4WTYA

Structure of the ptp-like myo-inositol phosphatase from selenomonas ruminantium in complex with myo-inositol-(1,3,4,5)-tetrakisphosphate
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
314
structure length
314
Chain Sequence
QTVTEPVGSYARAERPQDFEGFVWRLDNDGKEALPRNFRTSADALRAPEKKFHLDAAYVPSREGMDALHISGSSAFTPAQLKNVAAKLREKTAGPIYDVDLRQESHGYLDGIPVSWYGERDWANLGKSQHEALADERHRLHAALHKTVYIAPLGKHKLPEGGEVRRVQKVQTEQEVAEAAGMRYFRIAATDHVWPTPENIDRFLAFYRTLPQDAWLHFHSEAGVGRTTAFMVMTDMLKNPSVSLKDILYRQHEIGGFYYGEFPIKTKDKDSWKTKYYREKIVMIEQFYRYVQENRADGYQTPWSVWLKSHPAKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MYO-INOSITOL PHOSPHOHYDROLASE
publication title Structure of the PTP-like phytase from Selenomonas ruminantium in complex with myo-inositol-(1,3,4,5)-tetrakisphosphate
rcsb
source organism Selenomonas ruminantium
molecule tags Hydrolase
total genus 110
structure length 314
sequence length 314
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14566 PTPlike_phytase Inositol hexakisphosphate
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1690 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4wtyA01
3.90.190.10 Alpha Beta Alpha-Beta Complex Protein-Tyrosine Phosphatase; Chain A Protein tyrosine phosphatase superfamily 4wtyA02
5KA2A 5K9WA 1EEOA 4RHGA 3H2XA 4MBBA 3D42A 3MOZA 4ZN5A 1AAXA 4WTYA 1G1FA 1OEOX 4WU3A 4JBCA 3I80A 3D1OA 1ONZA 1PXHA 2OC3A 2F6ZA 3A5KA 2F6WA 3QCHA 2I6JA 5MMZB 4IKCA 1C86A 1BZHA 4J51A 3V0FA 2I75A 1YWFA 2CNIA 4QUMA 2BV5A 5KA8A 4JMJA 1ZCLA 2H4GA 2F6VA 2CNEA 3RZ2A 3B7OA 3ZM2A 1ECVA 2CJZA 2HB1A 3F9BA 2HNQA 4NYHA 4OHLA 2F70A 3ZMQA 2B4PA 3ZM0A 2I3UA 3ZMPA 3AWGA 3LJ8A 3SR9A 2P6XA 4D3RA 1ZCKA 2H4VA 1FPRA 4KYQA 3QCJA 4BPCA 4JNBA 3QCKA 2GWOA 1V3AA 3BM8A 2H02A 3QCCA 4R0TA 5KA4A 5EHRA 3GXHA 1G7GA 1PA1A 2GP0A 1KAVA 2I3RA 3BRHA 1LARA 1I57A 1XRIA 3EB1A 2WGPA 5LXQB 1T4JA 3QCDA 1XM2A 1SUGA 3EMUA 2GJTA 3BLUA 4NWGA 3EAXA 1Q6NA 2I4HA 4HJQA 1JF7A 4Y14A 4OHDA 4AZ1A 3SMEA 2I6OA 1BZJA 3F41A 5KA1A 4PYHA 2I4EA 4KI9A 5J8RA 1RPMA 1X24A 2CM8A 2Y2FA 3O4TA 2VEVA 2QEPA 2YDUA 3D9CA 2I42A 3QCEA 2CFVA 4I8NA 3S4EA 2PI7A 1U24A 5BZXA 4R0SA 2HNPA 4NWFA 2SHPA 4NNDA 1ZZWA 1OETA 1P15A 3V0DA 4KYRA 4S0GA 1XXVA 5KACA 2QDMA 4YR8B 4RH5A 1Q6MA 3NMEA 1T49A 1XBOA 1WRMA 3OLRA 5K24A 2NLKA 4GFVA 2BGDA 4RKKA 4GE5A 1OHDA 2I1YA 4WOHA 1PYNA 2F46A 1KAKA 1OESA 1YGUA 2QBPA 1L8GA 3S3FA 2BIJA 5BX1A 1GWZA 4NX8A 2H03A 1PTTA 2B4UA 5AWXA 1NNYA 4Y2EA 3V0GA 4GRZA 1Q6PA 3F81A 2G59A 2H04A 2J17A 1ONYA 1PTYA 5BUGA 1U26A 2HVLA 1EENA 5M43A 1MKPA 2CNHA 1C87A 2VEYA 1NL9A 2ZMMA 3MOWA 4GRYA 2CM3A 2F71A 5KA7A 1OHCA 2IMGA 1OEMX 1C85A 1G4US 1QXKA 3O4UA 3RO1A 1Q1MA 4OHIA 3QCIA 2I6IA 5BZZA 2CMCA 3V0IA 2PBNA 4HJPA 2QBQA 2A3KA 3RGOA 3AWFA 3ZM1A 1G7FA 4D3QA 1D5RA 3QCNA 4YAAA 1YFOA 2FJMA 3EZZA 2B4SA 1GFYA 4JMKA 3I7ZA 1NWLA 1XXPA 2QCJA 5IBSA 1C83A 1I9SA 2PQ5A 2MBCA 2BGEA 3D44A 4GFUA 4GS0A 1LQFA 2B3OA 4QUNA 3O3LA 5KADA 5KAAA 4ERCA 3V0HA 1T48A 1NWEA 2CM7A 2QBSA 1ZC0A 1BZCA 1WAXA 2CNFA 2NTAA 2HY3A 4QBEA 1C84A 2M3VA 1G1GA 2C7SA 2PSZA 2A8BA 4OHHA 2C46A 2P4DA 4HRFA 1G4WR 1JLNA 2NT2A 2I4GA 2OUDA 1R6HA 2OOQA 4H34A 1OHEA 2E0TA 4GE2A 1YGRA 3QCFA 1NZ7A 2G6ZA 2CNGA 4ZI4A 4QBWA 2PT0A 3BLTA 4QAPA 3N0AA 3S4OA 2VEWA 1Q6JA 2B4OA 2J16A 2NZ6A 3ZM3A 2VEXA 2JJDA 3ZV2A 3QKPA 4RI5A 5K23A 2AHSA 2QDPA 3S3HA 1FQ1A 3S3EA 1OEVA 3OMHA 1PTUA 3O5XA 2BZLA 3QKQA 2NT7A 1OEUA 1LYVA 5IBMA 3S3KA 5I6VA 1I9TA 2H4KA 1QZ0A 2QBRA 2F6FA 4B04A 1Q6TA 2QCTA 2OZ5A 1PH0A 1Q6SA 2PA5A 4DGXA 1G1HA 2CM2A 2Q05A 1YZ4A 3D1QA 2F6TA 2B49A 2ESBA 1YPTA 3U96A 1YN9A 1RXDA 2VEUA 1NO6A 5K22A 1VHRA 3EU0A 4GWFA 2NV5A 2F6YA 1U25A 2CMBA 4RDDA 2QDCA 2CMAA 3QCMA 5K9VA 3A5JA 5K25A 1C88A 3QCLA 4H1OA 4OHEA 1A5YA 2HXPA 3M4UA 1L8KA 4RI4A 4BJOA 4WU2A 2HCMA 1PA9A 2FH7A 3V0JA 2J16B 4TVVA 2RF6A 2Y96A 2R0BA 2ZN7A 2Q47A 5GTJA 3D1HA 2I6MA 3RGQA 4Z6BA 5HDEA 1YTSA 5KA3A 1FPZA 2I5XA 1J4XA 4RH9A 2DXPA 3PS5A 3QCBA 3GXGA 4D3PA 3CM3A 3QCGA 4QAHA 4ZRTA 2HC1A 2AZRA 1PTVA 1WCHA 1YTNA 3F9AA 5KA9A 1M3GA 4DGPA 4GE6A 2HC2A 2I6PA 4ICZA 3CWEA 4PVGA 3F99A 5KA0A 3AWEA 3V0EA 5EHPA 5KABA 1YTWA 2FJNA 3I36A 3MMJA 3O4SA 4R30A 2B07A
chains in the Genus database with same CATH superfamily
3VAJA 2KG0A 4C3KA 4WKYA 4HYKA 3ULHA 3BSOA 1TFYA 5DZ7A 4YDDB 3HF5A 1IJFB 1HA1A 3MPDA 3I80A 3CD0A 1RTJB 1R0AB 4CO1A 1ZAVA 1RISA 2BW7A 4IKCA 1HNXF 1FE4A 4J9QA 2ZBCA 3A4TA 3TR5A 1Q8LA 3H5XA 3C16A 1JLFB 3RZ2A 3KMSA 3B7OA 4XO0A 2UU9J 2XLIA 3KTQA 1PC4A 3F9BA 4YFUA 5EDWA 2DGUA 5B0BA 2XY6A 2BM0A 3J7YU 4FYVB 1IKWA 5KFYA 1JKHB 1FRLA 5IFMA 4J91A 5J1EB 2NR0A 4LRBA 1NO8A 4GVBB 2O66A 3QGGA 3QCKA 4DUZF 4BWMA 4U6PA 2DIVA 1JNRB 3EXCX 4WP8A 3LALA 2CG4A 3SI8A 1KAVA 1XN9A 3MPVA 1QJHA 1YJNS 4Q5VA 3W9HA 2BBEA 1I57A 3AOBA 2IPOB 3TW0A 2RQMA 3BO3A 1XM2A 1LWFB 4NRUA 2EKYA 2QA2A 2FPHX 1F9HA 4ZCIA 4KPCA 4WK3A 3OXFA 4Y14A 2MLZA 5DQHA 3TA0A 2R2UA 1LFPA 3RRGA 1RHQB 1N0UA 2LVWA 1TL1B 4OX9F 2PI7A 5BZXA 1VIOA 3R7SB 4KC5A 4DU7A 2VQFF 3TNVA 5J2MA 2OFGX 4NLQA 2BE9B 2L48A 2QSFA 4S0GA 4ZCLA 1MMDA 5IM0A 2DEIA 2Z8QA 2ATCB 4ZCKA 3SCIE 4FS2A 1B99A 2NLKA 4K5RA 2BGDA 1C0UA 3V6JA 4PG5A 3VVTA 1KAKA 5F41A 1R43A 4Q8EA 4Y2EA 4DG1A 2V8HA 4GRZA 2WK4A 4JV1A 