3MMJA

Structure of the ptp-like phytase from selenomonas ruminantium in complex with myo-inositol hexakisphosphate
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
314
structure length
314
Chain Sequence
QTVTEPVGSYARAERPQDFEGFVWRLDNDGKEALPRNFRTSADALRAPEKKFHLDAAYVPSREGMDALHISGSSAFTPAQLKNVAAKLREKTAGPIYDVDLRQESHGYLDGIPVSWYGERDWANLGKSQHEALADERHRLHAALHKTVYIAPLGKHKLPEGGEVRRVQKVQTEQEVAEAAGMRYFRIAATDHVWPTPENIDRFLAFYRTLPQDAWLHFHSEAGVGRTTAFMVMTDMLKNPSVSLKDILYRQHEIGGFYYGEFPIKTKDKDSWKTKYYREKIVMIEQFYRYVQENRADGYQTPWSVWLKSHPAKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myo-inositol hexaphosphate phosphohydrolase
publication title Substrate binding in protein-tyrosine phosphatase-like inositol polyphosphatases.
pubmed doi rcsb
source organism Selenomonas ruminantium
molecule tags Hydrolase
total genus 111
structure length 314
sequence length 314
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14566 PTPlike_phytase Inositol hexakisphosphate
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1690 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3mmjA01
3.90.190.10 Alpha Beta Alpha-Beta Complex Protein-Tyrosine Phosphatase; Chain A Protein tyrosine phosphatase superfamily 3mmjA02
5M43A 3V0DA 1I9SA 3QKQA 3F99A 1C86A 4QBEA 4TVVA 2PI7A 2I6IA 2OZ5A 4RKKA 5KADA 3RGOA 5KA7A 1G7FA 2NZ6A 4OHEA 1RPMA 3BRHA 4D3QA 1U24A 4PYHA 3D1OA 1PTUA 1XXVA 1ECVA 4JBCA 2R0BA 4GRYA 3AWEA 2B3OA 2B07A 2HY3A 1P15A 4HJPA 3ZMPA 4PVGA 1NO6A 2I5XA 2NT7A 1Q6PA 3EMUA 2Q47A 3AWGA 3I7ZA 1VHRA 2QBRA 1PTTA 1FQ1A 1AAXA 4HJQA 1T49A 2P4DA 2F6FA 1Q6TA 2HB1A 2CNIA 5KA8A 3PS5A 1X24A 4S0GA 5BUGA 1PYNA 3M4UA 1BZHA 3BLTA 3QCDA 3QCLA 5KA3A 5LXQB 1QZ0A 2ESBA 3NMEA 1G4US 1OEMX 1D5RA 3I36A 2HC1A 3V0EA 4QAPA 2GWOA 2P6XA 4RI4A 1ZCLA 1Q6JA 5KABA 1GFYA 2BZLA 4OHHA 1PTVA 3RGQA 4ICZA 2B49A 1XM2A 2CNEA 1YTNA 1L8GA 1WRMA 2QDMA 3QKPA 5K25A 4NWFA 4BPCA 5AWXA 2J16B 4JNBA 3SR9A 4OHIA 2QBPA 3OMHA 1YPTA 1U25A 2H4GA 2BGDA 1EEOA 4WU3A 1LQFA 1G1GA 2I4GA 2VEWA 4KYQA 4R0TA 3GXGA 3QCGA 1ZZWA 3S3EA 1GWZA 4ERCA 4IKCA 3OLRA 3MMJA 1ZC0A 4GRZA 1FPZA 5KAAA 3N0AA 5I6VA 1NZ7A 2B4UA 3GXHA 2CM2A 2HVLA 4D3PA 1OHCA 1SUGA 3EZZA 2HNQA 2HNPA 3ZM1A 1PTYA 5GTJA 1BZCA 1OHDA 3O4SA 4D3RA 2AHSA 1V3AA 1NWEA 5KA2A 4NYHA 5K9VA 1OEOX 1C83A 2CM7A 3S3HA 3RO1A 1ZCKA 2CM8A 1XRIA 1MKPA 2ZMMA 3U96A 1YWFA 4ZN5A 2BV5A 2H03A 4GS0A 4ZI4A 3B7OA 1C87A 4B04A 1WCHA 5KA0A 4QUNA 4R30A 2C7SA 4QAHA 4MBBA 4Y14A 3QCEA 5HDEA 2F6TA 2PT0A 5BZZA 1T48A 1NL9A 2F6ZA 2OUDA 2MBCA 3S4EA 1OEUA 2I3RA 3ZMQA 2I75A 5BZXA 2GJTA 2BIJA 2CMBA 2GP0A 4RI5A 3EAXA 3O4UA 1ONYA 3ZM0A 2SHPA 2WGPA 4R0SA 2A8BA 1RXDA 2CMCA 2QCTA 3CM3A 2IMGA 3V0HA 1Q6NA 3I80A 3V0JA 3F41A 4H1OA 2Y96A 3F9BA 2QDCA 3V0GA 4DGXA 5K23A 3ZV2A 4GE6A 2DXPA 2I4HA 1A5YA 2A3KA 4H34A 1G7GA 3O4TA 3S3FA 1LARA 2F6YA 2FJNA 3V0IA 1OESA 3D44A 1C84A 1KAVA 1Q1MA 2Y2FA 5MMZB 1YZ4A 2QEPA 2CFVA 1L8KA 3LJ8A 4OHDA 2BGEA 4NX8A 2NV5A 5BX1A 1PH0A 1J4XA 5KA9A 5K24A 2B4OA 2H4VA 1Q6MA 1XXPA 4RHGA 4RH9A 4QBWA 4YAAA 2HCMA 1JF7A 4OHLA 5EHRA 5IBSA 3A5JA 4GFVA 1FPRA 3EU0A 1C85A 2FJMA 3QCIA 4Y2EA 3F9AA 3D42A 1I9TA 2M3VA 1T4JA 2H4KA 2NT2A 2F6WA 2I6PA 3QCJA 5KACA 3QCMA 2OOQA 2PSZA 1U26A 1BZJA 2I6JA 4WOHA 2QBQA 3MOWA 2CNHA 3QCCA 2F6VA 3A5KA 4RH5A 4GWFA 1I57A 1YTWA 5J8RA 3D1HA 2PQ5A 4KYRA 1C88A 3EB1A 1XBOA 3BM8A 2QCJA 4YR8B 4NWGA 1OEVA 2B4PA 2F46A 2I1YA 2VEYA 2NTAA 5KA4A 2E0TA 1YN9A 2HXPA 2J16A 2H02A 2PA5A 2VEVA 1OETA 3S4OA 4WTYA 2I3UA 4AZ1A 3AWFA 1G1HA 1NNYA 4J51A 4GE5A 1NWLA 2C46A 1Q6SA 4GE2A 3H2XA 2I6MA 3D1QA 2VEUA 1EENA 2H04A 2AZRA 2FH7A 3ZM3A 2Q05A 4JMJA 1OHEA 1PA9A 3O3LA 1YGUA 1JLNA 2NLKA 2G6ZA 4JMKA 2I4EA 2QBSA 5KA1A 5K22A 3QCHA 4GFUA 3RZ2A 2B4SA 4WU2A 1G1FA 4ZRTA 2CM3A 2ZN7A 3QCBA 2OC3A 2RF6A 3ZM2A 2VEXA 4KI9A 2JJDA 5IBMA 3CWEA 1M3GA 3SMEA 2CNGA 1YFOA 3QCFA 3BLUA 2F70A 2I42A 2J17A 1G4WR 1YGRA 2HC2A 1WAXA 3QCKA 2CNFA 3O5XA 4RDDA 1KAKA 4NNDA 4I8NA 1LYVA 3F81A 3V0FA 1YTSA 4DGPA 2F71A 4Z6BA 1R6HA 2YDUA 5K9WA 2PBNA 2G59A 3S3KA 4BJOA 2QDPA 1PA1A 3MOZA 1PXHA 2CMAA 3D9CA 4QUMA 5EHPA 3QCNA 4HRFA 1ONZA 2CJZA 1QXKA 2I6OA
chains in the Genus database with same CATH superfamily
2GZOA 3MM9A 5D4OA 2UUOA 2MLZA 2PI7A 3CB4A 4UF4A 4FYDA 4MMOA 1VLOA 2F8EX 3LP2B 4OHEA 3VV2B 2OPRA 1KN6A 2YKNA 4E98A 4NLPA 2IBKA 1XXVA 4ZDNA 3KJFB 2QV6A 3QIDA 4KSEB 4LFCF 2C2KB 2OI2A 5LSLA 4HJQA 1U2FA 5HBMA 1WOPA 3EGVA 1BZHA 3BLTA 5LXQB 1OSCA 2YQ0A 1G4US 4IR9A 2MZSA 1T9VA 1RCXB 1PYTA 1JXVA 3AY0A 3N2AA 2IJNA 3BPSP 5B0DA 1Q7YT 1R8PA 3MPWA 4WKRA 5B09A 4CYUA 3C6TB 2BZLA 4OHHA 4PG5A 1B7FA 4JUZA 4Q8EA 2MGZB 3LTOA 4P71A 1SL2A 2UV8A 2GC6A 3M6XA 3MEEB 4K4VA 5J2QA 2CJKA 3S7RA 3D6HB 4X66F 2V2ZA 5E41A 4ICLB 2F4VF 3OTOF 2X1GA 2LU1A 5DG8A 4UY85 4R0TA 2SXLA 4TVAB 2R2TA 1FI4A 1RAHB 3NL0A 3I5CA 5A8KB 1F2GA 4I0WA 2C42A 1HIYA 2FC9A 3MM6B 1S0VA 4LFBJ 2N4DA 4OZ1A 2IMWP 2Y1RI 4OZLA 3BSNA 1RTHB 4ZK7M 4D3PA 3EZZA 5B0AA 2K8GA 5T7LB 2E29A 3DOLB 1IBLJ 1FJCA 1SL1A 3DMJB 4URGA 3V81A 2HHTA 2ZD1A 1MMDA 1EHWA 1TKZA 2BQ3A 3MAAB 5IS2A 5FIIA 3HSGA 5HDEA 2LA6A 3KK3B 3IWNC 2F6TA 3DLEA 5GAEI 3OTEA 5L1KA 1S1TB 5BZZA 2YNIA 1RDRA 2ZH8A 2HBYB 4KT0C 2AKWB 4PWUA 3MM7B 1QJHA 3KLGA 5H9EK 