KA 1D3WA 4NXMF 1FFSB 4A48A 4NXMJ 3VCDA 2UAGA 5EGYA 4CTAA 1P1TA 2B9WA 2ZDPA 2XC9A 2KHDA 4DPWA 1RWMB 2QEPA 4UOCA 4ZVTB 3IM9A 1FFWB 4KJIA 3M1VB 2HWTA 1S6UA 2HY3A 3LH2S 1CSJA 4I6AA 3PDNA 2GHWA 2KG0A 3TQ1A 3CMQA 1MMNA 2BZ2A 3P3DA 4KGVB 2DNGA 1N36F 3NEKA 2XMVA 2OIHA 3VGVA 1NJWA 1DTTB 1IKWA 1W78A 3K8WA 1NSKL 1EB0A 3MTJA 3BV8A 1RT6A 2QA4G 1FKOB 1N0VC 1VC5A 1IXKA 3JQKA 3T6BA 5I3UB 4HDGA 2ZD1B 4DPOA 5FDLB 4QPTA 4TQRA 5LSRA 4NLSA 2W9CB 4U8VA 2XGPA 5LJ5Y 4C9DA 1ROFA 3S3FA 4F8RA 4OIXA 2V8DA 3RRKA 4QWCA 1MW7A 4C98A 1C0TA 1F9HA 3LP2B 2RSQA 1BE4A 4O4GA 4WK1A 2CFVA 3NP5A 2HFOA 4ZN5A 3DLHA 3SCIE 3DDKA 3NCQA 4MAKA 2OKQA 3C8YA 4E8UA 2MQLA 1ITPA 5AJ3F 1M5VC 1BC6A 2R0BA 1S1UA 1PYSB 4I6WA 4NE9C 1RWOB 3H2UB 2RQCA 4CVMA 3ZZYA 3IG1B 4ZCKA 2CNOB 4AL5A 3MHYA 4DR1F 3PR5B 4YHHJ 3C15B 3W7BA 1RLCL 1S76D 1C83A 4O3NA 4DOZA 2D9PA 1Z4UA 4I56A 1N6QB 2DHAA 5I3PA 4RPFA 3IA0A 2VH7A 2O67A 2B7CB 2HFNA 1T02A 3CDBA 4CLTA 2CNHA 3ZMQA 1S99A 2OI2A 4C3KA 3R3TA 3IAS9 2G0CA 2UVVA 2RQMA 1SL1A 2FHMA 1H74A 1S7HA 4V19X 1X4EA 1UMJA 5EHHA 5F0UA 1Y00A 3PRVA 3OJSA 4DR6J 5I3QA 4R0TA 1JWWA 2C2NA 1C0UB 1YJTA 1QAXA 4JV5J 2OC3A 3ZFVA 1I94J 4B9TA 2R2TA 3FK4A 1DBDA 1C85A 2XO7A 1FNXH 1IWGA 2IVMA 2DJWA 1KEKA 1LV5A 3WX4A 2XB2D 1HBUA 5KFLA 5ETPA 2FVQA 2NT2A 4ZJOA 2PMWA 4QPXA 3U27A 1CC8A 1WCHA 3QLHB 3HZGA 3D28A 7AT1B 1BQXA 3W60A 2ZZMA 3CIMA 1WHWA 4DQQA 2CDRB 3D0IE 2H02A 5KG7A 3AD7C 4HKQA 3IAM9 3OXGA 4M5DB 4EBDA 3DLGB 5CD4H 2OZ5A 2C2OB 3CD0A 3AOCA 1FK9A 3KLHA 4PXCA 3DLBA 5H1SV 2QEXS 2UU9J 4C4WA 2QL7B 1NHUA 1ZCLA 3I9V9 5B0DA 2D7SA 1NJYA 2KKHA 4DL5A 4JI2F 2IM1A 3CVKA 2CJ9A 5HN0A 4CH1A 3L3CA 4YDDB 3OT9A 2BM1A 1VRQC 2DH9A 2C42A 4J9UE 3MM9B 2MKJA 2F1FA 5K25A 3QCKA 2CMCA 2HRYA 4QBUA 2FUG9 1CPZA 4LUBA 3UR3C 3KDOA 2UXDF 3N01A 1RAOA 4WFYA 3UNYA 5AE3A 4CH7A 1B99A 3DRYA 3UPFA 1X4FA 1HPZA 3DGPA 3ISZA 3PS5A 3OHAA 3O4TA 2LQBA 3O4SA 3MM7A 1SH0A 4DV1J 2LFVA 1VQMS 2IJNA 3IO1A 1HQUB 1S0MA 5HI7A 3QBCA 5LMNF 1TK8A 4OX9J 1JLAA 1ZTWA 4I7FB 3BO3A 1KHVA 1D0EA 4KPYA 4X4PA 2ILYA 1T95A 3W5YA 1T49A 2B51A 3EB1A 5ETRA 3EWGA 1Y5LB 1X5TA 1UKUA 2VEVA 2R7WA 3QGHA 3TJ9A 4DLGA 4NYZA 1TELA 3KLEA 5IS2A 3CJ3A 3HP6A 1YN9A 4NLOA 1VQPS 4PCQA 3ZO7A 3RJMB 1F1BB 2F7VA 2OOQA 3BGRB 2IVYA 3QJLA 1KC8T 2IM2A 2P2CB 3OTCA 4X65J 2DNMA 1YTYA 4P71A 4LJMA 3A8IA 4E0DA 3GIMA 4LF5J 3U7JA 4GKKF 2JJDA 1HWJA 4HHJA 1NO8A 2OEKA 3DN9A 4FZVA 5EN1A 4J9PA 2O3DA 1RT5B 1TU0B 2ZH2A 1G1HA 4ZLNA 1LFWA 2ZMMA 4OMFG 3OL7A 1JLGB 1REGX 1Q86T 5AXNA 4HR2A 4CM2A 1X4GA 3D9CA 1D5RA 5CCLA 1UCNA 3Q86A 1EEOA 4ED8A 3OFHA 2H4VA 2Y68A 1K8AT 2Q1LA 2RNEA 1GTEA 7FDRA 3A5KA 3NGSA 4QUNA 5DLFA 2WHOA 2M88A 4QW8A 2XLKA 2I42A 4D3GA 2FZCB 4F4ZA 2ZZNA 1X9MA 1UPPA 1VOMA 2UUAJ 3FBEA 2KFZA 4W90B 4IOAQ 2F70A 1LWXA 3UAGA 3Q2TC 3OVSA 1EIYB 3OFFA 4XPCA 3GFYA 2IRUA 4ER8A 1VMBA 4JB8B 2I0XA 4FXDA 4RBTA 2JFFA 4Z7CA 4BDPA 2UXBF 1VRTA 3OL9A 2HGLA 4PYHA 2M8HA 4DR2J 2XMKA 1YGYA 3FSYA 2QN6B 2Z57B 1PTVA 1UL3A 3K5MA 4CZCA 2OSRA 3S7RA 2YNFB 3S6EA 1FHTA 4ELUA 4U7UD 1FNMA 1RT3B 1RWKB 2UP1A 3MR2A 3H40A 2ZBPA 5A2QU 3TEGA 1F60B 2ZDOA 3N2AA 4URQU 1QD1A 2J8SA 4DDFA 5J2NA 2LQ9A 2H65B 2RUSA 3GJQB 1PTUA 2JLFA 3MMAA 4M5GA 2U1AA 2H04A 4H4OB 1Q53A 3BSOA 1XBWA 1RU1A 2B8QA 4IRDA 2RU9A 2BGDA 2CQDA 3UN2A 1UVIA 3C6UA 3MMJA 4MH8A 4RBUA 3GMGA 2WSEC 3SIPB 1P9QC 4NLYA 3NS6A 2DNRA 5KT3A 4S0GA 2DNQA 2HMIA 3I32A 2ZJPQ 1N5TA 2HW3A 2CM2A 4TVVA 4CQ1A 1TFWA 1Q6SA 5ETMA 4ILRA 2FDNA 2AZRA 2HK3A 4XIUA 2H5JB 4OYAA 1RBOB 3M2VA 1TL1B 3I0SB 3EZ5A 3R7BB 5HATA 2F63A 2JVRA 2UZAA 1QAYA 3MM5A 4LSNA 4MKAA 4W4MA 1A7GE 2FVPA 1RT7A 4QR1A 1IBKJ 2PMHA 1WDTA 4TLRA 3E01B 3D9BA 5DG9A 2YKNB 5KFIA 1UVMA 3CJKA 1NPPA 4OI4A 1YJ9S 3TEHB 1B4SA 4IKCA 1NH7A 4WTOB 1WHYA 2NV5A 1T4JA 2E0TA 1WUUA 1S12A 3D1HA 2Y1JA 3C6TA 4ZVUB 4Y28C 2ZH6A 1R7IA 1RB0A 4PXBA 4LQ9A 4LIWA 2R42A 4QIEA 4HJPA 2YWEA 4JI1F 1BQNA 1OHCA 3TA0A 2LQJA 4DR3F 2Y1OA 4MFBA 1VC6A 4J9LA 4EZ6A 1YTWA 4DSEA 4WKYA 1F9FA 4D3PA 3RAMA 1FF2A 3I5BA 4KBIA 1G1FA 2QLFB 3RBEA 3LPYA 3BYRA 1T94A 1RAIB 4MIAA 2HAIA 2YQ3A 4C8NA 3EDQB 1OHDA 2J5AA 2E7WA 4F4YA 3K57A 1IKXA 3OV7A 2CPXA 2V4RA 4PVGA 4JI7F 3H5SA 4NNDA 2GIFA 5IC6B 4XDCA 4JI7J 3D0GE 3JAMU 3MI7X 3SQGA 1OMSA 2RILA 4GRYA 2M8DB 5GAHI 2L9NA 3BPSP 4ZVHA 4ETXA 1FPRA 3W8GA 3AY0A 1T7PA 4LFAF 1T9YA 4DZ6A 