3V0JA

Crystal structure of ciona intestinalis voltage sensor-containing phosphatase (ci-vsp), residues 241-576(c363s), deletion of 401-405
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
319
structure length
319
Chain Sequence
KRRYRKDGFDLDLTYVTDHVIAMSFPSSGRQSLFRNPIGEVSRFFKTKHPDKFRIYNLCSERGYDETKFDNHVYRVMIDDHNVPTLVDLLKFIDDAKVWMTSDPDHVIAIHSKGGKGRTGTLVSSWLLEDGKFDTAKEALEYFGSRRTDVFQGVETASQIRYVGYFEKIKKNYGGQLPPMKKLKVTGVTITAIQGVGRGNGSDLSMQIVSERQEVLLCKFAEGYNCALQYDATDDCVTCEVKNCPVLAGDIKVRFMSTSKSLPRGYDNCPFYFWFNTSLVEGDHVTLKREEIDNPHKKKTWKIYRDNFTVKLTFSDAED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A glutamate switch controls voltage-sensitive phosphatase function.
pubmed doi rcsb
source organism Ciona intestinalis
molecule tags Hydrolase
molecule keywords Voltage-sensor containing phosphatase
total genus 108
structure length 319
sequence length 319
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00782 DSPc Dual specificity phosphatase, catalytic domain
A PF10409 PTEN_C2 C2 domain of PTEN tumour-suppressor protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1110 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3v0jA02
3.90.190.10 Alpha Beta Alpha-Beta Complex Protein-Tyrosine Phosphatase; Chain A Protein tyrosine phosphatase superfamily 3v0jA01
4RDDA 1PTUA 1YFOA 1XXVA 1L8GA 2G6ZA 2VEXA 3ZMQA 4QAHA 2H04A 4QUNA 1FPRA 1Q6TA 3B7OA 1C87A 2VEUA 2GJTA 2E0TA 2F6YA 1YGUA 1G7GA 2Y2FA 3QCDA 2F6FA 2RF6A 1XM2A 2YOCA 2F6ZA 2CNIA 3QCCA 3QCJA 2F6WA 1EENA 2Y96A 2C7SA 2I75A 4NWGA 4ZN5A 3BLTA 3S3EA 5KABA 2QCTA 3N0AA 2F46A 2HC2A 3F99A 3O4TA 3F81A 3A5JA 3QCGA 2BGDA 3ZMPA 3V0FA 2I3RA 3CWEA 2QDMA 3NMEA 1PH0A 2A8BA 2I6OA 3QCEA 3ZM1A 3RZ2A 5M43A 2FJNA 1FPZA 3F9BA 1U24A 4DGXA 2MBCA 2VEYA 1YN9A 4J51A 3GXHA 3I36A 2R0BA 4PYHA 2J43A 2B4OA 2FJMA 2QDPA 1Q6MA 4NYHA 5K23A 3ZM2A 2J71A 1A5YA 4ZRTA 5BX1A 1NL9A 4JNBA 2C46A 2B49A 4WU2A 2J16A 2PQ5A 4GE6A 1NZ7A 4YAAA 2PBNA 1Q1MA 2B3OA 1NWEA 2FHBA 1ZZWA 5KA9A 1T48A 1Q6NA 2CNGA 2CM2A 1G1HA 1ZCLA 1SUGA 2NTAA 1T4JA 3ZV2A 1D5RA 2J44A 2OC3A 2F70A 1OHEA 3BLUA 1LQFA 3D1OA 4WOHA 5EHRA 3QCMA 3EAXA 1FQ1A 1C84A 4H34A 5K25A 1ZC0A 1ONYA 2PSZA 4BJOA 3ZM0A 1PA1A 2QCJA 4GFVA 1JLNA 1NNYA 3EZZA 4R0SA 1GWZA 2G59A 1EEOA 4YR8B 1RXDA 2I4EA 3AWGA 1JF7A 3D42A 3F9AA 5MMZB 3EB1A 1AAXA 2JJDA 3RGOA 2HNPA 2BZLA 2QBRA 1QZ0A 1M3GA 4OHLA 5KA8A 2B4SA 2H4GA 2CM8A 2ZN7A 2GWOA 2WGPA 4ERCA 4QAPA 3D44A 1I9SA 1YGRA 4GRYA 2F6VA 2NT7A 2BIJA 4OHDA 5K22A 1BZCA 5KA3A 4GS0A 4D3RA 2Q47A 1XXPA 1YPTA 4RH9A 3S4EA 3RO1A 1PTYA 2ESBA 3I7ZA 1PYNA 2I6MA 4ZI4A 4WTYA 4JBCA 3A5KA 4IKCA 3I80A 4OHEA 4WU3A 4I8NA 4HJPA 2YDUA 1R6HA 2B07A 2B4PA 2H03A 1I57A 5KADA 5K9WA 1OESA 3OMHA 1J4XA 1VHRA 1NO6A 3V0EA 2SHPA 1T49A 1ONZA 2VEWA 3QCLA 2VEVA 3O5XA 2P6XA 4KI9A 2CMAA 3D1HA 4RI5A 1XBOA 4RKKA 4DGPA 2J73A 4NNDA 1LYVA 4D3QA 2B4UA 4PVGA 2FHCA 4TVVA 4Z6BA 1G1FA 2YA1A 2A3KA 2NZ6A 4OHHA 4GE5A 3V0GA 5HDEA 2QBSA 1XRIA 3S3FA 2HB1A 2IMGA 2AHSA 1ZCKA 2HY3A 4NWFA 3V0JA 1WCHA 2I6IA 3QCIA 1C85A 3RGQA 5KAAA 3QCNA 2J17A 1GFYA 2P4DA 1L8KA 3O3LA 1OEOX 2F71A 1Q6JA 2FHFA 2CM3A 1C86A 4ICZA 1V3AA 5BZZA 5AWXA 1OEVA 2PI7A 1KAVA 2HXPA 1YTNA 2CNEA 1G4US 3F41A 2H4VA 3BRHA 3S4OA 3CM3A 2H4KA 3SR9A 2OOQA 1WRMA 5KACA 2NLKA 2ZMMA 5IBSA 2Q05A 1I9TA 5EHPA 1YTSA 3LJ8A 4HJQA 2M3VA 3QKQA 2I3UA 2I42A 1MKPA 2HCMA 2J16B 4Y2EA 4RHGA 2HNQA 2QBPA 2OUDA 3EU0A 1NWLA 3ZM3A 3V0DA 3QKPA 1OEMX 3MOZA 4OHIA 2I1YA 1OHDA 4QBEA 1YWFA 2CMCA 4RI4A 1LARA 3S3HA 1OEUA 3SMEA 4D3PA 1G1GA 4S0GA 5KA0A 2I5XA 3AWFA 3AWEA 5I6VA 1P15A 2PA5A 2HVLA 4JMKA 4H1OA 1YTWA 4QBWA 3QCFA 1KAKA 3GXGA 1OHCA 2HC1A 3S3KA 3OLRA 2F6TA 3O4UA 2DXPA 3QCBA 3V0IA 5BUGA 3M4UA 5K24A 3H2XA 1BZHA 1U25A 5K9VA 2OZ5A 1G7FA 4JMJA 2I4HA 5KA1A 2I4GA 2QBQA 2FH7A 4GRZA 3D9CA 2I6JA 4RH5A 4R0TA 3V0HA 5LXQB 3D1QA 5KA4A 4GE2A 2QEPA 1C83A 2GP0A 3MOWA 4QUMA 4MBBA 1PTTA 1Q6SA 1BZJA 3PS5A 2PT0A 2BV5A 2BGEA 3U96A 4Y14A 5GTJA 5KA7A 4HRFA 5J8RA 2AZRA 2CMBA 4KYQA 2CM7A 2CJZA 1RPMA 2J72A 1WAXA 3MMJA 4GFUA 4R30A 3BM8A 5IBMA 3EMUA 1G4WR 1PA9A 1C88A 1X24A 5BZXA 2CFVA 1PTVA 2I6PA 4B04A 4KYRA 1U26A 3QCKA 2QDCA 4GWFA 4BPCA 3O4SA 2CNHA 2NT2A 4AZ1A 1YZ4A 2NV5A 1ECVA 1OETA 2CNFA 1PXHA 4NX8A 5KA2A 3QCHA 1QXKA 1Q6PA 2H02A
chains in the Genus database with same CATH superfamily
2JIXD 1N3NA 1MY7A 4PREA 4KRPC 5I17A 4NHCH 1YN6B 1A7NL 4BK8A 3B7OA 2XA8H 1G43A 1P4IL 1NM4A 2E8YA 2O61B 4KJYB 2X5PA 3J27A 3BUDA 1GGCH 5CIPA 5CHNB 4KJPD 2D73A 1ANUA 2NYYC 1U3HA 4HV8A 2AJVH 5INDB 1Z0NA 3H2QA 4IMKA 4KDVA 1HFUA 3W3BA 4Y1AD 2XKNA 2P5EA 3O4OB 5K5YA 1UVQA 1NAKH 5BOPA 1U95B 2YJLA 2C7SA 2XXCB 1E42A 3V4VB 1IEAB 5FR3A 3T0EA 4X5LA 2B0SL 4IGBB 3NA9L 5AVXB 3BN9D 1QWNA 1U8NB 1CD1A 1PZCA 3NT0A 5GS0H 2GVYA 4UIMA 3CXDH 2FJFA 1KB5H 3IJSB 1E4XL 2F15A 3Q6GH 4KKZA 3SDAD 1L7TL 3BH9A 4K8RH 3RAJL 3LEYL 1UB6A 1YMMD 5HSFA 1MFDL 3UBGA 1G1KA 1MF2H 1P7KB 1SXCA 2CIKA 4ZMTA 3BJ91 5DK2A 4M5TA 5TE7H 4RGMC 3T77A 2A5UA 2GIXA 1MFAH 1OGSA 1P53A 4Y4KA 4ZUSB 4GI6A 2IWKA 2YEVB 2JELH 3KPNA 4S0HA 1JZGA 5KBNC 4H88L 1FPZA 4FMFA 4P2RD 3IMWA 1N68A 2WSDA 2VEYA 1RVFH 4WENB 1P1ZA 3ARWA 3OR6A 1VACB 3HS0C 3OKLA 4WFGE 3IDNB 3LKQB 3CLFH 1A5YA 3KJ4C 