3V0JA

Crystal structure of ciona intestinalis voltage sensor-containing phosphatase (ci-vsp), residues 241-576(c363s), deletion of 401-405
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
319
structure length
319
Chain Sequence
KRRYRKDGFDLDLTYVTDHVIAMSFPSSGRQSLFRNPIGEVSRFFKTKHPDKFRIYNLCSERGYDETKFDNHVYRVMIDDHNVPTLVDLLKFIDDAKVWMTSDPDHVIAIHSKGGKGRTGTLVSSWLLEDGKFDTAKEALEYFGSRRTDVFQGVETASQIRYVGYFEKIKKNYGGQLPPMKKLKVTGVTITAIQGVGRGNGSDLSMQIVSERQEVLLCKFAEGYNCALQYDATDDCVTCEVKNCPVLAGDIKVRFMSTSKSLPRGYDNCPFYFWFNTSLVEGDHVTLKREEIDNPHKKKTWKIYRDNFTVKLTFSDAED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Voltage-sensor containing phosphatase
publication title A glutamate switch controls voltage-sensitive phosphatase function.
pubmed doi rcsb
source organism Ciona intestinalis
total genus 108
structure length 319
sequence length 319
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00782 DSPc Dual specificity phosphatase, catalytic domain
A PF10409 PTEN_C2 C2 domain of PTEN tumour-suppressor protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1110 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3v0jA02
3.90.190.10 Alpha Beta Alpha-Beta Complex Protein-Tyrosine Phosphatase; Chain A Protein tyrosine phosphatase superfamily 3v0jA01
3F9BA 1KAVA 1MKPA 4Y14A 3QCDA 4S0GA 1R6HA 2I5XA 1PXHA 5KABA 1NL9A 3O3LA 5KA0A 5KADA 3D1OA 1YN9A 3QCLA 4DGXA 1XXPA 4RI4A 2J43A 1M3GA 5BUGA 5BZXA 2H4KA 4MBBA 4OHHA 1NZ7A 3ZV2A 1G7FA 1ZZWA 2I6OA 2NV5A 2QDMA 2HXPA 5KA2A 3ZMQA 2QBQA 3AWFA 4WU3A 1T49A 1G4US 1PH0A 4RH9A 1YTSA 3F99A 3O5XA 4QAHA 2R0BA 3QCKA 2F70A 3D1HA 3EB1A 4WOHA 1ONYA 2OC3A 4OHDA 1I9TA 2F6TA 2J17A 1PA1A 3D44A 2NT2A 2HY3A 2YA1A 2AZRA 3ZMPA 1G1FA 3V0FA 1FQ1A 2CM8A 2HVLA 3QCEA 3D9CA 4R0SA 3I80A 2OOQA 1WAXA 1C85A 2QBPA 4JNBA 1OHEA 3I36A 1BZHA 3V0EA 3NMEA 1ZCKA 4RI5A 1V3AA 3O4TA 4PYHA 1X24A 3S3HA 1EEOA 3I7ZA 1G7GA 1Q6MA 1J4XA 2P6XA 1C86A 3H2XA 3QCJA 4Y2EA 2AHSA 4H34A 2RF6A 4ZI4A 2B07A 2IMGA 2VEVA 3CM3A 4ZRTA 1A5YA 1G1HA 4Z6BA 1L8GA 2Y2FA 5K9WA 3QCGA 4NYHA 1XM2A 5MMZB 3QCFA 4TVVA 4ICZA 5M43A 2QCTA 5K24A 4HJPA 2H4GA 2OUDA 3F81A 1YGUA 2J44A 3RO1A 5BX1A 5KA7A 5GTJA 5K9VA 2I3UA 2CM3A 3M4UA 1C88A 2PQ5A 2J72A 2GWOA 2B49A 2CJZA 2OZ5A 2HNQA 2H4VA 1QXKA 3V0IA 5KA8A 2J16B 3S4OA 5K25A 1Q6NA 4OHEA 4D3RA 1PA9A 1ZC0A 1AAXA 2CMCA 5EHRA 5BZZA 2ZMMA 1OETA 3F41A 4KYQA 2Y96A 2NTAA 4GWFA 1FPRA 3RGOA 3V0GA 2FJNA 2BZLA 4YR8B 1SUGA 2CNEA 2Q47A 3SR9A 2B4SA 4GFUA 2BGDA 3ZM1A 5I6VA 1OHCA 4NNDA 2QDPA 1BZCA 2P4DA 3QCHA 4GE6A 2FHCA 4IKCA 4HRFA 1YGRA 1Q6TA 2HC2A 2QCJA 1JLNA 5KACA 1BZJA 1Q1MA 1ONZA 1YFOA 4NWFA 2F46A 2H02A 3S3KA 3O4UA 1VHRA 3QCCA 3D1QA 3EZZA 1T48A 2VEUA 1U24A 2BIJA 2F6VA 2I6MA 2H04A 1I9SA 4D3QA 4I8NA 1PTYA 4DGPA 1C84A 4RDDA 1WCHA 1ZCLA 1U26A 4QBWA 5KA3A 1D5RA 2A3KA 2CNGA 4JBCA 2HB1A 5KA1A 1NWEA 2NLKA 2CMBA 1G1GA 4GRYA 4OHIA 1OEUA 4BJOA 2QBSA 5EHPA 4WU2A 3AWGA 4AZ1A 3N0AA 2G6ZA 4WTYA 2B4UA 2F71A 3QCNA 2MBCA 3RZ2A 3RGQA 4B04A 2GP0A 2PBNA 1L8KA 5IBSA 1C83A 3BLTA 3F9AA 4OHLA 3OMHA 2ZN7A 1KAKA 3QCBA 4GRZA 2QBRA 2F6YA 1LARA 1GWZA 1G4WR 1ECVA 2YDUA 1JF7A 4PVGA 1XRIA 2HC1A 3GXGA 4GS0A 3V0HA 3S4EA 2PSZA 1YPTA 2M3VA 3MOWA 2HNPA 2ESBA 1U25A 3BLUA 2Q05A 2GJTA 3SMEA 2B4OA 2F6FA 2I4HA 1OHDA 2FJMA 3S3EA 2CFVA 1PTUA 3V0JA 1QZ0A 2CM7A 2B4PA 3ZM3A 2I4EA 1OESA 4NX8A 1WRMA 1PTTA 1OEOX 3QKPA 3CWEA 5LXQB 5K22A 2WGPA 1C87A 1Q6SA 1FPZA 1XBOA 4QUNA 4QAPA 2BGEA 1P15A 2QEPA 2J73A 1OEVA 2PT0A 1GFYA 3PS5A 4NWGA 1NNYA 4BPCA 3EMUA 2NZ6A 4GE5A 3EAXA 3LJ8A 5HDEA 2A8BA 1I57A 2SHPA 4RH5A 4R30A 1YZ4A 2CMAA 5KAAA 4GFVA 4H1OA 3MOZA 3OLRA 4JMJA 3QCMA 1PYNA 2NT7A 2F6WA 5KA4A 4ZN5A 2FHBA 2G59A 1T4JA 3D42A 2DXPA 5AWXA 1RPMA 2BV5A 5IBMA 2CM2A 3U96A 1EENA 4KYRA 3ZM0A 2FHFA 4QBEA 1NO6A 2FH7A 2C46A 2PA5A 2VEYA 2I42A 3B7OA 2QDCA 3A5KA 3BM8A 2CNHA 3EU0A 2JJDA 2PI7A 1Q6JA 4KI9A 4HJQA 2H03A 2I6IA 1OEMX 1Q6PA 3QKQA 1RXDA 3ZM2A 3S3FA 2J71A 3V0DA 4D3PA 4GE2A 2CNFA 4R0TA 3BRHA 3O4SA 4J51A 2I6PA 2C7SA 1LQFA 2HCMA 4ERCA 4RHGA 2B3OA 3AWEA 2YOCA 1XXVA 2I4GA 2VEWA 2I3RA 1YTNA 3QCIA 4YAAA 5K23A 3MMJA 2F6ZA 2CNIA 3GXHA 4JMKA 1LYVA 4QUMA 1YWFA 1PTVA 2VEXA 1NWLA 5J8RA 3A5JA 1YTWA 5KA9A 2I6JA 2J16A 2I1YA 4RKKA 2E0TA 2I75A
chains in the Genus database with same CATH superfamily
4OZFG 1AMXA 4Y7MA 3WO3B 3A23A 5GHWH 3CTTA 3WHE1 3FCSB 3LH2H 2R27A 4B9ZA 1NBCA 4JPSA 4PJFA 4S0GA 2BVOA 2Z8VC 4GXUN 2HN7B 4P2CG 4ZMPA 4OUUB 4WK0B 2OR8A 5IBUG 3FQWA 1OF2B 4JANA 4YHOL 4E0RB 1U8CA 2A9CA 4FX5A 4GQ9H 2ED9A 2OCJA 2VMDA 4XP1H 1S78D 4KHTL 4YHZH 1QWNA 2J43A 3QQ3B 4XPGH 4ZOEA 3UJTH 3VXRE 2D9QB 1C16B 3EH1A 3HFML 4PJCB 2H4KA 4L3CB 5F1KC 1RZKH 3QXDB 3TIDA 3SDAA 3VWJC 1AQMA 3BE1H 1G9MH 2ZUXA 3QCUH 4GI9A 4RCAA 4HWEH 4GRWH 1KGIA 4JRYA 1GXEA 3TNMA 1HNYA 4XNXH 3F99A 1AKJD 1EBPA 1W0VB 4BFIB 1AQDA 1EO7A 3V4VA 3N1PC 5CSGA 4B9FA 2YS4A 2AZUA 1U8OA 4OVUA 5LGHL 1OLLA 2VLJE 1TZGL 4HXAL 4XH2A 2J17A 1XSJA 2AXHA 4Q74A 4GI8A 4Q6IA 1MCOL 5I8KH 1UGNA 3H9SE 2NT2A 3EFFA 1YC7A 4ANWA 2HY3A 4UZGA 1BF5A 3WAKA 1QFPA 2BWDA 4PWJA 1VGKB 4NQCA 2G60L 4C12A 1U21A 3D1MC 4IKNA 1IAIH 4XXCA 1NPUA 1TVHB 3QCEA 2NUPA 4N85A 2UXFA 5DEZA 2IBGA 4Z95L 5MI0C 5HYSB 1QWHA 