4WTYA

Structure of the ptp-like myo-inositol phosphatase from selenomonas ruminantium in complex with myo-inositol-(1,3,4,5)-tetrakisphosphate
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
314
structure length
314
Chain Sequence
QTVTEPVGSYARAERPQDFEGFVWRLDNDGKEALPRNFRTSADALRAPEKKFHLDAAYVPSREGMDALHISGSSAFTPAQLKNVAAKLREKTAGPIYDVDLRQESHGYLDGIPVSWYGERDWANLGKSQHEALADERHRLHAALHKTVYIAPLGKHKLPEGGEVRRVQKVQTEQEVAEAAGMRYFRIAATDHVWPTPENIDRFLAFYRTLPQDAWLHFHSEAGVGRTTAFMVMTDMLKNPSVSLKDILYRQHEIGGFYYGEFPIKTKDKDSWKTKYYREKIVMIEQFYRYVQENRADGYQTPWSVWLKSHPAKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the PTP-like phytase from Selenomonas ruminantium in complex with myo-inositol-(1,3,4,5)-tetrakisphosphate
rcsb
source organism Selenomonas ruminantium
molecule tags Hydrolase
molecule keywords MYO-INOSITOL PHOSPHOHYDROLASE
total genus 110
structure length 314
sequence length 314
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14566 PTPlike_phytase Inositol hexakisphosphate
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1690 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4wtyA01
3.90.190.10 Alpha Beta Alpha-Beta Complex Protein-Tyrosine Phosphatase; Chain A Protein tyrosine phosphatase superfamily 4wtyA02
1PTYA 2SHPA 2F71A 3ZV2A 1RXDA 2I6PA 4RKKA 2QDCA 2VEYA 2Y96A 1L8GA 2H4KA 2JJDA 5KA8A 1OEVA 3F9AA 1YFOA 3I36A 4KYQA 4GE5A 1G1FA 4OHIA 3CWEA 1ZZWA 1PTUA 3ZM3A 3F41A 4ZI4A 4PYHA 3GXGA 3BM8A 1PA1A 2ZN7A 3QCHA 3QCMA 4YR8B 1XBOA 2DXPA 2C46A 4WU2A 1VHRA 2H03A 1BZHA 4RDDA 1NWLA 2OOQA 2GWOA 1KAKA 2B4PA 4BJOA 4ZN5A 4GE2A 3SMEA 1Q6PA 4OHDA 3GXHA 5EHRA 1QXKA 2CNFA 2B4SA 3S3HA 5BUGA 5BZZA 5K25A 5GTJA 1C85A 1C86A 4GRYA 4OHEA 3ZM1A 1YGRA 3QCBA 1Q6NA 2F6TA 4RI5A 3U96A 3F99A 1I9TA 3ZM2A 4H1OA 4ERCA 1C87A 2VEXA 2NLKA 2HC2A 2I4GA 4NWGA 2F6YA 4R0TA 1BZCA 2OZ5A 1ONYA 1U26A 1G7GA 1C83A 3SR9A 3QCNA 4AZ1A 3F81A 1Q6TA 2CFVA 2QBRA 4S0GA 2I6JA 4HJQA 3RZ2A 1P15A 2I5XA 4TVVA 3EMUA 1Q6SA 1XXVA 1G7FA 3QCIA 3D44A 2HB1A 4NYHA 2QDPA 4QBWA 2QBPA 5EHPA 2HC1A 2BGDA 3I7ZA 1PA9A 2OUDA 2PA5A 1OESA 4HJPA 3MMJA 4PVGA 4NX8A 3S3KA 3MOZA 3A5KA 2NTAA 2PQ5A 3QCDA 1ZCLA 3B7OA 2QDMA 2CNHA 2HXPA 2PBNA 1X24A 4R0SA 4YAAA 3AWGA 2QCTA 4NWFA 1G4US 1OETA 3O5XA 2GP0A 2PSZA 1YTNA 2Q47A 3ZMPA 1WCHA 1PXHA 2H4GA 3D42A 3CM3A 3O3LA 1OHDA 2E0TA 3H2XA 1Q6JA 1YWFA 3D1HA 3A5JA 5KA1A 2QBSA 2H02A 5KADA 2M3VA 3V0EA 2I1YA 1ZC0A 3I80A 4ICZA 1ECVA 2CM8A 1QZ0A 5KA7A 2J17A 2VEUA 1PTVA 3F9BA 4GS0A 4OHLA 2B49A 1NNYA 2R0BA 3BLTA 1AAXA 3V0JA 1NO6A 2QBQA 3S3FA 3RO1A 5IBSA 1YTWA 5BX1A 1LQFA 1XRIA 5KA3A 1FPZA 2Q05A 3BLUA 1EENA 2G6ZA 1Q6MA 3QCKA 4D3RA 1OEMX 2VEVA 2I6IA 3S4OA 1XXPA 2F70A 3S4EA 1OEOX 1JF7A 1JLNA 5K9VA 3RGQA 2IMGA 3N0AA 1G1HA 3AWFA 2CM2A 4HRFA 5KA0A 2GJTA 5M43A 2FJNA 3D9CA 2CMCA 4Z6BA 1D5RA 3ZM0A 1MKPA 2BZLA 4DGPA 1LARA 3QCGA 2F6VA 2CM7A 3V0HA 4GFUA 1PYNA 2I3UA 2J16A 1YN9A 3O4TA 2H04A 2HVLA 2CM3A 4GFVA 4JMJA 3QCFA 1YPTA 2G59A 2CMAA 2I4EA 2YDUA 1RPMA 1L8KA 1YGUA 5KABA 4B04A 2HCMA 4JBCA 2F6FA 3V0IA 2I3RA 2J16B 2CNEA 4KI9A 2AHSA 5K23A 2HY3A 2F6WA 2Y2FA 1ONZA 5K9WA 2B4UA 2OC3A 3QCEA 4QUMA 3EU0A 2NT2A 4Y2EA 2FH7A 2ESBA 3EAXA 1SUGA 4JNBA 5LXQB 2I42A 4Y14A 1OHEA 2BIJA 4D3PA 2QEPA 4RHGA 3QKPA 2I6OA 2PT0A 5MMZB 3EB1A 3OMHA 5K22A 1NWEA 1T48A 1G4WR 4GWFA 4WU3A 4WOHA 5KACA 3ZMQA 1G1GA 2H4VA 3NMEA 5KA2A 5J8RA 1LYVA 1R6HA 2B3OA 5K24A 2CNIA 2WGPA 3QKQA 4QUNA 2NZ6A 2CJZA 2NT7A 1YTSA 4ZRTA 1A5YA 1BZJA 3O4SA 3LJ8A 5AWXA 4WTYA 1KAVA 1T49A 2P6XA 1J4XA 1PTTA 2I4HA 3S3EA 2I75A 1Q1MA 5IBMA 1YZ4A 4BPCA 2A8BA 4H34A 1FPRA 4D3QA 2HNQA 1U25A 5KA4A 1NZ7A 4R30A 3RGOA 2F6ZA 1U24A 1WRMA 2CNGA 3BRHA 2ZMMA 2B07A 4MBBA 1PH0A 5KA9A 1V3AA 1I9SA 3V0FA 1EEOA 4KYRA 3V0DA 1ZCKA 5HDEA 4GRZA 1C88A 3QCLA 4JMKA 1I57A 3V0GA 2MBCA 3PS5A 3AWEA 5I6VA 3MOWA 2I6MA 2CMBA 1WAXA 2NV5A 5BZXA 1M3GA 2P4DA 2F46A 1OHCA 4RI4A 2C7SA 3D1OA 4J51A 2HNPA 2BV5A 2FJMA 4DGXA 4I8NA 2BGEA 2AZRA 3QCJA 1GWZA 4QBEA 4GE6A 2B4OA 4RH9A 1C84A 2RF6A 4NNDA 1T4JA 3QCCA 4IKCA 2VEWA 3O4UA 3EZZA 1OEUA 3OLRA 1NL9A 3M4UA 1XM2A 1FQ1A 4QAHA 2PI7A 4RH5A 2A3KA 1GFYA 4OHHA 5KAAA 3D1QA 4QAPA 2QCJA
chains in the Genus database with same CATH superfamily
