3V0JA

Crystal structure of ciona intestinalis voltage sensor-containing phosphatase (ci-vsp), residues 241-576(c363s), deletion of 401-405
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
319
structure length
319
Chain Sequence
b'KRRYRKDGFDLDLTYVTDHVIAMSFPSSGRQSLFRNPIGEVSRFFKTKHPDKFRIYNLCSERGYDETKFDNHVYRVMIDDHNVPTLVDLLKFIDDAKVWMTSDPDHVIAIHSKGGKGRTGTLVSSWLLEDGKFDTAKEALEYFGSRRTDVFQGVETASQIRYVGYFEKIKKNYGGQLPPMKKLKVTGVTITAIQGVGRGNGSDLSMQIVSERQEVLLCKFAEGYNCALQYDATDDCVTCEVKNCPVLAGDIKVRFMSTSKSLPRGYDNCPFYFWFNTSLVEGDHVTLKREEIDNPHKKKTWKIYRDNFTVKLTFSDAED'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Voltage-sensor containing phosphatase
publication title A glutamate switch controls voltage-sensitive phosphatase function.
pubmed doi rcsb
source organism Ciona intestinalis
molecule tags Hydrolase
total genus 108
structure length 319
sequence length 319
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00782 DSPc Dual specificity phosphatase, catalytic domain
A PF10409 PTEN_C2 C2 domain of PTEN tumour-suppressor protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1110 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3v0jA02
3.90.190.10 Alpha Beta Alpha-Beta Complex Protein-Tyrosine Phosphatase; Chain A Protein tyrosine phosphatase superfamily 3v0jA01
1G4US 1XXVA 1I57A 2B3OA 3B7OA 4YAAA 1YFOA 2QBQA 1M3GA 1A5YA 1EENA 3BRHA 3SR9A 4D3QA 2CM8A 3O4SA 5BZZA 2F70A 1BZCA 5AWXA 1ONZA 1SUGA 1C86A 2F46A 2HXPA 2CM3A 3QCIA 4OHEA 2HB1A 2A8BA 5MMZB 1C85A 2Q47A 4YR8B 4DGXA 2PBNA 3QKPA 3QKQA 1T49A 2PA5A 2OUDA 3D1OA 5BX1A 3F9BA 4Y14A 2J72A 2B49A 2CFVA 1OEVA 5KA1A 2I4EA 4H1OA 2J44A 3ZMPA 2YDUA 4HJPA 5GTJA 3QCCA 1PA1A 1R6HA 2AZRA 2CMBA 3GXGA 2Y2FA 1ZCKA 3RGOA 5K23A 3ZV2A 3A5KA 5K9WA 2I3UA 2B07A 2I4HA 1C87A 1PH0A 2OZ5A 5KA0A 5KAAA 4D3RA 3V0GA 4HJQA 4GWFA 2J71A 1YTSA 1Q6NA 4QAPA 3BLUA 4OHIA 3AWEA 5KADA 3F41A 4ZRTA 5KA3A 1GWZA 2CM7A 3D42A 2P6XA 2VEUA 2I42A 5BUGA 1V3AA 2F6YA 2OOQA 2BIJA 1YPTA 3EAXA 1WRMA 3QCFA 3EZZA 4QUNA 3QCEA 5KABA 1Q6JA 2GJTA 4S0GA 2CNHA 3S3FA 5K25A 2NLKA 2J17A 4AZ1A 2H4GA 1XXPA 4GFUA 4TVVA 1Q6PA 4DGPA 2J43A 1G1GA 3V0FA 2Y96A 2VEXA 2PI7A 4QBWA 2CMCA 1PTTA 4PYHA 2NTAA 1Q1MA 3OLRA 4ERCA 2WGPA 4QAHA 2QBRA 1C83A 2HC1A 3QCGA 3I36A 2GWOA 5EHRA 5HDEA 1YN9A 3GXHA 2H03A 2H4KA 2I6OA 2F6ZA 3EU0A 4GRYA 5M43A 1OHCA 4IKCA 3V0DA 2YOCA 2VEWA 5BZXA 2B4SA 3O5XA 3A5JA 2I75A 1LARA 4NX8A 5IBSA 4I8NA 2I3RA 2H02A 2BGDA 2MBCA 1U26A 3CM3A 1XRIA 4WU3A 5KA4A 4RKKA 4PVGA 1NL9A 2BV5A 3LJ8A 2AHSA 4RI4A 3BM8A 4R30A 1T48A 2NV5A 2E0TA 3S4EA 4JMKA 5KA8A 4D3PA 2FHCA 1U25A 1ZZWA 1BZJA 2ZN7A 4GRZA 2F6TA 1LYVA 1WCHA 2QDPA 1JF7A 3F9AA 3QCKA 4KYRA 4RHGA 3QCHA 1U24A 2CNEA 1MKPA 4RDDA 4GE2A 1G4WR 4B04A 2HNQA 4ICZA 5I6VA 1I9SA 1YZ4A 4Y2EA 2I1YA 1PTYA 3ZM3A 2G6ZA 3ZM1A 2YA1A 1OEOX 2B4UA 3H2XA 1X24A 1LQFA 4R0TA 3D1QA 1G1HA 4GE6A 3SMEA 5IBMA 2I4GA 2B4PA 3QCDA 1XBOA 3PS5A 3I7ZA 2I6IA 1PYNA 2QCJA 1Q6MA 3S3EA 3QCBA 2JJDA 3MOZA 2FH7A 2HY3A 2J16B 4KYQA 3ZM0A 3I80A 4GS0A 1KAVA 5KA9A 3RO1A 2FJMA 5J8RA 1BZHA 3CWEA 3S4OA 1ONYA 5K22A 2F6WA 1ZC0A 3BLTA 3EB1A 4Z6BA 4MBBA 2M3VA 2C46A 2F6FA 2F71A 1OETA 3N0AA 4WOHA 3D9CA 1C84A 1YTWA 1QXKA 2F6VA 3QCJA 3QCMA 1NNYA 2DXPA 1P15A 2PT0A 2FHBA 1I9TA 2GP0A 5K24A 4NNDA 3F99A 1D5RA 1J4XA 2J73A 4BJOA 1NO6A 1G7GA 4GFVA 4OHHA 3EMUA 4JNBA 3V0EA 2I6PA 1YGUA 1ECVA 2PQ5A 3D44A 2PSZA 2R0BA 4GE5A 1FPZA 1L8KA 1OESA 4QBEA 1RXDA 4NWFA 1PTUA 3QCLA 1NWLA 4WU2A 1OEMX 4RH5A 1OEUA 1PA9A 1RPMA 3O4TA 1L8GA 4RI5A 2NZ6A 2ZMMA 2A3KA 2I6MA 2VEVA 3NMEA 3ZMQA 2H04A 2FHFA 5KACA 1YTNA 2VEYA 2CMAA 2QDCA 1Q6TA 2RF6A 2SHPA 1XM2A 4RH9A 3S3KA 3AWGA 4JMJA 4WTYA 3MMJA 2B4OA 4NYHA 1VHRA 4OHLA 1EEOA 3O3LA 2HVLA 1NWEA 1PTVA 4QUMA 2C7SA 2QCTA 2HNPA 1NZ7A 2ESBA 2QEPA 2HC2A 5KA2A 3M4UA 1FPRA 3V0IA 2G59A 4JBCA 2P4DA 4KI9A 1FQ1A 1YWFA 2J16A 3D1HA 3OMHA 1WAXA 3F81A 2CNIA 2I5XA 2CJZA 1GFYA 3V0JA 2QBSA 3O4UA 2H4VA 1JLNA 2CM2A 3S3HA 5EHPA 3RGQA 2I6JA 4J51A 2Q05A 4H34A 2QDMA 3QCNA 4R0SA 2NT2A 4HRFA 5KA7A 4BPCA 1OHEA 2CNFA 1C88A 4OHDA 3ZM2A 3MOWA 1QZ0A 3RZ2A 2NT7A 1AAXA 3AWFA 2FJNA 1G1FA 4ZI4A 2HCMA 1KAKA 4ZN5A 1T4JA 2BZLA 1ZCLA 5LXQB 2CNGA 2IMGA 1G7FA 5K9VA 1Q6SA 4NWGA 1PXHA 2OC3A 1OHDA 1YGRA 3U96A 2BGEA 2QBPA 3V0HA
chains in the Genus database with same CATH superfamily
4H26B 1G4US 4FQ1L 4ZRGA 1D3CA 1I7ZA 3AU1A 3KLAB 4FQXB 3UP6A 3JSSA 4AIZA 4PUBH 3INOA 5CBEB 2NY0B 1YEDB 1NCBL 1UD5A 3ELQA 2ZSWB 5FX3A 4F8TA 1BZ7B 2LT9A 5JLZA 1MI5E 1LQSR 1ZHNA 3CZSA 4IOSA 4QJ3B 4B9IA 4X4ME 4BCYA 5HHPA 4PJ5A 4PJBF 4OZ4A 5F6HI 3S4SG 1DP0A 1YMMA 2R1WA 1QRNB 3PWLA 4NP9A 3TYFA 3SY0B 3VD9A 5F7LB 1WCBA 5GGQH 2P80A 3SCMB 4U1SA 3X13A 2VZ1A 3P4MB 2VDRB 2ZYHA 2E5EA 3TYGH 4QHKJ 1PFCA 5LDSA 1YY8B 4Z7NB 5BX1A 5C0CE 3F9BA 1L7IH 1U8LB 4XVSL 4EDWL 5L8LB 5I1KL 2R2EB 2CFVA 1OAUH 2Q8AH 3R8BB 4ERSH 1MAJA 2ITFA 3UAAA 4HWZA 1HE8A 2DWXA 1ZT1A 3NDZE 3NJMA 5ICYA 1H8SA 4ZPVA 1FVCB 3ULSB 3BDBA 5C0GB 4JG0H 5ID1A 3ZHNA 3QXDB 1IC4L 4GRWB 1TVBB 2IANE 3F00A 4HU2A 2WO4A 1SVBA 4JPWH 4GIAA 3M1CA 5EA0L 2I3UA 1I8MA 1J5OH 2AQ3A 4OLYH 1IQWH 1PD1A 1ZHBA 2IVFC 2DYPD 4FFYL 4U0RC 3EYFA 1OF2B 1HH6B 3KDMA 2X0VA 2CBQA 3NJHA 5CILL 2AP2A 