1JERA 5LCVA 1AXSA 4LLMA 5IOPB 1FZKB 5GSRA 3FK3A 3D3VE 5E51A 5D5MF 1CICB 4GFTB 3REWB 2UUDK 2D7TL 4WDIA 5D72L 4CDGC 3NA9H 1JWSB 1P7QB 4ABQA 1X24A 4LLDB 1VHPA 3EOTL 2MFNA 1KG0A 3QXAB 3KCPB 4N6RB 1DJYA 1U8JB 4UT7H 4ZUUA 3GXMA 3ECWA 5GGSA 3H2XA 4Y2DC 1NL0H 3RFZA 1EEHA 3W11D 4OJYA 5DUBA 2UUPA 1UB6A 1JGUH 2F6AA 3IJ8A 3QUZA 4FNTA 3CM3A 4L4JA 2H8PB 3O6KL 3WS6A 4XNYH 4HS3A 4EKJA 4O2EA 1QZNA 3BZ4B 4JDVB 1UXMA 4ZFZB 5L6YL 4XX1G 5DHXB 4S0SD 4P2YA 1OQOA 3CN2A 1KJMB 1X7TA 5IQNA 3X12B 3EGSB 3IFOA 3SQOH 4NQVA 5IVOA 4OLXH 1EEQA 4K3JH 3TO4D 1M6OB 3CVHL 2X3CA 2GC6A 3UBXA 4W9CC 4NB7A 1GA2A 2BINA 3DDGA 4OIFA 3O2VL 4N2EA 3NIFB 4OT1H 1LO3H 4NPYA 2ZYRA 5KUMA 1ZT7A 3R18A 4ZFOA 1DCLA 5G4MA 4FCHA 3ZTJG 1NGYB 5A2AA 2ROXA 4IBYA 1OAZL 1QFWM 1E6JH 2HB0A 4FQXD 3DYMA 4XN8A 5IQ7L 5KYNA 2QADD 5KZCD 3HB3B 3P3TA 5FO9B 2XBTA 2G0KA 3HRZA 1T2XA 2O5XH 4YUEL 1MCRA 3L3IA 1T5XA 3TZVB 2Y72A 5E1HB 4AUYA 5E08H 2CJZA 3FHEA 2Y0SA 1OCWL 3LRSB 2HNQA 4NUQA 4ZXBC 1E28A 5TPWH 2FYYA 4PS4L 1SYVB 3OC8A 5CLZA 2J16B 4FXGC 2OMNA 3U82B 1QI4A 1NGPL 2XFXA 3WIHA 1T0PB 3SE3A 2ENYA 3HS0C 4J8RA 5BO1H 2FX9H 3DX9B 4LSTL 1AAXA 4O9HH 4XAWL 2NYYD 1WCBB 2F7QA 3EJTA 4NJAH 1RAMA 4N24A 4E41D 3T0XA 1N59B 4YL9A 5LCVL 1KTCA 4UOQA 2GT9A 35C8H 4NZTH 4L3EB 2QMKA 4HXBH 2YRPA 3EYQC 1ET7A 4PI0A 1IAMA 3DRTA 3VD0A 4NCC1 3HE7D 4K23L 5I1DA 2CM6A 3V6ZB 4DQOL 1I9RH 3RGOA 4H88H 2AXFB 4IRJD 1JS4A 1KZYA 3D69B 3R1GL 3JQOB 4JVWA 1MUJB 2A9ML 1RZKC 4G9DB 3W39B 1K8IB 2YRZA 3FU6A 5F44A 1C5CH 3MLXL 3Q2NA 12E8H 3ZM1A 1LLAA 4U1KB 2XVGA 3OB0K 5A7EA 1VEMA 2JFHA 1S7TB 3T3MF 2JIXD 3NCWA 1DQJA 1CTMA 2V8MA 1HCVA 1MIMH 1NIFA 1RUPL 2X38A 4JB9H 4FQ1H 3ZE1B 4TOYL 5IHZB 1B6DA 2P4DA 3L6FA 3ULUD 4JFFB 3GSQA 2M26A 4G71B 5A6IA 4NWUL 5ID0B 2Y23A 2OMXA 2FJFB 3A6CH 4DP6X 2OMYB 1ONZA 2MIZA 4YHPA 4OM0L 5E5MA 4Z9KB 1EDHA 3VI3A 4L4TB 3BZEB 2EAEA 4LPTA 3FTGA 5CN3A 2XXCB 2Y24A 3ZDWA 2R23A 1W0WB 3DXAB 1P4LA 3RRQA 4AIEA 1HT6A 4YL4A 2Z8SA 4Z1PA 1EHAA 1MCWM 2IAMA 4QOKE 5E00A 1E4KA 4QRUB 5F9DC 4EDXA 5IWLC 1MFBH 3DJ9A 2E7LA 5HGHA 3CFKB 4ZJ9A 3LN4B 3NJIA 1KBGH 2YMXH 3PQYB 3KXFA 4ZQKB 5EZLB 2Y9RT 5KA3A 1E8XA 4FMKA 2FGWH 3CHRA 2H3KA 4LDLB 4URTB 2ZUTA 2ATAA 4J3OD 4MRBA 3WUWG 3WIHL 3CSYA 1W8NA 3TWCL 1D7BA 3D09A 3D6GA 3MBWB 4WHYG 4O02A 1ZTXE 3SY0B 1U8IB 3CN0A 4AYFA 3S88H 2GJ6B 2VW7A 4WU2A 4RX4A 3N0PB 3QQ9C 3SSGA 5IK3A 3A67H 2UXGA 2Z7UA 4MAUH 4YX2L 1TYRA 3BSZH 4QHNA 1CFSB 2EO7A 2D7QA 5E9DE 2YAEA 2AJSL 3HKZA 4JO8A 2WUCL 1HQRB 1GQYA 4PAZA 3QIUA 4B04A 5D1QB 3HI1A 3UTTD 1SJXA 4I1RA 5KSVA 2C3HA 3S36L 3BQVA 1XF3A 4TS6A 5GGVY 4GSDL 4ZNCD 3ZX1A 1NEPA 2DD8H 2BLFA 2GJZA 3BUYA 3NJGA 2WD0A 2AEPH 2WUBL 1AO7D 5BRPA 1YYCA 1U2HA 2OMUB 2QBRA 5DFWH 4QKTA 1JZ4A 2EDKA 2B1AH 3UEZA 2BNRE 3VM5A 7PCYA 1HHIB 5I17A 4U7KA 4YOKA 5DMGD 5KSUA 1G1YA 1KN4H 3STLB 4BQ9A 4JRFA 2AAVA 3RZCA 4HX1A 4FLRA 4IEFA 4TULH 1MFMA 4POYA 4GS0A 3QZBA 3ZYZA 3IJYA 1KTDB 1AXIB 1FFOA 2G2NA 2K4WA 2QTEA 2MQCA 4Z7UA 4BGLA 4NQSA 3A4DA 5KVDE 4PJ5A 5IIEA 3BP5B 3W9DB 1ITBB 3DX6B 3EYFB 2V17H 4AQ8C 3TT1H 2AV7A 1FI8C 4OF6A 1MFAL 3MNVB 3OX8A 3ZSSA 3H1ZA 5CMAA 2IMNA 5JMOC 4B5EA 4FS0A 3B56A 4HIPA 5IBTH 3F7RA 4XP5H 5E2UL 5DLMH 4ELKB 3NAAL 1S2EA 4FFYL 3TCLA 1I1AA 4WGKA 3NIDF 4X83A 4Y1AA 3T0EE 1F3DJ 4PRHB 1CQKA 3NCYS 1PX3A 4WW1A 3KL0A 3SJVB 3VGAB 4PJDA 1OSPH 2X89D 3OHXC 4NKIL 1A1OA 1A1MA 3N44F 5JHDA 3QDMD 4E2OA 2WXIA 3GI9H 4UV7L 1GSMA 3GDCA 4CSSA 1A47A 1J8RA 4MJID 5D71H 3WKML 2YGPA 1RK1A 3Q5YA 2A4EA 4GJTB 1K5NB 2VDOB 1BM3H 4HJSA 4MA7H 1XCQA 1OSEA 4NKDB 1A7BA 3LPPA 2B15A 5DD5L 3CWGA 2AC0A 2NZ9C 3P30L 4O51B 2OP4L 4UILL 1I7RA 2MRYA 2DI8A 2OBGA 5ANMA 3CFMA 4ODTL 1HWHB 4ZFFB 4X0KB 3WFEH 1FFNA 1HSAA 4K9EH 2DQEL 4FQHA 4MA1B 4F8NA 1ZJBA 5C0FA 4K7PY 4HFUL 4X6BB 1CDBA 1UM4H 2FH8A 3D0LA 2G75B 1XSKA 4F1ZA 1SM3H 1G7PB 2QQLL 4JFXA 4BQ8A 4H8VA 1YMME 3LQZB 5M7QA 3BXNA 5JPNC 3GZKA 1YJDL 4EN3A 4YDJA 4TQIA 4DNLA 3QEUB 2WKOF 5F7WC 3UO8B 4EQ3A 4JM0A 4ZD3L 5AAWC 4XXDB 1Q94A 1RIUH 2XN9D 1BAWA 3QISA 4OFKA 3PWNA 4LASL 3K91A 2VQ4A 2YRLA 3P4MB 4OBRA 4RWYH 5EDSA 1IAKB 4Z7VF 2VEYA 1UXSA 2RJMA 3BWSA 1T21B 2YLHA 3AW5A 1KCVH 3T0EC 4H20L 4JLRA 4HISA 1LJMA 5KS9E 1P5UC 1SHMA 3ZUNC 3CQQA 5E8DH 4XMZA 1Q6JA 1T0MA 3KPLB 4ZZKA 2GUOA 3DURB 2EDHA 4K5MA 1A1NA 4QHLB 3BUDA 5EU6E 5A2JH 1KYFA 4GE2A 2MCAA 1W72L 1U8MB 4PJ8B 5CKGA 4I3SL 3MRLA 4HMCA 1SZNA 3TVMA 1YQVL 1LQFA 4QRFA 4N1EA 3BVXA 2Z64C 3SDXA 4LARL 3FXIC 2A9DA 3CSPA 5SWZD 1JHLH 4XR8C 5LBSH 3BVNB 1H3VA 1LEKB 2ZWNA 4Z6AT 5I2IA 3QW9A 1J48A 1LEGA 4HWNA 1F11B 2BFVL 1DHKA 4PJ7B 1A6AB 4EI5A 1SDDA 5FUZH 2YQ2A 4NO0B 4EI6B 2H32B 4QUMA 4C83B 4EVNB 3HE6B 4TKWA 1PTVA 3IDXL 3LHAA 2QFPA 5DHYA 3D85B 3PABB 4B60A 2R8SH 5CP3A 1N8OE 5BS0A 3TF4A 2NTFA 4OM1L 1BFTA 3QQXA 4I2XA 4RGMB 5FFGA 4PJ9B 4OD2A 2BRRL 3RVVC 3LXBA 2CPUA 2FQEA 3S7GA 5MEPB 2E7DA 5F0LB 1SOQA 1KNOB 4XNQB 3F7YB 4CMMB 3KZ8A 3FFDA 3IMTA 2NLJB 2AMUA 2HSIA 3CPUA 3DTXB 3VFSA 4I88A 4PP1D 4FQCH 3QCLA 1EUUA 4N9GB 2RQEA 1HIML 3SGJC 1NICA 3FB7A 1QOKA 4JY6B 4HC1A 2A83B 5I1JH 4WFFD 5BZXA 3V0VA 2OI9B 3UTSA 3HVNA 2WXLA 5J6SA 2DY2A 3NGBB 5E8OA 2JKXA 2EIZB 4HV8B 2WN2A 3FUDA 3WXWL 4U1HB 5CD3B 2CMRH 2J57A 2FLBT 4NQXB 3HNTL 3KYOA 3Q2WA 1EXHA 1T7XA 2X9WA 2XC8A 4I77L 4IHOA 2VSDA 3WJJA 