2Z56B 4O3PA 1KVIA 2CZ4A 3FK4A 2Q3PA 3M1VA 2FJDB 1NL9A 4GRYA 4DFKA 2FJXA 2F71A 1UFWA 4JV5F 2BRLA 4ZVRB 3PX0A 1NHKL 4AQYF 1SKUB 4KRWA 2MZQA 2VG6B 3GG1A 5AXLA 4O3QA 2VG5A 1EEHA 2PMHA 1RA7A 4NLVA 1A0OB 4PWDA 4OZ2A 1K1QA 2XI3A 4QYRA 1I9SA 1K8AT 1J27A 4H4OA 3VAIA 2GAGC 3JSBA 1XNQJ 3JTNA 3TZZA 1WAXA 4R25A 1LEOA 4DLGA 2P4DA 4OHZA 4DJBA 4X84A 5ETSA 4GKKJ 2WCXA 4F2RA 4UZBA 5DS7A 5E3QA 1FD2A 3EDRB 5GADU 1HNZJ 1CJUA 1TUWA 4P7TA 3C46A 3EXYA 2GX8A 1TK8A 1C1BA 2V9KA 1LWCB 4LF4F 1IUJA 1FQ1A 4X4RA 4EMDA 2AJFE 3EE3A 1RGVA 4B9MA 2OFHX 1FO1A 4MKAA 3FRYA 3TQEA 5G4DA 1NEEA 2DEJA 4PYAA 1T95A 2Q1LA 1REVA 1G1HA 1HBOA 5KFQA 4RZRA 1NJIT 1EP4A 2YKNA 5J2MB 1H3DA 3QGPA 4HR2A 5KG7A 1YN9A 2AT1B 5IM0B 1JNZB 2CZVC 5E2QA 3IM9A 2CMBA 2EXUA 3GB0A 3NNHA 4IG0A 2NYHA 3MUVP 2HMIA 2HXPA 1H73A 2V6AA 4BCAA 1RT6A 1C0UB 5IWAF 4A8WA 1NXIA 1LW2A 3SCKE 1DLOB 2PDAA 3CVKA 1M5HA 2RF6A 3M6WA 1IWAA 1H2UX 2RRNA 1QSSA 5LL6d 2E5JA 2WVDA 4DG1B 4X66F 3W2VA 4JI4F 2DRAA 4OYBA 1TL5A 5KFWA 4DL3A 1HHTP 2UVUA 4RBTA 3CULA 4NASA 1IBKJ 3ILJA 4PWWA 1T05B 2FC8A 3EMTA 1CS4B 4PABA 4QAHA 4UAGA 4ZRTA 1Y11A 3HHEA 3QBCA 1HR0J 3VWSA 1WACA 4CH7A 3I5BA 4OX8A 2NPIA 4M63A 4WIQA 3UW1A 3TUJC 2MSTA 4KHPJ 4PUOA 3HVRA 1RT1A 5EGYA 3N6NA 3VHQA 3D5MA 3MMJA 2VG5B 1Y7PA 2DH9A 2IRUA 3CCJS 1VOMA 3QRQA 3EGWB 5DG9A 3MM5B 1I51B 2CIMA 3FZ2A 2PEHA 4MBBA 3VVUA 4WTYA 3R7NB 2JJ4D 2XMJA 3D0GE 4WKRA 1J5OA 3D1OA 3T1YF 3UI3A 2WVFA 1FRMA 4KGMA 2HVHA 1YWFA 4RO0A 3R2CJ 5KG0A 1VDHA 2LQ8A 2QMXA 2F6VA 2CG8A 2KHDA 1RB0A 2HVIA 5IZHA 3N79A 4QJVA 2AYBA 2KFZA 3GQCA 2BANA 4ECUA 3WIUA 4HV4A 4USHA 2IMOA 5IT0A 2KI2A 2CQ0A 4K7QA 3SR9A 5DQIA 4EYHB 4LFCF 2EW9A 4L75A 3T5HA 4ZPDA 1CJUB 2MZTA 5IV3A 1ZA1B 4KYQA 3D6FB 2WB4A 3FEYB 2MLYA 3DU5A 3M32A 2UXBJ 4DR7J 4OYXA 3DXSX 5JVGQ 1Y3KA 4RW8A 4OI1A 2W01A 2GIQA 2ZJPQ 4C48A 3AQPA 2DITA 1NJYA 2IVYA 1U6FA 2MPUA 3PJWA 1RWMB 1UEUA 2K06A 2ZKUA 4DFMA 3P5TL 4OHXA 4NWGA 3ILOA 1N32J 2I4HA 3ENWA 1Q78A 2F00A 5B0CA 1Y5NB 1REVB 2H5EA 5KA1A 1YIJS 3MEGB 3PEJA 2QEPA 4RLEA 2YDUA 3H2VE 1EP4B 4I8NA 2CPFA 4AL5A 1BQMA 5U47A 4AXJA 5J2PA 4R0JA 2L9WA 4YS2A 1HFEL 2JEIA 3DOLB 2WVCA 4IG0B 1UPPA 1RT6B 1FEEA 4J37A 3Q8VA 2UAGA 2PN6A 4Y6IA 3J7ZT 1RA6A 1WTFA 2XZWA 4RKKA 4PG6A 1G2EA 2AD9A 3MECB 3TJAA 2BIJA 5KFAA 2XM3A 1WOOA 3M7VA 4PR6A 4C98A 2V4RA 2PA3A 3PM9A 1NNYA 3V0GA 2G59A 5B09A 2UV8A 2VFSA 4ZIWA 5GMEA 3UCGA 5GAEU 2HVLA 2RT3A 4FBUA 5DJBA 1U45A 3U1MA 3UAGA 2LYVA 4M5DB 3D6HB 2B8PA 1SCJB 1G4US 3DGPB 4DV6J 1RT1B 2GNKA 3PW0A 3NGSA 2UUCJ 3IP0A 3VV2B 2ZKTA 3W61A 2YNHA 3F73A 1T7PA 3OUYA 4ZN3A 2FY8A 4PXEA 1J5OB 1N34J 1U1KA 2G4BA 3NS7B 4C8KA 3KUEA 4O3NA 5KADA 1M5OC 4RKUC 5HJYA 3POTA 1B4SA 2OJ3A 3QFWA 1RU2A 2Y66A 5DM6Q 1GG4A 3TOQA 2BANB 4YB6A 4DX5A 4QWEA 1D9AA 4ZPTR 2OEMA 4DV2J 1V9OA 2KVQE 2DGTA 2VFTA 2DGOA 3PY8A 5HATA 2FLLA 1GXTA 1CPZA 4B3SJ 1JJ4A 3CC7S 3FBEA 2YQ0A 4CQ1A 4RW8B 5DM7Q 4V19X 1KFSA 2CQHA 4CO0A 4YR2A 4A8YA 2B7CB 3HVWA 2QLFB 2OAUA 1IKYA 1Q1KA 5CZXA 3JS9A 2OZ5A 1LKZA 2HGMA 1PH0A 2ZBRA 4CYUA 1K47A 3RW6A 3KJFB 3QCZA 4JYAF 4KR0B 3V6HA 3Q2SC 1M1GA 4I69A 4DZDA 4PRFA 4C8MA 1JBVA 4KBIA 1KONA 1TQLA 3CPWR 1FRXA 3S7RA 4B17A 3EJMA 4ED0A 1U4BA 2DRDA 3TX8A 2Q6CA 3L7UA 3MCMA 1WEXA 4A8XA 2H5IB 4J9OA 2KZMA 2QL5B 3NMAA 4KHMA 2R7RA 2R7QA 1O0PA 1FEHA 2VU5A 3I87A 3KHRA 4RH9A 4HACA 1ZTWA 2KFNA 3PYDA 3P5BP 1SQFA 3MFHA 5KFEA 1HNVA 4B3TF 5KFCA 3OL6A 2HZVA 2Z58B 3GCWP 3H0PA 3CWEA 2MQOA 1JLBA 4WZMA 2JHEA 2FYXA 2YNHB 3SXLA 3TJ9A 5L9NA 2Y1IA 4USWA 4ZVTB 4LQ9A 4LR9A 4JB8B 4DV3J 3EM1A 3IGNA 4Y28C 4OMFG 1S0MA 2MKYA 2M70A 3VCDA 2VQEJ 5F8MA 2DR5A 2RS8A 1HI1A 3W66A 4CTAB 3Q24A 1QVFR 2YKAA 3RR7A 1JXVA 2M0GB 1H7XA 3NCPA 2WW8A 3TAPA 2FGCA 5C2CA 2JDJA 1K1SA 3UD4P 1U02A 1N36J 4OHLA 2D3OR 3OXLA 2DNZA 2DT9A 1RAJA 2JOQA 5M2RA 2WBMA 3G9CA 3CJRA 2C3OA 2ZM6J 2OPQA 3HT0A 2QEXS 1H7WA 2OSRA 5BYQA 4DV0J 3AB4B 1GXUA 3C66A 3UQSA 5EHRA 2NXUA 5IQQA 1LNQA 3HVTA 2XO7A 2FQQB 3ZZOA 4F4YA 4EBEA 5HJXA 1WSRA 1J5EF 3L7OA 4ILRA 3DRPA 3KG0A 2LCWA 2MY8A 2DNMA 1VHFA 2VH7A 2GHWA 1DTQB 3BDPA 3ITHA 4ZP9A 1X5OA 8AT1B 4ECQA 2BE7D 2UXDF 2WJPA 4DX7A 3NCRA 3W9JA 4ZVEA 1RPMA 2HS0A 4OZNA 5D0RA 3D66A 4JI2J 1YJWS 2QA4G 3TQ1A 3ZNJ1 1CC8A 2CFVA 2CFXA 2CPYA 4LT6A 4YR3A 2HBZB 4DFPA 5HMXA 3PYGA 2NLWA 2FZGB 4USVA 5ETQA 2DHSA 3NNAA 1Q0NA 1FFWB 2HIYA 3RB3A 1R6VA 4UTGA 1RXOB 1CJTA 2E9ZA 1YVFA 2FZCB 1C4AA 1SXLA 3DDKA 1WG4A 4CVKA 2MKJA 4CLFA 2V4JA 4HACB 4WTOB 2CPJA 3GIJA 2V2VA 2DR8A 2I1RA 4O44B 1RTHA 2IRXA 2W25A 1Q79A 2ADBA 1UJ5A 2ZUGA 4DR4F 2F8HA 1EJ7L 4J9SA 4BS2A 2X1BA 1EETA 3ZZTA 3TARA 1JLBB 1Q1MA 1Q7YT 2HHPA 4U7UK 3L4BC 4KH1B 4P52A 2I0XA 4PKDB 5LSOA 1TUVA 3KLGB 3UO0A 2N4DA 1S0NA 1LWXA 1F5BA 2BQUA 3KK1B 1P9QC 4ZVOB 3WC0A 2MBCA 1KTQA 4IH5A 2CWXA 3MAAA 2B3OA 2R8GA 3HXMA 2ZC4A 5IT9U 3B6BA 2JLEA 5KFRA 4B9SA 4DV5F 4OYIA 2GCFA 4B08A 4RW9B 4XPEA 3ICLA 3M8PB 3NS6A 1YZ6A 1B0PA 3R5BA 3AA8A 2WW4A 2ZOGA 3VGUA 4MT1A 4CWBA 1T3OA 3US5A 4OX6A 3M30B 1X5PA 2G2ZA 1HQ2A 4Z2XA 3HVTB 1JLQA 1FTCA 3PVXA 2YNFA 3DRPB 1GNKA 3FSXA 4EZ9A 3FBCA 3PW4A 2QFIA 4Y2MA 2HHVA 1I6JA 2LMIA 4A4JA 2BQ3A 2EVZA 3RBXA 2BMBA 4LSLB 3MAQA 1AT1B 2FUG9 4JI5F 1RQ0A 2JWNA 1Y00A 3HM9A 3SSSA 2HW3A 4J9VA 3BEGB 4RBUA 4DQSA 5C7PA 2A0FB 3UVJA 1X4CA 2AX1A 3PCOB 3QT5A 1OYEA 