5KT6A 4DBQA 5D4PA 2NYHA 1HNWF 3E51A 1U6BA 1Q6NA 3SQGA 4RW6B 1QDUB 3VQSA 4H1OA 1LXJA 2KYZA 5BR8F 4FKXA 1JLBA 2R8KA 4DGXA 1J6UA 1NJIT 4A8OA 4Y65A 2J0SD 3Q23A 3FDSA 2DGOA 5GAGI 1J5EF 1LARA 1CQNA 1U6FA 1RT7B 4I68A 1FK9B 4WXOA 3UCUP 2DHXA 1N48A 2BEFA 1V5IB 3GSDA 2WOMA 1HBNB 2UUCF 3PYDA 3SMZA 1SUQA 5IBSA 1WELA 1KQSR 3G9CA 3DLKA 2HBRB 3QJJA 3WC0A 1F5AA 1TK5A 5D0HA 2W1BA 3NXZA 1Q78A 2A6OA 2WVDA 4OX9F 1IBKF 4ED8A 3CDWA 2YWWA 3QAEA 2H1YA 3Q8RB 2V2VA 3OJUA 1C4CA 2QEXS 1CC7A 1VQOS 4KB7A 4C8KA 2PQ5A 5CYMB 3TVKA 3T5HA 4P2XA 2F40A 2UUAJ 5BYSA 4Y2MA 3D66A 4I2PB 3BEGB 3CDUA 4TKTA 1JIHA 1B99A 1LFWA 2M7SA 2EFGA 1N5QA 4KO0A 2RDDA 3I5BA 3KUEA 5DRKA 1T05B 1HPZA 3MD1A 4DR7J 3DGPB 1H38A 2Q05A 5D0GA 1YGUA 3FVYA 3NCRA 1Q82T 4JMKA 1Y10A 5MLCV 4NZ0A 5K22A 2Z0GA 3GCXP 1VIOA 5HMZA 4ZP8A 1OPZA 2YTCA 3CD7A 3HVTB 3GP9A 3VAMA 3FEZA 3MPYA 4NLYA 4PWDA 2CQHA 2IRXA 2FVQA 2IY5B 3Q2TC 2PO4A 2BJEA 1M3GA 3K5OA 2K3KA 2J17A 3TWZA 1GTHA 4K4TA 2HQCA 4F4AA 3QCKA 1ZS6A 3DGVA 2J6TA 1P3DA 2CJBA 4L6V3 2XYGB 4F3OA 1NLKL 1LYVA 2ALYB 4Z6BA 4CO5A 3FBEA 1MLAA 2HGNA 1CLFA 2QSWA 5K8PA 2XWYA 4RZRA 3P4UB 5KFSA 4EZ9A 1UFKA 2V5HG 1A9NB 1S1WB 3OVSA 3CCQS 2ZOFA 3HK2A 3OXFA 4F4YA 1C86A 4QBEA 2B0GA 2NZ4A 4AXIA 3HJFA 2VFSA 2DNRA 1Y9OA 3BRHA 2VICA 4RW7A 4DV4F 1VC6A 1O5ZA 2J9DE 2N82B 2MLXA 3ZMPA 1X4HA 5JUMA 4KY3A 4TLQA 1R6YA 3LGNA 1X24A 1T03B 4KHPJ 2QYGA 5EWEA 2GHVC 2RQCA 2O67A 2G0CA 4NE9C 4RW4B 5ADZA 4QOTA 1RTJB 2ZVSA 1PAEX 3OL6A 2AJFE 1ZCLA 3K7RA 2YKOA 2DXEA 3D0GE 3DM2A 1JLAA 1N5YB 1GT8A 5K8OA 2XQCA 4DLGA 5IM0A 1X8DA 3ULHA 1BWEA 3DNCA 3J81j 1EEOA 2R8IA 4NCGB 4ZKAA 1NPPA 3I0SB 2D3O1 3D6FB 5LSOA 1F9EB 4X65J 4NYZA 1SCJB 4IKCA 3JSRA 3MMJA 1DLOA 2YWEA 3IWLA 1X4FA 1UVIA 3MMBA 3PW2A 3HHDA 5JVHQ 2BJDA 4PYAA 4IFVA 4OHXA 2J6UA 4ES2A 1SUGA 4OMFG 2EKNA 5D0RA 1RT1A 3NGDA 1ZM3A 2CJYB 1FJGJ 4ZN3A 3CDBA 2EK6A 3S3HA 1SJ4P 5EGYA 3HHLD 1VCTA 2EFOA 3BYRA 4ED0A 1WKKA 2J5AA 3E01B 3DRPB 4DFPA 5AE3A 3BDEA 4I6YA 2MB0B 4P7TA 3ZFVA 3GYNA 4V19J 2Y3YA 2LXIA 3EUNA 1RT4B 1HQEA 3PRBA 5F3ZA 1NPKA 4CCHA 1IR1A 3MPVA 2W9BB 2NS1B 2V8DA 4RI5A 3W62A 1ONYA 4ZJQA 4IFYB 4JV0A 2CMCA 1JBWA 4KGZB 1MMNA 2IMGA 1M5OC 2ZJQQ 2JLGA 4JYAJ 4K8RA 4DCOB 4QDIA 5CCLA 1TKXA 3ZZUA 3ZV2A 4Y2KA 2DXPA 1VQYA 3CJ4A 4LSNB 5IWAJ 1KHVA 2RU9A 4DR1F 1CC8A 2VU5A 5KT2A 1G2EA 2MY7A 2Z58B 2QFIA 5H1SV 2BA9A 1Q1KA 4MYTA 3EDRB 3N0VA 4F04B 4YAAA 2PMZD 2GQ2A 1KVKA 2RT3A 4MK7A 1RYSA 2K7JA 4IH7A 3I0RA 3KG1A 5F41A 3F9AA 2P6SA 3GLJA 2NT2A 1LXNA 1HWUA 3QGHA 4UQTA 2DGVA 2LXUA 2GAHC 2BJ8A 2CNKB 1U0HB 2MKSA 2I6JA 3M1VB 4WOHA 2H5EA 4NLQA 3K8VA 1TL4A 4JI4J 2RU3A 1XK8A 3W61A 2KB2A 4UZCA 4ZCMA 3MCMA 2QCJA 5RUBA 4J9VA 1R27B 3MECB 5SZTA 1YN9A 2X7IA 4A47A 1HNZJ 3TZZA 2A6MA 3EVWA 3KK2A 4C48A 2B8PA 1VGYA 4DR3J 2HLTA 2M9KA 5HANA 4LF7J 3W5XA 3BGUA 2HMIA 4UOHA 1FKPB 2HS0A 2E66A 5KFAA 2W4CA 5DQHA 4NCBA 1SQFA 4BLGA 3V2UC 4CH7A 1B0TA 3EGZA 3ZM3A 1SBRA 2DGWA 1OHEA 4DR5F 2JEIA 4AQYJ 2XJAA 1QY7A 2V94A 2VPYB 1ZOTA 1DTQB 4IG0B 3ZL8A 1LOUA 2EBGA 3GMGA 2MSSA 5K14B 3UR3C 1YRUA 4HHUA 1RAIB 1KHWA 5C2CA 1MWZA 4Q0BB 3QLHB 5BYQA 3L3CA 1U2CA 1N6QB 5J1PA 2VZ9A 1EAYC 1IQZA 3VALA 2V68A 4CQ1A 2FTRA 5DO2A 3V6DB 1UVNA 2NXEA 1SC1B 1GG4A 2L3MA 2R4FA 2VOPA 1V3ZA 2IDEA 1ZM4A 2CMAA 3FRZA 1UEKA 2ZH1A 3H4BA 3H4DA 1TUWA 3POTA 4RW8B 4ED2A 5LM7E 5K5MA 1X4GA 3QPIA 2G2ZA 3HHLA 4Y0FA 2FZGB 2NZ6A 3BZQA 1YZ6A 4J90A 3E2EA 3OJSA 2GIQA 4C8NA 3RRKA 1GH8A 4R8UA 2LFVA 2DHHA 4P72A 4QWDA 2ZUAA 1SKRA 1KQFB 1QE1B 4USJC 5B0FA 4DXLA 1FQ1A 1X60A 3OPKA 3VWSA 2CNIA 2RQKA 1BD6A 3BSCA 3DRSB 1QM9A 3Q8VA 5AXLA 5HVHA 1QVGR 5IT4A 1UMJA 4YFUA 1JJ2R 6AT1B 2GAGC 1D5RA 3UW1A 4TNOA 1UFLA 2M5YA 1WG1A 3V0EA 2GWOA 2P6XA 3A8KA 1JNRB 4OYMA 4QWEA 1S1UA 2FVCA 1DTTA 5CYQA 1NHVA 1XNQJ 4OV1A 1GXTA 3CWJA 2RAQA 2Q6CA 2G1DA 2XM3A 4DPYA 3VVUA 2HNZA 4OZ2A 3QQCD 5HROA 1L8GA 4Y2IA 3W2WB 1R43A 1C1CA 1RT5B 3W7BA 2ASYA 3OFGA 4QWAA 2GMLA 2PFFB 5C7PA 1NB2A 2I5JA 3QCGA 3CCZA 1SH3A 4USMA 1KVJA 3IRXA 2B4UA 4CM0A 4X2BA 3FBFA 1WACA 2DO0A 1N36J 3G8TA 2WSEC 1HD0A 1RBAA 3R3TA 2GIFA 2X1AA 1IXKA 3BKTA 4CLTA 2C3MA 9RUBA 3MDFA 1LK5A 4RUHA 1RWVB 3JYTB 3TEHB 4NYHA 3W3SA 1EETB 4Q8FA 1C83A 3TJ8A 2R7SA 3PKMA 2C2ZB 4L75A 2MHEA 2ZMMA 1NJZA 4OQJA 4GS0A 4QUNA 3DOMA 4QAHA 1KLMB 2PT0A 3MOJB 5DDRC 2V50A 2R7VA 5HP1A 2MQLA 3GFHA 3I96A 5KOXA 4M5KA 2N3LA 4A8KA 3M9OB 4J9RA 2GP0A 2WGPA 4B3RF 1S7HA 4FVCA 2Y0BB 1U49A 1HL6A 2P5VA 1YQHA 2HRUA 4DN9A 3R97A 2JOQA 3I80A 3F41A 3RW6A 1YWXA 3NS7B 3BQ1A 4MKBA 2XBPA 3W2VB 3K58A 1D09B 2I4HA 5DDQC 3H25A 1RLCL 1O0PA 5A0YA 1U1KA 2XCAA 2CWKA 2DEJA 2NV5A 3NBPA 4A8WA 3HVWA 2CQ1A 2H4VA 3J80U 2HWTA 4QWBA 4RH9A 3N6LA 4WJBA 2MJNA 4C3LA 3K5LA 1A0OB 1KONA 2RHQB 3BQ2A 1IUJA 1MU2B 1S6PA 4CLSA 4P2FA 2CQ3A 2EWHA 3QYYA 2FJMA 4ETXA 1LW0A 4HH0A 2V67A 5ETSA 2DH9A 1T3NA 1SQEA 4R0JA 1JQGA 4ZVEA 4PQUA 1F60B 4ELVA 4LF8F 1HI8A 4RH5A 2ZM6F 1YZ7A 1HNIB 3H5YA 3VAFA 4HACA 1Q8IA 1AYEA 3JQKA 1WD6A 1RWNB 5E3AA 4C12A 1GNKA 4HHHA 4ZJOA 5J2NB 2DH8A 1KC8T 4PPZA 2B51A 3NMAA 1G1HA 3HZGA 4YB5A 3EX7B 2J8AA 3IG1B 3SXLA 1WC1A 2LDYA 1U02A 5LXYA 2GIRA 1F2HA 1S1VA 1PA9A 3O3LA 2F00A 3FZ2A 3PJWA 4ZLNA 4DQQA 4OFZA 1MN9A 1UAWA 2B4SA 2YKQA 2ATCB 3R6GB 2HGLA 1N32F 2DNLA 3C14A 1LK7A 5KFPA 2KG0A 2JJDA 