4O2EB 4PAZA 3RL1A 1UXMA 1J5HA 5C0AE 2PWHA 2GIXA 2YXWA 2CBOA 4ISVB 4AM0A 1SFDA 5FOBB 2UXFA 2BCKA 3RFZB 1ZLVK 4FZ8L 1JZEA 1N0LA 3NCYS 4N6RB 4C54A 1G9EA 3NSJA 3QFDA 3KXFB 4KVNL 5D7HA 4LOUC 1A9BA 5A5FA 1DDHA 1S7TB 3WL9A 2FO8A 3HRPA 2VDNL 5I8KH 4HKJA 4ODVL 3IGKA 2P6XA 2KH2B 2VEUA 1KTDA 5KSAD 2EO9A 3KPSE 3QIBC 2H32H 1CD1B 3HMXL 1NPJA 5EULV 1JFHA 3V4PH 4RETB 4HUUB 3GMQB 2OMZB 5I9QC 5ADPL 3FCBA 3AY2A 5DJZB 2FQDA 2YPLB 3QCEA 1WTGT 2JB5L 1E5YA 3WEMA 2FX9H 3COOA 5HPOA 4DQAA 1ZK9A 2EEXA 4CW1A 3VXOA 1H6UA 3OKKB 4E5XG 1O0VA 4GW5B 15C8L 3GMPB 4YHMH 2Z34A 4NO3A 1K5NB 5DMKB 5TD4A 1R46A 2RD0A 2Y06H 3EYSL 3W39A 4ADGA 1H15B 4H5SA 1NGWB 2WMPA 1YJDC 4OUUB 3V4VH 4PJ8B 1ZLUK 4DZBA 2EVIA 4MRCA 1VFBB 3LNHA 1AH1A 1KYOK 3GRWA 1T2QL 4A7QA 1IAOB 3UCQA 4GO9A 1G1CA 3VWJB 3VI4B 4DKFL 4Z77A 2ZD0A 4YSTA 4GG6E 2VN5A 4BZ2H 4KDTC 3BPCB 5SX4H 3FQUB 4AUUA 3FMGL 1VFUA 4HAGA 2R0KL 5HDQH 1OT2A 2HC1A 3UJJL 5I5JA 4QRSB 3D2TA 3WS6A 3CTTA 4MA8L 4WTXA 3RWGB 5F9WC 2ED8A 2F9BT 3KGUA 4N90E 4X6BA 2F5BL 3SOBL 1U8HB 2ZUTA 1TZGL 3CZJA 1HNFA 3FT1A 2BRRL 3WFBH 3K1KC 5BOPA 1LVEA 5BQDA 3KG5A 4U1KA 1UM6H 3MQIA 1EHLH 5BZDB 1ZXQA 5DRXB 4Y5YB 5JZ7C 4BUBA 1C5CL 3MKGA 2ESVD 4F8PA 1ZSDB 4DSYA 4WF7A 1HESA 2OV0A 1NC4A 1Y1DA 4PCKA 4Y4KD 2A74C 4AE0A 1UAGA 1XMWA 3WFDH 3RE0A 5C0AD 4QOKB 1K8DB 1CFTB 5A1AA 4ACPA 1JDAA 3T1WA 1Q0EA 3T2OA 3OPUA 2K7QA 3MCLL 3G5XB 2ZPKH 2YEZB 3ARTA 4XMWA 1X5IA 3ALXA 5IG7A 2PETA 2Q5BA 1JUFB 1KBKA 3ZTNL 3RVUD 4JR9L 2X6MA 4JM2C 3KPSD 4F7CB 1B6UA 4HXAL 5F72S 1JWMA 3Q8FA 1YN7B 3FAWA 5DD0H 5CJXA 1MAML 4FNSA 1E9QA 4HFUH 1MJ7H 3FOMA 3X1EA 1WS8A 4L4TD 5FAAA 3MOBH 5JW4Q 2QR0A 3QIUB 5GGTL 2HTLC 4ILDA 1GOHA 1F4WH 1WAPA 1CFNB 2VUYA 3GIZL 5CJOH 4GO8A 12E8H 3H1ZA 3OKLB 1HK6A 1N7ML 1Q0YH 1Z5HA 1NCNA 4QRBA 3N44B 3SDDB 5JR1H 1P7KB 1IEBA 4KK6C 2VERA 2OMNA 2Q7YA 1MKPA 5EOCH 4Y4HD 4ZFQA 5ENWB 5EUOB 2YAEA 4LCWB 5BVPH 4XWGH 4HUWB 4ONGH 1I9SA 3S96B 2EEFA 1L9TA 2ZXQA 4GKZB 3ECUA 4WHYG 2CO3A 3CN3A 2JJTC 2XFGB 2GPZA 4A2GA 2AVFA 4IBQA 2NW3B 4CNIB 4E42B 1QFWM 3IJ7A 4IIQC 4S1QL 2NY4D 3BWAA 3HAEA 3H0TA 4Q8BA 5INDB 2FIRT 1IKOP 1ZA3B 4GXFA 4I0PD 4X6CE 4NM4L 3ZE0E 3JTSA 1NMAL 1OGTB 4HCIA 4RGMB 1OEOX 2B4UA 2FJFB 1C12B 4UI2A 3TTSA 1AFVL 1W72A 4NWTH 4XMKL 4YK4B 1RZ7L 1X24A 3ZRSA 3D1QA 3WIAA 5FO7A 4FFZH 1CB4A 3TJHC 1YRKA 3BZEB 2VNCA 2J1XA 4G8IB 3JWDC 1PY9A 1I9RL 1T1YA 3D9AH 4R4FH 1MOEA 3X14B 4EN2A 2V7NA 3PDDA 2HT2D 4XP4L 1Q6MA 5CEZH 4G59C 4OJFL 5KVMC 3VQ2C 1AZNA 5E2WL 3HPLB 4OI8A 2R0ZL 2VJ0A 1VLXA 1G9NH 1G9ML 5BNXD 5IW1A 4YX2L 3ILPB 3UTZB 3KEHA 3OHXB 2RR3A 3WIIL 3LV3B 4W9KC 4LLMA 5IQLA 3S36L 4CKVX 3L3DA 1ZE3H 3QQXA 4YNYA 4LLVB 1RLWA 4RRPA 3ARED 5BRZA 2X4OA 4UQ2A 2BWDA 4HFWA 5E6SB 4KDTA 3ZTEA 1KIRB 1T2JA 4MA1B 3EB1A 5D71L 2F6FA 1FO0B 4A67A 2APWA 3A4FA 2TRYA 5GISL 3SKNA 3QJTB 4JFFB 7FABL 5I6XB 4MAUL 3F5WA 4LPXA 4XC3L 1YTWA 4AH2A 4H8UA 2E7CA 8FABB 1ASPA 2ZJSL 1A7NL 5IJDC 2AEWA 1OANA 2OTUB 4UM8B 4WEMB 2ZCLH 1GYVA 2C3WA 1FBIH 2H45A 1S7UA 4MDIA 2P5WA 2LV4A 4XODA 5T5FH 5K9OA 1E5ZA 1RZJC 3PWJB 1EDYA 2XICA 4FLHA 5IROC 2ATKB 1M7UA 3F12A 3QWOA 3WEBA 4GFVA 3DMMB 4ZS6C 3L5JA 4NLHA 1DZ0A 1DQLH 1LWRA 3GLZA 2J5LC 4ELME 2PSZA 2VLKA 4JRYE 3LMJH 4P48A 1FPZA 5ITFB 1Q72L 4GAJL 3GMRB 1SOQA 3IDNA 1UOLA 3LEXB 2PW2B 4ABQA 4LARH 4RH5A 5CGBA 4FL4C 3U9UA 2ZX9A 1FH5H 4G6KL 1LO0H 1TJMA 1MPAL 3LHPL 4RFOL 4Z7AA 3VGHA 5D2NA 3U4EA 5E8NB 4X8CA 3RHWK 5L2JA 1EJOH 1UHVA 1KFGA 2PW1B 2ROYA 4JM2A 4PJHF 5HVHB 1KXQA 2YKLL 3LNGA 4FG0A 4FLSA 2VWEE 1Q4NX 3MXWH 4OY9A 2QDCA 4FQJH 2ZTBA 3DPBA 5FFGA 3NJJA 5F89A 5JNYA 3FHQA 4JKNA 1FNGB 5F3BA 1JF6A 3MUUA 5ABDE 2FSEA 2NMSA 3HMWH 4Z7OB 5JOFB 3KPPA 4BFRA 3FFOA 4FOMA 3MBED 3CU7A 3QDGD 4YPGA 2JXMB 3Q9QA 4HJUA 3M8OH 4ZFOB 3SZKC 1TSRA 4GMTH 1PTVA 2OBGA 3KPLB 3VFGH 2C9QA 4TLKA 3MRRB 2NR6A 3QUYB 4MZIA 5F9OL 3P2BA 1UASA 3CFNA 4PBXA 2HNPA 1M7IB 3CFCH 4UT7L 1D5XB 2ESBA 5HYIA 2X44D 1GGBL 5LCVA 3HCVB 1QRNE 4QRTB 3N5AA 3NSXA 4JFYA 4UU9B 2N7SA 5BS0D 4WKZA 1NMCC 2HJFA 3P2TA 3MJ8A 2PTUA 5FECA 4JBCA 2HT3D 4QTIH 4UV7H 3N55A 3ZJAA 4IIQA 3RWFA 5D7EA 3CNKA 4Z7NE 1MDAA 3BXNA 4Q4IA 4DTGH 4JCLA 3OAYH 1HYSD 3GQFA 4PJXA 3K6DA 4HMCA 1J1XH 4X5WB 4NKIL 4YL9A 5C0DA 1KXHA 4F7PA 1GGIH 1OAYH 1SYSA 3EF4A 5C07B 2XWZA 4KJWC 4POYA 3VYPA 4GSDL 1JNLH 4JANB 4AMWA 2FJGA 3JVGC 3ZDZB 5DD6B 4GRWE 3SDCD 2R51A 5E2VL 5KSVA 3UBXA 3DX1A 2EE9A 4NXSA 4WI7A 2XKUA 5T5NF 2R27A 1IGIH 4NFCA 3C87A 3QDMB 2YUVA 2X87A 3B2MA 5AOJA 3WNIA 1OHEA 2CNFA 2AHIA 1UOKA 4UT6H 4JO4H 1U8JA 4JRLA 2QVTA 3IDYC 4LCCB 4LL4A 4K55A 4K5LA 1Q1JH 3FCTB 3S35L 1BMGA 4UDUB 3GSXA 3JT2A 1KG0B 1MIEH 2BHZA 4MAYA 5KYUA 2J88L 4ZAKD 3NJVA 3UIYA 2I85A 1A6WH 2BVQB 5I73B 2AMGA 1AGBA 1UT2A 2WP3O 4ENEC 3J7HA 5I1HL 1G7FA 5HD8C 4NUMA 2WTRB 3CVDA 1TTFA 1RK0A 3SIKA 1KCWA 1XF2B 4B9GA 2VDRL 2YPLE 2Y07H 3TBSB 5CZVL 6CGTA 1YDPB 2EIDA 2X0UA 4JFQA 5GS0C 5AG8A 2XA8L 2PYFB 4TNWK 5IROA 2QV4A 1RZFL 3B5GA 3LRLA 4U1GC 3QQ4A 2ZF8A 1JN6B 4YLQT 5AL8A 4A2DA 3X11A 1UFUA 4U1NB 4FNPA 3DXAB 3VSVA 5I1IH 3D09A 3HZ3A 3GC3A 1QFHA 1WHPA 3UC2A 4QXVA 1JMXA 5KJ7E 5GRUH 2FEJA 3K6SA 2V5RA 3C5ZD 2XY2A 3CSYA 2GHWB 3BQUB 3GMOB 3HRZB 4PJEF 3VI4E 4WUUD 2D31A 1MCOH 2ZWKA 3CH1A 3RU8H 3G6JF 4O02L 3GMMB 4AQZA 1G5AA 2IGLA 2ZOWA 4YJZL 2FJSA 