3V0JA

Crystal structure of ciona intestinalis voltage sensor-containing phosphatase (ci-vsp), residues 241-576(c363s), deletion of 401-405
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
319
structure length
319
Chain Sequence
KRRYRKDGFDLDLTYVTDHVIAMSFPSSGRQSLFRNPIGEVSRFFKTKHPDKFRIYNLCSERGYDETKFDNHVYRVMIDDHNVPTLVDLLKFIDDAKVWMTSDPDHVIAIHSKGGKGRTGTLVSSWLLEDGKFDTAKEALEYFGSRRTDVFQGVETASQIRYVGYFEKIKKNYGGQLPPMKKLKVTGVTITAIQGVGRGNGSDLSMQIVSERQEVLLCKFAEGYNCALQYDATDDCVTCEVKNCPVLAGDIKVRFMSTSKSLPRGYDNCPFYFWFNTSLVEGDHVTLKREEIDNPHKKKTWKIYRDNFTVKLTFSDAED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A glutamate switch controls voltage-sensitive phosphatase function.
pubmed doi rcsb
source organism Ciona intestinalis
molecule tags Hydrolase
molecule keywords Voltage-sensor containing phosphatase
total genus 108
structure length 319
sequence length 319
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00782 DSPc Dual specificity phosphatase, catalytic domain
A PF10409 PTEN_C2 C2 domain of PTEN tumour-suppressor protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1110 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3v0jA02
3.90.190.10 Alpha Beta Alpha-Beta Complex Protein-Tyrosine Phosphatase; Chain A Protein tyrosine phosphatase superfamily 3v0jA01
4H34A 4OHHA 1G4US 2P4DA 3CWEA 2P6XA 3GXGA 1ONYA 2H03A 2CMAA 2E0TA 2I3UA 4BPCA 2HXPA 4HJQA 1ZC0A 1QXKA 5K24A 3S3KA 4OHEA 3QCBA 4QUNA 3ZM1A 3EB1A 3A5JA 4DGXA 2GP0A 3OMHA 3I80A 2JJDA 2I1YA 2IMGA 2CNEA 1YZ4A 1Q1MA 1C86A 1FPRA 2QBRA 1OHCA 3F9AA 1PH0A 5MMZB 2A3KA 4GWFA 3I7ZA 2RF6A 2HCMA 1FPZA 4TVVA 1L8GA 3QCJA 1Q6MA 4I8NA 1YGUA 3NMEA 1LARA 5BUGA 1MKPA 1YWFA 2J16B 3S3HA 2H4VA 4ZN5A 2J72A 1JF7A 1OESA 2GJTA 4YAAA 3V0GA 5KA0A 1NWEA 2CM2A 4YR8B 2PA5A 3QCMA 3PS5A 2BIJA 4WU2A 1GWZA 3QCDA 3RGOA 1J4XA 2CNGA 4GFUA 2I6IA 2F71A 4J51A 5LXQB 3ZMQA 2B4OA 3QCEA 1PTTA 1G7FA 4QBEA 4GRZA 4KYQA 3ZMPA 2PI7A 1R6HA 2BGDA 3O5XA 1NO6A 5KABA 3D9CA 4ZI4A 1PXHA 5BZXA 2WGPA 4HJPA 1XXVA 1V3AA 1Q6PA 2QBSA 2C7SA 3RZ2A 2FHCA 1I9SA 1ZZWA 2QEPA 2QBPA 5IBMA 4B04A 1G7GA 1WAXA 1C83A 1OEOX 4RH9A 5EHRA 3D44A 4GE2A 1EENA 1I9TA 5J8RA 3U96A 1NZ7A 1YFOA 3AWEA 2I6MA 1Q6SA 2HY3A 3B7OA 5BZZA 3N0AA 1OHEA 4RI5A 2OOQA 2NT7A 1BZJA 1U26A 5K25A 1RXDA 1BZHA 1YTSA 1YN9A 2DXPA 2I3RA 4NWGA 2I5XA 3BLTA 5KACA 2J44A 3V0IA 4RDDA 2CFVA 3ZV2A 4GE5A 4WOHA 3H2XA 1YPTA 2PQ5A 2B07A 4GRYA 4ICZA 3BLUA 4Y14A 2FHBA 1C85A 3O4SA 2I4GA 4NX8A 2QCJA 2BZLA 3AWFA 1BZCA 2I4HA 1KAKA 1XRIA 5K23A 2GWOA 2CM3A 4QBWA 5KA3A 4QAPA 5EHPA 2HB1A 5K9VA 4PYHA 2HNQA 3QKQA 3ZM2A 2J16A 1C84A 1PTUA 2CNFA 2B4SA 5KA9A 3QCIA 2J17A 4OHIA 5HDEA 2G59A 3F99A 2PT0A 1C88A 2VEXA 4KYRA 1A5YA 1X24A 3OLRA 3GXHA 2J71A 3V0HA 3RO1A 2OC3A 1T4JA 4AZ1A 1YGRA 2YOCA 1WRMA 1GFYA 1LQFA 2FJNA 3EZZA 2ZN7A 3EAXA 5KA1A 1U25A 1WCHA 2QDCA 2HVLA 1JLNA 2NT2A 2G6ZA 2HNPA 3V0EA 2HC1A 1YTWA 3LJ8A 4RH5A 3O4TA 4Z6BA 3F41A 3QKPA 4BJOA 2FH7A 1YTNA 2VEWA 1VHRA 4GFVA 4D3RA 3O4UA 3MOWA 2F6ZA 1LYVA 3ZM0A 2H4GA 5BX1A 1AAXA 4IKCA 1KAVA 2F6VA 3S4OA 1OEMX 3V0FA 1G1HA 3QCLA 3V0DA 2Y2FA 4WU3A 1PYNA 3QCNA 4RI4A 1G4WR 1M3GA 2H02A 1PA1A 1ZCKA 1P15A 1NNYA 2VEUA 2ESBA 3S3EA 3V0JA 2A8BA 3QCCA 2CMCA 2PBNA 3CM3A 3S3FA 2PSZA 2OUDA 3MOZA 5KADA 2F70A 1G1GA 1T48A 3QCFA 4QUMA 4NYHA 5I6VA 1RPMA 2HC2A 3BRHA 1T49A 2CM8A 4RKKA 3S4EA 2MBCA 3EMUA 2J73A 2I6JA 2SHPA 1Q6JA 1QZ0A 5KAAA 1FQ1A 2B3OA 2F46A 4JBCA 4S0GA 2NLKA 1PTVA 2QDPA 1NL9A 4JMKA 3F81A 2I4EA 4ZRTA 4NWFA 3F9BA 4DGPA 2NV5A 4MBBA 2QCTA 2I75A 2BGEA 4D3PA 1EEOA 5KA8A 3EU0A 4OHDA 2AHSA 4R0SA 4OHLA 1PTYA 4R30A 1OHDA 3I36A 3QCGA 5M43A 5IBSA 4QAHA 1PA9A 2CJZA 3A5KA 2FHFA 2NZ6A 2H04A 2B49A 5K9WA 2R0BA 2F6YA 2NTAA 3M4UA 4ERCA 1SUGA 4KI9A 3D1HA 1D5RA 3D1QA 5KA7A 2F6WA 1OETA 1U24A 2CNHA 1XM2A 1ONZA 2CNIA 2F6TA 3SMEA 1NWLA 5KA2A 3SR9A 1C87A 2I6OA 3QCHA 3QCKA 4PVGA 2B4UA 2YA1A 1I57A 2VEVA 1OEVA 1XBOA 3ZM3A 2C46A 2QDMA 2FJMA 1L8KA 2YDUA 2CM7A 2Q47A 2OZ5A 2QBQA 4GE6A 3RGQA 2BV5A 4WTYA 4D3QA 2F6FA 3BM8A 4RHGA 2I6PA 2Y96A 4H1OA 2B4PA 5K22A 2H4KA 3MMJA 4GS0A 4NNDA 2I42A 4JMJA 5AWXA 1ECVA 2M3VA 3D42A 1ZCLA 2VEYA 4JNBA 5GTJA 1G1FA 4Y2EA 3AWGA 2ZMMA 3O3LA 1XXPA 3D1OA 4R0TA 2J43A 4HRFA 2AZRA 2CMBA 1Q6NA 1Q6TA 5KA4A 2Q05A 1OEUA
chains in the Genus database with same CATH superfamily
1T6VN 2I60H 1XQ4A 2PTUA 3MRJA 3LZLA 3MV9D 1FH5L 2XNAA 1GS7A 5C2BL 1DVXA 2DLHA 2VLJD 1EJ8A 3H1ZA 3PL6C 1YEEH 1I1RA 5ABZA 1IFRA 2ARJQ 4QRUA 5JW4Q 4JHUA 1BDYA 4DGUA 3QE5A 2QHLA 4AL8L 1KCSL 3NSCA 1JTTA 1QXKA 1WFIA 4Y4HD 4ZI4A 4D0DB 2J1WA 2OJZH 2PPFA 3NK4A 4D9LH 4GSQA 4R5VA 5EO0A 3RWHA 5C07B 5JW3H 5BS0D 5I1AA 4OGYL 2XBZA 4HWUA 2MIZA 3ZKXB 1XIWA 1UWGH 2DM2A 5BQ7B 2DQHL 3U79A 1MCEA 1MFMA 2VZUA 3MUHL 2A9DA 3TO4B 4PRIE 3NIDF 4ZTPH 3LKPB 4MA3A 4LOVA 3ZSSA 4AM0A 4PY7B 2WKLA 2CKBH 3MLSL 4NM4L 4CGTA 1P4UA 5IZ7A 1VEMA 2A6JA 3BSGA 4N2IA 4Y2LA 2XZCH 4BH7A 3OTTA 2FWUA 4M5ZH 4HA1A 4P5TA 5MENA 1FPZA 5ALBL 5DZNA 2X4RA 1I82A 3FB6A 1ETA1 1DBAL 4LASL 1UCTA 5DJZB 2QQLL 4ZPVB 2FUTA 4G72B 3ZKXC 3PJSB 4XMZA 2VJ0A 1JPFA 2OBGA 4J3OC 5TFSL 3UZEA 3ZDWA 3T3PF 1RZIB 3L3GB 4ZXBC 1TVDA 3FU3A 2XTJC 3WG7B 3GSXA 5JQ6L 2Y7QB 5HJ3A 4YAAA 3IDNA 5KA0A 