1CBKA 5K22A 2WONB 3QYYA 4AD6A 4B9TA 4GWFA 1MWZA 4RDDA 1WDDA 1N0VC 2DNLA 3M4UA 3RZAA 1U2FA 3IGVA 1HBNA 4UY85 3HMJG 4FYDA 1NHVA 4MH8A 1RDRA 3RAXA 4Z6BA 3ZM6A 1YJ9S 1YTSA 5ETNA 4FF1A 2HHQA 3K2YA 4FXWA 5B0DA 1RTHB 2UUPA 3QCGA 2HC1A 1SIZA 3BJYA 4N56A 1CQMA 4TU8A 4X4SA 2N82B 1WUUA 3MM9B 4F4WA 2Y9HA 3HCXA 1NB2A 5KA0A 1NJZA 3FBBA 1S9GB 2YNGA 4ECRA 4DV0F 1K44A 2OPSB 1C0TA 4C13A 4K0KJ 3MMBA 4DQPA 3DYAA 4AT1B 4ZVPB 4QOTA 1MMLA 4LF5F 4WU3A 4ZLJA 1S57A 5C24B 4EO8A 1FK9A 5ETRA 5F0UA 2DYAA 3DLEA 4OYZA 2HK2A 1U7LA 4M5LA 4R5PA 2BV5A 4EWTA 2XMMA 3D9BA 2B9EA 5HROB 3DHWC 2DK2A 1IBCB 2AGPA 1BY9A 3CDAA 3ISZA 4FNHA 3DGVA 3OFHA 4OQJA 2ALZA 3A8KA 1RWUA 3LPYA 1RI7A 5D78A 3AOCA 1V3ZA 5B08A 4JNBA 2GWOA 2EC0A 1V3AA 2E1PA 3DOMB 5KA4A 3H5SA 1JLQB 2QG9B 3KWMA 4JV0A 4XIUA 4UOHA 4H4KC 2FJAB 1UVNA 3SDEA 3P6YC 4QF5A 2XMTA 1BZJA 2XPCA 4IOAQ 4USTA 3NNCA 2UVWA 1WC5A 2O3DA 1X24A 1MW7A 3O4TA 3D9CA 1FNMA 3T5KA 4K4SA 4HHJA 3UVJB 2ZH8A 2HNPA 4V19J 2FIUA 1IM4A 2HHUA 2B9WA 4U8YA 4ZHRA 3BGOP 1H6KX 2X7IA 5KACA 3R27A 3PYZA 1XTZA 2LEAA 3MWBA 4YR8B 2YKQA 1IKXA 1WRMA 4GFVA 1HPZA 3OD2A 2G1HA 2VICA 1YGUA 3S3FA 2ZH9A 1KKHA 4DL6A 4LF7J 3PEHA 2R8IA 5AWXA 4IR9A 1Q6PA 4Q2LA 2KB2A 2HHWA 3PACA 1W78A 2YWHA 1S1VA 3KYLA 3ZTOA 2QJ3A 1YHQS 4ED2A 3BH7B 1WHYA 4EFAC 2VORA 2WTFA 1C0TB 1ELOA 1T9TA 4C3MA 1NM2A 3MMBB 3KNGA 4ZOSA 2EK6A 2XC9A 4DR5J 3RB0A 3WC2A 4CLTA 2RMLA 2L9NA 1GQYA 1TMMA 4Y0FA 1E0DA 4C9DA 3DLEB 1SC6A 3ZM5A 3CJ5A 5F9NA 1BQXA 4B3MF 5KT3A 2V8VA 2MTLA 1ITPA 5L46A 1BZCA 2OMLA 2H3EB 2F9JA 4J9NA 2AJ2A 4R8UB 4F67A 2ZBQA 4RU9A 2J7UA 2E1MC 3TANA 4EK2A 4MK9A 4GE2A 3ILIA 3ZZRA 5E3RA 1YJTA 4QBWA 2RU9A 3G86A 3EPGA 3ELHA 3RB4A 1GXLA 2H65B 3HLUA 4NA3A 6AT1B 3ZM3A 4NLYA 3ZTQA 4OLOA 1S12A 2YKMB 4RNHA 1YBAA 1ZA2B 2UP1A 5F8HA 4FF3A 1WG5A 2SXLA 2P2CB 2DJWA 1RCOB 5D4NA 4X4TA 1EAYC 3CDWA 1FJGF 1K0TA 2MLXA 1YBUA 3T6BA 2C2DA 2HVZA 3FNNA 3JYTA 3KKFA 3CT9A 1RT4A 2HNYA 2B4VA 1H2TZ 5KG1A 2HEKA 2DD8S 2XMAA 3TWZA 4DL4A 5K25A 3X3UA 3K8VA 1SQGA 2FLOA 1IKXB 1S1UA 1F60B 4FZVA 4DN0A 1L8KA 4WU2A 1FDBA 3G6YA 3TEHB 2HZAA 2C28A 1ZBTA 2EFNA 1KNZA 5KFIA 1QTMA 2KT5A 2ZN7A 4HT5A 3UR3C 1RZMA 4MK8A 4CO2A 4IRKA 4LR8A 2NUHA 3I82A 4F4XA 2DXPA 1VMBA 3DLKA 2DNYA 4WZQA 3TA2A 3NY0A 4HDHA 2FVPA 4C11A 1JX4A 2DBBA 2IY5B 3I9ZA 4ELVA 3V81B 1HBMA 1U1MA 4QW8A 2V67A 1T03A 1J6UA 3L3CA 2C22A 2DGSA 2I6PA 1VQ7S 3GJRB 2KJWA 3E01A 3V0EA 3RYLA 1KVJA 1UWBA 5K14A 3MM7A 4LUBA 3DDNA 1OY9A 1S79A 1VQYA 3AD7C 2NXCA 4FP9A 2MKSA 3H2XA 3RU0A 2J9CA 5DRKA 1Q16B 1OEOX 3QLHB 4NXMJ 1BD6A 4A8QA 5IT9Y 1HIYA 3VAHA 3KJNB 3K89A 3KNAA 1BZHA 2CNOB 3NBPA 2W4PA 5KT7A 2DO4A 2CDQA 4JI0J 5KFLA 1R8AA 2QL9B 4X4UA 3H4DA 1QLNA 3PHTA 3SFUA 4BDPA 2MY7A 2FJBB 1JLGA 3KK3A 4KV8B 2B0GA 3CJ0A 3QAEA 4WE1A 2C2OB 2EFPA 2ZZTA 2OP5A 4H4MA 4DX8H 4ES3A 2BACA 1OSCA 2WBRA 4FPRA 3OHBA 4Q0BA 1FERA 3GXHA 1G7GA 2JFFA 3NAIA 2CQCA 4TY8B 3H7HB 3L7PA 2Y1JA 4ILLA 3V6DB 2EEYA 3VGTA 8ATCB 3VR1A 2VBYA 3N5BA 2B5JA 2HWHA 2NZCA 3EAXA 5BR8F 3N4WA 5IC6B 1TVRA 4B3RF 4F02A 3SV4A 1BWVA 2LXIA 4NLSA 3SMEA 2I6OA 4B3OB 2AX0A 3CCTA 2K3KA 3IC1A 4ZIVA 1PO6A 1TU0B 4YOEA 4E0DA 1RT4B 3TUZC 4CDIA 2HNYB 3AD9C 3Q86A 3GJSB 1M0SA 2M8DB 2VJUA 4X62F 1IJEB 3S6EA 4NLTA 2XYPB 4FXDA 5SUHA 5GMKa 1IVZA 4I7FB 3M2UB 5ETMA 5E5NA 3NWRA 3AXKA 4P74A 3JB9k 2ZWOA 1OESA 4Z37A 2XS7A 4DR6J 1PJ5A 3A3PB 2GCAA 4NX8A 5EHHA 4BC9A 2V69A 2HGNA 4OIXA 3RBEA 4V1Ak 2DO0A 1RAFB 5CXTA 4LVNP 4QPXA 4ERDA 1U26A 3OL8A 1HMVB 3W5ZA 4RUHA 2CNHA 2BE2B 1WC4A 1WF1A 2JLGA 1HBMB 2BYCA 3I0RB 1T03B 1QE1A 3NOCA 3GR1A 2W7PA 2V0NA 1YG0A 4FYXB 4K59A 5K14B 3MM7B 3T9ZA 2EC2A 5IXUA 3WX4A 1H72C 2QYGA 2VD3A 3H59A 1RWNB 1S59A 4NMXA 2DVIA 2HNDB 4ELUA 1GFYA 4DV7J 1HW9A 1EQMA 3HHLA 2GAHC 3SCJE 3D44A 3MOJB 1I5OB 2C3PA 3ZTSA 5KFBA 2Z0GA 3CCZA 4YP3A 2XSJA 3DM2B 3NBPB 3UWTA 5KFSA 1FJ7A 3O3LA 1XNRF 1FVSA 3J7A1 2R7VA 1YGYA 2MZSA 3SYZA 2PMZD 2PEBA 4LRDA 4ED8A 1LW0A 3DRYA 1S97A 4O3OA 3KHGA 2VZ9A 3KK3B 3HKZD 2ZDOA 4HRFA 5DDOC 5L1IA 3OTDA 1S77D 2HNZB 1FKOA 2I4GA 5ETTA 4H4MB 1R6HA 1K9MT 2DNGA 4DHVA 4DQRA 5I3QA 5AE1A 5D4PA 3JSRA 3LWMA 3C2PA 3M8QB 2B4OA 2JX2A 4IFVA 4LF6F 2J16A 5C42B 3UE2A 1VR6A 1FDDA 1S10A 2F3JA 2QT7A 1ZPVA 4CT9A 1F5CA 1BXNA 2MSSA 2QMWA 3G4SS 5I6VA 4W90B 1QVGR 1PSDA 4M1KA 3OR2A 4X65J 1HQUB 2FC9A 4OLPA 1Q6SA 3AQOA 2CM2A 1S49A 3OBIA 5I42A 1Q8IA 7FD1A 1UMJA 3QT6A 2HFUA 1FT8A 1HL6A 2LFVA 1TUGB 1WC3A 4NE9C 3C15A 1U25A 3BSNA 3N01A 3LF0A 1DTTA 1R8PA 3KXDA 4GKJF 4KGVB 1CQNA 4LIWA 4M5HA 2XYHB 5C25A 3BH6B 5F3ZA 5ETLA 5GVQA 1TFWA 1AW0A 2F8EX 2GS8A 4JI0F 4PWUA 2OPRA 5KOWA 1TKTA 2DGQA 2HG4A 1SC4B 3MCOA 3W2WA 2VG7A 4YB1P 3UPFA 4C8LA 4D3PA 3UD5A 1DURA 5L1LA 2CZ9A 3SEOA 1X9SA 4DSLA 2OHDA 5CD4H 4I68A 2RAQA 4EBDA 2Y8YA 2FTRA 2M9KA 4NRTA 4LFBF 3T1HF 1A7GE 3OFGA 3EZOA 3V4MA 3DRRA 3QRPA 4HTJA 2ASJA 2B07A 3R5CA 3GYGA 1T9WA 2BDPA 1JXEA 2RUGA 1RT3A 5IT4A 1U0HA 2XSJB 4MMOA 1FI4A 1FKPB 3A5KA 3NGKA 3FDSA 4OV1A 2UXCF 1C86A 5D4OA 1JJ2R 4X64F 1RT5B 1LW0B 3ENVA 2OEJA 4C7QA 5CCMA 2JC0A 3BS9A 3BSCA 1G1XA 3QNWB 4A8OA 3Q89A 3SMZA 4OJHA 3CJ8A 4IH7A 1FKOB 3GIKA 5L39A 1CJKA 1RTZA 3RG6A 3HJVA 2C2EA 4PXBA 4YHHJ 2M7SA 2C1EB 3M8ZA 2G1DA 2J0XA 4ECTA 2H4VA 3PX4A 3D0HE 2QFJA 4I4BA 3B4DA 2EG1A 4IFVB 2VDIA 1ICEB 2CJKA 