3WUZA 2WXNA 3SDCD 1HAUA 3DROA 4Y16D 5I1HL 1C8PA 3MROB 2CM6A 4GB9A 1V27A 2NQDA 1KT2A 1A7NH 3KDPB 3AM8C 4JDZB 4AV4A 3MV7B 1BFOB 3MRKB 2VOSA 4LSTH 5A7BA 1NZ7A 4DIXA 4ZNCD 2XETA 4Y5XB 4Y19D 3GI9L 4V1DD 4M5SA 4WI8A 4OZ4A 3D2UA 3GHPA 4U1MA 1GS6X 2Y23A 2ADIB 1Z3RA 5CZXD 4JFEE 2P49B 2JJVA 5D2NB 4V1DE 1OAUL 3A6CH 4UAOB 4KKPA 5ICYB 4NUJB 1U3JA 1RZJH 5EU6E 4K7PL 3B7RL 3VSQA 4DFIA 2AC0A 4M7LL 2HZHA 4U05A 4KFMA 2O5YH 4PMEA 2DICA 5GZNA 3S2AA 5EZPA 3N44F 2IALA 2J1YA 3DROB 3H9ZA 2JB6B 1IQWH 3UAJA 4BFFA 4RZKA 4EIGB 5DWUL 3DV6A 4HF5L 4B9CA 1HHJA 1ZGLB 2D9CA 4RRPM 5I2IA 2H7WA 1PY9A 3PJSB 4X7SH 3NZHL 1JLNA 1NNYA 3QORC 4Q4EA 1D3CA 1QUNA 4WTWA 1B0GB 5KTEL 5J6GB 4N8VA 1KFAL 5J11B 1RIUL 4H1LA 1OM3H 2CLVB 4JE0A 4UB0L 4Y89A 2CMRH 3VU2A 4I4WA 4HOMA 3V95A 5F88A 4DO6A 1MWOA 1NCNA 1YDPA 5CJBA 4DP5X 5I1CH 3N85L 1F4HA 5FYLD 3TOPA 1H8LA 3BUBA 4OM1H 5GISH 1U8IA 2BOLA 4UILL 4OHLA 3D4YA 3UP1A 5FUCE 3R18A 4DK3A 5HYSA 4PGCB 1TTUA 3RL2A 2BNRB 2IV9A 4JDZA 1SNRA 1MG3C 3MRKA 2G9HB 4N90D 1CK0H 4FXLA 4HA1A 4GRYA 3MCYA 3WO4B 35C8H 5ALCL 4YSDA 4KTYA 4IKJA 3ZHDA 1R17A 1AP2A 1DLFH 1T1XB 1G4MA 3BMWA 3ZBMA 5IMOA 5D7LE 3CUPB 4JUTA 1MCDA 4GYBA 5MEOB 3RDJA 4E9SA 3HG4A 3RVVD 1Z9NA 3PG2A 2GEQA 3KPMA 3PHSA 4JPKL 4YDKH 1HSBB 4G1MA 3LK7A 4Z7WB 4MA8L 2JB5H 4RH9A 2VO5A 4ZMAT 1J8KA 1ADWA 4KXZH 4TYUA 1SY6H 2KHAA 3BSZL 4OLEA 5HGBA 4XPGH 2F8XC 2ZX5A 4R4BA 3A24A 2JXMB 4X6CE 5ADPL 5IESL 1PTYA 2YRZA 1U8IB 4PRNA 3WDHA 5KN5B 1TZHA 4S1RH 3VWJD 4JBCA 3OSVA 3TT1H 3MFGB 1KTRL 3EXLA 2ZTBA 3D4ZA 3MOAL 3NABL 4KXCA 4WU3A 4IYKA 5EIIG 5DFWH 2R1XB 4H1LB 1U8JA 1YEDB 4YQXL 4OF3A 5CUSH 1AHMA 1YJDC 5MHSD 5SWZE 2XY2A 4XBEL 3U2SA 2DL9A 5ABDE 4LIQL 1MHEA 4XPAH 1IQDB 3UO8B 2UZYA 3PABB 1BEYH 3FB6A 3FH8A 3K2UH 3CFTA 2ZUTA 1QFPA 3SBPA 4AT6B 4HAFA 5T1MA 4MA1C 1KJMA 4R97C 4MMZA 3G6JF 3WKMH 1A6TB 1CDHA 5LBSL 4XNYL 4QO1B 2C9VA 3ISRA 3ZMNA 4JFEA 3SDXF 2WVVA 4H88H 1VENA 3HI5H 3WO4C 4AMKL 3RX9A 3LNGA 5DZNA 3JTTB 5C08A 6CGTA 3VX1A 4FEMA 2QADD 2GHWB 3MA9H 4NZRL 1P84J 1ZVSB 4PB9H 3RVTD 1WCBA 4FQHB 1XCQB 4Z7UB 2WY3B 4XMUA 4LGRB 3MUUA 1IE5A 3NCWA 3QXDB 5E5LA 4KTDH 1YEHH 4QYOA 5L9DL 4QIRA 3CXDL 4PBWD 2W9DH 3NIFB 1QVOA 2UWEA 3FDWA 4YHZL 2JFFA 1OEZW 4NKIL 5C2BL 3HG1B 5JIDA 1F2QA 3QORD 3DO3A 5FO9A 5E03A 1A7OH 5ANHA 2I6IA 1X5KA 3ARUA 3L4ZA 3EG9A 1BJ1J 1RAMA 4GKSA 5DRNA 2XVGA 5I6OA 3DHPA 1BECA 4Y4HA 3V6FA 4ZMOA 2AJUL 2NQCA 1EFXA 1OIOA 4NB7A 5C08B 3A22A 3ARVA 3EDKA 1QI5A 4RDQF 3HC3L 3PQYA 3S3SA 2EXWC 4RIRA 3ZDXB 3ZIYA 1UWYA 4KO6A 3MV9E 4I0CC 4XOCA 3TNNB 3EDFA 3UC0L 4Q9RL 1FF5A 1KJMB 3D85D 1JE6A 2Z3FA 1TNNA 3K2KA 5A1AA 2FR4A 1LK2B 2YAEA 1BQRA 3IB4A 4N2IA 2V17H 4AT6A 3ZE2E 4R7XA 3SKMB 43CAA 3O6LH 5D1XB 4OH2A 4X99A 3VXSA 3FBKA 2X42A 5IFAH 3F41A 1AFVH 3N3EA 2JWYA 3CM3A 2RTTA 2IG2L 4GSDH 3WIHA 3SGEH 1SRDA 1XGTB 1T1ZA 3G6JE 2Q3ZA 5J3HC 4IDJL 3DMMA 4OI8A 1NDMB 3GDBA 2K7QA 3G08A 4GINA 2E5EA 2PPDA 5IBSA 1MWAA 4MQ7B 2FX9H 2DMHA 2X4RB 1XVSA 4WCYH 1UB6B 2HG0A 2FAUA 2W91A 3ULVH 2WN3A 3IU4L 2X2JA 5HHVL 4E9VA 4G7YL 3DGDA 5CEZH 3KJ4B 4MNQD 1L4IA 4IGBC 1J5CA 5KSUA 2PW2A 3ZKQD 1MG2C 4NUQA 1NKOA 1CIDA 3TWCL 3LS4H 1SHWA 2OKMA 3B7UX 1NDGA 2ENPA 3ULSA 3CFDB 4OB5H 3CSYA 2YPKB 3KJ6H 5AW3B 3QEQE 4PGDA 4OIAA 3KBPA 3NEEA 3ULVD 2IPKA 5KSBE 5C0ND 3V5HB 1OEMX 4OHIA 1CF1A 4G9FA 3DJTA 2AV1B 1X5ZA 9CGTA 4YS4A 1UH2A 2X4UB 1OEUA 4UQBA 1MRCL 1AGEA 3SMEA 3DMMB 4HK3J 4S0GA 4E9WA 2XIDA 1CO1A 3GZOA 4DCQB 2AVGA 4WAFA 2JFGA 3H9SD 4NPYB 4FQXD 3FC8A 3RTQC 3GTVA 5CILH 1SDDB 3MLVH 2JFHA 2PWDA 4XP9H 2HUHA 5JNYA 3TNMB 3TFKC 3ESMA 5GGVH 5DC4B 4G6AC 1UAGA 3FB8A 2XC8A 3N06B 3PHQA 3TP4A 4TLUA 1IIIA 1JXDA 4GRWE 1UOVA 3BMVA 1YECL 2D31A 2FQGA 4LLDA 4G6FD 1BF2A 4UYPA 2F6TA 2APVA 4YHNA 2EDJA 2X6MA 5BZDA 5AB9A 2X6AA 1S7UA 1MVFA 1O9ZA 2RAMA 4K55A 3FU7B 3PXHA 2CKBA 1T20A 1A9EA 1KACB 5CSBA 3VTTA 2XQYG 2VDLB 2N0MA 2RBLA 1EHKB 2K6ZA 4W81A 3S2CA 3VXUB 4XGZB 4LE8A 4B41A 2WUBH 1AXIB 2XKSA 4LEOB 5I17B 5KZCD 4DKEH 5MEQB 3NEOA 5TE4H 3CZKA 4HUVB 1JSYA 3V0HA 2OMZB 2G75B 2GITA 4O02H 3WKNA 5DD5L 2ZQKA 2ILLA 4D0DB 3NZ8B 1G9NH 1BVKB 3RIFF 2DBLL 4FXGA 3HJ0A 2MFNA 4NJ9H 3N0PB 4LCIL 2JJUA 3Q48A 3J07A 1ACYL 2A9CA 4QHNA 1C8QA 1JPST 4XCFH 5A2JH 1CR9L 4J3UA 1U92B 4F8OA 8FABA 2ZIDA 1FSKB 2K3TA 2GBVA 1OE1A 2NYKA 2OPCA 3OAWA 1HN1A 2AXFB 5AL0A 4ANWA 1FH2A 4K8RD 5EBWA 2NTFA 1R5IB 3Q1EA 2UV3A 5DZLA 5KBPA 3OKDA 3QEQD 1RUML 2GFBA 3TNMA 1JHTA 2L04A 2GSGB 3GLZA 4WW2B 4XE0A 4E5XA 4ES9A 4CUCA 4NYLB 4S2SB 4RMWA 4QGTA 4B5ZA 1REIA 1ORSA 3FT2B 4GIAA 2XN9B 1EXUA 1RU9H 3ZJAA 2OMWA 1VFUA 1MI5D 1JGDB 5FM5O 1ROWA 2WXQA 4AKPA 3QCKA 3WTWA 1A4AA 1IAOA 2N59A 4XOEA 1IZJA 5LQBL 1A9EB 2CPCA 5DLMH 1C12A 1DDHA 5JW4N 5EEXA 4X6DA 2GI7A 2EQDA 1Q72H 2I60H 3P4MB 4MZ2A 4IRZH 2WCSA 4EUPA 3MNZA 1BXXA 3LQAC 1AH1A 4QAHA 1H3TA 3QDAA 2UZYB 4U6XA 3IGFA 3F00A 2J4WH 2R2HA 1KXVA 2CHWA 3IS0X 2ATKA 3QDJE 3ZU8A 4ABUA 1IC7H 2H0PA 4ONGH 1EH9A 2ED6A 3WFBH 1CXKA 2BM3A 4F5CA 3QUGA 3FT9A 1CWVA 3V4VA 1EENA 1X5FA 1GYVA 4IGBA 1K8DA 2EDMA 1RUAL 5SX4I 3EW3B 3T1WA 1CL7I 4BKLB 2VCOA 2VE6B 3U25A 1QFUH 3HG1D 1F1DA 1DO5A 3ZDXF 4ZW7A 2VW4A 5JHDB 2VTFA 4P9HH 4OLWL 5FKPB 1U93B 1SPDA 3A5JA 2C9PA 5AL8A 1HHGB 2ERJC 2ZT9C 5BW7C 3CZFA 1MNUH 4FQXB 1BVZA 4Y16C 4JFFE 3A67H 