5HMZA 4LR9A 1YJNS 3B78A 3F56A 1TL3A 3MM8A 4DS5A 2R7SA 1J5EF 1FWKA 2OMLA 1IKWB 4QU7A 2KTQA 5HMXA 4B3OA 3ZV2A 2RF2A 2VEYA 3MOJB 4NZ7A 1J5OA 3CJRA 1Q86T 1L8GA 1UWAA 2GX8A 2QA1A 2QC3A 4ED4A 4R8UB 2JJDA 2GC6A 3C15B 1XNRJ 5KFMA 3FKBA 2EW9A 2HGLA 1LOUA 4IQMA 1FI4A 4L72B 3EPIA 2C2RA 4KYQA 1DURA 1S10A 4WZMA 1G1FA 3QSIA 4C8OA 3SV4A 1IKYB 3FRYA 2BE2B 2IM3A 3Q89A 4RR5A 4U7UD 3CWEA 4CVKA 3JAMU 4HEA9 3THPA 3UW1A 2CZ4A 4KHMA 1YGYA 2ASYA 3HDSA 4JOUA 4ZA1A 3W1YC 2BR0A 4ZI4A 1REVB 4FVMA 4OYPA 3H90A 3PHTA 1IBMF 3OR2B 1PA1A 2U1AA 3J7A1 1X8DA 2ZN7A 1LWFA 1VLYA 4NYPA 4C0OC 2XB2D 1KHVA 2GHVC 4IH5A 3QCHA 2ZH6A 4NA1A 4HHHA 4P2SA 4GC6A 1TL1A 1VFJA 5F0WA 4IDKB 4EGLA 3T1HF 4YR8B 2BV3A 1WKKA 2AEFA 1NJZA 5IV3A 1XBOA 1BQMB 2DXPA 1LW2B 2RHQB 1X60A 3OR2A 4WYWA 1O51A 3SCKE 3WX4A 1ZTTA 2VA2A 4JI0F 4PWWA 2VJVA 4IRKA 1PG5B 1Z2LA 3M4XA 1VHRA 2ACMA 2AJFE 1T0TV 3BN7A 3HMJG 5GADU 3MUMP 4DV7J 2X1FA 1NWLA 4RDDA 2BE2A 2V63A 3SZ2A 2QX0A 3S01A 3PEHA 2JRSA 2UVRA 2G59A 1SJQA 2VTEA 2W9AA 1E8CA 2DGXA 1U02A 2K06A 5AE1A 1SUQA 2ZVIA 4F4KA 3CTRA 1LQ9A 3GXHA 3VAIA 5AT1B 3W8PA 5EHRA 1TUWA 2VUGA 2CQ2A 4QIWD 2GMJA 2NR0A 3PKYA 2ZNZA 4CO2A 1P9YA 3GG0A 5H9EK 1VQSA 4KYZA 5GTJA 1CJUA 3AOAA 2KXHA 5ADZA 1UVNA 4TVAB 3TR5A 3OV7A 3OFGA 4GRYA 2B8QA 3ZM1A 2CPZA 4I56A 5BYRA 5I3UB 1YJ9S 3H7HB 1IBLJ 1TK8A 2BANB 3ZO7A 5ETTA 1NK4A 3W65A 1NK8A 3MM5A 3F99A 3PYEA 4RW6B 1Q53A 5JXSA 2XNQA 4LQ9A 2AGOA 3KJNB 2OPRB 4NLPA 1AUDA 3ZM2A 2GMLA 2VZ9A 3RBXA 4YEAA 5F8MA 1WJ9A 2NYIA 2HIYA 1HBNB 3M2UB 4HT7A 4ZJQA 3V6DB 5KT7A 5GADI 1S6OA 2RD5C 1C87A 5KFGA 3F73A 4K4YA 2HC2A 3UCZP 5KG5A 4PXBA 4Y2IA 3OLAA 2HHVA 4NCGB 4DQSA 3OR1B 2LU2A 4DL3A 2I4GA 4DSJA 5HANA 1FCAA 2ROPA 3KJVB 1RWXB 3A3OB 5D15A 1ONYA 1YJRA 1G7GA 5E3RA 3SR9A 2OO4A 1X4DA 3UI3A 1RWNB 2P8IA 4Y6IA 4AE5A 2XLIA 3QCNA 1N5VA 2OPQA 1JQGA 2YKMA 5BYSA 3CJQA 1ICEB 3MM9A 3KLHA 4IRCA 5C24A 3F81A 4ED1A 5MAOA 1KQSR 2CFVA 2W2NP 3RW6A 3HT3A 2QBPA 4ZCMA 5ETSA 2VV5A 1EHWA 2BM1A 2HIQA 5BXIA 2VICA 2ADCA 3SEOA 2I6JA 3RZ2A 5J2NB 1NDCA 1QUPA 4RW4B 1M1KT 1FKAF 4TVVA 1Q6SA 4B9TA 2DGWA 4JI8J 1G7FA 1TKTB 2CYYA 1RWOB 2BX6A 2J9EA 3D44A 3NXZA 3QCIA 1LEOA 2EWHA 4ZS6A 4DX5A 1YITS 1IM4A 3N6LA 1SIWB 3BGUA 1SC3B 1PKUA 5CHCB 3G71S 3K5NA 3OTCA 2KT5A 5HVHA 3UDEA 4C8NA 2XO7A 2BGDA 4QIEA 2E7XA 5D3GA 2PA3A 2RQMA 4CH7A 3JSYA 5DDQC 2D74B 1B70B 4FS1A 2E5LF 2FQQB 4RNMA 2C28A 1M5SA 1TKTA 1ZPWX 2YKQA 2I1RA 3B4MA 3HN7A 1GQYA 4KR0B 2OUDA 5C2CA 1DLOB 4RX6A 4UQTA 4CLLA 2Y1LB 3VQSA 1OESA 3ZNJ1 1CSJA 2RSQA 1H98A 2HAIA 4HJPA 4NEYA 5DO2A 2UUBJ 3MMJA 5D4OA 2GC5A 2G0CA 1YRTA 3D0HE 3QAEA 4NRTA 2CJYB 3RBZA 3B82A 1R0AB 2LMIA 2WSEC 1N33J 4ZN1A 3MOZA 2YKMB 4IG3B 4IG0B 3A5KA 1S1WB 2WVEA 3H4DA 2BE7D 3EM1A 3BR9A 2UV8G 4YS2A 4DV6J 2P2CB 4R30A 2R7VA 2JC1A 1PYSB 1FHTA 2XNRA 1ZCLA 1ZOTA 4OI6A 4RLEA 3LW5C 3D28A 2HXPA 2PBNA 3AY0A 1PC4A 3C46A 4KGZB 3I4PA 4DUZJ 4YAAA 3FQLA 3KK2A 1RACB 3MMCB 4N8OA 4CVMA 2IIHA 5CZVA 1HNVB 2Q6BA 3CDAA 5T7LA 1V5VA 3VV2B 1U2FA 1RHJB 1KFDA 5HJXA 3BJYA 1WTBA 2DTJA 2UUWA 4EU0A 3AODA 5A8WB 2ZWOA 2VFRA 1N8RT 3MAHA 4HL9A 3JSMB 1XTZA 3O5XA 1WHWA 1D1UA 3E8OA 4DV2J 3H0PA 1VBZA 2DRBA 4IQXA 1HD1A 4HH1A 4CLWA 2YY3A 2DNYA 1RJJA 2UP1A 3KNGA 3ZMPA 2EBGA 1QLNA 3MR6A 4RW4A 3I5BA 3IMQJ 1PIEA 1S1UB 4RKUC 1OHDA 1F60B 3N9UC 1FXLA 1LK5A 5LMUF 3SYZA 3BPSP 3MMBB 4OJ3A 3IRWP 1XNQF 1K0TA 4O3RA 4RZRA 3BREA 4ZCKA 5D6GA 1SBRA 3GJQB 3MAQA 1IR0A 1TMMA 1XMQJ 1VQ5S 4NZ6A 2YVSA 2J0XA 3SQGA 2YNHA 3HT0A 3OT9A 4UF4A 1HI0P 3W9IA 4ENOA 1VS3A 1QTMA 1FX2A 3I9ZA 2OJ3A 2UUBF 2KG0A 3V0EA 4ZP8A 4OX9J 3QO9A 1WNEA 4RU9A 1WKJA 2IM2A 4ECTA 4NE9C 2H1YA 2XSJA 1IJEB 3M9OB 2J17A 4OHLA 2J8SA 2FHKA 3WQPA 2R7WA 1OY8A 3GFYA 2RIJA 5KG3A 4URQU 3BLTA 3DDNA 1JJ4A 2Y1IA 4OYBA 2DEIA 1U1QA 3U1MA 3RO1A 1T95A 4E98A 1YTWA 3AAWB 3VWSA 4PG8A 2RUSA 4CWBA 4LQ3A 1RTHA 2J76E 4LR8A 5K9FA 5KA3A 4LBHA 3HZGA 3MECB 5EWFA 4LIWA 4HTJA 1P3DA 3GSIA 1S1WA 4B3TJ 1LWFB 2FC9A 2VG5A 3GR0A 1HI8A 4OYAA 5KFXA 1FJEB 2GZOA 4LFBF 1KWMA 4ETXA 1RT6A 2RU3A 1G4CA 1NJYA 1B7FA 4HI2A 4NLSA 1LNQA 2VQEF 1U6ZA 1XWLA 3G86A 5H9FJ 3CCLS 4OL8A 4X64J 1FX4A 3BKTA 3R6GB 1H6KX 4RUBA 3QBCA 3S1TA 3K58A 2D3O1 1W26A 2AJ4A 2AYEA 3EUNA 1XBWA 5HMWA 5F9NA 2R2TA 4DFMA 4M5GA 1LFPA 4OZLA 3T41A 2IMWP 4NXNJ 2R4FA 2GFFA 5GVQA 1XXPA 1HBMA 1RHUB 2JZ5A 3W2VA 2F70A 5A5EA 3ZTRA 2B0GA 4EI2A 3CCUS 1OEOX 2A6MA 3GCWP 3GLJA 5DGAA 3CCRS 1WEZA 5F9LA 5M2UA 3RGQA 1Z2ZA 1F6TA 1GK8A 1BMQB 1X31C 4ZPCA 5DS7A 3BH7B 2WTFA 3M2RB 2Z2ZA 3N0AA 4J9SA 5FIIA 5DM7Q 4IR9A 3C14A 3CJ0A 1GNKA 2NUUG 4XDDA 3LGNA 4OV6A 5E0OA 3K2YA 2QIFA 5KFLA 4F0KA 1NKEA 4Y2KA 2EG2A 1NHKL 2WK4A 3PJWA 3PXGa 3RB6A 2JVRA 2L41A 2JFDA 2J6UA 2GJTA 4PWDB 2P6SA 4OYZA 2DXEA 4YY3F 2F5GA 3MAAB 3H5XA 3CCTA 4IG0A 5K20B 3ET6A 1IBKJ 4ZN3A 4BHQA 1UTAA 2HFUA 1V9OA 2VH7A 1SC1B 5JVGQ 1IR1A 3OR1A 2Y3YA 2C2NA 2CPXA 3T9NA 3KK1B 2GVZB 4NI2A 4DV4J 1TFWA 4GKKJ 1NB7A 4LF4J 5IQ6A 2BZLA 4QWEA 4LSNA 1HQEB 4NA3A 2B8PA 1N54B 2MKSA 3WDOA 3ET6B 3JXOA 2F6VA 3V0HA 3ZZUA 4A8OA 5HJYA 4GFUA 3BYRA 4Y2MA 1PYNA 2I3UA 5F3TA 2XI3A 1U1LA 4DPOA 4ED2A 2J16A 2B3TB 4QBWA 2K1RB 1RLDA 2CQ3A 5KFKA 1SIZA 2H04A 