1A8JH 3ZIYA 1IFGA 1JL8A 2XFXA 1OE1A 2A77L 2HTKC 1T49A 1EGJH 2O5XH 4JKLA 2QMKA 2NW2B 3E6HA 2BSSB 1A6UL 4G6AC 1FC2D 5F0PB 1EEQA 5INCB 2Q20A 2J3SA 3OKEB 4I2XE 2B49A 2DM2A 1T1ZB 1TPXB 4ZDHA 5K9QI 2VLJA 1WFOA 3QUXC 3RAJL 2YRZA 4LESA 3PY9A 3BDYL 3QO0A 3EBHA 3T3MB 3ZGIA 4J3OC 4LLYB 1GH7A 3ZDYB 4PI0A 4OIAA 2X4UB 2ERJC 4QTFA 1M1XB 3AFLA 2V9QA 5ANHA 2ZYIA 2VZOA 3ARWA 4KDWA 4MQ7A 4XVSH 2QJDA 4M4RB 1KCVL 4MCZA 3ZTJG 3P73A 1URZA 4QOKE 5I1AA 3FUJA 1CK0H 4M02A 2X2IA 2NY6C 4HU8A 1IILE 4HBQA 1FGNL 2QPEB 1OAKL 2X2UA 2Q3XA 5J3HD 4DERA 4ONFH 2QZ5A 1MWOA 3KLQA 4XO3A 3JT0A 4ZW5A 5IB3A 5ICZB 1TNMA 3QA3A 3S4SB 2Z31A 1SF3A 3WBDA 2NNAA 5JUEL 1QI3A 4LP5A 1GIGL 4QHNA 2W1NA 2XQ0A 2YLHA 2G5UA 3H9SA 4AWJC 3UOAB 3D42A 5CILH 5FUZL 2QVFB 1ZWIB 5BUGA 4EKJA 5EBWB 1CXKA 1JYWA 2YPLD 4FZ8H 4RAUA 2D3JA 3JVGA 2JV6A 1HC1A 2PMZA 3B9KB 4KVNH 1NCCL 4S1SL 3AUVA 3KLKA 1CJYA 1DQQB 4S0GA 3FFDA 2ILLA 4ODVH 2EEBA 4OZHF 4IMKC 2NLKA 4NJAH 4UM9A 3FTXA 5DUJA 3GJFB 3QEHA 2H4GA 3SJVA 5E23A 3RPIA 2G3NA 1S7WB 4FQPA 4PJ8D 1Q6PA 3CZGA 3PHAA 3BEVB 1U33A 5EUOE 4LCWE 4MA3A 4BWUA 2KYIA 2FLMA 2W91A 3L3HA 3DI3B 4I5BB 5AZEL 3U46B 3VXSA 1UWEL 2OYLA 1OCWH 1H8NA 2WBKA 1WFTA 4IQHA 1T7WA 4QBWA 1CE1H 3BCDA 3B9DA 4PYHA 1CLOL 4O51A 3QZOA 2A0LC 4RWYL 5HYFA 5FUCC 5JTWA 1WQVT 4H2AA 4YGVA 2YD3A 2B2XH 5HHOB 1DQMH 2QBRA 2ZIDA 1UWXK 1C83A 2F08A 2DWEB 3W9DA 4NRYB 2OPCA 1AD0B 4QAWA 1LYQA 3GPEA 1AGEB 2H03A 2CWRA 1TYJA 3KBHE 4XI5D 3UMTA 1BJ1H 2QTVA 5KW9H 1TQWA 1E6JL 3T3PB 1NJ9A 3DJ9A 1JK9B 5B1JA 1A4JA 5EHFA 1KEGL 3N40F 4XAWL 4WGWB 5KSUA 2WUBH 2F18A 2HN7B 2VOTA 2X6UA 3NYKA 4LCVA 4M8UA 4NPJA 4W81A 3EJUA 5E4OA 5EOTA 3E9UA 4E5XB 1IC5L 1ORSB 1TJXA 3ZDYF 2MHAB 2ICCA 4QOKD 3RWJA 2DLIA 2H02A 4PWGA 4UWQB 5TGBB 2BZCA 4PRDA 3RWIB 4UZSA 5E5RB 2BRRH 5FYKE 1JXGA 4HJEA 7TAAA 4G9FD 4HKXB 2ZXGA 3VI3B 5EF3A 4LPUA 4O5LL 1LO5A 1L9QA 1R5VA 1R5WA 3Q2CA 5T1DL 4HCRL 5FM5O 5DD5H 2JK5A 4PVGA 3LEYL 1YEGH 3CVBA 3L3OC 5GS2D 5TFSH 3IJEB 3RIFF 2CM6A 3WKPA 3CUPA 4JVWA 4AI7A 2PXYB 2GBUA 3D4ZA 3O3BB 3GKWH 3ATBA 4JFFE 4UAOC 3TZVA 3AXHA 4A38A 2H6PA 5CFHA 4GRLB 1CGYA 4P2QB 3S4EA 5LKNA 2UZXB 1M2VA 1UENA 3BVDB 4P2OC 3WLWC 2QHRL 4D3PA 3FZUD 2ICES 4YHZL 1U25A 4PGBB 3SBWA 5F93C 1IM3B 1MFDL 1QMUA 1XIWC 5J6GB 2V2TB 1UZ8B 3H7LA 2NUTB 2ZUXA 4AXWB 3NGBC 4HXAH 1J86A 4M1GL 1MAMH 1DVUA 1QHOA 3PG2A 4ORGA 2NYZA 1KT2A 3CIQA 1HAUA 3WEXA 3TBTB 4KV5E 3NP3A 1KMGA 5DTFA 5EU4B 4C56A 5GGTH 5FYJE 3X3FH 5IB2A 3QJUB 2YBRA 2IXQB 2M8XA 2YZ1A 1BZEA 1XCQA 2HRLA 4BZYA 5AVRB 3IMWA 3AG2B 1QLFA 5FYKL 5DR5L 1I8KB 2MMXA 4LHJB 1XSIA 1S9KC 3IK2A 3KNBA 4XBPA 3L81A 1N59B 3TVMD 4IU2A 1A3RH 1BFTA 4GPVA 1INEH 2XACC 3AB0C 3D39A 4Z7OE 2NY2D 2WQXA 3L9BA 1FO0L 1RLBA 3FUNA 3NCBB 4P8QA 4B6ZA 4HX1A 4LSPL 1CFQA 1G94A 5CN3A 5L6YL 1ZIBA 5IBMA 2E76C 4A2HA 4KJPD 2FCBA 3EOTH 3DX3A 1XBOA 3MA7A 3ULUE 3RIAK 3NQKA 4DT2A 1JBJA 4HYTB 3T3PF 43CAB 4TUUA 1JZ7A 3WNMA 2I07B 1LGVA 4MLIA 1JHKL 4B9CA 4AX3A 1KWKA 1JFQL 1NMAH 3G5YA 1L0YA 3HG5A 4ZW7A 1QZNA 1DBBH 2EINB 3IMSA 4TPRL 4NN7B 4Y19A 1Q9KA 5HJ3A 1GOFA 3MUGB 3QR0A 3K4AA 3HE7D 1U58B 5C97A 3M17B 5KA9A 1OTUD 4LOUD 2N1KA 1U4FA 3II1A 1S5IL 3V0AC 4UQ3B 4JGNA 4MMZC 4QUOA 3W3BA 4XZ4A 4XP4H 1AS6A 3EFFA 3UDWC 3V5HA 5FO9B 5DVLA 4MBBA 2WOBA 3ETBF 2R0ZH 1X5YA 1JSYA 2OJEB 3C8DA 1ZJAA 4WHTA 4L1LA 2ZX6A 1H9DA 4YX2H 5FYJL 5C07E 2FEDC 4L8DB 2OMUA 2F5AH 2DQFA 2Z93B 5SWSD 5DRWA 3ZDZE 2P28B 3OQ3B 3RTQC 1BD2B 2GJ6A 1ODAA 2WOYA 1P15A 2CDFA 2QSCL 3EG9A 3JTTB 3DX9A 5CF3A 2CGZA 1W0WB 2L7UA 4BSVA 5L4IA 3L2LA 3MVNA 3QDME 4W9LC 3QUZB 4BJOA 5EU7C 4N86A 2EJ1A 1FG2A 1MHCA 1JZ8A 4KWUA 3MRHA 2F54B 5GISH 5TH2A 7PAZA 7FABH 1DQDL 4XC3H 5F1NB 5IW6A 1R3HB 2ZJSH 4ZFOL 4X8GA 3ULUL 1RZ8A 4KQ4L 4M6AA 4P5RA 2W65B 1V5JA 3SGDH 2NXYB 4Q6IC 1A6TB 3VDBA 5IFJA 4MVBC 3FT2A 4X6FA 3FB5B 3S48A 5HJBA 3QG7H 1R1CA 5KBLA 3QRFM 4JHWL 4PYGA 2NLJA 5CLXA 2H6UA 4JO2H 3EJRA 1VPOL 5K9JL 3ARFB 3ZMQA 3IJSA 2H04A 1CGTA 1IARB 4G7SB 1QVOB 3QCVH 3S36X 2CMAA 4HUXA 5KEZA 5KVGE 1HOCB 2XXFA 1TKWA 4FMFA 4FNLH 4MASA 4PRPB 3F62A 4P2OA 2QLVB 5A6IA 4XTRC 4OFKA 4X5PA 4WTYA 5LBSA 2B4OA 2A9NL 2MWCA 4DKDC 5J4MA 1I3GH 1FNSL 1TCRA 1XIWA 3RPKA 3MRNA 3SPCA 4KKLD 1PLAA 2QVIA 2VLME 4JREB 3QRLA 3DXAE 3ARXA 1JNJA 2IFFL 4J3OF 3MNMA 1XZ0B 5DUBB 1A7BA 1NCOA 4AEHL 3BZ4A 2R1YB 2XWTA 3NCJL 4MJ5A 4Y2OA 1EVTC 5I1EH 4J4PA 1G1OA 2P45B 3BEWA 3BWZA 3B37A 3ABKB 2TAAA 1RJLB 1MCDA 4FQHB 1FPRA 5ECJE 1JGVH 1NAMA 4JZOA 1SNRA 1B2WL 1TTAA 5GGVL 5BUPA 4U1IA 1UG9A 4KO5A 4KO9A 4QRFA 5JIQA 3BH8B 3P9LB 4XC1H 1YWFA 1EAPA 1WFUA 5IR1B 2VITA 1WAXA 3F81A 3ULAB 5F9OH 5F1KC 2CA4A 3REWB 1EBAA 1P7BA 1GFYA 5HHVL 1I1AA 3ZW3A 3MUHL 1ZXKA 1LM8V 4GSQA 1PG7W 3N41F 4CN4A 5GJSH 1M6OA 3T3ME 3OF6A 3WNNA 2GUYA 3PWVA 3S2AA 4Q9CA 4R97B 2NY5L 4ENZA 3QZWG 2HTLD 2ED6A 5IK3B 3UABA 3ZDYE 2GI7A 4B0MM 1MY5A 4DPAX 4DW2H 3RGQA 3BVWA 1BQSA 1EXHA 1FVEB 1BM7A 1D9KC 2MCAA 5KVGL 2NT2A 4KK6D 1Z0NA 1RVFL 1PX3A 5IB5A 4IKIA 1C88A 4NKIH 5KSBF 3O3AA 2Z9TA 4M6ML 1P5VA 4MMXB 4B9FA 4WY7H 1ZEAL 1IKFL 2HG5A 1N3NB 2XETA 4NKMA 4OM0L 4H7VA 4GSDH 3MVSA 3QC6X 3VFOA 3BGMB 4NZJA 1NMBL 1MFUA 3MRLB 3MJ7A 4LRNH 2F74B 1AQDA 1DUZA 5D7JC 2XHNA 1MCLA 4MMYB 4FDWA 1BGXL 5D4HA 3DWTA 3NACH 1JPTL 4W9HC 2AGJL 1IIKA 5K9VA 3ARGB 