1AGFB 4ODVL 3S0PA 3NK3A 3PF2A 5DD1H 1PX3A 4YHMH 5HHXL 4JPSA 4EUPG 3KGSA 3UDWA 5KS9F 3MJ8B 4HC1H 1MLBA 3WIIH 4J7RA 3IYLW 1KYAA 1M2OA 2XUWA 4YLQT 4HWEH 4Y16A 4AJ0A 1FN4B 4AYID 1E3XA 2QPFA 3LPPA 3MRCB 5K9QG 3QDJD 5B3JE 2BX5A 2CLVA 1JF1A 3PWVA 4J1UB 43C9B 3GSNA 4P4KB 3DIFA 3FF8A 3Q43A 1T89A 4H0IA 3JV0A 4EJ1C 3Q8AA 1M42A 1B2YA 4MZRA 5HYIA 4G6JL 1G7HB 2BSTB 4PP1C 2PCYA 4KI5E 2A9NL 3QYNA 5HDOA 5C6WH 4RNRA 4G8IB 5DXWA 2YGVA 5HHOE 5J0BA 3EFDH 2C7UA 2J16A 4ZAKB 4NQDB 3QDMB 1RZIB 1AXSB 3STZB 2EECA 3S7GA 3Q05A 2VKXA 3BAJA 1CVSC 1ZHBB 3ET9F 4HJGB 1HQRB 1GPOL 1NKRA 2CJTA 1I1YA 1XF5B 3OLEA 1MCBA 4Y4HB 1T1WB 1UM6H 3FU8A 3RVUD 3T0XA 3LVTA 2VSCA 3T2OA 4AXWB 5CBAA 4C83B 5F96H 1IC0A 1QSEB 3LH8A 2PCPB 2YC1B 3TTSA 3WXVL 1HL8A 5AW2B 4A2EA 3P9LA 1KBGH 4JR9L 3F5WA 4ABQA 4XN9A 4MA8H 2ADJA 5L2JB 3D1OA 5KUMA 5LCVH 4YPJA 1W0VB 3MBXL 4MA3B 4U1SB 1S9VA 4YBHA 3TA3A 3LHAA 4PRDB 3TGXA 3QFJB 5CFAA 2DQUH 4GW5B 3ATEA 4O00A 4IRJC 4GW4B 3DSFH 2XG4A 1EEUA 3RFZC 4Y4KC 1KTBA 3CFEA 4MLIA 3QCVH 3MRRA 1WYJA 5JPMB 3OPZL 5FCUH 1ZTXL 4NQCE 3VFUA 1MAMH 5CN3A 4AQAA 1ZXQA 2VLRE 4HIIA 2JLLA 7TAAA 5I1EL 1LEGA 5IR1A 1P5UB 2WB7A 1WS7A 5ADOL 2KC0A 3NP4A 4L3EA 2P8MB 4ZS6C 3KWUA 1YEJL 1BWWA 3FOMA 4ODTL 4X6EA 4NRYB 1XF1A 3HTLX 3QAQA 2C3XA 1SN2A 4PY8J 4KI5F 4QXGL 5KSAB 1ZE3H 4NGHL 3Q3GB 4RSVA 3QEHA 4PGBA 5JA8B 2A0LC 2WWMC 2JI2A 3K4DA 4C4BA 5E51A 2G2RB 3V6ZA 4GJTB 1ZEAH 2OSWA 2R4SH 3WXWH 3GLEA 1JHLL 5C0DB 2CDFA 1I7RB 3OC5A 4U7KA 3UO1H 3APNA 1HZLA 3PNWA 4ZNEE 3MLXH 2B0SH 5EU4B 4K23L 4PBXA 5CEXB 3MRBA 4G71B 2PCPA 2XWTA 2I24N 4YXHH 1XGPA 5E2UH 5F3HB 2GSIA 1P9MA 4OCNC 3FONA 3TBSA 4MNHB 3TVMD 5TQ2L 5KSAC 3ASWA 3IJHB 2JI3A 2OR8A 2I6MA 5EZJA 2G75A 1CXIA 3UBXI 4BIKA 5EZLA 4U1JB 1XGYL 3VXUD 4MMZC 5DJ0B 1A1NA 1L9SA 1DQQB 4BFEA 1TU2B 4YHYB 3IDXH 5DS1A 3WAKA 3FN3A 1U91B 3EJUA 2HVJA 3S97C 5I30H 4HJPA 3HMXA 4OCXL 2NY2D 1JPGA 5E1AB 3TXAA 1E9QB 1N6QH 1T7YA 4JO2L 4P3WA 5C0IB 4BUBA 3Q06A 1YYLL 2YR3A 5HHNB 1A6WH 4FQ1H 3VACA 4KHTH 1JHTB 1CT8A 4JFFB 2B4CC 1ITCA 1J4XA 4APQB 3MX0A 4FRWA 4MLSA 1BGXH 5KYUB 4B9ZA 2FK9A 5CGTA 4K5NA 4YIQB 1AE6H 2YLHA 2BW5A 4MNQA 1FH5L 2UXGA 5K9OB 5L8JB 1FGNL 2VC2H 4JY4B 5T3XD 5BRPA 2DD8H 4WV1A 4ETQB 5A3ID 5DMIL 2LLLA 4A66A 1A1MB 1ZEAL 2WXFA 1JGVH 2EC9T 2FYYB 4Q74A 3DJSA 3ESOA 1NEPA 4LCUB 1CXFA 1LVEA 1TTCA 4KZ0A 5J1AB 1ADQA 3RZWA 1IMHC 1EDQA 3T2NH 1XCQA 3DMMD 1DJWA 4RGOL 4C4KT 4XMPL 1S7WB 3RZCC 1MUJA 3Q6GL 3DXAE 2EO1A 1G7LA 4FQJH 4N5ED 1JDCA 1EHAA 1G7JA 1KGXA 2EIZA 4BUGA 1LO0H 1TTFA 2VZSA 3KCWA 2YSTA 3RUGA 3VXSD 2EDNA 3SPVA 4ODSL 4S1DC 4FF9A 1TZAA 5KBKA 4HKJA 4NQDE 1WA0X 3R7QA 4F2FA 5I18L 4PW4A 4YBQD 2ATKB 3B34A 3K0WA 1IBHA 2FEDC 4MASA 5DK0B 1T3FB 1OT2A 3NTCH 2EH7L 2K78A 3C2AL 4FQCL 5GRJH 3JUYA 5BVJA 1Z5HA 1ND0B 2BXZA 2KPWA 3AJ7A 3AB0C 1MN4A 4L29A 5FF6B 4BZ2A 5KYYA 3TF7C 2ZXAA 5CEZD 2P4DA 2GB2A 1IAKA 5LAPA 2E27L 2F7IA 4LAQL 4H8WL 3W0WD 1AD9B 3DTDA 2XTJE 1Q6JA 3CPUA 4JFDB 4GMTL 3BSZA 3OX8B 4KK8C 4ICZA 3M7OA 3WELA 4M8UA 2F5BH 1NMAH 3K81A 3OKYA 2H6OA 3MLYL 1WZ1L 5B39G 4YHIA 3V5DB 4QNPF 4N8UA 3V9CA 2BY0A 5IOPA 4IBUA 2WLKA 4J4PD 1YLBB 1PS3A 5GGTL 4HQQH 1U8QB 1OK0A 3N1GC 3RIAF 3V5HA 4CL7A 4IK7A 2H4VA 2V7HB 3U7AA 2PR4L 3NQIA 32C2A 4CMMB 3TLRA 2R9HC 4NWTH 4KVPA 2OMUA 1L7IH 1QZ1A 4NN6C 2B7DT 2HFEA 2YD5A 1WTGT 1DVFC 2IQ9H 2N0KA 3LKSA 3QUMA 2HKAA 3H6AA 4MBRA 1RLBA 1D2PA 2XBTA 5B38B 1E65A 1DVUA 1DR9A 3ZUNC 2UY6A 5E4EC 2IDTA 5I0ZA 4CADB 4YSSA 3M86A 1MCOH 3BKYL 1VKXB 3CSFA 4XHJC 4MQ7A 3P30H 5C08D 5LCVL 2PTTB 3OZKA 4PREB 4KNSA 3GSUB 1QSED 1T1YA 1UWGL 2WV3A 3QJFA 4GP8B 2IMNA 3ZDYB 5KVEE 2VXUL 2OMBA 2X87A 2I42A 4GRMA 2JK5B 1N0LA 4KDWA 2AQ2A 3OF6D 1S78D 4KZDL 1MSPA 2WXPA 4A7GA 4XCCH 5EUOB 4WNQB 4JDVA 1NC4D 4I0PC 2CCLA 1QQDA 4FJ6A 3EGSB 4HKJB 3QIBA 1WLHA 4UOW0 4N2AA 1VJSA 5I82A 4ZMWA 5CZXC 2FT7A 1H3XA 2FEJA 2YXWA 4O58L 3BKMH 3BN3B 3MOZA 4C13A 2ITFA 1CGVA 1EAPA 2P5EB 2DQGH 3OAUH 4UU9B 3DHMA 3H7LA 2L3BA 3QHZL 2APBA 2EE9A 4FTVD 5CBAB 4BBWA 1UHVA 4HEME 1U4FA 2VMJA 2IDCA 4JFZL 4JW3A 2Z8VC 3SB3A 1BJ8A 1OTTC 2I5XA 1YMMB 3PWPA 5E99L 3BPLB 3OXSA 4AVKA 1OAXH 2PA5A 1KCWA 3WKPA 1MFDH 3GSVA 4A38A 3T3MB 4FG6D 4JZOB 2B1OA 2HVLA 1RHHB 1LWRA 3FQ2A 3VYPA 4QBWA 4YX2H 5E8PA 3IDMB 5I16B 1KAKA 2IANE 2NNXA 4IU3B 3KM2A 1ZAGA 4Z95L 5DDHB 2DTML 3D3VA 3RGVB 4ZODA 3ZLQC 3O4UA 5HI3D 2YD8A 1FL3A 4WU5A 1MJJA 1D6VH 3D2UD 1A22B 5IBLD 3VYNA 3WYRA 3QIBB 5DVNA 2JKTM 2VDOL 4M3HA 4NQEB 4KKLC 1IFRA 1MAML 1BPVA 1DQDL 2WXMA 3HNTH 2YS4A 5BQ7A 3KL3A 5E00A 2VISB 4Q6IA 4JKPL 4BE6A 5FYKE 3IE4A 5FB8A 2BSCA 2ROYA 4RH5A 2ZSWB 4OVVA 5CR1A 1CZ8H 3OL2A 1J05A 1MW1A 5ABAA 2ZOKB 5F7BA 3UCRA 4BFRA 1JZ5A 1W7KA 3MRPB 5F89B 4Q9QL 5DA0B 3OF6A 5EOTB 4KQ4H 1E2VA 1L9PA 3JTBA 3PJLA 2QEPA 2VTDA 1BFOA 1AO7A 1TZGH 5GPRA 4MWFB 5BXFA 2Z35B 5I1AB 1PTTA 2B77A 2DEYX 4XPTH 3FO0L 3CHPA 4LEEA 4TPRL 3HOGA 2NW2A 5HBBA 3V79C 2X4TB 5F96L 1D6EA 4NS0A 3I84A 2M26A 5D70L 4KVNL 3KPTA 2OW6A 2XXFA 2ODHA 1J86A 4OCXH 1CFTB 4HPOL 3BQUB 2DM7A 3BPOC 4N8CL 4OJYA 5CMAA 5JOPE 3BM8A 4PWEA 4OSUL 1BOGB 1FORL 3KXFE 3I3EA 1CYGA 3GS4A 4YSCA 1HINH 1T89C 1PLGL 4QRRD 3H6JA 1BLNB 1E5CA 1TOXA 4PY7B 1FL5B 2FO8A 5F1OB 1CN4A 5FA4A 1T21B 4RBPK 5CINH 5DJZA 5TH2B 3DGGA 2IC2A 2MNJB 3JT0A 2UZXB 2EDKA 