3PG9A 3PW5A 4JOUA 3H2UB 4IG3B 1YFOA 4MKYA 4JI2J 3MMAA 4LQ9A 5KFLA 3HD2A 3J81Y 5GVQA 2WVCA 2FVPA 2XULA 5F9NA 4NLRA 3LQVA 4RDDA 4OYBA 4QW8A 3AA8A 3D3CJ 1PBUA 1JWWA 2WAQD 5I42B 5IZHA 1IWGA 3LF0A 2XNQA 2HVIA 3MEGA 1S1XB 3BF4A 4LBHA 4JI6F 4C7QA 1M90T 1E8CA 5F8GA 4ECTA 3D9CA 3FQLA 4QW9A 3MR5A 2ASDA 4NZ7A 3QCNA 1M5VC 2MZQA 4JI1F 5J1NA 2HRYA 1FRJA 4CTAA 2U2FA 4B9UA 1TKTB 2E7VA 4DV2F 2IYIA 4DV6J 4AYBD 2QLXA 2NYIA 1IR0A 1FCAA 2JL9A 3TUJC 3AWGA 3I7ZA 2WZ1A 1YG0A 3RYLA 1U7LA 4MT1A 4ZITA 1GFWB 1HWLA 3A4TA 3EICA 4AXJA 2ACMA 1FX4A 2B5JA 3N6MA 2CQPA 4DG1B 1DRZA 2RRBA 3PHEA 4LF2A 4C6AA 5CXTA 4W98A 5HN0A 4J9UE 5IOLA 2J9DA 1T02A 1GFYA 4K4YA 1I94J 4TXSA 4ES1A 3UD5A 4KHRA 4C4WA 2YKNB 1CJUA 3DC2A 2R2UA 4FPIA 2C28A 1RTDA 4DDFA 2ZHAA 3FGVA 5CABA 4RO0A 1HMVA 1FVQA 2H4GA 1UTAA 4I4BA 1C0UA 2LQJA 5KFYA 2VONA 3DXBA 2E7WA 3MM8A 1MWYA 1Q7LB 1TELA 3LP1A 3SYZA 2XSFA 4DR6J 4DV3J 3N0AA 1RTIA 3GIKA 2RKIB 3BPDA 1CJTA 2LQ5A 3D3BJ 4DWIA 1RU1A 1TL1A 4CYUB 2O66A 1YBUA 2CQ2A 4FF1A 2QO3A 5AXNA 4FNIA 5K9VA 2WW4A 1RE1B 3MCSA 3VAKA 4ECVA 1TKDA 2XC9A 2CM8A 1MKPA 4AUKA 3QRQA 4ZLJA 1VQ6S 1T95A 3MR7A 1S0OA 2RJZA 3W64A 1VJQA 4RKUC 4RW9B 3FK4A 3GJTB 1T48A 3DI6B 1NEEA 2ZNYA 3TI0A 1YJVA 2MBCA 4NYPA 3R27A 2I75A 4U8YA 1UJ4A 1HI1A 4FYVB 2MQNA 4M5JA 1NSAA 2SHPA 3ITHA 2YKAA 1VIXA 4XIUA 2FJAB 2AZ1A 4LF6J 8AT1B 4UAGA 2B9YA 5DGAA 2WONB 5G0RA 4LFAF 3THVA 1GQYA 2AW0A 3OBIA 2YWHA 1RJJA 3E3XA 3BYPA 2G0IA 1S6UA 4WIQA 4QYZK 2VL1A 3BBBA 3D28A 1HNVA 2QYCA 1T94A 1AA1B 4C8OA 4ECSA 2MXYA 1HNXF 3OTBA 4ZVHA 3LP2A 5K24A 2YKMB 5CZXA 4FXVA 3S01A 1V5VA 3QGPA 2BQRA 2EFPA 3R1HA 3GV5B 3UN5A 5DLFA 2HNDB 4C0OC 4DOZA 4O3QA 2R8HA 5I3PA 1E6VB 2JRSA 2CPXA 2ZH3A 3QCMA 4RR5A 3SEOA 5E0OA 4UOFA 3DU5A 4HEA9 3MAHA 3I55S 5L1JA 3AOBA 5CCMA 3NAIA 1I57A 3SSSA 2BJ7A 3C6TA 3BR9A 1GQQA 4NLXA 2UUBJ 5KFIA 2MGZA 2DXFA 2FJVA 4ZPWR 3JTNA 2FHOB 4DV5F 4DPWA 3MEEA 2VG6B 2WOMB 2PA5A 2C2NA 3BGRB 4RUCA 4KV8B 4NEYA 4OJ3A 1VQ9S 1NPRA 3NCQA 1SUQB 1HYSB 4I6WA 8ATCB 3PW7A 2VD3A 1P6TA 2AJ1A 2OD4A 4CIOA 3GWCA 1TVRA 5A8KA 5I3UA 5D77A 4GE2A 1K0TA 3D1QA 3MM6A 3RBZA 3RAQA 3AXKA 4NEZA 2H4WB 3ISNC 3MUMP 2X3DA 3ICLA 2VJVA 1RTHA 2Y68A 1IKVA 1HQUB 2QBSA 3CIZA 1S97A 2OEKA 1PGZA 3T19A 3EPIA 3G6ES 1K1QA 2UAGA 1VRTA 1FEEA 1HHTP 3DMJA 2D74B 2K2PA 2XY6A 3J81U 1VMBA 2VG5B 1T9UA 4CVLA 3QCFA 3BLUA 2I42A 2AJ0A 3KJNB 3GPAA 2UUWA 8RUCA 5KFNA 2GO8A 2DEIA 1S1TA 3N9UC 4FP9A 4WFZA 1WHXA 2CPZA 2LU2A 1IR2A 2UVVA 4DS5A 1HPZB 3P49B 1XMBA 2JWNA 3AXMA 1N8RT 3MM7A 2D1CA 1J2VA 3MVNA 2I6OA 2HVDA 1N34F 2V2QA 1R0CB 3BQ0A 2OD6A 2HHQA 1YKWA 3UI3A 2WSFC 2DHSA 3UWTA 1HFEL 3KDNA 1WOOA 2QN6B 2X5OA 2DIVA 3EZOA 1ECVA 1VLYA 4F25A 4HJPA 2NT7A 3MZIA 3NS5A 3MUVP 1FK9A 1AAXA 2RQ4A 5CZVA 1DFDA 4MTPA 1N5SA 2EW9A 1HBNA 1EP4A 2XSJA 2IAJB 3GIMA 3CF5Q 4O4RA 2IPOB 2JC0A 4CH0S 5KG4A 1CULB 2OHDA 2OIHA 1ZA1B 4CLWA 4KJIA 3L7UA 3GTYX 2ZH9A 4J9OA 3IS9B 5HAOA 3CMAS 2KJWA 2QC3A 3CCMS 4DX6A 4U7CA 2WB1D 4RW7B 2AMCB 1WNEA 4C8ZA 2VKRA 2B7BB 1MWQA 2Y1OA 1K1SA 1NHUA 3CMQA 4BUCA 1UVMA 2F1FA 1LQFA 5CYMA 3VAHA 2GS8A 1L5UA 4BWJA 2LLZA 1KFSA 4KYQA 1EARA 2B7CB 4HL9A 3PIPQ 1S9EB 2XPCA 1RHQB 1FE0A 1C4AA 2WVFA 3NGSA 1BQMB 5KAAA 3THTA 3OHBA 1RU2A 1WC0A 2AEMA 1EB0A 3TRGA 1OHCA 3SFUA 3O4SA 2R7WA 5KA2A 1KKHA 3DGPA 3T5LA 1MROB 4G6VB 4WPAA 1SJRA 4EBCA 2H03A 3E8OA 3HM9A 1NXIA 2J76E 3HVTA 1QAXA 1SJ3P 3IAM9 4G3IA 1RAGB 3KHLA 2GVZA 2RILA 4I6AA 3T1HJ 3M2UB 1KQKA 2GJTA 2HURA 3FRYA 4ETZA 1U47A 1NKEA 1N5TA 3LAKA 4R0SA 2DNQA 2C3PA 1SJFA 4IFVB 2BV3A 4ID5B 1R3NA 4FF3A 3MEDA 2B9XA 4K5SA 3G82A 3F9BA 4GC7A 3HT0A 4GO7X 4XTTA 2HHHJ 4PRFA 3CSKA 4XK8C 3S3FA 4B3SF 2XY5A 3IBFB 1WOSA 4DPUA 3CCLS 3RU0A 2BGEA 5KFRA 3QJPA 3VF0B 1PH0A 2B4OA 1FT8A 1RHJB 3R9LA 1EX8A 1NZAA 4LF4F 1JF7A 4ZVRB 3EXYA 2EG2A 4CLLA 2XI2A 1CSJA 5B08A 1DQ9A 2F8MA 4CVKA 1IQTA 3R2CJ 3QCJA 5D0EA 3UDCA 4LMZA 1U26A 2KI2A 4B9NA 3KFWX 3MR2A 1RTJA 3QCCA 1VQ8S 4ZPVR 2QLWA 4XAKA 1XNRJ 2IVMA 5KFOA 4W4MA 1W2BR 1ZTWA 2MQOA 2B3TB 1A7GE 5ETKA 2LP4A 5L39A 4Q2MA 1S6QB 2I6WA 1FA0A 5D4LA 5KA4A 2HVHA 4CRJA 3DLLQ 4JV1A 1OETA 4U9RA 4JI3F 1C0TB 1WKLA 1JX4A 4NCGA 5F8JA 2YNFB 3KLHB 3M8RA 1GK8A 2V6AA 2W2MP 2BYCA 4C8YA 4J51A 4GE5A 3EDQB 1HWKA 2KU7A 4PUOB 4NPOA 4RX6A 1RKIA 7AT1B 1JLNA 4UTGA 5KA1A 2GX8A 4KGXB 1M5PC 4GFUA 3RZ2A 2ACYA 3V4IA 2VHGA 5JXSA 2XMTA 2F63A 1GMVA 4FXDA 3HD1A 1X9MA 4KAIA 1JJHA 4NI2A 1K9MT 4QU7A 1TMMA 5IBMA 4ILRA 3CWEA 3AD8C 2BXJA 2HFOA 4DZ6A 1DARA 1H3DA 3M30B 1QSLA 2M2BA 4OI3A 3DRPA 3CJRA 3KK2B 1ZPWX 3CD0A 4O3RA 1G4CA 1FERA 1WEZA 3MFIA 5LOQA 4DR2J 4YDXA 2Y8WA 3AB2B 5LMNJ 4ZHRA 3A8JA 4NLVA 5A6WA 4I56A 4U7UK 5LJ5Y 2RB7A 3NAHA 4PEOA 4F4WA 1QAYA 2OKQA 4IFYA 2CVEA 3NG8A 2OMOA 1GMUA 3QKQA 2BE9B 4WP3A 3DDKA 4EYIB 4AT1B 4EBEA 5K8NA 5GAEU 2XCPA 5ETPA 4ZVTB 4GRYA 1XMOF 2B3OA 2B07A 2KN4A 4HV4A 2I5XA 4U8VA 1PTTA 4RU2A 2MSTA 1S9GA 1IKYB 4B17A 3QT6A 4DEZA 2M8HA 1S99A 2DPIA 4HKQA 4R5PB 1NKBA 3C2PA 1AFJA 4O4GB 3LP0A 2BW7A 2BM1A 4ZVFA 5KABA 2HEKA 3H98A 3HHLB 4DL5A 5F8IA 5GAGU 1T11A 1U0HA 2ZH5A 3MTKA 3M1VA 4F4KA 3HHKA 3PNIA 1NNDA 2ZKUA 2U1AA 4WU3A 4JI8F 3TEGA 1GXUA 1X4BA 3NWRA 2XTJP 4H4MA 2R8GA 2Y66A 4LRBA 5E2QA 3DCAA 1WF1A 2CNNB 1FVSA 4NYOA 1SC4B 3FEXB 2M4MA 1QVFR 4ZVSB 1JLQB 3IGNA 1PTYA 