4F8OA 2R4RL 4MS8C 5D1XB 2OSWA 1DANT 4M29A 1NGYB 3ZLQC 3OXRB 1G7IB 4XP6L 1XGTB 5DRNB 1NH6A 5JW5A 3EADA 4Z7QB 4ALAC 4DGVH 5M95B 5DVOA 3HNVH 3ILQD 4NQED 1U8MB 4BE6A 5I5IA 3BDXA 1S9YB 3D69A 1V55B 4V11A 1VZGA 3PWUA 2Y0SA 3U25A 3UBXI 4TNEA 1AKJA 1EENA 2VDRH 3JUZA 4LVEA 3ARBC 2JB6B 5CZVH 5BZZA 4EZMA 1EEYA 4QRQB 4TSAL 1R3LA 4R4BA 4BWWA 1DUYA 1PKOA 2X1OA 5D6CB 2CM3A 3T8XA 3QCIA 3R19A 4CVUA 5C0JA 3ME0B 4IRSB 4KRPB 1XGYL 2Q1EA 1IGCL 3CVCA 4NNYB 3HFML 4YO0B 4D0CA 5HHOE 1AR2A 1TJHL 2VN7A 2XZAH 3MX0A 4EJ1C 3FONA 4MA7L 3S35X 5JIKA 1JPSL 4WJ5A 1UJ3C 3UXFA 2C1PA 5MI0B 2EC9T 3UGEA 4A7GF 2PYEE 4UT9A 1OEVA 1BOGA 3T3PE 1MVYA 4OZFH 5D1QD 4G6JL 4JLRA 1E0OB 3ZK0A 3ZT6A 4F1SA 4YHPB 3QDHA 4O02H 4HJIA 1PLCA 3EYOB 3IMBA 1R6HA 5TDOA 2CUHA 4QR7A 1NIEA 3NZ8A 4HLJA 5I6LA 2W07A 2VDPB 2WPGA 2FO4B 4IEFA 2YD5A 5MP6L 4WFGD 3GXGA 4ZS6D 2B08A 3HC4L 1TQBC 1A6UH 2OW6A 4JFUA 4FN0A 1XTMA 1S3KH 2OZ5A 3MV9B 3L5XH 3O4OC 1DJHA 1ANUA 1I9IH 2UWEA 3PV6A 4TOYH 2XU9A 2UUDK 5DS8B 1G7MB 3D06A 3VI3E 4LLWA 1RFDL 1KJ3H 3ZT7A 1AR1B 3HAEG 4MD0B 2XNAB 2UZIL 4CKQA 3GIVB 4FG2A 1XH0A 4NHUB 1KCRH 1OD9A 5HHNA 1FJ1B 3OD3A 4ZPTA 5E7FA 2PO6D 2BNQB 4Z0BL 2BSRA 2H2PC 4LBAA 1KCVH 5C2BL 2PCPB 2X4RA 2HH0L 3ASWA 1BYOA 1UURA 3HE6B 3KCWA 4G6FD 4YHOL 1H9VA 4WWKC 4IDLA 3T9WA 2XG5B 1FSKB 2AJZA 3WTWA 4LXFA 5I16B 2DLFL 2ITCB 5CBAA 3DUHA 3Q1SL 1VFAA 1E2VA 4Z18A 5IOKA 4P4KC 4Y4FC 2QSVA 5JUEH 2GW5A 1AKPA 5LAXA 4OZGB 5GGSB 3A67L 1D9KA 2WXQA 2G2RA 2NXZB 2G9KA 1AHKA 4BDVB 1NDMA 2BERA 1F6FB 1AZBA 3C6SA 4OF7A 3GWJA 4OBSA 4NENA 1LLAA 3PPSA 3LN4B 4D9QE 2FLBT 5A6MA 3I02A 3FT4A 1MWAA 3MRGB 1O6SB 3V8CA 4PLOB 1RIHH 1FIGH 3BW9B 4QRRD 4S1SH 2ZT9C 4KKAC 3F6LA 2ZUSA 3MO1A 4KFMA 5D7JA 3U4BH 1KIPA 5GZNC 4Y5XB 3L7FA 4UYPA 1I3VA 3IFPA 4BUGA 5LWYL 4AQEB 5MEQA 3W5NA 5EUKA 5F3HB 4TUOB 5HHOD 2WGPA 1Z3GL 2CJSA 2DWDA 1H0DA 2ZOOA 4QRAA 3AGWA 4ZOCA 1EO8L 1A1NB 2NCMA 3HS0B 3WS3B 4M1DL 3DBXA 5L0QB 2HKFL 1GAFL 3L13A 4M5ZL 4QLRA 2PYED 4MNHB 1BPVA 5AZEH 3I9GH 1W6LA 3MLRL 3V95A 3VXQB 1UWEH 5ETUB 4L1BA 2B1AH 4XR8C 1M6UA 3FN9A 2FTAA 5T1MA 4P07A 1M05B 2V3EA 4U6XA 4YC2B 1AGFA 2G60H 1OWWA 4FXGC 2H9GA 2EDQA 4OFPA 1CLOH 2UXTA 4IGBA 3CMOH 1FI8C 1QEXA 4BCZA 2C8NA 3QJXA 1WE5A 4ZX5A 1P7HL 1UM4L 2VEWA 2ZOLA 3O0RH 4L1TA 3S8GB 2OR7A 3L3KA 1DVFC 3ARBA 1HU8A 2VL4A 3CSPA 4CU7A 5GZOA 3LPGA 1VDGA 4YDMA 5GS2H 1KYUA 2WLLB 4AEEA 1E6JH 1KCUL 2H1XA 2ZKXA 4LLUB 2CZNA 2PPEA 3UYPB 4Z7VA 1CGXA 3ARYA 3LXCA 1BEXA 4F5CA 2HRPH 1MJJB 1LL1A 3US0A 1IC5H 1U21A 2QKIB 1QR1B 4NZFA 2QMJA 2RALA 3RURA 2WQ8A 4UILL 3TIEA 4RI4A 1AE6L 2RIKA 3Q6GL 2LU5A 2XX1A 3HR5B 4Z0XB 2K4AA 1OZTG 1RZKC 4MWFB 3ZE1F 2WKGA 1RL1A 1LILA 3AMKA 4M48H 5GS0D 2KUTA 2WTPA 2E0TA 3P9MA 1CG9A 2FIKA 1BD2E 1P5UB 3DV6B 3EFDL 4WI9A 1OIOA 5MENA 1B6DA 1WFNA 4QTHA 5CU5A 1ND0A 4EBQL 1HWGB 1CGVA 3CN2A 1MLCA 5GRVK 1BZJA 5CKGA 4WCYL 1NKOA 5IHUH 4YHLL 2F53D 3TJEH 3OG4B 4P05A 2K7PA 1M3IA 4ANVA 1JF7A 2F54E 1SHWA 3F9AA 1F3JA 3A21A 3L3GA 5IVZA 1BQHB 2VUKA 5BV7B 5EZJA 2Q87A 3MV8B 3QCHA 1OT4A 2BWIA 1IB5A 1N2RB 1N6UA 1QSFA 2XWBB 1ZJBA 2QHRH 1R75A 1HKFA 3IETB 3V6ZB 4YHZH 1VFOA 4WQOA 4CMHC 3LH9A 4J8RB 3ZXAC 2Y7QB 2YAHA 1MFDH 1Z1WA 4MHHG 1A6VH 2TSBA 3H3BC 1NEUA 2HTKD 4MJ6B 4ZIYA 3A4EA 4NC2B 3QI9B 4JPIA 4Y2EA 4G6AD 4M1GH 4B9YA 2VO5A 3CVHA 1SMOA 5IMLB 2OJZL 4PRPE 4NSKA 2GSIA 4MB1A 5ILTL 3S3SA 3QUXD 1PAZA 3RYMA 4Y4FA 2DQHL 4LSDA 4JZJC 4FX5A 1LE5A 2VORA 3LDBC 5CD5C 1BVZA 1KJVB 2C7UA 4J3OD 1E4KA 2ZX7A 1Q8MA 5DHVA 4BFKA 3MAWA 1Z9OA 4GOSA 1GZHC 4BA0A 4PRBB 5DR5H 4FF9A 3CZNA 2VXQL 3CIAA 1CBVH 3PABA 1HHGB 4JRXB 5DO2C 1A25A 1WISA 4OFDA 4E9WA 4ZTOL 2EEDA 3BRDA 1RH8A 4QDIA 5IHLB 4LSPH 2Y69B 5L6YH 1VACB 1G7HB 3ZM0A 1EDQA 2N56A 1L9NA 3T71A 1VF5C 2CA3A 2H47C 3F7KA 1EIBA 2OA9A 4APXB 3LIZA 3NSYA 1MW0A 4HUCA 2L7JA 1KBVA 3CFUA 3B34A 1EHKB 3DI2B 3HZMA 4N4YB 1DZBA 2X41A 3UTSB 3BKML 4WI4A 1B0WA 2CBMA 3TFBA 1WSST 2OMVB 4YDZA 3WELA 5HGBA 2P8MA 4D7PA 3IDXL 4XPHH 1QBML 3QCUH 3U30C 1RULH 2AZAA 1YJDH 3A6BH 4OGXL 1A1MB 3RG1C 2EDNA 3VM7A 1DVYA 2X28A 4XN2A 3M46A 3F99A 3DRTB 4GW1A 3R7RA 1YAZA 1HSBA 2CIIA 1B9KA 1DVFA 4CC4C 1EEUA 4X0NA 1S8DB 2CDGA 1BAFL 3IDJB 1BYNA 3AS1A 4YIQA 2B16A 3HIZA 1UWGL 2ALWA 4RNRB 1C9SA 2BK8A 3WFEH 2XKNA 3UYOD 5KANI 1XF4B 4FI6A 4Q56A 3UZEA 2R7EB 2WCPA 2A0LD 3QIWA 4NQVA 5DMIH 3EO0A 3CX5J 4MCNA 1JI2A 1NBZB 4ZO9A 5D1XE 2V2WB 5KS9B 1KXTA 3NMEA 4O4YH 4S10A 4ZXBC 5ISZB 1GTNA 3CVIL 1GPOH 3I9IA 1TTRA 4N2FA 2VLRA 3P40A 3EUUA 2XVKA 1I7ZB 3AU1B 4HH8A 4XCCL 2AEOA 1KTLA 4N2HA 4AIZB 4OV5A 3S3KA 1OY3B 3VAEA 4Z7QE 2J7LA 1CO1A 4K8RC 4PVNA 5B3JF 1O7DC 4KZDL 3B2UD 4GLRI 4NYHA 5JLZB 3DK2A 4OHLA 4AGLA 2WNXA 1ZHNB 4HUMB 1QFWI 1VPOH 2WN2A 2HVLA 2WAQA 5HHPB 1E8CA 4PJ5B 4HIPA 1WP6A 4OZ4B 1YMMB 2R1WB 3PWLB 5E2TH 3TYFB 3UTPD 1JYXA 4TMPA 3FT9A 1WCBB 3N1QC 5E0FA 4MB5A 1NBYA 4U1SB 3X13B 4JKPH 1CZ8H 1GC1C 2VMEA 1GGYA 2A9NH 1QTSA 4OLVH 1FNSH 4TSBL 5C0BB 1TZ8A 1OCOB 3KLHC 2YAFA 3ZDXB 5CKAA 1UKTA 1A3LH 2YN3A 1NIDA 2YXMA 4AC4A 2D7TL 4HWZB 4CN1A 3OMHA 3B9AA 1ZT1B 4U6VL 3ZX1A 5ICYB 3QP3A 4ZPVB 3TM6A 2FJUB 4RESB 2CNIA 5ID1B 1A1OA 2AI0H 3CFKA 4DO5A 1ZVHA 5JXAH 4I3SL 2VR7A 3QEQA 1I8MB 1WA2X 2YLKA 1ZHBB 3W11C 1MFNA 3EYFB 3EGDA 3KDMB 3DETC 5E6UB 1E9OA 1CT8A 1GZHA 5GJTL 4Z6AT 