3D7PA 5EC2B 2EXSA 3HUJB 3HR6A 3U4AA 1L0QA 4H40A 4ELMF 8PAZA 3VGFA 1PTUA 1YFOA 3FK3A 4HKXA 1F8TL 1KUMA 4LL9A 1HVXA 2Z31A 2EVIA 4TOYH 2K1MA 3U9WA 3VI4B 3QPXL 4HCGA 2Y7QB 3JZYA 1EEZA 1MPAL 3W81A 4G43A 4JJOA 3WIAA 3MSPA 5DSCB 1FPRA 3LPGA 2ZYRA 2OYKA 2XI9A 5HHXH 4U3SB 3SJVD 4K3EL 3QPQC 4QJ3B 3ECUA 2F5AL 3JWNG 2Z92B 2W65B 5C0AA 1ZHNB 2OYLA 4FAAB 5EO0B 4ZTPL 2KQMA 1XF5A 4DN4H 2YPLA 3BAEL 5C1MB 1FAIL 3FB7A 4PJBF 4QTHB 4MWFA 1GAFH 3L8QA 4DZ8A 5CSZB 3FFDA 1HEJC 4XXCA 1WD9A 1JNNH 1XCTA 2WCPA 1RZJC 3MLTA 4I0PB 4KPHL 4OT1L 1JZ8A 5KABA 2VORA 1HXYB 5KVGH 4LGSB 2CK0L 1IM3A 1SGKA 4BZ2H 4HU8A 1HH6A 5IEHA 4RNRB 2NNRA 2A3TA 2BCKB 1Q9WA 5E6RB 1I9JH 4JREB 1GJIA 2LU5A 3PCYA 3QNYA 4U4IA 3HS9A 5DD1L 4PJBA 1YEIL 3O6FD 3QJTB 1DZBA 3DV4A 3CZFB 1AS7A 2IAMC 1DL7L 5D1XC 3CHOA 1MVUA 4Z7NF 3QCEA 2QVKA 4HOXA 4TNVK 4R7DA 4OLXL 3HAEG 2BERA 2HH0L 4MMYB 2W65A 5D93C 5E8DL 3QXAB 4ZTOH 5LGJB 3DETD 4GIPD 4XVJH 4HIJB 4NO5A 4IMKC 2GC4C 2EXWD 4MAUL 2YAHA 3H3PL 3BZFB 1DN2A 1B0IA 3FUEA 4F9PC 4R97B 3VGAB 1SXZA 2OMVA 3FB5A 4YWGL 2ARJB 5AZ2H 3MLVL 4AEEA 3STZA 5T5NF 3VXPA 5DUPH 2AK4D 2PPAA 4HDIA 1TLKA 3QHFL 1BYNA 2CIKB 2GTWA 3CFJB 5EN3A 4ZBJA 5HVGB 2LOEA 1CFVL 2CO1A 5JHLL 4YAAA 4PGJA 3QUZB 3HJEA 2K6WA 5CSZA 3SPIA 3DUHA 1PKOA 1Y6NR 4IDLA 1TFPA 2VMEA 1NZRA 2ZCLL 4AUJA 1GHFH 4MCNA 1XXDC 4QRBA 1QP1A 4IRSB 3SGKA 2EIMB 1WFUA 2L4OA 1NCIA 1A2YA 3A6BL 4NN6B 1XF4B 4G6KH 5GGRY 1I8LA 3H9HA 2B14A 4MXQC 2WGNB 4M4PA 4O2CA 3UG3A 3OKMB 1F97A 1M56B 3IDNA 3LKQA 3LRLA 4XNXL 3Q1SL 2DQHL 2YWZA 4O2EA 5CP7B 3V5DA 3FQRB 2IXQB 4WCYL 2WZPA 4KITB 1Q9LA 3WJJA 1ILUA 1G7QB 5I6NA 4POUB 1ROCA 5T5FA 3VRIA 3DX7A 3JTSA 4GRLB 1JBJA 1UKTA 1B3IA 2F74A 3NG5A 2BP8A 2JIXB 4WEBH 3TV8A 2PR4H 3HUJE 2ZKHL 1L3WA 3D12B 1S7RA 4JRWA 4J28A 4NN5C 2HT4D 4QRFA 2AVFA 5JR1H 1JK8A 4LHUB 1CR9H 1KEGL 2VSKB 2JB5L 5EU5A 3REVB 2KDYA 1PSKH 4M43H 5HJBA 1FUNA 3AWGA 1UGKA 1TYRA 2QGBA 4M7LT 2VDRH 1CGYA 2CBQA 3HNVH 4C4UA 2PYEE 1AAXA 1U8MB 5J9PA 4KMLB 2J56A 3ALPA 4PGZA 5DYOA 4OCLC 2JJDA 3VQLA 1RJYB 2QBWA 3L3IB 3PUUA 3MRIA 4P48A 2Q6WB 3U9UB 2XX1A 3UMNA 5DQJB 2GTWB 1ZT1B 3CFJA 5E2VH 4JFHE 1PVHA 2H3KA 1VPOL 2O6EA 3PWUA 1YGRA 1G0XA 4PBVC 4P2QB 1B0RB 3FN0L 5ACZB 4S11A 5ANMA 2JCWA 1IGJB 4JG0L 1A47A 4NQSB 3HG0A 2P8LB 5H37H 1ZS8B 3RHWF 1C12B 3WFZA 4PJGE 4OT1H 4ZXBD 3HCVB 1V3MA 2W9DL 3BDBA 3M45A 2A6KA 5CLWA 2XPYA 4L1LA 1R47A 2ZUVA 4G6KL 4OZHA 4Z9KB 2BVOA 5L4MA 3S37H 5IQ7L 1D5MB 3GO1L 3HBPA 4D7BA 4K3EH 4WO4C 4ORGB 3QXTA 4UT9A 4ODWA 2RMNA 4IRJA 5I8CB 3L4XA 1HEZA 3RWGA 5F3BB 4MAZA 3SO3B 4PG9B 1T4KA 4JZNB 2IWEA 4BWTA 1SMDA 1YY8B 4LARL 5IUCA 3MGOA 1XGQA 4UF7C 4NKDA 1TZOA 2Q7YB 3BKML 1T80A 4TQ8A 3IGUA 3QS3A 4UMSA 5C6TL 2HVJB 1F4XL 2OZ4A 1JK8B 1AMXA 1CFQB 1YAIA 3EYFA 2EDFA 3F12A 3HE7A 1AXTH 1BM3H 3AG1B 4L8CA 3B37A 3RBSA 5HYJB 5ESQB 1NCCL 2Z93B 3FJTA 4NPYA 2DIBA 1NAMB 4ZFOA 2WTRA 3EO1B 3QWNA 2YRLA 1IGMH 2MEJB 4HCRL 1HHGA 2G60H 1USZA 4G7YH 4BWWA 3P4OB 1HINL 2X4NB 1OPGH 3BKYH 3FTYA 4QO1A 2EKSA 3QUXB 3S88L 5D1QA 3PWUB 2DBLH 1IL1B 3GIVB 4KH9A 5BCAA 5ENWB 1D2OA 5DZPA 4XXDA 2VEVA 4H8WC 3ZR6A 2P6XA 2YAFA 1YQ2A 3SE3A 1RK0A 4RAVB 1OP5H 2OULB 5KSVB 4M93C 3UTPD 4CJ1A 3TFBA 1JPTL 3L08A 1KNOA 1YEKL 4DQAA 2Z64C 3QDGA 3CMGA 2ZCZA 4C57C 4A37A 1C5DB 1LQBC 1I3RB 3IJSA 3NBNA 1U8JB 1YEDA 1TVBA 5AEAA 2COVD 2B4UA 4W4OA 3O8XA 5T1KA 2OL3A 2AI0L 3H42H 3B5GA 4PM1A 1YMHB 2BS8A 3RWFA 2OBGA 4KQ4L 4JRFA 4KX9A 3SKOB 3V0GA 1TZHB 2P8MA 4W9DC 4YHOL 5GGRB 5I66B 4HIEB 4PTUB 1OP3K 3DPDA 4OQTH 5CIPB 1MFAL 4OBRA 3RVWD 1HILA 1E8YA 4B3VA 1WK0A 4QI3A 1RZFH 5EIQA 3L4CA 2DLTA 1NCUA 5H37G 4UV4L 3MBEB 5I6MA 1RUQL 1BVOA 3D6GA 1S9XA 5JHDD 1LNUB 1U8KA 3BAKA 2YAOA 1KELH 3S8WA 1QA9B 1T03L 4KKCD 1SEQH 4KUCF 5IK3B 1O6VA 1BAGA 1OEOX 1OHQA 1LL1A 2SODB 4ODHH 4ISVA 1B88A 4HFWB 3ZSTA 4I9XA 5TFSL 4F7KA 4M03A 4V2CB 1UXSB 5GRYA 3PIQB 5BZZA 4E9LA 4EI6B 4PFEA 4OUUA 2ITEA 4PP1D 1I8KB 2ZPKL 4LOVA 1AQ8A 1OEVA 2D2OA 3FF7A 1ZT4A 4G59C 4WWOA 1QBBA 2WLNA 3DVNB 5EDXA 1UUSA 3L2MA 3ARYA 3P3UA 5TQ0H 5I1JL 1EIBA 2HRPL 4IIQA 5MP6L 3KLSA 5K69A 3WSQH 4IS6B 1T2QL 1FNSL 4JHWH 2NY2B 2PN5A 2CLZA 2ZCLH 3V7AG 1NDMA 3WUWA 2BNRD 5CZKA 2VISA 4P49A 4F93B 1OCOB 2X28A 2ITCA 3UXFA 5J6GA 3O9WD 3X12A 1U42A 4OI9A 5FC9A 5A2AA 3G6JB 4E9QA 1MFNA 5C0CD 4Q4IA 3H2WA 4XMLL 4HPOH 1DVXA 3BZFA 3O4OC 4PRBB 5C0JA 3FCTA 4X7CC 1CGSL 1JRHI 2YOAA 3DUSA 5I74B 3VXQA 1S7SB 2I3UA 1U8PA 4CSTA 3KVDD 2XVKA 5A16B 4NZUL 4MB3A 4RHGA 5IFAL 3HG1A 4OFYD 1G1YA 4ZMQA 2WZ0A 5D7KD 3M7FB 3BKCL 2OK0L 2QKIA 3TN0A 2CHZA 1CL7H 5JORB 5GZOA 4OI7A 5DFAA 1AHKA 4J2XA 5JW3H 4WI6A 5E8DH 4AZ8A 2J5LB 4ZTOL 4QBEA 4ZMPA 3IMVA 1UXMA 2YGQA 4YDLB 1N70A 1OGAB 2OQJA 3B9KC 4RMRA 2E56A 5E1HB 1ET5A 3Q5OA 3ZRFC 3I6SA 5DJAB 3VFGH 3FB8B 1R5WB 1UA7A 3NAAL 4JB9H 2Z9TA 3K6NA 4LCWD 4OZFG 5EPMA 4LCYA 3FS9A 4X83A 3EBIA 1I8KA 1Z9OA 1PTZA 1ETA1 5L6YL 3FTWA 3MVSA 4X4MA 3KBHE 1J7VR 1Q9KA 3BLKA 4HIQA 2O26U 4M9OA 2VR3A 3H54A 3K7UA 1IX2A 4WUUD 3BIKA 3KPSD 1MXGA 3P73B 3IK2A 2ZX7A 5BV7L 1NL0H 2IPKB 1MDAA 4H5SB 1CI3M 2LV4A 5KTEH 5AFAA 2PO6D 3Q2VA 3LCYA 2AZUA 2HLAB 5K1NA 4TUKL 5AOJA 4WUUE 1LDPH 5G4OA 3ULUH 1UC6A 5KW9H 1OSEA 1UCTA 1URIA 4R7VA 5EA0H 1J0HA 1P4IH 4FNLL 4HIPA 5F2FA 5ESAA 4R0TA 5EEWA 1BZ9B 1YEJH 3AY4A 