2HVLA 4X4OA 3HPOA 1JB0C 2XHCA 1WHVA 1FA0A 3KFWX 3QIDA 3T6JA 5H9EJ 4NXNF 1U6BA 2N7CA 4PWDA 4GFVA 3CSKA 2XEXA 1Q4RA 3IA0A 3KYLA 1GMUA 2H4WB 2N3OA 5JUMA 1YPTA 1F9EB 2B5JA 2DHSA 3IG1A 5I4MA 2YPYA 4ED0A 2UUAJ 1GXTA 3A1YG 4ZDNA 2KYXA 4DR3F 2MGZA 1BC6A 3MF5A 2QFJA 2YDUA 3B6BA 4ETZA 1I94F 1L8KA 1HWKA 1UJ6A 3KUGA 4JB8B 4C0BA 1JXEA 1NJWA 5KABA 1FDNA 3ZZTA 4ZVQB 4JBCA 2F6FA 5DGBA 3LUYA 3V0IA 4Y2CA 3W2VB 2I3RA 5DDRC 1X5SA 3SCLE 2FJBB 3PHEA 4HDGA 1AUSL 4NEZA 4WYLA 4DV7F 3NGKA 4U67Q 4WK1A 3VF0B 5ETMA 2DNQA 2AD9A 2A2DA 3H42A 1NUEA 4F0MA 4USIA 1OPZA 4DUTA 2Y66A 1MW7A 1UA0A 1EAYC 2BOAA 2OC3A 3S7RA 2FLPA 4H4OA 4KPCA 1UFLA 2RE1A 3MPVA 4ZP6A 3T19A 2D3UA 2XMVA 3EVWA 4IFVA 3L7PA 3ZC4A 1JLEA 3PG9A 2VG5B 2FH7A 3BQ2A 2ESBA 3QRPA 4IDKA 3QJLA 1N34J 3MAAA 4IOCQ 1FJCA 2EFGA 4F4AA 4ZIYA 3BBCA 1CC8A 2ZZTA 5DM6Q 4K4VA 1SUGA 2VFSA 3FDSA 3TWZA 4FNHA 1FK9B 1M0SA 3I0RA 1IBMJ 2DPIA 5LXQB 3IXQA 3TAMB 4Y14A 2JVOA 2BIJA 3MUTP 3H59A 2CQPA 4A46A 4QR1A 1CJTA 1S1XA 2HYIB 1HD0A 1WI8A 2ZBPA 3GJRB 4DV6F 3DKDA 3G87A 3PZPA 2WCXA 3HLUA 3LOUA 3QQCD 4WPAA 1SVDA 4I1TA 3BSOA 2VKZG 2X3DA 3JTNA 4PXDA 1U2CA 4Y28C 4ZVTB 4LUBA 5KFZA 1NK6A 4ZVHA 4GKJJ 2C1EB 4P71A 3EB1A 1P9QC 1DHMA 1I51B 3Q0AA 1FRJA 3C15A 2UZAA 1OS5A 2YKPA 1VIXA 3BGRA 3N4WA 5HAOA 3V6KA 2HS4A 2RUGA 1G4WR 1T48A 1J5OB 3UFCX 5T14A 4GWFA 1XR7A 5KFDA 3W9JA 1GQQA 2DPJA 3PNIA 3U02A 4HACA 5KACA 1B4SA 4MIWA 4AD6A 2LA4A 1NEEA 3HX9A 4LFCJ 1WG5A 3FCHA 3TVKA 4J9LA 3TYTA 2GC8A 1X4BA 4ZITA 1RT7A 3M05A 1VQ6S 2MQNA 2DH8A 2QLXA 1TL7B 1UFWA 2VBZA 3M8YA 1HMVA 3TUIC 1DAXA 2ZWPA 3VAHA 2KB2A 4ELUA 1P31A 3NMEA 5K8PA 2BQUA 3CJSA 5L9XA 2XO6A 1KP6A 1YZ6A 2CQ4A 3H40A 2FYXA 2VPYB 3OVBA 5J8RA 1LYVA 5KFAA 1NK7A 3T5HA 4B9SA 2IDLA 1X5TA 3P49B 2HBQB 2E5IA 3KUEA 4OI4A 4EUVA 1R27B 2CPEA 3BGFA 4ZIWA 2CPFA 6AT1B 1U0HB 1V3ZA 4RNNA 3QKQA 4QUNA 2NZ6A 3BGRB 4ITSA 3KMQA 1P8GA 3FEZA 4EZ6A 3HVTB 4KC5A 2NT7A 4ED8A 5F8NA 1KOHA 2H5IB 3G8SA 2CNKB 1X0PA 3QJPA 3PX4A 3NCPA 4HH0A 1Q81T 1A5YA 4U8YA 1FRMA 3LP1A 1H3DA 5KG4A 3N5FA 3JQKA 3OVAA 2CNOB 1N0UA 4NLOA 2Y1JA 4UY85 1MMNA 4D3HA 2Y67A 1KAVA 3OXFA 3ETMA 4R8UA 2JH3A 2P6XA 1HWLA 1FK9A 2XMTA 3I0RB 3L4BC 5CH7B 3GWCA 3GYXB 1KLNA 3TZXA 4FF3A 2XM3A 2FY1A 3LGMA 4H4MB 2VPZB 3MR2A 2VHGA 4WZQA 2EFNA 3DRXA 2A8BA 4BPCA 4IG3A 3O8WA 1WACA 3LPYA 3N5BA 4GMKA 2V6AA 1C1CB 2WB1D 4WFZA 4JI8F 3FBBA 4OHZA 3OHAA 1NK9A 1ZZFA 1KVKA 1VIOA 3UR0A 1T02A 2RU9A 4RI5A 5J2QB 1JLCA 1DLOA 2J8AA 1M1GA 1UVKA 2XTJP 2F8EX 5KFJA 4DPWA 3BO4A 2PN6A 2G2OA 3Q2SC 5HQ8A 1SV5B 5D3GB 2B07A 4PPZA 4MKYA 1Q8BA 1FNMA 4TY9A 2QBQA 5KA9A 1Q95G 2DY9A 3MMAB 3PYFA 4YHHJ 3V81A 1QJHA 2EFPA 2FC8A 1M5OC 1EEOA 1R0BG 1GT8A 4KYRA 2GCAA 1Q8LA 4NMXA 2HNDA 4AYBD 4IUFA 2OHDA 3SSQA 2XG8A 1I6JA 1U1PA 1Q6TA 2HBZB 4IKAA 3DLGB 4CO0A 4ILMA 4C6AA 4FXWA 5HMYA 1I57A 2MBCA 1S6QA 1ZS6A 2AX0A 1SKUB 2OD6A 2MEWA 3IAM9 3NOCA 2BQRA 1MLAA 2AQ4A 5IC6B 2CPYA 3QFWA 3AWEA 3MOWA 2F4VJ 1TKZB 2I6MA 4UAGA 4XTTA 3OTBA 3D0GE 1YI2S 1IUJA 2E1CA 3BKFA 5DQIA 4H4MA 3EXCX 1U09A 3OD2A 2OIHA 1VQNS 2O66A 4CO1A 2RJZA 4URSA 4CT9A 4G1PA 4EBDA 2C7SA 2PMZD 3PRDA 4TU9A 1Y5NB 2ADBA 4LRCA 1UETA 1KONA 1JKHA 2KVIA 4NL5A 1U1NA 2LU1A 4OHWA 4NX9A 3OTEA 4R0SA 2MY8A 1NPRA 2JFHA 4I8NA 2BGEA 2DRDA 4FP9A 3M2VB 3KK1A 1H0HB 1RSCA 1RTIA 1WOPA 1KTVA 2DY1A 2IJFA 2ZBCA 3IC1A 5L8RC 4DCOB 3VAGA 1C84A 3QCCA 1KLMB 2ZM6F 2BYCA 2BRLA 2PEHA 2BJ8A 2VG6A 3EJMA 1FESA 3VR1A 1YZ7A 4DDFA 2KM8C 3I32A 2BANA 4ZJOA 1WHXA 4BUBA 3HD2A 4GRSA 3U1NA 2AT1B 3BF4A 3R2DJ 1YKWA 2PDAA 3IM8A 5BR8F 2W2MP 3OLRA 4CLTA 2BZ2A 3NS5A 3GJTB 2KH9A 2D1CA 2HGMA 2RMLA 4OI3A 3M4UA 2JEJA 2EEYA 2CZ9A 2P9CA 3C6UB 4KGXB 4QYRA 5DQGA 1SI9A 2KG1A 4J9RA 1F1BB 5CYMA 3M1VB 4OHHA 2L3MA 3D1QA 3UCGA 1UAWA 2W2QP 3AHPA 1S72S 3PIOQ 3MI7X 2I9SA 1PTYA 1L3VA 2XLJA 3KLHB 1VRQC 2VBXA 5A2QY 1Y10A 5L46A 5KT6A 3J80U 5FJ4A 1YJ7A 2F71A 2BKPA 2I6PA 2QDCA 1JLBA 3TVYA 3OL9A 1XK8A 4RKKA 3OW2R 2YWGA 3BS9A 5KT4A 2MQPA 2XBPA 5CYQA 4NCGA 3EGZA 3NL0A 2BUNA 1VBXA 4KPYA 4GE5A 4NXMJ 4TKTA 4CNYA 2B51A 4CO3A 3W7BA 1NPPA 3WX8A 2DHXA 4WFYA 4EMDA 4EBEA 3PVXA 1PTUA 3TUJC 4CM0A 3H2VE 3US5A 3LALA 3DOKA 2W4DA 3QT7A 4Y34A 2OPRA 2LXUA 2WOMA 5EUHA 3BM8A 3SSSA 3FMWA 1WEXA 4KKOA 2V8DA 5IV4A 4DHVA 2PFDA 5F8GA 1HNZF 1NDLA 3UR3C 1RA7A 4JP8A 3W5YA 4DBQA 4WTOB 1FE0A 1WG1A 2N3LA 3DLEA 3MECA 5KG6A 3P96A 5I3PA 1HHQA 1U1MA 3P6YC 1KFSA 1XN9A 2AZ1A 2DXFA 3QCMA 1Y00A 3OL8A 1B0VA 4ID5A 3NGDA 4OLOA 5GMDA 2CUYA 3V6JA 1PCAA 4NOHA 4UZCA 5C7PA 1GMWA 3A3PB 1WWHA 2KT3A 2KKHA 3C16A 3I56S 5ETOA 2D3OR 4R5PA 1GX5A 2HZCA 2H03A 2OPSA 1BZHA 2NSCA 2MXYA 2JJ4D 4YB5A 4DQIA 1JLFA 1RT2A 4OV1A 3R5CA 5EHPA 1RAEB 2NXUA 3I5AA 2ZOFA 2AWZA 2XZWA 4NYOA 3QO9B 