1NWEA 4LVOB 4B3EA 4P5SA 1XGZA 2C1PB 7CGTA 4IDLA 3PS5A 2ZG2A 2Y9RT 2O5YL 5J6HA 1KCKA 4BWTA 2IXQB 4HU8A 3GMQA 3DVGA 4GFUA 1Y6MR 2EDRA 1CFQB 4JPWH 5BUAA 3E2HC 4F2FA 3QAQA 2ZUUA 4NN6C 2XV6B 1CGYA 1AO7A 1KTDB 2ZWKA 4GPVA 5FA4A 3RAJH 2FX8H 2CKBA 3BAWA 2ZKHL 1VFOA 3JTSB 1F97A 4HCIA 3ARFD 1TQTA 2G5RA 2MRYA 3KNBB 3C2AH 1NCDH 4PCTA 5DJ0A 5C09B 5KZCD 4E0RA 4PTUA 5HY9A 1PXHA 2WCSA 2NYZA 3M46A 4E41E 3LQZB 1NBYA 1EQWA 3OKMB 4M61B 4WJ5B 5D1QD 1ZA3A 1BD2B 3KH3A 4LNRB 5B38A 2KDGA 4HJPA 5GSVB 5MP6L 1BZ8A 2A9NH 3HMXH 4L5FL 4UT9H 1CD8A 4CN1A 4OLZL 1KB5H 1YJDH 3FSZA 5HVFB 3ZDZE 2LOEA 3ULAB 5D6CB 3OM3B 4ZMNA 3ULUC 3MZTA 4K94H 1FZOB 5HYQB 3MKGA 1Y07A 3MXWH 1MKFA 4XNUH 5JTWA 3WJMA 1UURA 2HWZH 5FGSA 1GGYA 4ZUVB 3QFJA 3QPXH 3WIIL 4Y5XB 4KKCC 3ZQWA 3VXUB 3K72B 4TLSA 1QI4A 3PWPB 2YD6A 5GSVA 1INQB 2X2JA 3L2LA 2ZUWA 4IMKC 1WFNA 3LY6A 4DPRA 3O8XA 1WZMA 4NQCB 2PW2B 2OYMA 2Y1OA 4TTDD 4GYBA 3AQYA 3UBHA 1BZJA 4PRPB 1ONQA 3IGLA 2X2YA 4LF3B 4N5UA 3QORA 3G6JA 1PZDA 4DVBB 2VDPH 3P4NB 5ESVB 2HMIC 1SOXA 5T3XE 1SM3H 2YSSA 3OVUB 4P5RA 2QTEA 2X2UA 4DPBX 4O51A 3DPDA 5I1AB 4FX5A 1HOCB 3OHXB 4EXKA 3QWOB 4RBPH 4TVPE 5C07A 4AGNA 4PJAE 3S5ZA 4RBPK 3IPFA 1ZDSA 2HKHL 3S3CB 2WGXA 2HT2D 2AEPH 1F56A 2QR0A 1FVCB 1L5GB 1MWAB 1CQKA 1NDGA 3LEYL 3GBNL 4RDQF 1PW3A 4IOFC 4R4FL 5EZOH 3E80A 3UTZB 4LZKA 5EEYA 2VM4A 4G3YH 3MC0A 5EBGA 5GZNA 1WK0A 2I4HA 5I0ZA 4W9IC 4DAGL 3EHBC 2OL3B 2IGFH 3H3BC 5E8EB 4G6AC 1RQ5A 1O5DT 3H9HA 1RI8A 3DRTB 5B7MA 2XJAA 1NCHA 1P7QA 3EO9H 5DJ2A 4L8SA 5C0DA 4JFQA 4TLTA 4R7VA 3FFCA 1NPNA 3THML 1RZKC 4KYRA 4UDTB 2DQCH 2XACC 3TPUB 2CUAA 4P04A 3QDGB 2DPKA 3FO0H 2J71A 1EX0A 3U46B 4Y4FB 4U31A 3RO1A 4KHXL 4PQXA 3U7WH 1QRKA 3BQUD 3KXFD 4OLEA 5HHMD 1TU2B 1JZHA 2AZUA 5DUBB 4U4IA 3ARDC 4LHUB 3QIBB 4NSKB 3G5ZB 3OXRA 2ZN7A 1FJ1A 1T66D 3DBXB 5KA1A 1JP5A 4PJXE 4CC4A 2ZPKL 2OTWA 3C5SA 1Z9MA 1QNZL 4D0CA 4DW2H 4MZ2A 1CUOA 3H9SA 3VXSB 1E30A 4A7QA 4AOFA 1C8QA 3MRRB 5L6YH 2CHNA 5FYKD 2AQ1A 1NGPH 4WU5B 1JNHA 4ZUWB 5IQ9A 2XV0A 4HCRL 1U93B 4JFVA 3BEVB 2VT0A 4PY7A 4Y4FC 2MNUA 4Z7VF 3S35X 1E4XL 1MWAL 1UUSA 3E8UH 3QUYC 1W7KA 3O3UN 4Z3HA 1QYGL 1MREH 1BYPA 2LLLA 4JQVC 4LAQL 2DM7A 2P45B 5DLMH 1CFTA 2WOYA 4QRQB 1JYVA 1RP8A 3S8WA 2RGSA 1C5BL 1SUJA 1NCWL 4P5TB 5D9SB 5MENB 1DQLL 3DMMD 1FFNA 2OLDA 4O2CB 4OIBA 3U36A 1DFBH 4HS6B 4U1GB 1ZVYA 2R29A 2YARA 3L3KB 4JFEA 1GMIA 4Z7NB 2DLEA 5T3ZE 4MD5A 3Q6GL 1U33A 4U3SA 1FL6A 3DO3A 3SKJL 5K9JL 1HH9B 5IJKA 1HQ4B 1ZLEA 1R5IB 1T5XA 2OMXA 4PRPE 3V0FA 1J8KA 4HBQA 2MCPL 3VXTB 3TCXA 4WU3A 5F9JB 3R0MA 5D72H 2NX5B 3QJZA 3RWEB 3PQYD 1YPZB 2I07A 4JJOA 4YHNA 2PR9A 3IDNB 1OP5K 2BWIA 3ZBMA 1J48A 3I9PA 4TRPL 1YEFH 5EOCL 3RFZC 2ZZUT 5C0AD 4LXFA 4GXVH 2AXWA 4M9OA 2A8BA 5KTEL 4YZFF 5JOPE 2VXQL 1ZTMA 4N8PA 5JNYA 1CG9B 4U1GC 2PN5A 1N8OE 1W72A 4QCIB 1K4DB 5LBSA 1YEJH 2WLIA 3WN5C 5B8CA 2ZXEB 3PWJB 2F70A 2HTLD 2IDFA 1M71B 3MRHA 4XP4H 2GEQA 4GS7B 3FHQA 4KKBD 3GI9H 3ZN6A 2BSRB 3X13A 4KMTH 3HC4H 4WV1B 3U1PA 2NY5C 2J73A 2IH1A 4Q97A 5KW9H 1PG7L 4JN1L 3QNXA 3NAAL 4N86A 4MAYC 2R29H 4XPFL 4OT1H 1VENA 4N0FA 1A5FL 3TGXA 4BUHA 1PTVA 1TSRA 4HBCH 1AGCB 3ZQ9A 5LNDA 2I4EA 3EBAA 3F9BA 1RMFH 4CILA 2Z35B 2VAAB 2DS4A 3V6FB 5AYQA 2DKMA 2QZQA 3L5HA 4HH9B 4JLRA 2Y69B 2ZAGA 1YA5A 4JKKA 3FQ1A 3ZYJA 3SDCA 3QCTH 4LLVB 4Z6AT 3GRWL 4P5KA 4R0SA 1W8EA 1KCRH 2YRZA 3H9ZA 2KH2B 3B34A 5DZVA 4AYGA 3G08B 1OHDA 4Z7AA 5E2VL 3K6IA 5EZOL 3WIAA 5CN1A 3RLSA 3WD5L 4L05A 3EW3B 2AJSH 4GSXA 5C9JB 1F4WL 4MBRA 4U6HA 3HE6A 2Y3NA 1XGYH 2ADFH 1EZLA 1QEWA 1IL1B 1MIML 1UOKA 4ELME 3OAYK 3B3IA 2NTAA 2XKNB 4N0YH 4M1DH 5ID1B 1FI8C 5CD3A 4ERCA 3TONA 2V2XB 4Q89A 3E3QE 4WW1B 5TQ0L 1FF5A 3CFBB 4UV7L 3JV4A 2YD5A 2Q76A 2VZOA 5E2JA 1SZNA 4JB9H 4BINA 1AIZA 1C08B 3VWJC 2PWDA 2NPLX 4E41A 1J5OL 3BXNB 4NUMA 1HIML 4XWOD 4LLVA 3VXPB 4GJTB 4Q9BA 3CE1A 4PJ8D 2H5UA 4XPFH 5HGDB 1TZGL 5J4MA 4F2MA 1Q9LA 4PJEA 1UEMA 3FUFA 4QTFA 4W6YB 1BLNA 3QEGH 2WLLA 2RA1A 2YQGA 2YPKA 3T0EC 5INDB 3QPQC 4MB4A 2QDMA 3F12B 5FF6B 5FDWA 1H8OA 5CZXD 1LMKA 3SDCD 5GGRB 3RVXD 4F8TA 1GJUA 3RGQA 4G9DB 1Q0YH 1WD8A 4WV1A 2BINA 5DDHA 5GZND 5F0MB 4ZBJA 4WW2B 3RIKA 2Y5QA 1E8WA 5DS8B 1E9OA 1FYTA 3I3EA 4MDRA 1KJMB 3D30A 2YIHA 4TOYL 1HCFX 1P6AB 1WBYA 1J5DA 3HUJB 1YQVH 3DSNB 3GSQA 4PV9B 1KZQA 2R39A 1XF5A 3RY6A 4TNVF 3CPLB 3UDWC 3D50A 3KPLA 2WQAA 2BSCA 3NSDA 4IOFD 3SIKA 1DL7L 4JNBA 5IKCB 4Y2NA 2Z4QA 1JDDA 1GYVA 4A63A 4JFTA 3ATAA 4MDJA 1CN4A 1EH9A 4OB5L 5DT1H 1XXPA 2ZMMA 1DQKA 3LXBA 4QO1B 3MLRH 3V4VA 3WFBL 4YSAA 4FQIH 1LNUB 4JM4L 3DO7B 2EJ1A 2EE9A 4DH2A 2B4CH 3P2DA 2CJSA 1VFMA 2QBWA 3UO8B 2BNUA 1B0GA 2FR4B 3H2WA 1WFMA 1VESA 2IAAC 4FFTA 5I66B 4IRZA 1T22B 1B3IA 5D9SA 2E9GA 3EYFA 4XWGH 4I9WD 3AAZB 3S34H 4J3UA 4CJ0A 3H9SD 5C0CD 1NCNA 4E42B 2IH1B 3VXPA 5GJSH 2EYTA 1P53A 2DTSA 3AG2B 1TETH 4OCNC 2CMAA 2FO1A 1ID5I 1X4YA 1TT6A 1X5MA 2HXPA 2O6FA 2JCCB 1G6RL 1JYNA 3GSWB 3BFWA 5IMKB 2DV6A 1XB6A 3STZB 2GFBB 4GB9A 2VDML 1OP3K 3PHOB 3QXAA 4XVSH 1E8ZA 3BSZL 5I17B 4P2AA 4QUNA 1URLA 4ODBD 3BOVA 5D7JC 4KDWA 4R26L 2VW6A 5ICXB 2GP0A 3L5IA 2X4PB 2XWXA 4HHAB 4RNRA 2AQNA 3VO0A 3EH2A 2H41A 2X44D 5F9JA 5KS9A 5AB2A 3NFNA 4Y1AD 1KIQB 3S88H 4JREC 5TPWL 5I24A 5BZDA 4ZTPL 3QFJD 1NBVH 3H4FA 1MHCA 1U2CA 4NUJA 5IVZA 