3V0JA

Crystal structure of ciona intestinalis voltage sensor-containing phosphatase (ci-vsp), residues 241-576(c363s), deletion of 401-405
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
319
structure length
319
Chain Sequence
KRRYRKDGFDLDLTYVTDHVIAMSFPSSGRQSLFRNPIGEVSRFFKTKHPDKFRIYNLCSERGYDETKFDNHVYRVMIDDHNVPTLVDLLKFIDDAKVWMTSDPDHVIAIHSKGGKGRTGTLVSSWLLEDGKFDTAKEALEYFGSRRTDVFQGVETASQIRYVGYFEKIKKNYGGQLPPMKKLKVTGVTITAIQGVGRGNGSDLSMQIVSERQEVLLCKFAEGYNCALQYDATDDCVTCEVKNCPVLAGDIKVRFMSTSKSLPRGYDNCPFYFWFNTSLVEGDHVTLKREEIDNPHKKKTWKIYRDNFTVKLTFSDAED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Voltage-sensor containing phosphatase
publication title A glutamate switch controls voltage-sensitive phosphatase function.
pubmed doi rcsb
source organism Ciona intestinalis
molecule tags Hydrolase
total genus 108
structure length 319
sequence length 319
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00782 DSPc Dual specificity phosphatase, catalytic domain
A PF10409 PTEN_C2 C2 domain of PTEN tumour-suppressor protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1110 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3v0jA02
3.90.190.10 Alpha Beta Alpha-Beta Complex Protein-Tyrosine Phosphatase; Chain A Protein tyrosine phosphatase superfamily 3v0jA01
1KAVA 3EZZA 5J8RA 3ZMPA 5BZZA 1G7GA 1RPMA 1M3GA 1YPTA 5KA3A 2PSZA 3F9AA 1Q6MA 3QCFA 2VEVA 2CM3A 3EB1A 2FHBA 4RH5A 1I9SA 1PTYA 1JLNA 3U96A 2PBNA 2I4EA 2I42A 2F70A 2Y2FA 1C85A 2I4HA 1EEOA 3SR9A 2F6ZA 2H4KA 3AWGA 4JBCA 2BZLA 2VEWA 2A3KA 1G1HA 5EHRA 1ZC0A 2NLKA 2BGEA 4PVGA 3AWFA 2I3RA 2CJZA 4R0SA 3QCGA 2DXPA 2QBRA 1T4JA 2G6ZA 2PA5A 1FPRA 1U24A 2OOQA 3QCJA 5MMZB 2I5XA 2HC2A 1U26A 2P4DA 2I1YA 1C86A 1YFOA 3D42A 1J4XA 5EHPA 4S0GA 2CMAA 3A5JA 5KABA 1T49A 2J17A 3V0IA 1T48A 1BZHA 3NMEA 2QBPA 4Y14A 2YA1A 2BIJA 1YTWA 1YTNA 1YN9A 3S4OA 2GWOA 4GS0A 1A5YA 1XXVA 1G4US 2QCJA 1WRMA 1I57A 1LQFA 1XBOA 3ZM1A 3QCMA 1ZCLA 4D3QA 2J43A 2NT2A 4JMJA 2A8BA 4DGPA 5KA1A 4RKKA 4JNBA 4WU2A 2NT7A 3LJ8A 3V0EA 1PTVA 3O3LA 2ZN7A 2CFVA 3MMJA 2F6WA 3SMEA 4NNDA 3V0JA 2HXPA 5BUGA 1OEUA 2B3OA 4I8NA 3QCLA 4NWFA 2I4GA 4DGXA 2CM8A 4Z6BA 2F6FA 4RHGA 1PA1A 5KA8A 1PTTA 4HRFA 2FJMA 2H03A 2YDUA 4RI4A 1PYNA 2VEUA 1ECVA 1OHDA 4RH9A 2Q05A 1JF7A 5BX1A 4OHDA 3H2XA 4HJPA 4IKCA 2CNIA 1YWFA 3BM8A 3O4SA 3OMHA 2J44A 1XXPA 2G59A 2HNPA 1YTSA 1C87A 5KAAA 2PQ5A 4WU3A 5I6VA 3ZV2A 1Q1MA 5KA2A 1EENA 2CNFA 3O4UA 2WGPA 2F71A 4RDDA 1PH0A 3D44A 2B4UA 2ESBA 3F99A 3EAXA 2R0BA 3F9BA 3QCCA 4ERCA 2IMGA 1FQ1A 5IBMA 1V3AA 3N0AA 1ONZA 4GE6A 5LXQB 5KA9A 3F81A 5K24A 1U25A 4GRZA 3QCBA 3QCNA 1VHRA 2Q47A 5HDEA 1NZ7A 4OHLA 3QCDA 3QKQA 4NYHA 2C7SA 2HB1A 3MOZA 1NWLA 4QBEA 2AHSA 1P15A 4WTYA 2H02A 5KADA 2J16B 1XRIA 5K9VA 2HY3A 2F6VA 2CNHA 2AZRA 1G4WR 1C88A 3BLUA 4B04A 1SUGA 5GTJA 4NX8A 1ONYA 2HVLA 5K25A 1WAXA 3B7OA 4QBWA 3I80A 2F6TA 2E0TA 3RGOA 1D5RA 1BZCA 3QCEA 2J73A 2HC1A 3I7ZA 4JMKA 4BPCA 2F6YA 1AAXA 1OEMX 2CNGA 4Y2EA 1OESA 1GWZA 4H1OA 4H34A 2CMCA 1OEOX 3D1OA 1NL9A 2B07A 2HNQA 4J51A 2I3UA 2I6OA 1PXHA 3D1QA 4D3PA 3AWEA 4QUNA 2OZ5A 2YOCA 1ZCKA 3ZMQA 1XM2A 2J71A 1QZ0A 2CMBA 2J72A 1FPZA 2H4GA 1I9TA 2B49A 1X24A 2BV5A 2QDMA 1LARA 4HJQA 3RO1A 2QBQA 2C46A 2QDCA 5KA0A 5IBSA 5K22A 1Q6PA 4ZRTA 4NWGA 3D9CA 1L8KA 4GFVA 1Q6NA 3D1HA 1RXDA 1OHEA 2I75A 2H4VA 3EU0A 3GXGA 2P6XA 3RGQA 2CNEA 4MBBA 2I6JA 2Y96A 1C84A 2NTAA 3BRHA 2HCMA 1MKPA 1G7FA 4R30A 2B4OA 2GP0A 5AWXA 5K23A 5BZXA 3ZM2A 3I36A 3BLTA 1NO6A 2RF6A 1R6HA 4PYHA 4TVVA 3S3KA 3S3EA 3V0GA 1G1FA 1OETA 3CM3A 4QUMA 4OHHA 1ZZWA 1OHCA 1Q6JA 1G1GA 4R0TA 3V0DA 4YR8B 4QAPA 4AZ1A 4ZI4A 2I6IA 2ZMMA 2QDPA 2SHPA 2CM7A 2VEXA 3RZ2A 1YGUA 4GRYA 1Q6TA 3QCKA 2H04A 2OC3A 3EMUA 1OEVA 4D3RA 3V0HA 2NV5A 5KACA 5M43A 2BGDA 1Q6SA 3S3HA 2B4PA 3CWEA 4GFUA 3F41A 3O5XA 5K9WA 1PTUA 2QBSA 2F46A 2FHFA 4RI5A 3V0FA 4KYQA 4GWFA 4QAHA 2OUDA 2QCTA 4KYRA 1YGRA 2GJTA 3ZM3A 1C83A 4OHIA 3QKPA 1YZ4A 2PT0A 3S4EA 2MBCA 5KA4A 4YAAA 1LYVA 4ZN5A 2I6PA 1BZJA 2M3VA 3GXHA 1NNYA 4ICZA 2FHCA 1PA9A 1WCHA 3O4TA 2J16A 4GE5A 2FH7A 3MOWA 4WOHA 5KA7A 2B4SA 2PI7A 3PS5A 3M4UA 3QCIA 2CM2A 4GE2A 4BJOA 3A5KA 3ZM0A 3OLRA 4KI9A 2I6MA 2JJDA 2NZ6A 1NWEA 4OHEA 3QCHA 2FJNA 1L8GA 1KAKA 1GFYA 1QXKA 3S3FA 2VEYA 2QEPA
chains in the Genus database with same CATH superfamily
3PHQA 1DDTA 3EFOB 2XN1A 5FV1L 3T4AA 5EULV 1I8KB 1CT8B 1JPTH 5T8IA 3DOSB 3A4DA 1KBBA 5LNGA 4X4MA 1T5WA 3BKCL 5G55A 3HZMB 2O5ZH 2XV0A 4Y5VC 5CEXB 3DDFA 5A5EA 1KTKE 1IJNA 3KPQA 3R19A 4NKIH 5AD0B 3GBML 2QVTA 3DO7B 1XH3B 3QORC 4JRYE 2AZUA 1AR1C 2FAUA 3KYKL 1QOKA 1R34A 3ZKXB 5MHSD 2K7PA 3MRCA 4KGJA 2IMNA 5C0DA 2W0PA 5D7IA 4DNLA 3SQOL 3OAUH 3A24A 1C85A 2Q8AL 3MLSH 4NZTH 5AOLA 2H0FA 3H8NA 2E9GA 4X8JB 1O6TA 2J6EA 3T1WA 4U1IB 1ACYH 5F0PB 3ZL2A 4FG4A 2A3KA 1SHXA 3O41B 2OP4L 4OD3H 3RURA 4YNYB 3WL9A 5FGSA 2UXGA 1JRHI 3QQ3B 4L1DA 4G3YH 1KCSL 4R0SA 1HSBB 2WXRA 5IREA 3QHFH 4L4TB 5KVEE 2GJZA 4FQ1L 3S37H 1NKOA 2CRMA 4L2LA 2EUXA 1I9RL 5EU7E 4MAYB 3FU6A 2OTUA 5T5NF 5MP6H 2VMFA 1VRSA 6PCYA 3TESA 4QHNB 3RPKA 3VDCA 1LLAA 3KLKA 5CCKL 1AQ8A 1C86A 1AHWB 3RX9A 2EIZB 4XCNA 5J7CC 3HN5A 2FR4A 1I7RA 4L8CB 5AQ0A 2XA3A 2IFFH 3KVQA 2ZYHA 4LDOB 