5E3PA 1C0UB 4Y0FA 2QTWA 4QPTA 3G6ES 2RF2B 2B4PA 3UN2A 3AA8A 4J9QA 5DLFA 2ASDA 4F8RA 4N41A 2JEIA 3RAQA 5KFTA 4DXLA 1VQPS 2Z57B 1TL3B 3KKFA 4YP3A 4DL5A 1Q6PA 5DG9A 4JI4J 5GAEU 1IKWA 2VOPA 2XMWA 1RKJA 1DRZA 1N52B 3GJSB 2B4SA 3PEJA 2CNFA 3MMBA 4PUOB 1EQ0A 3M6UA 3HSJA 3UN5A 3H4BA 1S1TA 1QE1B 2OTJS 5K25A 4RNHA 2DO0A 3LK7A 2P5VA 1EZZB 2JHEA 4OX8A 5L39A 2DNOA 3QLHB 3TW0A 4ZLLA 1WF1A 4PG4A 3CCSS 3TAQA 5KOWA 1KOOA 1NPKA 2UUAF 4JYAJ 1Y5LB 1FJGF 3QCBA 4ZP7A 3D9BA 3RJMB 5J1PA 2W9BA 3CJKA 1RT3B 4OYWA 4CRJA 1I9TA 4YDDB 4J90A 1RT5A 3PW5A 5B0EA 3PACA 5J1NA 4P7VA 3M2VA 1NH7A 2HLUA 1UL3A 2MZQA 3FBEA 4P74A 1HYSB 4C12A 4LSNB 4TY8A 3J80Y 1Q78A 5A6PA 5BR8J 2KZZA 1PTTA 3KG1A 3KWMA 2AX1A 1PBAA 2CZVC 2R7QA 3PDNA 4R0TA 4JI3F 4ZVGA 3QCZA 4DCJB 2VFTA 3IBWA 1GXUA 3AD8C 2YPZA 2Z2YB 2RQKA 1RWPB 1CJVA 1G3OA 3DLJA 4LVOP 4JI2F 4B3OB 1BQNA 3O1LA 4X4VA 2WVFA 3DM2B 2C3YA 4DMZA 5D8HB 2NCKL 4MFBA 1IQZA 2EFVA 1TZ0A 3ZM5A 4CLKA 5I42A 3HSZA 3IM9A 1MMLA 2HFSA 2QBRA 3KXDA 7FD1A 3QGHA 1GG4A 2VC0A 3PJ9A 4X4QA 4HJQA 5HROB 2G1DA 1HWIA 1PYOB 3U1LA 1U47A 1Q82T 2I6IA 5D0HA 3W61A 1X9WA 4FZVA 2I5XA 3R1LA 5D0EA 4BLGA 2LQ5A 1QD1A 5KG7A 3LWLA 2VFUA 4B9MA 1S59A 3DC2A 4USWA 4A8YA 3BB5A 2W9CA 5KG2A 3Q24A 3BDPA 3V4IA 2HC1A 3RTVA 1XR5A 2CQHA 2XWXA 2UV8A 2UXCF 4DEZA 1VYAA 2ZE2B 4Q8FA 3EXYA 2FJDB 3QJJA 4LT6A 4X4TA 2PFFB 4LVNP 4QR0A 2ABYA 4F3OA 4ED5A 1X7VA 1YRXA 2FB0A 2PA5A 3P4UB 5DG7A 3NCRA 5AXNA 1TKXB 2DBBA 3AFGA 1T8EA 4I67A 1UJ5A 2A2CA 1SB6A 4O3NA 5HSPA 1F9FA 1JLQA 4TLRA 2Z2LA 1UW9A 3AOBA 3H5YA 2VQFF 1L3SA 1BGXT 2OH2A 2VDIA 3GZ7A 4F67A 3RB3A 5C24B 3Q8QB 3H2LA 1CS4A 1C4CA 1TMJA 2NTAA 2PQ5A 4LRFA 4CI0B 4ZLNA 3NBPA 1IKXA 4WFNQ 2ATLA 1R8CA 5B0AA 2WSFC 3PW4A 4QU6A 5L1LA 3DMJB 2M8DB 2OFGX 3B7OA 3A8JA 1Q5YA 4M1KA 3GMGA 3H2UB 2EK6A 3D67A 3POTA 2HWHA 4I0WA 3SDEB 4TQRA 3HP6A 1OSDA 2KO1A 4KIAA 3W5XA 3CF5Q 2XY7A 4C9DA 1SL0A 3ADAC 4I4BA 2CPIA 3AWGA 4DJBA 5CZXA 2AV5A 4NWFA 4M5JA 2XSJB 3TZZA 3M32A 2VB6A 5D4NA 4HV4A 3CCMS 4PRFA 3IWNC 2DIVA 5L1KA 2J9DE 4U7UK 3MM5B 3HI9A 4YB7A 4CTAA 5KFFA 1HHSA 2JLGA 3G8TA 1PO6A 2RRNA 2GGPB 2PMWA 2DEJA 3DLHA 2WBRA 3VZHA 3NAIA 4N77A 1X9MA 2KFZA 2CQCA 2POKA 1FEHA 2QLWA 2MPUA 4X62J 2X5OA 1SXLA 2YWHA 4M5MA 1AB8A 4NLYA 3CM3A 4G6VB 3AJ1A 4KQZA 4DL0C 2BKNA 1RCOB 3Q8VA 4YB6A 1TL7A 5I3QA 5B7WA 3JB9k 1JMTA 1EIYB 2DVIA 2V67A 3KDNA 2J0QD 1RWWB 4UUWA 3GIIA 4DV5J 3H2XA 3AB4B 2JOQA 3BR8A 5GMKa 3A5JA 3WZ0A 2QEXS 1QVGR 2QBSA 3FEYB 5HP1B 1HNXJ 3L7OA 1SUQB 2QMXA 4YOEA 2ZITA 1YWXA 2H02A 3K8WA 5KADA 3QMQA 3HSDA 1HA1A 1QUVA 2YNFB 4IFYA 3QGGA 3W9HA 1U8WA 2FD2A 3K5MA 5IQQA 1ECVA 3MEKA 2CM8A 4QDIA 1OMSA 2O3DA 1MN9A 2VEUA 1DY3A 4NPOA 3HKWA 4FNIA 2YQ1A 4GS0A 1FWPA 1YBAA 1HNWJ 1VRTA 4YY3J 1MNEA 2XULA 4DN9A 1N56A 1KQKA 4WFXA 3KHLA 4FPIA 1KEKA 3DLKA 3CB4A 4KV8A 1N88A 2LQ9A 2BQ3A 4C8YA 4LFBJ 3Q8SB 5BX1A 4P9SA 3OUYA 1Y11A 4LFAF 4G1QB 4B3RF 1TL1B 2AM2A 2KJVA 3GIJA 2WHOA 3UPFA 4Y2AA 2MZJA 4HLBA 2IAJA 4S0MA 3NNAA 3Q23A 3GB0A 3RW7A 2R8IA 3TI0A 4ECZA 3FSIA 4AXJA 1N36F 5LMUJ 4PCQA 2HLTA 2YKNA 3QRRA 1TKDA 2QSFA 1Y7PA 4Q45A 1BWVA 2MHNA 3DXSX 3PR5B 1NSKL 2GCFA 4DSKA 3EMTA 4DR4F 4DV4F 3GE9A 1VHIA 1FFGB 4ZPWR 2VEVA 3NRSA 1VRUA 3GFXA 3M8WA 5L1IA 2GW8A 3RYLA 4RWWA 3GG1A 4X64F 3AXMA 3DLBA 3CJ3A 5IM0B 4O3QA 2OPPB 1JF7A 3UWTA 5HBMA 3MEEB 3R5AA 5CCLA 2F3JA 4IH7A 3H98A 2IBKA 3LAKA 4ZOSA 1NZ8A 3ZZOA 8AT1B 4FF1A 3WBZA 2JNJA 3MTKA 4QZVB 4J9MA 5J2NA 5J2MA 1G1HA 2UAGA 3MCSA 1AROP 4DX7A 3E01B 3GTYX 2Q6CA 2VL1A 4EWTA 4WFBQ 3J81U 1XQIA 4NLVA 3J7ZT 1N4LA 1RTJB 4JV1A 1CQNA 2G2ZA 3LANA 3VGTA 2R7RA 4DV2F 1F5CA 2BJEA 2Z58B 3PIPQ 1CULA 1B0TA 2G0JA 3AA9A 5C25B 3P5TL 1C4AA 5G0RB 4I2PB 1X4HA 3SFUA 1RAGB 4OYIA 1L3KA 5K14A 4DZDA 1TVRB 2BRKA 5AXKA 3GQCA 3M30A 2VA3A 4K4SA 2FJNA 4OMFG 4JMKA 1R7IA 4PG5A 1FERA 4Z6BA 4KFBB 1N34F 2IDEA 2N7YA 3M9NB 2E44A 3VAKA 1H2VZ 2PIIA 2CVIA 2YH0A 1JIHA 4ZPBA 1MKPA 4JV5F 2EK1A 3R3TA 4WIIA 2W1BA 3QYYA 4ECQA 1LARA 4LBIA 2V2QA 2QMUB 4UW2A 1D9FA 3KTQA 2MJUA 4DQPA 1QDUB 4MTPA 4ZPTR 2I5JA 3EPGA 2M3DA 2MQ8A 5HN0A 4FYXB 3DU5A 4GO5X 4BC7A 3FQKA 1HR0J 4LF7J 5KFPA 1YN9A 1HWUA 3K7RA 1WORA 1FFWB 2GS8A 2BA9A 2BKOA 3NGTA 4P72A 2AU0A 1MU2A 4ES2A 2FLOA 4JMJA 2W7AA 1U8SA 2QJ3A 3LA0A 3J81j 1RU1A 4NASA 2QA4G 3ETOA 5HQMA 3CUNA 1S4FA 4WWSA 4DFJA 3HO1A 4XK8C 2ZNYA 2CM3A 1Y3JA 1Q1KA 2FLLA 2E9ZA 4P2FA 3QZ8A 2OFHX 1YGUA 4DN0A 2FTRA 4DV1F 2PEBA 3G82A 3FSYA 2IFXA 1S77D 4USUA 3C2PA 2DNKA 3ENQA 3LP0B 5IT0A 1FXRA 2FPHX 3K5OA 1IWGA 3EVOA 2ZD1A 3IS9A 3KLGA 2J7KA 3DRSB 2HY3A 4R0EA 2F6WA 3G4SS 2WW8A 5DZ6A 2B4UA 2B56A 2CKWA 2KU7A 2QLJB 4I68A 4O44A 1B64A 2PC6A 3HHKA 3MR7A 3QCEA 3I82A 4WIQA 2C2DA 4OZ3A 2BACA 2FDNA 2NT2A 3GR1A 