2XMVA 1FKPA 3ZZOA 1V3AA 2AWZA 1U1LA 1EIYB 4HI1A 5C24B 2CM7A 3SCLE 1FJGF 5HROB 3TR5A 1VDHA 2MY8A 1C1CB 1XTZA 1DTQA 4MBBA 5J2MB 3A13A 5HVFA 1X9SA 4W92B 2DT9A 4QIFA 4RNNA 1U1QA 3Q83A 2W8LA 4Q0BA 4ECUA 4DSJA 1H72C 3QLHA 3IRXB 1HHSA 5EHHA 1DY3A 1WWHA 2OELA 5BJRA 1N6QA 4DPTA 3VGVA 3OSPA 2AZ3A 1YI2S 2QCTA 5ITHA 2QJ3A 4EEYA 3V0HA 3T5JA 2ZC3A 3T9NA 1KFDA 1VR6A 5ETMA 2JSXA 4X66J 4W90B 4Z7CA 2BUNA 3QWPA 3TO8A 2F4VJ 3D6TB 3OTOJ 1X4DA 2JFFA 1G7GA 3O4TA 4RW8A 2GGPB 4LSLB 2RDJA 4Q5VA 4YY3F 1U1MA 2MZJA 3LJ8A 1GEHA 2K1RA 5L9XA 5HP1B 1APSA 2PE8A 3FCHA 2ZJPQ 4C8MA 1HBUB 3NNHA 2MKJA 2I8EA 1QE1A 1YRTA 1JLGA 5FLXU 1H6KX 4OHVA 3M2VB 2ILZA 4DMZA 3DRSA 4WFXA 1IKXB 1RWMB 2I6PA 4IRDA 2EG1A 4UZBA 2QBQA 2X1FA 1RWXB 4KHMA 3VTIA 4B9VA 1H0HB 3KWMA 1VFJA 3KHRA 3D1HA 2Z56B 3SBMA 1TAUA 2M70A 2IJFA 1RAJA 1CEZA 1OY6A 4BCAA 2C2OB 4BC9A 1H73A 4HT5A 5D8HB 1OEVA 1RAFB 4JV5F 4B3TF 4Y6IA 3CTRA 2E5IA 1RT5A 1X5TA 5KOWA 1H7XA 1LW2B 4F67A 1S6PB 2I3UA 1HNWJ 1HNZF 4C9DA 4X62F 2O01C 4TLRA 3PVXA 1NJXA 2V63A 3PY8A 5BR8J 3HHEA 4RBUA 5E3RA 2FVSA 2CADA 3MEKA 3ZTRA 2Z2MA 1HD1A 2DO4A 2QL7B 4OYPA 5C2GA 3SSQA 1J5EJ 5L46A 2L48A 2HHSA 1M5KC 2PGCA 4PYDA 4WU2A 2LEPA 3TZWA 2RH3A 2E1PA 3QAUA 3JYTA 2ZN7A 3W63A 4K2XA 1EETA 1RUSA 5B7WA 4KH0B 2UUCJ 2BJ1A 1OQ6A 4WE1B 3R7NB 1IVZA 3A3NB 3T1YF 1S77D 3TAPA 1KLMA 2D41A 1U8WA 4FBUA 2CUYA 3BREA 4PWWA 1IBKJ 4OX9J 2KYXA 3AT1B 2DTJA 1Y4ZB 1RT3B 2AU0A 1S1VB 3MOZA 3GJQB 4N47A 2APOA 3NMRA 4RJVA 5A2QY 4X64F 4FKYA 4OI4A 1FF2A 5IV3A 5I4MA 4CLUA 5U47A 1BY9A 3BGFA 3CW2C 4RBVA 3K0JA 1RPMA 5HK4A 2G4BA 4TY8B 3AD9C 3W2VA 1VBYA 3R5AA 3HHLC 1PTUA 3PEHA 4USWA 4USVA 2IA0A 3QCZA 1KRPA 1YX2A 3Q8PB 1NB7A 3EMUA 3CC2S 2FB0A 3MAQA 1SL0A 3MURP 2UZAA 3JSMB 5L1IA 1N54B 2H5IB 5LL6d 3EE3A 6FDRA 1XQIA 3SCKE 4EO8A 1QD1A 1MU2A 2YQ3A 4BUBA 3C66A 1DQAA 4X4VA 2RD5C 1VQ7S 2A3JA 2XMAA 4CVMA 4J9PA 2IM0A 2YPZA 2DCUB 3NS6A 3DLGB 4ZCLA 3J7AN 4R25A 3KDOA 2Z4PA 1YTNA 3TVYA 4F4ZA 2D69A 1QAJA 2A1BA 2ZDPA 3I87A 1S5ZA 3OL7A 2QSFA 2CPJA 2J0XA 1HNIA 2IJRA 3JSYA 4WYWA 3CVKA 1FKAF 1NRKA 3PJXA 2VC0A 1ZZWA 4IDKB 4LRFA 3GJRB 2J9CA 4AL7A 1P9YA 3UN2A 2UVWA 5J2NA 1L3TA 4KRWA 4DF4A 4CLKA 1Q5YA 2HNPA 3ZM1A 2XWXA 5KFWA 3J7A1 3FMWA 2ROPA 2YY3A 1OHDA 2F3JA 4DL3A 2UXCF 3IG1A 2AHSA 2JEGA 5DQGA 1RABB 3T41A 4DV4J 1JLFB 5IXUA 1T3OA 3VAIA 4N5SA 3M7VA 4ZIVA 2Z57B 2VBYA 5ETVA 5L1LA 5DDOC 1VJWA 5A8WA 1XC9A 4EBDA 3MM8B 2F8HA 4ZPBA 1FJ7A 2FJEB 4F2SA 2L9DA 5HATA 1NJYA 5HQLA 4NRUA 3AH6A 3KNGA 1KP6A 3O4UA 5DZ7A 3ZM0A 4NOHA 2A2DA 2A8BA 4PG4A 1CJTB 2KZMA 3H20A 2CZ9A 4N8OA 1Y3JA 1S1XA 3ZO7A 3N79A 2N7CA 2ADBA 2AYEA 4X4SA 2MTLA 2JX2A 3IXQA 2WW8A 1RHRB 4DL4A 1E0DA 4ERDA 5DG7A 3PX6A 3LWLA 2XHCA 2Q79A 1KAVA 3P5TL 3BKFA 3I31A 5C42A 3T1AA 1TKTA 2MDAA 2HHUA 3A8EA 4ITSA 1KTQA 2CIMA 4ZOSA 4TN2A 4A8MP 3QRRA 2CNLB 4DFJA 5EHRA 3NGUA 9ATCB 3HT3A 2V2KA 2AV5A 1L3UA 2WTFA 2HFVA 3OLBA 3H5UA 1M5SA 2DXDA 2DRDA 2D3ZA 1P27B 2OOQA 2PSZA 2R8JA 2IYGA 3WBZA 4DG1A 2E5LF 5HI7A 1PKUA 2JH3A 3ZZYA 4U6PA 2LKZA 3CJQA 5BYRA 2UUPA 3ZM6A 5GMDA 4UQGA 3BM8A 2P6TA 4YR8B 2HKEA 3QRPA 3OR1B 1TTHB 3LPYA 1HWJA 3HLUA 2XMMA 1P31A 2FDNA 4O0NA 1UWBB 2W9CB 2QLBB 1Q8KA 3ZZPA 1JNZB 3ET6B 5LSRA 1RWKB 3ENQA 3TUPA 3BS9A 3SDEB 4ELTA 1S0MA 5IQQA 4ZN1A 4KGMA 2UU9F 3V6HA 1TK0A 2I6MA 1CVJA 2XNRA 1LKZA 2XI3A 2RKIA 3D7SB 3EPGA 4J9SA 1L3SA 1OS5A 1CBKA 1WEXA 2W25A 4DR1J 3RB6A 1G1FA 2LQ9A 4MYUA 4GC6A 2HFZA 1F9HA 2Z2ZA 2RF6A 4DCPB 2VEXA 5LJ3Y 5J1EB 4HTJA 2I2YA 4C3KA 2GFFA 4F8RA 1G4WR 4NLGA 3BO4A 4M5NA 2XEXA 4RW9A 5CAAA 1K8AT 4K0KF 2IVFB 6FD1A 3DI6A 3F0NA 1TVRB 5I3UB 2MQPA 3ZTQA 3AODA 2F71A 2W4DA 3LK7A 2PBNA 5HQMA 3G6XA 1UFWA 1PXHA 1IKVB 4DX5A 4JI5F 2XZDB 2C3YA 4KBIA 3HO1A 4WZQA 3PTWA 3HVRA 2OZ5A 2VTDA 1VRTB 2WONA 3GQCA 2E1AA 1NH7A 2EKYA 2H9ZA 2V34A 3TQEA 3LA0A 1YDLA 3U02A 2DNGA 3RB4A 3OVBA 4JBCA 2OPSB 2JEFA 1JJCB 1N33F 2DR7A 4KKOB 4M5IA 1RQ0A 4NMXA 1Q6TA 4MIWA 3K59A 3AJ1A 5KA8A 3H7HB 1REVB 1XR7A 1PYNA 2YKMA 2VH7A 4USHA 2YH0A 4DR5J 4QWCA 3NMEA 2R7RA 1FD8A 5KFQA 4PQAA 1FWPA 1HBMB 2HNDA 4LVOP 2MZTA 3ZNUA 2OPPB 4RI4A 1FDDA 2CDQA 2R7UA 1CJVB 1E6VA 5LMUF 2BR0A 3FMBA 4B9SA 3DRRB 3G8SA 2R9LA 4DSKA 2XHWA 1FESA 3ADAC 2QBPA 1UETA 4DZDA 2A2CA 1BQXA 4DV7F 1T9YA 2KVQE 4ECRA 3DXSX 2RRAA 3K2YA 4GRZA 1NDPA 1N56A 2VG6A 3EGWB 1EP4B 3RZAA 3BGRA 3C15B 4KV8A 2XSJB 3Q22A 2DNHA 4CO4A 3K5MA 3KLIA 1RT6B 5HMXA 3D5MA 1HYSA 5GMEA 4ES3A 1BLUA 4H4KA 3QO9A 3J7YI 2NXNA 3TZYA 2PN6A 3X3UA 3HP6A 4KQZA 4DUZF 1T9XA 1SB6A 4X4UA 3AQPA 2AYGA 1XRIA 3KLFA 5L9NA 2W8KA 1HQUA 1KBRA 4DR4F 1NJWA 2QX0A 4B04A 2C7SA 3BR8A 5F8LA 5D78A 1PC4A 3Q0AA 2ATLA 2CZVC 1FDBA 2DNPA 4K50A 3KJQB 1YRXA 1IBMF 4FF4A 4M95A 1PJ5A 2RE1A 5AJ3F 2VG5A 2C3OA 1VQ4S 5K9FA 4DCJB 3BSOA 2HW3A 1HARA 4ZPAA 3PW4A 2X1BA 1RI7A 4L3NA 4MKAA 2H65B 4DQRA 1EEHA 1F0XA 1VBXA 2QIFA 2OFHX 4KFBA 3PW0A 2DH7A 2I38A 1BXNA 1LWXA 1VBZA 3HJVA 2MHNA 1BC6A 2YWFA 4EWTA 4ILLA 2I0XA 3DOKA 4J9NA 3ZTSA 1RP5A 5HSPA 2HZCA 4X4NA 5MMZB 2BRKA 3S6EA 3LWMA 1RHMB 3ETMA 2W2OP 1OY9A 2GVZB 4EK2A 3R5BA 1DAXA 1XXPA 4RHGA 3LO3A 3ENWA 4GMKA 1BQNB 3OFEA 5F0UA 4DSIA 4AL5A 3BSAA 4C0BA 2V4QA 4TU9A 1RXOB 4LJMA 2C3UA 3JS9A 3MEDB 2BACA 3D42A 2R7OA 3R6LB 5H9FK 2H4KA 4JI0F 5G4DA 3G82B 1TL3A 3SCJE 3PX4A 2IAJA 