3DDFA 1PMYA 1CPUA 1C5DA 2AXGA 1GHFL 1ECYA 1AD9A 4KTDL 1JCVA 3OKNB 5C07B 4WOHA 2BCMA 2WLIB 3L5JA 3HC3L 4D7BA 4PREA 1RZ7H 5T1LD 1IEBA 4FLSA 4IGBA 3ZE0E 4F7PB 1NEUA 1RUAH 2XPGA 3B37A 2I7SA 4JMXA 5DJYA 3NDYE 5EOCL 1HL5A 1RZGB 4GKOA 3W0WB 3KDPB 3QG7L 2WCPA 1X9LA 2AITA 3C5XA 4Z7NE 1SNRA 1QX1A 5L2KE 1AYOA 1SY6H 4OCNC 4HWZB 1BXVA 3E2HC 2XWJA 4F37K 2VL5B 4LLQA 3BN3B 3IMWA 4FTVA 3TCTA 5IGXL 2NNCA 5CBEB 2ZP0T 3O2DH 2CK0H 4P9ML 5D6DC 5KG9B 2UY6A 3AFLA 2OX5B 3O0LA 1CMOA 1E9OA 2IGTA 2BS9A 4BFKA 5JW5A 5D7IB 1V3AA 2MCG1 4NT6B 3EGXB 5C6TL 2VXQA 3WV0A 2IWFA 1RUKL 3NESA 5CGBA 5GISL 4QI3A 1FL6A 3B2UC 4TNGA 2FH6A 5ICYB 2D3NA 4R5VA 5HYJD 4OV6F 3BAXA 3ZQWA 2WVVA 1GGBL 1UWGH 4MFHA 4WW2F 2QZ5A 4ATWA 1XEDA 1V3JA 3FQUB 1TETH 3ABZA 2NTSP 4PJ6A 5FGBA 2EUXA 1U91B 4L37B 4YZFF 5DUML 2IH8A 1NLBH 3DYOA 1QRNA 5BXFA 1A9VA 3QUKB 3TA3D 2P5WA 2UWEB 4KRPB 3DX7A 4OLZH 1XM2A 1KJ2H 2BIMA 3KR3H 3IFNH 2GVYA 3OJMB 3WN6A 4PLOB 2WTZA 1FDLL 3MO1B 2XI9A 1OGAB 4POUB 2F7OA 5D2LE 4BH8A 3VFGL 1YC8A 2QVTA 1QTSA 4JPVH 2DQFB 2XIDA 4ONOA 2PPCA 5C09E 3TJHC 5KVEE 1AS6A 4F8OA 4GAGL 3D39A 2BFGA 5JIMA 3MLSH 1R46A 4U3SB 3BWAB 5F8QC 3L3JB 1UTDA 5GTJA 4NRXB 4M5YH 4WU7A 3DARA 4ERSH 3PUUA 1GTNA 2PQ5A 2DM4A 1BVKA 2CLRA 2DJUA 2J72A 4H1LG 1IBHA 3IFPB 1OM3H 5HHQB 1O0VA 1HC1A 3QO0A 3RWHA 5F7NC 1FZOA 4HPYH 2VE6A 2B2XL 4P2RA 5IB3A 4ECNA 5D7SH 3HZ3A 3MRBB 5K25A 1NGWB 4AQ1B 1Q6NA 1WO2A 3RHWF 2W60A 3S48A 4HUVB 1WS8A 4V11A 3L7FA 1DLHA 4JJ5A 1RH8A 3ZBMA 1TFPA 1R3KB 1WCQA 2ZCKH 3UYRH 2FJHB 5DXWA 4M1DH 4NAMA 5E4OA 5IV2B 5KN5A 1NGZA 3C5JB 3FRPG 3GSVA 3K46A 3L5IA 2GJJA 3CVBA 1TYEB 2O6DA 4AOFA 1JUFA 3KPSA 5T5FH 1BZOA 4JFED 2AK4A 2XBDA 4LL4A 3MLVH 1A65A 3Q3GB 4FQPA 2VXQL 1KF9B 2Z91B 3Q44A 5E4EB 5IUCA 3O0RH 5EB9A 3QXUA 1KIQB 1W0YT 2R1XA 4AM0Q 2HKFL 3ZL1A 3L3HB 3CN4A 5GGUA 5FYJH 4MJJA 2WKGA 2P5EA 4UT6H 4WVRA 1JCKA 4CW1A 4NN5C 5DMIL 3LS5L 4WU5A 1DBBL 4HULB 1PCXA 1UACL 2IALA 5AUMA 2GSMB 3BKMH 4Q4IA 2XHNA 3RKDD 4YPGB 4DVRL 2VDQB 4R2GB 3BSHA 3VXRD 2R2EB 3MNZA 4JAMB 4LPCA 3WTYA 1U2CA 1WUNT 5I75B 4AYSA 3QCCA 3BT2L 3FDWA 3LNFA 1G9HA 3SQBB 4XNDA 3MRDA 4RMRA 4PJEF 3HHSB 4HS6A 3VFOA 1MQKH 3BAIA 3OJVC 1GKOA 3E6HA 4PGCB 1QR1A 2Q7NA 2HLFC 4PJXB 4E5XB 4D3QA 1WISA 3VWKC 5T1KB 1QFUH 5BPPA 4DGPA 3QDGD 4OJFH 3ROLA 5B3JE 8FABB 3BH4A 4P06A 2BERA 3L1FA 4N2OA 4Y1TA 2QQNL 2X12A 1H19A 3VXQA 3BAEL 2NY3B 4XN4A 1JN6B 3WEMA 1RIVH 2CJTA 3AS0A 1A7PL 4AKPA 1A6WL 2R4RL 2ZF8A 1HDMA 2KLSA 1IQDB 3AG3B 1BA9A 4AYMC 2CNGA 1FNEA 5AVXB 4X6EA 3RVUD 1JP5A 2CMBA 4KQ3L 3M1BB 3QRFM 4BJOA 3KPRB 3GB7B 4M5ZL 3KEDA 1WWWX 1E3XA 2WLMA 4W9JC 4ZXBD 5IJCC 2WMPA 4J27A 4IBUA 3O2WH 1ID5I 1EHXA 2VDNL 1ZGLB 3WY3A 4S11A 4XC3H 2UZPA 1U58B 1U42A 5EWIL 4HW6A 4DP2X 2F58L 4Z7QE 3VD1A 4AXWA 3ARDC 3SDYL 3S8GB 5C0DB 1XSOA 1A7QH 1P6WA 3D0VA 2XRAL 2PXYD 3KH3A 1JXGA 1ZT4A 2DKSA 3L1OL 4KDWA 2PBNA 4MSWB 2PCXA 2P26A 2Y7OA 2XBZA 4LRNH 5EA0H 5IBSA 3EYQD 4R5TA 2MCMA 4MZ2A 2D0GA 1Y6NR 5INDB 3FU7A 4KXCA 2Y36H 5CJOH 3WJLC 4QT5B 2YMOA 1MCBA 3QCBA 1FNHA 1N3NA 4ABWA 1NAKH 2VLKE 3RJQB 4BM7A 2KPNA 1IGFH 3MBEA 4UDTB 4FJYA 4ENEC 5KVFL 5LXGH 4NQED 1AHKA 1ORQA 5DWUL 4HIXH 4PVGA 2G9HA 1JBWA 5C8JA 2MQGA 2X7LA 1ETZB 2QTVA 5CHNA 2Q86A 3UERA 3DBXA 5EOTB 3AY2A 3RQ3A 2BY1A 3J07A 5SV3A 5HJGA 4N0FA 3CZNA 4HUWB 3VWJB 4ZMVA 2GJTA 5JO5A 1GIGH 2J4WL 1OHQA 3BP4B 4L3AA 3ZXAC 1K9TA 1DSFL 1P1VA 4OI8A 3LN9A 1UZ8B 2TSAA 1U92B 2VZ3A 5F6IC 3UC2A 1UEMA 3HUJB 3I2CL 4WUUB 1G7LB 3WHE0 5AENA 2WYIA 4HQQL 4NCC2 3Q8EA 1TTGA 3MLRL 5D7KD 4N0YH 3KM2A 3RYMA 1TXKA 2WANA 3EBHA 1F45A 4EQ2A 1XGRB 3GHPA 2DZEA 5MHSE 3X1NA 1PTTA 1HQ4B 2GHZA 4HUUA 4I5BA 3TL5A 3C2SA 2DQIH 1U0QA 1IEAB 3GZOA 3TS8A 2BGEA 1YAIA 2VR8A 2HT4C 1DE4B 3WY1A 1OEVA 3ARBD 5I73C 2ZUVA 5MI0B 4K7PH 2BMKB 3F12A 4PJIA 2WAHA 4Z7OF 3VU1A 1H3WM 2V37A 4G8EB 4X9HA 3X13A 4GW1B 4KUCD 1JMZA 3QQ9D 4M7LL 4RFNC 1QSFD 2X05A 2NZ6A 2ENPA 1CF1A 4AGOA 2E74C 2P80A 1J1XL 3QFJA 1CXLA 1R34A 1B3JA 4HJTA 5D7JA 3SDAC 4DKTA 2C7UB 4N5EC 3BESR 4LU5L 1TZ8A 4Y4KD 4Y2DB 3S5LB 2NY1D 5E6ID 2EIKB 4WENB 4P2QE 2G3NA 3S2AA 3EYVB 1D5ZB 4WWPA 3WO4B 5LNEA 4C4KT 1HILA 1GZHA 3IWVA 3ZR5A 1DBML 3L48A 3V4UL 5EN3A 5JOFA 2VXUL 3GMRA 2EINB 2YR3A 3G6AB 4K5LA 4JPKH 1FGVH 3ARFA 4LIQH 3LXAA 1B2YA 1WC7A 3IJEA 3M86A 1NCBL 5DZJA 4M6NH 4Q6IC 1BW8A 3IF1A 1ZS2A 2OQJA 3FTUA 3QIWD 5I1KL 1EUTA 1X7SA 4MQ7B 1A9BB 4X6FA 1J6UA 3T1FB 4TUKL 1RKRA 2EICA 2VLJB 3DROB 3FFCE 4XXCC 4KMTL 3WI9A 4B7LA 4Q8BA 2HKHL 2EDYA 3JWNH 1JNNH 3H9SB 1OWRM 1IGCL 2VXVH 2FSEB 5T3XH 3LZQA 4E9YA 4KDTA 2NDFA 3L3OB 2H1PL 4LCYA 1D7FA 4MDJA 3SYAA 3FT3B 3IRCA 1A4CA 1J9SA 2L7EA 2PPDA 5J9PB 4XHJC 4OD1H 2CGYA 1ESOA 1RUQH 2J71A 3V0DA 4RVBA 2LU4A 3V5HA 3DVGA 2CNFA 3O3DA 3ULVH 5FLUA 2J21A 5H35B 3ECBA 3HS0B 4O02H 2FR4B 1E5CA 1F13A 3D3VB 3MROA 4M1CD 4BFEA 1JPSH 4A7SA 3RFZC 3DMMA 1L0QA 5JHMA 1WZ1L 3RHWK 3QUZC 5K69A 3TBCA 1G7JA 1NGXB 1U95B 3FTYA 3WS6C 5CEXA 3WL9A 3D2TA 3P4NA 4ANVA 1MWAH 2IADA 3QCTH 3TYFA 3DGGB 2A77H 2AEQH 2E4TA 3BHBA 3CDGA 5FA3B 3GT6A 4ELDA 4ZOBA 2OJEB 2NZ9D 4PWEA 4XNAA 5BZWB 1OARH 4NRYA 1GYUA 4KMQA 1IEHA 3G5WA 4OLYL 3F58H 2YRBA 2ZX6A 4LF3B 4RKKA 2KS0A 4G8FA 3FQYA 2DJMA 4QYOA 1EJOH 2I25N 3B83A 4CSTA 2DMBA 3MV8D 9PCYA 1IBDA 4JREB 3SQRA 4OW6A 5BZDB 