4J9VA 4RUAA 4GKKF 3ZZYA 2KFNA 1TVRA 2J5AA 4EBCA 3EAXA 3BH6B 4JNBA 2R3VA 3H25A 3CMAS 3T5JA 1F2GA 1OHEA 2GJIA 4ATNA 1HNWF 3BO2A 3D3BJ 3PYDA 2AP6A 4RNFA 4LF8J 2XS7A 2DRAA 1GTEA 3SV3A 3NMAA 2ZHBA 4AQYJ 2V4QA 3KLFB 5B0BA 3N01A 1K44A 4X4PA 2XMMA 3PM9A 5ETPA 3E51A 3W66A 4DUYF 3LO3A 1N6QB 4WE1B 2WVBA 1NHVA 1KN6A 5MMZB 3Q8UA 1VQLS 3Q8PB 4X4RA 3IRXA 3CULA 2YWWA 4AXIA 1WSRA 2CQGA 4KY3A 1NWEA 2F00A 3IBFB 3MEEA 4MK9A 3ITHA 2C2EA 3AJDA 4YR0A 2M52A 1UPPA 3H8YA 5KFWA 2XCPA 4ECSA 1YJWS 4Q44A 1IVZA 3O5TB 2E5JA 3CGIA 1RU2A 3DOLB 2KHCA 3Q8YA 1H7XA 3WHIA 2G9OA 4PABA 4HI1A 4I2QA 1HBOB 2H4VA 3ENVA 4NLUA 2HVZA 3TEHB 4JUZA 2GQCA 1TUVA 4DR3J 2VU5A 3MEGA 3EE3A 4QIGA 4OX9F 1RGVA 3W64A 4DU7A 5IS2A 5LL6d 4JI6J 2ZOMA 1EKRA 1JLGA 2MZRA 3R97A 3EGNA 1P6TA 4W92B 2GO8A 2NPFA 3KUHA 3O2IA 2CNIA 2MLXA 4OFZA 3E2EA 2E29A 3RB0A 1YHQS 4W4MA 1KKHA 4FS2A 1VHFA 2J6SA 4DWIA 2HS3A 2F9DA 4O3SA 3MD1A 3OUYB 3GFHA 3LP2A 4KT0C 3KK2B 3A3NB 1FO1A 1YIJS 2KFYA 4JI3J 1RBOB 3MM6B 3PFOA 4BC9A 5E5NA 4CLZA 2GHPA 4OZNA 2IBOA 4DG1A 2NPIA 3IGNA 2L9WA 1UEUA 1RABB 2VG7B 3C19A 3R5DA 4K2XA 4OZ2A 4FYYB 3R8YA 2F65A 5IXUA 4N5SA 4LF8F 1WKLA 2GMHA 2YNIA 4J91A 4K5RA 4KO0A 3T1AA 1XNRF 1DQ9A 1J4XA 3OPKA 5A6WA 1SQFA 4MMOA 5G4DA 1R8AA 4C48A 1FRKA 4UT4A 1WC5A 3DNCA 1Q1MA 3D7SB 4U8VA 5GMEA 1FPRA 3D0IE 3R5GA 3DDKA 2HNQA 2E9RX 4OI1A 5KA4A 2W01A 4PKDB 4C8ZA 1RXOB 3M8PB 1XMQF 2ATCB 5KFQA 2F6ZA 4QF5A 2XGQA 4RL1A 2BVZA 1OPIA 3CD6S 2B6AA 4NLQA 2ILZA 2M0GB 4U95A 2DHGA 4GVBA 2UXCJ 1EP4A 1V3RA 1KDNA 2F9JA 2V9KA 3I31A 2HFVA 2GV1A 1PH0A 1S48A 2ZC3A 2V2ZA 1NB2A 1UZHA 4PG6A 2FZKB 3NEKA 1DZ5A 3CMES 1CEZA 3HHLA 4FF2A 4JI0J 3NWGA 1R43A 2H4YB 2MQOA 1FVSA 3OTOJ 5EGYA 1D9AA 3A13A 4FKYA 4HR2A 2CJ9A 1ZA2B 3I55S 2R8JA 2UUTA 1C88A 4WCEQ 1M5PC 3I6PA 3CMQA 7FDRA 4FYWB 3V0GA 3JQMA 1F5BA 2FGOA 3Q8RB 1YTYA 2UU9J 2E7WA 4ILRA 2DJWA 5J2PB 1JXVA 1W2IA 2XWYA 1KHWA 3TJAA 4B3TF 3UD3P 4CYUA 2HK2A 1URRA 2CQ0A 1SC4B 2GQQA 2EC2A 1GFWB 4DLEA 4DF8A 1T05A 2ROEA 4DR4J 2M7SA 2RS8A 1LW0B 4ICLB 3NBPB 1O8BA 1RT4B 2BE9B 2MHEA 3MM7B 4J9PA 1OHCA 3WC2A 4Q7AA 1FNXH 2GIFA 3E3XA 2QFIA 2IHR1 5D0GA 4NWBA 2OMOA 4JV0A 4J51A 1NCLA 2V50A 2HNPA 2M70A 1JJCB 2FVQA 1GTHA 2DNLA 2V5HG 2QSWA 1NMEB 1WTFA 4RW8A 2R2RA 2CQBA 1NAQA 1QAXA 4ECWA 1RT1A 4W98A 1GWZA 2B4OA 4GE6A 2A6OA 4A8WA 3VVTA 4NNDA 1NU4A 3X1LB 2ZBIA 2HVIA 2QV6A 3UDLA 1RADB 4IKCA 2HGNA 3K8VA 2ZUGA 3CDBA 3G82B 3UO0A 1SC6A 4F36A 3R5BA 4N7TA 5DQHA 3V4IB 5I3UA 3ZTQA 1U1KA 1C2PA 1RDRA 2DNNA 3BGLA 1OEUA 3M8QA 1NL9A 5ETVA 3BM7A 2KL8A 4ZHRA 1HNIB 2VF3A 1K8AT 1CJUB 1FQ1A 5LXRA 2MZ1A 2PI7A 4QR2A 2HNZB 1UZDA 2JSXA 4G1IA 4X65J 1GFYA 2A3KA 1X4CA 2GO9A 2C2ZB 4DV3J 1OSCA 1SH2A 4ZPVR 3UVJB 1S49A 2BJ7A 2CAJA 2J9DA 2RKIB 5IOLA 2HFOA 4XPEA 4OHYA 4NXMF 4XO0A 2H65B 4N76A 3DOMA 2H3EB 4M5DB 2Q43A 2ZJRQ 5JVHQ 4KHRA 1QAJA 5A0YA 2AF6A 2H4KA 2Z56B 2RHSB 2ZHOA 4P2XA 4X84A 2BW7A 2V2VA 3FUYA 3NWRA 1K73T 4DSLA 2R7UA 1YFOA 1HQ2A 2W4CA 2NSBA 2N82B 1NXIA 2QA2A 4TLQA 2RRAA 2ZM6J 4RW7B 3SFGA 2K2PA 1AZSA 1FKPB 1OQ6A 1OYEA 3TA2A 1LW2A 4LR7A 3BSAA 2JC0A 2OEKA 3CVKA 4LF6J 2V0NA 2Y0BB 2XMKA 2EVZA 3CDWA 2C2KB 1HBUA 4NYHA 2V8PA 4ZP9A 4PYHA 1KVIA 1S4EA 5K14B 3ENAA 5CYJA 1AYEA 2GAHC 4JI1F 2GJ2A 2PA8D 2J0SD 4QYZJ 3MPWA 1SQGA 3NGRA 4PYDA 4Y3CA 1QVFR 4Q0BA 3DYAB 4WP9A 2RQCA 5IC4B 2GIQA 3DGPB 1QAIA 3AXKA 1REVA 2F1FA 3FZBA 3PYGA 4P52A 4B9UA 1YVFA 4O4GA 5L1JA 4L3KA 4NYZA 5KT5A 4DV5F 3ZTPA 5A8KB 4YR2A 4UY8T 1FKOB 4K0KF 2F4VF 1R0CB 1IKYA 2BXJA 4O0NA 2FJXA 3H5SA 3G9CA 2XY6A 2RILA 1CC7A 3PO5A 1RLCL 2YNGB 3DI6A 2IYGA 4EO8A 4ZKAA 4CIOA 4MKVA 5LMNF 3OJSA 4IR1A 2GWOA 5CD4H 1MN7A 2BJ3A 4BJOA 1PJ7A 2H51B 2QL9B 3THTA 5KFSA 4X66F 3PO4A 2UXDJ 3PYZA 5F8HA 4GE2A 2R7TA 4MKAA 3NP5A 4OHDA 3I96A 3KG4A 2QL5B 3MGJA 1H2TZ 3FZ2A 1SJRA 2LEPA 1VC6A 1QXKA 2LDIA 2WONA 5K8NA 3ZL8A 3D3CJ 5BUGA 1Y3KA 4KE5A 3TEGA 5A8KA 4DL7A 2YKNB 3TX0A 1C86A 1U4BA 5HLFB 2HNZA 1X24A 4OHEA 5HO4A 1M1HA 1DTQA 3NCQA 4MAKA 4KAIA 2LECA 3I5CA 1ZH5A 1YGRA 1J6UA 3PX6A 2HBRB 2HK3A 3CC2S 2VC1A 3A8EA 4ID8A 5AJ3F 3EZ5A 5A5FA 3D54A 3DCAA 3HF5A 1VK3A 3CD7A 2OEMA 1EETB 2HQ3A 3ELHA 3OXLA 1GAOA 4LRAA 2V2KA 1GEHA 4G1QA 5HATA 1NSQA 3UE2A 2Q66A 4JYAF 4PR6A 3RRKA 2DGUA 4EFAC 1X9SA 4KHPJ 2BABA 2A18A 4MYTA 1CPZA 2XQCA 4DR1J 4ERCA 3MCMA 2WOMB 2VEXA 1LWEA 2ILYA 2M5YA 2C2OB 3DU6A 3FFIB 4DV0F 1PBUA 1RT1B 4DR2J 3F9BA 1TV6A 2X3GA 3MR5A 1ZZNA 5A2QU 3TNVA 2H54B 4WK3A 2B7CB 4M8LA 1V3SA 2LXFA 4NWGA 4DSFA 2MQLA 2F6YA 1BZCA 1OJ4A 2OZ5A 2O5DA 4A8SA 1OWXA 2LFVA 1C83A 2HURA 2F7VA 1LWXA 1YDLA 3I0SB 4OZ0A 2DR5A 2HRUA 5AXLA 2JLEA 2XSFA 1JLBB 1TUGB 1P1TA 4OIXA 4QWBA 2AIRB 2X1BA 1HQUA 2Y1RI 4C7QA 4ECYA 1UA1A 2MZTA 1ACMB 4WKRA 1R6YA 