4F7CB 5C07D 3V5HB 1SXBA 5B39G 2O61A 3G5VB 2FD6H 2ZOOA 3IAQA 3KJ6H 2HPTA 4YJZL 3QCJA 4PRDB 4O02L 3IYLW 1ZLVK 2C8NA 4UT6L 5BOZG 1JAEA 4B9FA 5FWRA 1NJ9B 2PETA 1ZMYA 1ZEAH 2PCPB 2DD8L 4A04A 1MRDL 3JUYA 2JSFA 2B1HL 2OYLA 1JZEA 1U93A 3LIZL 4A7VA 1ZOXA 5L8KB 4UINL 1YEEL 4JM2C 2V7NB 3OB8A 4XBMA 3N43F 4ONFL 2DWEB 3U9WA 1U92A 3FYEB 3MLWH 4M4RA 4X6FB 5T1KD 3IFLH 3RBSA 2CRZA 4JGMA 4FCAA 1VLXA 4NN7C 3RGOA 1J4XA 3TBYB 5GHWL 1QI5A 2VSDA 2GEEA 4RGOL 1P1VA 1CU4H 3VFPA 1RZGB 4DP8X 1TU2A 1OCRB 5CBAB 1JVLA 4KTDL 4I0PA 4JFXA 2B3IA 3CJJA 4POUB 1RH8A 4ZMWA 4BFBD 2YD8A 5IHUL 5KSAA 1RZ7H 2X1OA 3QWRD 3D8MA 1QUPA 1RL1A 5IK3A 1EEHA 4KI5C 2F1EA 2XPGA 3P0YH 2ADGB 2VDMB 2WV3A 4QOKD 1CL7L 4K5MA 4PJFA 5F7UA 1EAPB 1IBZA 1JPTL 1BZ9B 2DDQL 4JE0A 4GFXA 4QRSA 2YXWA 3JUZA 4BDVA 3AGWA 5ANHA 5E8EA 3RVTC 3RVVD 3ZL1A 1BFTA 1PKQE 1QPKA 4AC2A 1N9PA 3TEUA 3LKSB 2F8IA 4MMXA 1A9BB 3GUTA 4WEEA 5E9DD 2DYPA 1TENA 4K5OA 2VZSA 5IBMA 2QELA 1JERA 3HC4L 3IGAA 5DJDA 3DVFA 4PI0A 1Y1UA 1WAXA 43CAB 4KXBA 2ENJA 3S5YA 2AQQA 3D44A 3NH7H 2GSIB 5F89B 3IJEA 4ONFH 3WY2A 4YPJA 5AQ0A 1RIHH 4N87A 5BV7L 2F2HA 2PXYC 5D7KE 1Q6SA 2DWSA 2HWZL 1XMEB 5JDSA 5TD4A 3S35L 4WHYG 1B88A 3DX2A 3RB7A 1FRGH 5EOCJ 4MA8H 2GYSA 4APQC 3DVIA 3QUMA 1EK3A 5AW8B 5SX5H 2J8UF 4RI5A 5DMKB 3ABLB 2HG5B 4RGNB 3G5ZA 4C54A 1EHXA 5J5EA 4X6EA 1E4JA 1KXTA 1R17A 1WZLA 4JQIL 2PYEB 2EDLA 1ILSA 3RUGE 4NZUL 3MFGB 3NDYE 5E0FA 4KITB 2NY6D 1RJZB 2X87A 4JFED 4TTGA 3QFDB 4PREB 1QYGH 1N26A 1XGPB 2JFGA 1AZCA 2PXYB 3LKNB 1KPVB 4I85A 3HE7A 1GL4B 4RDDA 1UD3A 3ZV2A 4YUEH 1IGJB 1IMHC 3UGXA 4OCRL 2VXUL 4TSCH 3RB5A 3N91A 1CDJA 1BREA 3VFGL 1XCXA 1SXAA 3ARQA 2MNJB 1FN4B 5DTFA 1NH6A 1WAAA 1KC5H 3SDAD 5J6GB 1KCSH 2DQFB 4ZTEA 4XN9A 1JF6A 1HN1A 3CFCL 3LZOA 5ISZD 3PFQA 2P5EA 5HHXL 1UWYA 2LFGA 5DUML 5E9DA 3DK2A 1KZYA 1C1EH 1E0OB 3QJFA 4Y2DA 2P3YA 2FX7H 5F1NB 3FS9A 4JZNB 3DIDA 1GZHA 4JRFA 5KYUA 5C8JB 2OZ4L 4UIMA 1CLOL 1QHOA 3O8XC 1J0ZA 5C3IA 2WLMA 4M6NL 1DVTA 5EHPA 4JO1L 4Q9QL 5K9VA 3RTLA 2ORBH 4HEPG 2K7PA 3BD3A 5DFWH 5E9DE 1KELH 2EO9A 3HZKA 5AYUL 5KVFL 3VGBA 4JMXA 2QV2A 3QIBD 1EWHA 3BGMA 3SSGA 1FWXA 3D18A 2H0EA 2XTJD 3GUTB 1UB5A 1KN4H 3ESUF 5IQMA 4RFEA 4CADB 1BF8A 1I9EA 1N4XL 2M2DA 4CL7A 2UXTA 5FEBA 2WXLA 3FQTA 1QLRB 1KBKA 1EXHA 1BM3H 4OFQA 4DF9A 1CL7H 5IB1B 3C5XA 3MQIA 1UACH 4OD2B 1MHHB 2B5IB 2UZXA 3EJZD 1JZ2A 2R1WA 2XI9A 2HKFH 3KH4A 2WBXA 1A7QL 1H8LA 1AHWC 2H9GB 2D03H 2PO6D 2XQBL 5IB5B 2PF6A 1GZHC 2Q7AA 1D2OA 2BNQB 1GZPB 4RZCA 2R1YA 3B9EA 2VDLH 4MJ6A 4PRPA 1IAIM 3HN5A 5F6HJ 3WE6B 5BMFL 2Y2WA 3MV8B 4AGOA 3O2DA 5ERWA 3WKMH 4AVIA 1TR7A 2JI3A 1OP3H 1AR2A 2NT2A 3IDIA 2IAMC 5F97E 1Z32X 5EU5B 1MCIA 5D7LB 3V7AG 1OF2A 2R0LH 2IADB 3RKDC 3QKPA 4BZ1H 2X53A 5EC1B 4WF7A 1OGAA 1FRGL 4YHYB 3I9GH 4ZFFB 5TQ2L 1BFVH 2OI9B 4F92B 3A5VA 4MSWB 1QBMH 1VZGA 5MEQB 4Y4HC 1A4BA 1SEBA 1OCWL 3F64A 4WO4B 3WEMA 3N1GC 4ZG1A 4OLVL 4GAGL 5EBWB 3LEXA 4BGDA 2QVKA 4C56A 1G9MH 3QQ3A 3A21A 3T04D 2VABB 2IOMA 1G5AA 1OEMX 3S37H 4ZXBA 8FABA 2QPEB 1HHGB 4YLQT 4ZQTA 2VQ4A 4FQJL 4JGNA 2QQNH 3P4MA 1MJJA 4JM2A 5GS2H 4POYA 1PYNA 1YYMH 3HA0A 4KBPA 4PTTA 3W0WA 3KXFE 2AJUH 2F61A 1DJGA 2AJZA 3LPOA 3BGMB 1TCRB 3FRPA 3PQYB 4ODWA 1DQVA 2NOYA 2ADGA 1CBVH 3D2TA 5EU7E 2F5AL 4R26H 1YNLL 2UX6A 4JPVL 4P3CL 1FNAA 3S3DB 1CDIA 3AU1B 4NWUL 5D2LE 3SGEH 4A38A 3QEQE 4XBPA 1M05B 2P46B 3QZWB 1LE9B 5BO0D 3ECWA 4HGKC 4JDEB 1ECYA 3BMWA 1HXYA 4PWHA 2NQDA 4YBLC 1PLGH 3RL1A 1KTBA 1R3KA 1YEDA 3IKKA 2VAJA 2XNAB 4N8CH 2RIKA 4Q58C 2CJUL 2W81C 3T4YA 3QJXA 1DE4A 5FW7A 1AZBA 1CZ8H 1IEAA 3MRJB 5AD0A 3KL5A 2GPZA 4RESB 1OGAD 4IM8A 3LQZA 2ITFA 2VLJA 3AG3B 4HJ1A 1UM4L 4JBCA 1OCOB 5F89A 4B9JA 1MI5E 3K4ZA 4UF7C 3S34L 2QDPA 3OL2A 4MAYD 4MKMA 3PJSA 3PAUA 4JFFB 2XYCA 5JOEA 1CICB 2EDBA 2UUOA 2PCFB 5BV7B 3K71A 4DGPA 5AAMA 3UMTA 4B41A 4DK5A 3JTSA 3V4LA 1G7PA 1IEBB 2CIIA 2QCTA 3W5MA 4KFMA 4Z7WF 2VL5B 1MRCH 1AJ7H 3VXSD 4KJWD 4PMFA 3ZDZB 3A6BH 1CFQA 4R5XA 4M6OH 2BIIA 2ZNWA 2C4XA 4U1SB 3BUYB 1IJ9A 5T1DL 1PFCA 1HEHC 3HKFA 4LKCB 5JYLA 4GO8A 2CBMA 3HRPA 1GGUA 4RH4A 4FHKA 1T4KA 2P48B 3BYTA 1QG3A 1KTLB 4NKMA 5JPNB 3UZVA 5B1KA 4EDXB 2IMMA 4PRBA 3RIAF 5BQ7A 5KAQF 5DUJA 3IMBA 3ISRA 4YLCA 2F6AA 2NZ6A 3QFGA 4F93B 2YBRB 4TNFA 1U91A 5FYLH 4H26A 3TP4A 5CCKH 4FFVD 4OJFH 1M6OA 2HG0A 3VJ6B 4JN2B 5I28A 5L7XH 3TESA 4PGBB 5DJZA 2WSPA 1MZYA 3VFTA 4M9PA 3NPSB 2WXMA 3MA9H 3TVMA 5I1GH 5HHOE 1CJYA 4S1QH 2BS8A 5IW1B 2VWEC 3QHZL 5B1JC 2HFTA 4P4RB 1E8YA 1M3JA 3NZ8A 3GS0A 4S0SD 5IMKA 4JJHA 1RERA 1MRDH 4L37B 4JPIA 5HI5D 4MA1C 4M5ZL 4MCYB 3ZT5A 5I8EA 3NJGA 1O6SB 3LRGA 5HHOA 2IIJA 3SDXA 2Z93A 4PP1D 2QDVA 1NFDB 4FLSA 3WN5B 2OTPA 2VDQB 1JK9B 1ZA6A 3HFFA 3ZK0A 2NSQA 5F7YC 4PWEA 5FDYA 4B95C 4FOMA 4XXCC 5CIPB 1UGNA 3AROA 3ULUD 3V8OA 1LO3L 3U1SL 3L5XH 1T1XB 5I1CL 3FUHA 5E70A 3SB3A 4ZX6A 1D7DA 2D31B 3WLWD 1LK2B 2ITDA 1B4JH 5KBKA 3OKDA 3HHMA 4JRLA 5FM5O 1T5KA 3WY1A 4PJ9C 2JXMB 4OJDH 1HH6A 4XVUD 1JF1B 1N3NA 2M3VA 1FV1B 3OKEA 3FUKA 2CJ3A 3MFFB 3LVTA 1YMME 2XFGB 3QWRA 5EG6C 3Q2VA 3AT9A 1MNUL 2KBGA 4FZEL 5C9JA 2KHAA 5ETUB 3RTQB 2OTUA 4L9LA 1QZNA 4AV4A 3D1OA 5KG9B 3O6KL 2RH0A 1OARL 3ZR5A 5DHVH 4QWWD 4N9GA 2NYKA 1ODAA 2HN7B 2CDFA 3UYOD 3UC0L 4MD0B 2WINB 4DGIH 4EVNA 1G0DA 1ZXKA 5E9AA 4LOUD 