4QR2A 1U8SA 3H59A 1C1BB 2RUSA 4M1KA 3NOGA 4KGKA 4OI0A 1FFWB 5HVGA 1CULA 4QIGA 1RA6A 3IS9A 3KNAA 2IC3B 4J9KA 2IRYA 2NXJA 1NK8A 1FFSB 3Q8UA 2VDIA 1YJRA 4K4ZA 3M2RA 1OYEA 2ERRA 2E0TA 4B3RJ 2QLFB 4DQSA 3KLEB 2RDIA 2OJ3A 2UUBF 4LF9F 3MCNA 2YNGB 5GADI 4G1PA 4K5RA 1C2PA 2VG7B 4NXNJ 1YJWS 1U45A 1S9EA 4M5GA 1NNYA 2E1RA 1BQMA 2P9GA 3OFFA 3EZ5A 4WF9Q 2AD9A 2VB6A 2HFSA 3CO0P 2BRLA 2GC5A 4K4WA 1NK9A 2ZZTA 3IWXA 4NLSA 2W7OA 4JV2A 2CNOB 3UDEA 1SXLA 1SKUB 3HPOA 2C2DA 3P8BB 4GVLA 3K89A 3PR4A 1MROA 1VQSA 1VQKS 1X5SA 5DS7A 2NQPA 1LEOA 1YGRA 2KT5A 1ZM9A 5KFKA 3C16A 4ED4A 3P3DA 2GQQA 3NKYA 5KFCA 2RF2A 4IQMA 3F81A 3KK1A 2XMWA 4WFYA 4JI7F 3M2UA 3VZHA 4GKKF 4ZVOB 1HHQA 1HBOB 2ZM6J 1ZBTA 1CS4B 1GX5A 3PV8A 2GJIA 3RR8A 4AD6A 2VQEF 3V4IB 3DHWC 1WORA 4ID5A 3TA0A 1F6TA 4ZP6A 4NI2B 1P8GA 1WTFA 2AIRB 1O51A 2XLJA 3M8QB 4LF5J 3W9IA 3OD2A 4D3QA 1U24A 1LWCB 5CD4A 2R7TA 5EDWA 4DU8A 4IR1A 1KD1T 3LGMA 3CCJS 1YLXA 2YKPA 4DX7A 3ILLA 3THPA 2PDAA 4V1Ak 3VHQA 3QCLA 4ZHRB 1R6VA 3ZTPA 4QR1A 3DYAB 1N32J 2D7SA 5IT9Y 5M2RA 4QAPA 3M4XA 4WFNQ 2BABA 1PTVA 2B56A 2CFXA 1SH2A 4P74A 3Q8SB 2DY9A 1S12A 4IUFA 2H51B 2QDMA 5D3GA 1R8AA 4ZCIA 3D0IE 1HW8A 3KYLA 1KOHA 4IO9Q 3P45B 4DV0J 3OXLA 3FCWA 2LYVA 1S59A 2W2PP 2I4GA 2VFTA 3A12A 2CQGA 2ZDOA 4PG7A 1S9GB 3W9JA 1S6QA 4JI6J 3QZ7A 4MAKA 3OLRA 1NK7A 3OQ2A 3QMQA 4U67Q 1C0TA 3EGNA 1S9FA 2CAJA 3DRYA 3FBBA 2YNFA 3KLHA 3LP0B 1UKUA 3T9ZA 4PAAA 2V0NA 1W2IA 4QIWD 3TUIC 4PUOA 2DGTA 4DV2J 3CJ3A 3N01A 4IKAA 3U96A 5H9EJ 2KTQA 2ZUGA 2BV5A 1RAEB 2POKA 3CJ5A 5KG7A 4OIXA 1DHMA 4Y34A 2VBZA 4M94A 1EQ0A 2XZTB 4H4MB 5MAOA 4LQ3A 2IRUA 3D6MB 4ZVQB 4USIA 1OEUA 2Y1JA 4WXWA 5DZ6A 3UDLA 3M30A 2ZOMA 4HVZA 4WBFA 5KFXA 4ILMA 2J0WA 3T1HF 4ZIWA 4NXMF 2VA3A 5KFGA 4KC5A 3OVAA 1ZZNA 3RAXA 3KMSA 3V0JA 2BVZA 1WKJA 3I4PA 3O2IA 2KL8A 4WK3A 5GMKa 3PX0A 3C8YA 4B9TA 5KFEA 4GE6A 2ROGA 2QMXA 1HA1A 3GYGA 4H34A 4Y3CA 3MI7X 3Q24A 4NA2A 2FJNA 1R0AB 4GKJF 4XPEA 2OP5A 2E5GA 1FWKA 1PIEA 3CMES 1TUVA 4OYAA 3VGTA 3BN4A 1NU4A 2WBMA 4FNHA 3R7SB 2MKIA 5KG3A 2MJUA 1Q81T 2IFXA 2KZZA 2XB2D 1C85A 3M32A 4B3MF 4OX8A 4Y2EA 1IKYA 5CQGA 3BO2A 1WUUA 4I67A 4F3MA 4YHHF 5D6GA 3GZ7A 2W4PA 3GFXA 1NZ8A 1JMTA 3BN7A 4X4RA 2JFHA 4OZJA 4R5PA 4GWFA 2Q66A 3IA0A 2CPIA 4O4GA 1RADB 1Q95G 1Z2ZA 3RB3A 3EB1A 2FJWA 2K1RB 4U7UD 1FX2A 2FLPA 4NWGA 2JLFA 2HXPA 4IQXA 1S48A 2QL5B 1UZHA 2EXUA 1PJ6A 1TUGB 1SQGA 2PFDA 3ETOA 3CC7S 3TOQA 3OLAA 4ED3A 2IM1A 4OJ1A 2WRMA 1JLGB 4J5OA 3SQOP 4LFAJ 1SKSA 1G6BA 3D9BA 1VC5A 1YK9A 3V5RA 3HX9A 3H2XA 5IC6B 2OEJA 1RACB 2VJUA 3BKUA 2DHGA 1JLQA 3UD3P 1O6XA 3HF5A 1HNXJ 3W9HA 5F8NA 1U0SA 1NK5A 1EKSA 3I56S 1FRMA 1RT2B 2R2RA 2ZC4A 1KLNA 5C24A 1H2UX 2NXCA 1WDTA 1R8HA 1L3KA 2KH9A 2YWGA 3FCVA 1L3VA 5J2MA 3RBEA 4NRTA 1SJQA 2KJVA 4ECWA 4DV1F 2CA9A 3EZUA 4USKA 3V0FA 1FFGB 4CO1A 1KS2A 5B0CA 3H2VE 4PXBA 3RBXA 4EGLA 2W7PA 4BJOA 1RBOB 2KXFA 4AE5A 4UUXA 1QXKA 2VFVA 3F99A 4DL7A 4NZ6A 1XMQF 1ZPVA 1G7FA 4DV5J 2OMLA 2CPEA 4WP9A 3HULA 2NREA 3WX8A 2C1EB 3V6KA 2GGPA 4LSLA 1IM4A 4LRDA 1NO6A 1G3OA 2ROEA 1VHRA 1WI8A 2DITA 3KXDA 4O3OA 1I51B 2B6AB 5IV4A 1QZ0A 2CJAA 2G2OA 2ZBIA 3W8PA 2CWXA 2PA8D 5IT9U 1N52B 1HBUA 2W2QP 3HSJA 3NGTA 3R8YA 1ACMB 3M2VA 5FJ4A 2VBXA 2WJPA 2MKYA 1IKXA 2ZH6A 4J9QA 5SUHA 2BKPA 2VF3A 1YJ7A 2M8DB 1RB0A 3M8PB 1FNXH 1PAUB 2J16B 2H5JB 2ZBQA 1NDLA 2EC2A 1VQLS 1AUSL 4PG8A 4CI0B 3GXGA 2IMOA 3CCES 2P8IA 4O0IA 4LR8A 3TARA 3S3EA 3EMTA 1JLCB 4OYOA 3GXHA 2ZNZA 1LW2A 1N34J 5J2PA 1PYOB 2C22A 3SV3A 3K5NA 3H8YA 3TX0A 4N77A 4NA3A 2XO7A 4M5HA 1K44A 1S6OA 1DBDA 1TV6B 4DHVA 2LQ8A 2RMLA 3QIPA 3CD6S 2HZAA 1YWFA 2Y8YA 5DQIA 4ZI4A 4YOEA 3PDNA 5KA0A 5ETQA 1JB0C 5DJBA 3VQTA 2LECA 2OTJS 3W60A 4ANCA 2PA3A 1WSRA 3W8GA 2F6ZA 4RNFA 4CLZA 3DLBA 4IYQA 4A48A 4WE1A 2KT3A 4DJBA 2HRTA 3OL8A 1VRUA 4F0MA 1RXDA 2RS2A 3FEYB 4QYRA 4DN0A 2VKZG 2E7XA 1RT3A 2VODA 4DQIA 2QDCA 3KG0A 3QZ8A 2A3KA 4UY8T 4A8YA 1JJ4A 5A8WB 2DVIA 3US5A 1L8KA 1Y3KA 2HHXA 4IOAQ 4NX9A 4N56A 2B9EA 4LVNP 1RK8A 4MIBA 4TY8A 3EM1A 4EO6A 2ADCA 4XPCA 5EX3A 4N7TA 2DCLA 1DJ0A 1ROFA 2GV1A 2XMKA 4A8SA 4DUYF 3AA9A 4AL6A 1SIWB 3IP0A 3MGJA 2GJFA 3H0PA 1BUXA 3JSMA 3NLCA 1PBAA 1Q79A 4N41A 4CO3A 1X0PA 1XR6A 2FZKB 4B3OB 1X4CA 5KACA 3T6JA 2OGUA 1BZJA 1KR4A 2JEJA 5T41A 4P52A 3ZC4A 2AJQA 2CJ9A 1XJWB 4LRAA 4WTOB 5C42B 2V4JB 3DLGA 4NASA 4QR0A 3QJLA 2IDLA 3TX8A 2V9WA 1X5PA 3WQPA 1NDCA 1H7WA 2DR5A 3DU6A 5KFBA 1CG2A 1R89A 1FDAA 4K59A 1W26A 3NOCA 1AZSB 3SI8A 5KG5A 2HIQA 4IDKA 4RNOA 4QPTA 4BWMA 2FH7A 4TYBA 2HIYA 3QFWA 1VRQC 4B3SJ 3W65A 4YB7A 2BANB 2J0QD 3T5KA 5GAHI 1ZAXA 4V19X 4OI6A 4USUA 1WG5A 1JLEB 1JLFA 1UCNA 4LF4J 2RIJA 1XBWA 2CNGA 1NM2A 4NLTA 4UUWA 4RWXA 1OQ3A 1SPBP 3JQMA 3OUYB 1D3WA 1KSPA 2GCBA 4O44B 3BGOP 2JC1A 1KAKA 3O8WA 2HK2A 3ENVA 2Z2LA 5AT1B 4IRCA 3ZNJ1 4P73A 1YTSA 2OLWA 2WVBA 3D2WA 2EFQA 3U1LA 2CJXB 3PYZA 4DPOA 2DBBA 4MK9A 3FKBA 2CJZA 3PIOQ 2ZBCA 1NHKL 3SSRA 5KFMA 5F8HA 1GTEA 3HSZA 2I6IA 4MJKA 2MKKA 4ECQA 3GU0A 2MMYA 1P9QC 3I9ZA 4ZCKA 1ZTTA 3PO5A 3MFHA 1O5JA 4YMEA 4JI3J 1JK9B 2ZJRQ 2HGMA 2KXHA 1P15A 1KWMA 5DM6Q 2BOAA 1Q6PA 1N5VA 1GX6A 3LANA 2HVZA 3CNQP 3QBCA 2FIUA 4Q44A 1M1GA 3ELHA 1FD2A 2VTEA 4URQU 5KA3A 1Q86T 1X5OA 3MHYA 4KR0B 1NAQA 3IFEA 1HQ2A 4RNMA 1OMSA 3S8SA 2YX1A 3N6NA 