2DV6A 2HA1A 3FQRA 1ODUA 3RL1B 5CN2A 1HHJA 4AM0B 4KKNA 2D0FA 3BAJA 3WMSA 1OSPL 1A7RH 1KZYA 1OB1A 1KN4L 1IAIM 1PLGH 1TTGA 2BCKB 2OI9C 3MV9E 4K71C 4W9ZA 3UG5A 2F7OA 1N0LB 4P23C 4M8QA 4F8QA 5CCKL 4ANXA 4FP8L 4X7CC 1YNLH 1JIBA 3CGTA 3QFDB 3WO4B 4BFIA 4JL2A 5IKCA 1A9BB 1WWCA 1DDHB 3WL9B 1BFVH 4KTDL 5IMOA 2EDXA 1MFCL 4HKJB 3L3IA 4DGIL 2MOVA 2HCMA 1KTDB 5A3IC 2BNQE 2VC2B 5DZVA 5I76B 1ZCLA 4I4WA 2IFGA 1O9VA 3C60A 1NSNL 4XWOD 1KLFA 1RZIA 1NLBL 5CCJA 1KGIA 5E4IA 1MLBA 3ZM6A 2PNDA 4PJ7A 1L9MA 3SYCA 2CKNA 4AV4A 5LLIC 4KNUA 4CW1B 1OEZW 3VXOB 3IU3A 1NBVL 1AQHA 1OB0A 5BJTA 4OAWA 4OZGE 5JHDD 3L4UA 1SOXA 2Z7YA 4NO3B 1LE9A 1YG9A 4XPBL 3IF1A 3W39B 4ORZC 3RVXC 5EU6D 4FADA 5B7EA 1IAMA 4H5SB 3V0HA 4AZUA 2WMPB 4TQEH 4DZBB 2GUOA 4UNIA 3LQAL 4KOCA 3NH7L 3BSGA 5C0RH 1PX8A 4EKXA 4W70A 3ZUNC 4DF9A 4ZOAA 3UAEA 3RBGA 2VCOA 2VDPL 2W0LA 3MUY1 4LMQI 4Z77B 1XDTT 5B7FA 4ZX6A 2WC7A 3F8UB 4KXAA 1O7SA 2EXWC 1X5XA 2NQDA 2HVJA 2YPVA 3N6YA 3VXUD 2V9RA 4JCMA 3HG4A 4YEEA 4IBVA 5DQDL 4X6BB 3LZNA 5F6IC 3E8UL 2X4SA 3NA9L 4LPTA 5DK2A 4I18C 4ZXBA 1TQUA 1XEDA 2O26U 1CD8A 1RZJH 2YA0A 3QXAA 4AVKA 2FEDD 3QKPA 2ZOUA 4QIRA 4W68A 2WZPA 3D1OA 3S5LG 4U1KB 3THMH 3KGTA 1PFOA 3SHSA 4ZYKA 3RTQD 4N5EC 5KA1A 2D2OA 4F37K 1DBKL 4UUJA 3TGXA 2PWDA 1PIFA 2X89D 3QCCA 5DMGC 2K9FB 5MHSD 1NC4B 3HFMH 3HG0A 2NYYD 5EB9A 2QVKA 4YDIL 1BZDA 2WXRA 2JCCF 4X42A 3MRQA 3OJ2C 2Y2FA 1IAKA 4FQIH 1Z9LA 4KK9D 4Z7UA 4IKJA 4U1MA 1R17A 1YUHA 3VRIB 4ZMZA 2VOSA 3C8KA 4KUZL 3TONA 1TO5A 4BINA 3DVNA 3KPRD 3CFEA 1CXEA 3QJOA 4NM8H 5IG7B 4MVBD 3WIHL 1A4BA 5A2IH 2WWKT 5HSFA 2E46A 1BECA 3KDPB 1Q0XL 4Q6YA 1KIQA 3MLXH 4QAPA 3VFMA 2BNQD 2WLZA 1VSCA 3AG3B 2OW7A 2UY6A 1JWMB 2W94A 2VSDA 4G1EA 4GW4A 1E9QB 4YBQD 4ZQKA 3FOMB 1GWZA 2E7LC 1QUPA 2CM7A 2CBTA 2I7OA 2IOMA 4JS7A 1C5BL 2EDMA 2QR0B 3S3DB 4EE2A 3HHMA 4E0RA 5GGVY 1RFDH 4XTRD 1SGKA 2P47B 2QPFA 5ICXA 3MLVL 4HKZA 5DQJA 3O3EA 3QCFA 4M7LL 2FWOA 5DEGA 1KBWA 5EBMA 3FYEB 4A68A 3S34L 1IEBB 4GG8A 1BQLL 4Y2DD 2Q7YB 4Y89A 1Y7VA 2Y4SA 4ZS7H 4AQAA 4GAYA 4NCDA 2LVCA 3QWNA 4GINA 2OMYA 4P23A 3RGHA 5A5EA 4DNLA 3MV8E 1WLHA 2XV6B 4XVUD 3ARDC 1OM9A 3ARUA 1G6VK 4TVVA 3APMA 4HG4J 4J3SA 1PDKA 3Q1SH 3WCYA 1JZ5A 2QV2A 2Z6FA 1KENL 3HJEA 2EIBA 3HAEB 4NQTA 3H0TB 43C9A 5CLZA 4OFVA 1JOIA 2X9ZA 3ESUF 3BH4A 3JTSB 2WB1A 4RMWA 5J56B 3VRLF 4HQQL 4ERCA 1TLMA 1W72B 4OGYL 3OZKA 4JPVH 4PJCA 5FO7B 4ES9A 2F58L 1FF5A 3WDIA 2ZKHH 2BW4A 2YAQA 4DPCX 1K72A 4XNBA 2JKNA 5E5LA 4K23L 1T1YB 4PLKC 2YA2A 3NCCB 1BZ8A 2V7NB 2ETWA 1RK1A 3UYRL 5LWYH 5F7FA 4TYUA 5CP3A 3HVDA 3ZTDC 1BQKA 2F7QA 1BVNP 1OHCA 5AAPA 2UV3A 2WYTA 5IW1B 1N70A 3K80A 1K3IA 2ZONA 4MB4A 1EO8H 1MEXL 2DQGL 5D8JH 4JRXE 2XN9D 1KDIA 4X8JA 4LEBA 2APTA 4OKVA 2EVFA 4LLMB 4DP6X 5C09A 4ZX3A 3L3DB 3P30L 4YNYB 4CVZA 4N2GA 4FJYA 5BRZB 2XZQL 2X4OB 4UQ2B 2H6OA 2WXMA 4HFWB 5D7LB 5EIIG 4FG6C 4M61A 4C58B 3DK0A 3M7OA 3IFNH 1UM4H 3SKNB 3A23A 5GS0H 3F5WB 1CTMA 1NWOA 3FU9A 4AH2B 5JA8B 2WLMA 4JFDA 3QJVB 4PREA 1DCEA 1OVZA 4HC1L 3C2AH 5FV1L 3UTSE 3MOAL 5AAWA 4J39A 1BAWA 1S7UB 1V3LA 2P5WB 4MDIB 2VGLM 5K9OB 1KCUH 3QZBA 2YIHA 4BCXA 4CDHA 1U6AL 1HQRA 5D93C 3ESVF 4JMKA 3HUJF 1IX2A 3F12B 3QWOB 3QXWA 1OP3K 1RURL 4Z76A 2VRAA 5J12C 1RPKA 1GCYA 2VLKB 3HBZA 1HHHA 1BSIA 4GRZA 4QEGA 1LYVA 1WCHA 1AE6H 2GHZA 3IDNB 4X5QA 5BMFL 1KY6A 1PGRB 2P7TA 4B27A 3U9UB 5C3LD 1E4XH 5DYOA 3FUDA 3I9PA 2Q7NA 2AK1L 3EFDH 3ZHDA 3IKCA 2ZNXA 3A4AA 4K3JH 4PWIA 2F61A 4M43L 3FTVA 4Q9BA 5D2NB 3U4EB 1OOAA 4QCIA 5L2JB 2NY7L 3VQLA 4JM2B 2YAOA 4LNVA 2ISDA 2R8SL 2LHAA 5M7QA 2IAAC 1U3JA 4YHLH 4HPOH 3NIGF 3QI9D 1GJWA 3DPBB 5KBKA 3QJSB 2QADC 1PJWA 5KS9E 5F89B 4WI8A 5JNYB 5L9DL 3O6FC 2J8UA 5F3BB 2E7LA 3ZKQD 4J3OH 5ISZE 1A21A 2FSEB 3NAAH 3LIUA 3KPPB 5JA9A 1TFHA 3KMDA 4YPGB 3ZBMA 4DP1X 4OCSH 2XV2A 4EI6A 4RBPH 2FAUA 2BZDA 4V1DA 4IRJC 5D70L 4KROD 2JKWA 2CUMA 2YPKA 5DWUL 5E24E 2ZOKA 4S1DC 1MZZA 1R3KA 2VQUA 4ICWA 1INDL 3ELAT 4PJ5E 4F58L 1YMME 3BRFA 5IBUG 4TQ8A 4JFYB 3ARDA 2PR4H 3QCBA 1JZIA 4WHYH 4WKZB 2HJFB 3MJ8B 4BIKA 5ILTH 5FECB 2RTTA 4EI0A 2AFNA 2B0SH 2HY3A 2DQHH 1J8HD 4QYOA 4IIQB 3RWFB 3RB7A 3HNTL 4CMMA 1OAXH 2YD1A 3BXNB 4RX4A 3AZUA 4ANKA 3ZSSA 1YPZF 1KC5L 1QP1A 4PJXB 4X7SH 1BZHA 2H2PD 5C0DB 2CLRA 4F7PB 1SYSB 1BBDH 1YY9C 1T0PB 2DMBA 2R2HA 4WWKD 4WGKA 1WBXA 4JFED 1X7SA 3CDCA 2FJGB 4QXGL 3F01A 5H8DA 4I0KA 5KSVB 3UBXB 4B50A 5CUSH 5KUKA 3EZ8A 1JXJA 1J0IA 5FK9A 3T2QA 4BFGA 2J6EH 3QCMA 1LP9F 4QLWA 3FO9A 4PS4H 5I1CL 2MNUA 3EHBB 4F7EA 2NRDA 4RQQA 4YXKH 1F6AA 1U8JB 3RZCA 4JDVA 2FHBA 4EI5C 2OSLA 3SO3C 3LYRA 3B7TA 2J73A 3BT2H 3DX0A 3T65A 3GSXB 4JNBA 2R1XA 4N6QA 3V0EA 1N26A 1HQ4A 4MAYB 4N8CH 5KYUB 2R23A 3IDXH 4NUGL 1GY2A 4NKOA 1WHOA 4TSCL 3B9EA 5HYSA 1AGBB 1RJZA 4OGXH 4RA0C 1D6VH 4KKQA 2EUVA 4EPSA 2XZZA 3TEXA 5JPMA 3MJ6A 1RK0B 1KV7A 1I9JH 3LHAA 3MV11 3OLIA 4HJ0D 5H35A 1WK0A 3DYOA 2NUPA 4JAMA 4UTBL 4XN8A 4JFQB 3GM0A 1AO7D 3CHSA 4N85A 5SV3A 3SDXF 3T0DA 2FHFA 3GBNH 3U7WH 4PRID 4LK4A 2XVLA 1RUAH 4E41B 1I75A 3AABA 3RL2A 5ACMA 4MNQE 3QQ4B 1Q6TA 3GHPA 4L0YA 3X11B 3AWGA 1CVRA 2MNJB 3E38A 4F15B 1D5MA 4XXWC 2OZNA 5AW0B 4IOSD 1ZTXH 4CRPA 2WXPA 3K6SB 1VCAA 3CSYB 4A2LA 1JERA 1MRFL 3HG1A 4XE5B 1HWWA 1HE7A 1F1AA 2B5IB 4FL4B 2BZ7A 1NWEA 1ROCA 2D31B 3DLQR 