3I2CH 1AQHA 2AJUL 4HIEA 5DZLA 4YHPB 3HR5A 4H34A 1X5AA 2VUOA 4PM1A 1AHMA 1G4US 3OXSB 4H20L 1WDAA 5FUZL 5G4MA 2FLMA 5E9NA 1AGCA 2VM9A 3SDAB 5GXBB 2H03A 1F8TL 5SWSA 2XWZA 3JYBA 4LU5H 4L3ED 3C5ZD 1A3RL 4PJEB 3G6JF 4E5XB 1IC0A 4NQSA 4DK3A 1BVKB 4KDVA 5EIVA 3DDFA 3L5WA 1OW0A 3IEAA 5CNHA 4G1EA 4OSUL 1JGIA 5EEWA 3K74B 1SPDA 1VKXA 3GXUB 4NZUH 5HVHC 2DWDA 2JKNA 1P9MC 3A5JA 5CLWA 1G7LA 3C2SA 1MUJB 2L04A 3TFBA 3UBXB 1BAFH 4JFSA 2A77L 2EDMA 1ZK9A 3RGHA 4AITA 3CXHK 3I9AA 3CUPB 4I7ZC 1D3CA 1E9OB 4D0BB 1CPUA 3AMKA 2D7PA 2JKJA 3WCYA 4RETB 5C07E 1A66A 4JM2F 1PH0A 1T83C 5AENA 1NUDA 1GC1H 4HAKA 3ZL8A 3I7ZA 2XQYA 4R0LA 2Z34A 4JRYE 2JKTM 1QA9A 4WFGE 1C7TA 3H54A 4N2GA 4X5WB 4N2CA 5C0FA 3BQUB 5E7FA 3OB0K 1TVBB 5HD8C 3OKDB 4QF1A 3CSYB 5B1JA 3O3DA 3MRGA 3ALWA 1EBAA 2OSXA 1I9IH 4HW6A 1OXYA 2CCLA 5KYXB 1Z9NA 4P46A 3V4PH 1JXKA 3SKNB 1GW0A 5E6ZA 3BFQG 2NNRA 4JO2L 1KIUB 1FFNB 1PLBA 4PEEA 1IEHA 1XCWA 3GS7A 4NZRL 3RUGB 1YYCA 4LRIA 1REIA 2FEJA 1I9JL 5EOTB 4RFNC 4F9LA 2HN7A 1BAWA 3SDXB 3KYOA 3IDMA 3EDFA 2BIJA 3KLSA 5DYOB 1JDCA 1CGXA 5FGCE 1TOXA 3QSKB 4NM8L 2QPFA 4N9GB 2NDGA 2I6IA 3EYOA 4MGXA 2Q8AL 5TJWK 3IETA 4JRWA 4X5XB 3UTTE 4Z78A 4OGAC 3LRMA 2BVUA 1BD2E 2V2WA 2YAQA 2EYSB 5DHYA 2BHZA 4TVPH 3U9PL 4Z3JA 4GRZA 4UIKH 2WUBL 1LVEA 3T1FB 3D05A 4KRLB 2Y2YA 3QR2A 1DVFA 3U4BL 3T8MA 1WP6A 1QUNA 2VR6A 2ERJB 3OXRB 4AUUA 1JGEA 3HRZA 4E5XG 4HGWB 2TSAA 5J9PA 5DUBA 1VFAB 2AKRA 4UZUA 5EZLA 2YGNA 4TVPD 5CUSL 4AQAB 4AYID 3AADB 3G08A 2D31A 1S7SA 3EH1A 4FQQA 4JDVA 3NJJA 3CFMA 3GM8A 3LQAL 2A73B 4LSDA 1GGCL 2NY5H 1WGOA 3UYPA 2FHCA 1RJYB 1A6PA 4OW6A 5HGBB 3VMNA 1EAJA 3DTXA 2DEYX 2A74A 2F7QA 4PRNB 4QDGA 2F08A 4LOFA 5I16B 2AGJH 1UWGL 5DA0B 3F00A 5B8CC 2NXYC 4PRPD 5JHLH 2FIKA 4NFCA 4XAWL 5ADOH 2VDQH 3NCFB 2ARJA 1C83A 1SDDB 4FXKC 5EHRA 3KGTA 1INEH 3ATBA 3ABZA 2AABH 3AW5A 3P54A 3ULUF 3U96A 1YY9C 4M5TA 2D0HA 3CZFA 5F9WC 5D4HA 3U9UA 5IW1A 4DN3L 3G5YB 3CBRA 4U6HB 1R33A 3ROLA 2N4IA 1MFNA 1MFCH 4GBXC 2AI0H 4N0CD 1RIHL 5IM7B 5E2UH 4DESA 5BV7H 1OHEA 4BUBA 1CDUA 1YAZA 2AP2A 1MFBH 1UJ3B 3WNLA 1B0IA 4NCC1 1F4XL 1W72B 4QCIA 1L5GA 2BP8B 2V5MA 4PS7A 2VLMD 5B8CB 2CA4A 1PZCA 2BVYA 2G5BA 4G8AC 3DPBB 4LSQH 3RPIA 3FO0L 4FXKB 5LNEA 1EXUB 3JSSA 4HUVB 1OSZB 1G7LB 4D9RD 3EOTL 3PP3K 2NXZC 2DLIA 4NKMB 2NYYD 3ZIYA 1OZTG 1MFDL 2AEIT 2HAZA 1V3KA 1QEXA 1AZNA 4KKCD 4TQPA 4XT1C 1ETJA 3KLHC 1JNJA 3QA3B 1U4FA 1B9ZA 4KDTC 5IOPA 1H5BC 3BN3B 3QNXB 1MCJA 3IXAA 1ZLWK 1KFAL 2HVJA 2WO4A 2XZCL 2EH8H 4F5CE 4J3SA 3BDXA 5C0BA 2WJ5A 3T65B 3BZFB 4QDIA 2A9CA 4GAFB 2LLGA 4JEGB 3OMZA 2XG4B 3ZZSA 1UUNA 2OA9A 5KA3A 1BQUA 3FFOA 4IRJB 4WQOA 4P2OC 5DJXA 3DROA 3UMNA 3LD8B 4GG6A 1D5IH 5HYJA 4RLDA 1SOKA 5EF2A 3LNDA 1MCOH 2K78A 3VWKC 2P7TA 1N19A 2J16A 5IIEA 5KSVA 2D4DA 3LEVL 4P2QE 3MRRA 5DEGB 4UQ2A 5H4YA 4PSPA 3GWJA 2XRAL 1YVLA 2J17A 1A9VA 3NQIA 3NESA 4L5FE 4MS8D 3VFRA 4K9EC 5LCVL 1M05A 2AM1A 1CVRA 2Q10A 4JDEA 3I6LD 1B9KA 3EGDB 4F7TB 3QIBA 1KBGL 1R75A 3GXHA 2HJFA 2MCG1 1Z9SA 2W1NA 5IB2B 2H1PL 1RSYA 4HJGB 4X7TA 4JO2H 2L7UA 1JFQL 5F7MC 5IEHB 4HFWA 4N8VA 1LQFA 5JW5A 1D6VL 3N3EA 1TSHA 5E5MA 4LCYB 4JKPH 1OP9A 3EGXB 1EUUA 2CBTA 5GRZA 3A4EA 1YG9A 3H8NA 5F96L 4JANB 4KRPD 4F33B 5EV7A 3FQNA 1KBBA 3GJEA 4Z0XA 3O4TA 1Z9PA 4NUGH 2EEXA 4GRWF 5B7EA 5T1DH 3TJHD 1NMCB 3OAYH 5JPMB 2Y25A 4GXUM 3QYNA 2P80A 1E6OL 4PRHE 5FOBA 3HHRB 3B2MA 3MLTB 2R9HC 4DP2X 1F6AB 3SCMA 3LIZA 2DMHA 4PLKC 5GGVY 1S3KL 4BUCA 3B7SA 2PTTB 1NGYA 3SBWC 5I1DB 4KJPD 3M86A 5DQDL 4XXDB 1HHKA 1CD1B 4TQIA 1IGFL 2A6KA 3EBIA 3VSVA 4OQTL 1HTYA 1NEZB 4LL1A 5I73B 2GJ6A 2NY2C 2HKHH 4KZDH 3RHWK 3MJ9L 4IKJA 4OAWA 2AZAA 1CD1A 4OZIB 1GY2A 1F58L 1NDMA 1HWWA 2XIBA 4W93A 2E27L 1NMCC 2OMWA 3O3EB 3LRSB 1A0QH 1KBPA 4P9ML 4V1DE 2WZ0A 1SLXA 3WTXA 4KAQH 2ADYA 1M3GA 4OKVB 4OF3A 1R3HB 1I8IA 1X7SA 2RJMA 3DV6B 3W9DA 1KPUA 4PP2B 3O3BB 3RDTB 4A67A 1DQJA 4L1SA 4WWKC 5ACLA 4KI1A 2CSPA 1FNEA 1NCTA 1YPZE 4K8RH 3EYSL 4MMYA 4LKCA 3QCVH 4WW2F 2BZDA 4YFLF 1WEJH 3SOBH 2J88H 3CQFA 3V0AC 5AL0A 1HILA 1SJMA 2F9BT 4GAYA 4LPTA 1T49A 2A9ML 2GTZB 2E6JA 4KI5D 1A2YA 5D1XC 4OZIA 4OZGA 2FO4B 2Y7NA 3I2CL 4U7KA 1M7XA 4LKXB 1AY1H 2B5IC 3LXAA 5JOPD 2NUPA 2DLTA 5I6NA 4KK6C 4ZOBA 1HXMA 1PY0A 1U30A 4BXSV 1NFKA 1ACYL 4G80B 4AQEB 5KYUB 1FSKC 2DQTL 2NW2B 4WY7L 1L0YA 3CLEL 2KI6A 2AJYL 2VUYA 3CZKA 4UT6A 4UCFA 5DR5L 3LS4H 5I18H 4DCQB 2UVFA 1Q72H 5HSFA 4X8CA 1E5ZA 3POCA 4XNBA 1DN2A 1TO4A 1IM3A 1S5IL 3KM1A 4JFEE 5CFHA 1ZTXH 4MXWH 2ED6A 1ZCRA 3B6SB 4NNYA 3LRKA 1V55B 5EUOB 2MQCA 3PJLA 1GGBH 2DQGL 2DBLH 5HI4D 4N0UE 1PA9A 2Y23A 2CJZA 2EABA 4IBZA 5K33A 2Q3ZA 1KPVA 5F71A 2NZIA 2LU7A 4PJ9D 5BXFB 4GP4B 2OMBA 4PWGA 4QHMB 4UUJA 1XB8A 4JUSA 2BFGA 1KJ2A 1PCSA 4NQEB 3NN8B 4JQXC 4WO4C 4HKXA 4AG4L 2VLKE 1U8MB 3N85H 1I8IB 1OAZL 2XWJB 1FLTX 2PYEA 3QAZB 3KXFA 4ODSH 5IROA 4J5VA 2GHWB 3N06B 4G1MA 2E4FA 3I6KA 3L6FB 4NNPH 3U25A 1PDKB 1CXEA 1OAKL 4QWWC 1WLHA 4DFIA 1YZZA 4TQ8A 4JG0H 2AMUA 4NZTL 2XWEA 1V54B 5T1LD 5T1JA 1E9QB 4JQXA 4AIZA 2YEVB 1GSMA 1E4WL 3C60C 3BDBA 3MGOB 5CP3A 3IGAB 4KH9A 4KJYA 3CFKA 1PAMA 1OGAB 1LK3L 7FABL 1BZDA 5ITFA 3F58H 4OCXL 4WWNA 5FOBB 4OV6F 4YGAB 4MMZC 3T2NL 2QBQA 3MCKB 5AKSA 4AEIL 3A6OA 1GZQA 5D2NC 4D3QA 3KYMB 1E3XA 4XTRD 3CFJA 1AGFB 4YEFA 