2FJWA 4BHQA 2CG8A 2QDMA 2YKPA 1HFEL 4NI2B 3RGIA 4OHIA 2XI3A 3TZWA 2BR0A 2I6WA 4ZHRA 1S1VA 2AIRB 3W61A 5KFWA 1X8DA 5L9NA 1KLMB 2XEXA 1K1QA 2Y66A 1JKHB 1NB2A 3HHKA 3HHLB 3UCUP 4K7QA 3TX8A 3I4HX 5C42A 2XLJA 2R7RA 1RLDA 3M6WA 3SQOP 1V3RA 2QA2A 2J7UA 3R2DJ 5BX1A 4ZN1A 1MG7A 2M9KA 3VAMA 2ESBA 1SC1B 4J9KA 1ZA1B 4PWDA 4ED2A 3C16A 2B4PA 4KFBA 4E98A 2UUCJ 2F8EX 5KA2A 3F81A 5B0EA 2KVIA 4ED5A 3M8PA 2OPQA 3A3PB 2DNKA 3C2PA 3CWEA 2NXCA 3H0PA 2B56A 1DFDA 2DRBA 2CA9A 1G4WR 5MLCV 3QRRA 3DDIA 3H4BA 2GVDA 3HK2A 1W7WA 1LFPA 1JLFB 2VU5A 1XMQJ 4G1QA 3TO8A 2CAJA 2JLEA 5EWGA 2ZNYA 4TXSA 3NCRA 2ROPA 2B4OA 3KUHA 5F8NA 2CNNB 1XXPA 3T41A 1PG5B 4ILLA 5A0YA 5F8MA 2DNOA 3HKZD 2NS1B 3JSYA 2NXJA 2LEAA 3GPAA 4GO5X 4XAKA 2F00A 5IXUA 1SJFA 1F3VA 3I0RB 3GILA 4DX8H 3KXDA 2CJQA 1N48A 1ZBTA 2W8KA 3DKDA 1OY8A 1HNVB 3T19A 1K73T 2WBRA 2HGMA 1U2CA 4HHHA 3V4MA 3IS9B 4TU8A 5KFQA 4LFBF 2HQDA 1SKUB 4B9VA 1XIQA 2JL9A 3H98A 2RD5C 3V6DA 1AXQA 1K0TA 2NSCA 1YGRA 2R7QA 1Q6PA 2RKIB 5D0EA 4TU7A 4F36A 1YPTA 4B9LA 2JH3A 4KGXB 3TUPA 4KYQA 3OR2B 4BUBA 1NSAA 2HNZA 4D3QA 1WD6A 4DG1B 3AXMA 3BS9A 1FDDA 3W5XA 1SXLA 2RJZA 2F8MA 4DR7F 2ZH7A 4LBIA 3V0EA 1AT1B 2LKZA 4IQXA 3GTYX 1HNXF 3MPWA 4DR7J 1V3SA 4DV5F 2VQEJ 2NXNA 2MXYA 3N6MA 1XNQJ 2AJ0A 1JBVA 5K8MA 3V0FA 2VASA 4J9SA 2VPYB 4KTQA 5HQMA 4NLTA 2QA1A 5LXQB 3NRSA 1E6YA 5HK4A 3LQVA 2XYPB 2X3DA 5LSLA 3W2VA 4GE6A 2F6WA 3FDSA 4EEYA 4NL5A 2ZM6J 3MURP 4B3OB 3Q22A 4PQUB 2AT1B 2I5XA 2C3YA 5E5NA 2XTJP 1WSRA 1KP6A 1KR4A 4WJBA 3IGVA 4NWBA 3IR7B 4K4SA 3EPIA 3IN5A 5HLFB 4CYUB 1C84A 2NZ6A 4RW4B 4NPOA 4M5KA 2YQ0A 4F2SA 4DR4F 2DTJA 2UVUA 4M1KA 4IUFA 2OMLA 5ETQA 3EVWA 1U1LA 1M1GA 4P7TA 5IT0A 1M5HA 4B3SF 1VIOA 2R3VA 3MFHA 1L3UA 4ED3A 4OYBA 5C5JA 1TKZA 3CC4S 3UO0A 2I6OA 3GYNA 4OJHA 2ZZTA 3M32A 4NOHA 2W7PA 1G6BA 1TV6A 4R0SA 4HACA 3OTBA 1FX2A 4UT4A 2GA7A 1KN6A 2OEJA 3IBWA 3IMQJ 4KH0B 5HJXA 3QSYB 3MUTP 5JXSA 2VG5B 2EVZA 4DV7F 3N79A 1O5JA 3LANA 1RHMB 1CJVA 3VAJA 3J81U 1WF2A 2I1RA 1O6XA 1HYSB 3B7OA 4K59A 3PYDA 2LA6A 2CM3A 1YZ4A 3CCLS 1U7LA 3MCNA 4IDKB 1TMMA 1WC6A 4A8WA 1H2VZ 1S59A 2H4KA 1U8SA 1S1XA 4HT7A 3AWFA 3MPUB 2QFIA 4RUAA 1NAQA 3ZZUA 3ZZRA 4AZ1A 2ABYA 4RUCA 4MYTA 2DR5A 2BKOA 3DOKB 4Q44A 4YQWA 3L7UA 4RI4A 3ENQA 4LR8A 3HHDA 4GS0A 1KTQA 1RK8A 2UXCF 3GJTB 2E1RA 5CD4A 2MGZA 4BC7A 1ZZNA 1FDNA 4DL7A 4UQGA 4WU2A 1KS2A 4JOUA 1RT4B 1WOOA 2PEHA 3EDRB 3SSRA 2GQ2A 3DOMB 2RS2A 3PHEA 2WBMA 4HLBA 3BSCA 4RW9B 2FLOA 3JSMA 5HDEA 2DY1A 3RRHA 1KTVA 3KLGB 2V2QA 4CO1A 1GQYA 3E51A 1Q16B 5K8OA 3H7HB 3OUYA 4O3OA 1LWFB 3IRWP 1HQEB 1IWAA 1VYAA 2GMLA 2FLPA 3CJTA 1H3DA 1HHTP 4OYIA 1Y11A 3AQPA 1EJ7L 3MWBA 1U1MA 5CZVA 2YWGA 2V34A 3E8OA 3GSDA 1S9FA 2C2MB 2CPEA 1UEKA 5IC4B 1O5ZA 2FC9A 3GYXB 1NKEA 5HL7Q 3G8TA 4TU9A 3MOZA 3ZNUA 1GFYA 4GMKA 2KRBA 2RMLA 2GQCA 2WCXA 2HC2A 5KA7A 2EW9A 3DLLQ 3QCNA 3W9JA 4LF8F 1FRHA 4L74A 3NOCA 3EYZA 1FRJA 3NGUA 3RZ2A 4LF8J 4OHDA 3KG1A 4LBPA 3UD5A 1Y9OA 4D3HA 3EAXA 4P73A 2XZDB 1YJNS 2LXIA 2J16B 1TL3B 4P10A 2WVEA 2MTLA 2WVFA 1WC1A 3MOJB 3UI3A 1VHIA 2FHKA 4IG3B 1M1KT 2BJ7A 2G59A 2V8PA 5A8KA 1UFLA 1J6UA 2GCFA 4ZDNA 3M30A 4USTA 2AGQA 2XGQA 2W2NP 1LXJA 3HDSA 2DXDA 4AD6A 3Q8UA 1F5CA 4WFZA 4F02A 3RGQA 1U0HA 1UVLA 2R2RA 4N56A 2HVIA 1ZM2A 3UWTA 4OI3A 2E7VA 4O3SA 2I6IA 3POTA 3QYYA 1WTFA 4BS2A 5HVFA 1VBKA 1PCAA 3IBCB 1BD6A 3GV5B 1SC6A 4ID5B 4DQRA 3CPWR 2XMJA 3QRQA 1JNZB 2DGWA 4J9QA 2FYXA 1U49A 1T05A 2UUWA 1ZC0A 3KK1A 5JVGQ 3SR9A 4OX8A 4MYUA 3T5HA 3DLJA 2FZKB 5HP1B 2PD1A 2O5DA 5IT9Y 2FGCA 1Y3KA 5E7OB 2EXUA 4C7QA 1Z2LA 4DX6A 3HHLC 1ZM4A 4DBQA 2RHSB 2Z0GA 4D3RA 2QL5B 3VQTA 3T5LA 2UUTA 3M1VA 3WDOA 2YWKA 4NCGB 2BW2A 5FIIA 2N3OA 1PBUA 3KFWX 5A5EA 1T48A 1IBLF 4QIWD 1RP5A 1WI8A 3L4BC 5K20B 4KB7A 3V4IB 1IBLJ 2QZ8A 3DU6A 2LYVA 4QDIA 1RWVB 5H9FJ 4K50A 4LF6F 2OO4A 1DTTA 4EBEA 4M8LA 1WKKA 4LF6J 4FYYB 1GMWD 4IH5A 1VFJA 2BW7A 2CPJA 4QZVB 1XNRF 2GC6A 5K9VA 2QJ3A 2QL9B 5KFYA 2CPIA 4A47A 1RYRA 1R0CB 3OTDA 2W9CA 3FEYB 3F0NA 4YN3B 5T7LB 4JI0J 1U1KA 3IGNA 2XM3A 1QE1B 3SDEA 1FERA 4P9SA 3QCGA 1RTHB 4HV4A 1TL7A 4NYOA 1T9UA 3V0DA 3MEKA 4Y2MA 3U1NA 4A4JA 4LF4J 2XWYA 4IFVB 1S6PB 4JMKA 1X0FA 2IYIA 2DCLA 1TTHB 3I55S 2OEMA 2HHQA 2LMIA 2POKA 2D3O1 1YG0A 2B9EA 2OD6A 3VV2B 2HHHJ 4Q8EA 2X51A 3Q8PB 3HLUA 4EUVA 3LO3A 3ZM2A 4CWBA 2ADCA 1IUJA 