3U2SA 2APBA 2PCPB 3B7RL 2Y7LA 3Q6FA 5I74B 2EACA 3RZWA 3WKPA 4WW2A 5L2KD 4QHLA 4DP8X 5A2CA 3BPNB 1RK7A 2YAHA 5E94A 1LNUA 4KK9D 4PRPE 4XH2A 1L3NA 4HSQA 5IP4A 2NUPA 4JQIA 3VWJA 3NMEA 1LO0L 1J8HB 2VXSL 1JPGA 2A7BA 5DTFB 1WFJA 2OX5A 3IEAA 4QTFA 4OM1L 3T8VA 3LKRA 5J13B 1A8JH 5DMIH 1KCLA 4OF7A 3GM0A 3WI9A 4J7RA 1FIGH 1R3IL 4LNRA 2DH2A 2DWDB 1GVIA 2J8OA 5DJ2A 4XXCA 1QRKA 3O2VL 1MHPH 2AK4B 2V7NB 2J20A 3U6XS 1TQTA 5L0QC 2JFHA 1NZRA 2E5EA 4DESA 2EYRA 2IIJA 3FTWA 4M48H 2J25A 1L0XA 2JIXA 1UB5B 1ZDSA 3MOBL 4HUCA 5E23A 2ZP8A 4JMJA 4JKMA 4PRPA 2XTLA 1ZLEA 4K2UL 1DN0B 1VFAB 3O3LA 1D5XB 1S7SA 1TZHB 1MPAL 1S7TA 3G04B 3IU4L 4WY7H 4AYDC 4N2LA 1GIGH 4MRBA 2XACC 4OCWL 1ID5I 5HI4C 1LEIA 2LAGB 1IFRA 5EUOA 2EIJB 2PETA 3JBG7 3V9FA 4QRUB 3ISRA 3OLIA 4XMWA 1GGCL 4ECNA 4FTVE 1B0WA 4NQTA 4ES9A 4F57H 1T1WA 4GS7C 4L3EA 3EOTH 1S7UB 1CFQB 2XC8A 2XZQH 4JM2F 3X13A 4HUXA 3SPJA 1GZHC 3VI3A 5FO9A 1GAFH 1U33A 3E1ZA 3L45A 1FVEB 3FN0L 3DYOA 1VCAA 5C0IB 3NIFB 3PDOA 1OTUC 1YCSA 4L9LA 4Z7NE 3P0VL 3IDXL 5EEZA 2OBGA 3EH5B 4ABUA 1JFQL 1E4XH 3ZKMC 3BPCB 5IB2B 4QT5A 5ENWA 4ETQB 4O02A 4X4YB 5E08L 4M8VA 2CNIA 4FTVA 4ZXBA 2EDNA 4GW5A 3U4AA 4JFEB 4AYGA 5AVVB 5CUSL 2W80C 1GGIL 3RL1A 4YDJA 4ENZA 3T4YA 5KAAA 3APFA 4MJJA 3IAQA 4N2OA 4YL9A 4MX7B 1IAKB 1I8MB 3O9WB 4GMSL 1T20A 1UXWB 3OAYH 4X6BB 5C2BL 4MBRA 4LPCA 4BEIA 4ELKB 4YDIH 4DGWC 3CH8A 1Q94B 2VIRB 5JHAA 3ILPA 4U33A 4U6XA 1HZLA 3PHSA 2A6JA 3WFBL 4MB1A 4JFSA 1G9NL 2UUDK 2XFXA 3MUHL 5DSCB 2MH4A 2W65A 3S8WA 1IC4L 3R06B 2V2TB 4XGZB 1CFSA 1KELL 5LNEA 3ARBB 3QJTB 1CXLA 3T3MB 4HX1A 1QAWA 1DBKH 4MCMA 3SE9L 2G9HB 1DQJA 1GR7A 3PWJA 4PJXB 1E9PB 5GIRB 4HJ1A 3TO4B 5E5RB 3D12B 4MD0A 2CBMA 2F08A 5CAYB 1TJHH 2IQ9L 4YPGA 3L3GB 3TEUA 3Q8AA 1UD5A 1DJSA 4NC1C 2WCGA 5L4MA 4G1EB 1D5MA 2CCLA 1YY8B 4I0PB 35C8L 4ZX3A 5KTEL 5D7KD 3OKMB 4JN2A 3ZKQD 4TTDC 4PEEA 1G1YA 1V3MA 4J3OF 1UYWL 3T0EE 3VNZA 1EV2E 4JE4B 4ODUA 3QQ4B 3QDAA 4YSPA 5EZJB 2WTZA 1BQHG 5CF3A 5ISZB 4LZKA 3KM1A 3HTLX 2YPLB 4ENED 3VJ6A 5A3IC 4URTB 5CEZL 3MRNB 4G9FD 3UJTL 2NLJA 3RPBA 6FABL 3BLUA 3P40A 4LL9A 2F54B 4UILH 3MLUL 2BMKB 3BAWA 3ALPA 4JFDD 4X6EB 4OFKA 3EO0B 4ZUVB 4X6FB 4N0FB 3U7WL 3VE0A 5EZOL 1E4KC 1G5AA 5DGQA 2AITA 2X89D 5AL0A 4ANUA 3H2QA 3G5VB 1UWXH 1FHGA 4Z3FA 5H94A 4WDIB 3VX0A 5DFVD 1W6WA 3FO1A 3PF2A 2VITB 4BIKA 3PLYA 3MRQA 1V55B 4GSDH 4HIEB 3L3KB 3VMOA 5J8OA 1M1XB 1M71A 3WJJA 4BFBD 2FZ3A 5IV2A 4GFTB 4J6RL 12E8H 4EI6B 3F83A 4DQOL 3LZFL 4HWBH 2Z31A 1T80A 3WN5C 4ELDA 4U6TA 3DETC 1XGQA 5IZ7A 4XP9H 1IBDA 4W81A 5H37H 1RV6X 3N40F 3AWEA 3KPMB 1BAFH 5FCSH 3FCTB 2JV6A 4MCZB 1J0JA 2AJXL 4JUTA 4Q9RL 2G5UA 3O3AB 3QEUB 1A1NB 1WWAX 2OR9H 4UM9A 1GY1A 4BQCA 3QAZB 1PZDA 3ARGA 3OF6A 1OO2A 1Z3GH 4H25A 1HI6A 1KTJA 5JMRA 5KVFH 4OI8A 1DDHA 3CN0A 1NBYA 4BZYA 5AVZB 1GKEA 1U3ZA 5IBSA 1TQWA 1HL4A 1OCWH 2B59B 5J3HD 3ARSA 3MCKA 4K71B 4UQDA 5IROD 3OB8A 4OCXH 1NLDL 4X99A 3QWOA 1C5CL 2GI7A 3N85H 3ECBA 1INEH 1LK3H 4N24A 2VORA 1ES0A 2OW6A 1ETZB 5TDNA 4WO0A 4P46A 3DGDA 5EO1B 1KBPA 4H20L 3V4PB 4TYUA 4PRHB 3RBSA 4AJWA 3QCVL 4IGBC 5IHZA 2K4WA 1BJMA 5D4JA 5EZPA 2ZWYA 1AXSB 4UT6L 4KZCA 2VZUA 2BO0A 2KZ1B 4GMTL 3EBGA 1H9DA 1NPJA 1QLFA 2VNCA 4LARH 5DMKA 1UJ3C 3S3DB 4M4PA 1ZLVK 3EGXB 4HPOH 2Y3NA 3N1PC 1KJVB 2EXSA 3VXQB 4HG4J 2F68X 3HCVA 5D1QB 4H5SB 3D07A 3MV8B 4RGNC 4LSVH 1A22B 1MFDH 4PRAB 1WCBB 2DM7A 4NAMA 1RIHL 3IETB 4Z3JA 2CRZA 4P2OC 4Q9CA 5FO2A 1G1FA 2NW3B 3HAEG 4CU7A 1T7ZA 3FCBA 3E3QE 1AGEA 5ETUB 2EYSA 3KHQA 4FXKA 3HR6A 4NQCB 2Y9RT 2CKNA 2P28B 2DQ6A 3VFTB 4DO5A 2VR5A 3AITA 2R39A 4F8LA 5CWSA 4F7MA 5GJSL 2I6IA 1WA2X 2BCKB 1FHNA 5E2TL 5AYTA 3M1OA 4QRPE 2VW4A 4ABWA 3QFDA 4X8XA 5IR1B 3CWGA 2Z4QA 1UWEL 1JP5A 3EGSA 4DCQA 1WJ3A 5FYLL 1MNNA 1LK2A 1OP5H 1WVZA 1B3JA 3BZFB 3SY0B 3BZ4B 5EBLA 4ZTPL 1Y18B 1R75A 4PJ9C 3UJIH 1ID2A 2FYYA 3TXAA 1MLBB 4GRWE 1HKFA 1HZKA 3DIFA 4J3OD 3TBBA 3QIWD 3TF4A 1A4JA 2Z35A 3RWIB 1AZRA 2VKXA 1AGFB 4HWZB 5EIIB 5B3JE 3RE0A 2X4TB 2Q2LA 2R56H 2EDKA 2XKUA 1T03H 2R2HB 5E8PA 3G08B 2EDBA 4YHPA 1U8QA 3GLZA 3V52L 1QKZH 4P3CH 4QJ3B 3N3EA 3KLAA 1A4BA 3QO0B 5FKPB 3C6LC 2HJFA 1A25A 3LV3B 4PV1C 5D6DC 3V6FB 3VFPA 3VFRA 3LH2H 4BSVA 2B1AH 2H9GA 4JFFB 3MBEA 2YA0A 4FI7A 4QYOA 3VXMD 1GZQB 1MCEA 1TVBB 3HPLB 2YD4A 1SBBA 5CP7A 2GCYA 4JO1H 1GA2A 2XWTA 4NKOB 1A7PH 1N7ML 2ITEA 5FUZL 4YAAA 1QRNB 3ULVL 1MCPH 4HJGB 3VD1A 3VRLF 3CXDH 2I6PA 1BZJA 5F9OH 1CQKA 4HFUL 1IAOB 1XEUA 5DMGC 3O4TA 1Y6KR 2WVSA 1VFOA 4WFGE 5KA7A 1X5FA 1IC7H 3KPOA 4QHUB 3QUMB 3OR6B 3WXWH 2K1MA 4J3UA 4HS6A 3KLQA 4MJIA 3SBWA 2PI7A 4M00A 4KQ0A 2AXWA 1JZ8A 2YUXA 3GB7A 3DMMD 5DZOA 5AW8B 3VXUD 4DUXA 1AS8A 2APSA 4HUVB 2EVGA 2AEPL 3LXUX 5CJXC 4DEPB 5B7EA 1OE1A 4J2XA 4YHKL 4X0NA 5PAZA 3UH8A 3LPFA 4P3WA 4P3DA 3QJVB 1N10A 3V4UL 3ZHLA 1AXTH 1B4JL 3HZYB 4OZFA 3RVVC 4IOIB 2UXTA 4YK4B 1U2YA 1H5BA 5CEZE 4DAGL 3I74A 2H3XC 4V11A 3SHSA 4LU5L 4KJPD 1DEEB 5ADPH 4AE1A 5E9DB 5IQ7H 1ZHBB 2CIIA 3WDJA 4CVXA 1IGTB 2YGOA 2YSSB 3MRJA 5F7LB 3GC3A 5B1CA 3TT3H 3H54A 1IU1A 3UBXB 4PP1C 4BKLB 1JMZA 4GQRA 1KPRA 5GZOA 1JVLA 1AO7E 1DE4B 1FQ9C 3UJJL 3SDYL 4RMTA 3KVPA 3KYNB 1T1YB 4BFKA 1NGWA 4PBWD 4U7SA 3F9AA 1C8PA 3DGCR 2C4FT 4UMSA 3QHZH 1ZGLM 4LHUD 3J07A 2JCCB 3QXDB 2PO6B 1N3NA 4XBPB 1JZ7A 