5KA0A 3O6LL 1E7VA 4XRCA 1BMGA 5HI3D 3MA7A 4HKZB 5EC2A 4BFNA 1SYSB 3HRZC 1E27A 1U8NB 3BDYH 4ZMLA 1XBRA 1CO1A 2I69A 2CHZA 4RI4A 5C0RH 4N2MA 1CD8A 1SXNA 1A7OL 3HHRB 3IMUA 4QHKI 5HGDA 1FVEA 3ZKND 2P47B 5I1HH 5EEUA 5ECJE 4WGWB 3SKMA 3G5VB 4M3KB 3SE3C 3V52L 4LHQB 1X9UA 3KXFE 4QHUA 3H55A 3TU6A 4HWUA 4RH9A 2OL3A 2KLRA 1YTSA 1EFQA 1UXWA 2YD3A 5FKPA 2VN4A 5AFAA 2V8LA 3JV6B 3L3KA 4YWGL 3MOQA 3Q8AA 3QC5X 3GRBA 1ONYA 2VOSA 1T03H 4W68A 5FGRA 5IVZA 3T6ZA 4ZT1A 4G8GD 3V4PH 4ZPTA 3VXPA 4XN9A 3LNHA 5B1CA 4OFPA 4A39A 3OHMB 1AR2A 3COOA 1L7TH 5HHOD 3UJJL 2VDQH 1HEZB 3J8F7 5IVXE 4BE5A 2DWYA 1BP3B 2JXMB 3L4YA 2C9AA 2BIHA 4KNTA 1XL6A 3AVEA 3ORJA 3X3GL 3LEVH 4Y4FB 5T5NF 4NX0A 2OV0A 3L5WA 3RZWA 3OR6B 4FQ2L 3PDOB 1QHQA 5IFHL 2VABA 2X87A 3NTCH 2EDBA 5I5MA 3ETBF 2QPFA 3BMWA 2XZCH 1PLCA 1ZXKA 3OGCB 4XHQA 1ZCKA 1VPOH 3O4TA 5IMLB 1YECL 1RUMH 4DUVA 4MJ6A 5FECB 4XMPH 5JORA 4FFWC 3GMLB 4ZMAT 2V2TB 1I3RB 1QNIA 2VSKB 5F7DA 3RU8L 4P46A 4Q9QH 4Z7UE 3MLTB 4QTHA 1QLRA 2P8LB 5GS1A 2IAMC 2B4CL 4PJ5E 1CD1A 3C08H 1E4KC 3DJTA 5DRWA 2VEVA 2W80C 4FD0A 4LEOA 3PL6D 4ZRTA 3GSUA 1KBBA 1JJUA 1S7QA 4LKXB 1H3UA 1F8TL 2J8UF 1C8PA 4JO5A 3U0TB 4NKQB 2K1MA 3G6JF 5MMZB 3IMVA 1LEIA 3SE6A 2Y07L 5BCAA 1HINL 5JA9A 5FDYA 2VDKH 3QHTC 4QOKB 5I6PA 1J8HE 2WZ0A 4X7TB 2YD1A 3QEGH 2X70B 1JSYA 4Y16D 1Q0XL 4Y1AE 4N8CL 5I5JA 2AV1A 2QEJA 3IS1X 3FF7A 3WFDH 2W9EH 4PJDE 2JLPA 1EPFA 1TZIA 1JE6A 3GEFA 3NABH 3NIDE 5JHDE 2V2WA 2GTWB 4FZ8L 4RA3A 3BVWA 1ZVNA 4A6YH 3QIUC 2FQGA 3N06B 5HPMB 3OHXB 4TLKA 1TNNA 3R4RA 5K59E 4H8WH 3M17B 4IBSA 4BZ1A 2V9RA 1GGCH 1YNLL 5E9DB 4PLKC 2WLJA 4B96A 1T22A 3UZVA 4ZUTA 3GMOA 3QEQB 3KL5A 4NP9A 2ZCHL 3PRZA 5ANME 3UACA 5KBNC 5EN2A 4ZMTA 3OPZL 4Z7NF 3F7LA 3ZE2F 1CZ8L 2X4RA 5GGQL 2H6OA 1C12A 3BEWB 3MBXH 4MQXC 1TQUA 4P23D 4P49A 1YJDC 4X6DE 3RZCC 1SJEB 2PP9A 4JGNA 1EEYA 1XGYL 2LFGA 4LKCB 2A4ZA 4Z0XA 4IBWA 1HYSD 1G84A 2O1AA 3V0GA 2BNRB 1Z9SB 1KPRB 4G7YH 3RDTA 2UX7A 3VI4E 2IIJA 3QQDB 4WTZA 6CGTA 2WXHA 3TBBA 4QLRA 4WNQB 3RVXC 3DJZA 1DFBL 4G43A 1X6NA 3OAZK 1F4XL 2VKXA 1XGPB 1X4ZA 1NAML 2MTPA 1PS3A 4JDTL 4WEBL 4G6JL 2QVKA 5I8EA 4CNIB 4L9LB 5JHLH 3CBKB 1KENH 4MX7A 4RIRB 1HJCA 1NPJA 2NY6D 5I6VA 5IY5B 5HYSG 5JPNB 1JF1A 4C4UA 1BZCA 1MCFA 2KERA 4HLZH 2FHCA 5FK9A 1X5YA 2YWYA 5E5LA 1P0SE 3SGEH 3U36A 4XNMB 1KB5A 5FCSH 4HC1H 2NNRA 3GPSA 5EO0B 1PVHA 3KG5A 1U8PB 3F7PC 3K2KA 4BELD 4PJAA 3MOAL 3GD1C 5D7LA 4KROC 3VFVB 3BSGA 2CO4A 3M8OL 4L05A 4WKXA 3T0EB 3TN0A 4ZUVB 1P5UB 4OZGA 4I8NA 1CE6A 3CZGA 1EH9A 3OQRA 5CGYC 4JX0A 2Y06L 3MCKA 3HMWL 1BWMA 1A3ZA 5BVPH 1KDJA 1UASA 3BIBX 4RDDA 3SDXE 2NXZD 4BSWA 1F3JA 4E9TA 1BZEA 3DUUA 2VMCA 3PDDA 2WWMC 1CF8L 3O81A 4FL4C 4OFDA 4TLUA 1NWOA 2H9GB 2WVUA 1JMXA 2CKBL 2ZKWA 1CD9B 5AL0A 3UJIL 2ZKYA 4HWBA 3FB5A 2O61B 2YUXA 5GGRY 2YWZA 1ZHKB 4KKAD 4ONGH 4X50A 5LWYH 2CHDA 3AWGA 3FMGH 4YHMH 2E27H 4UUJB 3ES6A 1V3KA 5BS0E 1N7ML 3U6XA 3K6DA 4DGYL 4QXTB 4I2XE 4EN3C 5C6WH 3RVTD 1TJIH 4OCXH 2JQAA 3VA2C 4XMTA 2PYFB 3MFFA 4WJ5B 1K2DA 1JNHB 3NIGF 1P2CB 5BMFL 3R06B 3LD8C 4MHHI 5CFAA 3BGFB 1Y7VA 1FFTB 1YMMB 4JFZH 4FERA 3V4LA 1FNAA 1A4KB 2DTMH 3VQLA 5E2TL 5CN2A 4CUCA 1KYUA 4KNQA 2AJYH 3QUYD 3RTQA 3QPKA 4XCEA 4QWWC 1AZRA 1Y0LB 2MTAA 1BECA 2CAKA 4PLJC 5DD6B 3S8WA 4GG6F 4ADIA 1T5WB 5I1CH 1DDHA 4NM8H 4F80A 2L4OA 1DUZA 2A74B 3SPVA 1EO8H 3UTOA 3S36X 3ZKXC 5JNYA 3MGAA 1KB5L 3MNMA 4MJ4A 5IB5A 3PIQB 1PAZA 5KS9B 4Y19D 2YAHA 4D8PB 2IH3A 3I74A 3MGOA 4QEGA 4YSTA 2IPKB 3MV7A 1XL4A 4H8WC 3TVMC 1S7WA 2N3JA 2ZNXA 4R4BB 1PLGL 5EF0A 5JUEH 1R0AL 4LQFL 4XMXA 5EU6B 4YJZL 2BP3A 1XGUA 1UURA 4NJ9L 2FJMA 5GRXG 5ITBL 1YEFL 2HG5B 3OKLB 3JXAA 1DN0A 3HR5B 1UB5A 4PH8A 2BIOA 2EYTB 4U1SA 4Y5XA 1I1CA 2R2HB 3K4DA 2VLRD 4EI5C 5I30H 3GJFB 1GZQB 4AENA 1OESA 1H3XA 4F57H 2EDXA 1G6RB 4J4PC 3S3PA 2YUVA 1I1YA 2MNJB 2E7CA 2EKSB 2Z93B 3AUWB 3ZQXA 1HOCB 3PHQA 4KC3B 3QG6B 4V1DA 1MJUL 2JB5H 3EF4A 1FPZA 4QUNA 1QBBA 3B7TA 2HVJB 5F1IA 2BSRA 5E9AA 3Q01A 3X2QB 2VGLM 32C2B 3HBPA 3IDGB 4AM0A 5CWSB 1KELH 4P5KB 4ZW3A 3KVPA 2FJGA 1XIWA 2NQ3A 3E2HB 2ADFH 4FQLH 1ZLSH 4IOIA 5CD5C 4IS6B 1OVZA 2X3AA 4J6RH 4G5ZL 4F7CA 2IBBA 4BPCA 2OW6A 1WD8A 1OT1A 1SRDA 1G9EA 4G6ML 4JFPA 3RNKB 4I13B 2JTYA 5EOQL 4LVEA 5KBKA 3FONB 3S5YA 1DZBA 1QQDA 4HFWB 3SDCD 4R4FL 4UZUA 4TTDC 3L5XH 4M3HA 4TUJB 2MCPH 3PGCB 3QUMB 2P5WE 2VT0A 3ME0B 3VGHA 1R3IL 1JGVL 3ESUF 4MLIA 3ARSA 3BH8B 1XD0A 4OF5A 2RB8A 4MWFA 4UM9B 4DAGL 2ZX8A 4ZN5A 5LKNA 1U93A 4ONFH 1G1KA 3Q6FA 5CCHE 3V5DA 3G9AB 2DQHH 2JCCF 1GS8A 3D39E 3VXUD 4NNYA 4ENED 5F1NA 2W0LA 3ZK0A 4G70B 4CVWA 2Y7LA 4W9IC 2FHFA 5FWQA 4TV3A 4IDLA 1QUNA 1MCPH 4DPRA 4M3JA 4C58B 3HG2A 5FR3A 5E5UB 4Y9BA 2OLDA 5DHVA 2X28A 4QF5A 1IVTA 2Y2TA 1NEZA 2DBLL 5CXPA 4YS4A 4OFYD 1LE5B 4Y2OA 2OZ4A 1HNGA 3KMDA 4MMYA 4XP9L 1KB9K 1HKLL 4LESA 3NOIA 4S1SH 3BX7C 4MXVE 4N8VB 2BOCB 3OL2A 3ZE0B 4YLQT 4AV4A 4XX1E 5KYUA 2J1ZA 2C9UA 4YDMA 1N6UA 3V9CA 1AC6A 3ULSA 1TTFA 3VD4A 1E8ZA 4M8QB 1R3HB 2K9FB 3CUPB 4QXWA 4BFJA 4WEMB 1QSVA 5L2KB 3K71B 2CUIA 1HESA 1WBXA 1SLUA 2Q6WA 1I7ZA 4OGYL 3O4SA 4EUPG 2GTZB 4DKEL 2G2RA 2EXSA 3KPSE 1FLTX 2VDRL 2DMHA 2AK4E 4LSUL 2YOCA 2GAZA 4GY4A 1R33A 4QRTB 3TNNA 1CLZH 1ETB1 1KGJA 4K15A 5FGBC 3GBLA 1EGJH 1UGKA 4URKA 1NUNB 1UM5L 3SKJL 4ENZA 