2ZUAA 3MMBB 2N7CA 2X7IA 3FFIA 5HMYA 1SPBP 3T1HJ 4A8QA 1U0SA 5K14B 2JJ4D 3UDVA 2GJ2A 2P8IA 1FXRA 3CJ8A 4I4BA 4RNOA 3C15A 2VV5A 4ZITA 1S9GB 5IBMA 1N6QA 2XO6A 3O4UA 4YR8B 1VK3A 4QF5A 4OHYA 4UUWA 3ILIA 2V69A 4WK3A 1SC4B 1FKPB 2HC1A 1S1TA 3ETMA 4ES2A 5KA3A 2VKZG 3G6XA 4PWWA 2XMTA 2HBQB 5AXKA 4RNMA 2PGCA 1Z2ZA 3ZM3A 4FDFA 2WTZA 3CULA 4PR6A 2AKWB 4ZP9A 3LF0A 4MK8A 5EWEA 4EBCA 1C0UA 4X4NA 1RGVA 4R5PB 2I3UA 3ITHA 4WWSA 1RTZA 1FRXA 2HVZA 1FWLA 3HVWA 1J4XA 3PO4A 2NYIA 4KE5A 1S7IA 2EC2A 2KVQE 3IP0A 4FYVB 1SJQA 4IFYB 2ZNZA 2ZBIA 3GXHA 3DRSB 2MB0B 2FQQB 5J2MB 3M8QB 4DPTA 1X5OA 3CM3A 5GMDA 1WG1A 4FKXA 1OO0B 1G4CA 1HMVB 5DM7Q 2F8HA 1RBAA 1HBOB 5GMKa 2UUPA 1S0OA 4OHWA 1L3KA 2XY6A 4RJVA 3FGVA 3VAKA 2AYBA 3DLGA 2XSJB 3RTVA 2GIRA 1YHQS 4KHPF 2AP6A 4EO8A 1XMOJ 1D9AA 1I57A 2HPUA 3L7OA 2YPZA 4QU6A 4NXNF 4ZP7A 1OEOX 3T5JA 5F3TA 4O3RA 3RRGA 2QG9B 4C13A 4QIGA 4RR5A 3BRHA 1VQLS 3FCVA 5F8HA 4JI5F 1SUQB 3BB5A 3NAIA 1RZMA 2VBXA 4JI3F 1N52B 2J9DA 3MM9A 3CJ5A 3GG0A 4KO0A 1GXUA 3RB3A 5D0GA 4Z6BA 1NRKA 4Q5VA 1RABB 1Q79A 1RHKB 2B6AB 2DRDA 4ZJQA 4FVMA 3PW5A 3BN7A 3BDPA 2FPHX 3QAUA 1EARA 3LP0A 1I1GA 2CNIA 1LWEB 4C8KA 3MEGB 3PIOQ 4K0KJ 4AT1B 3A5JA 5CYMB 2RHQB 1UVKA 2F6TA 2DISA 2CADA 2YKQA 3ZM0A 1Y4ZB 4ZVEA 3W3SA 3NXZA 4F25A 1K47A 1KVIA 2F5GA 4AL7A 3VQSA 5J2PB 4RDDA 1OJ4A 4UY8T 2I1YA 4WF9Q 1FJEB 3MEEA 1QSYA 4HVZA 4DHVA 2EEYA 4X66F 2AHSA 5FD1A 4WFNQ 4CT9A 2CWXA 2HWIA 1TL5A 4CO0A 2E5LJ 2J9DE 4B9UA 3D7SB 2QSWA 4K2XA 1DURA 4I1TA 5DGBA 5KOWA 3DLKB 4CIOA 4NX8A 3K59A 4QIFA 2W2QP 2V4JB 3K58A 4FXWA 5DM6Q 1UWBB 1RE1B 1FO1A 4RX6A 4B9NA 4RW6A 2L41A 2YX7A 2GAHC 1P1LA 3FBFA 2HVLA 2JEJA 2RT3A 2W2PP 3D68A 4NLWA 3QJJA 4NLQA 2DR8A 2HFUA 5HROB 5KG2A 2CMBA 5AXLA 2DEJA 3BO2A 3M8WA 1WWHA 3DMJA 1KVJA 1K1SA 2BXJA 4TYBA 1CQMA 2RUGA 4PKDB 1JLNA 1C1CB 3OVAA 3JTOA 2UUBJ 2CQCA 1M0SA 2FVSA 3DM2A 3ET6A 2CZ4A 2J6SA 2QO3A 1U1PA 3TAPA 2HB1A 2PFFB 3FCWA 4ZVSB 2BOAA 1X5PA 4F4XA 1RACB 2K8GA 2BRKA 2KHCA 4QWBA 2C2KB 2IYGA 1SIWB 1NH8A 1RYSA 2FY8A 2ZFHA 3BKUA 1TK0A 1XQIA 3H20A 2NT7A 2SXLA 5KFXA 1WELA 4RHGA 1H98A 4OYOA 1FRKA 2YNFA 4O0NA 1BQMA 2EWHA 3GP9A 1Q8IA 1MSWD 4LF9F 1X9WA 3GFXA 2DNPA 5EHPA 2EKYA 3OFGA 3CD5A 2LCWA 1RT3A 4ZVFA 2V9KA 2PBNA 1S48A 6AT1B 3D0HE 2FZGB 2G1HA 4RBVA 2CPHA 5KG0A 1OY9A 2P9GA 1ZZWA 1SKWA 1HL6A 5A8WA 3I7ZA 2QLWA 1V6HA 3QJPA 5KFNA 3M6UA 1VIXA 3AD9C 4H4OA 1BXNA 3MM8B 1HNZJ 1NEEA 1KOHA 3R2CJ 1BY9A 3ZTSA 1KQFB 1D09B 2MKYA 3O6QA 1BGXT 1S9EA 2RH3A 5FLXU 4ECUA 1RKIA 4OV6A 1JLCB 3VTIA 2AGPA 1AB8A 1HNWF 1N5VA 3H2XA 5E3RA 3FRYA 5LSOA 2K3IA 1VK8A 2NCKL 4WKRA 2C2EA 5HVGA 4JI8J 1C1BA 3K89A 1CJUB 2X1FA 5KTQA 2HKEA 5M2PA 2LDIA 1JLBB 1NZ8A 1UTAA 4YY3F 2CNEA 3N0AA 5DJBA 4JV2A 4ED0A 1X0PA 3QZ8A 4JMJA 1W2BR 2QSFA 3O5XA 5E2QA 3AFGA 1S57A 1JNRB 3HXMA 4J90A 4LSZB 2R9LA 2C28A 1URRA 2J0WA 1VQ9S 2YNGA 4F4KA 1PC5A 3I36A 3E01A 2K7KA 4DLEA 2XY5A 3G82A 2GJFA 3T1AA 1YRXA 3PJWA 2VJVA 3UD4P 3K5OA 4P7VA 2E5HA 2BANA 1SI9A 2R4FA 4ZPDA 1RWNB 4WFBQ 2YNIB 2R7UA 4Q45A 3HULA 1Q7YT 5KAAA 2HIYA 4ZI4A 2R7TA 1MN7A 1RTIB 1SV5B 1HKAA 2OELA 3GZ7A 1HI1A 3Q8SB 3VR1A 4AQYJ 4DV3F 1VJWA 3M7VA 3W1YC 1GX6A 3OHBA 2H5EA 2FHJA 4MMOA 4LRCA 1ECVA 3SZ2A 3HKWA 1QUVA 3BDEA 4NLDA 4AE5A 2Y1IA 3CCRS 4UZBA 3JSBA 5CYJA 1GK8A 2CQ4A 3W64A 2HQIA 2SHPA 3WBZA 3QCIA 1H6KX 3GV7B 1NK7A 2OPSB 2DO4A 4DU8A 1LYVA 3KJVB 4L6V3 4QYZK 2Y0BB 3PYEA 2GGPB 4DUZJ 4OYMA 4YR2A 4U9RA 1QSSA 1T11A 4OJ3A 3D5MA 2VG7B 4PYDA 4P74A 4ZPVR 2QC3A 2BE9B 3UNGC 2RVJA 3Q8QB 2X5OA 2J0QD 3BSNA 1GFWB 3HMJG 2YKMA 2M3VA 4NI2A 4ZVRB 4ZP6A 1VQ5S 1B0VA 3A3OB 3MPYA 1Q8BA 3Q23A 1TKXA 3K0JA 3QSIA 3SBMA 2XMUA 1DARA 3MR6A 1NNDA 3DRPA 1KLMA 2U2FA 3Q0AA 1JKHA 2QMWA 3BJYA 2DHXA 5H9EK 3RBDA 1YJ7A 3HHLA 4ZOSA 1YJWS 2BE2A 4RW8B 4BWJA 3TR5A 4FS1A 1YZ6A 1N34F 2IMOA 4F3MA 3Q8RB 1N34J 7FD1A 4CTAB 3J7ZT 3M9NB 2CQBA 1T8EA 5DDPC 4G1PA 3ZM6A 2V9WA 1WRMA 2GHVC 3OLBA 3NBPA 3NGDA 5CYQB 5J1NA 4Z7YA 4K4TA 2NQPA 4WOHA 4EGLA 4PG5A 3H4DA 3H2LA 1L8KA 2BQRA 3QGIA 2WONB 2GO9A 3SYZA 2AQ4A 3CCSS 2ZC3A 4ELTA 4CLLA 2LVWA 3KLFA 4CO3A 3KWMA 1VQ8S 3KK3B 4UY85 3R97A 1RT6B 1RPMA 5JVHQ 2M2BA 2HNDA 1UEUA 4FNIA 3IXQA 3KOAA 5ETOA 5D4PA 3QQCD 4DF4A 1X4HA 1UEVA 2NLWA 3GJRB 3J80U 2ZH9A 4EMDA 3LOUA 2V0NA 4K8RA 4O4RA 1AUSL 5HMXA 4DUYJ 5F8LA 2AYEA 2BKNA 2P9CA 