1BFVH 3MRIB 5E5LA 1DQML 4P5TA 3RJQB 3IJ9A 1E42A 5F88B 1PAMA 3GIVA 3EJJX 3K72A 1FCGA 1ZOXA 5CILL 4OLUL 4IIQA 3QZWG 4M1DL 2AABL 2B1HH 3KD4A 1PLGH 1BQLL 1FPTL 5L2JA 3SR9A 2ARJA 2VL5A 2IWFA 2VTFA 2KH2B 3KYMA 3O8XC 1AO7A 4LSDA 3CCHB 1S9VA 4JFHD 4F1ZA 2I5YL 3TM6A 1SLVA 2MMXA 1G1HA 4RGOH 1RJYA 5A2KH 2QGDA 2O6CA 1N5AA 1N8OE 3VVWA 3H7BB 2I3RA 2IAMB 4I18C 4P2QD 4Q52A 3T9WA 4QY8B 3DVGB 4B27A 4U49A 2FBRA 5DUJA 4PJBF 5HHOB 1I8KA 1CT8A 3T2LA 1QTYT 3VWKC 4XT1C 4YEEA 4DW2H 4QWWD 3DOSA 4X6DE 2YXVA 3WG7B 5L4FA 1FRGL 1AY1H 3FJTA 1U26A 3DX4A 3UTZB 3KPNB 4IBQA 1PPIA 3EO9H 1FNFA 4JCMA 3HLAB 3HZMA 5D6CA 4Y2LA 3A67L 2C7UB 4IIZA 3H9HA 4X5RA 1AOZA 4PJHF 4EI0A 1WT5A 5DHDA 2EIKB 4Z0BH 5F7BA 4UBDC 4JG0H 3PE9A 3BP5B 2JKJA 1NFKA 2Y67A 1XB8A 2JELL 3VFWB 4JPWL 4X5XB 2DQUH 2VH5L 3IWUA 1JYWA 1BOGA 3C5ZD 3LNHA 1NC4B 3MA9L 4F58L 4HJ0D 5E8NB 1T48A 1QWHA 1YEWA 3UZVB 1W78A 5DC0A 1SDYA 3QUHA 2YPKB 4H8VA 1CDBA 1AGBA 3WV0A 4A2FA 3BH8B 1RK1B 4U05A 4X6DA 5HTSA 2MQGA 2PYEB 5AALA 4NUMA 4DP5X 1SQ2N 1D9KB 1YN9A 4YNYA 1XT5A 3QQ3A 1U0QA 4Z7OB 4K15A 3UZEC 4GPVA 5J1SC 4GS0A 2YLHA 1BM3H 1HSBA 3VUAA 3FSAA 3HC0A 3V7MA 5IB1B 2A9MH 2P8MB 3NJNA 2DQGL 2BXZA 4PJ8A 5HXMA 5TDPA 3BDXA 2X38A 2EDMA 4OR1A 3TTYA 4F2EA 4RISH 4QNPF 5I0DA 4DGPA 3GSUB 5E95B 4RQQB 4P9HH 3IBOA 4JDVB 4ZQKB 5BVPH 4E9XA 2HH0L 4M7KL 3V0EA 5J6GB 1TTFA 4L8CA 5HYJE 4ZMAT 4WWNA 4AYMC 2WBJD 3F12B 2PCPA 4IOSA 3V4PL 5JXEA 3EFDH 2AJZB 3O6LL 5HVWA 2VM3A 2YBRB 3T71A 3WFEL 5HYSA 1LJMA 3BQUC 3CMOH 1FBIH 4FFZH 3TZVB 1BZ9B 2WWKT 4A37A 3Q05A 2H8PB 3TN0C 1XF5B 4FN0A 1J8HA 4H88H 5DTFA 3LEVH 2Q10A 2B3OA 2ZCLL 2N3JA 3QCLA 1WBYB 4YSUA 4IBVA 2DWDA 3PFQA 5DS8B 1WWCA 3FRUA 4NQXB 4RWHA 4HH9B 5HYJA 2CDEB 2EUVA 3FT0A 4RI4A 5HYEA 3ULUL 3ZE1F 3ZO0A 4WFEE 4NKMB 1UGNA 1EUUA 2BFVL 3E38A 3K4DA 3K5SA 4HDIB 5J0BA 1UB5A 3NJFA 4YSRA 3FB7B 1GL4B 2C9VA 5EU6E 5HY9B 3NDYE 1VIWA 4PREB 1P9MC 4HJPA 3POHA 4XCCH 4LCYB 3RKDD 1YMMD 1JNNH 1L0QA 3CVDA 4JFQA 5GISL 1XXPA 3HW7A 4ZNCD 1VFAA 3BAJA 3ULVE 3QH3B 1ZTMA 4K7FB 1DVYA 3F65A 3VFGH 3G04A 1JHTB 2GAZB 1HFUA 2GFBA 2HT3D 4NN6C 4P2AA 4GKNB 1MJJB 1P4IH 3HI5L 1EENA 1T4KB 4XNYL 4WSJA 1P7QA 3APNA 3GGWB 5CINH 4O5LH 3Q8BA 2E46A 4AT6A 1PH0A 1BQ5A 4CNIA 1U8MA 2IMMA 4L0ZA 2RB8A 5C6TH 2EEAA 3O6MH 4JZJB 2XKNA 5DYFA 2W9LA 1DQKA 2HRHA 1TQVA 2FQEA 2CBTA 3OPUA 5L4JA 2Z7YA 3DVFA 4K9EC 2ZCZA 3P4MB 4YGAB 3KLHD 4X0KA 3PP4H 2AJVH 4KWUA 5TH2A 1WIOA 1I1AC 3OLEA 4FP8L 1AKJD 1VACB 1D7CA 4BK8A 3QCNA 3BPCA 1BVLB 3IPEA 2CZNA 5IB2A 1VHRA 3KNBA 2NRDA 2V5TA 1U8CB 4X4YA 3QCDA 3FOLB 1X9LA 4KPHL 1OHQA 2CIKA 3OKKB 4FQQB 1UXLA 4G9FB 3O6FD 3ASWA 1NBVL 1RU9H 4KJYA 3AXLB 2OMTA 1JWMB 5I1DB 1WFMA 3H9ZA 1KGCD 1NIEA 2WCSA 3U0PB 2DS4A 1YN7A 1YY9C 2ZX8A 4Y5XB 3O9WA 1G7HA 2IV9A 4KKNA 4B50A 4ELKA 1WC7B 2VDNL 2VN5A 5PCYA 2VIRA 4ZOBA 4KZ0A 4UQ2B 2HPTA 4ZK8A 3GUTB 3BUYA 5BVJB 2ZG3A 2P5PA 1BFOA 2N01B 4RRPM 1E9QA 4XVJH 4Z5RB 4NX8A 2ZG1A 4M62L 3FTVA 3R06A 5D7LB 15C8H 2P3YA 3VSVA 4OLZH 3ARBA 3MX0B 1P1ZA 2X7LB 1KJ3H 4N8VA 4KRPD 2VLJE 3T0AA 2G9HA 3IVKB 5GIRA 3TO4A 3UAAA 3TJHC 1A6AB 4NO5B 3NP4A 2P9RA 4FEMA 3D33A 4WWKC 3AU1B 1KTDB 1IT9H 3I6KB 5IHHA 2NY0C 3RYMA 5ILTH 4ZMWA 2WXIA 1VDGA 1ZRUA 2K8QA 3N42F 3FT2A 3L3GA 4X5QA 1LEKB 3KGRA 3AB0C 1QR1B 4JHBA 3QUKA 4LCCA 1NGZA 1NL0L 1YY8A 2WXKA 4YIQB 3WNMA 1WAAA 3LKNA 5IVXF 4N9GB 2NY6D 4MXVF 1A6ZB 3ECWA 3WNNA 4RAVA 1R3HB 1IKFH 2HB0A 4K8RC 4F80A 1NICA 2BP3A 4JM2B 5ISZA 2CWRA 1ORSA 2VLJA 4Y4HB 5FLUA 3MRNA 3WD5L 2Z0BA 1KCRL 4OQ1A 2I60H 4ONFH 2F54A 4Z77B 4ILDA 4F7PB 4OZIE 4KKBC 3TCLA 2CJUH 2B49A 3QDGB 1EJOL 5SX4I 3EO0A 5E2VL 5CGYC 1NCJA 3D09A 1NUNB 4IW4C 1C5DB 5EO9B 3SIKA 5J06A 1TTGA 1G9HA 1KZQA 1C12A 2K6WA 2XRAH 1CLVA 3G5VA 4U0RC 5A2JH 5ACZA 5B1JA 3WOVA 4O2EB 4PS8A 1ET7A 2EEXA 3PNWA 4WDIA 4DK3A 2WBXA 4N20A 5JOPD 4WK4B 3Q5YA 5DURB 1BWMA 3QEHB 5ITFA 3RIFK 2VITA 4HT1L 4Y2OA 3WKQA 2BOCA 3MV7E 4EXPX 4GFVA 3SSGA 3TJEH 5AZUA 4TPRH 1K4CA 3CFTA 3B9KB 4ZYKB 1EO7A 1U6AH 4K7PH 1UG9A 2QSQA 4OZIA 1PEZA 3GMMA 3ARPA 4KKCD 3QI9C 3EU0A 4NQDD 5ANME 3BVWA 4GYBA 3RZCD 3ZTNL 1AQDB 2ZSWA 2ZCHL 3Q2VA 5DJ8B 4MBBA 1IGML 25C8H 4NQED 5I17B 2WZPA 4YMPA 1WFIA 5D2NE 4B60A 3KPMA 2BZCA 5FWQA 1TIUA 3LRGA 1A6WH 3MRHB 4I77H 4X6CB 3FCTA 3SJVB 1Q1PA 4JMXA 3QULA 5CJOL 5AWXA 4L4VD 2EUZA 1GS8A 2F74B 3OAZH 4LMQE 5ESVA 2VZ1A 1IJ9A 3E2HB 3SE6A 4G6AC 5CD5C 1DBBH 3BYYA 3BN9D 3HR5B 3MCLL 3MV7A 5C0BE 3Q43A 3FRPA 5EUKB 4F3FB 3Q8FA 2KLTA 3IMVA 4UNUA 5IFJB 1X5ZA 1PL3A 4IRJB 4Y5YC 2PTTA 5DEGA 4Y16C 1S5HB 1MFBH 1YEJH 1BHGA 3BGFC 3CFKB 3SDCC 5HDQL 4UT9H 2RALA 4P23B 5D2NA 1QBBA 4NM8L 3CBKB 4K5OA 4NKQB 3DECA 3V4PA 4OD2B 4APQB 3EJRA 4YXLH 2OS7A 5HPMA 1VB9A 5ICXB 1AXSA 1UA6L 3LHPH 5C0BA 2GY7B 3KPRE 4AEFA 5AW0B 3H1ZA 1QLRA 2Q9OA 2N56A 3EMUA 5HDBE 3JQOB 4AM0Q 3EGXA 1ZSDA 3MRFA 2QADC 2LFEA 3GPSA 4XXWC 3V0HA 4FE9A 1NWPA 3VXQA 4HV4A 2N7BA 3WEXB 2ADJA 1HQRB 3NK3A 1T83A 4PR5B 4M29A 1INDL 4H5SA 5CBEA 5HHVH 5KG9B 3PWPB 4EUPB 3O5XA 5KAQG 1KFGA 4Z7UE 1MVUB 2ZXCA 3X11B 4K07A 3FS9A 4NOFA 5I66B 1WCBA 2IWEA 2VDRB 4HF5L 3MRBB 2WQXA 3ZHFA 5E56A 2NW3A 2VDLH 1J0HA 4UAOC 1FZJB 3X1FA 3WIIL 3K2IA 2OPCA 5F7YC 4JDZB 3IJHA 3SGEH 4NQCA 3S4EA 2IC2A 2A6KB 2HKFL 4KI1A 3LPWA 1XTMA 3FQTB 3MDJA 4O00A 1LYVA 1HHIB 2OXGA 