4QIVA 1NK0A 2HC1A 3HI9A 1SV5B 3UE2A 1Q6JA 4MFBB 3M05A 3HFVA 3QGIA 1UVJA 4ICZA 4DF8A 1YHQS 4ANDA 1NKCA 3M8SA 4OJGA 3DLJA 2UVUA 3CJKB 4KIAA 3ZZ0A 2BX6A 1UEUA 5AWXA 1KOOA 3OMHA 1YPTA 2KXNB 1IKWB 2HS3A 3V6JA 1G1GA 3J7Z5 1TU0B 4RLEA 2V9KA 3Q2SC 1S7IA 3OR1A 4YR3A 4DSFA 2C2RA 2HFNA 1REGX 3M9MB 1FPZA 2IA6A 2ZFHA 2YPYA 3GSIA 4MK8A 1U09A 1E6YB 4OL8A 1UWBA 4LRCA 2W9CA 2QGFB 3CT9A 3QSIA 3ET6A 3RG6A 2H4YB 3SDEA 1TL7A 4CO0A 3MMCB 2CQ0A 2E1CA 2RUGA 3P5BP 3BDPA 1IM6A 3C3LA 1OEOX 1FRXA 5DLGA 1RYRA 3BBFA 3T3FA 1XMOJ 3I5AA 2FLOA 1SKWA 4P2SA 2KFZA 2WVEA 4C3MA 5CYJA 1VK3A 3CCWA 1NH8A 4FVMA 4H4OB 4EMDA 3KTQA 1MNEA 2HBZB 4OYXA 2XMUA 1Q8LA 4CZCA 5J1EA 3EYZA 2CG4A 3G2XA 4PXCA 1TMJA 3Q8QB 2CMBA 3C46A 1D1UA 4LREA 1OIAA 2CQ4A 1Q5VA 3TUZC 2CPDA 3KLIB 1QSYA 1JKHB 4CM2A 2DGSA 3FNNA 3QO9B 2VQFF 1T9WA 3UVJB 2UXBF 2FQQB 3GV7B 1W78A 2V8PA 5FDLA 2GNKA 1Q4RA 3LUYA 3EXCX 3FSYA 3PRVA 2WK4A 4NLUA 3IR7B 4URSA 3KLFB 3CO9A 2D9PA 2F7VA 2XGQA 2YNHA 4JI8J 1FXDA 4PXEA 1OESA 1LWEA 7FD1A 2DNMA 2Y2FA 3U7JA 1EKRA 4P75A 2NXUA 4RWWA 2QG9B 2UXDF 3PR5B 4OHDA 3IN5A 1T8EA 3LALA 5KG0A 1KTVA 1KEKA 1FRKA 3TANA 3B82A 1T0TV 2L9NA 1YTYA 2OPSA 3PO4A 1TK8A 5T14A 1HR0F 4KKOA 2FYXA 4WFAQ 4B9LA 4DL6A 2HQIA 1FPRA 3IC1A 4KFBB 3I4HX 3QCIA 1REVA 4PPDA 1FEHA 1T4JA 3G6YA 4LIWA 2HAIA 3NGKA 4GVBB 1RAAB 3DOKB 4I2QA 1HBMA 4M63A 3CUNA 2OPPA 4ZPTR 1XN9A 4J9MA 3M9NB 4D3GA 2CVIA 1C88A 1FDNA 1CJVA 1CPZA 1J5OB 2EFNA 2B4VA 3DRRA 2NSCA 4XO0A 2EVZA 3HDSA 3WX4A 4HTIA 2B8QA 4NL5A 1D9DA 1I6JA 5IFMA 4WFBQ 1ZZFA 3G87A 5C25A 3GIRA 3D68A 5CA5A 2MYFA 1FHTA 1TL3B 3C15A 4FS1A 2M3DA 2QA4G 4O3PA 2EI5A 1RT6A 2QA2A 2DY1A 4J37A 2JHEA 3VZIA 4YY3J 3QCHA 2LCWA 1VQMS 2I9SA 4FYXB 3MCOA 1RBLA 3QSYB 5E3QA 1K47A 2OPQA 2DR6A 3M2RB 1SC3B 1CQMA 1NUEA 2ZH2A 1LWFA 3QWUA 2BQUA 4DQPA 2FPHX 3J80Y 4RL1A 4I8NA 1XEZA 2MLYA 4ZLLA 3LGHA 4F0HA 4C13A 4MKVA 5K9WA 2DNKA 1HWIA 2VPWB 1N0VC 4ZPDA 1HI0P 1X7VA 4OZNA 4PG6A 3RUBL 4HDGA 3IM9A 5EHPA 3UNGC 5KFJA 2KFNA 4ER8A 2MEWA 1RTZA 2UUTA 1I1GA 4CNZA 4LFBF 4WWSA 5JVGQ 2NUUG 1FWLA 4F36A 1D8YA 4JV5J 4B3TJ 2R3VA 3OR2A 1RWWB 5KA7A 4M5DB 3AHPA 4YUDA 4C98A 2ZE2B 3AQOA 1IBLF 4I64A 3CDEA 3CJSA 1FGSA 1BHNA 2ZVIA 2R0BA 4M8LA 4WP8A 3A8IA 4X62J 4Z2XA 2Q47A 1UJ5A 3C16B 1NSQA 2RF2B 2OSRA 3KUHA 4S0GA 2I1RA 3M4UA 3KK1B 3SZ2A 1WDDA 3QCDA 5KG2A 1MN7A 2L9WA 1QSSA 1BQNA 1GXLA 4ECZA 5HLFA 1F1BB 1QTNB 4WYLA 2JFKA 1TL5A 1U1RA 4G1QB 4DL2A 2AM2A 2V69A 4FF2A 2BJ9A 1FRLA 3KUGA 2E9TA 4DU7A 3QT7A 1Q16B 4HDHA 5CD4H 2Q1LA 2B43A 1QUPA 3WC2A 2B49A 4HH1A 2DRAA 3T1YJ 1C1BA 5LXRA 3C6UA 1N4LA 1WRMA 1WHYA 3MWBA 2AGQA 3PZPA 2GVDB 1DURA 3TAQA 2VEWA 2IC3A 4I69A 1NBEB 2E9RX 4LSZB 1ZC0A 3KLEA 2EBEA 1RHUB 3RB0A 4WIIA 2YNGA 2D9OA 2IIHA 1G1XA 2VG7A 4X64J 3A3OB 1ZAWA 2GC8A 2FLNA 5B0EA 5GTJA 4HHJA 2LA4A 2AF6A 4ANEA 2DISA 4H4KC 2CQBA 1S10A 3RO1A 1ZCKA 4ZVUB 5D3GB 1VQNS 3RGIA 4LBPA 4R30A 2HNYB 2B9WA 1SVDA 1J27A 2QFJA 1NL9A 1F5CA 1FXLA 4QYZJ 3KHHA 2UUAF 5F0WA 2BIJA 2X51A 3B6BA 3EAXA 4YR2A 4IRKA 2BKNA 4DI6A 2OAUA 3CE8A 3KKFA 2XLIA 3AJ2A 1ULRA 1Z2LA 4N8NA 2Y96A 3K57A 2ASLA 4L76A 3V0GA 2OUGA 1HBOA 1CS4A 3KOAA 4DR7F 2PI4A 4CP5A 4ZIYA 1SI9A 3V0IA 4DFKA 3UCZP 3HXMA 4OZ0A 4IO1A 3O6QA 4Q2LA 2CPYA 1YZ4A 4E8UA 3TYTA 2C2MB 4NX8A 1JBVA 3M8QA 1R0BG 1J4XA 3N28A 2KG1A 5E3PA 4OYIA 4BC7A 1OY8A 4DLEA 1LWCA 1BWVA 2AHOB 1CJKB 1VK8A 1FRIA 2VIHA 2Q43A 1BE4A 3FFIA 4IOBA 2UXCJ 3AB4B 1RZMA 1R7IA 1X31C 2K7KA 4Y00A 4DS4A 5HMYA 2CRLA 2M3VA 2NPFA 3TQ1A 2F6WA 3PRDA 3WIVA 3DYAA 2BJ3A 2J8SA 4A46A 2CNHA 2GCAA 2IVYA 4E2FB 1TFWA 1YTWA 3NEKA 2G1HA 3HHNB 2WHOA 3L09A 1XBOA 3CCTA 2CQDA 3PJ9A 1FTRA 3NRBA 3M8ZA 1TQLA 3MM5A 3OTDA 4RNHA 1W7KA 2VEYA 4QBUA 1QAIA 5ETOA 5KFHA 1ELOA 1FKOB 3MD3A 2H02A 1Q0NA 2VEVA 3S4OA 2Z2YB 2PEBA 4E0DA 4Y2CA 5A8RB 3AWFA 3M32B 2ZHOA 2MKCA 3GONA 4NXNF 3I82A 2N3OA 3I32A 4KHPF 4F50A 5A6PA 4DL0C 3GCWP 2HS4A 2VDHA 4PZVA 2HZVA 2NLKA 3Q86A 4O3NA 4DPXA 4N76A 1RLDA 2ZWPA 1H98A 3QCBA 3QT8A 2F65A 4ECYA 3W66A 4NA1A 2XYHB 3ZZZA 1LNQA 1WI6A 3PFEA 2AEJA 3CJ8A 3PYEA 2C2EA 2W9AA 1NSKL 1QUVA 4KTQA 3IR5B 3GR1A 1NSPA 1N88A 5I3QA 3W5ZA 5M2UA 5M2PA 4F4XA 4CH1A 1EJ7L 2VA2A 2CPFA 4X65F 2E5LJ 3J7YU 2E44A 3UR0A 2RVJA 2JVRA 1PA1A 2OH2A 1WHVA 1H2TZ 4I7FB 3G6VA 2QZ8A 2QE5A 1UPMB 1UVLA 3V0DA 1URRA 4HYKA 1AXQA 5KADA 4YEAA 4UOGA 3R5DA 5CHCB 2MQ8A 2F9DA 2W24A 4LFCJ 1FO1A 3L95X 2LQBA 2J7KA 3D1OA 4ZJLA 2VFRA 2ABYA 4LF5F 2QMWA 2QA4S 1R0AA 4X4TA 2BDPA 3L7PA 2J9EA 1T49A 4NCAA 2UU9J 5A76A 1PSDA 2PI5A 3QGGA 3K5PA 1OEMX 4TQRA 2QL9B 3D67A 2J7WA 3R5CA 5KFFA 2ZBPA 1OJ4A 2AJ4A 3R7BB 4EUVA 2VV5A 3ILJA 1WC6A 3TJ9A 2E5JA 2QTWA 4GO5X 2R7XA 2ZH7A 5JJBA 2ASJA 4JYAF 2FGCA 2XMJA 3CIMA 3ILOA 2M0GB 4NWFA 4JNBA 4K0KJ 3MXHP 4C11B 1U25A 2YX7A 5AXMA 2HQDA 3EWGA 2HWIA 2D3UA 3I9V9 4DV0F 5IWAF 4U96A 3AJDA 4KPCA 5KFVA 1W25A 5I6VA 4JI5J 2CM2A 2HVLA 1OWXA 4F26A 2W7AA 3ZM5A 1NO8A 3UN3A 1NWEA 3B78A 2AQ4A 3CD5A 5KTQA 4G1IA 4P2MA 1RSCA 1UW4A 5KFZA 1B7YB 4Q45A 4ZPCA 5DG9A 1N33J 3Q8YA 4CDIA 3KJVA 2LMIA 5B0GA 2KM8B 4Y14A 3QCEA 3G8QA 1RT2A 3RR7A 2NZCA 4JI4F 3NGRA 3F56A 1YGYA 3SCIE 1WC3A 5GADU 1ICEB 3H5SA 3WHIA 1Y5LB 2BE2B 1IBCB 5J2PB 1IJFB 1DQ8A 1U1NA 4B08A 5KG1A 4KPYA 1NCLA 2CYYA 3MM9B 4DR3F 1PJ7A 5LMUJ 2PMHA 4LF7F 4BHQA 1XR5A 