3UTPD 1YUHA 3W56A 4AX3A 5FYJD 1JV5A 4OJCA 2P5EE 4XVJH 5KVFE 4QXUH 1Q9KB 3O9WD 1E8YA 1CFVH 1ONQA 3BEVB 1UD3A 3T4YB 2VEXA 4XO8A 3DOIA 4JHWH 1X7QB 1BZ7B 4ZTPL 3S37H 2W65A 1CD0A 4NGHL 3T5WA 1MEXL 4HUMB 4GW5A 2I75A 1HWGB 2QLVB 3F9BA 2XJLA 3FBKA 3UOAB 1OGTB 5J4MA 4EE2A 3SDAD 4NN5B 2FTAA 1A2YB 5JIIA 3VH8A 5KABA 2IDQA 4G8IB 5D2LB 4FG0A 4JRYD 4JS7A 4HJGA 3CVCA 5C09B 3U46A 3T65B 3VFTA 1NBVL 2Q9OA 2WB7A 1FFPB 1DEEB 3GUTB 1E4XH 3T8VA 5CZVH 2G3MA 2Q7AA 3S4SA 5B4MC 3BPCB 3TEUA 5BUGA 5FHBH 3NH7H 5DRXA 1H15B 1KT2A 4MVBD 4MTMA 4GBXB 1JPGB 3SPIA 1N64L 4PMEA 1BQHG 2IV9A 3S3SA 5I19H 2I6OA 1FN4B 4S1RL 1FZMB 1YO4A 2VR9A 4XP6L 5HYQA 2QVIA 1ZSDB 3VB8A 1NDMB 3VWKB 3VSUA 1G4US 1CXEA 1TJHL 2X4NB 2L0DA 4ODXB 4UB0L 5FV2A 4H4NA 4Y2NA 3JWDH 1MAML 1YMHA 2PYEE 4YZWA 1WAAF 2ZUUA 4X6CF 5F7LB 4NQCD 3H2QA 3TGXA 2XWZA 3F8UB 4BH7B 4JDEA 2G4EA 3WFCL 2CHWA 4NO2A 4ZX5A 5E03A 25C8H 3SBQA 4OHDA 3RVWC 4ZAKD 4JM2F 1A3RH 1LGVA 2JJWA 4ODUB 5SX4I 4LPUA 2MOGA 1TITA 1U3YA 4BSVB 3PREA 3LJ3A 3WMSA 2R1WA 3MRFA 5C70A 3INUL 5AZEL 4I3GA 1HI6A 4LBEA 2XQYG 4AC4A 2YGQA 3IDMB 4FNPA 1OOAA 5HHXL 1JBVA 4LHUA 1MHHA 1Z5LA 2C4FU 3CD4A 5H37G 3SN6N 1RU9L 5LQBL 1KIUA 3I80A 4FMFA 3L95A 3OG6B 3ARDB 3QRGL 3Q8FA 3SDDA 1VENA 3MRGA 2JH2A 3GHBL 4FKEA 1GC1H 1Z3GL 4Y5YA 3VO0A 3OAUH 1GYAA 1N9PA 2D7NA 1U3HA 3MNWB 4XP4H 4WSGA 2PUQT 1AGEA 5DQDH 3KLQA 1W6LA 3FUKA 1XR9B 4OQTA 5CSZB 2RD0A 1GS6X 2XACC 3MZTA 4L29B 4LEXH 4KPHL 4N0UE 2BXZA 4WHDA 5DEFA 3II1A 5F7EL 5IEHA 1N8ZB 1OE1A 3NJNA 1C86A 2VM9A 3EO1B 1F3DH 1A5FH 4WY7H 2KYIA 4WNSA 1WRFA 1FVDA 2IWEA 5F3FA 3GBML 4S2SA 4K94H 5LXVA 1QLEB 4IIZA 4OZ4A 1YN6B 3U2SB 1KB3A 1MJ8H 3Q1SL 3EOBA 1DL7H 4XTRC 1EXUA 2QHRL 4OZIF 4QD2E 3HAEH 5EEYA 2GCYB 4K3EL 4KJPD 1BFVH 4MS8D 3IU4H 4AQEB 4H25B 5K9OA 5I1AA 4P4KB 2H4GA 4OCSH 1KBWA 2JKIS 4GSQA 4EZJA 4ZFGH 1RPQA 3DRQA 1MRFL 1TDQA 4ADJA 1Q90A 4MB5A 1A4BA 2B59B 2BNQD 3S8FB 1BVOA 2R1YA 2CK2A 4H0IA 3EHBC 5C97A 2J56A 5BRZE 2OA9A 4OLWL 3NN8A 2ATPA 4AYID 1JYVA 3BGAA 5KA7A 4D0DA 3GMQB 2XQ0A 5AW7B 5GS0H 3DVNB 3ARVA 1OP4A 1NLDL 1TCRB 1XB6A 4YO0B 4DWHA 2J8OA 2I3UA 5FKAA 1DN2A 1V7ML 4AW4A 3SZ6A 4EZMA 3DOHA 1GAFH 1OP3K 2AJZB 3DUSA 4PJIE 4HU2A 4ZW6A 4X8JB 5CZXC 3T0DA 3L2LA 1EHNA 2XWTB 4XC1H 5C3LD 2F53A 2VDML 4Z7QB 3DV4A 4M93C 5EU4A 1FL5A 2APWA 3RAJL 2X4UB 1XH3B 1WA2X 3AUVA 5IHWA 3GHEH 2BVOB 3RWFB 5I73B 3MBEC 4PRNA 3ZHNA 1NBQA 2FNWA 5L0QC 3FQWB 3LKPA 5A40E 2ZMMA 4JANB 3M88A 5FDWA 1SBBA 1QG3A 1U8CB 4WK4B 1G5AA 3GLZA 5IW3A 3K7UA 2D31A 3ZUCA 1IL1A 3WKYA 2AEOA 2ZJSL 3KJ6L 4K5PA 1QI3A 3KNBB 5TFSH 2VLKB 1YNTA 5E99H 4CU7A 4HIIA 1JK8A 5B7EA 3CVHB 4TSCL 1DQML 3NEXA 3QVAA 4PJCF 2DQUH 4A55A 4OQTL 1UA6L 4QRRE 1U8HB 3EJQA 5TF1L 3GJFH 4X4XA 3FQ1A 2WIMA 5K9KA 1AQDB 1IQWL 1XXDC 4UT9A 5DC9B 3R19A 4YHKH 4FFWD 4HAFA 4Z0BL 4MBRA 4NNDA 3GSXA 3IPEA 3JWDC 5GGTA 5JW3H 2XX1A 4L5FL 4GE6A 1J5HA 3FUMA 4O2CA 2W1NA 4XH2B 2IAMD 1A4AA 2HC2A 4QRBA 1TPXB 4Q6IB 5T1DH 2IOMA 3L3GA 2GUYA 5T3XD 3OKEB 4WHTA 3AXHA 3VXME 3O4UA 4P2OB 1NSNH 5KYYB 1JPFB 4R26H 1AGBB 1I8KA 3JVGA 1AJ7L 4LL9A 3CXFA 4QO1A 5DD0H 4XPHH 1T66C 5JDSB 2A38A 2ZCLL 1YA5A 2OYMA 4JO1L 3UBXI 1OE3A 3ULVD 4LLMB 3T08A 2F8XC 3GDBA 5TE4H 4DN3H 4MNQA 1DVTA 3EJUA 3QUMH 3RUGA 4RX4D 4WFGD 2WKOA 2WP3T 1JDDA 4WDIB 2BVQA 1NFIA 4FHKA 2DWXA 2B5IC 1BLIA 1IM3A 1IT9L 5E7FA 1FHGA 3WIAA 5D7JC 1IC7H 3LXUX 4QRQA 4Z7VA 5ICZB 3QIUD 5EEXA 4OH2A 3NCJL 4KI5E 5DUBB 4X9YA 4P0DA 1UB6B 3QUZB 3QJHB 2ZYHA 1M1XB 4TPRL 1H9DA 2DYPA 1GZHC 1QW8A 5FYLH 4AUUA 1QBMH 3OLGA 4HK0A 3V6BR 4JFHD 1SEBA 3ARFC 3F5WA 4JO3H 1OAXH 4BWWA 5I8CA 3IFOB 4P2QB 4NQVB 1WPCA 1XB3A 1TF4A 2TRYA 3QSKB 2A3TA 3UBXB 4NBYB 3RZCD 3I6GB 1I8LA 4ACPA 3MACL 1WBZB 5HYFA 4YC2C 5DO2D 4F3FA 3GS0A 3TFBA 4OHLA 4YHYB 5CJXA 3QA3A 3WFHA 1GPOH 1O5DT 3TFKC 1T5KA 3NIFF 1AIFA 3EYSL 4PJ5D 7FABH 5IFAH 4L8DA 3VDBA 3N6YA 2WXNA 4M8UA 3ZYJA 1U2YA 2UUDH 2EXYC 3WTVA 1PPIA 5GGTL 1D9KB 4GG8A 4KDTC 1ZWIA 4TM9A 3HRZB 3IJ9A 1V3MA 3KBEA 4YDVA 1ZVSB 2DQTL 3FFCB 2FX8L 3O3AB 4A2GA 1PIFA 1KXVA 1E28B 3LV3B 5DURD 2A6KA 3QFDA 5EZIL 5KYWB 3HI6H 4HUXA 5ALBH 1XF2A 1I1AD 3BWZA 4YXKL 4U1JA 3MV9E 1EFXB 5L8LB 4R7LA 1P31A 4J8RB 4N2LA 2B4OA 5DMKB 2CBTA 2Z7WA 3DMMC 1ROCA 3VGDA 2GFBA 2VAAA 3CMOL 3DIVA 4WI0A 3MRIA 5CFHA 4HG4K 1DQLH 2QR0A 5E5RB 2JMRA 1WFOA 3DRTB 3QS2A 4WUKL 1B0GB 1G7HA 5I1DB 1QZ0A 4PD4J 1TQBC 3QDJB 4NIYE 4WNJA 1G94A 3OXRA 3MRJA 4ZO8A 5E94B 2R4SL 4KI5C 1FA4A 4YIQB 2J88L 4BZ1H 2BNUB 3EO0A 1FYTA 2I26N 1QVOB 2F0CA 1DLFL 1LDPH 1KEGH 4NN6B 2Y1YA 4XVUD 5IROC 1VZHA 5HXMA 2WWMD 4J12A 4NO3A 4FADA 1DQJB 3GK8H 1ZK5A 3ARTA 3ARGB 5JOPE 2B4CC 2ZT9C 4A7QA 1OIOA 1I9EA 3AY4A 2DEYX 2XY1A 4HUKB 2OMTA 1H6UA 3L6FB 3LN5B 5L4IA 3ZE1F 3KJ4B 3GSQB 5JQIB 3AM8A 5K1JA 2RFXA 4YAQB 1AANA 2D7PA 1GMEA 3OWEA 4WKZA 4YHPB 5E5MB 5HDQL 3CC5B 4ZO6A 1A6ZA 3PPSA 2KMWA 2RR3A 4OF7A 1VJSA 1VFUA 3FTGB 1I8UA 1BG1A 4NOBA 3LZFH 4R30A 1RJZB 1J88A 1OP5K 5JLZA 2ZSWA 1ZLUH 2VYRE 2X2YA 2X4QB 1YZ4A 1QNZH 1MCWW 3DVFA 3BWUF 4L48A 4Q0XL 5GRUH 5D70H 5E1QA 1V27A 4MXWH 5AVTB 2VXTL 4H2AA 3P40A 3FYEB 2F6WA 1X5XA 4GOSA 5JR1H 1KB9J 2J8UE 1MKFA 4JM4L 3V7AE 5HGHB 2JJUA 4PJHA 4BXVA 4PLJD 2KI6A 1RPMA 1MCQA 4WI6A 1F42A 3KXFB 3X11A 3UROR 3U25A 3APCA 2FB4L 4AYGA 1EENA 1F6FB 4PRPE 