4K3JH 2NNFA 1NCBH 3L7FA 4HFUH 4RHGA 3Q9PA 4PJGE 1J88A 4OIFA 4PU2A 3G5VA 3QCVL 5IK3B 4U3CA 4Y4FD 1MW1A 3L4WA 5EIIG 2C1OA 3TYGH 1Y7VA 1KYDA 5CSZB 1A9EB 3BT2H 4AQ1B 1OP4A 3MUJA 2I42A 2CLZB 3GI8L 4PGZA 4FXKA 1X9QA 2VXTL 5GTJA 2WIMA 4JCWA 2WLHA 2ZUXA 4ZMPA 1NICA 3CVHL 1I3GL 1HZKA 3AWGA 3KJ4C 4JFYA 3K4DA 4PJIE 5EO1A 2EIJB 4GRMA 2M8XA 3IGUA 4EPSA 2KZKA 1PFOA 4GRWE 5D1ZC 5GRJL 4KKPA 4MXVE 1LQBC 1UZ8B 1Q6NA 3CZUB 4KJWC 1OAYH 3R4RA 4FLHA 5L2KE 4JFHE 1FFPB 3S3SA 3MRLA 1CTNA 2Y1VA 5DD3L 1F4YL 2K6YA 3K6SA 4WEBL 2VJXA 4Y2DB 3I02B 5KSBE 1UADC 1LO2L 2COVD 5MI0C 1ONYA 2X89A 2E75C 4R7NB 3SDDB 2I3UA 4BPCA 3UX9B 3JTBA 1XWVA 2Q6WB 4OT1L 4ZAKC 1ZC0A 2PR4H 2WWMC 3IKCB 3L1EA 4U33A 1Q9LB 1PLAA 2H3XC 4GQ9H 4K2UH 1LO0L 1W15A 2DL9A 5AL8A 3MCLH 3O3AB 1G7IA 3T4AB 4YHKL 3QISA 3GXFA 5SWSD 1TZGH 1ZSHA 3SDXE 1A1NA 5KBDA 3EB1A 3ZZLA 3C8KB 5EN2A 1BQHG 1U4EA 4KXCA 3UTOA 4GG6E 4Y2DD 4WSGA 3KVPA 4NS0A 3B5HA 2ICCA 2JIXA 4GMTH 4JFDD 1F4AA 3BVVA 5HHQB 2BCKB 2CLRB 3SDDC 2LQRA 3SD2A 1Z9SB 1QRNB 2P5WB 3VG0H 5CN3A 1E8XA 1J5IA 4GW4B 2B1OA 3P3YA 2AMGA 1TZOA 1XH1A 3ETBJ 2P49B 4Y19B 3GO1L 4PP1C 3ARGD 5JHBA 3JWNG 1LILA 1YJDL 4URTB 1L8GA 1AO7D 5HDRA 5GS0H 1H9DA 1W0WB 2WNWA 3ZTNL 2V9TA 3AXLA 3IDGB 2MCPH 1L0PA 4XOCA 2XY1A 1R5WA 4R0LC 5HDLA 4RZKA 4QHKI 3RGVD 3V7AE 3ZDXE 2XTLA 5DJAB 2AQ2A 2QLVB 3NCJH 1MI5D 2VLKB 2J72A 1E6OH 5A40E 2V3FA 4ETYA 2GJTA 3KPSB 5ISZB 3MO1A 3C08H 2W38A 1URIA 4JO4L 4X5LA 4CSTA 4UQBA 3WDHA 2BPBA 4PRNA 4QXUH 4XN4A 5IB3B 2WXNA 1BD2D 4PJAF 3DO7A 2CNGA 1ED3B 2F71A 1L0XA 3A67H 32C2A 2X4OA 1RLWA 1JV5B 3BYYA 4UWQB 1CLVA 2SODB 1RK0B 1MJUL 3QRGH 4OF0A 2EXYD 3QH3A 1MELA 5FGBA 1A3QA 4KKLD 2VXSL 3QWQB 2DQUH 1QTYT 2X41A 5BVPH 1IAOB 1HEZB 3ZMPA 4UZGA 4LPYA 4WFFE 3FFCE 4LPXA 1BIHA 5BO1L 1U0QA 3U48A 2JI2A 4JO3H 5CKAA 3IPEA 1KY7A 3ZUNC 5CFAA 2ETWA 1HEZA 3OKOB 4UV4H 1R5VB 3KS0J 4Y4KD 2XPCA 2I60L 3TVMD 2WNXA 2ZXGA 5J11C 2AQPA 3TA3A 4UMGA 1Q94A 5C0BE 4RIRB 2OMZB 1JNLH 2E6QA 3QEQA 3VGAB 5HYJD 1R0AH 4XVSL 4FEIA 3KHQA 3LZFH 1ZJBA 1L9TA 2IFFH 2XXCB 4XNXH 5AVYB 3UJJH 3APFA 5GGSY 3KS0H 1PD6A 2XA3A 3FTVA 2I7OA 1M9WA 4BCXA 5HHXH 4XCCL 1F0LA 4PJXA 1U3HB 1R5IA 1OE2A 1T5XB 2PYED 3CFTA 3OJ2C 4M03A 4G7VL 1I3RB 3WNJA 1EENA 3O8XD 1OPGH 3NCMA 4MD5B 4U3SB 1AH1A 3B7YA 5E8DH 3VI3F 1IGTA 3NQKA 4X8JB 3U0PA 4HXBL 2OCCB 4L9LC 3QNYA 4DQOL 1WAPA 1R5WB 1KLFA 1DUYB 1Z3GL 1I3UA 5BZZA 3FT2B 3SPGA 2C9AA 4X4XA 4NZJA 5L2KB 3II3A 4X5QA 4BM7A 3D39E 3PWVB 4JB9L 2V5SA 4Y1TA 5D5ME 5J56B 3SGKC 1NC2D 4WI2A 4UT7H 3WI9A 1KJ3H 1Z7JA 1M2VB 4Y19D 1U8HB 3MUGA 2ICEB 5FUCC 3WDJA 5CEZH 4AX3A 3HBGA 4MAYA 1N8ZA 2F1AA 1F90H 3MRDB 2O5XH 3ARBD 1XF2B 3O6ML 2WOBA 4X6CB 4F58H 4F8NA 5KACA 2V37A 1OEZW 4F27A 3NCBB 1WCBB 3ZTNH 5T8IA 1NZRA 4PJ7F 4PGBA 3BPNC 5DRXA 2BNRB 4UQIM 1Q9WA 4RFNB 5AUMA 4APXB 3PL6D 4M8VA 3GSVA 3OKKA 4Y4FA 5AZ2H 4CAGA 5FO8A 4P3CH 3O45B 1EZUA 1JZGA 1MDTA 5F0LB 5B3JF 2WVSA 2BS9A 3QZMA 4UDTA 3U6XA 4HH9A 1QMUA 3FO2B 4JLRB 5JR1L 4QNPF 2QSCH 4OGQC 4F3FB 1IAIH 3T09A 2EE0A 4Q7DA 1NPUA 5E6IC 1IM9B 1UB6B 4JPWL 3IFNL 2GIYA 5FYJE 4BSWA 3HG1D 4MCYA 1OCWH 3ETBF 4N6QA 4U1MA 4A2LA 5A6LA 2W91A 5DRWB 5GISL 3HNTH 4G2AA 3BISA 3P0VH 4OZ4B 4Q4IA 3ML9A 4RQQB 5D93B 5HDQH 1BBDH 4MQSB 4DKFL 2R69H 2AXGA 3Q13A 1FFPA 2ID5A 3FQWA 4M56A 1P2CA 3S3PA 4HOMA 3Q6FA 3QCIA 4OHIA 5HDEA 2AJ3B 2D3JA 1GPOL 2ENSA 3JXAA 3F99A 5ENWB 1XZWA 3QEHA 3UZQB 3FB8B 5CEZL 2YA2A 3BAEH 4P3DB 1PU0A 3V0HA 3DUUA 5CCJA 4JY6A 3T4YB 5AD0B 4HUUA 1DN0A 3VI4E 4J23A 1JF1A 3G3LA 1RLBA 5LDUA 1QRNA 2P5WA 3O2WL 2WXKA 3HI6L 1FZMB 3RWIA 1H6TA 2WJPA 5GJTL 2NXYD 5LGYA 5BNXD 4Z7WB 1HWGB 3BWZA 5I19H 1T0PB 1DQML 1NO6A 3LH2H 3MUGB 3V2AR 3VFNA 5K59F 3SE4A 4I89A 1CYWA 4QTHB 5M95B 4PJFF 4J4PD 3MBWA 1K6QL 4ENZA 2HC1A 4K3EL 5AAMC 3RQ3A 3UTTB 1IBFA 1KTCA 4DVBA 3PWVA 4NQDA 1NAKH 3QORB 1T1YA 2QSQA 1HSAB 3F41A 4G59C 2X0VA 5HGGS 1JBVA 4OLYH 3ULVD 1IEBA 2CIIB 2DDQH 2NY6B 1PJ9A 1P5VB 4JFEB 3R1GL 4PV8B 4WHCA 4XNAA 5DZOA 5LQBL 4GFVA 1MFAL 5EA0H 4NO0A 2BOCA 3VAEA 3OXSA 3GM0A 3NFSL 1TQVA 1ZE3H 4MA7H 3X12B 4QI3A 8FABB 2J4WL 3RVXC 1J1XH 4OCXH 3OKNB 4K7PL 1RK7A 5F7DA 2VCOA 2CGZA 4I3RL 4BZYA 3ZM0A 5BX1A 5FO8B 2IALA 2CGRH 1I3RA 4GAJH 4QGYA 1SRDA 3I75B 3TBVB 3TU6A 2NZ9C 1XX9C 2ICWB 1U3HA 3OJVC 4YSRA 2ZOTA 2YD9A 1X7TA 1CXLA 3QORC 3HI5H 2YKLL 4LLDB 1TNNA 3RL1B 1YO4A 2AVFA 4LO9A 4D9QE 3W9EB 5I1KL 1ACYH 4Z0BH 3RWDA 4TUOB 4FAAB 1G7JA 2CAKA 5JW4R 1FDLH 2J5LC 1FV1A 2KYIA 2VEUA 1VERA 3O41B 4XPBH 3MNZA 4L4TA 1I7ZB 5JOFB 4PJ7E 3VFSB 4WJ5A 5B38B 2GK0A 2MOVA 2OUDA 1U3NA 4W9HC 4JKWA 5FV2A 3QDGA 4JQIA 1UASA 2HRPL 2CM5A 4L3EA 2GT9B 5G2NA 2PMZA 5JQHC 3HPJB 1CK0H 3FH8A 5IREA 1M3IA 4JR9H 4HOZA 3TCLB 4KTGA 3SDCB 1JHTB 1FLRL 1HKLH 4AYFA 1BIIA 5IB5A 5E94A 1Q6JA 1UACL 3QQ3B 1LLAA 1HIMH 2PCXA 4M00A 3S2AA 5DMGD 5HDBB 1KN2L 1A6ZB 3L54A 2RD0A 1HNGA 3VGFA 1IBDA 3HE6D 1IUZA 4S0GA 3QCUL 1K72A 5AVTB 2J2ZB 4O2EB 3WIHA 1F3RB 1L6PA 3WV0A 3GZPA 3ZTJG 4A2EA 4Z3TA 4MQXD 5KSBA 2XWRA 3CSGA 3QYMA 3X3GH 2HX8A 3WJLA 4JO1H 5D4IA 4Q9QH 5DJAA 4CMHC 4M5YL 2H4EA 3X1GA 4D3PA 2Z8SA 5KA8A 2I9TB 2FAUA 3NRQA 3T0WA 4G7RB 1IJNA 1ZY9A 2BERA 2VERN 3S8GB 4R7DB 4L4JA 3LS4L 4OHLA 5DF0A 4FQHA 1DEEB 3TO4C 3OR6B 1L6XA 4DVRL 5I1DA 4HF5L 2EIDA 1PTZA 3PJNA 3O0RL 1A65A 