1QTMA 5HANA 2KYZA 3V0GA 4N8OA 1U1OA 2E1MC 3T5KA 1QM9A 2CJYB 3HVAA 2CJXB 1N5YA 3MECA 3T1YF 1C0TB 1URNA 1FTCA 3OTEA 4O4GB 2H51B 2HXPA 2AJ1A 2BABA 5K24A 2LQ5A 1HIYA 5KA1A 2RQKA 1X24A 2Q6CA 1OQ3A 3HF5A 2ZITA 2OUDA 3S01A 3SSQA 1GAOA 3EM1A 1T3NA 2R7VA 1NCLA 2H3EB 4Q0BA 3RG6A 1YQHA 1T9WA 3CGIA 4DZDA 2LU2A 4B3MJ 4L73A 1NJIT 3G6ES 1DQAA 1GEHA 1WEYA 1S1UB 5L1LA 2VA2A 1VS3A 1YX2A 5LXYA 1TQLA 3WZ0A 3BGOP 1N56A 4GFUA 1WC4A 4Z2XA 4O44A 3US5A 4RO0A 4KYRA 2QMUB 3TZZA 3EGNA 2VTDA 1ONYA 4L3KA 3QIPB 3HFVA 2Z2LA 2LU1A 2DKOB 2VEXA 5IV4A 4U6PA 3QKQA 1V3AA 1SQEA 2I8EA 3V0IA 2MKIA 2FHOB 1TP7A 2IA0A 4KSEB 2BM0A 2KM8B 4UQTA 1C86A 4HTJA 1QUPA 3BR9A 3KK2A 5CXTA 4MIBA 2CJKA 2A2DA 4A8YA 3MEDA 3V6HA 1YRUA 2Z58B 1JB0C 4F3OA 2ALZA 4EO6A 1Q6NA 4U67Q 4XPEA 3Q89A 4NA3A 2QRRA 2C22A 1QDUB 2ZH4A 1XJWB 2IRYA 5E3QA 4OHEA 4YMEA 5HLFA 5C24B 4X64F 4RW4A 1NUEA 3G87A 3QMQA 1T9XA 1HBUB 3W65A 3EX7B 3RW6A 4CLKA 2ZBRA 2D9OA 4IO9Q 2XHWA 3TWZA 4L72B 4QIVA 2JVOA 3HHEA 3GFZA 3MAAA 1K44A 3PW0A 1WDDA 3N9UC 1Q81T 3X1LB 2NZCA 1R8CA 2MZ1A 2JFDA 3GJSB 1ZAWA 4BJOA 5FJ4A 2DK2A 1FK9B 3KLHB 3E2EA 3BKTA 4DX5A 4I2PA 4LR7A 5IWAJ 1VQOS 1Y5IB 1B70B 2B5JB 2H1YA 2NXEA 3S3EA 1F0XA 3PCOB 1IQZA 1OEUA 5C7PA 3ZTPA 2JHEA 1NKBA 2UV8A 4PPDA 4J91A 1QY7A 3SCLE 2O66A 4TNOA 3OMHA 3PJ9A 2VQFJ 2A8BA 3I96A 4BWMA 5LMUF 3MGJA 3OPKA 2AYGA 3W2WB 2BVZA 3HFZB 3CUNA 2M7SA 5A8RB 5JUMA 2VB6A 1B0PA 4FYDA 1SJ3P 1O0PA 2J9EA 5J2QB 1HPZB 3DGPB 4DV6F 3NS5A 3THPA 4LF1A 3WQPA 3DOKA 4FPRA 3MM7B 1QJHA 4C11A 4LF7J 5K5MA 3KHHA 2HNQA 2W2MP 1JLAB 2J9CA 1WF0A 4F3QA 3R7SB 3F9AA 2E29A 3CSKA 4ED7A 2Q6BA 4N47A 1FXLA 2BOPA 3NWRA 4B02A 2JNJA 2IJRA 3DOMA 4OZNA 5IV3A 3KLEB 2I4EA 1R3NA 2MLXA 4U7CA 2WOMB 4FF3A 4ICLA 4GE2A 4ECWA 1DLOA 4C8LA 3TZYA 1MWQA 4F67A 2GX8A 2PFDA 3CE8A 4YAAA 3UDEA 2KXHA 1RHQB 5AWXA 2YWHA 4KGMA 3DI6B 4B17A 4H4KC 1ZTTA 3FMWA 5G0RA 3EUNA 1S4EA 5GAEI 2BBEA 3NNCA 2QLXA 4Y14A 3DLEB 3H25A 1SKSA 2UUOA 3SSSA 4DFPA 2DBBA 3PW7A 1ONZA 4EK2A 1UJ6A 2P9EA 2NUUG 3N28A 5D77A 3K7RA 4YR3A 4ERCA 2I4GA 1FNOA 2ZBQA 2Y96A 5T14A 4R30A 3UVJA 3OL6A 1LQ9A 1G1GA 1N4LA 3A8EA 3CXCR 2VICA 3ZTRA 1YRTA 2DNLA 2YH0A 2DH8A 1NB7A 3B8HA 5AE1A 5IQ6A 4TY8A 4YDXA 2DXFA 1TL3A 2ZVIA 1IKYA 4GKJJ 4USMA 2B9XA 3LA0A 4IG3A 2HHVA 4LVNP 1PBAA 4M5LA 2VORA 2W9BB 5BXIA 2HHUA 1B7YB 1SQFA 1PYOB 1VRTB 1XM2A 2VA3A 1G1XA 4YHHF 1N8RT 4YB1P 3ZZZA 2DNZA 3DHWC 3IRXB 2DVIA 3CB4A 1U1NA 2R7SA 4XO0A 3U02A 3AWGA 3TUIC 3ENVA 2W25A 2AWZA 1VCTA 1HBMA 2B4UA 3CDAA 1U4BA 1XEZA 3K8VA 2KDOA 1LQFA 2C2ZB 4DV2J 4ID5A 1NBEB 1F2HA 4PXDA 2YQ1A 3FBBA 4IO1A 3BBBA 2G4BA 4DN0A 5J2NB 4OLPA 3HPOA 2H54B 3T6JA 4JBCA 2YXLA 4ILMA 3MMAB 5ETSA 5E3PA 2CKWA 2DHSA 3CJRA 1Q78A 4KPCA 1TL4A 4DR6F 1FVQA 2KN4A 5HP1A 5KA0A 3C6UB 4NLVA 2R8IA 1NK4A 3N5FA 4JV5F 3CMAS 1I94F 3H5YA 2FJAB 4ECXA 4FVCA 1VBYA 2CIMA 1NZ7A 4X4VA 4WXWA 2KFYA 2D1CA 4OLOA 4FBTA 4U8YA 1BLUA 5I42A 2HMIB 2Y1LB 2E5JA 2GJIA 2XNRA 1Q8LA 4YB7A 1U2RA 4JI4J 2AV5A 2CNFA 2VFRA 4NMLA 4HEA9 4KHRA 3ELHA 2CJZA 3PHTA 3PG9A 2AJ4A 5KT6A 1JMTA 3FSXA 3FCHA 1CJKA 3HJFA 4KKOA 2PEBA 3I5CA 3W9HA 3CCES 4W92B 4UF4A 3MM5B 2F9JA 4LSNB 4JV1A 2VC1A 3HD2A 1R27B 3UE2A 2DXEA 1EKSA 1F3FA 4O23A 4LR9A 1RT7B 1Y0HA 4MKVA 4DSKA 2UU9F 3MR3A 2BZLA 1U25A 1XMBA 2GIQA 1R0AA 1R6VA 3CJKB 1IJEB 3QIDA 1JX4A 1HQ2A 4DL6A 3M2UA 3G8SA 2VFTA 2L48A 1ZAXA 5J1EB 2OP5A 4X62J 1S6PA 5DRKA 3S4EA 4K5RA 5KG1A 3P45B 2ERRA 5K23A 4DV4J 4DEZA 5KFHA 3KJQB 1DJ0A 2HBZB 4X4SA 3BN4A 2HLTA 2XBPA 2AGOA 3HX9A 2H48B 2HHSA 4OZ2A 2F71A 2VJUA 1NJXA 2P6XA 2EFOA 4G1IA 1MKPA 4AXIA 4MFBB 1ZAVA 2N3LA 3QPIA 2H03A 1B7FA 4FS2A 4ZK7M 4DV1F 2MQMA 4YB6A 4Y2EA 3GU0A 4ID8A 2RF6A 4USWA 3CCWA 4ENOA 1QVGR 4WP8A 2CQIA 4OX9F 2E9ZA 3LWMA 1DQ8A 2MHNA 2QA4S 1VQ7S 2QBRA 2J8AA 4ED1A 2CQGA 3R9LA 2E1PA 1DY3A 5JJBA 3OXLA 1SIZA 3SQGB 4DSFA 5B0AA 4RW7A 3GCXP 2J17A 4ZCMA 3BEGB 2OPRA 5D4LA 3TJAA 3X3UA 4CVLA 4GFVA 4J37A 1APSA 4X65F 1GQQA 1SUGA 2LA4A 4ZHRB 3C19A 3TUZC 3DYAB 1S1VB 3S1TA 4QWEA 4LF5F 1N32J 2CZVC 3HZEA 1J5OB 2BRLA 3EMUA 1UW9A 3ZTQA 1H38A 1TVRA 2KM8C 4R5PA 1QXKA 4RKUC 2BYCA 2RU3A 4OYWA 2MZRA 5GAEU 2MZSA 3JTPA 1AYEA 3GONA 4IFYA 1A9NB 5DO2A 2LEBA 2RIJA 4NRUA 4WIIA 2OPPB 2MBCA 4F4AA 4N7TA 2CZ9A 3A8KA 4X4OA 3QCDA 1EKRA 3VZHA 4Y6IA 3C16B 3M8QA 5E0OA 4KFBB 3J7AN 3RBZA 2VBYA 2AW0A 