1GQQA 3NAHA 1UCNA 1N5TA 4Y2CA 5KG6A 3EB1A 2XI2A 2AQ4A 3O6QA 3OR2B 1NZ8A 4DEZA 3RR8A 3OR1B 2XHCA 3MMCA 1VK8A 3P49B 5IC4B 5J2QA 3LAKA 4LQ3A 3JTPA 4YY3J 4OZ5A 3IM8A 4B9LA 1U24A 2HQDA 4X4PA 4O23A 3LH2S 4PQAA 2ILYA 1PKUA 3MAHA 1AUSL 5A8KA 3C15B 2VBXA 2OSQA 3AB2B 4HH1A 3L09A 1RSCA 4CLKA 1Q4RA 3H25A 4DL7A 4OL8A 4F0HA 2OTJS 2LXFA 5HVHA 1B0VA 3EZ5A 2RB7A 2KKHA 5BX1A 5D8HB 2OPRB 2W2PP 4CP5A 2OIHA 1TKTB 4NI2A 2VG7B 3JTOA 2HHHJ 2D74B 1VI7A 3EGVA 3G82A 3H5UA 3NEKA 2LQ9A 3D68A 4RW6A 4QDIA 2ZFHA 2ZMMA 2LKZA 4JP8A 5AE2A 4QWBA 3FSYA 3C6UA 1QXKA 4ZA1A 3I0SB 2GMJA 2I6IA 2RQ4A 1CSJA 4M5GA 4G6VB 1VBKA 1T3NA 2P6SA 1BHNA 3CJSA 2OMOA 1DJ0A 1H74A 3HJFA 2L9DA 3QCNA 3HZGA 2FJMA 2Q79A 2Z4PA 2B9XA 1RK8A 1XXPA 3OT9A 3VQSA 1U0HB 2HPUA 2VKRA 3BN4A 2YVSA 3TZYA 2M4MA 3ZXWA 1QUPA 1S4EA 1WEYA 1X9WA 1XR6A 2WTZA 3QJJA 3I6PA 4QR2A 1P1TA 2CM7A 4OYOA 2R7UA 1NK8A 1CG2A 3HZEA 4DR1J 4LSNA 2BW2A 4TN2A 3RRKA 1S9EA 5F8JA 4HKQA 1P6TA 4A8KA 5DGBA 4HHHA 4M95A 3DLHA 4QQBA 2OPPA 1NZ7A 3MTJA 3JQMA 2BRKA 1AZSB 3AA9A 4ZI4A 3G2XA 2M2BA 1GX6A 1VYAA 2JJDA 1DFDA 4G1PA 4QIVA 3NOGA 3BKTA 4DX6A 5HQMA 1SJFA 3C14B 1DRZA 1OYDA 2ADCA 1VBYA 4IO9Q 3MMCB 4IFYB 3GLJA 2NQPA 5J2QB 4EI2A 5H1SV 5HP1A 4J9RA 2R7WA 2CDRB 1FRKA 3G8SA 2BABA 3T5LA 2P5VA 3CNQP 1JK9B 3DRXA 4JI7F 2OI2A 3KK2B 3M8SA 5F8IA 2KM8C 2F6YA 3TVYA 3MM8A 2FVCA 3T6JA 1CJVA 1A5YA 1EIYB 3PR4A 2I2YA 2PC6A 4FBTA 2AJ0A 2POKA 1S6QA 3Q8RB 4CO4A 2ROPA 2LU1A 2RILA 2GO8A 4NI2B 1JJCB 2PMWA 4O0IA 4MYTA 3QCBA 3OJSA 2HSEB 1HNXJ 1BC6A 3K58A 4WIIA 2ZC3A 3CJ2A 2ACYA 2CKWA 2BM1A 1UKUA 3K5NA 1MROA 3ZZYA 3C6UB 1OIAA 4PG4A 4ICZA 1UFLA 1U8SA 4OYMA 1J2VA 4ZP6A 1M5PC 2BX6A 2RVJA 2RDDA 4DSFA 2XSFA 4F0MA 3BGRA 1YJ7A 2V2ZA 4WYWA 1U8WA 1TK5A 1AAXA 2MZ1A 1RT2B 5DQGA 2QRRA 4DUZJ 3PV8A 1WNEA 4K4VA 1MMNA 3WX8A 1YITS 3FJ2A 2XMKA 1X4HA 2CNIA 3FFIA 2V8DA 2W2NP 2MKCA 3IA0A 4ZP7A 3M4XA 3ZM2A 2RUSA 4LFAF 1URNA 3ZMQA 2Z2ZA 2I3UA 3PO4A 3ZMPA 2OPPB 3LJ8A 4ECWA 3QPIA 3UDVA 5SZTA 1PAUB 4OX9J 1N33F 1X8DA 4IYQA 1RWVB 2DHAA 2A6OA 2KZZA 4RX6A 3MUMP 2QN6B 2FJEB 3JAMU 1S6PA 3A8EA 2E9RX 4ATNA 1KQKA 1BLUA 2A10A 2BZ2A 2BKNA 2XLKA 4NZ0A 1LARA 1JLEB 2V68A 5A0YA 2GC5A 2V94A 2IAJB 4PPZA 1NJXA 5HP1B 1N6QA 1VRTA 4L72B 5H9FJ 3A3OB 5J8RA 2F9DA 2Y2FA 2HFZA 4ECXA 4FYWB 3ET6A 5HSPA 1T9XA 2XZDB 1Z4UA 3QIPA 3BBFA 3KOAA 1N5YA 4YMEA 4Y2KA 3T19A 3OPKA 1P15A 4J90A 3CD5A 3MM8B 4JV5J 1JLCA 3LOUA 4I2PA 4TLRA 4DL5A 4AQYJ 2W4CA 1JB0C 1SUQA 1Q7LB 4DR3F 3B78A 1UVKA 3H8YA 3S8SA 1HD1A 1XIQA 2EBEA 4OHYA 3V2UC 4UY8T 1PILA 3MZIA 4J9PA 1X4EA 2H4WB 4KKOA 2AEJA 5CYJA 4USJC 4GC6A 2IJNA 2BJ3A 1C87A 1WORA 5HO4A 1U0SA 1MROB 2AF6A 3CTRA 2HBQB 4I67A 1O51A 2R2TA 2YWKA 3DN9A 1RUSA 9ATCB 4ED7A 1NPKA 3TUIC 2R4FA 4P2XA 5KT2A 2QC3A 4NLDA 2YTCA 3KHHA 3EZZA 3DRSA 3G6ES 2QLWA 3HP6A 2O1PA 2PQ5A 3HFKA 2KM8B 2BGEA 1NKEA 4G3IA 2FJWA 4GS0A 2V2KA 1NPPA 1E6VB 2H5JB 4LF4J 5LSLA 4C0OC 2JFKA 2XS5A 2CQGA 1ZM3A 4NL5A 1APSA 3P8BB 3CMAS 4CLLA 5I3UA 3RBZA 2HY3A 3OL7A 1NH7A 2AGOA 4WFAQ 2MKKA 1AFIA 4ED6A 4P73A 1RBAA 3T41A 3DU6A 1OHEA 2JEGA 1HNWF 1TKZA 2ZDPA 3HO1A 1T9UA 2XQCA 2HBYB 2PT0A 5FDLA 4FF2A 1TELA 2CPXA 4ITSA 5ITHA 4U95A 2W2MP 1WJ9A 1VQ6S 2QDPA 1TL7B 2CQIA 2RJZA 1S9FA 1RE1B 5IWAJ 1R3NA 1X5SA 1RWKB 3TAQA 5HBMA 2UUAF 3C3LA 4K4UA 2G0JA 1X0PA 3IR5B 1VRTB 3W9IA 1F9FA 1Z1ZA 4X66J 4JI4J 3LGNA 3ZZZA 4PEOA 3QIPB 4LIRA 4CM0A 4OZJA 1N5YB 2F6TA 2UUOA 2OD6A 4ANCA 4MIBA 2YY3A 1IBMF 2ZUAA 2VEUA 1VLOA 3IN5A 4CH0S 4FYYB 3FCVA 4ICLA 4CT8A 2EI5A 3VZHA 4H1OA 1HNIA 1MLAA 2VIHA 4RI4A 3M6UA 2YWWA 2HCMA 2VTDA 2FH7A 4FDFA 4TVVA 5LJ3Y 5HVFA 3R1HA 3RGQA 2AEMA 4NWBA 2YX4A 1V6HA 3J7AN 3T1YJ 2DXFA 3PJXA 3LP1A 4KO0A 1HKAA 1H98A 2BKPA 1V5VA 1WC6A 4P2FA 4J9KA 4F2SA 2VASA 2AV5A 4PVGA 3W60A 1D8YA 1P8GA 2IJRA 1GQEA 4USUA 5KFKA 2GHVC 2B9YA 2E5HA 3JSMB 1VQ5S 4R30A 5K8MA 1GTHA 3GU0A 3DMJA 4ES2A 4LFCJ 1B3TA 4WPAA 1VQ9S 1YZ7A 3FCWA 3AY0A 3RBDA 1VJQA 4JMJA 1H2VZ 3KLEA 2VKZG 1RU1A 5I3UB 1AYEA 5LSRA 3HX9A 5M2PA 1ZZNA 3OVAA 1FX4A 4RW4B 4DV4F 4P2MA 1TKZB 4PAAA 4KSEB 3QSIA 3ILLA 2HURA 4URGA 5LMNF 3J7Z5 3VALA 2PFFB 4BPCA 2XY7A 3N6MA 3GP9A 4TLQA 3GPAA 3BGLA 1ACMB 4MTPA 4ZLLA 1YWXA 2K7KA 5RUBA 3SQGA 3BRHA 4ZVHA 1LWEA 3VAFA 2JFHA 3QCDA 3R5JB 5HBMB 2HLUA 4JI8F 5J1PA 4GRSA 2XNQA 1HYSA 4WP9A 3C16B 3KUGA 2XWXA 2P8IA 2B6AA 1XQIA 4RU2A 5I3PA 1ZTTA 4NWFA 3QWPA 1IKWB 4ZPCA 3QRRA 1ZZWA 5D4LA 4OV6A 2R42A 3PZPA 4NMLA 1S5ZA 2NSBA 1L3KA 4OYWA 3KLFA 3V4IA 3A8JA 2E5GA 1WWHA 1WOSA 3F0NA 3I32A 4IH6A 2VOPA 1XEZA 2MYFA 2H04A 3K5PA 3Q83A 3LP1B 2HQ3A 4QWCA 3PXGa 1FRHA 4ZMMA 3CCSS 1S6OA 1H0HB 3I56S 2FB0A 3NKYA 1XMQF 3J7YI 4ZN1A 4NXNF 1PYSB 3UDCA 2F4VF 1T9YA 2XMWA 3LP0A 4AUKA 4KYZA 3UNGC 4WFBQ 3HSZA 2KO1A 3DMJB 1S6UA 1DQAA 4PXDA 4KY3A 4FPIA 2RH3A 3FEXB 4Y65A 1X0FA 4HHUA 2GCBA 2HYIB 3DDIA 4DMZA 3QGIA 2AIRB 3KLEB 4OJ1A 4B02A 1NK6A 2W8LA 3CJ3A 4N76A 1TKXA 2ZVIA 3NS5A 4I6WA 4FVMA 4NOHA 3M1VB 4QPTA 5ETVA 1G1GA 2A8BA 3FGVA 1RWWB 2D41A 3LGHA 1EKSA 1Y10A 2UUBF 3ETOA 3JAMY 4RR5A 4WYLA 3ZZUA 4H34A 5A5FA 4JYAJ 2BA9A 2R7OA 1N8RT 2VJVA 4O4GA 3N0AA 2J9DA 1DBDA 1TZ0A 3NGTA 1XMBA 1TP7A 4DPWA 3W8GA 1S0OA 3QKPA 4PWDB 4ID5A 3B54A 1AROP 1DY3A 3QATA 3NGDA 2FHJA 4IG3A 1RAEB 5LXYA 2J8AA 5E7OB 4H4OB 3NGUA 3MCSA 1L3UA 3OHAA 2ZEJA 