2B16A 2NY3D 3MOBH 1HNFA 1JE6A 3QC5X 5JXEA 4Z7NE 3TVMC 4LSUH 5DWUH 3ZT7A 2R0BA 4GQPH 3BPCB 3IU3A 2VC2L 4FXGC 4EI6A 4EI5B 3OKMA 2X3BA 4M61A 3GDBA 1FVDB 1K8IB 3OPZH 4HKJB 1FL3B 3L1OL 1SYVA 4PD4K 2YN5A 5KJ7E 3QR1A 4PJ9A 3P9WB 1RHHB 4P2RA 3FQRA 3QRFM 4QRRD 2EXYC 1ETZA 5MEOB 3E9TA 4F91B 3WFBH 2A6DA 4DIXA 3PV6B 3OC8A 2XTJB 4UZSA 4PJIF 3UO1L 2BRRL 2ATKA 1DLHB 2D7MA 1KSRA 2X4SB 1C87A 1IQWL 4Q9RL 3QCHA 4A2GA 4BZ2H 3QFJB 3RWCB 3OQ3B 5A16A 2BP5M 4HCGA 6FABL 5KEZA 5CILL 2FATL 2BWQA 3QHFL 4PJ5B 2G0LA 4PCSA 4HS3B 5IVXA 3DV4A 4K23H 1A0QL 5F9OL 2FJMA 2PPDA 1XD1A 3O2VH 2QSVA 5F7AA 2PTTA 3Q44A 3SZKC 5IHZB 3VI3E 2AVGA 4AIXA 1IRAY 1RHFA 2VN3A 3H0TB 4H8PA 4WK0B 3BWUC 1C16A 1XCQB 4PRHD 2E59A 5DQJB 1NINA 5L2KD 1YNTF 1AD0B 2XG5A 3L2NA 2CJUH 3G5XA 4G11A 5C0AA 4MVBC 5CU9A 4YDJB 4BXVA 2WXPA 2V7HA 4KRPB 5MEOA 2RQEA 5DZAA 4AIOA 3DLQR 1NGXB 5HGAA 1NCBL 4LCYA 3S96A 1VCBC 2PXYD 3Q3GB 3D25A 2WWKO 1CBVL 4HEPA 1XIWD 4HDIB 3ILEA 1RPUA 1OAQL 1D7BA 1LO0H 3TPUA 3DV6A 4Y2EA 2QT6A 2AK1H 2R83A 4LCCC 4MB3A 5G4OA 1PAZA 1X5XA 3ILQD 3KR3L 1DQIA 4RWYH 2AZRA 3D4YA 2HTKC 2J8UE 3UCRA 4B60A 5ACMA 4A7TA 2VERA 3TA3D 2PWEA 3BEWB 4Z76B 4ZFZB 5KA4A 1OARH 1KPRA 1OEUA 3V6OA 1AXSB 5GRVL 4M1CC 3JWOL 5HYJB 3CWEA 4ONGL 2YEZB 4GI9A 4XN1A 3RNQB 3QO0B 3HOGA 1CZ8L 3VG9C 2QVFB 4Z3IA 3C9NA 4KVCH 1OSPH 3O4LE 1GKOA 2UVEA 4V33A 4ZPVA 1YEGH 4HXAL 2OL3H 4UILL 4ZD3H 2MKWA 3IK2A 4O2EA 4K9EH 2UWEA 5AB0A 1WEJL 4CU8A 5AKTA 4BDVB 2G9HB 3K1KC 3MCYA 3DHMA 4QRSB 4MCMA 4CVMA 3NJIA 4ZMOA 1QSFE 5D1ZD 3QWOA 4DFHA 5C0EB 2EKJA 3N85L 3M7OA 4L5FH 1GIGH 2WPGA 4PJEE 1TFPA 2N59A 5DZPA 3OBAA 3ZYIA 4PCKA 1CLZL 4PS8A 5EFIB 4G7VH 2VISB 4L3EB 2NY1C 3H56A 4LIQE 4CRPA 2W0LA 5E4AA 1UQSB 1I7RA 1EO7A 1FZKA 3BPCA 1MFVA 2D3VA 3IU3B 4NRXA 1GSKA 3SDYH 5CZXC 2NY4C 4DP7X 5BRZB 5CBAA 1COBA 4OI8A 5IFAL 2GBTA 1C5BH 4GIPD 3S96B 1G0YR 4MMXC 3HUJE 3NEEA 5IBUB 4G82A 2X6CA 1I31A 1FCGA 2E76C 2GTWB 5DMKA 3SBPA 2O30A 1I9RH 3EHBB 4LCIH 3ARBA 1DVFB 4N0UB 3IE4A 1N5YH 4ZDHB 5JYMA 4TSAL 4XTRC 4DEPB 1SJHA 4RGMC 5DS2A 3WTSA 4UQ2B 5BUGA 1NGPL 3MA9L 2J16B 4P2QA 1U8PA 2LT9A 4OLWL 5D5MB 1CF8H 3KPRA 3G5WA 1YN6A 1RZFL 1TZHA 4M93B 5LUMA 3WS6C 2ZCKL 4LBEB 1H5BA 3B8SA 1NJ9A 2R69L 3KYNA 5D6CA 2B0SH 5DURB 5JXEC 3LKSA 4MMXB 3L3DB 3KJ4B 5K9KA 2O26U 2A74B 4HVBA 4FQ1L 4NUJB 3W81A 3SO3C 4YZWA 4PRIA 3KWUA 1G7FA 3L17A 1A4KA 1S7TA 1VCAA 3MLYH 2P1YA 3QUXD 5F88A 4ACTA 1NBZA 1UXSA 2UZPA 3S9DB 2BOBB 3LQAC 1MN4A 1XSIA 5D7JA 5E5MB 5BRPA 1VPOH 3UIYA 3WHE0 3ZUCA 3VFNB 4I9WE 4H5SB 4HFWB 4N8VB 5CM1A 5I19L 4L8CA 3LHAA 4OD1L 1KUMA 4D8PA 4C55A 3ZKND 3RJOA 3O4OC 2WWOA 1ZANL 4ANUA 1A8JH 1I7ZA 5LN8A 1ZGLP 1D9KB 2WYZA 4KQ4L 2JLPA 4O2FB 3QXAB 4OQTA 5AVXB 1VF5C 2XIIA 3ALXA 4UBDC 3PHSA 2YD0A 4CBZA 4DAGH 4EN3C 5I1EL 2HT3D 4FQXA 4G43A 5EUOE 3T3PE 4H88L 4LLMA 2QGBA 4I1NB 4PJFE 1E7UA 5CEXA 5JDJA 2VH5L 1XR8A 4PLJC 5DVNA 1SLWA 2NX5E 1MUJA 3ISYA 5CGBA 2UZYB 1HXMB 4TL4A 2G3ZA 1JWMA 3WOVA 5C0GB 3WU1A 4OD3H 4L8DB 5CHNA 5FUCE 2B08A 3EHBD 1NM9A 4XC1H 2DM3A 3S4SG 4PN6A 1T22A 4GRLD 5AOZA 2ZX8A 1Q1PA 2NUTB 2X4RB 2A5UA 4LPCA 4IMLA 4YO0A 4AEFA 4HJSA 2Z6FA 2WO2B 4FYQA 4NC1E 4S0HA 4XCEA 1FQ9C 1H8NA 3X2QB 2XN9E 3HC3H 4E9LA 4TNWK 1U26A 1NCAH 4HEME 1QSED 2V0AA 3L7EB 1K4CA 3FUIA 2J20A 3IFNH 3NCCB 4F33A 1MCLA 4GW1B 2NTSP 4UM9D 2APSA 4ZFOA 1I8UA 4NKDB 5D7SL 5I1LA 4U4BA 4FDWA 2AXHA 4ZW6A 4N2OA 2I3RA 5DEZA 5KOVC 3A4AA 4NC1C 4RRPG 1AQMA 1JFQH 3GSOA 1A14L 2VN7A 1NA8A 4HHAA 2WBJA 5F3HA 3FCSB 2FSEB 1Z5LA 3U7YL 2O5XL 1K5WA 1SJVA 2WY3B 5I5MA 4HIPA 4PBXA 4XBGA 4ALAH 2PQ5A 5ICUA 2EYSA 3QNZB 3KZ8A 2X2HA 5F0PB 4PW9A 4Y14A 1EO8H 2HT2C 4QTIL 1XIWC 4QHLB 4C4KT 5DD1L 3B83A 2BIQA 4TVPL 2FJHA 2W5PA 1F1GA 3CZNA 3MRKA 5IMOA 1Q38A 4U6TA 3FO1A 4NQED 3AWFA 1SXSA 2OMTB 5I1IL 1YEIH 5IIEB 5KSVB 5EB9A 2EYTB 2WLLB 3ZTDC 1XAKA 2K4WA 4UU9A 3LSOB 5BJTA 2FT7A 3L1FA 3PGDB 5CILH 3R4DA 4N2NA 1ZLSH 4JANA 1C84A 3OD3A 3BJ91 4NQXA 2Q7YB 2NRDA 3D07A 3QS3A 4PUBL 5I16A 2VZVA 1KYUA 3LSOA 2Z7YA 1R47A 3GBML 4R2GB 4TTDC 2G59A 4JZJC 3RNKA 2CBQA 2ZSWB 4GSUA 2ZXDA 4P2RE 5TDPB 1T89C 2EDQA 1CFNA 3VXMB 1MLCA 3JWDH 3NEOA 2EYRA 4FFVC 1TZ8A 5T5FH 1L3WA 2YPVA 3GI9L 3O2DL 2VMDA 2XKNA 3D2UB 4M6ML 4N2MA 4B9YA 1HDMB 1RPQA 2HCZX 1BOGB 3KPSE 3MKKA 2MCMA 5KN5B 2XIDA 2IDSA 2ZOWA 3QGVA 2EE2A 3VFUA 5C0JB 4OFDA 5BW7A 4X6BB 3CVBA 4KXZI 4Y16D 4E9YA 3WFHA 2JFCA 4N2HA 3N04A 1L7IH 5TF1H 4FABL 1P5UB 5M94B 4PGDB 2BP8A 3BAKA 4WAFA 4KHTL 4ZMXA 1BM7A 3BCDA 4HEMA 1QFWM 5T3ZL 1G6RH 5FV1L 3IMTA 3UGEA 3BDYL 5C09E 1G7HA 1TG8A 2HSIA 1KCLA 3MOWA 4U6VL 2F6ZA 2EADA 1OAKH 1XO8A 2HKAA 3TBTB 4DGVL 1LYVA 3PIQA 4MWFA 4QRRB 1GAFH 3RJDA 2ZOLA 4KQ3H 4Z7QF 3QZBA 4L29A 1KAVA 2R23B 3IE9A 4G6ML 4LNVA 4Y5YC 4XO9A 1KFAH 4YDLC 4K3GA 4FN0A 4Y19E 5FA3B 3DXAB 3WL9B 1KN2H 5C6TL 1Y18B 2WVVA 1NOAA 1JUFA 4DKEH 1K5NA 2IBBA 2Q1EA 5EMYA 4HWBA 2H6OA 4PBWD 1C08A 3GNMH 3L3IB 1TZAA 4UV7H 5DRZA 2PWHA 2CLVB 3LKQA 4MAZA 1O0VA 1CR9H 4WU5A 4ZUWA 1S7SB 4U6YB 3QUZA 3O2WH 3ROOB 2GSGB 2PBNA 5D7IA 1TQBC 3D3VA 1D9KA 3UZQA 4N3UA 2CLVA 2WBKA 4RMVA 4NWTH 1UXWB 5DQDH 1THAA 3G6DH 1U8LB 1I53A 3P77A 1CS6A 5I6VA 3DNKA 3KR3H 1KTLA 4S11A 3ZMNA 3G04A 1CB4A 3O6FA 2R1XA 4F5CA 3WMQA 2EYRB 3FU6A 2QADB 1RJLA 2COQA 4R84A 5GGRA 2FNWA 5K5YA 