4Z1PA 1AGCB 1PA9A 3I3DA 3QORA 4YQXH 5HJ3B 4Z7UA 2I85A 3VI4B 4UOQA 2GBVA 2DQFB 3BZ4A 5C08A 1QASA 5HDWA 4Q89A 4MAUH 3II2A 4HJIA 4EN3D 4S1SL 5TPWH 1RZJL 4GXUM 5I18L 3ARFD 4W4OC 4AIOA 2VSCA 2Y5QA 3G6DL 4M5ZL 3VRJB 4QRQA 1IO4C 2E8ZA 2MTPA 4IRSD 1AGFA 2ATPA 1UT1A 2FX7H 2X4TA 1OGPA 1C7SA 2H45A 1ZVHA 2WYTA 4Z7WF 5L9DH 1G1KA 2FBJL 4OM0H 1JWSA 3G08A 2B4CL 2JJDA 1GW0A 4E5XB 2PWHA 1OF0A 3TBVA 1XIWD 1QNIA 4WO4B 2Q8BL 3LV3A 2D31B 1PQZB 5LWYH 5FUOL 3RHWF 4QBWA 4B3VA 2NTFB 3FQYA 3HB3D 3HPLA 1PDKB 3TNMB 4NKOA 2ITDA 3TURA 3IE9A 1S7QA 3FQ4A 3Q3GA 5LGHL 4KZEH 3GMPB 4HJGA 4QIRA 3UGEA 1DVFB 1EMTH 2P5WD 5DT1L 4XPTL 2QSCH 3QCFA 4N2GA 3P11H 3F7YB 1CMOA 3HE7D 5F0MB 3OR6A 3H3KA 1PCXA 1HINL 5GRJL 2DTML 3UIZA 3Q7JA 1UA7A 3IFNL 2PXYC 1AYRA 1E5UI 1KTCA 1RVFL 1SYSA 3Q1SL 4E9SA 3J27A 4LEXH 5T5FH 2O6DA 1T3FA 3QRLA 4ZW3A 4FQXB 1EEOA 4UTCA 3F5WB 1G87A 1GQYA 1FLRH 2AV1B 3EUUA 3C12A 1FA4A 4QUOA 3HUJE 3T3PF 5DHYA 5FS5A 1X5XA 4MS8D 1U36A 3S5LA 5CKAA 1QSEB 2FO4B 2YSSA 3PQYE 4Q9QH 2X4QA 4LGSB 1EEYA 4PW3A 5D71H 2Q6WA 3UBXA 3MJGX 2XA8L 4HIJB 3L3JA 3HN3A 1NCDH 1MVYA 1F3JB 4TUJA 8FABA 3VU1A 1B9ZA 2QDWA 2F19L 1T7WA 1CIUA 1OAQL 2ZPKH 3D51A 5E6IB 3MJ7B 2Z34A 2BP8B 3HUJA 3LTVA 1WDAA 3D42A 2IDSA 4NCC1 4FCAA 4BKSC 2ZJSH 1FE8L 4HD5A 4GQQA 4U4IA 3INUH 4OY9A 4P0DA 5KABA 2APFA 2E8YA 4TLKA 3PQYA 5FO8B 3MUZ1 3TA4D 2NXZB 3HG1E 4IOFD 3FQRB 1OSPH 2IAND 3PYCA 4Q58C 1MRFL 3C6SB 2DN7A 4X5WA 3BVUA 4Z7QF 5H2BB 3QBTB 5F8QC 3CCHA 3ECQA 4K73A 1QBLH 4J3SA 2OSWA 3SGJC 4NN5C 4C4BA 5KYWB 4JKWA 1IGFL 2IAMA 1IX2A 5T1LA 3FZUC 1B3IA 4U1HB 1FZKB 2FEDD 3O2WH 3B7TA 4NI6A 1RIUH 4QY8A 3IJSB 3W11D 4AIZA 3OKOA 4BK4A 5BS0D 4N26A 1LQFA 3P9WB 5HHOA 1XBOA 2QGCA 3ATAA 3QYCA 1FNGB 4OJCA 1NCIA 5EF1A 2HKHH 4XRCB 2FATH 4RMWA 4AW4A 1AFVH 3T2NL 5JHDD 3HG1A 4XMLH 4P06A 4KTEL 5CKGA 5I8KL 2NT7A 3LKSA 3CZNA 4RMUA 3FT9A 1L0YA 1PTVA 5IBTL 2XTJD 5ITBL 4R7NB 4DP2X 1EA9C 4HMDA 2IPKB 2JXMA 5F6HJ 4OTXH 3ARZA 4KFZC 2H2PD 5EEUA 2HT2D 4X5XA 4NC1E 3HRZB 1NCBL 3F58H 1G9MC 1E5CA 5GRYA 1NIFA 3ZVVA 3FB6A 1A14H 1J1XL 4KHXH 3UZVA 4F9LC 1YNKH 4U1SA 2E86A 3CXHK 3IS1X 2AZAA 2CM8A 3MACH 3ZDYF 1DVZA 2VZTA 4PH8A 1UURA 3TU6A 4XCYB 3CDZA 4KO6A 2P8MA 1FNAA 2X53A 2J55A 3ZQWA 3U2IA 2V5YA 3LD8B 4Z76A 1OHDA 4RH9A 1TSHA 3DVNB 5DJCA 1NA8A 1C16A 4DVBB 3AREC 3QUZB 3KJ6L 3WAKA 4JQVC 3P69A 4UQ3B 1J12A 4RAUB 3NCWA 3GSUA 1JPEA 3QG7L 4RQQA 4WHDA 2GJPA 1VFMA 2ZF9A 3U2JA 3ZBMA 5C0RL 1GQQA 5JHBA 2BNQE 5D5MF 3GDBA 1S78D 2MKWA 4HULB 1ZIAA 4ODSL 5J6GA 2HNPA 4WCYH 1ILSA 4KY2A 3D5OF 2PQ5A 2E74C 3F12A 1X4XA 1IQDA 2F5AH 1BVNP 2V2WA 4JVPA 1TJGH 4C4KO 1CR9L 4TTGA 4WK0B 5K39B 3TA3B 1RZKC 2LLGA 3TZVA 3PNRB 4U1NA 5H8DA 5TK2A 3GXTA 1TNNA 3FMGL 2H8PA 4XX1E 1UKTA 3B5TA 4HMCA 1XF5A 4YL4A 3SGKC 3F99A 4G7SB 4WJKB 3NFPA 2WUBH 3QCCA 2DLHA 5KBMA 3PDDA 1RSFA 3L4UA 1L6ZA 2X2UA 2HG0A 5DS8A 1B6UA 2BNQA 1CXHA 2ZONA 3DUSB 4G8EA 4IHOB 4OLWL 4MA7H 4NQXA 1BVNT 3FUDA 2JKNA 1BGXH 2NW2B 3SDAD 1BBDH 3IFLL 5DVLA 4K3DL 3TYGH 1HCZA 5FYJE 1K5NA 3UADA 2P7TB 3I02A 1CICC 2VDRL 4M56A 4Z8FH 4WU7A 5J1AB 2UX6A 3ZYZA 3QCBA 4YDKL 1DUYA 4FNLH 2Q47A 1L4IA 4GO6B 4KBPA 5HY9A 4TSCL 5HDEA 5DD3H 1S3KL 3V0VA 1MW1A 3UTSD 1R46A 1SF5A 2XPGB 1YEKH 3HE6C 2H1LM 5F7HA 1KXTB 3WNLA 5T1KB 5JPMC 4K7FA 3FFCD 3IMUA 2F8XC 4DZBA 1XR8A 4U1MB 2WJ7A 5DA4A 5IJVB 5JW4N 2K0RA 2BSTB 4HOWA 4LSRH 5A6IA 1FCCA 4A38A 3P0YL 2DQDH 4KRPB 2GI0A 1QFWI 5DEZA 2F6VA 3GGWA 3HBGA 5D1XB 4CN1A 1YECH 3QAZC 1G0YR 4ZUSA 2HRPL 4HC1A 4KVPA 2FYVA 4KDTC 4KRMB 4OJFH 1QP1A 4B04A 3V8OA 4G43B 3QXVA 2FQFA 4BCYA 2WXQA 2NY4B 4HSAC 2J4WH 3LN5A 3O45A 1JPTL 2FLRT 4P4KB 3C5SA 4K71C 4OJYA 3SD5A 1DTUA 4GUOA 2E7LC 2WWMC 1S9KC 3KMDA 5ACMA 4Z78B 1F8TH 4UNTA 1ODAA 3GXPA 3IKCB 2HSIA 1BVLA 1B6DA 2UX7A 4FMFA 1SXBA 4ICWA 5MI0B 4NKIL 4TVPH 1KIQA 3FOLA 3QFJB 4KKAC 4IDLA 1FYTD 5ELIA 4JUSA 4FQQA 3H4FA 4NZUH 4HVBA 1PD0A 1WS7A 1NPNA 3CFCL 2GT9B 4LVOB 3M1BA 2AFNA 3OAUL 2AI0L 1UJ3A 3M1CA 4PY7B 3RIAF 2A6IA 3MLSL 4HS8L 4NZTL 2CMCA 1ZJAA 3I6SA 3OQRA 1P84J 4Q6IC 4J51A 2E4TA 3MLXL 2Y6SC 3M6DA 5D1QC 1BEYH 5GZND 4P04A 3AT9A 2D03H 4CDGC 1KB9J 3N44F 3EF4A 4BH7A 4OD3L 3EJCA 4C4KT 3TBWB 3TCXA 4G3YL 4FZEH 4NRYB 2NNCA 3QHFL 5K1NA 2VUKA 2J71A 4JG1L 3S37L 1YLBB 4OZ4B 1ZLWK 4KO5A 4CJ1A 2IXQA 5MERB 3AS0A 1I9TA 5JTWA 2WMPB 4IJTA 2HT4D 3N9GH 5F7KC 2DKSA 5MP6L 2XQBH 4RA0C 3MX0A 2C46A 1JZDC 1SDDA 4NIKB 1T89A 5D7SH 5FDYA 3BPLC 3LOWA 2GCBA 3OKLB 3AU1A 1KTDA 4S1RH 3HAEH 2IFFL 3LDBB 2A9NL 3BZDA 3FOMA 1OAZH 1SVZA 3VGFA 2WIIA 3US1A 2BS9A 2PW2B 4OZFG 1RUMH 1QR1A 1WAEA 4MASA 3RLSA 4FDWA 2HTLD 4AGNA 5JORB 1P7BA 1E4WH 2A9AA 1QLEH 3BEVA 1XZ0A 3CH1B 4LCWD 1PS3A 2R2CA 4P48A 1R3HA 4X9FA 4XWGH 3DNKA 3MJ9H 5ERWA 1S2EA 4AEIH 1PZAA 1UH4A 2G75B 3SQRA 1FIGL 2R8SH 3LCYA 3WFZA 4A7QA 1QQDA 4POUB 1MKPA 1VENA 5K23A 2ZUTA 1MHPL 4Z77A 4EDWH 3MUGB 4ONGL 1W0YT 4L18A 4BD4A 1TPXC 5IM7B 4K9JA 4M48L 2AJYL 3QS2A 2LT9A 3D25B 4QJ5B 3S3EA 4BFRA 3LHAA 1ZHLB 4OZHE 3KL0A 4F24A 2AAAA 2WB7A 4EIZC 4J3TA 4WTZG 3NRPA 1GC1C 2XWBB 3DXAD 3MOAH 4KX7A 1Q1JH 4QDGA 2WQUA 3L08A 1XDTT 3B2XA 3ILDA 4WHCA 5DUPH 4ICXA 5JDJA 4WY7L 3EUDA 3L8QA 1GIGL 5FHAH 5CU5A 1ADQH 5GHWH 2BVYA 4JDTH 5F3HA 3TGXA 3U7YH 4CC4C 2Q87A 4ZYKA 4YSEA 2OYPA 4FQHA 3MRGB 2R23B 4KK5C 