5DUBB 4Q56A 4OM1L 4WW2C 1FGVH 3EF7A 2X1OA 2XPGB 1QRND 2OP4H 2QQKH 2RACA 1UT2A 5TPWH 4M7LH 5FEBA 1YPZB 4G1EA 1JPFB 3GJEB 4NBZB 3VFTA 4BKSC 5ID0B 5E94B 1Z66A 4MVBC 1HYRC 2ICCA 5IB4A 3VGEA 1TTGA 3O3AA 5IWLC 4GUPB 3NCJH 4GQRA 4Q89A 3LHPL 1U8HA 2DQFB 4DVRH 3SIKA 1U8NA 5ITBH 2EO9A 5E6IC 3ZZLA 2Z31D 5KEZA 4OM0H 5MI0C 1ES0A 3NPSB 3FULA 4PPTA 3KLKA 1CFTA 3ZUCA 1N6QL 3DIVA 4K7FB 4JHAH 2DQTL 4UQ3B 2AK4A 2KPNA 3OV6A 3MPCA 3RTQD 3GMRB 1JYWA 4NQEE 1ZS2A 3PP3K 4QAMB 1FYHB 1KJVB 4ZFGH 5H35A 2EEFA 1U3HB 1RZJL 2HTKC 1A6ZB 1INQA 1U26A 1QRNA 3HR5A 3POCA 4GMSL 2COQA 5E23A 4YL4A 1Q0XL 3AT9A 2EO7A 2VDKH 4OJEH 1RXLA 3G6DH 3SBRA 2Y1YA 2ZICA 3V10A 2FWOB 3P3TA 1U92A 5D7LB 1IC5H 3QXWA 2E7CA 1P5VA 3THML 3QIUA 3VQMA 1ZA6A 3VB9A 2PO6A 4X6CA 3LDBB 3WO3B 4I18B 1GRWA 1W8OA 5HVHB 12E8L 1J10A 3GMPB 5D1QE 3RU8H 3KPOA 3VFSB 2VEUA 5FDWA 1R5WA 3MROA 1LO3L 3P2DA 5D5ME 1ZHNA 4OCWH 4KROD 4QXVA 3FTUA 5DJ2A 1DQKA 2V3FA 4NO0B 3OBAA 3AGVA 4I89A 1A14H 2HRPH 4LSPL 1V8HA 4G9FD 5HYQB 5IMLA 2YOCA 4YSRA 1BEXA 2EADA 1KB9J 5CNHA 2BNQD 4AJYV 4JZJB 5EOQL 3DRTA 1QRNB 2Z8RA 3F6IA 3HR5B 4FCHA 2XNAB 4KY2A 4LVEA 3I50H 1UEYA 5E1QA 3MLXL 1AKPA 4XP4H 5HHPB 4JRYE 3HZKA 4GRWF 1QW9A 2ZSVB 3KPLB 3RDTA 1J1PH 1A6AA 1RIUH 1ULVA 5L8KB 2NT0A 1FV1A 2MOQA 4LOUD 2XWTB 5KW9L 1D5XA 3V0FA 4HJIA 4ODVH 5DS2A 5HGDB 4LSVH 3FU5A 3MRNA 1BIIA 3BP4A 4Z7UF 1PH0A 1XSOA 1T7WA 1H5BA 4JM2D 1SYVB 2CO6A 3C8DA 4OFYA 2E76C 3VTMA 1RMFH 2FL5B 4OD3L 1IFHH 5I66A 3MRCA 1TMCB 4M00A 3ESPA 3ZDYF 3FT1A 4DEUA 3GJEA 1DJIA 1ECYA 3FT4B 3MJ7A 1JWMA 1T0NB 3E80A 3MRBB 4X5RA 1PNDA 1PSKL 3B7SA 5EUOF 2QDPA 1CLZH 5EU6D 4PB0H 5T1KB 3WXVH 3CC1A 4UNVA 1LNUA 1U8KB 2NY0B 4KHTL 1DZ0A 4PRIE 5C0BB 2DRUA 4XPFH 2WBJD 1BG1A 1S5IH 4DP0X 1M9WA 4WI4A 4NKMB 3D33A 1PLAA 1HXMA 4WLCA 3K91A 5CMAB 1A8ZA 4Y8DC 3MV11 5FGCE 5FGRA 1GW6A 1C08B 4DP7X 4OBSA 2FRGP 1RIHL 2BNQB 3BP7A 3IDXL 3UPRB 1MCQA 3ZT7A 2B3OA 3W11D 2NX5B 5KA9A 1BVLB 5C86A 2CM2A 4RMSA 1L7IL 5JDSA 4OFIA 2O5ZH 3TCTA 4F37F 4NNPL 3B6SA 5DD0H 1RZQA 2TRYA 4IRSA 4KRNA 2JCCF 4A6YL 1I1AA 1N7ML 1JGEB 3RVTC 4I2XB 3W2DH 3NSFA 1AR1C 1BD2B 3SQOL 1PNCA 3JWNC 1CGSH 5KVDH 3T4YA 5HHMD 1OTTD 2D03L 4QHMA 3UERA 4YBLC 2DI8A 1CDYA 4H34A 3O4LE 1T6VN 4GO8A 4GW4A 5FHBL 2PUQT 3GMOB 1JVKA 1H19A 4LBEB 3DOIA 2ZP8A 5F0PB 2AV7A 2QGEA 1JHLH 1T4KB 3S3BB 4H1LH 5IMKA 3VWJC 1RIVL 2Y22A 2YKKA 2Z7YA 4L0ZA 3CK0H 1BVKA 3RY6A 4I48B 3JZ7A 5JIHA 2OTWB 2EXYD 4LL4A 5F6IC 1GWZA 1RZFL 3L5WA 5HI3C 4M4RB 1KGYE 1OZUA 2EH7H 3C2AH 3DRTB 4DP6X 1RZ8A 4OQ1A 2J7LA 1RXDA 4J5VA 2BOBA 5EZIL 2VDKB 1N8OE 2PPFA 2QTEA 3H9YA 5D1QC 5E0FA 4PD4K 1FFRA 5AOZA 2IO5A 3EZJB 3MREB 1W9XA 2CDEB 2WSKA 2Y3NA 3DVFA 5ADOH 5D71H 1TTRA 3RDTB 4I1PA 4C54A 2NNAB 1SF5A 5IFHL 4MJ5B 4F15B 5BS0D 3RGOA 1CMOA 5BS0B 5EUOE 3PGCA 3D18B 4GBXC 5CD5C 2M83A 3G5XA 3FO2B 2XTLA 4ZI8A 5F3BA 3SGDH 2CM8A 2I07B 4HMEA 1ZVHA 1XF2A 2WW8A 2J6EA 3UTQB 2RCSH 3UYPA 3QCTL 1JZDC 4U1MB 2A6DA 5FFOA 3WNPA 4OHDA 5LNDA 5DT1L 5GGUB 2O5NA 3MC0A 4J8RA 2EUZA 5C2BH 4QKXB 4LU5H 1QR1B 5IB3B 3SDCA 4GS0A 4TQHA 1GR7A 1O75A 2Q47A 3DSNB 1AZVA 4Z7IA 4UIKH 5AYTA 3OZ9H 1RZKH 3FU0A 5AYUH 4M7KL 1OD7A 4XNMA 1GZHA 4S1QH 4O4YL 2R1YB 4U1IB 3MREA 3MO1B 4QTFA 4DW2L 4OZHB 4FNSA 4NQXA 1N8ZA 2G2NA 4ELKB 3VI3F 1TQTA 4BFKA 1PYNA 4IRJD 2WTZA 1T66C 4RRPA 2JVUA 4XN7A 5A43C 2OTWA 2M2DA 4P06A 4IM8A 3IPFA 1Z2KA 5I30L 3R0MA 4O51B 3K71B 1NC2A 2KI6A 4PLOB 3NPSC 5DRXB 1PIFA 3CHXA 4LMQI 2GTZB 3AQZA 2BC4B 2YXVA 2Z6FA 4LVOB 4Q2ZB 2DQIL 4JHAL 5H4ZA 2B4PA 2AMGA 3C08L 3WEOA 4Z7VF 2NCEA 1HKFA 2ZOWA 4OM0L 1TJHL 5JIIA 5D7JB 3T0ED 1ZTMA 4R90L 5KG9A 4RGNB 1PKQA 2VMCA 4UDTA 1GG4A 3JWDH 1BVNP 1VFAA 4WEEA 2I9TA 2BIHA 3HC4L 4UT9L 2FO4B 4P59L 1RU9L 3OHMB 5TK2A 4BINA 1PJ9A 1N0XL 5J7CC 4GRLA 2A0LD 2WWMD 5TPWL 5KSAA 3GPEA 2EIEA 4X99B 3S3PA 2QKSA 4X7TA 3LYRA 3MRLA 3TVMA 3OWRA 5E4EB 4DERA 4F7TA 1YEEH 4Z8FL 1DVFB 5JLZB 1N6UA 2CCVA 5EEUA 5IEKB 3MGAA 1DANT 3U4BL 1EJFA 1CYXA 3VXMD 1C7TA 3FUMA 3IFPB 1JZ6A 4JANB 1NAML 4XTRD 4AGLA 4Z6BA 2B59B 1G7QA 4YPGA 4M7KH 3VGGA 3FQXB 2QHRL 1JYVA 3FL7A 4OZGB 3T0AA 2YQBA 1XRIA 2C7UB 2AEIT 3VMNA 4DPBX 4CC4C 2HB1A 2QELA 1EO7A 1JL8A 5HY9B 1RUPH 2WSPA 1D9KC 5AD0A 5IMMB 2HYMA 4GAYB 5ALCH 3RVXC 3FFCA 4FD0A 5DQ9B 1WCHA 4YHLL 2B4CL 1I8AA 4FLRA 3WFEL 3PGFH 3OJMB 4IIQC 2ZWLT 3KWTA 3W38A 5AUMA 3E3QE 1TQBB 5D1QD 5C0IA 4UINL 2VN4A 2OMTA 3C75A 4P2QE 5AWNL 2VN3A 2ATPA 5FECB 5IB3A 1OP3H 4NKQB 1MRCH 3O3LA 3E6HB 4WI3A 3RUGF 2F53A 3UFIA 4AOFA 1FFOB 3S4SG 2CUHA 4EN3A 5D71L 1L6XA 4PJ7B 2BIPA 4XRCA 2WO2B 1GGTA 2I60L 4JRLA 1CT8B 1NEZG 1R24A 3NJKA 4Z95H 4JRYD 4LRIA 1T04B 3VFRB 3EYUH 4B97A 2CNEA 3HE7C 4R7NB 3LPFA 3D39E 5H37A 2F00A 1PMYA 4UV7L 4TF4A 5F9WC 3VX0A 3QUHA 4KAQH 2Y6SD 3NCXA 2M8XA 3IETB 4XH2B 5IHUH 2VL4A 1I9RL 3QRGH 4MQTB 3WUWB 2YEQA 3C6LB 3OXRA 4N6RA 4OKVA 3FCBA 3SD2A 5G5DB 5DLLA 1QI3A 4XVTL 3VXUA 2BCMA 3V4PH 2ZE0A 2ZXEB 4ACTA 5EHPA 2XACC 1P31A 1XXFC 2CA3A 3SBWA 1EPFA 3O8XC 1JDDA 3UABA 3CXHK 1RUMH 4PRHD 3TZVB 3MN8A 3SQOH 3VRJA 1FIGH 4PJIE 3ATDA 4TVUA 4OB5L 2AXGA 3FQYA 3HPLB 4R90H 4WHYH 4Y4FC 4Y2EA 1JK9B 3TWCH 1RQ5A 1AYRA 5HDQL 3QDJB 1HQ4B 3WHXB 3HHSA 4NC2B 3GNMH 2BPBA 2P5ED 5FXCH 3V0DA 1L0XA 4XNZB 1CC3A 4MXVE 1MJUL 2FX9L 4PJ6A 3VSUA 2CMCA 4OIFA 4HKXB 