1OPIA 2OPRB 3QIPB 5K23A 3C19A 2MPUA 2RS8A 4F0KA 3NNCA 5KFTA 4FYYB 3TNVA 3OSNA 4DV7J 2VOOA 3D44A 2AEFA 4AQYF 4QF5A 1S0NA 1Z4UA 2XS7A 5HBMB 3HFZB 5BX1A 3D0HE 4QZVB 1Q6MA 4B02A 1Y7PA 1KNZA 1VHFA 1X4AA 4OLOA 3UAGA 3AFGA 2DJWA 2AM1A 4YDDB 3TA1A 1VRUB 3UFCX 4DUZJ 3IMQJ 4Y2AA 1M0SA 1UA0A 4X4OA 4L73A 2B6AA 1U6ZA 5KFUA 2JNJA 1TAQA 4DR4J 3GG1A 5KG6A 2WSCC 1ZM2A 2ZOGA 2HSEB 2DHAA 4M5MA 4WKYA 5HL7Q 5ETLA 2VASA 5J2QB 1IBMJ 3TW0A 3JAMY 5AJ3J 3MTJA 2XZWA 1P1TA 1UPPA 2B4PA 1B4SA 4OYWA 2F46A 2CZ4A 3M8PA 3N4WA 2NTAA 4TYAA 3WIUA 2PC6A 2J16A 2XY7A 2DNYA 1U4BA 4F7VA 2YXLA 3CULA 2R2SA 4AZ1A 3HMJG 2YQ1A 1YSJA 3TVZA 3OL9A 1RISA 4A4JA 3CCSS 3CC4S 3TAMA 1AUDA 1JLCA 1WSVA 5IQ6A 3V81B 2Y0SD 2HQGA 2ZD1B 2AZRA 5C5JA 1UJ6A 1FRHA 2CKWA 1TKZB 2HYIB 3J7ZT 1B70B 1S79A 4KGVB 1VYAA 3DLEB 3IAS9 1MW7A 2A18A 2GMJA 3RBDA 2GO9A 5F3TA 1OYDA 2GMHA 2YNIB 1TV6A 3VAGA 2A0FB 1XNQF 4ZMMA 2F70A 2RSQA 4CLPA 2WB4A 1WAXA 1EZZB 5ETTA 1LQ9A 3KLGB 5AE2A 2COLA 2ZZMA 2CJQA 3L4BC 2OSQA 4JI0J 4WCEQ 3B4DA 2JJ4D 3SQGB 3GV8B 3S3KA 1V6HA 1JLBB 2QDPA 4OI2A 4QUMA 1UEVA 3AOAA 5HJYA 4HRFA 4R0EA 3UQSA 1I9SA 1N36F 4TVVA 1R8CA 3N5BA 3MPDA 3R1LA 1VS3A 2PMWA 4WZMA 1GAOA 3VCDA 4JP8A 5D15A 4KE5A 3OXGA 4YR0A 5A5FA 2AX0A 4OLPA 4LF9J 2ZEJA 2ZZNA 3UCGA 3VGUA 2PEHA 4JB8B 1S76D 4QCLA 3JTPA 4ICLA 3MUTP 3H90A 3OV7A 2QBRA 2HWHA 2F6FA 3JQJA 1H2VZ 3DLKB 1PILA 1F9FA 3CGIA 2ESBA 2GW8A 2V8GA 2E1MC 3VVTA 2VPXB 4ZVPB 1I3OB 1S4EA 2DGUA 4RUAA 1AW0A 1FJEB 4HI2A 1F3FA 5T7LA 3DOLA 4B3OA 1XM2A 2AJ2A 2Q6BA 4IOCQ 2GHPA 3QKPA 4EI2A 4BPCA 4J7CA 4OHIA 1TP7A 3MAAA 2BGDA 3GILA 1WTBA 2CQIA 3KK3A 3S1TA 2V4JA 1VQ5S 4JI7J 2MQMA 4GKKJ 2KM8C 2NUHA 4KO0B 1TFYA 4ZA1A 1UVKA 1V3SA 5KT7A 5A5EA 2VQEJ 3RAMA 2HHVA 2OO4A 3BM7A 4AFFA 3U1MA 1AZSA 3F73A 2Y1IA 4D3RA 1Q53A 4UOCA 4ELUA 2ALZA 4RW6A 3R5GA 1V9OA 4PWDB 2EEYA 3OW2R 4X4QA 1HKAA 2CQCA 3B7OA 4CT8A 2KRRA 2BANA 2FD2A 3PCOB 2HHWA 4NWBA 5AE1A 1RT7A 1JLEA 5E7OB 4DUTA 4NMLA 2FLLA 3FUYA 2LDIA 4L74A 2N4CA 1AT1B 4QQBA 1FNOA 5EUHA 3ENAA 3OUYA 4Q7AA 4O44A 4LUBA 4OV6A 5E33A 3B54A 4LR9A 1TL7B 2O5DA 1GMWD 4CWBA 4EU0A 2FJDB 3O5TB 1XERA 5KT4A 4J91A 2R7QA 3IBWA 2DGQA 2KKHA 3MPUB 4USTA 3GFZA 2DNNA 2F6YA 4OJHA 4XDDA 2DPJA 5HQ8A 3BO3A 3B4MA 3DDNA 3P96A 5KT3A 1WHWA 4C0HA 3B8HA 5K20B 1LFPA 1AROP 3FQKA 2HCMA 4I2PA 2G2YA 4JI2F 3NRSA 4F3QA 4IH5A 3A5JA 3EU0A 2Z8QA 4RBTA 2K3IA 4M5LA 3H5XA 5FDLB 1HLWA 2W01A 3GE9A 4ZLPA 3PKYA 5KT5A 5E5NA 1T05A 3DM2B 1F5BA 1JLAB 5A2QU 4PXDA 2NSBA 2YNHB 3JAMU 2F6VA 4XDCA 3PYFA 5IM0B 1SV5A 2YWKA 1LWEB 1Y0HA 4X4PA 4MFBA 1YIJS 4KYRA 3GIIA 2JFDA 3HVAA 3M6UA 2GCFA 3MF5A 3ISZA 1VOMA 2X3GA 3V4MA 1PCAA 5AXKA 4LBIA 3CJKA 1DLOB 2CDRB 4NXMJ 4L3KA 3MMBB 1IKWA 4WTYA 3R5JB 3A3PB 4DV6F 2WTZA 4C97A 3RW7A 2L08A 4TQSA 1RT1B 3FSIA 2AGPA 1NWLA 3W1YC 1W7WA 1ZA2B 1S57A 4OHYA 2VEUA 3LW5C 1NDKA 2PIIA 3U1NA 1E6YA 2XYPB 4JMJA 4DFMA 4A8FA 2UP1A 2AX1A 2FZCB 4GKJJ 1S1WA 3LAMA 4I2QB 3DHXA 2AP6A 3MMCA 3H40A 1BMQB 3JSBA 4ZRTA 3JB9k 3KMQA 1YJUA 2CM3A 5ETRA 4A8XA 3K17A 1JXLA 3O1LA 3ZM2A 2Y9HA 2DB1A 4K4XA 1HQEB 3SMEA 2XO6A 1I94F 2BW2A 3OHAA 2MZRA 4LIRA 1AFIA 2BBEA 2HC2A 4WK1A 4H4OA 5C25B 4B3MJ 2ILYA 4RU9A 2EPIA 4NNDA 4X84A 3DN9A 4PCQA 3QT5A 4YHHJ 5F8MA 4KYZA 4P10A 1T03A 4L72B 1R6HA 5FLXY 1F3VA 3UO0A 3IO1A 3SIPB 1TKXB 2G59A 4U95A 4DR6F 3CJTA 4DV3F 4RW4A 1AB8A 3BBCA 1JKHA 4B9MA 3LOUA 5M43A 1XWLA 3BJYA 3UVJA 2W2NP 4LF1A 4FYWB 2XS2A 4RKKA 2F4FA 2PD1A 1IJEB 2OPQB 1N5YA 1LWFB 3CDAA 3ILIA 3AWEA 2HY3A 1UA1A 3TP2A 4ZP9A 1RKJA 1KQGB 2P4DA 3I0SA 2HB1A 1B64A 3I0RB 3PS5A 4F2RA 4CLFA 2YH1A 2BOPA 3EVMA 2CXEA 3PXGa 1GMWA 3I36A 3GYXB 4PABA 3OT9A 2YX4A 3WDOA 2YVSA 3OR2B 4LF6F 3RGQA 1UP1A 3DFEA 2H3EB 2HFUA 4GVBA 2QT7A 3AD7C 2DKOB 2HPUA 2HG4A 4RUBA 2NR0A 5HJXA 3ONQA 3SFGA 2XGPA 2IBOA 4HR2A 2XS5A 1K0VA 1UZDA 3E01A 2Y67A 1Q8BA 4DV1J 1IWAA 2R42A 2KDOA 1M1HA 4HT7A 1Y00A 3BV8A 4FZVA 1RT4A 2QA1A 1J5OA 2HMIB 2VORA 2DNOA 2EK1A 4ERCA 3BH7B 2XG8A 3ZZTA 2AYBA 2KT2A 4Z37A 5HLFB 1Y11A 2JDJA 2W9BA 3MR3A 3G4SS 1YJNS 1S72S 1RGVA 1D9FA 1PYSB 2FHMA 1RWPB 1MSWD 2HNQA 1D9AA 2GHWA 1XMQJ 1BZCA 1N0UA 2WBRA 3NWGA 3ZZRA 4QPXA 4ED5A 1B3TA 4S0MA 3C6UB 4ZN5A 1U1OA 1LV5A 5EX0A 5DM7Q 2DNZA 1C87A 1WCHA 5LT5A 1R8BA 5DGBA 3HKZD 2IHR1 2JZ5A 3FJ2A 2WCXA 4LSNA 1RWUA 1QLNA 1MG7A 3RRHA 2G9OA 5KAKA 3ZMQA 5BZXA 2FJXA 2H54B 1T9TA 3Q89A 2JFGA 2LEAA 2Q3PA 4PKDB 4EZ6A 1DZ5A 2HQ3A 3HSDA 2VOSA 3POTB 1VBKA 1Y5NB 3FC9A 1A6LA 4YB6A 2N7YA 4BDPA 4DSEA 4IH6A 1OO0B 5EN1A 4K2JA 3RJMB 5GAHU 1URNA 4OHZA 2DD8S 1ZYQA 4EYHB 1WC4A 1SH0A 4R8UB 1WF0A 3WZ0A 1SC6A 3CCUS 3RTVA 2L41A 2KHDA 4P9SA 1VQPS 3PFOA 1ITPA 3IR6B 1FNMA 3K8WA 4M5DA 3CPWR 4ID8A 2ZE2A 5KA9A 3MECA 3HKWA 3U27A 2FC8A 2H48B 4OHLA 4Z7YA 3N5FA 1SIZA 1D8ZA 4GFVA 2HLUA 3H42A 5FD1A 2D3OR 2FHJD 3DLHA 1S1UB 1DTTB 2HQFA 5CYQB 3T6BA 4LF8J 2HK3A 4FBTA 2HNZB 4OZ3A 4G1QA 5EWFA 3A5KA 2O3DA 1YBAA 4ENOA 4IG0A 2MQQA 2JVOA 2BZ2A 3KG4A 2I5JB 4ED6A 4GRSA 5K14A 4LR7A 2LVWA 3EVOA 1G7CB 2FHKA 3PYGA 3GG0A 2GVDA 1OSDA 3IM8A 4DX8H 1P1LA 3G96A 3FFIB 2HVEA 4HLBA 3PM9A 2HBQB 3QATA 2K06A 3MR6A 2Y1LB 2ZHBA 3V6DA 3BGLA 4LT6A 3R2DJ 3VAJA 1EENA 3VR1A 2ZWOA 2QRRA 2KHCA 2G6ZA 4ECXA 2FUG9 3HFKA 5HO4A 4ZS6A 2RHSB 3DOMB 2G0JA 2KO1A 1R31A 3HZEA 4UW2A 2OC3A 2DR9A 4NLWA 