3MV11 1HQ4A 3BCFA 1FQ1A 1CFNB 2BDNH 2F18A 4LSTL 2BIPA 4FMVA 3P0VL 3D9AH 1QHQA 1HE7A 3RY6C 1ZRUA 4OZGF 2WLYA 3NJHA 4X6CE 1E27A 3E38A 3VW3H 1DUYA 4F15B 1T1ZB 1E3FA 3ES6B 4ZRTA 3CG8A 3KPSA 2BHUA 3FO2A 4GRWH 4HWEH 2BMKA 2E8YA 2QJDA 1XEDA 2AK4B 4YHLH 1KB5A 4FJ6A 4Y88A 5BJTB 3FT9A 3NIFE 4OHDA 3EXLA 3K5SA 4Z7VE 3CDZB 4IU3B 1HAUA 2O5NA 5C08D 1N12A 3ULVH 3CFNA 3G04B 3EFFA 3EJCA 5LCVH 4QRTA 4XBEH 4G8EA 3E0GA 1P4IH 3FQXB 3EYVA 1QR1A 4R5TA 3CC5B 1Q94B 2OJ1A 3STZA 4Y5YA 2B4CC 4QYOA 1I4FB 1WQVT 2XZAH 1N70A 2LAGB 4IJTA 4XXWC 4CJ1A 2MCAA 3MNVA 4Q52A 2IDCA 2EDFA 1IB5A 4KZCA 2AQTA 1CGWA 2R4SH 2G60H 3GC3A 3UEQA 1BQHB 5D8JH 1JPSH 3U4EA 5ITBL 1DJIA 3D1QA 1IU1A 1I3GH 1OWWA 1YPZA 2I07B 4I18A 4JBSA 3WGVB 5EF0A 3RZCA 4PTTB 3W0WB 5JW4N 1UKSA 4GW5A 1XM2A 5CJOL 4JW3A 1U21A 3FCBA 4E9QA 3EDDA 2ATAA 6CGTA 3VD7A 3BUYA 1N0XH 3HN3A 5LVEA 1RUKL 2ZWNA 5KA2A 1BVKA 1A7PL 1SVBA 1Y0LB 1V7MH 2XWBA 5FAAA 1CFSB 3TF7C 2DJ4A 3FAXA 1ZT4A 2DWTA 1WC7B 3PGFL 5FYKL 3FTZA 2ENPA 4MFHA 4JFPB 1KFGA 3P4OB 4H8VA 5JW4M 5IF0B 3ELQA 2C46A 4NGHH 1EANA 3BKCH 1UB5B 2LTQC 3ZHFA 1WD9A 4YWGL 1OW0C 3WNIA 5KANG 1SVCP 3HZKB 3E3QC 5T33H 3S5LG 1A7OH 1DSYA 3BW9A 3RGVB 3BUQA 3P40A 3V5DB 1CU4L 2FWSA 5TF1L 3IVKA 4EVNB 3SDCC 2BVQB 1VFUA 2YRPA 1DE4B 3F58L 1WZ1H 3FZUC 2ADJB 4YE4H 3IXTB 3BI9X 4ODXB 4ZX5A 3HZYB 5GS1C 5J1SC 3HG2A 2Y96A 2B59A 4WUUD 1C9SA 2VDLB 1ZWIB 4Q0XL 2CH8A 4XRCB 2LVEA 2FEEI 4IMKA 3RWFA 3LZRA 4V2CB 5JZ7D 1V5JA 1HOCA 2WTPA 3OHXA 5IR1B 3WE6A 2G3MA 4WSJA 2LHAA 4Z9KB 4CVXB 2NCMA 5HXMA 2YC1B 3AS3A 1J1XL 3VTMA 4LIQH 3GKZA 4MXQC 3U30B 1BFOA 1X5LA 2VITA 5TE7L 4OUUA 2KZBA 4PRBB 4H0HB 4DZ8B 5TTRA 3O3LA 1OANA 5KSUA 1QI3A 5INCA 4MJID 3RFZA 3OF6D 5GS1B 4ZIYA 2IANA 1ADQL 1GYAA 3I50H 1MCCA 2DJUA 1JGVH 2X6VA 4LRNH 4LMQE 5H8DA 1E2WA 4EBQH 1R1CA 4Q2ZB 3INUL 3PWPA 2OXHA 2CMCA 2R56H 4U1HA 2E9JA 3VRLE 5A2AA 3DVGB 4NFDA 1PIFA 3T71A 1CFTB 4QRQA 3Q06A 2J5WA 1J05B 3MV7E 1P84J 4RAHA 2IWKA 4IHOA 2I26N 2VLLB 4HUWB 1PQZA 1PEWA 4F7MB 3RTQA 1DVZA 3O0RH 4WEUD 4HLJA 2KDYA 3QZNA 4XE0A 2AQ3A 3J2PA 4XP4L 4Y19A 5FYJD 4PJ5A 5TGBA 4ZK8A 1KELL 5AYUH 2K1MA 2QQQA 5DC2A 3EFDL 1A4AA 3EOBA 4UOW0 1XR9B 1B3JA 1AANA 3V4PA 1T20B 3C5SB 1I8AA 4NUPA 4PWFA 1ZA3B 4LNRA 4R90H 1I7TA 4JS7A 4L1DA 1NAMA 5GZOC 2CMRL 1TQSA 4GRMB 2LU4A 5K69A 1Z5LB 2WQXA 4QD2E 4QIRA 3S97C 1CCZA 5K9OB 2I1YA 1YZ4A 1V10A 2C3XA 4JZOB 5TE4L 4XZUA 3BJLA 1R6VA 3NIFB 1N0XL 2FJFB 5CBEB 3B1UA 2OS7A 4NYLA 3LB6C 4RAUB 3QZOA 1SEQH 4EIZC 2DTML 4FXLA 2DWXA 4CW1A 3ULSA 1J86A 2UYLB 2ZX5A 3AS1A 1MPAH 2EH7H 1KWGA 2OAAA 4JFHD 2X10A 4GAGH 1YRKA 3O8XB 4RFOH 3B9VA 1QFWI 4XODA 4YO0B 3MUZ1 3H9YA 3HG1A 5DD5L 4GIAA 1YGUA 2W65A 1AR1D 3P3SA 3VQ2C 1KYOK 1M57B 3FSWA 4JDTL 2IANE 4X0NA 3MBXL 4BSVB 2WZPD 1E2VA 3S3HA 1GYUA 3NZ8B 4WO4A 5GS0L 1TJHL 1PLGL 4JDZA 4E68A 2E9IA 1HK6A 1WS7A 1T7VA 3GYRA 4XP6L 3ET9F 3EIFA 5DMGC 3RX7A 4MSWA 3UTTD 3ZE2E 2DN7A 4BV1A 5DK0B 1FVEB 2ZP8A 3V5KB 4EIBA 4TOYH 4QT5B 1DQQB 1S7RB 4P2QD 1F3JA 5EO1B 3FT4A 3VDBA 4J4PA 3EF4A 5IVXE 4JDZB 3BEWA 4NPKA 2Y7MA 4PJCB 2PYFB 2OMVA 1KEGL 2P8PB 1VEOA 2WP3T 3QJQB 2HLFD 1FL5A 4JHBA 5F6IB 4M1GH 4EDXA 5KABA 2YAMA 5DD0H 1MAML 2F19H 1N64H 1LP9B 5BZXA 1M6UA 4RISH 5ECJE 3SE3A 4HDIA 4OKDA 1L9SA 5C0EA 1M7IB 3ARDA 5H4ZA 1KENL 3IU4L 5F1OB 1Q6PA 2B3RA 3MZGB 1WE5A 4YHYC 1OWRM 2C7SA 43C9A 3WFDL 2JCCF 4YSTA 4XNYH 2HZHA 4KI5E 3N1MC 2EP6A 4Y5XC 1KNOA 1DO5A 2YKKA 4I3SH 2OKMA 1I7TB 7TAAA 3L08A 4MB1A 1L9PA 4DZ8A 1A4JB 3FU0A 3KPMA 4FQXD 2X4UB 4OLWH 4RH9A 1I1YA 3CGTA 4L23A 1EEQA 3H0TA 1I85C 3A24A 2YGVA 3RWJB 2HTLC 5CIPH 4RSYA 2EE3A 4CMMA 3JTTA 4YSPA 5A1AA 5LG6A 4IOIB 4XNUL 1LEGA 4J2QA 4C58B 3B7OA 2CNZA 3ASOB 3VDCA 2CWRA 3UAJC 4Y16C 2W65B 5ALBH 3CX2A 1NSNL 2VLLA 1A02N 1SHMA 2LV4A 1RZJH 3GXNA 3NTCL 4WEMB 1CGSL 1GPOH 1MJ7L 2BC4A 3FTGB 3T65A 1HSBB 4ODTH 1HHJB 4IOSD 2E7MA 2RHEA 5DJCB 5ESAB 3UIZA 1DSFH 4BQ6A 4YIQB 2LLNA 2CK2A 5ALCL 4LRNL 5EULV 1QSZA 3OZKA 1FO0H 1RD6A 4P07A 3WFCH 1P7KB 4A2HA 1BJ8A 1Y1DA 2AQSA 4NENB 3T0EE 4Z7VA 4HKJA 1WT5C 4RFOL 4OCWL 2F1BA 4YSUA 1MHPL 2CDEA 5AWNL 5EBLB 4EI6B 1LHZA 1KTDA 1FVDA 1K8IA 1FL5B 3GLDA 3KL0A 4W9LC 2B07A 1DBMH 2JELL 4AC4A 3H7LA 3LKOB 3UABA 4OIIL 4I0PB 4DN4H 4M8RA 1V3MA 4MJ5A 3QUYB 2G3NA 4AWJC 2GITA 1NFIB 4KJQC 2YJLA 3IJYB 4P3WA 2QFRA 4I8DA 4PJGB 3RZCB 2IPKA 4YPGB 3FB8A 2X09A 5C2BH 2BZLA 2B0SL 4TMPA 3RURA 4HUKB 3WYRA 1EHAA 1KTKE 3CFCH 3VACA 2VDNL 3QO0A 2DRUA 2APFA 4R7DA 2CM3A 2DAVA 5DS8A 4A37A 1I8LA 3Q6FB 5IP4A 1GA2A 2DYPD 3QZLA 3WENA 3O4LB 5GGQL 3BSZA 4FYTA 2CNFA 1YY8A 1MXDA 1SYSA 3SE6A 8PAZA 5ADOL 5AVWB 2N0KA 1R3JA 1J8SA 3FQXA 1LE5B 5IF0A 1UXLA 1JDAA 3QG6B 2AJXH 4LAJH 5HDBF 2ZAHA 1TPXB 3OJDA 4C56D 5HBBA 1Q1JL 3QUHA 4HAGA 5A7EA 5JHAA 2CUMA 1KCBA 2PABA 5CN2A 3R8BB 5BCAA 2FWOB 1CI5A 3BN9C 3P0YL 4GQQA 5C7XH 1SYVB 3HAEB 3TYFA 4MDJB 4PVLA 3F3HA 3LDBC 1T0MA 3BRDA 3CDGB 3O45A 4GO9A 4LB8A 5ANMB 1GFYA 4I18B 4QRPA 1UWXK 2EEBA 2F54E 4ONOA 1GS6X 5IVOA 3X11A 3IT8D 5F7HA 1MSPA 2QVMA 5FOJA 1H3WM 3VM7A 1VFAA 1HQRB 4JRYD 1ZLUH 3IGKA 3VQ1C 5DSCA 3IFLL 4D94A 3DPBA 3NH7L 4MAYB 5FCSH 2A77H 1RPKA 1JNLL 4F7TA 4Z6BA 3X14A 1QSFB 1QNZH 3G6AB 5FO9A 4UV4L 2C9PA 1E50A 2OW6A 2WUBH 1PCXA 4D3RA 1V05A 4QLRA 1T2XA 2YZ8A 4YXKL 1MCWW 1YYLH 3TT1L 