4N0YH 2H26B 1O0VA 4HETA 1WC7A 1EZVY 1KCSH 3L13A 2GUYA 4G82A 1DVFA 3AWEA 5I6VA 1W6LA 4FQ2H 4MGXA 1I9IL 2VMFA 1XD0A 2X4QB 1MNUL 1Q1PA 4EUPH 2X88A 5CN1A 2V8LA 1OSYA 4QUOA 5A2FA 5HYFA 3HS0A 4NKIH 3DO7B 5C9KA 3QFJA 1CBJA 4AIOA 3VXME 5F70A 4U3XA 5ISZB 1Q0YL 1IC4H 3CDZA 4JGMA 4Y7OC 1MAKA 3FNKA 3IVKA 1JXJA 5EBWB 3T2LA 1U25A 5IHZA 4F91B 4KK5D 4N0CD 3F7VA 3BEVA 1YEIH 2FJUB 2HJFB 2QBQA 3QZWA 4XP9L 1X4XA 2FH7A 3GBDA 3VRJB 4GRZA 1XH1A 5IVOA 4EN3D 1MHHB 2D4FA 3SCMC 1IAIL 3EHBD 4ALAH 2GY7B 4CKVX 1S7TA 4HUUA 4DP2X 1U4EA 2FJGB 2OXGB 1AQDB 4WFHD 1NAMA 4ZFOB 1NSNH 2UYLB 2VQTA 3OJDB 2K3HA 3DJ9A 2WKOF 1X5HA 2HX8A 3UZVB 3P9MA 1JFHA 2KZ1B 5KBLA 2GHZA 2WD0A 1A3RL 1EXGA 1R3JA 2V37A 1EEQA 2ORBL 3QXAA 1JFQL 4MBBA 2UAGA 4UM9A 4IU3A 3KPQA 3WHXA 4M8VA 1H8OA 4LCCA 4ONHB 3G04B 4L8BB 5F7MC 3SKUD 5DLML 2J2ZB 3EJTA 2AQTA 2VDPB 1IBYA 3ORJA 4YSOA 5F44A 4QF1B 5GGSA 4FXKA 4JZJC 3MCLL 5DJYB 1G5AA 4JFQB 1A1MA 3HKZA 3EDEA 4UT7L 4ZPTA 2CJZA 3B9KA 4IOFC 5BQ7B 1DUZA 3NCBB 3MMJA 3CX5J 3RU8L 4DZBA 1OXYA 4U1GB 2DKUA 1BZ7B 1K4DA 1XH2A 1IKNC 2GUOA 4MDIB 2OR9H 4NPJA 1FO0B 3S36X 4NO0A 3VXMA 5IKCB 3MJ8A 5E9AA 3VXNB 2QSCH 3D69A 1EHNA 2QDCA 1PDKA 4QXTB 3VFOA 4R83A 3GSNL 3FKUS 4OJDH 2OJ1A 1YEWA 3O3UN 3F8UB 4R6UA 4Y9BA 4UDUB 5AQ0A 5ICZA 4GRLD 4WI0A 2NV5A 3MOBL 4LCCB 1PXHA 1FYTA 4OV5B 2FGZA 3VG0L 2AV1A 3SDYL 3WGVB 3B7TA 2H02A 5BUPA 4TVSa 5T3XH 4EZMA 1XXVA 1A7RH 5FO7A 3PHAA 3FSOA 1XHHA 1JWSA 1AGFA 3EJJX 1IQDA 1K85A 4HW6A 4LOUC 2VXQA 2ITDB 2E0TA 3UGUA 5LJYH 1DL7H 5IFJA 1TPXB 5KS9B 1I75A 3MKGA 2I9TB 4JM2C 5GRUH 3VWKA 1CB4A 2Q0ZX 1CLYL 1MCFA 4TPRH 4LLDB 4RSYA 5IROA 4LPXA 3BI9X 2CD0A 4D2NA 3QCCA 3E6FA 1JNLH 1P7QA 3IF1B 3IS1X 4TRPL 2VDNH 3IGAA 1NH6A 1AHWC 1BAWA 3RVWC 2ZCKH 2UUPA 3QI9D 5SWQB 5DZ9A 1T2JA 2H3NB 3LIZL 1H3PH 4IOSD 3Q2LA 5DEJA 2NDFA 4XWGH 3QCUH 5E0QA 4UIMB 2N4IA 2Q5BA 3QCGA 3RY6C 1LD9A 1BFTA 1WTLA 2BGDA 3BQUA 3MGTA 3HI1B 3D3VD 3GSUA 3LEYH 3QIBD 1FE8L 1U8QA 3VG9C 2XHNA 4BDVA 3RGHA 4K3DL 5GISL 5KWYC 5M43A 3LKOA 4N1CA 2AJYL 5E6UB 3BUIA 5LXVA 5LGHH 5C8JB 1YN9A 3WIHH 3PWPD 4PYHA 1E40A 3VXRD 4IKIA 1X6LA 1IEHA 2N7SA 2AQRA 1S3KL 4CN1A 4DOHE 1YC8A 4AVJA 3FQTA 1C5CL 2AJZA 1N2RA 4X0NA 5DRWA 5I1GH 2KLSA 1FIGL 4LPVA 1Y18B 5ABZA 1WE5A 3DK2A 4NYLA 3QFDB 4S2SA 2JV6A 3ZHNA 1CFNA 2BWIA 1BXUA 3OMZA 2ADFL 1KN4L 3QIUC 1M05A 4PRPB 1WISA 1GA2A 4J4PA 2ZZUT 1X7TA 4Y88A 5DJ8A 2PBNA 3WMPA 3O2VH 5D1XA 1EJ8A 1X5MA 1M6OB 1CL7L 4B27A 5CAYB 3SQRA 1GXEA 2CJUH 3QZBA 4DP4X 1ZCLA 3IJYA 2WMPB 3OXRB 4OKVB 2VAAA 1QBLL 2NPLX 3NIDE 4C47A 3QUML 5IM7B 2J44A 3CMOL 3GSVB 2VDPH 5JQ6L 2F70A 3DBXA 4XCEB 3T09A 2VQ4A 2PYFA 4R3SB 2ADYA 5ICYA 2XFGB 3TWYA 3KCPA 4ODUB 1WJ3A 3UC0H 3ZTJG 4PJBB 5GGTA 4PS3A 3ELAT 2A4ZA 3BWUC 1ZXKA 3BEWA 3NA4A 1IFGA 1LO2L 3UTOA 2JCCB 1OB0A 1YNKH 3ZM0A 4QHLB 3TC9A 4RGMB 1PA1A 5GZOC 1RK1A 3MRHB 3QNZA 4GFVA 2WPGA 1QQDB 5DJ8B 4YGVA 4EN2A 5E2WH 3GFUA 5E00B 3VRLE 4G8EB 2KYIA 3QS2A 3DXAD 3BWAA 3O3AB 4PYGA 4XMVA 2NY2C 4F80A 5FGCB 2HMIC 1WFMA 1JF7A 5E2TL 3WE1A 4P3DB 2Y1AA 1BYOA 3MLRL 4PCTA 3P11L 5IK3A 5I6XB 1X4YA 1LO0L 2XOTA 4P2QD 5CGMA 4H8WH 5KA8A 4P23C 4FFZA 4FFYL 5K9KA 3BGFB 4FQXA 3NGBB 1F58L 1ZT4B 4FADA 2R8SH 2V2XB 1RZ7H 1WICA 2X2YA 4GKZA 2PXYC 4JLRB 3TL5A 1TENA 4HBCH 4NLHA 3T3MF 3FCGA 1QTSA 2PP9A 1LGVA 3C60D 2W9LA 4XNAA 5JOFA 5DHXB 3DGGB 3HI5L 4QT5A 5JHBA 2BOCB 2AHIA 1CPUA 5IQ9B 4JM2A 5IMOB 3LIZH 2MNUA 2VDNB 1I1AC 1E28B 4PEEA 4CC4A 1IC5L 3V4VH 5FW8A 3GHBL 4FQJL 5JMOC 3L81A 5C70A 2HLFC 1SJEB 4BCXA 3BPCA 5D96B 4K9EL 3X3GH 3OAYH 2ETWA 3RO1A 3NIDF 4FL4C 3BT2L 1R3HA 4GXVL 4X5WB 4CVXB 2IPTL 2P5WE 4QHPA 1KXTB 1NCBL 4JRYB 5EOCJ 4Z5RA 5HHME 2VXUH 4QY8B 1H5BC 4MVBD 1IBBA 3MUGB 4UQEA 1E5BA 1XAUA 3QJRB 4H44C 1FQ9C 1YUHB 2BNQA 1L6ZA 3PREA 3BLBA 4PW3A 4WK4B 4YQXH 5EBLA 4OHEA 2YARA 1GOGA 3MRFA 1CICD 3IPBA 3CN0A 3KYMB 4RMQA 1ZE3C 1TQUA 4M93B 4UT6A 4U6VL 1J8SA 1UD6A 5DRXA 3SDYH 2WXJA 1URLA 3EH4B 3JV5A 4HLZG 4NCC2 5DHVH 5T1LD 2XWBB 1NGWB 3EYSH 4Y2NA 4ONFL 5D70H 1G7LB 4G6FB 3WMQA 1NWPA 2EIZB 2FBOJ 1A6WL 1DANU 4JN2A 4NRYA 1GZQA 3W0WA 1VHRA 2C7FA 3AVEA 3F7QA 1F18A 3L17A 5F7UA 3LNDA 5ERWA 1FCGA 1NIDA 2XN9A 4JLRA 3QB7C 1D7FA 2MCAA 7PAZA 1B0WA 5EEYA 2H8PA 2CMAA 4QD2E 3BWZA 4P46D 2AJSL 4LCWB 4NQVB 1MCPH 3VFOB 1E2ZA 3TT3H 1RK1B 2NY5C 3MRHA 3QNZB 1R5IA 1B4RA 1NQBA 4PVNA 5BQDA 3D07A 2W07B 1LYVA 4GG6E 3MCKA 1NIBA 3M17B 4Q6IC 5B21A 1IRAY 1D9KB 4N90E 3RWHB 2FHCA 4TVVA 3WGUB 2IDSA 5IV2B 1JUFA 5F93C 1IC1A 2ZXGA 1J5OL 4PJ7F 3GHBH 4HEPA 5I18H 1G4RA 2FX8H 3ZHLA 2GT9A 4POYA 3LNEA 4O02L 3S3FA 4L9LB 3JWOL 2XSKA 3QEGH 2JI1A 1XB3A 4CBPA 2F19H 3DI3B 1P84K 2CIIB 3WXWL 2OR7A 1DQJB 3ARFB 1U91A 4NN7C 2GC6A 3HC0B 4M6OL 4OLUH 5GJSH 4XAKD 3BWSA 2EYSA 2ICWJ 3FFOA 1EAPB 4PSPA 5LDSA 4PJEF 3EYOA 1LWHA 3AG3B 3V6OC 3MJ6A 5ESVB 3JV6A 2ZX8A 4YUEL 1IIKA 1TETL 1QRNE 2IDQA 2ROXA 3WNOA 3HZMB 4N24A 1OTUD 1OF0A 3K0YA 2NNFA 1JTOA 4K5PA 1AKJA 2FGWL 1O6SB 1F6LL 4GXUM 1M7IB 4OZGF 3RWCA 1H3PL 3T8MA 4E41B 5JHDA 1CE6B 3ZHKA 3OM3B 4YFLF 3TESA 2WVSA 3P11H 3DX8B 4IOIA 1Q9WB 4RAUA 4TVPH 4EN3B 4BQ6A 3LXCA 1X7SA 5KYUA 4QRTB 4YDVB 5IVXF 4R5TA 4QHMB 1JRHH 3KNBB 1CG9A 4HS3A 4XNDA 4PHZA 3TJEL 4DKAA 1TVHA 4X8JA 1JPEA 1Y6KR 2VQUA 2AM2A 1LWJA 2G0LA 2H8PB 3VFWA 4Y19B 3KLAA 