1UCNA 1VR6A 2IA0A 4ZVOB 1AW0A 5FDLB 4LF6F 2RNEA 2XPCA 2F4FA 3B54A 3QIPB 2HHUA 3QWPA 1HNIA 5EX3A 4DX8H 2CA9A 1P15A 2JFFA 1OYDA 2CDQA 3HFKA 1YX2A 2JEFA 3EDRB 3EMUA 3P3DA 4Q5VA 1T94A 4CT8A 2FLNA 2HHHJ 4GO7X 4OHXA 4LMZA 3MFHA 4KB7A 4EYIB 2GGPA 3M8QB 1JX4A 2E1RA 2QDPA 1NO8A 1ZM4A 4KSEB 4JI5J 4KTQA 3NMRA 3QGPA 4C3LA 1PA9A 1C0TB 1O6XA 3IAS9 5FLXY 1T03A 2JEGA 3NY0A 2DYAA 1S9FA 1OO0B 1FRIA 2UUOA 3M32B 4IOBA 4Q8EA 1OY6A 3IR5B 1EP4B 3FBCA 3I9V9 5L9NA 3JSBA 3BBBA 2HSEB 4W90B 3QIPA 4KFBA 5HL7Q 1U6FA 3T1HJ 2LKZA 4F4ZA 3MHYA 3RBEA 4C11B 2B9EA 2IC3B 3TAPA 1W7KA 4PVGA 2KZMA 5ITHA 4J37A 3S3KA 1HL6A 2H4GA 1FE4A 4FKXA 4C8LA 2R8KA 4DPYA 3GFZA 1X4EA 1CS4B 4J5OA 2HNYB 3I0SA 2DGOA 2R2UA 1T05B 3QCDA 4A48A 4BCAA 3UNGC 3BQ0A 2HZAA 3FC9A 1R31A 3DRRB 2AW0A 4C11A 4UZBA 1XMOF 4K4UA 2QDMA 2LLZA 3W2WA 2FJVA 1GQEA 1BLUA 1BHNA 2CJQA 2FJAB 2V4JA 3FFIA 3NGUA 1SQEA 1JWWA 1FRLA 4I7FB 2AEMA 2CVEA 4TYBA 1PJ5A 5FD1A 2GAGC 2HMIA 1VQ7S 4YN3B 3VVUA 3EDQB 5D4PA 1N5SA 3LP2B 1LWCB 1TP7A 4QWAA 4CO4A 3VAMA 3HULA 1OETA 3ISNC 1VMBA 5JMNA 1NKBA 2HW3A 2W9CB 3M8ZA 1XJWB 1MG7A 1ROFA 2JL9A 1Q5VA 1H73A 3BQ1A 1TR0A 5F8JA 4DV0J 4DX6A 5LT5A 3GIMA 4B9LA 1WCHA 2LCWA 1DTQB 4RPFA 1TL4A 5IT9U 4OI0A 2FHJA 2HVEA 3IFEA 4HVZA 1S9EB 2DGVA 3O3LA 2UXBF 4RBUA 1HW9A 2EFQA 2JFGA 4LFCF 2J7UA 2EBEA 3D66A 3FCVA 2UUCF 4M5LA 3FJ2A 4HHJA 5DETA 2UVWA 3JYTB 4CLFA 5I42B 4LF9J 1Q6JA 1KR4A 2NXNA 1YWFA 2RDIA 1PILA 2DNZA 3TQEA 3DM2A 1ZETA 1MWYA 1C1BB 1UEVA 3CEDA 1SCJB 3LAMA 5HI7A 2CJBA 2HRYA 3CWJA 3ZZRA 2VONA 3ITHB 3ULHA 2AEJA 2I1YA 1JNRB 3EWGA 2AJ0A 3X3UA 5B0FA 4QQBA 5E41A 2NUHA 2VG7A 3LWMA 1ZC0A 1QZ0A 4IYQA 2CPJA 3HHDA 3OSPA 3PX0A 3R7BB 4I7FA 1PTVA 1JBWA 2B9WA 4JI7F 3CC7S 3AH6A 3KK3A 3W2WB 1FKOA 4FBTA 2OUGA 3MM6A 4J7CA 4DOZA 1VC0A 1HPZB 1Y9OA 2W24A 4CLYA 3PR4A 3T1YF 4Z37A 3T5LA 2DR8A 2UVVA 4JI5F 2XLKA 1B99A 2V8HA 4ZVEA 1FPZA 1XRIA 3D5MA 8RUCA 2Q05A 2H5JB 3K57A 1U0HA 1C1BA 1YBTA 2HQGA 4F02A 4USHA 4XAKA 5KFCA 1EENA 3QLHA 5L38A 1RCXB 2YBVA 1URNA 1Q6MA 2IC3A 1KS2A 1E6YA 1RWVB 3LPEA 2B9YA 1A0OB 2PI5A 4ILLA 3QCKA 1RTDA 1HBOA 3QAUA 1S7HA 3KHRA 1HI1A 2HZVA 1JJHA 4NMLA 1VK8A 4RW7A 2DK2A 5D77A 5HVFA 4DR2F 1WC4A 1XIQA 2F8MA 2WSCC 3T3FA 3JTOA 1NK5A 4NLGA 2KN4A 2W4PA 2UUPA 2CNLB 2IJRA 3EZOA 4RW9B 3PCOB 4CTAB 4WF9Q 2D9PA 5KG1A 1GX6A 1K1SA 2A3JA 3CCWA 3GONA 1ZYQA 1HHTP 4OZ1A 5K9VA 4D3PA 2B7BB 4X66J 2UXDF 1S97A 1SL2A 4LBPA 3HK2A 3NGSA 3TA1A 3IRXB 1D09B 4LRDA 3BGOP 2VIHA 2VPWB 1K1QA 1N5YA 5KAKA 4C8MA 2IVFB 3TUPA 3C8YA 3AWFA 1YJUA 1IR2A 4IO1A 2M88A 1JLAB 4ID5B 5ETQA 3M9MB 2CM2A 1V6HA 4LSLA 3RG6A 4RUCA 5KA0A 1AFJA 2NS1B 4PZVA 3KLEA 2AZ3A 2W7PA 4JV5J 2WB4A 1KQGB 2DISA 3DRPB 4PXEA 4DFPA 3THVA 1LXJA 2O67A 4C97A 1NHUA 4ECRA 2E5HA 4LF5F 2DGQA 3J7YI 4K59A 3KLIB 1S0MA 2NXCA 5F41A 3KDOA 4USMA 2CMCA 4B08A 2KT2A 3VGVA 2HS0A 2MKIA 2XMJA 4NLDA 5LMNJ 4JV2A 4FYDA 1VI7A 1YBUA 3D68A 2WBMA 2FVRA 3JAMY 4KHPF 4O44B 1XEZA 1LWEB 2OLWA 3UAGA 1RP5A 3RRGA 3TQ1A 3PY8A 3PKMA 4GC7A 1WDDA 3LP0A 3C6TA 2LEAA 3ZTSA 3LTOA 2KRRA 4P10A 2CM7A 2R9LA 3KLGB 3N79A 1RK8A 1X5PA 3DRPA 3HD1A 4O23A 4RNOA 4J9NA 4RJVA 1U1OA 1U0SA 3O4TA 5BYQA 3LF0A 1RB0A 3T6BA 4YQWA 4OJ1A 1BXNA 4EO6A 3HFZB 4ECXA 1T7PA 5H1SV 4GVLA 1M5VC 3D6MB 2D41A 4U6PA 1YJVA 4ZLPA 3QCFA 3M8RA 2MJNA 3D6FB 5ETRA 5J1EB 1RAFB 2CRLA 4P7TA 3RU0A 3UQSA 3K0JA 1APSA 2CMAA 3Q2TC 2BEFA 3U7JA 3BSCA 3TUZC 4A8KA 3NNHA 3TRGA 2I4EA 4I6YA 2HQDA 3IR6B 2FJWA 1TQLA 2RH3A 2ZH1A 2L48A 3OFHA 4LIRA 2FHOB 2FIUA 1HQUB 2MKYA 4YUDA 2B9XA 3OSNA 2C22A 4PXCA 4B04A 1SH0A 2CJXB 2HCMA 2YX1A 2OP5A 3PJXA 3OTDA 2K1RA 4Z2XA 5LJ3Y 3NNCA 1MROA 3KHHA 1Q8IA 3JSRA 3RUBL 2J16B 4KBIA 2CNEA 4KI9A 3AB2B 1NDPA 2OD4A 2IM0A 2IPOB 2AHSA 2N4CA 3OJUA 4QIVA 5K23A 2VBYA 3TARA 1UEKA 1ZM3A 3EGVA 2Y2FA 1ONZA 5K9WA 1BE4A 4M5IA 5GAGU 2LEBA 3N6NA 2XMAA 3M8PA 4LRBA 1RYRA 2J0WA 2FVCA 4K7QA 1JKHB 2BJ9A 2XZDB 3DHWC 4E2FB 1ITPA 3GIKA 1FTCA 2KJWA 2X1GA 4Q2MA 2VDHA 3ZZPA 3EU0A 4Y2EA 3QT5A 2DR6A 4KGKA 4X4UA 2Y8YA 2MLZA 1RT3A 3V2UC 3EZUA 3KLEB 1NJIT 1RWKB 5KFNA 4BDPA 2Y9HA 2HWTA 5IT9Y 1RHQB 1T9XA 3E01A 2I42A 1L3TA 2APOA 3GU0A 5B0CA 3CCES 3CD0A 3NS6A 4XDCA 4KGVB 3AOCA 2CWXA 3HCXA 4Y65A 5J2MB 3CCZA 1FJGJ 2V34A 1SJ3P 4L75A 4RHGA 5DG8A 4NLXA 3IGVA 2MDAA 3IO1A 1CBKA 3BO3A 4IOAQ 1VRTB 1T3NA 5KFYA 1CLFA 2ALZA 3CCJS 3RZAA 1F2HA 1ZTWA 1B3TA 4DL6A 2EPIA 3ISND 3OMHA 1HKAA 5D78A 2ZJPQ 4IRDA 1MWQA 2DNMA 3N0VA 3TZWA 1WOSA 3CD5A 3QPIA 4IFYB 5CD4A 2NQPA 1HIYA 1X5OA 3DOMB 2A0FB 2R8HA 1VQ9S 3ZMQA 2ZH2A 4PPDA 2DITA 4M63A 4GVBB 5GAGI 1FGSA 3LJ8A 4V19X 1UWBB 3NKYA 4P6QA 3HZEA 3J81Y 9RUBA 2HHWA 4E8UA 1HR0F 4CVLA 3MDFA 1E6YB 3CO9A 1F0XA 4ZIVA 2OELA 4P2MA 1SPBP 2OGUA 1K9MT 2C3UA 4F25A 