2CM7A 3KWTA 3T6VA 2R9HD 3WY4A 2EABA 4NWUH 3HNTH 3FTXA 1A02N 3VFVB 1DBMH 4F57L 2DW5A 5C97A 4DEPC 1AD9B 3RU8H 3X14B 3VD3A 3EOTL 4YXHH 5CJXA 2XZQL 2ZX6A 4HK3J 2Q3AA 4F91B 1WWBX 5DJAB 1GAFL 3V4VB 5TF0A 5F1IB 2B08A 4YK4C 4X6CA 3FSVA 3FUIA 3IDYC 2ZX7A 5FV2A 5IIEB 1W0VB 2F74A 4CN4A 2XG4B 3BVXA 2J3SA 5F72S 1CFBA 4E9QA 3F41A 5C7XH 2BWQA 3HR5A 3PUCA 1E4XL 3IDMB 4AIXA 4RI5A 1NGYA 2ZSVB 5IFJA 1NMCC 2GJRA 4JHVA 3BFOA 1LGVA 4OI7A 1JYVA 2ZTBA 4JMNA 4ALAC 3BSZH 4GKZB 3N42B 5EC1B 4GG8A 2YGNA 3QKPA 2E75C 4HUWB 1L7IL 4BUQA 3KAAA 4NCC2 4XCEA 1H3PH 2PT0A 4FI8A 1F5WA 4NUGH 1YNTF 1CFNA 3NJMA 4P23A 5CEYB 2PO6C 1NUDA 4IMKA 2F53E 1LO4H 3GZQA 4OD2A 4APQA 1CC3A 4YDIL 1U21A 1U3HB 3UGUA 2VLLA 2PPAA 5F9DC 5AVTB 2JJUA 3QR1A 4DETA 2EO1A 2NQDA 3D6GA 4FQCL 1QW8A 4Z7AA 1IBZA 5FR3A 2DMCA 3SKJL 3STLA 2KS0A 1JV2A 3N04A 4OI9A 4AQ8A 4OH2A 1NFDE 3HMWL 1BW8A 1GJWA 2KC0A 2Z93B 1S7WB 2V17L 3K7UA 2QHRL 3DTUB 3PWPA 4EUPA 3CIAA 1DBKL 3OLRA 2I6MA 3X11A 4MQSB 3EKCA 2WCPA 5I66A 5I6XB 1NWEA 4I18A 3IJEB 4AMKL 5MENB 4JO4H 1FGNH 2IDFA 1P84K 4MNGB 1TJHL 2UZIH 4H26B 1GFYA 3LPGA 3OKNA 1B0IA 1FZJA 1KTRL 2WVVB 2VR9A 3MAWA 1KB9K 4QO1A 4X50A 2XZCL 3CU7A 1ROWA 4G8GD 3VWKA 1KAVA 1TR7A 4KK9C 3QEQE 5HYSG 2Y7NA 3EYOB 3APMA 2R1WA 3QUYD 4Y4KB 1F3DJ 4MNHB 3S5ZA 1FL5B 1NFDA 3FQTA 2WGXA 5AB0A 1A2YA 2IGFH 4EI5B 4HAGA 2G3XA 1ZHKB 5GRXG 4LDLB 3FPXA 2QKIB 2WB1A 4XBGA 5HJ3A 3EYVB 3DV6B 2C1OA 3VI4A 3CC5B 4RH5A 2DQFA 1UCBH 3LIZH 4ISVA 4UILL 1NIBA 4TUOB 2PBNA 2ORBH 1JAEA 1G43A 2I9LB 2Y2YA 2EC9T 4KHTL 2IDQA 2W9EH 3HC4H 2FRGP 3WNPA 4CMMB 3VRJA 2I42A 3QEQA 3QZBA 2WQVA 4RBPK 5D1ZI 2YKKA 3LEYH 5JOEA 3UZEA 4E5XA 3FQXA 4JJHA 3APDA 2YRPA 4YHIA 4JM4H 2A73B 4WO4A 4BQ6A 1HVXA 1PQZA 2NYZA 4PMFA 1F11B 3WTXA 4GSDL 4MMYB 3DK0A 2DXPA 2NTFA 4FQJH 4N9OB 4AH2B 1FFQA 4OJDH 12E8L 3DV4A 1Z5HA 4HKZA 2WZ6A 1BZHA 3BGAA 5AOIA 3ZHNA 4CBZA 4B7IA 2WTRA 2BSSB 3LJ3A 4J2QA 2XY2A 4U1LA 4PRIB 4U3CA 1R3JB 1WF5A 2UWEE 2EXWD 4XP9L 4MNQE 4LLMB 4PJAF 1BAFL 5GGRY 3J8F7 3GI9H 5EHPA 5T3ZD 3IJ8A 4UT7H 3BQUA 3DI2B 1BM7A 2F7RA 3A5KA 1M7DA 4GI6A 4PJ5E 1WSST 1Z3GL 43CAB 5KVFL 4YHNB 2BLFA 1HH9A 2QBPA 5C0EA 1OCWL 2BVTA 5JHDB 2HFTA 3IXTA 2BSCA 3UBFA 4OCXL 3ZSSA 1BECA 2B0SL 5HGHB 3MRPB 3UG3A 3ZPDA 2NNAB 4PGDB 5ES4B 3N85L 1JN6B 5J11B 1TVHB 1A8ZA 4POYA 5JA9A 3O3UN 4D9QE 3ZZQA 4LP8A 4L8SB 2NY5L 1JOIA 4N6RB 5E8EB 5I26A 3RB5A 1K4DA 1GYUA 2WLKA 3C60D 4LARL 2OZNA 3L1OH 4PJ5A 1L0PA 4KITB 3SYQA 4HPOL 2NT2A 2QFRA 4WI0B 2EE6A 4PJ7F 1FV1B 4HETA 1M3IA 2NY7H 2BP8A 5ALCH 1XGPB 3MRKB 4UDUB 1IGJB 3W0WD 2ZUQC 4G6KH 4N8VG 4LSVL 2EDJA 1T6BX 1PZBA 1MFDL 5HVGB 5FO8A 4JZJC 1THAA 4U6HA 4JRWA 3FQRA 4FFYH 4WWOA 5LGJB 5K9KA 2MOGA 2R2BB 3O3EA 4WSGA 2ESVD 5BXFB 2X87A 1TLKA 3B3BA 2EZ0D 1DJXA 2F61A 1UVQA 3GSNA 3T77B 1NDGA 4YEFA 5KA8A 3UYPA 4E41E 1FZKA 1BZ7B 4JB9L 2PPFA 1MRDH 1RXLA 5HHMD 1FNGA 1F4XH 5JUEH 1SN2A 1E8XA 2R1YB 4BHUA 4B5ZA 5EDXA 3NJXA 2J8UF 3ATDA 2DYSB 1KG0B 2Y07H 3UJIL 4ZI8A 1SYVB 3O4SA 4WEBH 1HYRC 1KYOJ 3CQPA 3VGEA 2X12A 2E7HA 1AQKH 3GSWA 4Y5XC 5KSBE 3F84A 1D7FA 1JF5A 1SM3H 2X10A 2Y68A 2D7NA 6PAZA 4PJFB 1TEYA 1T03L 1AAJA 3FO0H 3GD1C 5LCVH 2VAAA 4ANWA 1CLCA 4N2BA 5D7JB 1D5ZB 4NNXB 3TVMD 3T3PB 4E41A 1QKZL 3HRZA 5DFVC 4XOBA 4EZMA 2YWYA 2IEPA 4PM1A 3GMRB 3LH2L 2B1AL 4OCNC 4D0DA 3FAWA 5C09D 1OGSA 3PWVA 3TEWA 4PGCA 1FQ1A 4FQIH 3CSBA 2X6UA 4JO1L 3SE8H 5HGAB 1A7PL 3UYOD 2VGLM 1CXEA 1MCPL 3JT0A 2OK0L 2ZZUT 3CXDL 1BMZA 5DZ9A 3V0AC 5F9OL 4IJ3C 5I23A 4FJ6A 4LLAA 4PGBB 3U30B 5IKCB 3DVNA 5IFAH 1IC7L 2A9BA 2VABB 3GO1H 3QUZA 4PWJA 3WXWL 4UQ3A 3O3DA 1BBJB 3T8XA 4YDVB 4Y7OC 3CZUB 3RTQB 1I3GH 3NRSA 3FRPG 1MRCH 4XXDB 3D39D 4JM2C 1ZPUA 1ZHNA 5CZXC 2Z91B 4CADA 5I6LA 1DANT 1SZNA 2VQUA 3CLFH 1P69B 1MAML 5J3HC 1AXTL 1BG1A 5IROC 4E9VA 1ZGLP 5E6RB 1A5FH 5FK9B 5K39A 1CE6A 3B2PA 3NRQA 1T0MA 4LPTA 4YPJA 5IQ7L 5CNHA 2JMRA 3GBDA 2WLJA 4UM8B 3TT3L 1R17A 3TYFA 1YYCA 2KQNA 3WS6C 1YJDC 3GMLB 4AENB 4OVUA 1UOLA 4JG5A 1A4AA 4J27A 5FECA 4MYPA 5FGCE 2NW2A 3C8KB 3TNNA 3SCMD 3V55A 2P7TA 1LP9E 4ADJA 2EKSA 2X6CA 3QHZL 3WIAA 1KGIA 3QVAA 4OIFA 3IGLA 1BFVL 5AVXB 4EJ1C 1OEMX 4LLUB 5KSVB 1S46A 5CMAA 2ICEB 3BOVA 4QCIB 2EXTA 5DF0A 2B1HL 2QLYA 3ZDXF 2OZ4H 3B1UA 1PLGL 3F01A 3ZKND 3BEWA 3GSVA 1YHPA 5C07D 5EOCH 3RB7A 2BNRE 2IH1B 1ZXQA 4HKJB 4U1JA 1PG7W 3QDMD 4M43H 3W1ZA 4RMBA 4BZ1H 1DSFH 5IJVA 2J1ZA 5T3XE 2I6OA 1RUAH 4HWUA 2BSTA 4U0QB 4DO6A 3DUUA 4KV5E 1CD1B 5D1XA 2OZ5A 1MIEH 1LP9A 3HHMA 4QRRB 3ZDYB 2FL5B 3CJJA 3S7GA 1NBZB 1GMIA 5FB8B 1BQRA 1N70A 1Z5LB 3VFOA 3AQZA 4IRJC 4XAKE 3F7LA 1RZQA 5KYXB 4B41A 3KPSB 1RZGA 2ZUXA 3EJTA 2X5OA 2AXGB 4PV9B 2P43B 4ZAKD 4E9LA 4H8WH 1DP0A 1Z3RA 2DBLH 2IBZX 3ARDD 1AY1L 3C5JB 3DGGA 3IAGC 3EO9L 1J9QA 1OK8A 4J3OC 3NQIA 5A7EA 1FAIH 1KNOA 5FCUH 3SDCA 2C3GA 4AV5A 3EAKA 3IKCA 3QDJB 5TF1H 4KY1H 2YD6A 3FKUS 4EBQH 1SXNA 4Z0BL 4PLKD 1BLIA 4WNQA 3VFMB 4QTIH 2AQPA 2EEBA 4PSPA 1L5GA 1SJHB 4QXTA 1G7LB 4JANB 2X4PB 2DIEA 1TQUA 2BRQA 1GJIA 1XMWA 2WLNA 4JRXE 2J6EH 4NUQA 1PYWB 5MEPA 5ESAB 5IOPB 2ADGA 5E0QA 3RDJA 3OR7B 4HLZG 2AMUA 5IBUG 1E28B 1BMWA 5AVYB 1FF5A 2VR3A 4YFLI 3NCMA 4HV8B 4ZW5A 1BM3L 4R30A 2B4OA 4BGLA 2BIQA 1U8HA 3MLTB 2C9XA 2YMTA 2A9ML 4OZ4A 4XODA 2WTOA 1KYOK 4LNVA 5LJYH 2E9JA 2XCMC 2CRIA 1H15B 