3G71S 2B3OA 1DTQA 3PTWA 4QU7A 2OPQB 4KY3A 1LOUA 4FKYA 2DGXA 4CNYA 4Q2LA 5D6GA 5KFSA 2UUAF 2WB1D 2XSJA 3HSZA 2QMXA 1VC0A 2OGUA 4DQSA 4NZ0A 2PA8D 4JYAJ 2LP4A 3G2XA 4RU9A 3ZM1A 4F0HA 2NSBA 4UOHA 3DOLA 1NWEA 4JUZA 1KFSA 4F0KA 2HZCA 2GP0A 4G1QB 1C2PA 2BJ3A 4OL8A 2CWKA 5KG3A 5DDOC 1B3TA 1U8WA 1Y5NB 4ELVA 4DR2F 1VHRA 1L5UA 3TAMA 5HSPA 4DPXA 4MT1A 2W9AA 3V0HA 3H2VE 2CMAA 1FWPA 2LXUA 2VD3A 5A0YB 3B4MA 2YVSA 1YKWA 5KT2A 1QTNB 2HSEB 3HI9A 2DCUB 4JP8A 1S79A 4BPCA 3NY0A 5CQGA 3TVZA 5AE2A 1TKTA 3KNGA 1JLEB 1HR0J 1S6QA 3IC1A 2JEFA 1ZA2B 3D66A 2GQQA 3VAGA 2MMYA 2HURA 1YVFA 4UW2A 1G7GA 4L76A 2B7BB 3OQ2A 1JIHA 2FD2A 4BLGA 1LNQA 4YP3A 1YBUA 1PSDA 1PKUA 3G9CA 3BH7B 1CJTA 1P15A 4O3QA 4C8OA 3H8YA 2IIHA 5D78A 1RQ0A 3L9ZA 2ASDA 1XWLA 3DXSX 1SL2A 2OJ3A 2MQNA 1WNEA 3QCFA 1PJ5A 2NPIA 3QO9A 1LW2B 4IRCA 4CO4A 2HNZB 3GR1A 5EDWA 2N7YA 4OQJA 3G86A 2E5IA 2EG2A 3GQCA 2K7JA 1FXDA 2YNHA 2K1RA 4UOFA 2CXEA 4K4WA 4OZJA 3DLKA 1PIEA 2ZOMA 1CLFA 1T9TA 4QYRA 4CLSA 2UVRA 2I4HA 2ZJQQ 2V4JA 1KFDA 2FJNA 3LK7A 1AFIA 2CRLA 1NPRA 2C7SA 3CJ0A 1E6YB 4Q7AA 1RT2A 4WTYA 1CS4A 1OPZA 3W2VB 2IM0A 3FRZA 3PR4A 1IBKF 4Y2IA 1GXTA 3MD1A 4NZ7A 2CVEA 1ZYQA 3HJVA 4QAPA 1UA0A 1NJZA 2CNLB 1I9SA 1KD1T 3KHLA 1C1CA 4H1OA 4USIA 2IC3A 1PJ7A 2KZZA 4X4TA 3G4SS 4M63A 1XBOA 2V50A 2ROEA 2IHR1 4YUDA 1VQ4S 1NU4A 3HO1A 1TKZB 2EK6A 1MROA 3MPVA 4P2XA 2ZEJA 4OZ5A 1YDLA 2Y8YA 1TAQA 2IBOA 1IBMF 1OEMX 3M32B 1KNZA 3LP1A 3NGRA 1T03A 1TV6B 1RCOB 4J9RA 1IBMJ 5KFUA 2WB4A 3R5JB 4RWWA 2AEMA 4RUHA 2ZHBA 1OHEA 4DPYA 3M8ZA 1OYDA 3MZIA 1FTRA 2MKHA 2ASYA 3LAKA 1JQGA 3AA9A 2FIUA 3RB6A 1S5ZA 1BHNA 1NKCA 3HFKA 3DRRA 1CJVB 2HBYB 2JLGA 1AAXA 2RAQA 1JLQA 1MWZA 2OSQA 1NDLA 3R1HA 1S77D 4OFZA 2JFHA 2WVCA 4ANDA 4BC9A 2IY5B 1RSCA 2Z2MA 4XTTA 4JI6J 3NCPA 2VOPA 2WW4A 3NAHA 3QT8A 1TR0A 1UA1A 3ADAC 2R2SA 2OTLS 3TVYA 2MQQA 4ECSA 3WX8A 5BUGA 4U96A 2F4VF 4DXLA 4NEYA 1VBZA 4I67A 4F04B 2F4VJ 1ZOTA 2IJFA 4QOTA 1XR5A 4GO7X 5T41A 2HHXA 1UPMB 3FZ2A 5BYRA 3HSGA 3OVBA 3BR8A 4MK9A 1UJ4A 4NWFA 5KFGA 3TJ8A 5KA9A 1YBTA 4CO5A 2QBSA 2BJ9A 2MGZB 5C25A 4GE5A 3A3NB 4RH9A 2DIVA 2WVBA 4C3MA 3FJ2A 2W4PA 2XG8A 1BMQB 4MJKA 4UZCA 4UOGA 1PJ6A 4RNHA 2ZH1A 2ZE2A 4O0IA 2YX4A 1PGZA 2CUYA 3JSMB 2UUCF 2FB0A 2WZ1A 4F7VA 3MM6A 5F9LA 3EZOA 4YOEA 4N41A 3HHNB 1KHWA 3PY8A 1BZCA 2V8VA 3AAWB 2YBVA 1L3SA 4X4UA 4R0JA 4DL3A 2HQGA 4NA1A 4NLRA 1NPKA 4EFAC 4OYXA 1RAEB 4PWUA 3TW0A 4IG0B 1XMQF 3GFHA 2DPIA 5D3GA 4LFCJ 1SJRA 4CP5A 3NNAA 5KA8A 3GV8B 1LEOA 3QNWB 1EP4B 3TP2A 1GMUA 1H7WA 2DIUA 3A8JA 3MAHA 2FJEB 2J0XA 1PTYA 3CJ4A 2MY7A 1VQNS 4ZVGA 4E2FB 1RAHB 3CCMS 3FVYA 3LWLA 4OZ3A 2I6PA 1TUWA 5DZ6A 3DFEA 4KV8B 1LK7A 1F5AA 4ZCIA 5A8KB 2PT0A 3ISND 2YKAA 3N0VA 2D69A 3EXCX 1IKVA 4MKYA 1K0VA 1PTTA 2JRSA 3NGTA 5LM7E 5KFAA 3QT6A 1LWCA 1U0HB 5K22A 4C12A 4F26A 2MYFA 8RUCA 3IWLA 2AM2A 3CCZA 3QAEA 4IRKA 3BO4A 1FJGJ 4DCJB 1FDAA 4I68A 1P6TA 4C6AA 5L46A 1RU2A 2Y2FA 1RBLA 3E3XA 1U45A 4KRWA 2XLIA 2HK2A 2VQEF 1U6ZA 3RYLA 5F41A 1I9TA 1XNQF 2IAJA 2FC8A 5SUHA 1V5IB 4H4MB 2ILZA 1T05B 1FX4A 4IKAA 4DSIA 1CULA 4RW8A 4C0BA 3EXYA 4DPUA 4OYZA 2RF2A 8AT1B 4YB5A 2DGTA 3V81B 3SV4A 1SJ4P 2XQCA 2ZM6F 1EZZB 3PRBA 3QFWA 5DQGA 2MHEA 5CA5A 3KHRA 1HBNA 1K9MT 2B43A 4FN5A 1KSPA 1L3VA 2D41A 4QR2A 2G0JA 4ZKAA 5CYQA 4DS4A 1JBWA 4WCEQ 2X1BA 1YI2S 3RZAA 3PEJA 3AOAA 4N5SA 2B49A 2YDUA 2B9YA 2WONA 3DC2A 3CIZA 3ETOA 3JYTB 1HW8A 3OLRA 1IR1A 4OJ1A 6FD1A 1A0OB 1N36J 1JJ4A 5D4OA 1RKJA 2A1BA 3OLAA 3KK3A 2VDHA 3EGVA 1JXVA 3M6XA 1FFGB 2ZWOA 3BQ1A 4J9OA 4WZMA 1PA9A 2XHCA 4NZ6A 2DT9A 4LSLA 1VRUA 3MAQA 2DR9A 1RTJB 4PAAA 5IZHA 3NWGA 1J5EF 1YJUA 1EENA 4Y65A 1J5EJ 3SDEB 1UFKA 8ATCB 2EFQA 3KTQA 2CPDA 1FJ7A 2KJWA 3CCTA 2GW8A 1TL7B 2H5IB 3KLIA 2CM7A 2RDDA 3BPDA 2OH2A 2G2ZA 5HBMB 3N5BA 4USUA 4R8UA 4ANCA 4ZS6A 2V63A 3BQ2A 1NK5A 5HMWA 3VGUA 2VTEA 2VIHA 3R1LA 2PN6A 1OQ6A 3D3CJ 2MQ8A 4ZVQB 1RT1A 4I2QA 5GAHU 3HSDA 3PVXA 2MJUA 1P27B 3FFIB 4QR0A 2C1EB 2RB7A 3W66A 5AJ3J 5KFCA 1Q6MA 2L9WA 2WRMA 2OD4A 5DS7A 3W8PA 2DB1A 1YWFA 4PZVA 4JNBA 3VVUA 2IVFB 3FMBA 3F56A 4DR1J 4RU2A 3U96A 2XZTB 1IN0A 3G6YA 3QIPA 1S1WB 3DDNA 3TZXA 2JC1A 1ZZFA 4Y00A 4K4UA 2AJ2A 2CQ1A 3AB2B 3O2IA 3SMZA 1S1TB 5DDQC 4EYIB 3MMCB 3PYFA 4IQMA 1FD8A 5KFKA 2XS2A 3BBCA 1WHVA 4FXVA 3C3LA 2V67A 4ZJLA 4EZ9A 4BCAA 1EQ0A 1UETA 