2DAVA 2PTUA 1PZ3A 1SXNA 2F7PA 3B8YA 3VMPA 3QQDB 5T1KD 1QO3B 3MV7D 4P9MH 2EDHA 4LHUA 2R23B 4NQCD 3KR3L 2A74C 3CIQA 5I75C 1NCGA 3GBEA 2GAZB 1Q4NX 2QQLH 3JVGC 4JN1L 2VIRB 2X1PA 3GF8A 4AH2A 1MJ8L 3EJZC 2FX7L 1HKLL 5I19H 4GXVH 2OX5B 2ENQA 3EOTL 3M07A 2HNQA 4BM7A 2PABA 5GGTH 2R29A 4AM0B 4TKWA 4IKLA 5PAZA 2VDQL 3MRPA 5F89A 3ZM3A 3CSTA 1J9QA 3X11A 3A21A 4WFGD 4KY1H 2H0EA 3CWGA 4G70B 5LGHL 4FCAA 3JVFC 2OSLB 2YPVA 4I4WB 2DWEA 4IHBA 3D48R 3A23A 1M7IA 4KI1A 4KK5C 4XP6L 1KLUB 1RZPA 1FBIL 4XI5D 4XP1L 3VDCA 3R4RA 4GG8B 4Z76A 2OV0A 4FQPA 4LSVL 2Y6TE 4EN3C 4WTXA 3ERXA 5L2JA 4YAQB 2KZKA 5DHVA 4JPWL 4XB3A 2EJ1A 3GSQA 1GIGL 2PWEA 4NQXB 1JFQH 2NY7L 4BYHA 3OLRA 1E9PB 1OCZB 3CQQA 3SPCA 5D7IB 3QG6B 4ZX4A 5IVXE 3I50L 5A2CA 3SE3C 3WU1A 4FJYA 1EWHA 3Q8BA 4JO8A 4RRPG 5KANI 1VZGA 2HAZA 1KBWA 1GY2A 2EZ0D 4MNGB 4JG0H 25C8H 4TUOB 1HJBC 3BP5A 2PF6A 3WFBL 3EYOB 4FOMA 4XN2A 5DF0A 5K9VA 1ETB1 2E8ZA 2GG1A 1EZUA 3DX9B 5D6DA 2OTPA 3T8XB 1MUJB 2I4GA 3WFDL 2B1AL 3VFGL 4EOWL 3F12B 3S3DB 2YQGA 4KKRA 1RULL 1ZCRA 1QLRA 2ZXWB 5FYKL 4D9LL 4J3SA 15C8L 4P3DA 2GY5A 3VI4E 3B5HA 5DO8A 5I73C 5A6MA 4QLRA 3SY6A 4RDBA 1BBDH 5JOEA 1GYAA 4FA8A 3QPQD 5CJOH 4HULB 4RA3A 4DFHA 4GE2A 3MLPA 1L6PA 3SODB 1UT9A 1LP9F 2DMCA 3GBLA 1NGYB 4P2OB 5K39A 3ESUF 5BVPL 2BSED 4H4NA 3AXIA 4QXUL 2F6AA 5D2LF 3P77B 4JL1A 1N4XL 5FM8A 4MNGA 4K5MA 5DC0A 1WT5A 3N44B 4XXWA 2EP6A 4JDTL 4LEXL 2K8MA 4A2MA 4TOYL 1OAKH 3SKNA 3HLKA 1T04A 1MVYA 4NUGH 4PJHF 5SX5K 3VFRA 4AENA 2GSIB 3BVNB 4N2GA 1E9PA 1QACA 3LAFA 5CN2A 2I6PA 1LXMA 5DK2B 2NY6B 2Z8WC 1DE4A 1DVQA 2V5SA 3O4SA 4ZMZA 4ADGA 3EBAA 4JPVL 4OGZA 3LHPH 2CDFB 2VJXA 1EUUA 3VE0B 3EGSA 4X6BB 4W4OC 3KPRA 3O6FB 1WF5A 3H2PA 3MRFB 2BFVL 5K59E 3TH2T 4MXWH 1Q6PA 3WFCL 3T0EC 2DWEB 2E74C 5B39A 1N2RB 4ZUWA 1YMHA 3EJZD 2DIJA 4HGKC 4N8CH 3CGTA 2DJ4A 4RGND 2WXKA 3HVDA 3BWUF 5AVYB 4HKZA 2C3VB 4MCZA 4YHML 4HMCA 3AADB 4PJDF 5EBMB 1BZ9A 5DUBA 5FKAA 1OT4A 2K7PA 2WYTA 2YPKA 4P5KA 4FABL 3BYYA 3T65A 3KEDA 4HZLB 3T6VA 1VPOH 2ODIA 1E43A 1NKGA 4QXGH 4D8PB 4PJEB 3DO7A 3QNXB 3FO0H 3Q3GA 4DEWA 4H0GA 2CNIA 2X0UA 4OQTL 1DE4B 1FJ1A 2F6WA 3FTSA 3MXWH 4UQ2B 3RVXD 4XVJL 4E0RB 1G1CA 1TJXA 4BFOA 1N64H 1A2YB 2EXTA 2QCTA 5KSBA 1S9WB 3G08B 2CKBL 4KNTA 3SKNB 5J1TC 4C4KO 4C12A 1T6WA 5AZEL 5TE4L 5KAQF 2D7NA 1RULH 3RL1B 2VZ1A 4C56B 1J1OL 4MJHA 1KCRH 1CLCA 4KHXL 1SYVA 3N6YA 2R0KH 4YH6A 5HGAB 3OWEA 4UYQA 1J05B 4QHLA 2MJWA 4BFJA 2HFFB 3GYRA 1ZY9A 1FO0H 4RISH 2D7TH 2XTSA 5F72S 3QJQB 4FC3E 3CV5A 2BZ7A 3MRQA 4YDMA 1U24A 4TSCL 4CMHC 4CILA 5I1DA 2EILB 3RDTD 3O9WB 2J43A 3QDHA 1BDYA 1OOAA 4LLQA 4EIBA 3T5WA 3CMOH 1KBGL 4JR9H 5E70A 1ZT7A 4O02A 3KDMB 4XBGB 4F57H 4ES8A 4N8VG 2VAJA 4Z7QE 2E7MA 3EGDA 4LLMA 4FQ2L 4OCRL 3RFRA 3QDMA 5A16A 3STLA 4U3SA 1G0DA 1OLLA 3ZL1A 3ZRSA 2J6EH 3SDAB 1R5VB 3W37A 2IH3A 3J7HA 1DBAH 4PJFE 2QZ5A 4AYFB 1BAFL 3S35X 1ZHBA 4KY1L 4BD4A 4BKTC 5T1JA 4PJ5D 4Z7AA 2IWFA 3IFNL 1EFQA 3ILQC 4P2QA 1PG7X 2YRPA 3VQ2C 4N2HA 4HYTB 5HDQH 2FB4L 4Y0GA 1AZUA 5M95B 1HH6B 5IEHB 4K7PX 2WNKA 1F3JA 1TJHH 5IW1A 5HI4D 3T4YB 5CLYA 4NM8H 3U4EB 4A6YB 4Z0XA 3MRIB 2LU4A 2KUTA 3C09B 3O45A 4E41D 1C7SA 2NZ1A 2XY1A 3BFOA 1QTPA 5AW7B 2VERA 1S6NA 3K74B 2EIBA 5AVWB 5LN4A 5DMKB 4B9PA 4J6RL 1IAMA 3CFNA 4FQIH 2VN7A 1O7VA 1YJDH 3LEXA 3OC8A 2V2TA 3MI6A 1IGCL 1R3JB 5E4OA 4R0SA 3NIFE 4F58H 2WXRA 3J8F7 3C60C 6TAAA 4YR8B 1AC0A 5A2KH 5GGVY 4S1QL 1LHZA 4LLYB 4J3OD 5JIMA 3CDYA 5C0BA 2DQDH 4PV8A 3EB1A 5EO9B 1EBAA 3FT3A 5B1JC 4L4JA 4X6FB 1U58B 5GS3A 4WDIB 3ARRA 5HDBB 4QY8A 4NO3B 1VADB 2UY7B 3X17A 3H7BB 3QQ9C 4Y2OB 1TQBC 5CJQL 4ONGL 1M1XA 3CVHL 1HCZA 3SDDB 2F7QA 4LSQH 2P46B 2GC7C 2CXKA 4GUPA 2GBUA 4Z8FH 1KB5A 3VFNB 1AR2A 2UZIL 3QDGB 5AVUB 1UB5B 2O5XH 3FQUA 1EX0A 2CGZA 2DMBA 4JFUA 4N0YL 3IFLL 5JDSB 4UQAA 3ZT6A 2NUPB 2X70B 4LKXA 4P4RA 4QT5B 4NZTL 1DEEB 3HS8A 1J8HA 4JM2B 5F1NB 2MPAL 5F8RC 1EERB 4ELMB 5BRZB 1WWCA 4UB0H 4UT9H 4JFOB 4NM8L 3P4OA 2JJTA 5E8PB 5I16A 2IAND 1MH5B 2AJVL 4JCLA 4RGOH 3NESA 4IMLA 4L1SA 2HX7A 1PLBA 4YEEA 3ZYJA 4AGNA 2CGRL 2R4RH 5CU5A 4URTB 4ZI4A 1VGEL 3PAYA 4JQIH 4WTYA 3A4AA 3UIZA 1FLRH 2PR9A 3UZQB 3QYMA 1QMUA 2AJSH 2B08A 2FIKA 4LCCC 5DVKA 5C6TH 1HQ4A 4DPRA 3I80A 4G3YH 2W07A 1J6UA 2A6DB 4PV9A 1WFJA 1V55B 1P4LA 3KHOA 4IOFD 3O6KL 1AANA 3Q9PA 1Y7VA 2DLFH 1N9PA 4IOSA 2WTPA 5CP3H 3SDCC 3LPOA 3GMPA 1I57A 3GO1H 1CJYA 3EOTH 3GJFA 3PP3H 3OG6B 2YD7A 4XPGL 1TYEB 1ODAA 2BY3A 1XEDA 2FX7H 3MJWA 5FOBA 2SHPA 5EB9A 5GS0C 4UOZA 1R3KA 4X4KA 3WJMA 3OG4B 1JVLA 1RZGA 1KPUB 2R7EA 3FOLA 2BP5M 3LEVL 4LNRB 4P07A 1A3RH 1SBSH 3R1GH 4A2GA 1I3UA 3HAEH 2GTQA 1E27A 2D4DA 2I5YL 5JQIB 2H9GA 3U83A 3ILQD 1PGRB 2P8LA 5J4MA 2PMZA 3FQWB 4QRRE 3Q9QA 3D39B 2GJZA 4BELD 5FYKH 4JDEB 1IO4C 4A7VA 3HUJA 2FT6A 5E6SB 4WJ5B 3F6JA 4HU2A 1JYXA 3EFFB 1M7DA 2HUEA 1OSZA 4OD2A 3MFFB 4Y2DB 5D6CA 1LDSA 1OQOA 1G7HA 1ZMYA 3ARGC 4NKOB 4PRBA 1KTKE 4PH8A 4OHHA 3I74A 4WNJA 4D3CH 2OP4L 1CDCA 1DCLA 3F58L 4X9YA 2H2SD 4Z7WE 5GS2D 1KCBA 1HNGA 3PPSA 2WQ8A 2V9RA 4KJQC 3RURA 4LQFH 4ABVA 1BOYA 3EADA 3M46A 5F7WC 2YLKA 3ARGA 4V2BA 5I8OL 4TN9A 2O1AA 3EH1A 5GZND 1JPSH 4M6MH 4L29B 5FF6A 5IHZB 2ICWB 4JFFD 1GFYA 2P5EE 2C4XA 2NY6C 2WKLA 4JFZH 1A6UL 1P5UA 4XHQA 5EUKB 5LVEA 4U6YA 4X4XB 3AU1A 3ZKMC 1I1AB 