1JDDA 4Y1AB 1JF1A 1R6HA 5EF0A 1C1EH 4CVLA 1F4YH 1WG3A 4M03A 1OY3B 4NQQA 1RY7B 4RISL 1BD2B 4ELME 1RFDH 1U8KA 3DBXB 2EE9A 5IMLB 3CM3A 4P9HL 5FYKL 5BVPL 2A83B 3T6WA 2BIIA 4OLYH 3SEPA 3G6JE 2F7OA 4ZSOE 4YR8B 4AZ1A 1CBJA 3IFPB 3TC9A 2NNFA 4M5YH 1BZDA 5MEOB 2V6HA 1OTSC 2PW2A 3EFDL 2DM2A 5KVEH 3ABZA 1BG9A 1OAYL 4KJPC 3P9MB 3CMOL 1FBIL 4FFZL 3S5LG 5GS0D 3DK2A 4M61B 3OAYK 2BSDA 4AJVA 3CH1A 4H88L 2FGWH 3BE1H 2VDLB 3QJFA 3EHBB 1HHHB 4FA6A 1CDJA 2G75A 1E5AA 1COBA 5JIHA 3G6JA 4A2GA 1VFUA 1JWUA 4MA8H 4PV8B 4TNVF 5DU7A 4ZSOA 3AT0A 2XQYA 3Q2NA 2IJ0C 3ZE2E 5IM7A 2QBSA 3HHSB 4HJSA 4A6YH 1ML0A 5EFIA 3V0FA 4CSZA 3LN9A 1TMCB 3KWWB 2CALA 1P0SE 3CZFB 4ETYA 1ZHLA 4XCCL 4DK5A 4W9FC 2W0LA 3S3BB 1C83A 4FL4B 1U41A 4XNMA 3VMNA 1JNNL 3T6QC 3UTTD 1M4KA 5D70H 2YXMA 4ZFZA 2KZKA 1M3JA 3BP6A 4CSPA 2C1PA 2E6QA 1UXSB 3ME0B 3CVBA 4LLWB 4PGEA 3V5HA 2XPYA 4XPGH 1WWWX 2X4NB 3ZT5A 2PXYA 5TQ0H 3BZEA 2X2YA 4FRWA 5CINL 5H4YA 2NR6A 1XVSA 5BZWB 4CBPA 5A2FA 1AD9A 5FIEA 4ZX6A 4AGMA 3O6ML 4H8HA 3NIGE 2BIOA 2MKLC 2ZKHL 5DJAA 4QWWC 4WUKH 1LQBC 2BIHA 5T33H 3PP4L 1RERA 2AJVL 3V9EA 3LRLA 2NY2B 2XG4A 2AKRA 5JIMA 1JVKA 3ALXA 4E9TA 1KLUB 2ZSVA 4GAYB 4D8PB 4UOZA 1B0GB 1URIA 2PCFB 3FUHA 3NDZE 2EO9A 2PWFA 4KI5F 1T0PB 1VZGA 4R0LB 3TIDB 1NIAA 2QVIA 1IIKA 5DQ9A 4HUMB 3Q06A 2HXAA 4HUWA 4KDVA 3NESA 3C5ZC 3ZMPA 4HJ0C 5E6IC 1G7GA 1EDHA 2E7MA 2NY1D 1A9VA 3D3VE 2VAJA 3NVQA 5KVGE 4TSBL 1SVCP 1PKQB 4N8UA 5KBNC 1QBML 4HJTA 1NDMA 2CUIA 1FO0H 2WWNA 3IU3B 1RI8A 3QQXA 2OA9A 1I9SA 1N0XH 5AVRB 5FWRA 3TTSA 4XVJL 5EOTB 5GS3A 1G7MA 1QR4A 3DOHA 2QPEB 3MRRB 1MW0A 4OLZL 2G3MA 1ORQB 4MD5A 5KWYC 1UT2A 4L8BA 3OC5A 3A3YB 1OGAB 3D3VA 1ND0B 1X44A 3FQNB 4MDJB 3TIEB 5DUBB 5IVNA 4F5CE 1W6LA 3IJEA 1IT9L 5ILTL 5AZ2L 1ZC0A 3HNVH 1KLFB 4H26A 2X1WL 1HYSD 4P2RA 3VXNA 3NIDB 3JWOH 3S2AA 1ULVA 4OCYH 1SLUA 3QRBA 5D2LE 3IMBA 3QCGA 1T4JA 4YDZA 2G6ZA 2AJ3B 4Q4IA 5IG7A 2C9QA 4LOVA 5D1ZD 2BP5M 3FH8A 3LQZB 3ATFA 4Y4KA 4PJXE 1GG4A 4Z7VB 4LEBA 4UDTA 3FT4A 1IKFL 3CDCA 3QXAA 3B56A 4DKAA 1MFEH 1OT4A 5HI4D 2HFGH 1QSFD 2XIBA 4AVKA 4A68A 2F15A 2DL2A 3MGTB 3DV6A 3LPOA 1OM3L 2A74C 3D0VB 4FHKA 4Z9KB 1EERB 2R0KH 4NFBA 5SWQA 3RGVA 2DJ4A 4JFVA 3NEOA 4WRLA 2EDQA 3L7FA 2I9LA 4AQAB 3MN8A 3A5JA 2CJUL 3FT1A 3TFBA 2DBJA 2E4FA 2H6OA 4NO2A 4R83A 1J1OH 1YUHB 2WQ8A 5D2LA 1UQSA 3NCYS 5IB3A 1BREA 4AQEB 5ADOL 1T0NB 1IV8A 2XRAL 3RKDC 4TNEA 3KWVA 5HGGS 1MOEA 3BKCH 1A6VL 4O51A 4XX1G 4PRNB 4A2HA 3QIBB 3ABLB 3NZ8B 1OWRM 4BINA 5IF0A 1PEWA 1X9UA 3REWB 4PJCE 4U6VH 4XVTL 3LD8C 3ZKMD 1M6OB 3GBMH 3JWDC 1A9EB 3MUUA 3VX1A 2MNUA 3KYKH 3TJEL 1S3RA 4FOMA 1XXVA 5CD3B 3NN8A 3CHPA 1R0AH 2CBPA 2AQQA 1U6AL 3AREA 3KS0H 4K7PL 1IZKA 1ZEAL 4H13C 1PZ5B 1RD6A 3BLBA 1ZCLA 2XQYK 1GHFL 1R24B 2WUCL 3CE1A 5FYKE 3ULSB 25C8L 4Y19D 4HXAH 1LMIA 1EZUA 5EZLB 4AIEA 1OP5K 3KLHC 2ESVB 1DVXA 1A6WL 4GI8A 4I77L 5I75C 3TA3C 3G5ZB 1I7ZB 4U1KB 5JPNA 1PTZA 4RSYA 4PJCA 3TBTB 1E3FA 2CKBB 5CO1A 3L5XH 3QIUB 4KKPA 3MVNA 2WLZA 1MWAB 1V54B 1FFTB 3P9LA 5IY5B 4M4RB 4J39A 4QTHA 1HNFA 3O6FC 2FT7A 2GSIA 2VW6A 4AGQA 2RFXA 1MFBL 4YHYC 1YEJL 2G3ZA 3AUVA 3PL6D 4I8NA 4FTDA 4NKDA 1TCRB 3MRPA 3DX0A 4DP7X 3N43F 2MNWA 3PXJA 2Z64C 1GJUA 2LOEA 2F6FA 2B7DT 5GGSB 1Q90A 1TVHA 2DWTA 5HHXL 2DLTA 2YDUA 1MI5B 1XF1A 4KI5D 4YXLL 1MCHA 3P77A 4BELD 4N6RA 2NZ1A 3HE6A 2BHYA 1MCBA 3O11B 4GBXD 5GJTL 1TETH 1B4RA 1I1FB 3ARVA 4GUPA 1BQHB 4AKPA 2G60H 3OMHA 1XGPA 2EDDA 1Y0LA 4KRPC 1DQDH 1IGJA 5HHVL 5A3ID 4URKA 1NAKL 1S7XA 2OTPA 3O2VH 4QOKE 4GRLA 2BVOA 2BNUB 5SWZE 1KY7A 4A1RA 3DRTA 3ZV2A 3QUXD 3SKMA 5BQ7A 1L9PA 1HSAB 5LGJA 2R4SH 3MOBH 3LKOB 3VXRE 4Y2DB 3TWCL 4QAMB 3ZYJA 1RZPA 3KG5A 2E7LA 1F6FB 3ATBA 2VW7A 4K2UH 2NY6C 3U9WA 2AP2A 3F7VB 3T2PA 3VXOB 4BFGA 1V3AA 2HWZH 2MTAA 2A4EA 5MI0C 4DGYH 3HFFA 1QSVA 1VFBA 4OCWH 5BO0D 4O9HL 3W2DH 1BZ7A 4WW2F 2LV4A 4NERA 2CCVA 5SWZA 1P5UB 4KVCH 3N0PB 1IGCL 1GGCH 3NACL 1XGTB 1X5JA 5KS9E 3UYRH 4MAUL 5TPWL 1SYVA 5DFTA 3VXRA 4YZFF 4WV1B 1U8LB 3MCYA 3FN0H 1NAMA 1J88A 2FX7L 4V1DD 5DMYA 4XCFL 3MOZA 5L9DL 2WZAA 4OJEH 3P0VH 4GAFB 4LVEA 3D0LB 3AU0A 4MMXB 2D4FA 3GIZH 4WUUD 1P7KA 2PLTA 1BWWA 1JFQH 3EDJA 3GKZA 3OHXB 2AHSA 4PJDF 4RX4A 1XB6A 5LWYL 2CNHA 1B88A 4PVMA 1X4ZA 4AITA 1EPFA 2GJ6E 4UQBA 2AZRA 2H0PA 1O7DC 5E08H 4IBUA 1PX4A 5JO5B 3I3EA 3MV9B 5KS9A 1I1YB 4KKCC 2E0PA 3H9SE 4GRWH 3EADA 4PS7A 4HPYH 4JZOA 5HGAA 3RZCC 1IL1A 1H3UA 2EDXA 3WFCH 3P73B 4KZEL 5K25A 1KLGB 1EMTL 5DZLA 5C07B 1IBBA 5EUOF 3ABMB 3LDBC 1WFNA 4GMSH 4XTRC 2QSCL 2PABA 4PGBA 5C2BH 5IKCA 3H4HA 3P11L 4JFFE 1HEJC 3RUGB 3I7ZA 5I1GL 2P80D 1MKFA 3S36X 4GXUN 2BC4B 4G7VH 2XWJB 3BN9C 1MEXH 5EH1A 5EA0H 3WFBH 3VG0H 2XVLA 2F58H 4GIAA 5BRZE 1WZKA 2GJ6A 3FK3A 3VI3F 4YJZL 1NANH 3RTQA 5J9PA 4LEXL 2ZOKA 3OLDA 5HJBA 1IC4H 5DJ6B 5T5FL 1QWNA 3CFJB 4KXCA 2Z91A 4X4KA 4HUKB 1FLRL 3FONA 2Q86A 4RGND 1ONQA 4ZS6D 3FU7A 4NNYB 3OJMB 4O4YL 5FK9A 3D1QA 4ODXA 4D3CH 3R4RA 1UEYA 3KYOB 2HMID 2CG9X 4C56E 3CSGA 3HAEB 2LU3A 3LXAA 4Q9QL 3K2MC 5D71L 3WEAA 2MOQA 2XWEA 4PYGA 3WO4C 35C8H 2ITCA 1VLXA 4AJ0A 1CLYL 3KGTA 1UYWH 3C8KA 2ZPKL 1QLEB 3CU1A 2J8UB 1CB4A 2JNZA 1CF8H 4LAJH 4DIXA 3U36A 2YK1H 4TL5A 2JWYA 5CEZH 1AR2A 1I75A 4RZCA 3UJTH 4LLDA 4Y9FA 3QR0A 1FDLL 3I9GH 6FABH 1VERA 5MHSE 2NQ3A 2ZJSL 