3K5NA 3MD3A 2MDAA 3R5CA 4FF2A 1HWKA 3RU0A 4QWDA 4PUOB 4DL0C 3ITHB 3PO5A 2AD9A 1GWZA 1SJ1A 1ULRA 2OMOA 3QCZA 1RWUA 5C24A 4CLFA 1DQ9A 3PYGA 2I2YA 2LLZA 5DQHA 4OI1A 3SCJE 1RI7A 2VBZA 2KXNB 2VEUA 4K4ZA 1Q6TA 4I64A 1X4BA 3N4WA 5U47A 3KUGA 5HVHA 2DHGA 4N8NA 2ZUGA 2WSFC 2A3JA 2VF3A 3NOGA 2IMGA 1NXIA 4CLWA 2VPXB 2HS0A 2HVDA 2GV1A 1RA6A 1EHWA 1RA7A 2IFXA 1AUDA 3D4JA 2A3KA 9RUBA 2B5JA 4NLUA 2MQPA 1GQEA 2VHGA 3MVNA 2MKCA 4KGZB 1HW9A 5D15A 1WACA 5EWFA 4WPAA 3SXLA 5K9WA 1A6LA 3T9ZA 4KIAA 2EBGA 3AHPA 2DR7A 1D1UA 4JI2J 3BREA 4GRZA 5IM0A 1SH2A 2MPUA 2DNNA 2VONA 1OETA 1FVSA 2HS4A 1REVA 4Q43A 4NEZA 3UR0A 4K4VA 4KO0B 2W1BA 4OYPA 3W2WA 5E41A 4HTIA 2XCPA 5A8RA 1AZSA 3BBFA 3N6NA 1D8YA 2ALYB 4FYXB 2UXDJ 3RR7A 2HIQA 5J2QA 3ZNJ1 1NHVA 3LP0B 5ITHA 4WP3A 1KVKA 1N88A 2M4MA 2GVZB 1EX8A 3CW2C 4M95A 1Y3JA 4DS5A 4OZ0A 1EETA 2BEFA 2CVIA 2GFFA 4QBWA 5LMNJ 3I6PA 2G9OA 3PYZA 4DMZA 5CH7B 1U47A 4LRBA 3IWXA 3UD3P 2WK4A 1H73A 4MK7A 5KFTA 2JX2A 2VFUA 1MU2B 3MEEB 3RB4A 4P72A 4ITSA 2EFPA 2WOMA 1SQGA 5KFZA 3EZZA 1NO6A 4ZVPB 2HFZA 2WW8A 2DGVA 2QDCA 4KH1B 3DI6A 2XNQA 4AXJA 3MCOA 2OFGX 5KAKA 3JS9A 5KT7A 4GKKJ 3MUMP 1KAKA 1S49A 1OPIA 4ED6A 3F73A 1R89A 3B82A 5KFPA 4RW6B 3DLEA 1NL9A 1FKOA 3MDFA 2R7OA 5KG6A 3MCSA 5I3UA 3ONQA 2VZ9A 4FYWB 3Q83A 2ZD1A 5FDLA 3RGOA 1PYTA 4DCOB 5F8GA 4JI0F 2VG6B 5A2QY 2PSZA 3SEOA 2GAGC 2E66A 3AODA 1X7VA 4WYWA 2VOOA 3JQJA 2VODA 2HHTA 3DMJB 2R8KA 4NLXA 1UP1A 2W8LA 4LF4F 3LP2A 2XZWA 3IBFB 2P4DA 4DX7A 1KQSR 3FC9A 2A10A 2KYXA 3DM2B 4ECZA 2GWOA 1NK6A 3OR1B 2Y8WA 5IT9U 3ET6B 2BA9A 1U1QA 2Z2YB 3AWEA 5F3ZA 2WJPA 2HHHF 2EC0A 5B0GA 3CEDA 5B0FA 2H4GA 3LJ8A 3PNIA 3ZZOA 3PZPA 2W9BA 3T1HF 3M2RB 2WVDA 2B0GA 2CYYA 3IG1A 2UXBJ 4BBYA 1U09A 3DRXA 3IRXA 2QGFB 1IBCB 1R8AA 1BQMB 1RUSA 1D9DA 2HHPA 1LARA 4YS2A 2J6UA 1RAGB 2PA5A 4U7UK 1J2VA 1RJJA 2JC0A 4R0EA 4Y2AA 4A8OA 2JWNA 2KG1A 4KHMA 1TAUA 2MZQA 3RO1A 2XJAA 5A8WB 3CD6S 2QX0A 1G2EA 3G6VA 1NNYA 1U26A 4UUXA 4RNFA 3NMRA 1S9EB 5DG8A 4QWAA 1WOSA 3LGNA 4GC6A 3OBIA 3IWNC 2XS5A 1VQSA 4GVBB 1F6TA 1U6FA 1QSLA 5HQLA 1C1BB 1X31C 3P4UB 3BQ0A 4TKTA 1ZM3A 2BJEA 5L1KA 1FWKA 4PG8A 2ASLA 2MKKA 4PABA 1B64A 3QLHA 2JFGA 1LW0B 1Q0NA 1YJRA 5KFOA 3CO9A 3B4DA 5EHRA 1OY6A 3THVA 1G7FA 4M5DA 2E1CA 2YNGB 3CCQS 1H72C 2I5JB 3AH6A 5L1IA 3JAMY 2KH9A 1GX5A 3G82B 2QIFA 1QZ0A 4TY9A 3A13A 1XMOF 3KG0A 2P6TA 1R43A 3R8YA 1T3OA 1E6VB 4WFXA 3S4OA 2M3DA 2BANB 4NMXA 1AFJA 2D3ZA 4WZQA 1RAAB 3TA1A 5J1EA 1X9SA 1EAYC 4A8KA 2YWFA 1WI6A 1RDRA 2ZBCA 1FPZA 3BLTA 4YR0A 2JZ5A 3R5DA 5GTJA 1A5YA 3EJMA 3EE3A 3NLCA 1MN9A 2HNYB 4JI1J 1U6BA 1X60A 2GO8A 5RUBA 2A0FB 4DR3J 3KG4A 5KA4A 4G3IA 5B7WA 4PPZA 3F41A 3H59A 4K0KF 3KHGA 3C66A 2W24A 1FI4A 2VEYA 3AQOA 1RAFB 4NWGA 3UDCA 2I9SA 3QCHA 1HQUA 4DGXA 4KYZA 2C3PA 2COLA 2BJ1A 4I7FA 2E9TA 4P2SA 4UTGA 5E3CA 2OHDA 1P8GA 4Y2KA 2KJVA 4ZPAA 4NRTA 3AOBA 1RTDB 3HVTB 3RUBL 2WSCC 2OLWA 2E5LF 3R7NB 1BZJA 2YKMB 4LFAJ 4V1Ak 2KTQA 2YH1A 3BGRA 1TKXB 4RKKA 1KDNA 1GMWA 1RWXB 3DYAA 4WBFA 4URGA 4B04A 1RWPB 3DRPB 2BIJA 2R2UA 2FJVA 1J5OA 4I8NA 3TX0A 3TA2A 3D6MB 3DGVA 2BE2B 1JXLA 1YZ7A 1KBRA 2NREA 3O8WA 1RT5A 4KAIA 3OSPA 4TN2A 2NLKA 2CPZA 2XYHB 2OPPA 4C97A 1JLGA 4ZMMA 1PH0A 2C46A 4OZ1A 2BJ8A 3S3KA 3NMEA 3NBPB 1N5SA 5KT4A 2XMAA 1ZPWX 2WTFA 2UUBF 3RAQA 2HYIB 3QCMA 1HWUA 4AL6A 1HWIA 3QKPA 3KJFB 2D74B 2V6AA 3KLFB 3EMTA 1W25A 2OTJS 3TRGA 4C48A 5KABA 2AHOB 4J9VA 2VFSA 5G4DA 2J76E 3K2YA 4P6QA 1NMEB 5KG4A 5F9NA 3QGPA 5KG5A 2J6TA 2HNDB 2CQ2A 4ES1A 1JJHA 1HNIB 3LW5C 3KYLA 1SH3A 1RHRB 1OEVA 2N82B 2EPIA 2V68A 2V2VA 1FKAF 4DI6A 4OI0A 2ATLA 3I56S 3CC7S 2KFNA 2RRNA 3L7PA 2BV5A 3LGHA 4ZIWA 3PX0A 3FQKA 1HD1A 1N5YB 3GIRA 3MECB 3P5BP 3QGGA 1HD0A 1MWYA 1HA1A 3GB0A 4J7CA 3F9BA 1BUXA 1N5QA 2A2CA 2OFHX 2E44A 1JLEA 3SFGA 1Y10A 2G0IA 4A8SA 2CDQA 4Q0BB 3OW2R 4LQ3A 4W98A 4XDDA 2ZN7A 4HRFA 2B4SA 2QBPA 3CJQA 3PW4A 5IQQA 4B9SA 2E1AA 2H4YB 1HNZF 3AXKA 2NR0A 4LFBJ 3AD8C 4M5MA 2R8HA 1RXOB 3ILLA 2CG4A 3PJXA 4L3NA 3GSIA 4O44B 2IA6A 2C3OA 4B08A 1C4CA 4UAGA 3V0JA 3KNAA 1CG2A 4G6VB 1LW2A 3BZQA 3MUVP 3CF5Q 1AA1B 1B0TA 4PQAA 4IR9A 3QCCA 4ZLLA 5BYSA 2K2PA 3HCXA 3HD1A 1Q1MA 2AM1A 5L8RC 4JI8F 2EFGA 3J7YI 2XCAA 2RE1A 3F99A 3IFEA 1H2UX 3LTOA 1HNXJ 2Y0SD 3VF0B 4DV5J 3C14B 2LECA 2BKPA 3W5ZA 4OHLA 2Y1RI 1TL1A 1VLYA 3HSJA 3I0SA 3UN5A 