3MRMA 1YEHH 2J1ZA 2ZSVA 2EDDA 2X70A 3AACA 3CH1B 3OMIB 4OLZH 3RGBA 1E4WH 1SVCP 1HHKA 5DJXA 3WSQH 4P5TA 5KJRL 1CI5A 1RZGA 1ZPUA 4Z7IA 1JGEA 2X1PA 2PKDA 1ERNA 2VTDA 3F58L 2XFXB 1OTTC 4XPAH 1GG4A 4HAKA 3ZHKA 2WZ5A 4EUPA 3P4LA 5AOIA 4XNUH 3E6HB 5AVTB 5J11B 4HAFA 4JB9L 3V0IA 4XMLH 1UZ6E 1FQ1A 4ZDHB 2VLJB 4ZMQA 3WAJA 3L5IA 1O9ZA 4WV1A 3CZFA 3RHWF 4XVJH 3RVVC 2O4EA 3QO0B 4WNQA 3BZ5A 2CPCA 4QGTA 5E08L 1AZVA 4E2OA 5DJ0A 3EJPA 4RMUA 4NQUA 4ZNCD 4MQ7B 4PJGA 5F8RC 4MCZB 4M6NL 3P73B 4G5AA 1FYTD 2FLRT 2OL3A 2D7TH 5I1AB 4N8VG 2NZ9D 5DK3A 3PNRB 3B1UA 3GHBL 2LVEA 3VMOA 3B56A 4UV4H 4E68A 5IB3B 1NMCB 4DP0X 3L4WA 3QA3B 1DLFL 1KTCA 2Z31B 2ZWYA 4X5XA 2NNAB 1JPEA 2R9HC 3MLUH 2KL6A 4QHNB 1ZMYA 1BBJA 4HZ1A 3GRWL 4PBWD 3H9SB 1SDYA 3MFFA 4I7ZC 5GJTH 4CBPA 4RFEA 4HWBA 4AG4H 5LG1A 5C70A 4MXWH 4C4UA 1X4YA 4IJTA 3D05A 1LK3L 2GVYA 1KN4H 5BXFA 1BWMA 4RAUB 1CF8L 1AACA 4K15A 1RUMH 4FP8H 1AI1L 1W9XA 1B4LA 2VR6A 1ZSHA 3BISA 1AXIB 4GXVH 5E2UH 2EYTA 4N25A 2VXTH 4KXZH 4JFHE 3D52A 1GTFA 1N19A 3FFDB 3SZ6A 4KTDH 2O5NA 5DVPA 3UZVA 4MNQD 2DZEA 5BO1H 3MNVA 4W9JC 4UM9B 3QEHB 3SJVB 4U6YA 1J1OL 3RPIB 4UQIM 3TH4T 4TVPE 4PJFA 3IDYB 1N64H 2AQSA 4GSUA 4IRZA 4EI5A 1H6TA 4URKA 4MA3B 4ANWA 1WZMA 3ZL2A 4FA8A 1SYVA 1XXVA 4HWEH 3L3HB 3VJ6A 3BSHA 3VXSB 2GG1A 1RIVL 2UAGA 1YFOA 3K46A 4PMFA 4TTGA 2TSAA 1XMEB 1ZOXA 4O51B 4UNTA 1ONZA 1SUGA 3BWUC 1JGUH 2YUZA 4YGVB 1IEHA 4ZMTA 3LY6A 2FRGP 2VDKH 3LS4L 4UTCA 4ZTPL 3H55A 4CVWA 5DD1H 3W9DB 3LQAH 4EZKA 1KB9K 3NH7H 4PQXA 5LHDA 4MQXC 4EN3D 1OCCB 3TA3A 1G1YA 3KLSA 4HCFA 3SE6A 3FN3A 2CO7A 2V9TA 1NJ9B 3FBQA 3R4DA 2OUDA 3EH2A 1A4JB 2Y7LA 3ZHFA 1NGZA 5HYEA 1RIUH 5KSUB 2E9JA 4BFOA 2UYLA 4N0YH 3HC3L 1FNLA 5EOTB 1KSRA 4ZSOA 4AYBA 4XXWA 4FEMA 4AEIL 3ZN6A 4M7ZB 2YWYA 2Y66A 3RWJB 3GSNA 1KXVC 4NN5C 4OIIL 4MZRA 5DQDH 5DUML 3E8UH 3OKOA 4QKXB 4PRDB 4WW2A 4WFEE 1JS4A 4XP5H 2IH3A 3EYVA 3I6GA 1LO5B 1R5VB 5BRZE 1R5WB 1EJ6A 1YPZE 1CYWA 4TVPL 3W56A 2JK5B 2F8XC 1DBKH 2VT0A 4KVPA 5DEFA 3DJRA 4H8QA 3RA7L 3SYPA 4UNVA 3TF4A 2J71A 5K59F 2F00A 5ADOH 3ARSA 1NM4A 4KY2A 1PF3A 1VGEL 3CUPB 1T03H 4U3SA 3TZVB 4XNMA 3BP7A 4P3DA 5IFHL 2HKAA 4NC1C 4NQSA 2H6PB 1XSOA 3OPZL 5CXPA 3S3PA 3CK0H 1M2VB 3EO9L 3VD4A 4N2BA 2WSPA 3GI8H 2P5WE 4QRPE 4Y5VA 4BZ1A 3CHQA 4JFHD 2ERJB 4E9YA 5DLML 1W72L 5C8JA 1TQCC 5AVVB 3EAXA 4PW9A 2MQ0A 3BAKA 4Z95L 4Q9QL 1H19A 1SJEA 2VLKE 4GY4A 4PJDA 4TVPD 2GEEA 2NY6B 4MJ4A 3BVNA 5I71C 1QTPA 1OF0A 3Q1EA 4KKPA 4ORGB 2ZP8A 5F8QC 3WEOA 2XDHA 2HFFA 1YEJL 3JWNC 1KT2B 4GQQA 4PY8I 2MQGA 3TPUA 3WEXB 4X4YA 3NRSA 3JZYA 2OQJA 5DTFB 4C56B 2BS71 5E8EA 5I18L 3AGVA 4GFUA 5D2NE 5IB2B 2YBRB 1FA4A 1KB5A 2JIXA 4M7LH 3GGWA 3PJNA 4AYSA 1ADQA 1XCQB 1KXQE 2GK0A 1NKRA 1J0KA 2RBLA 1QLFB 4LEOA 3FDWA 5FKAA 2OYPA 3TT3H 1I85C 1OT1A 3WY4A 3KNBB 1OM3L 5IVOA 4XBPB 3QGVA 3ZMEA 4ZW3A 3B2XA 4UZUA 3L4ZA 4IU2B 1HXMA 5HGGS 4Y16D 1IJ9A 4YFLI 3D39B 2JELL 2QGEA 4TNVK 1TMCB 2FGWL 3M1BA 4HX1B 1CFQB 1CLYH 2AK4D 4AVIA 3QFJA 5T1LD 5C0IA 3WGUB 3MA7B 3APNA 5TE7L 3H2QA 3C6LA 3QBTB 3EBAA 4R3SA 3KWXA 2BSCA 4JFVA 1SHXA 3G5YB 2QPDB 5I74C 3MACH 5EIQA 2W60A 3MYZA 4L4VA 2X10A 2Z8RA 4X2UA 4WFED 4XX5A 2FQGA 3KWWA 2MQ3A 2P5ED 4Y9BA 5HJ3B 4Y19B 1Q9KB 5E51A 3AG4B 3IBOA 3WU1A 5ALBL 4Z3GA 2E8ZA 4HA1A 4K23H 3SE9L 3QCZA 1ZPLA 1EHNA 2GC7C 1THAA 2ZUVA 3EFFB 3V5HB 3UYRH 2AJVH 3T4AA 3DO4A 5F21B 2R69H 2IG2H 2VDLL 4PJXE 4WHTB 5A3ID 4Q6KA 3CM3A 2VH5L 1PPIA 3N1PC 1MCWW 3TNNA 5H37G 3UL4A 1L3NA 4UOJA 1YEWA 2P46B 3NPSC 3IXTA 1T80A 2ADYA 2OMUB 3P1VA 4NZRH 5D96C 4TRPH 4WNJA 2DQFB 4ALAH 2WLKA 5DRWB 3P30H 4QRPD 4QRUA 2GJ6B 4WGVB 2Q10A 3O2VL 1QNZL 2XZQH 4F7MA 3EG9B 1L6XA 3DX9B 4YQXL 4R30A 3G6AA 3NN8A 4WI2A 4URTB 2J5WA 5D7IA 4LEEA 4BSVB 4MXVF 3N85H 2DY2A 3BD4A 1WJ3A 2X12A 3DSNA 5IBLD 1FG2B 1MHCB 3PGDA 3US9A 3VU1A 4PG9A 1KXVA 3MRHB 4R2GC 4YBLC 5TH2B 1MNUL 2VLLA 1GZPA 3VXPA 4FNRA 5IW6B 2NQCA 1PZ2A 1SDDA 2EIMB 3QNZA 3NCYP 5E5UB 1I7TA 1ZVSA 1RZ8B 4AGMA 4Z3EA 5D7SL 5GGRA 4HC1H 2H3XC 3MOAH 5IFJB 1F11A 4X6DA 3LB6C 4G7VH 1PYWA 3FT2B 4X6FB 5E6IC 5C7XL 1B90A 1TQVA 4LSSL 2EXWD 4ODHH 2NLJB 3DIVA 4UTAH 4ZX4A 1YNTA 5LCVL 1LXMA 5DZLA 5FM4A 2HMIC 1FQ9C 3PF2A 4GE2A 1RURH 5B4MC 3KEDA 5DVKA 2HNQA 4H8WC 2AKRA 3IJSB 4UAOB 4RMTA 1OGAD 4N2AA 1AC0A 4HUXB 4P46C 2OP4H 4XVOA 1XF5A 1TKWB 2K70A 4ZMAT 4P2OB 3CSGA 1YZ4A 3D2UD 4Y2NA 4LVOC 4AENA 1A7QL 4BA8A 4FCAA 1TCRB 4KH9A 4GUQA 4N5ED 3Q3GA 1XIWB 4N2NA 3MRNB 1A7PH 1J18A 3V0WL 2NR6D 2FD6L 1XD1A 2R8SH 4QHKI 1IQDA 3QSKB 4GKLA 5DD3L 2ICEC 3BZ4B 2X4PA 2DQUH 5A2KH 5L9DH 2XWTB 3LZQA 4MJ5B 4Y2OB 3X1FA 3VGAB 3NP4A 3PIQA 3JUYA 3QZMA 3BEWB 1K8IA 1NCAL 1K9TA 2R0LL 3D3VA 3IMRA 1NAMB 4JZOB 1PSKL 4U1IB 5AVXB 1MHPL 3TP4A 5JPNC 2DQ6A 1EAPB 2BSED 2VITB 1BLIA 5DWUH 1UCBL 1CICC 1I85A 1FFNA 2NTSP 2XWJA 3UTQA 4XCFH 2BY3A 1I1AB 1X5GA 1QFUL 4I1RA 2VLJE 4F58H 1OP5K 3MLTA 4X9HA 1CXFA 2HFGH 2FUQA 1TMQA 3L4YA 1M6OB 1NUFA 4MDRA 4PGCA 1H5BC 2L7EA 3PWVB 3NFSH 1T21A 4PS3A 4FD0A 4RAVA 1BWWA 2IMMA 3MNZA 1ZGLA 1QOKA 2BIQA 4NO2A 5DURD 5EU5A 3T0WA 3WMPA 4WOHA 5PCYA 3PWPA 3RUGA 5JOPE 3V79C 4M56A 3IPFA 4YLBA 1IFHL 7PCYA 2AQQA 3VD1A 5IB5B 2DEYX 3OGCA 3O3AB 5CSBA 4BK5A 4W93A 3VM5A 1CS6A 1P5VB 5A6LA 2HG5B 4NKMB 3H2WA 2MPVA 4N1EA 3RIAF 5IBUB 3QEUA 1JRHH 2MCMA 3VFOB 