1WFOA 5EEYA 3INUL 4GW4B 4C56A 1AOHA 5GSVB 5DLMH 1WICA 2PR9A 4YBQC 3ZE0E 4XN8A 2XBZA 3P4OB 5AAWC 2H4VA 4HKJA 4WI6A 1S9WB 3GSOA 1JGEA 2FVNA 3O4LE 4IRZH 2BSRB 1FLTX 4OFVA 2OSXA 4WI9A 3NA9H 3N55A 4YBLC 2I6JA 2Y96A 1ZE3C 3AG4B 4E68A 1TYEB 3LRMA 4I1NB 1TEGA 3C6LD 1RUPH 3MBXH 1OWWA 4XB8A 3C8DA 1KCVH 3KBPA 3O2WL 1RIUL 5KYXA 1KCWA 3OV6A 4J6RH 2P4AB 3M7OA 1UKSA 2HKHL 3QWRD 2FATL 3TFKD 1AFVL 2UUPA 4EN3C 3C5JA 1I7UA 4XMLL 3ARFC 3CUPB 5I71B 1ET5A 3VGGA 3O4LA 3NPZB 7FABH 1U30A 2OLDA 3QDJA 4IRSC 1K6QH 4UZSA 3SGDI 5D4HA 4MA1B 5HGBB 3ESOA 1G7IA 1JPST 3LIUA 3WFHB 4F7EB 2ROYA 1FG2A 2VE6A 4X7TA 2Y7QB 3QE5A 5I6MA 3RX7A 1SEBB 4DPAX 2GITA 3T0WA 4ZMQA 1XIWC 4LSTH 1G7LA 4JANA 1S7VB 5L2KE 2X4PA 4FYQA 3UAJA 3VWJD 4BJLA 3C6EA 3F58L 4G8FA 2EILB 4ADGA 3MROB 5LKNA 4RFOL 1A14L 4KHXL 2LW3A 1HEZA 1YNKL 5IOPA 3HB3C 2JK5B 3OXSA 1EAPA 3OR7A 1BA9A 3VRIA 1ZT7B 4J23A 1NGQH 3EGDA 1CG9B 1KGXA 3MACL 5ALBH 3DPBB 1P4LB 3QAQA 4ZMLA 1WHOA 2JI1A 3WENA 3CWEA 4YN3A 1KJ2H 1JGVH 4H20H 5K9WA 1PTUA 3QZLA 1H15A 4Y1AA 2N1TE 1RCYA 4XNZC 2OMVA 4DKDC 2VLKB 5KOVC 1TJMA 1K8IB 2HX9A 3PV6A 3DBXA 4GMTH 4WGWB 2XPCA 4FXGB 2X41A 1AMXA 3GK8H 5KVMC 2DIJA 3EO1B 3FL7A 1XH0A 5B8CC 2FUQA 2GTQA 2WKOA 2VQ1B 2G2NA 5FA3B 5D9SB 4WCYL 2XDHA 4D0CB 2PWEA 2HVJB 2IH3B 2I7OA 2F5AL 1AANA 3QZWB 1TJGL 3CSYB 4FQ2H 2FWOB 4MS8C 3T08A 3ZIYA 2D7PA 2P5ED 3P9MA 3GMOA 1KUMA 3GSXB 4WJ5B 4L3ED 1KXVA 3KE0A 4R2GB 4YBHA 4N5ED 4DSYA 2X4UB 2E9BA 2WUBL 4I2XB 5DYOB 2N7SA 3G9AB 1T5XB 1Q8MA 2OMYB 4U7KA 2BX5A 4JL1A 4KAQH 1M2OA 4W9HC 5F71A 2HJKA 1MNUH 1T5KA 5T1MA 5E2TH 4MA7L 3BIKB 5I0VA 3ZW3A 4PTTB 5B4MD 4PV8A 5BMFL 1BBDL 1FZMA 3TYGL 1BAWA 5JIDA 2FB4H 2XG5B 2Q0ZX 3OZ9H 4Z8FL 4OIAA 2V7HA 2VLRE 1MCIA 4FNLL 4LFHD 4F8NA 1EJFA 4LASH 3P4NA 5DD3L 2FJNA 2Q7YB 3MFFB 2X4OB 1CDUA 5IJDC 4R97C 4ZQTA 4IOFC 3S2CA 5K9JL 3N41F 5BZZA 1Q0EA 4XN4A 2XJAA 3S8FB 1U8OA 5FYKU 1OGTB 5A16A 4EAEA 4NUJB 4ZTOH 1UXSA 3ME0A 3GSQB 4GW1B 4JFXB 1XQ4A 2DQDL 1MVFA 3IS0X 1NC2D 1JVOA 5BZWA 4ZX4A 4MLSA 3EB1A 2FEDC 1JK9B 2VLRA 1ZLUK 3W11C 4OJFL 1U8JA 3SE3A 1V8HA 2P8PA 3JT2A 2I4EA 2BSED 2J4WL 4PJIB 5C2UB 5B39A 2AQNA 4FG6D 4OF8A 1M9WA 1RUQL 5TFSL 2FD6H 1KGUA 2WQRA 2A77H 4HIIB 2VISB 2H4KA 2LABA 5DEFB 2OMWB 3NCEB 5J11C 1F8TL 2BPBA 1T4WA 4FCHA 2BIMA 3CBJB 3KXFD 3TT1H 1FVDB 1KLUA 2XTJC 2XN9B 4GAYA 1B0GA 5D96C 1P6AB 5DRZA 2X3BA 5TQ2H 2Q76B 3TIDA 1FSKC 2W60B 2H2PC 2ZCKH 2CO3A 2HT2C 3FQUA 4NZUL 4Z3IA 5IEHA 2FDBP 4PRBA 1I9JL 3US0A 1UJTA 1EQWA 5HVFB 5D7KE 4HU8A 1IC5L 2JLLA 2NX5B 5T5FA 1SFHA 1IE5A 2GTWB 1U24A 4L23A 1NDTA 2OOQA 4YHKH 3ESNA 1YEFH 4R8WL 1XH1A 4W6WB 3F00A 3V4UH 1PKQA 1ZCRA 1BEYL 5J56B 2XSKA 4HJJH 2D03L 2CMRH 1EGJH 3LKPB 4M7ZC 1M7UA 4GG6B 2OR8A 3PPEA 3B1TA 4LU5H 2YGPA 1U92A 4FZEL 1J4XA 1F6AB 2KDYA 1NCCH 4MGXA 3TN0D 4BQBA 2DQCH 1XGYL 1WIUA 4JFDE 3TCTA 3U6RA 4M93C 4EPSA 2X6BA 4XI5D 5IEKA 3Q6GH 1XFPA 3N9GL 2XQBL 3F64A 2J17A 3MLZL 4PWFA 1ORQA 3GS4A 5E00B 4ZW7A 1CWVA 1JGDA 3D2UB 1LWRA 4IMLB 3UC0H 3MJ8A 3EH2A 1OGAA 3K4ZA 4XZUB 1ND0A 3FQNA 1S78C 4LKXB 3BUIA 3QJQB 1ZVNA 5D7SL 3PXHA 2OMZB 1LE5A 4S1RL 3PAZA 3DROA 4NSKB 4CVWA 3S4OA 1KLFA 1OPOA 1SHWA 1OAZL 1U91A 4CKQA 4F9PC 1BVZA 4CVMA 5AUMB 1RUML 5JLZB 2AABH 2QCJA 2AJ3A 1CL7H 2ENSA 1U95A 1E4WL 1QLEL 4Z7VA 4XWGL 3T1FB 3UGXA 1VCBC 3UPRB 1WFUA 4LHQB 3KR3H 2I5YH 2X89A 3MJ9L 4AEIL 1CDGA 1FUNA 2CHNA 3HG5A 3MGTA 2R8SL 1OAJA 5D7JC 4ZDHB 4O2FB 1H8LA 5A2AA 2PP7A 4S0SD 3SDAC 2YC1B 4EDWL 3ARGD 3OF6D 4A7VA 1MHCB 4DPCX 4I1PA 2CFVA 2DOCA 5BV7H 1BPLB 2ZKXA 1AIFA 4DGUA 3MLYL 4KMQA 1YUHA 4Z6AT 3RVTC 5LXGH 1VGKB 2RA1A 3THMH 1YEHH 2WVUA 2X9ZA 1UM6H 1RULH 4JCLA 5CP3H 1URZA 3MOAL 5T1DL 5SWSD 1A7RL 1T0OA 5DUPL 1QUNB 3REWA 3LRSA 2OMUB 1M6OA 1BZEA 3BX7C 1N6VA 5FHAL 3WS3B 4OZGE 1ADQL 5GHWL 4JDTL 3ZDZF 3U7YL 4HHWA 4ERSH 4I0CC 2H41A 2JELH 1KIRB 4NP9A 1BQKA 2AMGA 4N25A 4DP0X 5I73B 4NWUL 1PZ5A 4Q2ZA 5C3TA 3HNTL 1R5VA 3S6CA 1DBML 4OHDA 3WFDH 5KSUA 3RU8L 5I6KA 3K1KC 3ULSA 4YXHL 3Q48A 3SOTA 5EZLA 3BM8A 4PB0H 1PIGA 4TM9A 3L2MA 5GGQH 1G1CA 1INQB 4LOUD 1C87A 1IVLA 3BWZA 5LNDA 5HVHB 2VZVA 5C7XL 2DQGH 1T2JA 4BA8A 1KPUA 4OZGA 4ZUWB 5EU3A 1NGXA 1XAUA 3BSZL 4M4RA 4EIBA 4RDDA 2E59A 3MKGA 4N2AA 2W95A 3KJ4B 2HH0H 4KXAA 1H3PL 2ATKB 1TCRA 2H3NB 3VGHA 2UY6A 3BP4A 4NUGL 3V8CA 1QTSA 4OFDA 2QELA 5GZNC 5GGSA 1YPZB 4C57C 1LO4L 5KA9A 3O6LH 4P59H 3WIFB 5BZDB 2ICEC 4JFZH 1U25A 4GRZA 2EAEA 1KBWA 2ZP9A 4NLAA 3A6BH 4Q0XL 4KXZI 3EW3B 1ITCA 3O11A 1J8KA 4WTWA 5D7EA 1V3KA 1Q9WB 3ROLB 3S3JA 5ICUA 2HT4C 4K8RD 5KYUB 2UZXA 4S10A 3VH8A 1YMHB 3WTYA 4Q74A 1Q9LB 1VZIA 4RDQF 5I1JH 2XHNA 1TYJA 3I3BA 3AW5A 4RGMC 2YEZA 2BNUA 4C55A 3N50A 5D55A 2PP9A 2J16B 4QRFA 2FJGB 4AL8L 2OJZH 3OKDB 3ARTA 1HSAA 4CKVX 3WIHH 1TU2A 2UZIL 4HW6A 4WI3A 4DQAA 4E9RA 4G70B 2XXCB 2QV4A 7TAAA 2ENJA 1CXIA 1TZIA 5DR5H 3VXME 1PZCA 2HTLC 3EJZC 4HFWA 5F7AA 3RA7H 2KT6A 3QIWA 1U93A 5B7MA 5FPIA 2IGFL 3B6SB 5DDHB 3LNEA 4D9LH 2ATAA 1JPSH 1A1OB 3WTSA 3HBZA 2C4FU 3HI5H 5I16A 1JE6A 1XD0A 3E8VA 3K8MA 3PIQB 4MJID 1P5UA 4PJEB 5DD1H 4UF7C 4BBWA 2HC1A 2JFFA 2R29A 4JMKA 4YHMH 3G5YB 3STBA 3TEZA 2L0DA 2ORBL 3RIFF 3PHQB 3VXUE 1OCZB 3IGAB 3B34A 4Y2EA 2XQYG 3HC4L 1HE7A 1U8LA 1PSKH 2WV3A 2WXHA 4OV6F 1BSIA 4IU3B 2DJSA 3HRPA 3KDPB 4G7RB 4LIQE 