5KA2A 1D3WA 1UJ4A 1N48A 3CJ2A 3W63A 2W7OA 1QSLA 1LV5A 3GV7B 2WGPA 5LXYA 1H74A 2YKOA 1Z1ZA 3OBIA 4LF1A 5RUBA 1RAJA 3DLKB 4KV8B 4NLTA 2WVDA 1HARA 4KKOB 4X4NA 2CJZA 3M7VA 1XR6A 4MIBA 2QT7A 1SJ1A 3ZFVA 4GKJF 2JFKA 2MMYA 2RDDA 4NZ0A 3V4MA 1PAUB 1KD1T 2GVDA 4FPRA 1OIAA 3QFHA 4HTIA 2HWIA 2YX7A 1S7IA 1YTSA 4ZRTA 1EARA 2GIRA 4A8FA 4Y00A 3O4SA 2V4JB 4RBVA 5AWXA 4MH8A 4ER8A 4R0JA 3IN5A 1PGZA 4X65F 2AGQA 2Y8WA 1T49A 4OJGA 2QZ8A 3DRRA 4OLPA 1TU0B 2YQ0A 1DARA 5A0YB 2BJ1A 2YNFA 1SH3A 3SBMA 2R2SA 4LF4F 2I4HA 3S3EA 2HPUA 2HHQA 3T5KA 5IBMA 2HHXA 3SQGB 2HBYB 2W8LA 3S6EA 1BUXA 1EB0A 3VAFA 5KFVA 2RB7A 4ZMMA 4K4TA 2AGPA 3G8QA 3CT9A 3EGWB 2HHHF 3RGOA 3MCOA 3M1VA 5KT2A 2Z8QA 4CP5A 3HHLC 4PWUA 1JLQB 3UDCA 3ZZ0A 1HMVB 2KI2A 3C6UA 4OZ5A 3WIVA 5B08A 3J7YU 1S9GA 2B43A 2MKHA 2D7SA 4MJKA 2ZMMA 1TK5A 1BY9A 1R6VA 3NS7B 3VALA 1NLKL 4O3OA 1WUUA 4CLUA 1MROB 3ZM6A 2WRMA 1LWCA 3UDVA 4ED3A 4K2JA 3D2WA 1T03B 1NKCA 4UUXA 1RE1B 1ZCKA 5GAEI 2J9CA 1YG0A 3KJQB 3L09A 4C3KA 5A8WA 3DDIA 1AFIA 4GRZA 4DI6A 5A76A 3QCLA 3IBCB 1U7LA 1IBLF 2EI5A 2ZBQA 2HEKA 5K5MA 3G2XA 4AT1B 4DR6J 2G1HA 3VAJA 5ETNA 3V5RA 3SMZA 1IJFB 2ZH5A 4ED7A 4B3RJ 4I6WA 3ILOA 1WC6A 4J9OA 4QYZK 2IVYA 1MSWD 5LM7E 3ILJA 3SDEA 4DQQA 2WAQD 2L9NA 5FDLA 5E33A 3TAMA 1WAXA 2NV5A 5BZXA 4FDFA 4AUKA 5KFUA 3LGHA 1S79A 4F4WA 4F26A 3K5LA 3VZIA 2VQEJ 4JI6F 4PQUB 2KVQE 1N5TA 2YNIB 4ZVUB 5F3ZA 4MK8A 3C6TB 4DPXA 2AMCB 5CABA 4QW9A 3MWBA 2I0XA 3L95X 1VBYA 5EN1A 2IYIA 3P8BB 4O0IA 6FD1A 2BM0A 2DB1A 3TANA 2Q1LA 2RS2A 2BV5A 4M5NA 2FJMA 4DGXA 1EEHA 4QBEA 3DLGA 2CG4A 2QO3A 4K4XA 4DU8A 1T11A 4RU2A 4LF7F 1C0TA 2RF6A 3EICA 4AQYF 3K59A 1JXLA 5B0DA 3QZ7A 2YH1A 3N6MA 2NLWA 4EK2A 5G0RA 1UVMA 4RO0A 3QT8A 4WXOA 1VJQA 2VEWA 4USTA 4OQJA 1X4FA 3MMAA 1YSJA 1RYSA 1VBKA 2Y1OA 3EZZA 5C42B 1RI7A 2M2BA 4IO9Q 4M5KA 2I2YA 5EWGA 3D4JA 2VQFJ 2MGZB 4DV1J 5HROA 3KG0A 4QAHA 3JQJA 1G2EA 3C66A 1DJ0A 2AYGA 2ZFHA 1AXQA 3EX7B 4RH5A 3UN3A 2VOSA 5K8OA 4OZJA 1Q7YT 2Z2MA 1C1CA 1ZPVA 4I64A 4QOTA 3RAXA 1B7YB 4QAPA 2ZUAA 4CZCA 2FZCB 3MFIA 1ZAWA 4FXVA 5K8MA 2SHPA 4DV3F 1M5HA 1ZAVA 3MR3A 2OPPA 2XI2A 1NJXA 3MM9B 1RXDA 2Y96A 4OX7A 9ATCB 4KO0B 1X0FA 1OEVA 3F9AA 3I36A 2KDOA 2DH9A 2C3MA 1CG2A 2ZHAA 2QA4S 2LDYA 1LXNA 4OHIA 4D3GA 4DCPB 3W3SA 1ZZWA 3C3LA 4UTGA 2PMHA 2MKCA 5AE3A 2LYVA 3F41A 1VCTA 4USKA 1NBEB 4TY8B 5KFHA 2DR9A 4NCAA 4FXDA 1TAUA 3HSGA 3GXGA 1EQMA 3BPDA 2NZCA 4ZCLA 4K50A 4FN5A 3R7SB 1E0DA 2YX4A 5SZTA 2W9BB 1EETA 3DGVA 2EKYA 1SJFA 2NZ4A 3ILLA 1NZ7A 2IM1A 4ES1A 1RT5B 4NA2A 3TJ9A 5F8IA 5KFBA 2VOOA 4YFUA 3Q22A 2CJKA 3VTIA 4C2MA 2XYPB 3TJ8A 1R8HA 2JDJA 3IWXA 1XNQJ 2XHWA 4AL6A 1G6BA 2C46A 2MY7A 5EWEA 4BWJA 4WU2A 5SUHA 2BW2A 3AD7C 3DOKB 4PUOA 3R9LA 3BKUA 2VORA 2RAQA 1NDKA 3QNWB 1D8YA 2OOQA 1S1TB 1NH8A 1MWZA 2HFZA 2XMUA 3DRSA 2FUG9 1TFYA 2FY8A 1RA6A 3CO0P 2V9WA 2AM1A 1KAKA 4ZN5A 4NLWA 2DNGA 2ZH7A 4U7CA 2MKKA 1ULRA 2BJDA 2C2MB 2QG9B 2Z4PA 3SMEA 2GQ2A 2YNGA 3DI6B 3UVJA 3CW2C 3ILIA 3TP2A 1F3FA 3Q86A 1FD2A 1HW8A 3A8IA 4R5PB 3PW0A 1S12A 1WHYA 2RKIA 5CXTA 5F0UA 5BZZA 1N6QA 3S3HA 3CIZA 3EVMA 2Y68A 2XC9A 1C85A 2OPSB 3HKZD 2X1AA 3M6XA 4ANCA 3AQPA 3ICLA 3DGPA 2XCAA 5J1EA 1TK0A 1FXDA 4N8NA 1VQMS 1RT6B 1NK0A 1D9DA 5C42A 3DYAA 4V19J 3B8HA 4ZHRB 2A10A 2FHMA 4ZPAA 1M90T 2ASJA 3QSYB 1GMVA 2YWKA 3SCIE 3PW7A 4H34A 2H48B 2ZDOA 2F6TA 1YLXA 3U96A 3FEXB 4ERDA 1FRXA 1UP1A 2HHPA 2KRBA 2RVJA 3BBFA 4ZJLA 3F0NA 1HWJA 4PYAA 3A12A 3U27A 2HKEA 1G1XA 3DXBA 4OYXA 4TNOA 4H1OA 5KA8A 4IFVB 4LREA 2PO4A 3DRYA 2IRUA 3UCUP 2GA7A 1AZSB 1FKPA 1VC5A 1J5EJ 1JJ2R 4C4WA 2NLKA 2DCLA 3UNYA 1NRKA 4Z7YA 3V6HA 5GAHU 2KXFA 3G6YA 4TU7A 4MYUA 1NM2A 1SKSA 3M30B 1HFEL 2HVDA 5E3CA 4PQUA 1VGYA 3FVYA 3MM7A 1N36J 1U26A 1NNDA 3O44A 4M5DA 2EFOA 2HNYA 1Q7LB 4WXWA 2F8HA 1FT8A 4C3MA 3SI8A 2YNHB 4XPCA 2QMWA 2DXDA 1JNZB 2E5GA 4R25A 2KXNB 1U45A 3S8SA 1Q6NA 3AQOA 1ELOA 2EG1A 4AZ1A 2CQ1A 5B09A 4ZLJA 4LSLB 2Z0GA 2AKWB 2VASA 1JLAA 4S0GA 2NYHA 4DPUA 1HNXF 1FF2A 2J6TA 1G7CB 2JX2A 2YKAA 1NZAA 5J2PA 1J2VA 1TKXA 4CH0S 3HVWA 4AFFA 4AL5A 1XXVA 2VPXB 1RQ0A 3CJ8A 4B17A 2HHTA 1MU2B 2CDRB 4F3MA 3OQ2A 2E5LJ 4UOHA 3MXHP 1P1LA 2HB1A 5T41A 1UPMB 1RZMA 4C98A 3G6XA 4DUYJ 1W7WA 2AJ1A 2IRYA 5B0GA 4DR5F 3ZTOA 4DUZF 1XC9A 4HHUA 4HT5A 4WP8A 1SKRA 2DGTA 3I7ZA 2HFNA 3HHLB 3IP0A 2XZTB 1DBDA 3BYPA 1S9GB 1TTHB 2D3ZA 1HNVA 5D4LA 5T7LB 4F7VA 5F8LA 2ZOGA 5FLXU 1OY9A 1SV5A 2IJNA 1M5KC 3SSRA 4DSEA 3RGIA 5IWAF 2AHOB 1RTDB 2GVZA 4NI2B 3POTB 2DD8S 2GNKA 3J7Z5 2IVMA 4WKYA 2IMOA 2LXIA 3KHGA 2AYBA 1GH8A 1UW4A 2GHWA 4D3QA 2IAJB 4NX8A 4ICLA 1LW0A 1S5ZA 2D9OA 3VCDA 4ANEA 1FRHA 3GIRA 2HQFA 4YHHF 4LSZB 3VHQA 2ASLA 2R42A 5DRKA 1CJVB 2K8GA 3BDEA 4CYUB 3PRBA 3OFFA 2MTLA 