3GB0A 3GIJA 3MM5B 2Z30B 1Z1ZA 5CH7B 2VUGA 4DUYJ 3L9ZA 1B0VA 1RA7A 1FXRA 3O5XA 1RHKB 4K4UA 2LXFA 2HNYA 4NLDA 5BXIA 3EJMA 2M52A 1RAOA 2RRNA 1EQMA 3FBCA 4DGPA 2VC1A 7FDRA 3H2LA 4Q43A 1RCOB 3NNAA 1WF2A 2OTLS 3FSXA 4JI1J 4YB1P 1B0PA 4YP3A 1ONZA 3KHGA 5A0YB 1D0EA 2CPHA 3LH2S 4OX7A 3RGOA 1K73T 2LEBA 2P2CB 2FY8A 3NBPB 3CCVS 4PYHA 4CT9A 3W2WA 3QFHA 4PR6A 4H54A 4OZ5A 2AT1B 4PVGA 2GA7A 3AAWB 1H74A 4A8QA 4P7VA 1NK6A 4QJVA 3CJ0A 5KFDA 1KDNA 1LW0B 2BM0A 2V8VA 5BUGA 4FN5A 2RQMA 3NP5A 2DYAA 3ISND 4ED1A 1CJKA 4QIEA 4PQUB 1UAGA 3DKDA 1NK4A 3ZTOA 2JLEA 2NPIA 3I6PA 1VC0A 5EWGA 2QMUB 3M8YA 2V8HA 4HACB 1FE4A 1U48A 2MKHA 2CNEA 4FDFA 2FJBB 2ZBRA 5K25A 3SR9A 4FS2A 1YBTA 2E5HA 2HHHF 1PG5B 4DSLA 3AOCA 2DGXA 4C2MA 1X9WA 3HCXA 1GWZA 1M5HA 5E3CA 1NMEB 2BE7D 2FGOA 4FPRA 1FKOA 1QTMA 1NZ7A 2VPZB 4D3HA 1YITS 4YN3B 5A8RA 4ED7A 1ZETA 2GJ2A 2FHJA 2OFGX 3KLVA 3M6VA 1WC5A 4K7QA 1Y5IB 1JXEA 3UPFA 2AYMA 1M1KT 4Y28C 4G65A 2OEMA 3ZXWA 3C14B 3SV4A 3JXOA 3P6YC 1WEYA 3CEDA 3PEJA 2HAFA 3NY0A 1RWOB 1WG4A 3X1LB 4OX6A 2A10A 2ZKTA 2KFYA 3MMAB 4MH8A 5IC4B 4ATNA 1YVFA 5L38A 4OI1A 4ZVGA 1ZAVA 1XNRF 1XIQA 1UW9A 3DRXA 2DIUA 3A1YG 2OUDA 3G86A 1O8BA 3S4EA 2I3RA 1PC5A 3TJAA 3TZXA 4TU7A 3MEGB 1UWAA 3D54A 2UV8G 3JTOA 3O44A 2NLWA 3OFHA 1IN0A 2F9JA 4F02A 3CM3A 4K4SA 2J7UA 3UD4P 4OHWA 4CTAB 4J9LA 3M8WA 3HN7A 4YQWA 3G71S 4P6QA 1MMLA 1I5OB 3PHTA 4I7FA 4TY9A 1A5YA 2RNEA 3KJVB 5HMWA 1VISA 2AGOA 2IM3A 2BKOA 1C84A 3TA2A 1Q1MA 2HHPA 2UVRA 4BBYA 2QEPA 2CFVA 5H9FJ 2MZ1A 4OYZA 4ALZA 5K8MA 2EFVA 3BH6B 1VHIA 2YBVA 3M6WA 3RRGA 4O23A 4FXWA 2XLKA 4QBWA 2B5JB 3UDVA 5B0BA 1SJ1A 2O1PA 3W5YA 1X4EA 1UL3A 5DETA 1KVIA 1HW9A 3F44A 1YJ9S 3D4JA 2M88A 2E9ZA 4QU6A 4MIAA 1I9TA 3GFYA 1S49A 1ZH5A 4DR2F 1YJTA 3VGSA 1CJUB 1GQEA 3FZBA 5LMNF 3MOWA 4YS2A 3CXCR 1RTDB 2BMBA 2EC0A 5J8RA 1HMVB 3L7OA 1C0UB 2P9CA 3BB5A 4C8LA 4KH1B 2VFUA 5ETNA 4IG3A 3LP1B 2I1YA 4EFAC 4O3SA 5D4NA 4UT4A 2GQCA 1RTIB 4C11A 3IGVA 4ZP7A 2VQFJ 2CG8A 2KRBA 2J6SA 2UXBJ 2ZITA 2F5GA 1TR0A 2FVRA 1TL1B 5I42A 3GJSB 2DR8A 2C46A 1Q6SA 1PO6A 2DRBA 1U2RA 2NCKL 3CCRS 3LPEA 2H04A 5JMNA 4TU8A 4NLOA 3IRWP 4CLYA 2I4EA 3GR0A 1S4FA 4CO2A 2UXDJ 4I1TA 1T7PA 3NCPA 3PACA 1BGXT 3IBCB 3CJ2A 4KI9A 2FY1A 2QLJB 2IM2A 2VBWA 4RPFA 2G13A 1HR0J 1X0FA 5DDPC 1V3RA 5IT0A 2CNFA 1TZ0A 5F9LA 3DDIA 5THWA 5L8RC 3ITHB 1FTCA 3UNYA 2V4RA 2DK2A 2P9EA 3TAMB 2KVIA 5G0RB 2YDUA 2BE2A 4BS2A 3OTCA 4CNYA 1WJ9A 3QNWB 1U1PA 1VI7A 2ZH4A 1HNVB
chains in the Genus database with same CATH topology
1UVLA 2VQEF 3V0DA 3V4IB 3DHWC 4ID5A 1N34F 1URRA 3MM9A 5D4OA 4HYKA 3BQ0A 2OD6A 1AXQA 2PI7A 3TA0A 2HHQA 3CB4A 4ZP6A 5KADA 1P8GA 4YEAA 3UI3A 1WTFA 2WSFC 3R5DA 2DHSA 1O51A 3UWTA 2XLJA 4FYDA 5CHCB 3M8QB 4MMOA 2F9DA 2W24A 1HFEL 2F8EX 3LP2B 4OHEA 2OPRA 1KN6A 1FO1A 2YKNA 4D3QA 3L95X 1U24A 2LQBA 4E98A 1LWCB 2DIVA 2R7TA 2J7KA 3D1OA 4NLPA 5EDWA 2VFRA 2ABYA 2IBKA 4IR1A 4LF5F 1ECVA 2QMWA 1KD1T 1XXVA 1VLYA 4ZDNA 2QV6A 3QIDA 4F25A 4KSEB 2QA4S 4LFCF 4HJPA 3LGMA 4X4TA 1R0AA 3CCJS 2NT7A 3MZIA 2BDPA 2YKPA 3NS5A 5LSLA 3MUVP 3L7PA 1FK9A 3THPA 2J9EA 1AAXA 1U2FA 5HBMA 1T49A 4HJQA 2RQ4A 2PDAA 5CZVA 4NCAA 1PSDA 1DFDA 4MTPA 2PI5A 3QGGA 1BZHA 1N5SA 3BLTA 3QCLA 1OSCA 5LXQB 4ZHRB 2EW9A 1G4US 3K5PA 4QR1A 1HBNA 1EP4A 1OEMX 4IR9A 2MZSA 2XSJA 2IAJB 3DYAB 4TQRA 3GIMA 3CF5Q 4O4RA 2J7WA 2JC0A 4CH0S 5KG4A 2D7SA 3R5CA 3AY0A 5KFFA 5IT9Y 5M2RA 2IJNA 5B0DA 1Q7YT 1R8PA 2AJ4A 2OIHA 4QAPA 3MPWA 4WKRA 5B09A 4EUVA 2VV5A 3C6TB 4KJIA 3M4XA 2ZH9A 4WFNQ 2BABA 4J9OA 3IS9B 2E5JA 2BZLA 4OHHA 1PTVA 2B56A 4PG5A 4GO5X 2R7XA 2ZH7A 2CFXA 1SH2A 5JJBA 3Q8SB 1B7FA 3CMAS 2KJWA 2ASJA 4JYAF 4JUZA 3CCMS 2FGCA 4Q8EA 2MGZB 4IUFA 4U7CA 1SL2A 2WB1D 4RW7B 1WNEA 2UV8A 2XMJA 3CIMA 2QDMA 5D3GA 4C8ZA 2M0GB 1R8AA 2B7BB 2VKRA 4JNBA 4ZCIA 3M6XA 3MEEB 3D0IE 1K1SA 1HW8A 1NHUA 3MXHP 3KYLA 1UVMA 1KOHA 2F1FA 4IO9Q 4K4VA 5J2QA 4C11B 2CJKA 3S7RA 1U25A 4X66F 3OXLA 5E41A 2LYVA 4ICLB 2F4VF 2YX7A 1LQFA 3OTOF 5AXMA 5CYMA 3VAHA 2HWIA 2X1GA 2LU1A 1L5UA 2I4GA 4BWJA 2VFTA 5DG8A 4UY85 2LLZA 1KFSA 2D3UA 4KYQA 4R0TA 2CQGA 2B7CB 4HL9A 2SXLA 3PIPQ 2R2TA 2ZDOA 4PG7A 1S9GB 3I9V9 4DV0F 1S6QA 3NL0A 1S9EB 5IWAF 3QZ7A 5KFVA 1FE0A 3I5CA 4MAKA 5A8KB 1F2GA 3OLRA 4I0WA 1C4AA 1NK7A 1BQMB 2C42A 5KAAA 1W25A 3THTA 2FC9A 3MM6B 5I6VA 3OQ2A 3QMQA 4U67Q 3OHBA 1S0VA 1C0TA 2N4DA 3EGNA 1S9FA 3DRYA 4OZ1A 3TRGA 2Y1RI 2IMWP 4OZLA 2CM2A 3BSNA 1RTHB 4ZK7M 2HVLA 4D3PA 1OHCA 1OWXA 4F26A 2YNFA 3EZZA 3KLHA 2W7AA 3LP0B 5B0AA 3SFUA 1NO8A 3O4SA 1UKUA 3T9ZA 2K8GA 5T7LB 2E29A 2R7WA 2V0NA 3DOLB 1FJCA 1NWEA 1W2IA 5KA2A 3B78A 1SL1A 3DMJB 4URGA 4QIWD 2AQ4A 3CD5A 3TUIC 5KTQA 4G1IA 4PUOA 2DGTA 3DGPA 3V81A 2HHTA 2ZD1A 1UW4A 3CJ3A 5KFZA 3N01A 1MMDA 4IKAA 3T5LA 1MROB 4Q45A 4G6VB 5H9EJ 3U96A 2KTQA 1SJRA 4ZPCA 5DG9A 2ZUGA 2BV5A 1TKZA 4EBCA 2H03A 2POKA 3CJ5A 3E8OA 3HM9A 5KG7A 3KJVA 2BQ3A 5IS2A 2J76E 2LMIA 5FIIA 5B0GA 4OIXA 3HVTA 2KM8B 1DHMA 3QCEA 4Y14A 2LA6A 4Y34A 2VBZA 3KK3B 4M94A 3IWNC 5HDEA 2F6TA 3DLEA 1QAXA 3G8QA 5GAEI 3OTEA 1RT2A 3RR7A 5L1KA 1S1TB 1SJ3P 5BZZA 3IAM9 4H4MB 5MAOA 4JI4F 3F56A 1YGYA 4LQ3A 4G3IA 3SCIE 2IRUA 2YNIA 3KHLA 1RDRA 4USIA 2ZH8A 5GADU 2RILA 4I6AA 1OEUA 2Y1JA 3H5SA 4WXWA 3UDLA 3M2UB 4KT0C 3M30A 2ZOMA 4HVZA 1Y5LB 3FRYA