3BVNA 3EFFB 4ZFGH 1O75A 4FFZL 4XVTL 1PZAA 3BKCL 1BV8A 3VRLF 3IN2A 2R2BA 4IIZA 5FYKE 3LNIA 3SPIA 2BRRH 1O9ZA 4XPGL 2FD6L 3KJ6L 2MQ3A 2WAQA 2JJUA 3EUUA 1VGKB 1JTPA 1JZ7A 3ARTA 5EEVA 2AQRA 1JVOA 4PJBB 3EGXA 5J3HC 2X3CA 2CJTA 4PB9H 1ZVSA 4PJ9B 4P2OA 1O7DE 3APCA 4X50A 5CO1A 2H2SD 4WWID 1IAIL 4N26A 1YNKH 4JY5H 4LL9A 4HLZH 3P69A 2XJLA 4Z7UF 1VRSA 3QXUA 4NQDB 4ZRGA 5BS0E 3NVQA 4YDNA 5IQ7L 4LDEB 5FO7A 1U2HA 3SKMA 1ADQA 1QOKA 4WENB 2MHAA 5KVDL 5H94B 5FUOH 2MFNA 3NJFA 1KBGH 1U8OB 1G1GA 2D3LA 1T48A 1FGVL 3F7KA 3AS0A 1XZ0B 4XPTL 3T1FA 2JVUA 1V7NH 3DX8A 1MF2L 3T0EA 4PBDA 4JY6B 4MZRA 4RKKA 1TTRA 2YK1L 4LEOB 1WJ3A 1X6LA 4JG1L 4XCFL 1J9RA 3ZKNC 4B5EA 5KAAA 4OU3A 2ICWA 5DO2C 4PLNC 1HCZA 3CTTA 4TM9A 5DJ8A 2IH3B 1KTRL 5IBTH 5DMIL 3SDAC 4TSBL 2FZ3B 3BGFC 2NNAB 3T0EB 5J06A 2LGNA 4XNQB 3VFUB 4U6XB 4M48H 3WUWA 1LO3H 4NO5A 3U1SH 4E5XA 5C0JA 4OZIE 2WXJA 3F81A 2F8OA 4AM0Q 4ANVA 1HCVA 3P30H 4ZSOB 5AW5B 1ZT1B 3O0LA 5C7ZA 4NJAH 3KPPA 1JWUB 1KEML 1KIUA 4GP5B 4M6AA 1EEOA 3OV6A 2VR3A 2JQMA 4LLUB 3B9KB 3KYAA 1CBJA 3ECUA 3RX8A 1YEKH 2B39A 3GXPA 4YHLL 1OOWA 2XPGB 3PIQB 3QUZC 3F84A 5IVNA 3D0VB 2YMTA 3OC5A 5A43C 3I36A 1YNKL 3FPXA 3D4GA 2CMRH 5GGSA 1NAMH 1ZPLA 5IBSA 5M43A 3ZTCC 2FZ3A 4HIQA 3X3FL 4FTDA 4YDVA 1D6EA 1BYNA 1TCMA 4A2DA 1AGBB 3QULA 4NI6A 2Q76B 1G9EA 2JB6B 1D5XB 3GZOA 4LK4A 3H3KA 3CSBA 4H1LG 4U0QB 5FYKU 3UC0H 2H3NA 3BWUF 5SWSE 1E28A 3H6JA 4CKVX 3V9EA 5FW6A 4V1DB 3LEVH 3MRBA 6PCYA 1OOAA 5KA7A 3ARVA 5FYLL 1FFTB 3FNKA 3HLAA 2GCYA 3PP3H 1EGJH 1FYTB 4FFZH 4PJ5E 2FJHB 2CNIA 5LBGA 1ONZA 5L88L 2IO5A 3LZNA 1KMGA 3KPRE 2RACA 2YGQA 5IVXF 3BZEA 3SR9A 5F1SA 3DYMA 3QCKA 3BZDA 1VADA 3MBXH 3NIDB 1FNGA 3CK0H 4KXAA 1F11B 3QI9B 1F00I 4K55A 2E7DA 1OGTA 4HJJH 3IDMB 1OEVA 2FECL 4TSCL 1AE6L 3LS5L 2C3VA 3VFGH 4WHYH 3OAUL 5BW7C 1XHHA 4PIRF 4IGBA 3D08A 5E6RB 3TV3L 3TIDB 5LLIC 2ZUQB 4AW7A 3GMRB 3M6DA 2CM7A 1RZ8B 4C56E 1IGCH 1TJGL 5BMFH 4LSPH 5IESL 3VXSE 4JFFD 2K45A 5DFTA 4RVBA 4EE2A 5LGKA 2VSKB 3AY4A 2BNUB 4I1RA 5C97A 3N44B 2OZNA 3V10A 4XP1L 3TYFB 3BM8A 3BZEB 3BP7B 1XGTA 3LHPL 4NO5B 2R29L 4MASA 3KW8A 5TE6H 1FIEA 2AKRB 4CSSA 3QI9C 3NIGE 2NNAA 4QLWA 4J3XA 2J6EL 2ROYA 5I15H 3TA3B 3N1QC 4R4FH 3MMJA 3QEQB 4HX1A 3DX6A 1R4XA 3CHOA 3KD4A 1BZOA 3D48R 4OQTH 2P47B 3PDGA 1MHEA 3DIFB 3QDMA 5D7IB 1HINL 15C8L 1YQVL 4XBGB 4U6YA 3GSQB 3EJYD 3J27A 2WBJB 5F3HB 1JWMB 2H1LM 2VLJE 3VXMA 3Q8BA 4NBXB 4I0PD 4TUJB 4R97C 4KO5A 4KC3B 4JCMA 4XCYB 4KO9A 5AW7B 3L3OB 3QORD 4WW2A 4HWEL 3QUML 4ILDA 1XGRA 1IKNA 1I1FB 4NQDE 4WJG3 5HI3D 3THMH 3TTYA 2HYMA 4ZYKB 1Q6TA 1ED3A 2Q05A 2DIBA 2A7BA 4XCNB 5L2JA 4AT6A 3QCUH 4YNYA 3VI4B 2J21A 4X9IA 1ZV2A 3C5ZB 2ZOLB 1KLUB 3WNNA 1MDAA 1VAHA 2H47C 5ABAA 3M45A 3UAEA 4LHJB 4RISL 4B9IA 3EYSH 4LP4A 3ZRCC 5L9DL 1WUZA 4IMLB 4JPKH 4GG6F 3A6CH 2APBA 4J28A 1UXSB 4JFFA 5IJDC 1KDJA 1FHGA 1HL5A 2IAMA 3BAJA 3EZJB 1VZIA 3N41F 3L3OC 1DQDL 2NQ3A 1U8QA 3MRQA 3ARBC 5DJCA 5ESAA 3QCBA 4KK8C 2VRKA 4HETA 4ZNCD 3DJTA 4JRXE 4JFFE 2I27N 4JE4B 5A7BA 2JJDA 3MU3A 2FATH 5T3XH 2WLKA 3FBKA 4P5MA 1EGJL 2W9EL 2BHYA 4A7GF 4FQXB 1KCRL 1H5BB 4C83B 4KROD 1U8OA 3AACA 1I1CA 2EO1A 3MV8D 1WHPA 1PD0A 4MJ2A 4G7QB 5J12C 5LXGH 1IO4C 4B5ZA 2VE6B 1IL1A 3T6ZA 5T3XD 1NIFA 1EA9C 2A4ZA 2LTQB 1ZANH 2DKUA 1KXQE 5I6OA 1KJ2B 1LP9E 3T5WA 2DH3A 1BMGA 3LCYA 5CP7A 2W60B 3SKJH 4LARH 1INDH 2QFPA 4L4VD 4N9OB 1A5FH 4ZMQA 5K9JH 1Q6MA 3BLKA 1ZTXE 4ZO7A 3SN6N 1C7SA 2FX9H 2HJLA 3O3AA 3MO1B 4WCYH 5T5NF 5EU3B 2JB5H 3S5LB 1MKPA 1HHGA 4FQXC 3DX7B 3PL6B 3WSQH 2FEDD 1I9IL 2VL5A 5E6YA 2XZQL 1A7NL 1WA0X 1J7VR 1MFEL 4GI6A 4G5ZH 1FGNH 5H37A 6PAZA 5J12B 3LVEA 1YN7B 5DYFA 5L8LB 3II2A 1AC6A 2HLAB 3F62A 3FMGL 3KPOA 3SPVA 4YXLH 2R59A 5HYSG 2PA5A 1YYLL 1EMTL 4DGYH 4MDIB 5HHOB 1X5YA 1U8NB 3OZ9H 3CBJB 4FQ2L 1FZOA 3MNMA 3N40P 2G60L 1OP5H 1MAJA 1Q90A 2NY0C 4O02A 4MNGE 3JQOB 5HJ3B 3L4YA 4RIRA 2GVYA 4L3AA 4F8LA 4S1DD 3MV7A 4XWOC 1QQDB 2GIXA 1T03H 2GTWA 4DTGL 3WNKA 1WS8A 4GKNB 2HLFC 3GHBH 2I9LB 3BRGC 4OF6A 1NWPA 1WTGT 1NMBL 1DLFL 2R0LL 4ONHB 1JGDB 3GTTA 3KWWA 4JHWH 3CLFH 3U2JA 2ILLA 2YHGA 2G9KA 4WHTB 5AOJA 1GTFA 4U1NB 2D03L 2XQBH 3TCTA 5JPMC 2ZUTA 1CO1A 4AVKA 4QHPA 2BSED 2QVIA 2CO4A 3INUH 3QT2A 3TEYA 2FE0A 1HZLA 5C0CB 32C2B 5CSZA 1TQUA 2R0KL 5I0WA 3FXIC 5E1AA 4H20H 5FUZH 5L4JA 2HT4C 4ZNEE 1WV7T 2CDGA 1AQKH 3AJ7A 3RY4A 4CUCA 1G6RA 3FQTB 2QBPA 4E9XA 2VQ1A 3OR7B 4G8GE 1V8HA 3VWJD 2GKIA 2YAEA 4U0RC 2XBTA 1E4KA 2DQGH 3LEXB 4OAWB 1AD9A 2X6BA 4X6DF 4M6NH 1TXKA 2EVGA 1UOLA 3JWDC 4MX7A 1J18A 1QFUL 1SF3A 2FLBT 2WXIA 4EZLA 2VL4A 3WXWL 4S1QL 1OSPL 4IBYA 1V3LA 4K8RC 1L9QA 4HS8L 1A21A 4PW3A 1BLIA 4BH8B 5IWLA 2AJYH 3HZMA 5TE4H 2NT7A 4ZODA 4BK4A 5E9DB 1NM4A 5IQ9B 4ODVL 1ROCA 1SNRA 4PJ7A 3VJ6A 1ZKAA 5K25A 3MV7D 5EU5A 5FX3A 3TJPA 4ISVB 5C2UB 1P69B 1TEFA 1HU8A 4XP5L 1MFUA 1OT4A 5FLVA 3FQUB 3D39D 2P9RA 2YPLB 4AXWA 1GS8A 4Z7NF 1KULA 3KPSD 1U8MA 4FKHA 7PAZA 5DU7A 4N2EA 2CFVA 3I6LE 5FECA 2ZWZA 1FC2D 2XWJA 4P06A 4XMKH 3TBWB 4UOZA 5JHDB 3BRFA 2DL2A 4FQCL 3SOBL 3QEGL 2DQUL 4MMZA 5ICZA 2ZT9C 3BHBB 4RAUA 2R0KH 3V4PL 1IZJA 3BKJL 2RMNA 3EYUL 4PGCB 4F37K 3CVDA 1NCJA 1ONQB 2C9UA 4P9HL 5AWNH 4OD2A 3OGCB 4YUEL 4BKSC 4TLUA 4ONHA 4HOXA 2PW2A 3IWVA 4OM1H 3TS8A 3RIFF 2YGPA 2W07B 2ZWLT 4HJUA 4Y4HB