3KWUA 2O61A 2FJUB 3E6HB 3L5HA 5C0CD 1GSMA 3NCCB 1T5WB 5C0AD 4MMXA 3LEYL 3NH7L 4I89A 4KTGA 3NQKA 4FNTA 2HFEA 2K70A 1JXJA 4EDXA 3FXIC 3N43B 4PWIA 1REIA 3MMEA 4KPHH 4YGVA 3JSSA 3K71A 4HLZH 1XM2A 4FQJL 5GRWA 1W8OA 4ZPTA 5D7IB 3LMJH 1I1YA 1NBVH 1NJ9B 2JTYA 1Z5YD 2EDFA 3DMMA 3VXUA 3UERA 4DP4X 3G5XA 3NT0A 3P73A 1E2VA 4L3CA 4AZ8A 1HWWA 3NSYA 4P5TD 1E3XA 4OB5H 2VDNH 2YKLH 3RUGA 2VDML 4AQ1C 3MU3A 3QPXH 3GI9L 2AQRA 2EQDA 4XNXL 4UT7L 2C4XA 2XWJA 2GJZB 3D9CA 1I4FB 2L8AA 1PZ3A 3UBXI 1CTMA 1IUZA 4M62H 2OTUB 1OHEA 1ZTXL 4DOHE 1AO7D 2W94A 4UU9B 3ULVF 2MCPH 2P6XA 1M42A 4NYLB 4JFHE 2X70A 4ZOEA 1ZS8A 4Q97A 2VLME 5JHLH 4XCNB 5H35B 4X7SL 4EF3A 2FR4B 4JDEB 1I7RB 4OGYL 5C9JB 3E1F1 3QCTH 4LHUA 4P2QE 3U2SB 1W0WA 4X7FC 3ZTCC 1SOXA 3FTGA 3BGMA 2GSGA 4FL4C 2V5MA 2LE9A 5E94B 4XH2B 2Y7OA 3L1OL 3MGOA 4MD4A 1JPGB 1IC0A 1X5HA 2OX5B 4UV7L 4WGVB 1WYJA 1A64A 2AERT 4OHHA 1P6FA 2YD2A 3IDIA 2NY7L 3MJ9A 1F1AA 4AXWA 1G1GA 1ZZWA 4R0TA 4JY4A 1OV8A 4LNRB 5ALCL 5DJ2B 4G6KL 4XOEA 2EE2A 4W9ZA 4UZUA 3HI1B 2EYRB 1EJOH 1NCAH 2NZ9D 3BWAB 1UA3A 4A6YB 2JIXB 4FFYL 2JKRM 3T3MF 4E42B 2FQGA 5TE4H 4PRPB 2C3VA 4XAWH 4KZDL 3QUYC 4L4TD 3DYPA 1S7SB 4ATWA 5JYLA 4YLQT 2CO7A 1FFOB 4MAYD 5FFGA 4R0LC 1LEIB 1IKNC 3SDDA 1ADQA 2F18A 1MRDL 4XP5H 4F8QA 3O0LA 1WAAF 2KUTA 5JUEL 4HZ1A 4F2ME 3NPSB 2AC0A 1NWOA 4GWFA 4KROD 3C5ZA 1T1WB 1IGMH 4LF3B 4L3EB 3ZM3A 4WEBL 3L1GA 3TBSA 3MNZA 4JO2H 2QJDA 5HYQA 4OHIA 1AQKL 4KQ4H 3VRLE 4OIBA 2P44B 1KEMH 5JXED 3DJ9A 2HLEB 1SM3L 5HGBA 4ZRGA 1NQBA 3VB8A 4F7EA 2UVFA 2HG5A 3FO0L 4K3JH 4LESA 5LCVL 3ECVA 1MJUL 3GKWH 1ZV2A 4X2UA 2GHWB 1J0ZA 1J8HD 4QT5B 3AJ7A 4ZMZA 1O5ZA 3MROA 4O02B 4A2EA 2F7PA 1S7RB 2C3HA 4WW1A 32C2A 4BFIB 3BSZA 4FTVB 1FORH 1WGVA 1BVKA 1QBAA 4ZXBB 2D7QA 4O58H 3K74B 4DZ8B 4GW5B 4XOCA 4FQIL 3FB8B 4L1SA 3FUJA 1QW9A 3OJDB 1CXKA 3RL1B 4YDJB 3SE8L 4EZKA 3LQAC 3D0AA 3DPBA 4AC4A 4N5UA 2EXWC 4DP9X 4GE2A 4YZWA 4NGHH 4NBYB 4XMZA 4LPXA 4ZPVA 5IB4A 1T20B 1O6SA 5FYLD 3ZDWA 2WBJA 4Z7NB 5IJCC 4E0RB 3CC1A 1JNJA 2WP3T 4JREC 3GO1L 1FO0B 3ILPB 2EP6A 5EV7A 1CLOL 4PFEA 1E2WA 2A6JB 4G6JH 3QARA 4PVBA 4WI8A 2XFXB 1YMME 1I3GL 1MRCL 3QG6A 2W65B 4JGUA 4IK7A 1CFSB 5D9SA 1DQLH 4HX1B 3CLFL 1DQJB 3CLWA 2X09A 3PWJB 2A74A 4WFED 5DO2D 4FNQA 4U1GC 4AUYA 4EE2A 3GSXA 4HF5H 4WJ5A 4RIRB 1QA9A 2TRHA 3IDNA 4MD0B 1O9VA 3W57A 2VEVA 1CI3M 5IMOB 3E9TA 4YPGB 1JLNA 3BH9A 1T5XA 1PLCA 2OMYA 1D5MB 2GJJA 3IM1A 2WLLA 4MQ7A 1AE6H 2CO1A 2OJEA 3QIBC 3C60C 2K6YA 2CA3A 4XZ4A 3MNWA 3BIKA 2OMXA 4ODUB 5IK3A 5JHMA 2MPAH 4JBCA 2H6PA 2IPTH 4K3EH 2DF3A 2AQSA 2DD8H 4CUCA 4UTAL 2NLJB 2QTVA 5E1QA 3GXMA 3MFFA 4PJBE 3I9PA 5KYYA 3UDWA 1J05A 3LXBA 2DI7A 2YHGA 4R90L 2OZ4L 3N1MC 4M5ZH 3G6DH 4OCRL 4EOWH 5I1IH 4A04A 1AGDB 3O9WD 5EOCL 1KGCE 3I50L 3VE0B 4BZ1L 3X3GL 1TOXA 1DSFL 1E90A 4ORGB 5IQLA 1RUAL 4PJHE 3GSQA 3T0EB 3ULUF 2CQVA 2V3FA 2VZ3A 2Z9TA 5DZNA 5FYJH 1TF4A 2BJMH 3UTOA 4HC1H 1MIEL 3BHBA 1II4E 3QQDA 3FO1B 2QDVA 1JK9A 1SN5A 3MRQB 1ZPLA 4R7VA 5LLIC 1I7TB 2Z7WA 4S0GA 1F1DA 2FZ3B 2R0WH 3ARBD 3F6LA 1ZTXE 4PJIA 3UAFA 1EVUA 1NFAA 4H8WL 2Z31B 3TO4D 1MCQA 1GY2A 1HKLH 1P6WA 2VISA 3GTVA 3I6LD 5DEFA 1IM3B 1FAIL 3MO1B 4XPTH 4YC2C 5FCUL 5EPMA 3QC5X 5TF1L 1QFUH 4KY1L 4NXKA 4EBQL 2ODIA 2LQRA 1GGYA 1YQVL 1FL6A 5JMOC 4QTIL 2OQJA 1F2QA 4I0PD 1YEIH 4JQXC 1RVFH 2IBGA 2EEDA 1HOCA 5J6SA 4HOMA 3HI6L 1WZ1H 2QVMA 5TE6L 3CQFA 3V6OE 4QNPE 4UM9B 3ARGB 1H6TA 3PWUA 3O4OB 4LK4A 4H25B 5AOMA 2NZIA 2J6EL 3AM8A 4XC3H 5CGTA 1HCYA 2Z4TA 1DDHB 5ISZD 2ED7A 1JTTA 4J5VA 1U3JA 3MCKB 3ZU8A 5I1CH 1G7JA 2F54D 3FSWA 3WMQA 4X99B 4PWGA 4ODVH 2GBUA 5K59F 3I75A 4U31A 3SPIA 1QO3A 3H56A 4R26H 1ES0B 1MCOH 5TDNB 3REVA 2MHAA 3BWSA 4P46B 1EEQA 1J11A 2EUWA 3TH2T 3CDFA 4NZFA 2ED9A 3GJEB 4MFHA 1DVUA 5I8EA 5I9QB 3WLBA 2XA8H 5E2JA 4AK1A 5IHZB 1F4YL 4ZIYA 3HVNA 1U4EA 4QRSA 3D2UA 4IMLA 3V6OA 3KDMA 5DMKB 5DC4B 1XXFC 4HHAA 3HJEA 1QNZL 1MCCA 2JJWA 1QD0A 3K91A 3KPLB 3U0TA 1AMYA 4OLYL 1KB5L 2UYLA 5JOPE 2CCWA 3N41B 3HCVB 4NSKA 2WGNB 4J28A 4M5YL 2XU9A 3ZE1E 1AG6A 1FNEB 2OFQA 4GQ9H 5KZCB 4RHGA 2K45A 1NKGA 4HRFA 3D34A 5JLZA 5B38A 3KBHE 2VDKL 2FJMA 2X6MA 5C92A 1KTBA 3QT2A 1SJVA 3MRDB 4NQDE 4WV1C 1QHQA 4FFYA 2WJ5A 3AGVA 5D4QA 4TUKH 2FGWL 1AGEB 3T1FA 4F15C 1D3CA 4NQEE 5D93C 5FFOA 4IKCA 4FXKB 4XMKH 5EG6C 4RETB 2WXPA 4L37B 3OHXC 4JPVH 5K1VA 4F7MB 4L4VE 4UWQB 2YC1A 3SCMC 1EEUA 2DB8A 1KIUA 5KBLA 3MYJB 3QFDB 1PD1A 2Z4QB 3EGSB 3RY6A 1CF1A 3S3PA 4A6YL 5DUMH 2JB6A 1VGKA 1LK2B 2CNFA 1JS4A 5EBLB 5F21B 3O4UA 5DVNA 1IZJA 1IILE 3AY4C 2WWMD 5B1BB 3D44A 2G30A 1Q9OB 4NQDA 3ZKNC 2FYYB 3L3HA 3DIFB 4KGLA 1B9KA 3VGAB 2JCCF 4MB5A 4NQEA 1QUNA 5D70L 2OMUA 3B2UD 4K94C 1FAKT 1V3JA 1Y6NR 4PRHD 5FF6A 3IGFA 5I1AB 5ITBH 1CO1A 3ZR6A 4KKQA 4KKAD 5E8PB 2R51A 4L4VA 4XPGL 4YHPB 5IFHL 3HZKA 4QRPB 1FFNB 1YYMH 3ARWA 4WHYG 4XPFH 4GUCA 5TQ0L 2HJFB 3VFRB 1DLFH 1L9RA 1N26A 1X6NA 3WKML 4EKJA 4BSVB 4WAFA 2H9GB 3MBEB 2EDRA 1F18A 3VB9A 4QYOB 5D1QD 4ZAKC 3MV8D 4R6UA 5C6WH 1KTLA 2XWTB 2PF6A 1ZA3A 4GRWB 5T33L 5ID1A 3RFZC 5EB9A 4CSSA 5D7IE 3ULUD 4K3GA 1AZBA 4QBEA 1P15A 3WDIA 3DIDA 1HWHB 1GPOH 1OF2A 5FGBA 4ZUWA 3CFDA 2YZ8A 3KPOB 2V8MA 3KJ6H 1FYHB 4OLVL 2B1OA 4NQCD 4HS6B 2J5LC 4EXKA 1H3WM 1T7XA 1S9XA 1U3YA 3GB7B 3QG7H 4BK5C 5C0RH 1R33A 3A0OA