3CJKA 3UD3P 2VPXB 4N8NA 2R9LA 2B43A 1X4FA 2Q43A 3FKBA 1HQEA 1WDTA 2XCPA 4NX9A 4Q8FA 2B49A 2CQDA 3CCUS 3SFGA 4WJBA 3BO2A 4KAIA 3EU0A 4B3TJ 2XULA 3R6LB 3HHLD 3W1YC 3A5JA 4LF9F 1FWPA 3IBFB 1C1BB 5DLFA 4EUVA 3AFGA 3D1HA 1QDUB 2X5OA 5KA3A 2GGPA 1FPZA 5A6PA 1FD8A 3PS5A 1SB6A 4NLOA 4Y3CA 3K8WA 1YTYA 4Q44A 2F7VA 2CRLA 3M9NB 5CQGA 5KA9A 1HBOB 1EB0A 3AXMA 3IWNC 2BJ7A 4J9UE 1M3GA 1N52B 3LP0B 2ZZMA 2YKNB 4U9RA 1XJWB 2ZD1A 2WVEA 5GADI 2RE1A 4AFFA 3DCAA 3G6XA 4KHRA 1DQ9A 2J8SA 4KTQA 4TYBA 1FRJA 2JC1A 4RHGA 3OXGA 4DV1F 2HMIB 2XHWA 3PYEA 2FGOA 1LW2B 2DKOB 5KFOA 3SV3A 3S1TA 4UUWA 3CC2S 3MR7A 4J51A 1NDKA 3NMRA 3E8OA 3M2RA 3W2VB 5KA8A 1QSYA 1ZCLA 3QO9A 1J5EJ 1TKXB 1UVLA 3IFEA 1RHRB 1KS2A 1VS3A 1NZAA 4JI1F 3MPYA 1KP6A 3BSAA 3MGJA 4ANEA 5CA5A 1C1CA 2UXDJ 3O8WA 2GJIA 2IBOA 1S1TA 1QAJA 2FY1A 2MJNA 4TNOA 5GAGU 4PUOB 1LK5A 2Z2MA 1FPRA 2MQ8A 3I31A 4KT0C 3HSJA 2QA4S 2RKIA 2BJEA 4MJKA 5KFFA 2WHOA 4ID5B 3PKMA 2W24A 5GAHU 4B9VA 4IG3B 1DQ8A 4DUYF 2L41A 5A6WA 3AJ2A 4C97A 5LXQB 5KFVA 3KLVA 3OTOF 3EMUA 2LDIA 3CJKB 1FKAF 2HQGA 3CJTA 2V8GA 4U7UD 5ETPA 5GMDA 1SC3B 1VRUA 2E7VA 1HHSA 2CM8A 2ASDA 1HQEB 1FJCA 1SPBP 3HI9A 3ZFVA 4USKA 3PW2A 4DOZA 1XWLA 3R5GA 2YXLA 5A8RA 3GONA 4DR4J 3CMES 5KFPA 1XXVA 3GYNA 2KHCA 4DCOB 2GO9A 1NBEB 1T8EA 4MKVA 4ANDA 4DI6A 5D0GA 2VA3A 3O5TB 3EYZA 1T49A 1XBOA 3M32B 1KEKA 2YWFA 2N7CA 2CNNB 4WP3A 1RYSA 2PA8D 1L5UA 2FVRA 1RTIA 3WZ0A 2VFRA 2UV8G 1MNEA 1IM6A 5KG3A 4DSEA 4QR1A 1ROFA 2LA4A 4U96A 4Q2MA 2ZH5A 4P71A 2VEYA 4ZLPA 3LUYA 4IO1A 1IQZA 4EU0A 5B0GA 1GFWB 1BQMB 3IG1A 2CQ3A 4S0MA 1IQTA 5J2PB 3D7SB 4DV5J 2BQRA 4K4ZA 2RS2A 5D3GA 2G0IA 3BF4A 4RNNA 1UFKA 3PFOA 2FHKA 3GV7B 3ZL8A 2HHSA 3MVNA 4NA1A 5FLXU 4M8LA 1NLKL 3E3XA 4N41A 4XK8C 1C83A 4ECSA 4CI0B 5F8LA 1I94F 3R3TA 2KYXA 3BYRA 2RDJA 2G2OA 2J5AA 1V3SA 1WELA 1WHXA 2DGXA 1ZAWA 5CD4A 3TA1A 2CNFA 4UOCA 1UA0A 2P9CA 2OH2A 1U48A 2C46A 3BN7A 1C1CB 4K5SA 4YR0A 4ETXA 3PX6A 4JI5J 1IBLF 3R5DA 1GMUA 1AUDA 4WFNQ 2AM2A 5A76A 2RKIB 1Z2LA 2HQIA 4UF4A 3OUYB 2YQ3A 4N8OA 5CYQA 2QIFA 1IR2A 3K0JA 4QIEA 1M90T 1YRTA 4DL2A 4FNIA 1KQFB 1KD1T 5BJRA 1R0BG 3G71S 3QKQA 4KPYA 6FD1A 3MR3A 4QIWD 1ZS6A 5GAEI 1QZ0A 1VRUB 3POTB 3EICA 4DQQA 4LVOP 1PJ7A 2IYGA 5KFZA 4DF4A 1XMOF 2ZH4A 5A8RB 1FXRA 3WBZA 4RL1A 4DCJB 6FDRA 1NO6A 3MM6A 4GC7A 2D9PA 3HDSA 1UEVA 2MB0B 1B70B 4ZVGA 2QDCA 4ZK7M 2K1RA 5KT4A 3I55S 5KFMA 3OTCA 2ZOMA 1R0AA 2V5HG 2CJYB 3HULA 3FBFA 4OZ3A 3GYXB 4LF5J 4B9UA 2A2DA 1WC1A 1UZHA 4DR2F 4KGKA 2XNRA 2P9GA 3GXGA 1IKYB 3H42A 3KMQA 2F1FA 3NRBA 4CYUB 4KIAA 1F3FA 2KL8A 2CJAA 1JXLA 1KOHA 1YRXA 2UUTA 2EFVA 3IG1B 4OI0A 5J1EA 3F99A 1XC9A 3AWEA 2LA6A 3CWJA 4GVBA 1RAGB 4CLPA 2FJNA 4WFZA 3O4SA 3ZTRA 1UAWA 5LMUF 1EEOA 2MMYA 3O1LA 3MOZA 3U1LA 4ZN5A 2IMWP 1NB7A 1ZZFA 3PRVA 1V5IB 2R7SA 4ECZA 4C3LA 1BE4A 2F65A 2QLJB 2YX7A 1NU4A 3R9LA 2F6ZA 1R89A 1LWFA 4KFBA 5MMZB 3V0FA 2G9OA 3HT3A 1QAIA 1KQGB 2LLZA 3TP2A 2DNKA 2CADA 1SKSA 1HNVB 3CE8A 1B7FA 2YBVA 4U7CA 2DNQA 3AWGA 2DCLA 1QD1A 1AFJA 4CNYA 3MUTP 3VTIA 1Z2ZA 2JH3A 4LF8F 5CYQB 2N7YA 3W63A 1UWAA 1C2PA 2VOSA 3KFWX 2HS3A 2NXJA 3W5XA 2JFGA 1NDPA 1YX2A 3TYTA 4CLUA 1JF7A 4AZ1A 3CEDA 2ZNZA 4BC7A 4PYHA 3CUNA 1OY8A 1U2RA 4DPYA 4ZPAA 2VEVA 2DR7A 2ZH3A 2XEXA 1OPZA 2GIFA 3DLBA 2V2QA 1M5KC 2IJFA 2QYCA 2AGQA 4CH1A 2ROEA 2C2NA 2VG6A 3M9MB 2VDHA 3QSYB 2OPQB 2OGUA 5CAAA 2EWHA 2K1RB 3A3NB 3BPDA 2OO4A 3OLRA 1D3WA 4FKYA 4BWJA 5K24A 3D4JA 1F3VA 4KGXB 2EG2A 1VQKS 3N9UC 5HMZA 1CULA 4N77A 2VONA 3ITHB 5M43A 4F7VA 1PAEX 2D69A 2Q6BA 4CM2A 4ES1A 4G1QA 5CABA 3MOWA 4C4WA 3GFZA 4B3MJ 3MCNA 1OHCA 2DGWA 2OEKA 2E44A 1VLYA 1Q8BA 1WF2A 3JQJA 4BLGA 3AWFA 4JI6F 4K4YA 2J7KA 3GR0A 4KGZB 2LEBA 4K4WA 1LWCA 4DS4A 1CJTB 3ENAA 2C2MB 2FLNA 1EKRA 1S7HA 2RQKA 2IM2A 1FDAA 1RBLA 4M5NA 4KFBB 5JJBA 5DGAA 4QYZK 3ZNUA 3OLAA 2QA1A 2XG8A 1IR1A 1X4BA 2BUNA 4ZVFA 2V4JB 1E6YA 1D8ZA 4EBCA 4QBEA 2HWTA 2COLA 3OV7A 2C7SA 5K9FA 3CO9A 4KJIA 4CLYA 1VQ8S 4HVZA 5L1KA 3IS9A 1FJGJ 2AHOB 3OLBA 2JZ5A 2E0TA 1EETB 3IAS9 3QCFA 1LV5A 2DB1A 3L9ZA 1KDNA 2GW8A 1U1QA 1FESA 1FJEB 1DLOA 3Q8YA 5K23A 4N5SA 3Q0AA 3HHDA 5C5JA 1OEVA 1UEKA 4F26A 2MZRA 4LSZB 1UA1A 3R8YA 1REGX 2ATLA 3MAAB 2H54B 1T05A 2H4KA 1RAOA 2QBRA 1CS4A 3FRZA 3AOAA 1Q6TA 2QCTA 2PGCA 1P9YA 4OJGA 2DH8A 1CEZA 1NKBA 4DSIA 4YB5A 4FF4A 3KHLA 2IFXA 2H9ZA 1VQOS 3WIVA 1OWXA 4HLBA 5AJ3F 3OTEA 1L3VA 2CVEA 3MM5A 1UZDA 3H2UB 1KN6A 4ZVUB 1FE0A 3UN2A 5F3TA 2CQBA 4M5KA 3UR0A 4PCQA 3ZZ0A 4Q45A 3HHKA 4RUCA 2LEPA 2YNFB 4A47A 5B7WA 1UJ6A 3E2EA 1R0CB 2H4YB 2GQCA 1CULB 1SVDA 4OX7A 3T5JA 3FMWA 3CD6S 2I5XA 2NXNA 1PGZA 1YK9A 5IV4A 2YPYA 4C8YA 3N0VA 4G1QB 1PTVA 4MFBA 3RGIA 1P3DA 1JLAA 4C0BA 4GE6A 5FLXY 2MQMA 1HWUA 1Q8KA 5KABA 2J76E 3CDUA 3PRDA 1HBUA 3MEEA 4I6AA 1TL3A 2W9CA 2BVZA 5HMYA 2X1FA 4JI3F 2XGQA 3K7RA 1OY6A 1MU2A 1HBNB 2HIQA 4DPUA 5MAOA 3QCHA 3AJ1A 2NREA 2B51A 1FHTA 1MN7A 4AYBD 3PJ9A 1E6YB 1OQ6A 3MEGA 2U2FA 2RHSB 2KTQA 3EVWA 2BJ8A 5BR8J 2F70A 4B3RJ 2RF2A 3IS9B 1SKRA 2KXHA 3FZBA 4DPTA 3RJMB 3DOLA 4ZKAA 3TRGA 2RQCA 3PDNA 2YNGB 3J81U 2KXNB 2MHEA 3LPEA 5KG2A 2O5DA 4R0TA 4X62J 4FN5A 4USIA 5BXIA 2NS1B 1PA1A 2BJ1A 4KB7A 2UVRA 2A2CA 3DYAB 3MECA 5KTQA 2W7OA 3SZ2A 4EGLA 3OVSA 2ILZA 5BYSA 1FK9B 3THTA 1RLCL 1PJ6A 2KDOA 2UU9F 2CPIA 1SUGA 1LOUA 