4KU1A 4UQ9A 1YEWA 5B21A 1BEYH 5TQ0H 3CSYB 1V5JA 5AL8A 1T6BX 5FUOH 1MH5B 1HE8A 2J1XA 3SZKC 4MXQC 3HPLB 2JB6A 1TNMA 2OKMA 3OR7A 4KNUA 3PU7A 5IK3B 3F04A 5LN8A 2O26U 2ZOOA 3ALXA 1GJUA 4OD3H 4QHNB 3TVMD 2XZAL 3I3EA 3JWOL 1DBKH 1CFTB 3W81A 3O4LE 1SLXA 4N2GA 4AL8L 4FLQA 5L88H 5DDHA 4B9IA 1KCSL 1PW3A 2NCMA 3DPBA 3FO2B 3IMRA 3VX0A 5IVXB 1E9PB 1Q6PA 2Q5BA 3I9PA 3QXTA 4B5ZA 3WGVB 3OC5A 4GAYB 4U1MA 2ZUYA 3H6JA 4P2AA 5AEAA 4HWBH 4UQBA 4JFUA 3QZOA 1J5CA 1Q1JH 2GJZB 4EI5D 2AXWA 3TEZA 1QLEH 3AABA 1A14H 4PS3A 2WO2B 2VERN 2YEVB 2FT7A 5D93C 3MCLH 4P46C 1D7CA 4NZRH 2RALA 2X6MA 2Y2WA 4XPAH 3JV4A 3K8MA 4KZEH 4P3CH 3PWPE 5GS1C 1MLBB 4ICWA 5I17B 1QEWA 2XY2A 4N2AA 1J86A 2PCFB 1BOGA 5BO0D 3IGAB 1A6VL 4OZHE 1M6UA 4ETQB 3NBNA 3NJVA 3IB4A 3QQNA 2J6EA 4IEFB 1F0LA 4YK4B 2CIKA 2EDNA 4M5SA 5FYKH 5I6NA 1KGCE 3VYPA 2WIIA 4QXVA 4EOWH 4Z7UB 5ISZE 1FFOB 5IOKA 2FBRA 4NQSB 4Z95H 1SPDA 5CD5D 1E8WA 3MRNA 1X9QA 3BAKA 5FX3A 2BH0A 5J8RA 5AWNL 3I3DA 5FS5A 2AV7B 3L9RB 5HTSA 3F7VA 4HZLA 3OX8B 3WN5A 5CMAB 5KYXA 2LLLA 3UBGA 3UTSD 4WFHE 2VJ8A 3LPOA 4TTDD 1E65A 4NC1C 3LY6A 4HOZA 1J8HB 3P2BA 1DBAL 1CLOH 5D7LE 1MCJA 2WBXA 3TCLB 2YK1H 3EJSA 3UAFA 1YEEH 5I18L 3GSOA 2JK5A 4Y1AB 3RDJA 1EHLL 2JKNA 2FEDC 4ZUSB 4GAJL 1QACA 3QORB 3CN1A 4WW1B 2PETA 1J7VR 3NZSA 1W72B 2BVUA 6TAAA 4MD4A 1NCHA 1K6QL 4TSAL 1A1OB 2CCWA 1ZGLM 2VMEA 4LLVA 3NIDB 5JHDB 2BCKA 2NY2C 4KROB 2VAJA 3BUPA 3QQ4A 4P48A 3QAZC 1GY2A 1RK1B 1F2QA 3ZMQA 3DGCR 4B9CA 1LO5B 1XCQB 2R0ZH 4IGBD 4MD0B 3IETB 3KBFA 3MJ9A 4E41A 2WXOA 4JHVA 3NRPA 2OSWA 2R0BA 4PGBA 4XPFH 5E95B 2YFNA 5DK0B 2ZNWA 3CQFA 3Q2LA 5GJTL 5ANMB 1II4E 1KULA 4FL4B 3V9EA 4I9WE 2V5YA 3TWYA 4X5WB 2DICA 4WCYH 1HSAB 4FTVD 3RDTC 4LSPL 3FCTB 4XPBL 2GJPA 1W78A 4K71C 2E9GA 1IIIA 4KKRA 4PJEA 4ZRGA 4X6DB 2AZRA 2R0KH 3E0GA 1P7BA 4YUEH 1G1CA 3C09B 3MXVL 5KJRH 3D05A 3I50H 1JK9B 2CM8A 5TDOB 1ET5A 3HNSH 3GJEB 5DZLA 3EJYC 1K3IA 1UT1A 4JQIA 4NZJA 3VI4B 1NCAH 4NNXB 3EIFA 4N90D 4EN3B 4ZMQA 4PS8A 2J6EL 2P8MA 3TH3T 4KH9A 1JDAA 3CHOA 3ZHLA 4RNRB 1HAUA 1WGVA 2BK8A 1UUSA 4KRLB 1H3PH 5J11C 1QMUA 3PWNB 2D3VA 2QVMA 3CZUB 3QJRB 3ZDXE 1QRND 5D9SA 3CX5J 4JFYB 1UJ3A 4X5QA 1UXSB 4OKVA 1CK0H 3ISWA 5IG7B 4PR5B 3TN0C 4JLRB 4ZTEA 4CVXA 5FO8A 3WYRA 4LAQL 3NPSB 2AHSA 5AOKA 2JWYA 3MXWL 2LAAA 5FWRA 2R0LH 1EZVX 2GBTA 3UZQA 5CCKH 2P48B 5I71B 5KW9H 2GUOB 1MW3A 4PRDA 1J0YA 5C0CD 4P4RA 4Z6BA 2H2SD 1PZCA 1FCCA 3AQXA 3LNIA 4H44C 3RB5A 3S98A 1MI5E 4PB9H 1RUPH 2VN6A 4ODHH 4TOYH 3MRLB 4ABUA 1X5ZA 1PX4A 3S3DB 5LUMA 5DD3H 2R2CA 3SDXB 1OCOB 1SBSL 3D07A 5I1GH 3SE9L 4GPVA 4L4VA 1KTRL 2XUWA 4N26A 5EZOL 5HHME 2OZ4H 3SCMA 1S8DB 1WITA 3U4BH 2JELL 1G0DA 2K7PA 1ZHBB 2EDEA 4P2RD 4IU3A 3E9UA 3Q13A 5EUOE 3MJ9L 1AZBA 4KVCL 4OCRH 4V1DE 1N6QH 4NQDE 1Y1UA 1SDDB 4ALAL 3ZM6A 1IC4H 2NSQA 4KTEL 5K9VA 4PJ7F 2BOBA 2ARJQ 5I0VA 3OMAB 1Z5HA 4FNQA 2EUVA 1XR8A 4N0CC 2CLZA 4GRLA 4XMLH 5BS0B 4GQPH 4Y9GA 2C1PA 2XKNA 3OKDA 4I2XB 3RTQC 4YEFA 1PZ2A 2A7BA 1IBYA 1F5WA 3TOPA 3ZGIA 3LKRB 4AGQA 1UWFA 1SFHA 3THML 1M05B 5K9JH 2MH4A 4Q7DA 3BAYA 1A6TA 4TUOB 3ZTNL 1VDGA 2VC2L 5I6KA 3ETTA 3DETC 4XNUL 4L8BA 4OUOA 1CDHA 1S3KH 2DW5A 2B8OT 1BJMA 3ULUL 1G9NL 2G0LA 2VDLL 3FB7B 5MEOB 2XVKA 1ORSB 4ZW8A 4ZS6D 4P9HL 4P5TD 1MCHA 1A0QH 4MQSB 2WWNA 2H7WA 3V0VB 4ELMA 3V8OA 4PCYA 2P24A 1J9CT 2DH3A 3FOMA 2AJSH 3QPQC 3VVVA 3HN3A 1G7IA 2W0PA 2Y5TB 3SGDH 1AI1H 5CU9A 1VADA 5DJ2A 2NNXA 1W8OA 3GSNH 3B7YA 3KYOB 3KHQA 5A1AA 4P57A 3E6FA 2CGRL 4IHOB 4OI7A 1BZ9A 1G1OA 4DOHE 3L13A 1C5DB 2WW8A 4OZFB 3ILQC 5HJ3B 3LCYA 4Y5XC 2YAPA 5CR8A 3GBDA 3Q8CA 4F2FA 5CILH 4HKXB 3WTXA 1BG9A 4ZDHB 4HRFA 4JK0D 5IBUB 3TBWB 4WI2A 1OAUL 1RLWA 3EH4B 4FI8A 4JVPA 4C56A 1Q1MA 1A7RL 2XPGB 4OLVL 1ED3A 3OKOB 3P4OA 4PW3A 3W2DL 3D25A 5I6XC 3C5ZA 4Q9CA 4F8QA 3T8XB 2X1XR 3TPUA 1A8JH 2ITDA 2WCGA 4MJIA 2P46B 1CGUA 4KKNA 3BW9A 1XIWC 4XMUA 1UM6L 3FCBA 5G5DA 1VFAB 4RBPK 2F54A 3OJDA 2NR6D 4X2UA 3QWRA 4JPIA 3RPBA 1CQYA 1MFAH 1YEIL 1SOKA 4RMTA 5J13C 1A4JB 3DBSA 2YQGA 1V10A 4MMXB 1Z0NA 3EHBD 5ESQB 5JW5B 3SD5A 3N1QC 1H5BA 5IKCA 3WEAA 5D7IF 4BQBA 1XGTB 1ZIAA 2DWDA 5IJDC 3N91A 5A6MA 3C12A 5KA1A 2O4EA 1YQ2A 1QKZL 1MXDA 2OSYA 4YGVB 4CRPA 4OHIA 4Y4HB 1RD6A 4ORGA 5CZXD 3US1A 1MWOA 2C4FT 5DR5H 4YLCA 1SOSA 3IEAA 3O4OC 4BGDA 5D1ZD 1YUKB 1G7QA 1HXMB 4UM8A 5JW4Q 2YD9A 4HJIA 4FLHA 2P5WB 2F61A 5IW6A 4HEPG 1F00I 2OULB 4HT1L 3MBED 3IN0A 4KAQL 4LQ1A 2HX7A 4LNRA 3MRKB 1NPNA 1LD9B 4AQOA 1U6AH 3L8QA 5KSAC 4MD5B 4PWHA 2FUQA 1CXHA 2JFGA 2UY7B 3WFZA 2VH5L 4HJJL 4X9IA 4E9LA 4GMTL 3EOAA 3QJVB 1E4JA 2EH8H 4G9FE 3NJMA 3VX1A 3N42B 2IGLA 3WD5H 4JG0L 4NP4L 1E3ZA 3N43B 2VJ0A 2A6DB 2XTSA 1JZEA 4S1DD 3L7EA 3B2VL 3FB6B 4U6TA 4XAKD 2NY0D 1Z0MA 2HJKA 4B7IA 3LS4L 5KBMA 4JRLA 4QGTA 4RMBA 1UCBL 5F0PB 4MNGA 4BDVA 1KPVB 3P0YL 3QO0B 2E6JA 3V0HA 3RWHB 2QQLH 3VUAA 3S4EA 5C0BE 4PGEB 1RMFH 3APMA 2DLTA 1MPAL 2VE6B 4PIRF 1NCNA 2N56A 2VR3A 2WTRB 3B4NA 4MS6A 3GMPA 3BLUA 2Q05A 2XPCA 5ALCH 4AK1A 2ITCA 3HKFA 3G5YA 5DJCB 5ADPL 1DLHB 1SJHA 3GKZA 5JHAA 4X6CE 2VDNB 2HG0A 3MVNA 5L7XL 1WT5A 2ITFA 3QNFA 3QI9A 4B0MM 5C7XL 2IDFA 5I24A 1NCCL 1T04B 1YEDB 4W4OA 4YH6A 4AEIL 5D8JL 1JUFB 43C9A 5LDUA 1T66D 2NW3B 3KPSB 4X4KA 5EDXA 2AK4B 4BUHA 1KBPA 4DPBX 2IMMA 1JTOA 2DKUA 1CN4A 5D1XA 