4AG4L 1G6VK 3LH9A 3U2JA 3L4WA 3MLRH 2O5YL 4BJLA 3MACH 2H32H 2GJ6E 5ID1B 1UKSA 3QA3A 4TTDD 3UAJD 1P5UC 2VDQH 3FW6A 3VXRA 1SXBA 1G7MB 4G8GB 1AZZC 1IEBB 2J57A 3GINA 4XXCC 3GSXB 4KZDH 4I13B 5D7EA 1S8DB 2XG4B 4N2OA 4DP8X 1A7BA 2YAQA 4JVWA 1R6VA 2W9EL 3BH4A 2M1KA 3ARBB 5BO1L 5GRVK 3S4SA 1NGPH 5I6XC 4WW2A 4E5XB 3WY3A 2PO6C 5C07B 3OAUL 1RURL 5AKVA 5DJAA 5SWSD 4HBQA 5DEGB 4P57B 3V52L 1XMWA 2JTDA 5T3XE 4JO4H 5AG8A 3IRPX 5I73B 4YDJB 1LP9A 2GCYB 2X9WA 4DVBB 1H6EA 2E4FA 2HTLD 4KVCL 4J4PC 5FYJD 2OUDA 2W0KA 1FVDA 4G7SB 1HYSD 4JRXD 5CBEA 4D0DA 4IHOB 3LRSB 2CUMA 3VXSB 4HGWB 5BJTA 1PD1A 3V6FB 2HCZX 4Z7WF 1OALA 2CQVA 4G42A 1I8MB 2C9QA 4RI4A 4P46B 2VZTA 4HS8H 4PJAF 3UX9B 1MCWW 3C6LA 3WCYA 1DQTA 4UU9A 3E6HA 3CVHA 3S3CB 1CGXA 2Z0BA 4PJGB 15C8H 4UTCA 2Y67A 1FGSA 3VNZA 4F37K 3OLIA 4IQHA 4JFHD 4FKHA 3N9GH 4AMWA 4MSWB 3U36B 4HHGA 5TQ2H 4IEFB 4F24A 1FIEA 1ZGLP 4HQQL 2A38A 4Y1AE 1YTWA 4XNBA 3NJHA 2PLTA 3PWJB 4FFYH 5K9OA 2YD1A 3ROLB 3B2VH 2IH9A 3S3KA 4BHUA 4EPSA 1FL3B 3F7YB 3P2BA 4UZUA 4OZ4B 3BO8A 3QCBA 4IJ3C 4KDTC 5I0YA 1JZ2A 1QEXA 4N85A 2WZ6A 3V0IA 1I8LC 4XPHH 3HI6L 1H3WM 4B9GA 1SFDA 3ETTA 2GQHA 2OSYA 3S98A 4KTDL 5TTRA 4HH8A 5E5MB 1W78A 3K72A 2ZD0A 5HGHA 4ZMVA 3PWVB 4J1UA 43C9A 5I1LA 3U6RB 1OANA 3NIGF 3OKEA 1KN2L 4YO0A 2BZDA 4F2MA 5L2KD 2H3XC 1PLCA 1DLHA 3HNSL 1NJ9A 2AQPA 3P9MB 5ACMA 1K8IA 4KJQD 2A74A 1HK6A 5DJ0A 5ID1A 3HZ3A 1K5WA 1H3VA 1OAZL 2MQ0A 3BRFA 1HILB 4PCSA 4G72B 3CHRA 4R26H 4QUMA 3TJHD 4DP9X 4ZYKB 5K9QI 3B83A 4QRUB 3QW9A 4JGJA 5C0NC 3PS5A 4YHNB 2J6WA 4XN4A 3WEXA 5I5RA 2E46A 2VDKL 3SO5A 4FQQB 1IAKB 5DA4A 4KJWC 3T6ZA 3OSKA 2F53D 3CDFA 2B5IC 2VE6A 2Y2WA 4ZUWB 3D34A 4CN6A 4J6IA 4LASL 5DRZB 3EYSL 1YAZA 4J8QA 5CCJA 4LSUL 1WAXA 3P30L 2HT2C 1UQSB 3V52H 3NN8A 1OD9A 4RGNC 3LQMA 3B7YA 4OJAA 3CN2A 3KGTA 2X40A 4WHYG 3WS3A 4M62L 4YR6B 4PLNC 1YEFL 3FFCD 4PRHE 1F4WL 1ZANH 2AXJA 3ARDC 4HUWA 4HX1B 3ECBA 5H94A 1PTVA 3VRIB 5LXGH 3MLSH 4KYRA 3MYZA 1KXHA 1DUYB 1GY1A 2IPTH 4MQXD 3KBFA 4F7MA 3P73A 1BD2D 2MHAA 3UBHA 4AZ1A 3LKPB 1QPKA 3LS5H 1I7UA 2Z4TA 5D93B 3QHTC 3MV9D 4NBXB 5KACA 2Y5EA 5C0EA 5FM5M 5JOPD 4FFWC 4Z7WA 3K72B 3WENA 5I1LB 3RA7L 4DESA 4CSSA 2H04A 2SEBB 4PRIB 5C0BE 1A6UH 3FMGL 1DLHB 4XCYA 1YGUA 2QJDA 1MF2L 3QR1A 1PEWA 4JGNA 3MV9A 1I7ZA 1HH9A 1YQVL 5C7XH 2YWYA 1T3FA 2FIRT 2IMMA 3VO0A 4KI5D 3K1DA 1KJ2B 5DHYA 3TBVB 5BV7H 1PDKB 4LQFL 4QXTA 4X8JB 4FXKB 1EMTL 5F7HA 2NTFB 2YAPA 3RWEA 5J11C 4C59B 2B5IB 3DA0A 2VABA 2W80C 4EE2A 1IT9H 2YEZA 3BCDA 5EORL 4MKTA 3ZTEA 4PWJA 2KLTA 5I15L 1GOHA 4FQHA 4Z7UA 1ZLSL 2V3DA 3STLB 4B9KC 3D25A 5JW5A 2A77L 5BZWA 3U7YL 2A6KB 1HI6B 3TPKA 3GI8H 3GBMH 1A3LH 2ZWYA 1A14L 3AAZB 3MJ9A 3ZDZE 4ADIA 3VDBA 1LEIA 2I3RA 1MWAH 1INQB 3P69A 3DV4B 1IGIL 1QYGH 2W0LA 3PJSA 1GYWA 1HE8A 4TV3A 3UJTL 4ZMYA 3ESVF 3H9SE 3MXVH 3KPRD 2I5YH 3QDMD 4PLKC 1GS7A 5E2TH 3L5WB 2XZAH 1DBML 1CE1L 1I8UA 1ILSA 3QAZB 2LR4A 3RWEB 3QUMH 5K23A 4LLQB 4N0RA 5KYNA 1N7MH 4OZIB 5CWSA 1MHPH 3P54A 2J55A 2O6CA 2KDGA 4JNBA 3RJDA 4OGYH 4IJ3B 2FEEL 3NFPA 3NJVA 2J4WL 3QFDA 4NO2B 3TCXA 3GMOA 4Y9EA 1DFXA 4FFVC 4HFUH 3QP3A 1I31A 5DD6A 2FD6L 4JJ5B 3Q01A 5JHMA 1ZGLM 2D0GA 4W6XB 3MRDA 3S48A 3SJVA 5C0FB 4U0RC 2P80A 3N5AA 3QA3B 2EEBA 1SBSL 3R1GL 4LSTL 2VSMB 1Q1MA 4GO6B 2J21A 3TIEB 1I4FA 2RALA 1Q6NA 1A4BA 1T48A 1G1HA 4KQ0A 1D5IH 2X9XA 4OGAD 2Y7NA 5HJ3B 1MNNA 4WVRA 3CFIC 3RVVC 4KWUA 5I28A 1QWUA 1KBPA 1OE2A 4K9EH 1PYWA 5I74C 2X4QA 1O9WA 4KX8A 4O2EB 4B9IA 1G6RA 2D7MA 4U1LA 2AMUA 2NY3C 2ZYIA 3RGVD 2YD9A 1KMGA 4F20A 1WG3A 2BHZA 4GQ9H 4OIIH 2OL3B 2P52A 4P3CL 5D7LD 3HRZA 3TYFA 5K25A 4PCKA 3NFPB 4NO2A 3VGHA 3ECWA 3FRPG 3SPHA 5DUPL 4YLBA 1UH4A 2K9FB 2WO3B 2E6JA 1NCWL 1NPNA 4P5KB 3TEZA 2XRAH 3C6EA 2DS4A 1B6DA 3ILPA 4ZFFA 1ID5I 2QCJA 1A6VH 1NC2D 3APFA 1BBJA 3GMMB 2XWZA 1YEGL 4FULA 3ZTNL 1J87A 1JWUB 2DQJH 3L95A 1BM7A 1OGAE 3BAWA 2G59A 4I77L 2XKNB 1S7RB 3FUKA 3NJFA 5IBTH 1J48A 3U82B 1R34A 1FPTL 4J3TA 4MYWB 4WIQA 4XPHL 4AXWA 5HI5C 4PV8B 5K1JA 3INUH 2BC4A 4HT1H 3S6CA 1WP6A 2C9SA 5HJ3A 3OLGA 4HLEA 4JG1L 1WC7B 4OZIA 4UCFA 3QZOA 2RIKA 3CZLA 1WAAE 4ODHL 4LDCA 3RUGB 3HC2A 2WQUA 3ZKNC 1Q8MA 2XWCA 2GITB 2BZLA 3TO4C 1ASOA 1DBJL 1IAIH 1CDBA 4M1DH 4JO5A 3L7EB 1KYUA 4JY6B 3BPLC 1ZPUA 5KJRL 3IKCB 4YHLH 2EEDA 2W0FA 1XQ4A 2Q20A 3E7JA 3CFUA 3L3GB 5B4MC 3HZKB 4NQCB 1BZCA 5KA3A 1NOAA 2MCG1 5EIVA 4OUOA 4D3RA 4Y9FA 4Y4FB 1UENA 4QYOB 3U30C 3CIAA 5EOCH 4S1SL 3U4KA 2WHVA 4CSZA 3F5WB 2WXGA 1Q38A 3PJNA 1IGML 2V0AA 4AL8L 4BH8A 4MX7A 4OLVL 3NCMA 5I5JA 3CBJB 3I6KB 4JAMA 4PG9A 1ZVYA 1FG9C 1VIWA 4HIXL 2QSCL 3MV7A 1CQYA 3VNYA 3JV4A 3K8KA 4L4TD 4KUZH 4BUHA 1SVBA 4L4TB 5BRQA 3M1OA 1W72H 3R4DA 5AD0B 4NIKB 1RURH 4XWOC 5JLZA 2E7LA 2ESVB 1BP3B 1NLDH 4QJ5B 4LARH 3Q44A 5EO1B 1UJ3B 2VRAA 1KIRA 2X4OA 1OM9A 1ZV9A 3LX9A 2RFXB 4PIBA 1ZLWH 3OGCA 4HZAA 5EU3B 3MOBH 4HK0A 4UM8A 4ZUVB 3VI4A 3ZE2F 3ZKSD 3PWLB 1T2XA 3WD5L 5TGBB 2Q86A 1KXQE 1M53A 3S37L 1NCCH 4NUJA 4E9TA 4Z6AT 4PIRF 4TNWF 5MEPB 3TV3L 4P23D 1NPJA 5F3HA 4APXB 4LHQB 3CD4A 4EQ2A 4MD5B 5T1MB 1WD8A 5K9JH 2F1EA 4O2FA 4WKZA 5TDNA 1T5XA 4B3EA 1K8DB 1O7DE 2B2XL 4G11A 3L1FA 1AC6A 4I0PA 1UD4A 3BHBA 2EUXA 1MIEL 1MREL 2A1WL 2ZUWA 4YDIH 1QFWL 4N2EA 3S4SB 3CTTA 4JFXA 1JGEA 5JXEA 4BWUA 4R2GB 2RQEA 4U1NB