1NDCA 2GJTA 3BLUA 3K5OA 1FF2A 4R5PB 1N48A 4B9NA 4A48A 2JSXA 3J81j 4M5DA 1SJ4P 4DL0C 2D9OA 1C4CA 3HSGA 3ISND 2W7AA 1BQNA 3S4EA 4Q7AA 4DF8A 1W25A 2KVIA 4R0SA 1F0XA 3DGPA 3TJ8A 2ZJRQ 1DAXA 4IDKA 2BJ9A 1OETA 1U09A 4LRFA 1FWLA 4IOBA 1PYTA 2QDMA 5F8GA 4XPCA 1S48A 1OS5A 3EDQB 3BDEA 5KFNA 2K3IA 2RD5C 2F8MA 3TO8A 3GWCA 2I1YA 3K5LA 2HQFA 1OMSA 3G87A 3K57A 2Y0BB 2OKQA 4CVLA 3G96A 4MK7A 2XLJA 4GO5X 2AWZA 3CW2C 1FX2A 3SDEB 3GFXA 1YI2S 1CC7A 4X4QA 5HK4A 3UCZP 2CA9A 4I0WA 1PIEA 1EENA 1MSWD 4E8UA 1JMTA 1XNRJ 4MFBB 3RW7A 3VGSA 1S7IA 4URSA 4HT7A 4TU9A 1OQ3A 1JLAB 5KFTA 4ZIYA 1OEMX 1C85A 3Q8QB 5DZ6A 1S76D 1HWIA 2XJAA 1SJ3P 4D3HA 4HJPA 2MZJA 4ZHRB 3T3FA 1HBUB 2ZH6A 3MEEB 5J2NA 3BQ2A 1EARA 5A2QU 1TL3B 2VC1A 4LBIA 3MR5A 2W9CB 3TEGA 2PFDA 2B4SA 3V6KA 2QCJA 1S0VA 1MU2B 3MPWA 1HPZB 2LQ5A 2ZITA 3SQOP 3TVZA 4LF6J 2HRUA 2JVOA 3KLHA 1NDLA 4F4AA 1OSDA 2V50A 3Q23A 2R7XA 2E9TA 3PG9A 3CCES 1WC0A 4PPDA 4YN3B 1XBWA 2IDLA 4CCHA 5THWA 2M3VA 1GTEA 4RJVA 3MHYA 3CF5Q 4OHHA 1G3OA 2RF2B 1FGSA 1S1VB 2K2PA 3MURP 3H98A 2N4CA 3CGIA 5T14A 3GIMA 3GFYA 1D1UA 3SSQA 3IMQJ 2ZZNA 3CC4S 1P27B 2Y1RI 1Q86T 3CSKA 1UPMB 2G6ZA 2AYMA 3VAKA 4QAPA 4NZ7A 2VEWA 2IA0A 4ZPVR 2ASYA 3MI7X 3PFEA 5K8OA 4RI5A 2AHSA 4URQU 3OW2R 1XNQF 4WCEQ 1YBTA 5HVGA 4GKJJ 1OEUA 5A8WA 3S3KA 3K5MA 3ONQA 4N7TA 5EWFA 2I9SA 4FKXA 1RACB 2F6FA 4L6V3 3BB5A 1BGXT 4ECVA 4GKKF 4HL9A 3H40A 2ZWPA 1BQNB 2GA7A 2CPZA 2MKIA 1HNZF 1SJ1A 1VC5A 1YQHA 4IDKB 3EPIA 3AODA 1VK3A 2NYIA 2OELA 3F44A 3OFEA 2EK1A 4F25A 3NL0A 1M5VC 4ZPWR 5D6GA 2ZBIA 2CMAA 3QCMA 4ZJQA 4LFBJ 3T1HJ 4OHEA 2KYZA 5L8RC 1PA9A 3M8YA 2DPJA 2DY9A 1N54B 1Y3JA 3JSYA 4L3KA 2E66A 4LBHA 2NCKL 1SL2A 4CTAA 2I6MA 1HARA 2E5IA 2I38A 4QYZJ 2FDNA 2W8KA 1UW4A 2HVDA 1LQ9A 4OHWA 4NYOA 4UT4A 2F40A 1KWMA 5DDQC 1A6LA 2P9EA 5KOXA 2UXCJ 3T1AA 5F8NA 1YSJA 1FDNA 1RHMB 2EFGA 4X64J 4IQMA 4DFJA 1U1RA 4C12A 3JYTB 5G0RA 2EBGA 1HHQA 4Z7CA 4DSKA 1HWLA 3QT7A 3HHLC 5J2NB 2DXDA 1I3OB 4BBYA 3KG1A 1URRA 3M9OB 5K9WA 2Z57B 4DXLA 2FHJD 1AXQA 1S1UB 2DNPA 4ED4A 4CRJA 1KTVA 1IBKF 1A9NB 1ONZA 2DHXA 3KLHB 2ZHBA 1N88A 7AT1B 1FA0A 1DTQA 3P3DA 2I75A 1HR0F 4QUMA 5D0HA 2FVQA 5K8NA 2C3YA 3UN3A 4IQXA 4FVCA 3NGRA 3DLKB 3IXQA 3EVMA 4KHPF 3R7BB 3TZWA 2HB1A 1E8CA 3BV8A 2HNQA 4C11B 2Z30B 1P1LA 2I8EA 2B4PA 4X4VA 2HGLA 2XZTB 3M2VA 2RNEA 2LQBA 2P6XA 3MFIA 3BZQA 2J9EA 4NLRA 3CCRS 1MN9A 5AXNA 3E01B 2C3MA 4D3RA 1UWBB 3IWLA 3UDEA 3TUPA 3LANA 2DNNA 2X1GA 2I3RA 2B7BB 1NHUA 5HN0A 4H54A 3B82A 1RJJA 1XRIA 1S99A 2LU2A 4KH0B 5A8WB 2DY1A 1YDLA 2Y8WA 5EN1A 3W8PA 3T9NA 4O44A 1RTDA 1W2BR 3DC2A 1PBAA 4IUFA 1O6XA 2CVIA 3QCEA 1ZPWX 4TY9A 5IS2A 1JLGB 1UETA 4DSJA 4WE1B 4IRDA 2UXBF 3V0DA 4DR7F 1KLMA 5FJ4A 3KLGA 4Q0BB 4AL6A 1CLFA 2U1AA 4O4RA 4C8ZA 3NMEA 2YPZA 3KK1A 2CQ2A 1HLWA 3D6TB 1OHDA 3DKDA 3LW5C 4DLEA 1N32F 1PYNA 1PG5B 3BR9A 5K5MA 4LBPA 1GMWD 5LJ5Y 1F9EB 3MF5A 2HZCA 1NCLA 4M94A 1D09B 3FC9A 2CPEA 1NJWA 2B5JB 1RAAB 2HLTA 5KG4A 2M3DA 1ZAXA 1WI8A 3Q2TC 1TVRB 3DHXA 4G1IA 2UUWA 4LF2A 2X51A 2VOOA 4RW9A 5G0RB 3CMQA 3M8PA 2H48B 3IRWP 2QBQA 2G13A 3ZM1A 2BR0A 4ZCMA 3FQKA 3AAWB 4XTTA 1AB8A 3M30A 5EX0A 2J6UA 4M5JA 1QAYA 3I7ZA 4A8MP 4C6AA 4GFUA 3CCLS 1VFJA 4C8OA 2KH9A 3PW7A 4L74A 5LT5A 2W1BA 2BJDA 4LSLA 1SL0A 2VB6A 3MPUB 2IA6A 1N5SA 4DV6F 3SSRA 3J81Y 5B0EA 2UUCF 3I4PA 4TYAA 1TAUA 2NT2A 1QE1B 3M2VB 3D67A 2APOA 2WONA 4ED1A 3G6VA 2CNGA 1N34F 2DHHA 4WXOA 1UVIA 3EUNA 3S4OA 3Q8UA 4JI7J 4OI6A 3DLJA 2LDYA 2VEXA 3BKUA 4JV2A 2DR9A 3HHLB 4F0KA 4E2FB 5CCLA 2BZLA 3AH6A 2LXUA 1LYVA 1U1NA 4NLGA 1NK9A 5KT6A 3ZC4A 1RTDB 4DV2F 1KBRA 3RAMA 1FWKA 4O3SA 1MWYA 3MM9A 1R31A 1EZZB 2MQQA 1S9GA 2VV5A 1TV6A 1R27B 4B3SF 4R0EA 2OPSA 1VHRA 3HHNB 4ED3A 2LP4A 4GVLA 1KLMB 2MGZA 3MEDA 4ENOA 2JFDA 3N28A 3D3BJ 3NCQA 1UJ4A 1RAHB 2Q66A 2J16B 5C24A 4ZDNA 2GVDA 1O5ZA 1OPIA 2QL7B 1U6BA 1KHVA 2R0BA 1SBRA 3R5AA 4RUAA 1GH8A 5HROA 1U1OA 5DO2A 1DHMA 3C6TA 3R97A 2J0WA 2E7XA 3FSIA 1R8HA 5I42B 5A2QY 2HC2A 3OTBA 2G2YA 4QBUA 4W92B 4LFAJ 3CCQS 4DBQA 3EVOA 2HFNA 3DOMA 3QJLA 4CIOA 5T7LA 1IXKA 2KJVA 1DTTB 4P10A 5HQLA 1VRQC 2W9BA 2E7WA 1N33J 3U1NA 3N5FA 2WSFC 1KRPA 5C25B 4L3NA 2RIJA 3CDBA 1X5TA 1K73T 3IR6B 3GILA 1KSPA 2CPDA 1Y9OA 4G65A 1T0TV 3QQCD 3DXBA 3QGHA 2ERRA 2FHMA 1GAOA 2W9AA 2QO3A 1DARA 2VUGA 2RSQA 2GC6A 1NK7A 4PYDA 3W2WB 3SIPB 4DUTA 3QT8A 3CIMA 1VC0A 3WHIA 4TQRA 4NCBA 1IN0A 3ZM0A 5DLGA 4WF9Q 3HVAA 3QWUA 4OJ3A 4TU7A 3N2AA 2VPWB 4DV3F 4P9SA 1QAXA 5KFJA 3DRRB 3PNIA 1EQ0A 2XMUA 3EGNA 2H02A 4U8VA 4PXCA 2VQEF 2AU0A 3N6LA 2GP0A 1GEHA 1TR0A 3DNCA 1RT3B 2DGVA 2HK3A 3THPA 2D3ZA 1F6TA 1T4JA 1G7CB 1GK8A 2JEFA 1VQSA 2Y67A 2MKHA 4DR3J 1W26A 2CPHA 3FCHA 3BR8A 1N36F 1Q6NA 4DWIA 1SC1B 2RRAA 2HAIA 1Q81T 2DCUB 1FNXH 1RABB 1IKVA 2PI5A 4ECYA 1T9VA 3EX7B 2ZM6F 2I42A 2I5JA 5HAOA 1TV6B 3OSPA 4RNFA 1KC8T 1CJKB 3GG0A 3V5RA 1RKIA 5ETOA 2J0SD 1NK0A 3U7JA 2MGZB 3MEDB 2Y1OA 2F5GA 2C42A 1RHUB 3DLGA 4YQWA 3IO1A 3J80U 1RLDA 4I2QA 3LGMA 2GVDB 4EO6A 3R1LA 1TMJA 4WOHA 2IRYA 3GSDA 2JRSA 2NPFA 1RCXB 3KDNA 1SJQA 1F2HA 2B4UA 1TL4A 1WHWA 1SH0A 2RDIA 4YDXA 1IR0A 3TZXA 4JI2F 1ONYA 2J17A 1R6YA 4I56A 3TX0A 2ZE2A 3BGFA 2AJ4A 3C6TB 1S72S 1B0TA 4LJMA 4R8UA 3CIZA 5KA7A 4NYPA 2IMGA 3PYFA 2J6SA 2R7TA 4OHIA 2A3JA 3RGOA 5A8KB 4D3QA 4ZVSB 4I64A 