2Z31B 5DT1H 3FO1A 1ZDSA 1PYWA 3HG4A 2PCYA 4Z7WA 2R1XB 4U1IA 1C5BL 1RURL 4PV9A 4Z76A 4F9LA 3WEOA 2P80D 3QFJD 1NTDA 2BZ7A 4JFOB 3A24A 2P5EB 4CW1B 3MUJA 5D7JD 4U6XB 3B8YA 4NENA 4WU5B 3DTUB 3VMPA 1BEXA 3N50A 3B2PA 5E56A 5AUMB 2NUTB 1SHWA 3KH4A 5J6GA 4APQD 1WLHA 3WE6B 2XA8H 3IE9A 4XWGH 2E56A 2WBWB 4K3DL 1JNLL 3MNZB 4GAAA 2ICWJ 2ATKA 3INOA 4ATTA 4KO5A 3U30C 1RHFA 1OAQL 4A2DA 3CFJB 1SQ2N 3CXDH 3ARFD 4XO5A 3FN9A 3MRDB 4L5FE 4MDIB 4HS6B 2XIBA 3D34A 3HBQA 1IGYA 1P4BL 3QWNA 4AG4H 1MJJA 4I0CC 4DQAA 3H9HA 1T4KA 2WOYA 1ZLVK 3RX9A 3BT0A 1D5IL 4P05A 4Q2ZA 4PJXF 4UT9H 4TVUA 1K72A 3ROLB 3GZQA 4LSVH 3K8KA 4Z8FH 2XQYK 4J28A 2P49B 2FJSA 4PGDA 5BNXD 3MUGA 5C2BH 5B7MA 4B27A 3VXQB 2IXQA 3IXAA 4XVOA 2BRRH 1FORL 1J8KA 2VLLA 5E8EB 5HVFB 15C8L 3EFOB 4FMVA 3UBHA 5DMJB 1FNEB 3ZM0A 4G7RB 4B9PA 2PYEB 5GS0D 2FH7A 1AFVL 3WNLA 1WGOA 1N2RA 1T20B 3HN5A 5A16B 1RP8A 1PLAA 1D7DA 4NQUA 3Q9PA 4FI7A 2X4PA 4XOCA 1GKEA 3C6LD 3FQXA 3X1GA 2LOEA 4RGOL 1IIKA 3BDBA 5LGJA 1OCCB 5D4HA 1PZSA 2PI7A 2AKRA 1TO4A 5DEJA 3UTQA 3DMMD 2YD7A 4RAVB 3G6JA 3TBSA 5IEKA 4Y5YC 2WZPD 1ZT4B 4FF9A 2PO6B 4ZPVA 3UGEA 1U3HC 2VERA 5JW4N 3AT0A 4D0BA 4XCYB 4IJ3C 3IDNA 4I0PD 3ZO0A 1KSRA 3ESNA 2D03L 3FU7B 1UAGA 2X2UA 4KTDH 4F7EA 1XH2A 2NPLX 4M93B 1CIUA 2JKJA 5KVGH 4J5VA 4R0TA 1N4XL 1N3NB 1JWUA 3FU9A 4D3CH 4J51A 4WO4D 4ZO9A 4YLBA 4X5RA 1TYJA 2BHFA 4IOSD 5L0QB 1JL8A 4CBZA 3MRRB 4UQ3B 1S9VB 2CJ3A 4RDQG 5F97E 2HTLC 3DJSA 3OKYA 4KHXL 2ZWSA 1CGXA 1NANI 4N0UB 5D4IA 1YTNA 4DEUA 2ZX7A 4YAAA 2H3NB 3ABLB 3TA3A 3C2AH 4WWKB 1IMHC 1Q72H 4LGSB 1JNJA 2NYZA 1AD0A 2QMJA 2PR4H 5HGAB 5JO5B 4JCLA 3OB8A 5FO7A 4CC0A 1YTWA 1FIGH 1MCIA 5LGKA 4P9MH 4DIXA 4YDIL 4UQEA 5EO9A 1DVQA 3KWWB 4F2EA 1UZ6F 5C0AA 3WTUA 3CU1A 1DQTA 4JFTA 4CA4A 3IBOA 3LKOA 4JJOA 5C6TH 3HUJF 1COBA 1PXHA 2DYRB 2WKLA 3P77B 5KTEH 1YN9A 2CKNA 1V7NL 1AZVA 3ARED 1FNGB 1KLUB 4JY5L 4PB0L 5K39B 1EZVY 2R0WL 5BRZB 4I5BB 2I9TA 4QRPE 1F90L 4MNQE 5DZNA 3RUGE 4BEIA 1NOLA 3H3PH 3KM1A 3SOBH 3CH1B 3P9LA 3D4GA 5KA2A 4UU9B 1XQ4A 2CDGA 3AWFA 4UTAL 1BQLH 3KYNB 4PJIB 4FFZL 1E9QA 3DX3A 4KZ0A 1UZGA 5T33H 5E24E 1MHEA 1H8NA 1HHGB 4R4NC 2VXSL 3O6ML 3VFGH 3QCKA 2F70A 3ARWA 3HA0A 1AE6H 2H6PA 3ZGHA 5DI8B 2CO2A 2I27N 4LEBA 2EC9U 3F85A 2B5IB 5I16A 1QBLL 3FB8A 3L4WA 4G2AA 4JFEA 5EZPA 4AJYV 1NC2A 2VOTA 5FYLD 1G4MA 3HZYB 4GUPA 2EYSA 4PG9B 3L9EA 2CPCA 5JOPD 1QO3B 3NFPA 2FX7L 3LXCA 4APXA 1E5UI 1HILB 2B2XH 1NKOA 4N2KA 5JOFB 3GMRB 3FNKA 2J20A 3NZ8B 1DVFB 4N2DA 1ZXQA 4P46D 1IILE 4QRRB 5MP6H 2DB8A 2XTJE 5F7FA 1S7RA 4KK5C 1WC7B 3PYCA 3QDHA 1HFUA 2Z35A 4J3BA 2I07A 1QFWH 4G7VH 3IF1B 5BJTB 2CM5A 3K6OA 2UZIH 1A02N 4PJGA 1CJYA 4YC2B 5LB1A 3GXNA 4GRMA 3HI5L 2ZWLT 4K8RH 4MAYD 4ONHA 5B39G 3JVGC 3NCCB 3GSWA 2LLGA 1YYMH 2ZCZA 4LCVA 1IM9A 1RFDL 3ETSA 4N28A 3WU1A 4DP9X 3OSVA 4C59B 3O6FA 3QDGA 4XOAA 3VXMB 4MDJB 4G6KL 5J1SC 1CWVA 5J5EA 3QJZA 2F8IA 2DM7A 3ARPA 1BLNA 4UANA 1KCUH 4X5PA 3QNYA 4PSPA 3V5HB 4CILA 5A2IH 3O3DB 4NOFA 1BF8A 3RGVB 4ZW7A 5I76B 1VGEH 2VORA 5K24A 2ICEA 4XWOC 3W57A 4FFVC 2XNAA 3MROB 2FEDD 1T2QL 3NCBB 5FGCE 4QHMA 3PXHA 4ZOAA 2OK0L 2B0SH 4X80L 1FO0B 3WFBL 3FT9A 3QJSB 1JG9A 4KK8C 1FYTE 1IFHL 4WV1A 4AQAA 1G7JB 1J5DA 1M57B 1JWMA 3P4NB 2IADB 3TYFB 2XZQL 1O7SA 2K78A 1KIPA 1T4WA 4X7SL 2VITB 1TQBB 1IBGH 2A6IA 3PP3K 3UZEC 3HMXA 1KCWA 2PXYA 5CLXA 4X4YB 2FAUA 1T1XA 4QUOA 4ANKA 4JO4H 3IDJA 2DJ4A 3AG2B 1I8LC 4GBXD 3J2PA 4Z78B 2AZAA 1TQSA 1HYRC 1E67A 2EE3A 2P44B 5EBMA 3V0IA 5CJXC 5IW1A 2VDPL 3LEXA 3U83A 2XTJC 2YPVH 1BBDL 5L2JB 1IBBA 1A7PH 1AC0A 1G0XA 3RDTD 2A0LC 3Q1EA 5JXED 2NY4B 4LFHD 1DQVA 1JPTH 1O75A 2XN0A 2YBRB 3GBNH 3N85H 5IF0B 1KXQE 3F41A 4PUBL 2ADGB 4PCKA 3KDMB 1DVSA 5LNDA 2QQKH 3EGDB 3MJ8B 2WXJA 4FXLA 1HEHC 2HFTA 3MJ7B 6PAZA 2CUMA 1GVIA 1KXVC 1TQCC 2WBJA 5F9JA 3VTMA 1JZ8A 1PZDA 4MMZB 5HGDB 3KGUA 1MRCL 4JZOB 5IM7B 4KKBC 1N68A 2ERJC 2VUKA 1IKFH 3AAZA 3CBJB 3S34L 4PJHE 3SKMB 4YXLH 3U2IA 3HCVB 2X4OA 2NNAA 3ZTJH 3V55A 3L1OH 4K2UL 1UXWB 5DC4B 1GYCA 5FKPB 5HHVL 3HLAA 4XBPB 1T6WA 1ET8A 1OHCA 3MV9B 3L3KB 3W37A 3CSTA 3TN0D 4AL8C 3RP1A 2QDPA 4YBHA 3FOLB 4DF9A 2EVHA 5AOLA 1UYWL 4CN1A 3KLAA 3FUFA 3EYUH 3VXPB 4JZNB 4GQZA 5C0EB 3DGDA 4JKWA 5DWUH 5CR1A 3B7RL 4UYPA 3FSOA 5DK2A 3N04A 2DLFL 2IV8A 4FE9A 1JHTB 4M7KH 1INQA 3TJPA 1JRHH 1VEPA 4IMKA 2V3DA 1A6PA 2BP0A 2ZKMX 2NT0A 4KUCF 3ARBA 4AWJC 5AD0B 3DOSB 2W9LA 3L5WB 4LDCA 3AADB 2JCCA 1HHKB 3AM8C 1DSFH 1PZ5A 5GHWL 1RI8A 1S78C 3FULA 4RGND 3VFRA 1QSFA 2F15A 4UQIM 3LH2L 5EBWA 1ZCLA 1LO2H 3CXHJ 2D2CC 1IAOA 4HQQH 3ZDYE 1KJVA 1EZSA 4OAWA 3FQTA 3H7BA 1UC6A 3UO1H 5FYKD 3LH8A 4Z3GA 1Z66A 2WYZA 1NAMB 4GQ9L 4HH9A 4XP1L 2JVUA 3QYCA 5FW6A 2XQBH 3CVIH 2F2HA 4NM4H 4YHZL 2NLKA 4Y4KA 4FOMA 3IRPX 5CEYB 2XVBA 5GS1B 3UJTL 5EHPA 4N0CD 2CD0A 5E6IA 2W94A 5AAMA 4F92B 4U1LA 1RZKL 1CE1L 3ARUA 1ZANH 2L3BA 3QNZA 3KGSA 4B9GA 2EIJB 2GSIB 3E1F1 4XO9A 2B4UA 5DD1H 3BE1L 1G9ML 1A6UH 2IGFH 3QCUL 1NCDH 2V3EA 2V7NA 4HWEL 4WEEA 3L4UA 3Q7JA 2F71A 3QCNA 1LEIB 3MX0B 2X88A 1RZ8A 4XNXL 1F86A 4DP1X 5CJ8A 4GXFA 2VJXA 1AGCB 4YFLI 2J8UB 2B08A 5CSBA 1KWKA 1SUJA 3ASNB 2DN7A 5CJQL 5LG1A 5DHDA 5F72S 4JHZA 3SPJA 2EYRA 2FL5B 4KOCA 4PRPB 3MV7D 1FVCA 4O2FA 2YHGA 1Q0EA 2WYHA 2V2WB 4G6FB 2HPTA 4DETA 2HFFA 2V9TA 3RPIB 