1J4XA 2YMOA 3F7LA 2JJSC 3MJ7B 4KI5F 5TQ2L 1AQDB 1DUZB 4H4NA 2QZQA 2RQ8A 3HJ0A 2G5RA 3H9SE 4PS8A 4ZT1A 4ESKA 2E56A 1CFVL 1HKLL 5GS1C 3HI5L 1JGLH 1XF1A 1QLRA 3NCFB 3EDDA 1L5GA 2E7DA 3DA0A 3VNYA 1OEUA 5CINL 1VKXA 4UIKL 2IF7A 3ZQXA 3IAQA 4EOWH 4W4OC 5L88H 1A5FH 5JW5B 3WXVH 3I6KA 3SE8H 4JZNA 3R18A 4N0RA 2I9LA 3Q9PA 4NQDD 5IF0A 4HUNB 4TSCH 3BO8A 1KYDA 4YSUA 3LD8C 4XMZA 5F9DC 4HKBA 3BWSA 1F86A 3D69B 3KM1A 3SJVE 2XBTA 3PWUB 4YDKL 4JMJA 3A47A 1DVQA 3R1GL 1AKJB 2VZUA 3IDIA 3REVA 2CU9A 2XJAA 4I88A 5FHBL 5AYUH 1EEYB 1WEJH 4UTBH 3VXSE 2CGRL 1R3LB 4ZMPA 2I32A 2A2QT 1BVLA 4R4BB 1DUYB 3T8XB 3UAJC 3QYCA 1T04A 5C71A 5C0JB 4CC0A 4FG6D 5CO1A 3ZHLA 2X1WL 1HOEA 1P4IL 4D0CB 2VJXA 1H3PL 1A3ZA 5HHMD 3V4PA 2FB4H 2OX5A 3MX0B 3FONB 3QB7C 4OF6A 3Q2LA 1XXDC 2CG9X 1X5LA 4XB7A 1M56B 2Y24A 4P46A 5AWNH 1QW9A 2ENQA 1MCKA 2Y9RT 1JE6A 1T22A 2C1PB 5KBDA 1BMWA 1LNUA 3GK8L 1BOGB 1OARL 2J16A 5M94B 3S3BB 4JLRB 3QDJA 3CDFA 5K39A 2CJZA 5TDOB 3FTSA 1Y6MR 3NZ8B 3X3GH 1GMEA 2W07B 3V0JA 5J6HA 4IEFB 1BPLB 1CCZA 1U3HC 4OLXH 4J2QA 2COQA 3V4VA 1DBAH 4KKBC 1L7TL 4JB9H 4JDZA 2ICEA 3RNQA 4NQCD 2UWEB 3BIBX 3PV6B 2I6JA 4ZOBA 1NQBA 1ZE3C 1PY4A 4OFYA 1XHHA 4LLWB 4Y1AA 3MLPA 3K6OA 4ODSL 1S9WA 3FU6A 4DAGL 1AGCA 5E08H 5HHNB 1M7XA 2WGXA 4N28A 4ZPTB 1HIMH 2ROXA 3H3PL 4HMEA 2BSBA 2BSRB 3RDTA 4HOXA 3MBWA 1T1WA 3SDAA 5HY9A 4M6NH 2X4RB 1AHWC 4X0KA 4EZJA 3DDGA 5D55A 1G1FA 2NY1D 2NDGA 1R5IA 1S5HA 1XSJA 4LSVL 3O6FD 4D7BA 2AJZB 4AJVA 2FQFA 2X2YA 3P9WB 1YQVH 5CBAB 1WBZA 4UQDA 1VFAB 1WUZA 4HXBH 1DLFH 3MGTA 1UA3A 4LP4A 5LAXB 4FG4A 4NWGA 1NUNB 1I82A 1D9KB 5E8OA 2G2RB 4UM9D 3BGFB 5SV4A 3GMOA 5DJDA 1YUKB 4YBHA 2D7QA 4PP1D 3EFOA 1FRGL 1NDMB 1XB6A 1YMHA 3CWGA 4A1RA 3C6SB 1MCIA 4JUTA 1ZLVH 4NENB 1F90L 1LK3H 3I02B 3FT4B 1CF8H 4Q14A 1MWAB 3X17A 3F7VA 2E75C 1Z7JA 4KZCA 1I8LA 3SBQA 2JJSA 4KK8D 4NGHL 1KPUA 3NIFB 3MO1B 3OAUH 5D7JB 2EXTA 1KIPB 2H26A 3L7FB 2DIEA 3IFPB 4KJQC 5MEQB 3O6MH 1EMTL 3QJQB 2EDLA 5EUKB 4OM1L 3LKQA 4NN6C 2UVFA 4XXDA 4YUEH 3S97C 4DP9X 1AS8A 4NUJA 2DWDB 1H0DB 4I9WE 3ZIMA 3ZKND 1J1OH 1VZHA 1QPKA 2BNUA 5H4ZA 3EGSA 3DBXB 2JKTM 4XH2A 5DZAA 3GJFK 1MCFA 4RMSA 3D39E 5L2KD 2VQ1A 1RU9H 1GS6X 3K6FA 4OLUL 3U0TA 3VA6A 2NX5A 4WIQA 3B2VH 1ZVNA 5FYLE 3FU7A 4DGXA 5T1MB 4K2UL 2Y25A 1WBYA 1MCWM 4U6XB 1I9EA 3BHBA 1AGFB 3HEIB 3D08A 3PHSA 2H9GB 1NGQL 1ECZA 3IMVA 3ERXA 4IGBB 2MCPH 2VXUL 2V6HA 4Y0GA 2YAMA 4BFJA 2ZOLB 3LS4H 4P5SA 4ZTPH 1ZLUH 3L3KB 1AG0A 1MJ8H 1EVUA 2O6PA 3O8XC 1XZWA 4HT1H 3ZMPA 1GSKA 3GDBA 3ARBB 2WSDA 1SEBA 1QWNA 3WEAA 4JRWA 3ZZSA 1MFBH 3IS0X 5JHLH 5KBMA 1JZFA 4APQA 4DN3L 3EYUH 4TVSa 3EH1A 3RGOA 1TJIH 3UERA 1ZDSA 2BNRA 1A4AA 4Z7VB 3LH2H 4UQCA 4YWGH 1MNNA 2AANA 5IWLA 2EH8L 1W0VA 5HI3C 3CFJA 4D3RA 6FABL 2ALAA 1EEZA 5CM1A 4TLUA 5I0ZA 1OSEA 4HJQA 4BFNA 4G3YL 1QTYT 5CNHA 2FGZA 1LHZA 4WEEA 2JI1A 3VWKA 4OIIH 2AAVA 3TIEB 4FFZA 3WUZA 3KLLA 4OHIA 2E4TA 1XCWA 2GY7B 4FERA 2BSTA 3EJQA 3H42L 2JTDA 3L08A 3P9MB 1CG9B 2FIKB 4ABUA 2GJ6E 3F41A 3RPBA 2VN4A 3WTXA 5KA3A 5MENB 3E0GA 4QTHB 4XVTL 1ND0B 4TVPH 5SWZE 4TTDC 2EDFA 1MLCB 4PB9H 2HPOA 5KUMA 1U3HA 1JWSA 1VGKA 1G7QA 1TQBB 5EORL 4K0OA 5DHMC 2XWRA 1F3JB 1RQ5A 3L3GB 5IVZB 4YSPA 2XTJC 5FYLL 3DTXA 1GC1H 5EZJB 3OPZH 2R2BA 3GLAA 1QSFB 3IKKA 4R7DA 3EYQC 2ICWJ 1IZJA 3EO9H 1M1SA 1MRDL 2CNHA 3VD5A 3S88H 1JTOA 4Q4EA 2YC1A 3O6LL 1OCRB 1QFOA 2WY3B 1ETB1 3ZKMC 1MFEH 2XJLA 1OTTD 4DGPA 2VB5A 3KYKH 4Y9FA 4Z95H 4HIIA 1AHWA 4Q89A 1FL5A 1NANI 1XGUA 3M88A 4JPIB 5D5MA 1N5YH 4Q9QH 1QSED 2B3RA 1AMXA 2GC6A 1TETH 1WAAA 4BHUI 4EXKA 1X7QA 2DMKA 4U2YA 5B38A 5I1DA 5T5FA 4NSKB 2GSIB 1PTTA 4XNZB 1DFBL 5HP5A 3QUKA 2VUOA 1UEMA 4P4KB 4Y4FB 4P59L 3SE4C 1LE5B 2VKWA 1PD6A 2AXFA 2V9UA 2C7UB 1CDCA 3CZLA 3MRFA 2PUQT 3ULVE 1MZYA 1OHQA 4MLSA 5DHVB 5IM7A 5FW7A 2EYRA 1TZAA 4FKHA 5IUCA 1QFWL 5HJGA 4N3UA 3MRBA 3PABB 5FUOH 1JYNA 4FCHA 1YO4A 3MR9A 2JELH 3D85D 2FGWH 3BJ91 4JDTL 4PIRF 5G4OA 4D9LL 1HI6A 1IE4A 5HDBF 1DQKA 4WTZA 1ACYL 1ZAGA 1AJ7L 5D4QA 1R33A 3W9EA 1KBPA 2D4DA 3AJ7A 1NCDH 2YK1H 5HYJA 4A7TA 1T5KA 3HZMB 2AJSH 4Z78A 3PNWA 6PAZA 4S0HA 2P26A 1LO3H 3ET9F 1FE8H 2V5YA 2HKHL 5HGBB 2P8MB 4MKTA 3O81A 2VXVH 5CGTA 4PJAA 1AS7A 3OHMB 5ALBH 5TF1H 3M1OA 3PXHA 2VDMB 3VYNA 4DGUA 3QUMH 3SE9H 2GY5A 5SWZD 3TN0D 1D5IH 4LCUA 4LMQE 1BJ1J 5T1JA 3B3IA 5D1ZC 5DCCA 2VDLH 3U4AA 4GW1B 2CIIB 1HSBB 1B0GA 1DVFB 5D2LA 5LBSL 5I8OH 2CDGB 3ULVL 4KI5D 4WSGA 4YIQB 4JFZL 5KSAC 2NY3B 5HDOA 1ZTMA 2ZN7A 3O2VH 1QAWA 2XKNB 4TQHA 3LZLA 5C6TL 3F6IA 2J6WA 5BVJA 3QEGH 3K2MC 4L48A 5SWQA 5A40E 3QIWB 4NQVB 2ENYA 3BKJL 4YXLL 3GXTA 2Z65C 3EO0B 4HVBA 1KEMH 5I24A 4JY6A 3S8WA 3BAWA 1G4WR 1TJGL 1X9LA 4FLQA 1ZGLP 1NAML 1KXTB 4HHAA 3RGVC 4MQXD 2C3HA 1J9SA 4L4JA 5E1AA 1J9TA 2V0AA 4P04A 5IJKC 2VLRB 3VA2C 4M6OH 1CPUA 5FO8A 4U3CA 1VEOA 1KTLB 4AVHA 5HHXH 4OV5B 2BOLA 1NGPH 2BO0A 1XO8A 4ZMYA 3ULVD 4X80L 1IBBA 1NWPA 3HI6H 3US1A 1IM9A 1RMFL 3BKCL 2XTSA 3CLFL 5TQ0H 4UT6A 1GJIA 3ARPA 5EO9A 1ZLWK 3PQYD 5HPMA 2YMTA 3GLDA 3QJFA 3Q2WA 2QLYA 3BZFA 4FKEA 4OD1L 4YZFE 3QORA 6PCYA 4LDCA 3TO4A 1NBYB 1AY1L 2B7DT 2C7FA 3GZKA 4P9HL 4HJ1A 2W81C 4M5YH 4RDBA 9PCYA 1X3DA 4CMHB 3LPWA 1ZLDA 1I7UA 2QPUA 1A47A 1ZV5A 5J13C 1D2OA 2BP5M 3DC0A 4FQCL 2AJUH 3DX7A 2FD6H 3OKDA 1DL7H 3ATFA 