5T7LB 2HRTA 4HEA9 2YKOA 1RKJA 1FNOA 4CVMA 3BPSP 2W9BB 1HNWJ 5IQ6A 1SV5A 4PQUA 2YQ1A 1VQMS 4DZ6A 4X4NA 1NRKA 5IBSA 2UZAA 2YKMA 1SI9A 2O01C 4OFZA 4OI2A 2X3DA 3UDLA 1SL1A 4XDCA 1X4AA 4RWWA 5KAAA 3V0HA 2F4FA 1QM9A 1HD0A 2KRRA 3MR6A 1ZC0A 3LQVA 4JOUA 3G82B 1SQEA 4DDFA 2NTAA 4RW6B 2YNIA 5HQ8A 5CZVA 2UUAJ 2QV6A 2WOMA 3PO5A 3OVBA 2OUDA 2BEFA 1LXNA 1FCAA 2HVEA 1F2GA 5FD1A 2R2RA 2KT2A 4ZS6A 1SIWB 5KAKA 1IBMJ 1KLNA 1V3RA 2IHR1 1Q6JA 3ZV2A 1BMQB 2KXFA 5LOQA 3S3HA 3PIOQ 3OMHA 3GIIA 1QSLA 1JQGA 3O5XA 5HANA 3NRSA 3IBCB 5E0OA 2Y1LB 4H4KA 1JBWA 1IKVB 2O67A 4BUCA 2DR6A 1YJRA 2GV1A 4F3QA 3GJQB 1X7VA 5K20B 3V81A 2LQJA 3DLLQ 2DXEA 4LSNB 2Q05A 2I5JB 1YZ4A 1S9EB 1Y4ZB 1WOPA 5ADZA 2KT3A 3U96A 2XCAA 4Z7YA 2X3GA 1RWXB 2HHXA 3DI6A 4GMKA 4XAKA 1KQSR 3DLGB 2KFYA 3D2WA 4I2QB 1QY7A 1RT7A 3QLHA 2MQPA 2WAQD 2QMUB 3O44A 3A13A 4QIFA 4NLUA 2ZNYA 2ZJQQ 2DPIA 2MJUA 3W3SA 2VHGA 2MDAA 2WSEC 2K8GA 2ZE2B 4L73A 4UQGA 2PO4A 2VC0A 2ACMA 2AZRA 3PRBA 4LR7A 5F0WA 1SKWA 4KV8A 1UW9A 3OSNA 2CYYA 2HFVA 4QWDA 3R6GB 4DGPA 3VZIA 2IM3A 4CLWA 1YTWA 1DZ5A 4MIAA 1PYOB 4Y2AA 4PZVA 4DV4J 1SV5B 4PQUB 1KOOA 1CJVB 4TY8A 3G8QA 5CYMA 1G1FA 5LMNJ 3V6DA 4IRCA 4JBCA 5KFHA 5B0AA 2BKOA 1NKCA 4U67Q 5JMNA 1ZM9A 1N4LA 1S6QB 2F6WA 2I6JA 5D77A 5LM7E 1WF0A 4B3OA 5F9LA 3S01A 2GJFA 3D6MB 3FQLA 4TQSA 4F36A 1X9MA 2YNIB 4ZJLA 2DH7A 4JI8J 2WOMB 2MHNA 3MTKA 4A46A 2QTWA 2CJQA 3CJ4A 1VHIA 1WKJA 4I1TA 4K0KF 4UZCA 3L95X 1UTAA 3D3CJ 1XR7A 4I7FA 3M2UA 1WTBA 2AYEA 3HFVA 2D7SA 3QCJA 4TXSA 1VQNS 4NPOA 2G0CA 3RRHA 1N5VA 3BGRB 3EGZA 2IYIA 1Q5YA 1S1XA 2DISA 2WGPA 4F3OA 1BWEA 2CQ1A 1PC5A 2X1AA 2DIUA 5JXSA 2VPYB 4HJQA 2FZKB 2AEFA 1HMVA 2GHPA 3FFIB 2BE2A 4P2SA 3F41A 2YX1A 4MIWA 4WXWA 3I0RA 4OZ1A 2DTJA 5KFDA 5IOLA 1W7KA 1N56A 2M8HA 3OL9A 4F04B 3GFHA 2AZ3A 5KFUA 1XMQJ 3DI6B 2OTLS 4NLWA 2QSWA 1HWKA 4NXNJ 3JXOA 4RPFA 1RT7B 3LP2A 2BOAA 3VQTA 4RH5A 2HNDA 3GE9A 3GJTB 2F4VJ 3KG4A 2JVRA 1WHVA 2L3MA 7FDRA 1S6PB 5EWGA 1U1LA 3M8WA 4K4XA 2QBPA 3DM2A 5DETA 4QZVB 1PTTA 5A0YB 3W62A 3W7BA 5FIIA 3RAQA 1NK4A 2IDEA 4NYZA 3HSDA 1TTHB 1SJRA 3MR2A 1N6QB 1VGYA 2JL9A 3FUYA 3AD8C 3ISNC 1PBUA 2HNZA 3ET6B 4CLSA 3GMGA 2CUYA 2R2SA 4DCPB 3QCIA 1WI6A 5BZZA 4OI4A 4PG8A 2FVSA 2HHTA 1ZOTA 2PBNA 5E3AA 2UUBJ 3RB6A 1NMEB 2PI4A 3GV8B 1NNDA 3M8QA 2QE5A 1JLCB 1D5RA 4I2PB 5C42A 4AXIA 5CYMB 1YFOA 4LF7F 3W5YA 4JMKA 1FVQA 1SUQB 1OJ4A 4M5IA 3D0IE 2OLWA 5L9XA 3VF0B 4F4KA 1LQFA 4CO5A 2AW0A 4ELTA 1HQUA 4KKOB 4ERCA 1Y5IB 4XDDA 2R8KA 5E3PA 1M5SA 3BQ0A 2PSZA 2YKPA 1FRIA 1G4WR 2AKWB 4OHVA 3IBWA 4DR5F 4X2BA 2XO6A 4GO7X 2C2ZB 5KG5A 2GIRA 2V4QA 2CNKB 1OO0B 2M52A 5CH7B 4C8NA 3HD2A 1VBZA 2IVMA 4K2JA 4KQZA 3NLCA 4NCGA 1VIXA 3P96A 1S1XB 3DRSB 1RADB 2PE8A 2EFOA 4EZ6A 4QU7A 5D15A 3S3EA 2RU3A 3M05A 5I4MA 1HI8A 2VPZB 2J0QD 4LF9J 4OYAA 4NZ6A 2GC8A 3CB4A 1TK0A 4HH0A 4QCLA 3D28A 1RWOB 2WB1D 1I9TA 3H20A 4MKBA 2AM1A 1B7YB 3SCLE 1S1WA 4NCAA 1GX5A 4NEZA 4WK1A 4IKAA 2CXEA 1U47A 3J80Y 2ESBA 1YPTA 1CVJA 3TAMA 2DHGA 1HW8A 3W64A 2H51B 5AT1B 3Q8SB 1G6BA 1UAGA 3LP2B 3EZUA 1D9DA 4MYUA 2FHOB 2JEJA 3KJVA 3QCLA 5FDLB 1ZYQA 3MXHP 4HI1A 3V0JA 4K8RA 2Y96A 1FKPA 2W4DA 1B64A 3QAUA 2Q47A 1U49A 4DV1J 4WFYA 4WFXA 2ZH2A 2Y68A 4DPXA 3I5CA 2QLBB 1X31C 3QMQA 1RT5A 3UFCX 2RRBA 5MLCV 5E3CA 4ZJOA 3CM3A 3CJQA 3F9AA 1D0EA 3HFZB 2OD4A 3I5AA 1EX8A 4ZITA 1NSKL 4ZPBA 3HD1A 2WVBA 3U02A 4IOCQ 3M6VA 4UOGA 2ROGA 2HFOA 2GQQA 3FEZA 1TKDA 1FTRA 5EHPA 2HRYA 4JI1J 2W2OP 3IAM9 4DU8A 2IM1A 5T41A 3IWXA 4OZLA 3ADAC 5ETKA 4ICLB 2E29A 1JIHA 3I9V9 2AMCB 3D42A 2B8QA 1HNIB 3P45B 1RHKB 1W7WA 1H38A 1NK5A 2GFFA 3EWGA 3F56A 1S4FA 3PIPQ 1PXHA 2HFSA 4EEYA 3I4HX 2OC3A 3G8TA 2EPIA 1NSPA 3IR7B 2MEWA 4N47A 4F3MA 3OR1A 2E1RA 1NAQA 4DUYJ 4RW7A 3K17A 4WWSA 1T11A 2ZHOA 1WD6A 1AA1B 4OI3A 5HLFA 4KO0B 5H9EK 1UP1A 1ECVA 3OTOJ 2CJZA 2L08A 1TAQA 3ZO7A 4NYHA 4USMA 2AYGA 1IWGA 1VCTA 1NH8A 1R7IA 3Q8PB 3BBBA 3ZTPA 2XBPA 4E98A 1ZCKA 1QTNB 4NXMF 8RUCA 2E5LJ 3BM8A 3QCCA 4NCGB 5B0FA 2IC3A 5LXRA 1YKWA 4LRCA 2M88A 2HS4A 3NG8A 5H9FK 3CCVS 2I6WA 4OHDA 2R8JA 2WSCC 3M8RA 1S1WB 2A18A 3BREA 2VA2A 2I4EA 2Y0SD 4KI9A 3QFHA 4IR1A 5L38A 4P72A 4MKYA 3I0SA 2XGPA 4C2MA 1VQ4S 3AJDA 3TAMB 1PCAA 4W98A 4A8SA 3KJVB 2V63A 4EYIB 2IM0A 3KLIA 2R3VA 2Y3YA 1RYRA 3CCMS 2XY5A 4ZLNA 4RBVA 1L8GA 3SQGB 4NLXA 1GWZA 1LWEB 2H03A 4OYPA 1FFSB 2GQ2A 5E41A 2FJVA 3F81A 4A8FA 3GIRA 3DFEA 4HTIA 1I94J 3ZZPA 1MKPA 2AJ1A 4QWAA 1HYSB 3UCUP 4L76A 2B6AB 3KJQB 2HKEA 2YWEA 4DQIA 3RTVA 4AE5A 5L1JA 2YWGA 3O4UA 5KFXA 2CMCA 3NWGA 1AZSA 1LFWA 1EHWA 2F63A 4K2XA 3FMBA 4MAKA 1W2IA 4J9MA 2LECA 4DR6F 2V8PA 1IBLJ 3BM7A 1NWLA 2V9WA 1WKLA 3KLFB 3V4IB 1RAIB 3GV5B 3X1LB 4QW9A 3C14A 2E1AA 4QUNA 1NSAA 4RW7B 4IFYA 4Y00A 2QGFB 5HLFB 1NWEA 2QBSA 3WDOA 2ZHAA 4YB7A 3GCXP 3WQPA 1C84A 2GJ2A 1SH2A 4K50A 3KUHA 1JLNA 3PTWA 2HBRB 2J9DE 3LO3A 2GVZA 2HAFA 5A5EA 3KK2A 2Z2LA 1ZH5A 4Y2IA 1U2CA 4DV7F 3QJPA 3NXZA 1XMOJ 5DDPC 3BLTA 2EFQA 3UN5A 3H2LA 1KHWA 2IC3B 2VTEA 2C3UA 1I1GA 1F1BB 4RWXA 1PTUA 2DNOA 3R2DJ 3B4MA 5DG8A 5IBMA 5EUHA 1FXLA 1GMVA 2R8HA 1YJVA 4I6YA 5DG7A 2A6MA 4LREA 3BKFA 1M1HA 4QR0A 3M6XA 4OZ0A 2IVFB 1GMWA 2Z2YB 3QZ7A 1JWWA 3D1QA 4DR2J 2DRBA 2VBZA 2B3TB 3MEKA 1RXDA 2W2QP 1X4DA 4ETZA 5HL7Q 2NV5A 5C2GA 4ER8A 2CAJA 5K9VA 4CO3A 5CHCB 