4XVSH 1RK0A 1LL1A 1GGIH 1IAIL 1MCNA 1M7IA 3HC4H 3ABKB 4LVHB 2ZPKH 2ARJA 2CKBB 2ID5A 3EDJA 4PTUB 4E41E 2BRQA 4WHYH 3UGUA 2Y6SD 2NY2B 2HNPA 3O4LB 3UZVB 1XH1A 2MOVA 3QAZB 1NFDA 3GMOB 1IGTA 5K1NA 1HOEA 3U4KA 1PNDA 2GSGB 2EE2A 2Y7QB 4KITB 1BX2B 3EH3B 4N2BA 3NA9L 4N1HB 5D55A 3DVIA 3W11C 5IHBA 4A2MA 2MOQA 1C12B 1FRGH 2YN3A 1GYWA 4TNEA 5ICXA 5F7UA 2ZXAA 3ZRCC 2CDEB 1WEJH 3F83A 3RWDB 3KYKL 2G3ZA 1SGKA 4TUKH 2I60H 1CYGA 1FGSA 3TBYA 3NCFB 4FA7B 3L4TA 4KMTH 4Z7NB 4XCNA 1NL0L 3FQRB 4GEIA 3ZT5A 2F5BH 1BIIA 3SO3C 3P0VL 3PWPB 4QY8B 3QULA 4LCUA 2MQ3A 4J6IA 5A43C 4TNWF 3FZUC 2I9LB 2WZ6A 3QKPA 4OZHB 2GTQA 4XNYL 1G0YR 3ULUE 4LSQH 3WN5C 3N2JA 4H1LB 5IB1B 3VSQA 1C87A 4DK6A 3QDAA 5ISZB 5B1BB 1U8KA 3SQOL 5KJ7E 4OLXL 4K3JL 1WAAA 5HDOA 5FO2A 3QHFH 5B38A 5SX5K 5FK9B 4Y8DC 2QADC 5E8PA 2HFEA 1WYJA 1KB5B 2QV4A 2YKLH 4OT1L 1NNYA 1DQDH 3MRHB 1LO3L 2XWBA 2QV2A 5J11B 5EO1A 4H0HB 1L5GA 1KLGA 1HH6B 1KIRA 1I85A 4LLWB 5AB2A 1L0YA 6PCYA 3FRPB 3BLPX 3L1GA 5DUJA 1E6JL 5D7LB 4ZX3A 3IVKB 3H4FA 2Y67A 4OU3A 5F3HA 3P73A 4OCWL 2FLMA 1HXYA 2O5XL 1NC4B 4Q9RL 3MOZA 5TPWL 3VMNA 3FH5A 4YVNA 3MODH 4I48A 1Z9PA 4ALAC 2N59A 4W4NA 5BO1L 2FX9L 3WS3A 2ZYIA 4O9HL 5CP7A 1YRKA 5JW4R 1PG7H 3OAZH 4NJAL 2MWCA 2CM2A 4G8GA 5DZVA 5CAYB 3LQAH 3BSZA 5SWQB 2EADA 3GGWB 3QJXA 1O9ZA 35C8L 4NZTL 4LCWD 3UBXG 4HXBL 3UPRA 1Z5YD 3HG5A 3FQ2A 3O8XD 5HHOA 5GIRA 5TTRA 4H88L 4XO3A 4AEFA 4QF1A 3UTTE 3V6FA 4DKDC 2ICWA 2ADJA 4RETB 3D52A 4ZBJA 2WZAA 4J3SA 3IAPA 3V52H 3OGOE 4DCQA 4UDUA 3ULUC 1C5CL 1AGFA 1VIWA 12E8L 1AO7E 3MFFB 3CZSA 1K2DB 3PFUA 2J12B 1NIAA 4P9HC 5DJDA 2ZSVB 4EIBA 3S97C 3QH3A 1HEJC 4I18A 1SJVA 3U6XS 4B41A 1MIML 3IAGC 3GQFA 4JB9L 2EE0A 4FQ1L 5A7BA 4QCIA 4D3PA 3EJCA 1UJ3C 3BIKB 3RTQB 4YWGH 2LV4A 2OMBA 3U0PA 2C4XA 1O6VA 4I85A 3GYRA 1ZT1A 1AZZC 1MFUA 1DDHB 2B3OA 1PKOA 1EBAA 2J1YA 3A6CL 4H5SA 1J0IA 3VFMB 3IDIA 1B88A 3S3JA 3TH4T 1MFCH 2ZYSA 2I5YL 3ZDXB 1K4CA 4LOVA 3PL6A 3W9EA 4YSQA 4GG6B 4ZOCA 3UAAA 5DLLA 1RJCA 3RJOA 1H3TA 4DVBB 4RFOH 1DZ0A 2A6JA 2O6CA 4HHAA 3MMJA 1DFXA 2AI0L 1FO0H 5DJ6B 1NDGB 3H2WA 4IMLB 3WIFB 3MGOB 4KKCD 1D5BA 1YWFA 5BUPA 2V5SA 2IAND 1YEGH 3QZWA 3MUY1 3A5JA 4J3OC 4Y9EA 4DN4L 3CMGA 4UAHA 4UOZA 3SCMC 4Y16A 4XODA 1KBGL 1ASOA 2OXGA 2YMXL 4Y9FA 5KA9A 1XGUB 2FD6H 3FCSA 1P6FA 5F2FA 5D4JA 2XG5A 2FGWL 1MI5B 3FU0A 2HN7A 3AROA 4OUUA 1UB5B 2VW6A 2Q3AA 1OF2A 4E0RA 1Y18A 1BAFH 3QDME 3DV6A 3BPOC 3GXUB 3JVFC 3S88L 2XX0A 4XNZC 5HHMB 4MJIE 1BQ5A 5FM4A 3LIZH 3QQ3A 5C0NC 2AQ2A 3K72B 3A67L 5GS3A 1C16A 5EUOB 4MAUL 4L3CA 3BSZL 2CLVA 3N40F 3NACH 4GRLC 4N8UA 3QXDA 1M3IA 2GIMA 1YY8B 1JV2B 3ZRSA 4V1DB 4PJBF 4NQDB 5DVMA 2EO1A 3ZV2A 1G7FA 5F1IB 2BSRB 2DWEB 2VDRB 1KBKA 3BVTA 3IFLH 4AM0B 3K6FA 3UDWA 1MG2C 5F71A 4MJ5A 2QDMA 2FJGB 1XD1A 1XIWB 3CFBA 5I5IA 5DMGC 4WI5A 4KTGA 3JWNG 5IFJB 2YEZA 2DD8L 3UTZA 2EDWA 2EVGA 1KN2H 4P23A 5J13B 2AEPL 4JFPB 3D1HA 3NK4A 3QPXH 1RK7A 3D06A 3VYOA 5C71A 1IZKA 1F1DA 4LHUD 2B1AL 1LP9E 1QQDB 4LVNB 3DX8A 4Y9CA 2HCZX 1KN4L 3MA9H 3SDDD 3WY4A 4FZ8H 1F58H 1MIEH 3NEEA 4JRWA 4TULL 4ANUA 1U3HD 1VGKA 5A2KH 4MWFB 5DK3A 1TVHA 1FNLA 2DOCA 2SEBA 2WSDA 3A6BH 5F89B 5L8JB 2XN9E 2YGOA 3O4OB 2N7SA 3Q6FB 1WZAA 1XF4B 3D9CA 1FZKA 2V17L 3TT1L 2OTWA 3IWUA 1BXUA 5ADOH 3LZPA 4NNYB 2DKMA 3REWA 5F1NB 5FPIA 1PKQE 3QIBB 4HKBA 5T3ZH 5K5YA 3RWJB 5IBTL 2B14A 4XP5L 1JWSA 4NLHA 1P7QA 1QUNB 5DLML 4DEWA 3MV01 3D48R 4AI7A 4DOHB 3LQAC 5KSAB 2EVJA 1L0XA 2KZ1B 3QXAA 5DHVB 4PYHA 1OPGH 3KW8A 1HH9B 4IIQC 4ZMNA 1NEZB 5ESVA 1CB4A 4MNGE 3QXWA 3UXFA 3WTSA 4PVLA 4KRNA 4KGLA 1CL7H 4KFMA 3QCJA 4Y2EA 4ZI4A 2FT8A 2KL6A 1OSPL 6FABH 1WHOA 4QLWA 2H8PA 5KYUB 4DP4X 3ZE0F 4YHNA 4BQCA 3P3RA 3GI9L 3BZ4A 4FA6A 4JDVA 4G6JH 4I9XA 4LOUC 4DW2H 3ULSB 5D71L 5SWZE 5LBSA 4MA7L 2GYSA 1BM3L 1N12A 4QJ4B 1UT9A 1TVBB 4XX5A 1WWCA 4JG1H 1M6OA 5M43A 1I7ZB 4R8WH 4JGJA 5E7BA 1TMCB 1WZLA 2GABA 4L8SB 2G2RB 3L17A 4DP7X 5JXEA 4D94A 1PTZA 4HALA 2GAZB 5K33A 2EDTA 3HHMA 1O7DE 4GSUA 3FQNB 4DKFH 1M71B 3DO4A 3TNNB 1U36A 1NGYA 2F53D 3MOAH 4Z7WE 4BIKA 4GS7B 1KCRH 1NBZB 1UM4L 1YUHB 3P0GB 4C55A 3CV5A 2AM2A 1LVEA 1JV5B 3CCHA 3V9FA 4B95C 1SM3L 1ZE3C 4ADGA 1USZA 5I6LA 2BY3A 3IDYC 1XMWA 1J0HA 3LRSA 1IRAY 4R4ND 4F2MA 1HJBC 5DZPA 4HF5H 3OKKA 1SYVA 3FAWA 1QFOA 2B7DT 3VFNB 4DHLA 2W65B 5GRJH 3FSAA 2HX9A 4R7NB 2HKAA 4TNWK 4IBVA 3E3QC 3DX9A 3KPMB 1WCBA 1RIUL 3VAEA 4WFFE 3VH8B 1N59A 2YXFA 1A9EA 4RWYL 4V2BA 2A9NH 5D2LF 3U46B 4JFQB 4JKMA 1KCVL 2HVBA 3P54A 4JVUA 3RILA 3TA4D 4G9FB 5CF3A 2AXFA 4KMLB 1IZJA 1GS7A 3K2UH 1MVUB 5DRXB 5E8DL 4FXTA 1MUJA 1KT2B 5AZ2H 1T1ZA 4KK6D 2ZOUA 4G9DA 2E9IA 4UV4H 3W39A 3BKCH 3GI8H 4P59H 4TQHA 4U1KA 3CK0H 1S7TA 2L8AA 1SF3A 2AK1H 2XYBA 4KX8A 5C0BB 1EJ6A 4PVNA 1WT5C 4XCFL 1YMHB 2CUHA 3QI9C 1W15A 5IHZA 1GW0A 1D2OA 1QLFB 1IGMH 2W91A 4B50A 4W4OC 4XPTH 3RL1A 4H1LH 2VLRA 4N2FA 4RMWA 1PEZA 4KV5E 5T8IA 1JHLL 5LBSL 5ID0A 3CQPA 1Q6TA 2FJFA 1O7DC 4JN2A 5EULV 4X6CB 2OMYA 2ESVD 3WHXB 1SY6A 3NSCA 1OK8A 4MNQD 4L4TA 1SFDA 4JR9H 2A73B 2VDMB 1A3LL 4NWFA 2DTSA 2FWOA 5T1MB 4FKKA 1I3GH 3MRFB 3O2DA 5FUZL 1ZSHA 5EEVA 1HI6B 1W0WA 3PJLA 4IBQA 4LBEB 4PG2A 1HL8A 4YDZA 2VTEA 4GIAA 4NDMB 2P1YA 1TSHA 5J57B 2I6MA 2ILLA 2KZBA 3FO9B 1INDH 1MHHB 4JFDD 4XWOD 2ZICA 3HS9A 4QRUA 2R8SL 3ET9F