3KK2B 4KC5A 4ANEA 1IM4A 5H9FK 5SZTA 1Q6JA 4OZLA 1YFOA 3MEDB 3J81Y 2XY7A 5GVQA 4ETZA 4FP9A 2MZJA 3O5TB 3CJSA 2B8PA 1KQGB 4PG6A 3S8SA 1TZ0A 2YKOA 2YKNA 3VAFA 3IM8A 3SI8A 2F6YA 3AB4B 1Y7PA 1U48A 3NS7B 3D1QA 5KFVA 1YITS 1VQ6S 4ED4A 1Q7LB 2FLNA 3CDWA 4NA2A 2DYAA 2BV3A 4DR4J 3O3LA 1FQ1A 2EG1A 4Y34A 4IYQA 4F4WA 3OL8A 3MAAB 3QCJA 1SC3B 3EU0A 4B3SJ 5F8JA 4AQYF 5D0RA 3MR7A 1VDHA 2V4QA 2C3MA 2BJDA 2AX0A 3W63A 3ZXWA 3FZBA 2K3KA 1FEHA 3QATA 3JQMA 1WJ9A 1PA1A 1XC9A 1HLWA 1WKJA 3M4XA 4I2PB 3QWUA 4U95A 4KGKA 3VAIA 1U1RA 4J9NA 2QT7A 3LPEA 3PX6A 1XN9A 5DZ7A 3AJ1A 1CEZA 5B0BA 4DV7J 3U1MA 2F6ZA 2ZH3A 4DUZF 2PC6A 2HEKA 3VGTA 3QZ7A 4FNHA 2QLJB 1SL0A 3M8YA 3QRPA 2JOQA 1VGYA 5HMZA 3AJ2A 3ILOA 2NXUA 2QFJA 1TKDA 4DF8A 1SB6A 3IR5B 4LREA 5KFRA 2F40A 3M05A 1S0VA 4ZVOB 2RDIA 4I69A 1FCAA 2QBQA 1X4AA 1IR0A 4WE1B 3GXGA 3EPGA 3NGKA 3NKYA 3V2UC 2R8GA 2BDPA 4C11B 1ZPVA 4CCHA 1DRZA 4DR5F 2AZ1A 1FT8A 1YLXA 4P2MA 4X84A 3SFUA 1FRMA 4DR5J 4EWTA 2UXCJ 5F0WA 2MLYA 4TLQA 3GR0A 2VC0A 1N0UA 5KADA 3RBXA 4HDHA 5A76A 1HHSA 3I87A 5B08A 1BZHA 1OIAA 2AU0A 3THTA 1GTHA 4ICLB 2GJTA 2H4WB 1DLOB 3U1LA 2GZOA 2ACMA 5LJ3Y 3D6HB 1T9VA 2HWHA 2WGPA 1G3OA 4PEOA 4NYPA 3M9OB 2Y9HA 1YGUA 2DNYA 1RXDA 1Q95G 4V19J 1ZETA 5G0RB 3R5AA 1M5OC 1IKWB 4ZN3A 2L3MA 3BM8A 4IG0A 2LQ8A 1LXNA 1JLFA 1FRLA 4HL9A 2F6FA 2ZKTA 2X1AA 3OXFA 1V9OA 4DUYF 2IM3A 1XTZA 3AA8A 4NASA 4ECTA 1V5VA 3BH6B 2XS7A 1W2IA 3BLUA 3O1LA 1EP4A 1MLAA 3WIVA 3UVJB 4A8XA 3VGSA 2NUHA 1GT8A 4C0HA 5CHCB 1Q5VA 3DXBA 1KKHA 3L95X 4ECVA 3UN3A 2AX1A 2E5GA 2ROGA 4TY8B 3T3FA 3TOQA 3CWJA 2AF6A 3I0RA 2ZKUA 1IKYB 4DWIA 6FDRA 1OESA 2LEPA 1YK9A 1HNVA 2G13A 3M8RA 1CQNA 3L09A 4B3MF 4KV8A 4LVOP 3IS9A 1WC5A 3MOWA 4PG7A 3CDUA 1UZHA 4RI5A 4DL2A 3M9MB 1Q82T 3R5GA 5A6WA 4CVKA 2RKIA 3V6JA 4K2JA 3CCVS 2CFXA 2EK1A 2DGSA 3M4UA 3OR2A 3PM9A 3S3HA 3I5AA 5M43A 1DHMA 5HAOA 5HQ8A 2DR6A 1HBMB 1FE4A 1UAWA 4DG1A 4PRFA 3J7YU 1NDKA 4M94A 2HRTA 1HI8A 3CCJS 3PV8A 4H4MA 3A4TA 3DCAA 4QJVA 5KFBA 2ZWPA 3PEHA 5KT5A 2O01C 2FH7A 1SKRA 2RRAA 2X3GA 2KRRA 2F46A 3ENWA 1G7CB 4A8MP 3JB9k 2HFSA 5CAAA 2RQ4A 2ATCB 2PE8A 2ASJA 4Y0FA 3V81A 1S6OA 3WIUA 3ILJA 1R8BA 5BZZA 1RCXB 4C2MA 5ETKA 4B3OA 3MCMA 4PQUA 4NYHA 3TUJC 5KFMA 4LT6A 5K9FA 5I42B 3ZM5A 1F9EB 1NLKL 4WYLA 4CYUA 2VL1A 3O44A 5MMZB 1U24A 3GCWP 3JYTA 3VWSA 4DSLA 2PI5A 2YWWA 2XYGB 3F44A 1CJKB 4KKOB 3I80A 5MAOA 5EX0A 3GLJA 4MTPA 1DAXA 4LRFA 3LGMA 1EEHA 1YWXA 4RLEA 4J9MA 1XNRJ 3FEXB 2O1PA 4FPIA 2HAFA 1RTJA 5IWAF 1R0AB 1RISA 2GHPA 4EYHB 3PKMA 5IBSA 1UFWA 4J5OA 3BGFA 4K5SA 2QTWA 3M2UB 2W4CA 2VG5A 4WU3A 2Q05A 5HBMA 3VVTA 2VQFF 3PACA 2FJMA 1KAVA 1CVJA 2I75A 2QYCA 2EI5A 2W2OP 1HYSA 1TK5A 1Z1ZA 4YEAA 4OHXA 2R8JA 3KUEA 4G65A 2AZ3A 2VOSA 3I31A 3I9ZA 4M5HA 4IDKA 1WC0A 2FVRA 5IFMA 2G2YA 4Q2MA 5DLGA 4ATNA 3C46A 1NWLA 2V5HG 2BQ3A 3RW7A 2D3OR 2L9DA 1R8HA 4LRAA 3KLVA 4LF7F 3OJUA 5BYQA 1R6YA 4QYZJ 3CC2S 2QYGA 1S1WA 1XR7A 2A18A 1E8CA 2QDPA 3PXGa 1AROP 1YTSA 2P5VA 2PQ5A 1QLNA 5C2CA 3WHIA 3ZV2A 2IDEA 2P6SA 4I0WA 1RT4A 4RW7B 3EZUA 1S10A 1H0HB 5D0HA 1I6JA 1NHKL 3MMCA 4OHHA 1FRIA 4CLYA 2Z8QA 4RW9A 2K06A 2OPRB 3D6FB 3KLGA 3R27A 1IM6A 3NNHA 1ICEB 5KFFA 2ZJRQ 5K8NA 1C87A 4GWFA 2Z56B 5H9EJ 3Q8VA 1LWFA 1HQEA 1T0TV 4DSJA 2KL8A 1GG4A 3NRBA 4HHUA 2UVWA 1TVRB 1FA0A 4M5NA 4PUOA 1VQYA 3HM9A 1TUVA 1OWXA 1WHXA 3KKFA 2MEWA 4DFJA 4HH0A 4HYKA 3R5BA 4RUBA 1JK9B 2LXFA 1VQKS 3TQEA 1M90T 3LALA 3UFCX 4OX7A 4CDIA 1ZS6A 4OHVA 5LT5A 2KT3A 1I51B 1UVJA 1DTQB 1YSJA 5M2RA 3PX4A 4RZRA 2N4DA 4USKA 3MR5A 1NZAA 1TUGB 3PIPQ 1O51A 4GKJF 2VBWA 3PFOA 3DU5A 2J16A 1VI7A 2PI7A 5E3AA 5ETLA 5EX3A 2IBKA 3J7Z5 1F2GA 1VJQA 4KHPJ 3DOLB 3M6VA 2GMJA 4IOCQ 5L9XA 2I6JA 1R0BG 1SVDA 2DEIA 2Q47A 1X5SA 1S4FA 4NXNJ 1PO6A 3OFEA 5C2GA 2NZ4A 3TAMB 4NLGA 1PC4A 4JI5J 4B3RF 3D2WA 2XI2A 4JI3J 2QLBB 3GIJA 2LDYA 1SCJB 4B3RJ 4J51A 3P8BB 1KWMA 2D3UA 1R31A 4TVAB 3KDNA 2IPOB 5CCMA 4LMZA 3EVMA 4A8FA 5L1JA 1FDBA 3P49B 2B07A 4GVLA 1TKTB 5L38A 4DV2F 4FBUA 1KONA 1Q4RA 1S6QB 3QT7A 2KZMA 2APOA 2GVZA 3ZMPA 1OYEA 1FGSA 4DQIA 3CDEA 2FHJD 3D6TB 4ZA1A 4IR1A 4HH1A 1BWEA 1CJTB 1KOOA 2WAQD 2KT2A 3BGLA 2AEFA 2YTCA 1M5PC 1HI0P 2FJXA 4O3PA 2QE5A 2NTAA 1NM2A 2KU7A 2PI4A 4OI2A 4DN9A 2Q3PA 2AJFE 2M70A 1KRPA 1MU2A 3NG8A 3QO9B 3FBCA 2RDJA 2B3TB 5GADI 2FTRA 2GC8A 5HO4A 4X66J 