1C88A 1L3SA 4O4GB 3KLIB 1RT2A 2CWKA 2CNLB 4RNOA 4LF1A 1RHJB 5AXMA 3AT1B 4RUBA 1U1PA 3BQ1A 4QU6A 2CJ9A 5LMUJ 4X65F 2J7WA 5GTJA 1VISA 3GTYX 1WEZA 5HDEA 2FD2A 1U6ZA 1D9FA 2IIHA 9RUBA 3A12A 3BYPA 3CDEA 5HMWA 3DOKA 1WCHA 1YTNA 3H4BA 2N3OA 1JJHA 3O2IA 1Y0HA 4ZP8A 2V34A 2JLFA 5K8PA 1YRUA 5AE3A 2E5LF 1ZM4A 5KT5A 1KR4A 3FVYA 3P4UB 3A1YG 4O3RA 3HN7A 5KA2A 4W4MA 3MMAA 1RWPB 2VFVA 1LXJA 4UW2A 3RUBL 2C2RA 4J9LA 4NA2A 2K7JA 1JLEA 3MD3A 4LF8J 3PR5B 2XYGB 3UNYA 2IAJA 1MG7A 2E1CA 1XK8A 3CCWA 2GGPB 1KFDA 2H4GA 2M5YA 2CNEA 3C19A 4DS5A 4LMZA 5KFGA 1Y5LB 3LK7A 2D3O1 4PG7A 1SH3A 2DNHA 2GVZB 4ZVQB 3PHEA 2BXJA 3TI0A 2XMVA 3H5YA 2NZ4A 4D3GA 1VJWA 4JUZA 2ZD1B 2C2KB 1UL3A 2BOPA 1X4GA 2RHQB 1HI0P 2MXYA 3VAMA 3VAGA 4P7VA 2ZBPA 3GSIA 1VQPS 1XERA 2CJBA 4FS1A 4UOFA 4ALZA 2GMLA 2BV3A 2KN4A 4HDGA 2WRMA 4LRAA 1O8BA 5EWEA 1GT8A 2ALYB 3M2RB 2ABYA 2GZOA 3QO9B 4NLPA 3I96A 3B8HA 5JUMA 1FFGB 4YHHF 1X60A 2OUGA 2NUUG 4DN9A 3MD1A 3BO4A 5HI7A 3BGUA 2SHPA 4NNDA 1S1TB 4KYRA 3C8YA 1O5JA 1WKKA 1RP5A 2VBWA 3K59A 4K4TA 1Q6MA 2YH1A 1NUEA 2VF3A 4JI6J 4GE5A 2F46A 4QIGA 1VQLS 1Q53A 3HK2A 4TVAB 3THVA 1E6VA 1N5QA 3CO0P 4UUXA 5M2UA 3TVKA 4YY3F 1PTYA 5BUGA 1WSVA 1Q95G 1UVMA 3VGVA 3ETMA 3IRXA 1L3TA 3AHPA 3DOKB 1Q82T 4F8RA 4NEYA 4P75A 2EKNA 5H9EJ 3LTOA 2CM3A 1K0VA 2HWIA 2N3LA 3H90A 3D54A 3KDOA 2ASLA 3RO1A 4UQTA 5GAGI 2XB2D 3V0IA 2A3KA 1T94A 4TKTA 2VQFJ 1G7FA 2KU7A 2XTJP 3MMAB 4P6QA 2NXEA 2QX0A 2PD1A 3E51A 3W65A 4YAAA 3Q22A 3NP5A 4ID8A 1RBOB 4M5MA 1TL7A 2NSCA 5GAHI 4RNMA 2MQNA 1R8BA 2B56A 1LK7A 5E33A 1WG1A 2HHHF 2VODA 3OQ2A 2VFUA 4BUBA 1RTJA 4YEAA 1RTIB 4CNZA 2KRBA 2FLPA 1T48A 3U27A 2QLXA 2KG1A 5D0EA 1JLFA 2WZ1A 2H1YA 1Q5VA 4C0HA 4FXVA 3ENQA 5J1NA 1YJUA 3JQKA 2OOQA 2JNJA 2QZ8A 1YGRA 1JKHA 4AL7A 4F4ZA 4CZCA 5D3GB 1M1KT 2AJQA 2ZH1A 3QZ8A 5AJ3J 2NZ6A 3HKWA 4YUDA 2MQLA 1R8CA 4X4OA 2CQ4A 1FXDA 5AXKA 1MWQA 2CJXB 2J6TA 2ZH7A 2NT7A 4DR1F 3SBMA 3MDFA 2DNRA 1YLXA 4ED5A 1NSQA 5BYRA 2XWYA 4B04A 3A8IA 2CQPA 3LAMA 1NPRA 2ZOFA 2HQCA 4WBFA 2PA5A 4DGXA 1TL1A 2YH0A 3PKYA 4J5OA 2VL1A 3PW5A 5DDRC 1ZM2A 2ZVSA 1ULRA 4J7CA 1VC6A 3OJUA 2P6TA 3JSMA 2D3UA 1UVJA 3OFFA 1KVKA 2GMHA 2XS2A 5EX3A 5JVHQ 4BJOA 3LWLA 2A1BA 4BHQA 4ILMA 1HWJA 2IBKA 1XR5A 2AZ1A 2D1CA 4Y34A 1G4CA 3CXCR 4JI3J 1BUXA 2PIIA 1J4XA 3IRXB 4O0NA 3BBCA 3HPOA 4F50A 4DPOA 4RW4A 4KE5A 4Q43A 1ZETA 4CLZA 1F5AA 3CD7A 1T02A 4HI2A 1VBXA 3LA0A 3MM6B 1P31A 3QIDA 2UVVA 3I36A 2AP6A 3GZ7A 1QUVA
chains in the Genus database with same CATH topology
4KTQA 4TYBA 5T7LA 1IXKA 4CIOA 1FRJA 2KJVA 2KG0A 2JC1A 4FP9A 2MKSA 4C3KA 4WKYA 1DTTB 3H2XA 3OXGA 4RHGA 3RU0A 2J9CA 5DRKA 4HYKA 4DV1F 1Q16B 2HMIB 2XHWA 3ULHA 2W9BA 3BSOA 1OEOX 1TFYA 3QLHB 2E7WA 4YDDB 2FGOA 1IJFB 3HF5A 2WSFC 1HA1A 3N5FA 3U1NA 5C25B 1KRPA 1LW2B 1BD6A 4L3NA 2RIJA 4A8QA 3I80A 3CDBA 5KFOA 3SV3A 5IT9Y 3S1TA 1X5TA 1K73T 3VAHA 3IR6B 4UUWA 3GILA 2CPDA 3CD0A 1KSPA 1RTJB 3CC2S 4CO1A 1R0AB 1Y9OA 1ZAVA 1RISA 3KNAA 4IKCA 3DXBA 1HNXF 1BZHA 3NBPA 4J51A 3QGHA 2W4PA 3NMRA 2ERRA 5KT7A 1FE4A 2DO4A 2FHMA 1GAOA 2ZBCA 3E8OA 3M2RA 3W2VB 2W9AA 4J9QA 5KA8A 2QO3A 1QSYA 2CDQA 1DARA 3TR5A 2VUGA 2RSQA 1ZCLA 1Q8LA 3QO9A 3H5XA 5KFLA 1NK7A 1R8AA 1TKXB 1UVLA 1JLFB 3W2WB 3RZ2A 4X4UA 3KMSA 3IFEA 3B7OA 3H4DA 3CIMA 4XO0A 2XLIA 1VC0A 1QLNA 1KS2A 3SFUA 3KTQA 4BDPA 1PC4A 1VS3A 2MY7A 4TQRA 3F9BA 1NZAA 4JI1F 4YFUA 5EDWA 3MPYA 2DGUA 3BSAA 2FJBB 3MGJA 4NCBA 5B0BA 1JLGA 5CA5A 2BM0A 4KV8B 3J7YU 3KK3A 2XY6A 2B0GA 3CJ0A 1IN0A 1C1CA 3QAEA 4WE1A 3ZM0A 3O8WA 1IKWA 2GJIA 5DLGA 2EFPA 5KFYA 2IBOA 1S1TA 2OP5A 4H4MA 4DX8H 1JKHB 4ES3A 3HVAA 1FRLA 3QWUA 5IFMA 1QAJA 2FY1A 4OJ3A 2MJNA 4TU7A 4TNOA 5J1EB 2NR0A 2VPWB 5GAGU 4PUOB 4DV3F 2BACA 1OSCA 2WBRA 4FPRA 3OHBA 1LK5A 1QAXA 2Z2MA 5KFJA 3DRRB 1NO8A 1FPRA 2O66A 3PNIA 3QGGA 4Q0BA 2XMUA 3EGNA 3QCKA 3I31A 4DUZF 4KT0C 4BWMA 4U6PA 2DIVA 2QA4S 1FERA 2RKIA 2H02A 1JNRB 2BJEA 3EXCX 4PXCA 4MJKA 3LALA 2VQEF 3GXHA 1G7GA 2CG4A 5KFFA 3SI8A 2AU0A 3N6LA 2GP0A 1KAVA 2WHOA 4ID5B 3PKMA 1TR0A 3NAIA 1XN9A 3DNCA 3MPVA 2CQCA 4TY8B 2W24A 1QJHA 5GAHU 4B9VA 1YJNS 1RT3B 2DGVA 3THPA 4Q5VA 3L7PA 4IG3B 1DQ8A 2Y1JA 2BBEA 2D3ZA 2L41A 4DUYF 3V6DB 4ILLA 1I57A 5A6WA 3AJ2A 4C97A 3TW0A 3VR1A 5LXQB 2VBYA 1T4JA 3N5BA 1G7CB 2RQMA 2B5JA 3BO3A 5KFVA 1XM2A 2HWHA 2JEFA 1LWFB 1VQSA 2EKYA 4NRUA 3KLVA 2MKHA 2QA2A 2FPHX 3OTOF 3EMUA 2LDIA 2CPHA 3FCHA 3BR8A 4ZCIA 3EAXA 1N36F 3CJKB 1Q6NA 4DWIA 5BR8F 4WK3A 3OXFA 1FKAF 4Y14A 3N4WA 1TVRA 2RRAA 4B3RF 4F02A 2V8GA 3SV4A 5DQHA 3TA0A 2HAIA 1Q81T 2LXIA 4NLSA 2DCUB 3SMEA 1FNXH 2I6OA 1VRUA 2R2UA 4B3OB 1LFPA 2AX0A 3RRGA 3CCTA 2K3KA 3IC1A 1HHSA 1IKVA 1N0UA 1PO6A 2PI5A 2LVWA 2CM8A 4ECYA 2ASDA 1TL1B 1HQEB 4YOEA 1FJCA 3EX7B 4E0DA 2ZM6F 2I42A 3HI9A 3ZFVA 4OX9F 2PI7A 1RT4B 3TUZC 1VIOA 2I5JA 3PW2A 2HNYB 5BZXA 3OSPA 1TV6B 4RNFA 4DOZA 1XWLA 4KC5A 1M0SA 1KC8T 3GG0A 2M8DB 2VQFF 3TNVA 5A8RA 3V5RA 4X62F 5J2MA 1IJEB 2OFGX 1RKIA 4NLQA 3S6EA 2L48A 2J0SD 4NLTA 3CMES 2QSFA 4S0GA 4ZCLA 1MMDA 1NK0A 5KFPA 1XXVA 3U7JA 3GYNA 5SUHA 5IM0A 2MGZB 4FXDA 3MEDB 5GMKa 2Z8QA 4I7FB 3M2UB 2KHCA 2GO9A 5E5NA 4ZCKA 1T8EA 2C42A 3SCIE 3DLGA 4FS2A 4YQWA 3IO1A 2VA3A 3O5TB 4I2QA 3EYZA 1T49A 1XBOA 3LGMA 3M32B 4EO6A 4K5RA 1KEKA 2NLKA 2BGDA 2YWFA 3R1LA 1C0UA 2N7CA 3V6JA<