5FB8A 3CSBA 3HOGA 4KYQA 4Z7WA 1HL9A 1A1OB 3H54A 5JHBA 1KAVA 3CFKB 3B9VA 4P3CL 3ABMB 2DBJA 4PB0L 5KYXA 5IW3A 4OZIF 5J8RA 3CWEA 3KL3A 4Y4KC 4JQXA 1GYAA 3QEQB 2CNYA 1NCAH 1J9CT 5CZKA 2DS4A 3LDBB 2F6WA 1CFMA 1DR9A 4EO5A 5K9KA 1UWFA 2HJKA 4UIMA 1PSKH 3MA9L 3C12A 3EGDB 3FW6A 1MHPH 4BEIA 1E9OB 1CT8B 2KKQA 5F9JA 3FQRB 1DEEA 1UCBH 1NC2D 1HHJB 5IVXA 4JPKL 1OB1B 2IBGA 3TEZA 4IDJL 4M8QB 4C83A 2Y72A 4BFIB 1IL1A 1DJWA 4LQFL 1SBBA 4BQBA 3H6JA 5IKCB 3NK3A 1D5ZA 3AQXA 1I9TA 3ZSTA 5IMOB 3BKYL 3L3IB 3HLKA 2NSQA 1G7GA 4QGYA 5T8IA 1EGJA 1F4YH 4LIQH 3TEWA 5EF0A 2I6PA 3WDHA 5JQ6H 4I4WB 3VGGA 1PZ3A 1IFHH 3QNYA 2AV1A 2BIIA 3WJLC 1O5PA 1ZIAA 3C60B 1L8KA 1KLFB 1NCJA 1Q94A 1RZIB 4NWFA 3SQOL 1PTUA 2DYPA 2CMRL 4JJOA 1MLBB 4KZEL 4PJ7B 2CUAA 3QS2A 1DN2A 4HIEA 1LO2H 1ID5I 2ZXCA 5I1JH 4KAQL 3ZE2F 3ZZ1A 4BE5A 3IU3B 3U30B 4FLRA 5BJTB 3DGGA 4QHMA 4OAWB 4RDQG 5AVZB 3TWYA 4AYMC 1IEAA 3GDCA 5TQ2H 3VXRD 1LJMA 1LE9B 4CVLA 3IF1B 4KFZC 4YXHL 3PXLA 4HS8L 2FECI 2GUOB 4JY4A 2V7HA 1BZ9A 5HBBA 2C9XA 2RF6A 3S2CA 4TLTA 1Y18A 1E8YA 2NY4C 2IV9A 4RWHA 5CINH 5KSAA 2QTEA 4B0MB 1L6ZA 2N59A 3B5HA 3EDKA 2I24N 4XPTL 4XGZA 2ATAA 1DCLA 3PYZA 5IQMA 1QWHA 3FUEA 3NIFE 3QAZC 4GQRA 2HVJB 3O3LA 1KFAL 2J4WH 5C0EA 2C7SA 5HVGB 4WZ9A 5GSRA 3G5ZA 5T33L 3UO1L 1NZ7A 2VXSL 4B60A 2IAMC 2CLZA 2X4SB 2BIPA 5GRJL 4L8SC 2CRIA 5DK2B 4ZXBB 4A7UA 3QXAB 5IMKA 5KVDH 2HT2C 3WMQA 2CGRH 1D7DA 4ZYKB 3NIDB 1SFHA 3KWUA 4UUJB 3WN5C 1SXNA 4YE0A 3ZKXC 4PGJA 5H2BA 2G2NA 3DHUA 3MRQB 2DLHA 3MLYL 1OGPA 1IAKB 2X2JA 4R2GD 4YR6A 4RISL 2WXOA 4Z7UB 2ZP0T 4U1MB 1YUHB 1U8IA 2NOYA 3II3A 3S3HA 4WDIA 3C8KB 2IEPA 4PJ9D 4U1JA 2ZYSA 3DVNB 4OV6F 2QDVA 3KYMA 3CFEB 3WFCL 5GRXG 3LB6D 1LEKA 2H0FA 4D3CL 5J1TC 1W16A 4JFSA 1TCMA 4Z7VE 1M2OA 1KIQB 2RACA 4DESA 4F5CE 5ERWA 3SGEI 3VFMB 4OGAD 1MWAL 2UY6B 5F3FA 2VM4A 5B4MD 4P5MA 5FGBC 1G9MC 4G1EB 4GW4B 5EC1A 4B5EA 4ZQKB 1Q90A 1L7TH 5T3ZL 4TQIA 4D8OA 1UYWH 2ESVA 2YUXA 3ZR6A 4KPHL 4S1RL 4Y4KA 4ZN5A 4E0RB 2BZLA 1V7NL 2DLEA 2Z0UA 2FBRA 5ICXB 1M4KA 5MENE 4HKZB 4ODSH 5DQJB 2I26N 3O3EB 5DEGB 2FWOB 5F9AC 4DAGH 2WO3B 2XIBA 5EBMB 5LXQB 4GBXD 1JXKA 4NCC2 3DX6A 1FG9C 3H3PH 1HILA 2LW3A 1J48A 3QRGL 4GG8B 4TL4A 3S3CB 2V3FA 4M7JL 4RMBA 4AQAB 4FXLA 1FUNA 4GAYB 1EPFA 2OI9B 5FWRA 4PJIF 4K71B 2OMYB 2OYMA 4P23B 3WOVA 4AITA 5IT2L 1WC7A 5EDXA 1OLLA 1PDKB 3KBEA 3ISRA 4AW7A 5T3ZD 4EMZA 2B3OA 43C9B 2AEIT 4L4TA 4YAAA 4NZUH 2A6KA 2R0WH 2B77A 2QSTA 4ZFGL 3D4YA 4BGDA 3WJLA 1CICD 5FHAH 3IU4L 3MBEC 3KCPA 4QWWD 3FQYA 4J1UA 2F15A 3IE9A 1MJUL 5C08D 5SX4I 3W0WD 4PJCB 1VJSA 3VB9A 5E9AA 1C7SA 4FE9A 5IJCC 4DQOH 4Q0XL 1MXGA 4OHEA 5FLVA 1NFDF 2ID5A 2JVUA 3CLEL 4Y4HA 1RK1B 3GSQA 2FYYA 4BUQA 3VFPA 2CCLA 1T5XA 2YZ8A 4C12A 2P24A 5HYQA 3WE1A 3FL7A 4MJJA 1ED3A 5BUAA 1F00I 3GMLA 3JQOB 4X8JB 3FPXA 5E4AA 5F7EL 1A7OL 4WEBL 4OKVB 1TSHA 5C09B 4HJPA 4I0PA 4OLUH 4CVZB 1BA9A 3IMTA 5GGTA 3V6OC 4H40A 4KH2A 1FZOA 4JY5L 4M61B 3OJVC 5EBLA 1V3MA 5T1KD 3Q44A 4WFFD 5EG6C 5I1GH 5IESL 1IKNC 3JYBA 4K9EL 4Y7OC 1LQBC 2VXUH 1IBYA 3BMWA 2WNKA 2K1MA 2OCJA 4NZ8A 1B4RA 4L3ED 4KMLB 3SDCC 5F6IB 5LGHL 3ZRFC 4L8SA 5BW7C 4JJ5A 2Y6SC 1QD0A 4HZLA 4JFDB 1K5WA 4PREB 4LPCA 5DZJA 5C1MB 1CYXA 2I7SA 2Z4QA 4LVNB 2ITDA 3UH8A 4B9PA 3HC2A 1HQRB 2A6DA 6TAAA 1EFXD 4FULA 4JN1H 5AW7B 1G6RH 4WO4C 4D0DA 5DHXB 5JQIB 4P2YA 3EH5B 3CVHL 4MXQD 4Z76B 6FABH 4R96A 2W8CA 2Y2WA 4AK1A 1R0AL 1V3AA 1X9UA 3OB0K 4UQEA 3AREA 3U1QA 2PWGA 1HHHB 2EDOA 4OQTH 4ZAKC 3HG3A 1VIWA 1CU4H 2WVTA 4OCXH 2P7TB 5LNGA 3JWOL 3PUCA 3HBPA 4QYAA 3WYRA 4F37F 3BUYA 4UMGA 4EQ3A 3W2DL 1SY6H 1OAQL 5DYOB 4AJYV 2HPTA 2VWEC 3ZOAA 3IKCB 1Q6JA 3UAJD 2V33A 4QCIB 3I3DA 1JV2A 3GO1H 4AL8L 1TNNA 3DOHA 5CLYA 2DBLH 1QBLL 1KELL 1CWVA 1ZANL 4PD4J 4PG2C 5EORH 1ZT7A 4XNQA 2J8UB 1J0JA 2F6AA 4XMPH 3B83A 1G0YR 4BBWA 2AABH 4P3WA 4Y7MA 3QZNA 2VLRE 1T83C 3LIZL 1WPCA 1C16A 2XPZA 1P6WA 1VCBC 5CJQL 4EI6B 4BQ6A 2HYMA 2NTAA 4Z8FL 3C5ZC 4H1LH 4V1DB 5KYNA 2AERT 2BHFA 2YPKB 2ZOKB 5ACLA 5E9DD 1CXIA 2MIZA 4QKTA 1PZAA 1R3KB 3T0VA 4KKBD 3U2IA 2VDML 1U8KA 4MDJA 3ARDB 4WRLA 2H4KA 3NCMA 3HB3B 2I6OA 1DJSA 2F6ZA 4R83A 1CUOA 1YEEH 2EKJA 1M71A 1MCPH 4NO0D 3T77A 4QYOB 3P0YL 2VDOH 3V0DA 4AJWA 4CMMB 4F33A 3T0AA 1KGCD 1UVQA 3HPJA 1FGSA 4OLWH 2YO3A 4FTVD 3QQDA 2Z4TA 1F3DH 4GLRH 4KQ0A 3OL2A 3MBEA 3QDGA 3V4UL 4DWHA 2CLRB 1MDTA 1QFWH 4NX0A 3FO0L 2UY7A 2R2HB 1DQIA 1WBXB 1MCBA 3ZPDA 4PJBA 3D5OF 2Q76A 3CXHJ 3PUUA 3VUAA 3QDAA 5EEZA 4YL4A 2C34A 3QEQE 2QL1A 2F8OA 4ABVA 4D9LH 3IDGA 4XN1A 3ZZLA 4RKKA 2Y7OA 1ORQA 2FSDA 5FK9B 1JHLH 2C26A 2G4GA 3RFZC 5C0ND 2EP6A 2XN0A 1L4IA 2ZG2A 3FO9B 5J3HC 5BS0A 5I15H 4F7EB 4RQQB 3WIFA 2FE0A 1F6AB 2XWEA 3VH8A 3AU0A 3BM8A 3RZCB 4JDVB 4AUYA 2OSLB 3D18A 2V5MA 4C4KO 5LXVA 4QJ4B 1JK8A 1HINH 3T65B 3BH9A 1JWUA 4WUKH 3NJLA 2R1XB 5I75C 4HIJA 1HQ4B 3IEAA 3V6OA 4NWUH 4ZNEA 2R23B 4GG6F 2FHCA 2N7AA 4NKOB 3L4VA 1ZZWA 3UAFA 1CGWA 4FQLL 4DPBX 3CZEA 3IGAA 2D7OA 2VMJA 1AXTH 1P6AB 4WJG3 5DYFA 1RJZB 5HYSB 1EA9C 1FFPA 4GP8B 5GHWH 1KGWA 3QCKA 4NQQA 5GRZA 3SDCA 5JPMB 2MCG1 2WXNA 5BW7A 2IQ9L 2DTSA 2XBZA 5JIHA 4X98A 5H35B 3ASOB 2WLJA 4UYQA 3NPZB 2NUPB 4JAMB 4LF3A 3T0ED 3QQ3A 3ULVH 3N9GH 3BJLA 4PJ7E 2VLRD 4BJLA 1W0YT 4WU7A 4C4BA 5D93B 2J8UF 4IBYA 4N26A 1X5AA 2VZVA 4PJ8C 3RL2B