2YNHB 1WF1A 2AMCB 5AXMA 4NCGA 2K1RB 2DY9A 3UQSA 4JI4F 3GIKA 2HVEA 4USVA 4PG4A 1OS5A 2HBRB 3R6GB 4FF1A 2DD8S 1KQKA 2E7XA 3V4IA 2XPCA 1FEEA 1H7XA 4ERDA 3M2VB 2KB2A 2Q43A 5IT4A 2JFKA 2QV6A 1OSDA 3MFIA 5DQIA 1S0NA 4ECRA 1RT2B 1CS4B 3I4PA 1TFYA 2GC5A 4OV1A 5ADZA 3PKYA 3TVKA 4ZPBA 3K5PA 2YPYA 2W01A 1GMVA 5CABA 3HHLD 1P9YA 2Q66A 4ZIYA 2ZOFA 2VG6A 1IVZA 1YBAA 2YX1A 5T7LA 1AW0A 4RWXA 3CD7A 1QE1A 3J7A1 1M1HA 2CQHA 3CMES 1RTHA 4HI1A 4CI0B 4M5IA 1WKLA 4X62F 1U02A 3MPDA 2IC3B 4IFVA 3OR1A 3C6TB 1WC3A 4USJC 4DU7A 4DV4F 3GYGA 5THWA 3CJ2A 5M2UA 4DJBA 2XSFA 2C2DA 5FLXY 4IOBA 5BZXA 4GC7A 1WOPA 1BQNB 1MROB 3HVRA 4ES3A 3LP1B 5HJYA 1T03B 3MMBA 3M2RA 4C3LA 4K4YA 2VEWA 3HT0A 1VISA 4C8ZA 1WAXA 5LL6d 3D1OA 2V2KA 5K14A 1I3OB 1ZM9A 5KACA 1QVFR 2DGQA 1S97A 2F3JA 2GNKA 5L39A 1BWVA 5D8HB 3LUYA 1H2TZ 3DRRB 1IKXB 1QAIA 1S9GA 1D9FA 3V5RA 4N77A 2Y3YA 1GXLA 1JLQB 4F2RA 2HVHA 4LF9J 2JSXA 3ZTOA 2V94A 4QW9A 3TI0A 1KLNA 1GNKA 5BR8F 1VR6A 1IR2A 2CQPA 1L8GA 5IOLA 1NDCA 4NCBA 5BR8J 1FKPA 1C4AA 1SBRA 4C8MA 4DFMA 2BMBA 4ICZA 1E0DA 2W4DA 4I6YA 2C3UA 1X4DA 3UDLA 1U2FA 2HLUA 4CLZA 4ZLJA 1RWWB 1N32F 1N33F 1CC7A 1O8BA 3D67A 4LRDA 5ETVA 2DGUA 4QQBA 1N33J 4RH5A 5ETTA 3OSNA 4RL1A 4ALZA 4F50A 3D3BJ 3GIIA 4F0MA 4Q8FA 5C42B 4RNNA 1HNWJ 4GVBA 5C25B 2V8GA 1HHQA 1UAGA 1TMJA 4WFAQ 3RR8A 5J8RA 4KQZA 2Z2ZA 2H9ZA 3BF4A 3CTRA 3UCZP 2EFNA 3DRSA 2HHWA 2ZE2B 4AYBD 2XULA 1LKZA 4PWDB 5J2MA 2GMHA 3MM6B 1IJFB 1MMLA 5LOQA 2E9RX 4YY3J 1LW0A 4PYAA 4K4XA 2NPFA 1HMVA 1RHUB 4IH7A
chains in the Genus database with same CATH topology
3AWEA 1B0PA 1HBOA 2AJ0A 3M8PB 5DETA 5F3ZA 2HHHF 2EC0A 3JTNA 3G96A 5B0GA 3CEDA 5K8MA 4FYDA 1ZCKA 3V0FA 2VASA 1V3ZA 4J9SA 1SJ3P 1O0PA 2J9EA 4H34A 3CCUS 5B0FA 4NX9A 2VPYB 2AYMA 2KXFA 5J2QB 4KTQA 1HPZB 4DV6F 2KT5A 4NLTA 1LK5A 3NS5A 3THPA 4AUKA 4JYAF 2H4GA 2QA1A 5LXQB 2I5JA 3LJ8A 4MKBA 3DOKA 4FPRA 3ULHA 3MM7B 1E6YA 1QJHA 3LQVA 3PNIA 3ZZOA 3PZPA 4DGPA 2W9BA 4C11A 5K5MA 5LSLA 3T1HF 3QCBA 3W2VA 4GE6A 3M2RB 4QCLA 3KHHA 2F6WA 2HNQA 1E6VA 2B4VA 3FDSA 4EEYA 4USHA 2MKSA 1JLAB 4NL5A 2I6MA 3MURP 2B0GA 2J9CA 2CYYA 1X4CA 3BSAA 1WF0A 3IG1A 2JEGA 4B3OB 2CQ3A 4F3QA 5D3GB 2I3RA 2DNHA 3A1YG 3F9AA 3Q22A 4PQUB 2E29A 5CZXA 3ISNC 4BBYA 2C3YA 5E5NA 1DZ5A 1L3TA 2I5XA 2HCMA 3CSKA 3QCLA 1U09A 3DRXA 3IRXA 1KR4A 4ED7A 4WJBA 2Q6BA 4N47A 2W7OA 1FXLA 3TYTA 2BOPA 3IGVA 2FJBB 4B02A 4OHZA 1R8AA 1BQMB 4NWBA 1D9DA 3IR7B 4K4SA 1SUQA 2HHPA 3IN5A 3EPIA 5HLFB 1LARA 4QBEA 2J6UA 1C84A 2NZ6A 2PA5A 4RW4B 4NPOA 3DOMA 3WC0A 4OZNA 4U7UK 3KLEB 3Q24A 3GG1A 2I4EA 4F2SA 4DR4F 1J2VA 1RJJA 2DTJA 3N6LA 3TNVA 2UVUA 3NMAA 1R3NA 4M1KA 2IRXA 4U7CA 4IUFA 2WOMB 2OMLA 2JC0A 5KOXA 4FF3A 4ICLA 4R0EA 4GE2A 4Y2AA 4A8OA 2JWNA 2HNYA 3VALA 1U1LA 4ECWA 1DLOA 2KG1A 4KHMA 4C8LA 4P7TA 1R6HA 5IT0A 1M5HA 4B3SF 4CH0S 4F67A 2GX8A 1TAUA 1VIOA 3CE8A 3D42A 4YAAA 4ZP8A 2B6AA 3P5TL 2KXHA 2MZQA 3MFHA 1L3UA 3VZIA 4ED3A 1HR0F 2DXPA 5AWXA 4DQPA 3RO1A 4CO2A 2YWHA 3MTKA 4KGMA 5A8WB 3DI6B 5C5JA 1TKZA 3CD6S 1NK8A 1WTBA 3CC4S 2DPJA 2I6OA 4B17A 4H4KC 1G2EA 1ZTTA 1PILA 1LWEA 3GYNA 3G6VA 3FMWA 4OJHA 1YTNA 3MEGA 3M32A 4NOHA 2W7PA 2M0GB 5G0RA 1UW4A 1G6BA 1TV6A 5CYMA 3EUNA 2EBEA 4R0SA 1NNYA 1U26A 4UUXA 5GAEI 3ZZTA 2BBEA 4RNFA 2QLXA 3OTBA 3NNCA 4Y14A 3DLEB 3H25A 1SKSA 3NMRA 1S9EB 1IKVB 1M3GA 5DG8A 2FGOA 4QWAA 3LGNA 3SSSA 3V6DB 4N76A 4DFPA 2GA7A 2DBBA 3PW7A 3P96A 1KN6A 3IBWA 4KR0B 4IH6A 2EFVA 5DDRC 1ONZA 4GC6A 3OBIA 2VPZB 1UJ6A 3G8QA 3IWNC 2P9EA 1LWCB 2XS5A 3MUTP 1PXHA 5J2PA 2NUUG 3N28A 3FEZA 1VQSA 2VG5B 2EVZA 5JXSA 4DV7F 5D77A 1M5SA 3K7RA 4NCAA 3N79A 4DL4A 1O5JA 3LANA 1RTDA 3HVTA 4YR3A 1U6FA 2HG4A 3VAJA 1QSLA 4ERCA 2I4GA 4OI6A 1FNOA 4X4RA 2Y96A 1C1BB 5T14A 1JF7A 4R30A 3OL6A 3BQ0A 1LQ9A 4TKTA 1G1GA 2KO1A 1WF2A 1N4LA 3A8EA 2I1RA 1ZM3A 2BJEA 5L1KA 3CXCR 1HYSB 4PG8A 5GADU 2ASLA 2MKKA 3B7OA 1YRTA 1B64A 2DNLA 2YH0A 4K59A 2DH8A 3J80Y 1U1QA 3QLHA 2LA6A 1NB7A 2CM3A 4HJQA 1YZ4A 3B8HA 4URSA 1M5KC 5AE1A 3MXHP 3CCLS 1U7LA 5IQ6A 3PFEA 4TY8A 5GAGI 2HQ3A 4YDXA 1LW0B 4IDKB 1UJ5A 4A8WA 1H2VZ 1TL3A 2IAJB 4KT0C 1YJRA 2ZH8A 1XRIA 2H4KA 1IKYA 1XERA 2DO0A 2OAUA 2QCJA 1FD2A 1U8SA 1S1XA 4HT7A 5KFOA 3AWFA 3CO9A 3B4DA 5EHRA 4RUAA 3THVA 1NAQA 1G7FA 2B9XA 3ZZUA 3ZZRA 4IG3A 4M5DA 2HHVA 2E1CA 4AZ1A 2YNGB 1UWBA 2ABYA 4LVNP 3CCQS