3FCWA 1RTJA 2C3OA 3RBDA 3RB4A 4MKBA 5IT4A 3K89A 1HPZA 3NRBA 3QT6A 1TKZA 4WFAQ 1U48A 2CNHA 4DG1B 3L7UA 3ZM3A 1QTNB 4A8MP 1RAAB 3KK3B 3DN9A 1FD8A 2XGPA 2GVDB 4BS2A 4U9RA 1TAQA 2ERRA 4F04B 2QCTA 2CXEA 1S6QB 4LF2A 4OYOA 4Z7CA 5JJBA 2MKJA 2HNDB 3NLCA 1G4US 5A8RB 2LQ8A 4LF5J 1W25A 4DR6F 1KSPA 3CNQP 3MVNA 1FEEA 5IM0A 1JBVA 4JI7J 5D0RA 1EKSA 2MSTA 2GP0A 2OKQA 3CDEA 2PSZA 2ZKTA 4KJIA 3CDUA 3GYNA 1YTNA 1JLGB 1WDTA 1VRUB 3P45B 3FRZA 3PV8A 2Q79A 1U49A 5J2QA 1SL1A 2E1MC 2ZEJA 1V5IB 3SCJE 2GCBA 4FYVB 5U47A 3RAMA 2CQIA 3JYTA 4U96A 2OTLS 1PXHA 3LH2S 4NLRA 3CJ5A 4LFAJ 4I69A 1D8ZA 5THWA 2AYMA 3M8SA 4X62F 2ZH8A 3HFVA 1UWBA 3CCVS 2QN6B 1S9EA 1S57A 1Z4UA 2E0TA 2MLYA 3BZQA 1XERA 4YB1P 1VLOA 1WD6A 2WONB 2IY5B 2XY5A 2IA6A 5CQGA 3D1HA 3MEDB 5ETKA 2B4VA 1PC5A 2CPDA 2C3PA 2K7JA 4I2QB 4KGMA 1B0PA 2RT3A 3DOLA 3GCXP 2OPQB 5EHHA 1ZM2A 4L6V3 4ECUA 1VQKS 1GXLA 1A6LA 2ZZNA 5E2QA 2M3VA 4DR7J 3KJVA 3I80A 4ICZA 3T1YJ 3OL6A 4CDIA 1YJTA 4OI2A 2HMIB 1S0VA 5KA7A 3JS9A 1N32F 5MLCV 1VOMA 4PEOA 4CM2A 2E1PA 3OL7A 1SJ4P 1WSVA 3HVAA 3LP1B 3N28A 3R6LB 2A1BA 3M6VA 1S0OA 2R8GA 4JI4F 1FDBA 1NNYA 1AAXA 2OSRA 1NO6A 2R0BA 1YK9A 3V0JA 3M2UA 1VJWA 5HK4A 4O4GB 1FNOA 3V6DA 1HLWA 3K5PA 4RUHA 2K3IA 5IBSA 3S3FA 3ZXWA 2P9GA 1RISA 1LQFA 1GMWD 4FVCA 4O4RA 4RW6A 4BBYA 4Q0BB 4AL7A 5AE2A 2UXBJ 5E7OB 1QSYA 1WF2A 3BLUA 3CCQS 5M2PA 2PE8A 5DJBA 2G6ZA 1BWEA 1RTZA 4ZVPB 4B3SJ 2CNNB 2G2YA 2VTDA 4I6AA 2Q3PA 2W8KA 2CADA 2YTCA 4JI2J 3HJVA 1KTQA 4OHVA 1E6VB 3OVSA 4D3RA 1QE1A 2V8VA 3G96A 1OEMX 1JK9B 3DFEA 3CXCR 2CJAA 3ISZA 2ZD1B 3CJTA 3IS9B 1F3VA 4B3MF 4M5HA 4HACB 4DL2A 1A7GE 2VBWA 1CVJA 3TO8A 1IM6A 2ZE2A 3S4OA 2HAFA 2SXLA 3MURP 3KOAA 1K0VA 1RKIA 1AA1B 1PJ6A 3S4EA 3TA0A 1YQHA 3VQTA 4X4SA 2EXUA 4H54A 1P27B 1T9TA 2DKOB 3IWLA 2PI4A 5CAAA 1WF0A 1JLNA 4N56A 3MCNA 4F4YA 3UD4P 3L3CA 1W2BR 4L74A 1JLFB 1RT2B 4H4KC 2GJFA 1R89A 3ZNUA 4OYMA 4URGA 1S0NA 4K4ZA 4FF4A 3R27A 2IMGA 2K7KA 1S1XB 3C16B 4DZ6A 5LJ5Y 5KFRA 2K3KA 1S6UA 1BD6A 3LQVA 2B5JB 4G65A 4YMEA 1PYTA 4F3QA 4HYKA 3JTPA 5C5JA 2ZZMA 4HRFA 3W60A 1RAIB 2LP4A 2R7XA 3KJFB 3WC0A 4MFBB 3KMSA 2CG8A 3TVZA 4TN2A 4DS4A 4Q43A 1PAEX 2DNRA 5M43A 4B3SF 2ZVSA 4L76A 2QRRA 4ZCIA 1FTRA 3BV8A 3HHEA 3QRQA 4DF4A 1JLEB 5ETLA 2DR7A 1Q8KA 2OSQA 4ZK7M 1R0AA 2MB0B 1S76D 2HHSA 3D42A 2L9DA 1O0PA 3D9CA 2I5JB 3QGIA 1RTIB 5BJRA 1Y0HA 3W62A 4DL4A 2QYCA 4Q2LA 1D5RA 2NXJA 3GPAA 5E3QA 3ZM0A 1TV6B 4B3MJ 4USVA 5HVGA 1N33F 5DZ7A 1WC1A 4DGPA 2YWEA 4UQGA 2BDPA 3DLLQ 3KLIA 1XMOJ 5LSLA 1WOOA 2JWNA 4I2PA 3CPWR 3QCGA 4PAAA 3VGUA 4QCLA 1O5ZA 3B4DA 4C0HA 2B49A 3VGSA 3FGVA 2CPHA 1WELA 1RHRB 3GP9A 1RT4A 1RBLA 2H9ZA 5KT3A 5GAHI 4P73A 5DLGA 4WJBA 2DNPA 4A4JA 3M6WA 4OX6A 2N4DA 4G3IA 3HXMA 2UU9F 3CC4S 4L3NA 2M9KA 1H2UX 2YXLA 1IBCB 3K17A 4ECVA 1F9HA 2QE5A 3TX8A 1N5YB 1HNZJ 5CYMB 3C14B 2WW4A 4F50A 2OI2A 4N47A 3F44A 4TXSA 3M2RA 2EC0A 2FZGB 2CQDA 2OEJA 1RPMA 1T3OA 1UFKA 1U2RA 2G13A 4LJMA 4CQ1A 4EEYA 1N32J 5H9FK 2ROGA 1IWAA 1RWMB 1T9WA 5CA5A 1VQ4S 4RW9A 1FDDA 2COLA 2M8HA 2CFXA 4MK7A 3GV8B 2V68A 3SQOP 4K4WA 1LFWA 1Y4ZB 2DGSA 2OAUA 1C0UA 2HQCA 4QIFA 4E0DA 1I94J 1TELA 3WIUA 1KQFB 2FVSA 1ZM9A 5KTQA 3R2CJ 4FBUA 4A47A 1L3UA 4CCHA 4ELTA 1UAGA 1REGX 3OXGA 1DQAA 1S1VB 4F0HA 5KFIA 4USJC 1QAYA 3GV5B 2W2OP 1HYSA 1WC3A 2F40A 4TU8A 3PW2A 4IH6A 3DHXA 4QJVA 3IR7B 1RAHB 1HBNA 5KFEA 4XIUA 4QUMA 1T9YA 2AJ2A 2YQ3A 5C25A 1H72C 2LQJA 1Y5IB 2P6TA 3I87A 2E1AA 3DLEB 4PQAA 5HQLA 4B9NA 2G4BA 5DDOC 2HRTA 2VODA 1I1GA 1KRPA 1FWLA 1NSPA 3BEGB 8ATCB 1HBUB 4HKQA 2QEPA 1YRUA 3QKPA 2I6OA 3FBFA 2O01C 2PT0A 2FGCA 4MT1A 4ED6A 4DR7F 2F63A 2DNHA 4EZ9A 3MPUB 4KH0B 4QBUA 1IKVA 2QL7B 4DR1F 5HBMB 2LQBA 1R3NA 3H20A 3OFEA 2I6WA 2FHJD 2KYZA 3ENWA 5CYQB 1T9UA 2RDJA 5K22A 2DCUB 3BSNA 4WU3A 5HP1A 1WEYA 2ZBRA 4WOHA 3W8GA 2CWKA 4O3PA 1RAOA 4BUCA 3HHNB 2W2PP 1Q0NA 3MD3A 1HBMB 2DT9A 1MMDA 1LK7A 3HVRA 4NCBA 3A4TA 1G1GA 1JLCB 4WP3A 4ANDA 3QWUA 1DTTB 1UMJA 3GYGA 3TOQA 2MZSA 4CNZA 2PD1A 5IFMA 1I5OB 2Q47A 1QY7A 1UKUA 4JI1J 2XS2A 4KH1B 2KHDA 4ZPDA 1E6VA 1BQMA 3AT1B 4UOFA 2CIMA 1RT7B 4ZVRB 4BWMA 4J9KA 3H5UA 4P75A 1H38A 4C8KA 1R6HA 2B3OA 4DSIA 4DLGA 3Q83A 5K24A 5KA1A 2QLFB 3BN4A 2X7IA 4K8RA 1RHKB 2PGCA 2C42A 3NOGA 2ZJQQ 2VG6B 2FJEB 3ZZZA 2XYGB 3R1HA 2NXEA 1L5UA 3KNAA 2M4MA 1AT1B 2BOPA 1IN0A 4ELVA 1RTHB 4CLPA 3I4HX 4DR5J 1KBRA 1ZA1B 3CE8A 3AD9C 2QYGA 1U1RA 4WE1A 4RW8B 1F5AA 2QLBB 2DHHA 1NSAA 3MMCA 2G0IA 4A8QA 3KLFA 3J7AN 2WVCA 1BZJA 3R7NB 1R8BA 2J7WA 4K0KJ 1UVJA 1Q79A 4OJHA 5IZHA 2V94A 1X4AA 4UOCA 4WTYA 1FVQA 3FSXA 5CCMA 1VQOS 3UD5A 2MSSA 5AXMA 3DMJA 3HM9A 4M94A 4CLSA 2BMBA 4QWCA 2WJPA 3SXLA 2I75A 3RR7A 4H4KA 1YZ4A 2E66A 1KC8T 2VD3A 3D6HB 1CQMA 2ALYB 2E7VA 3MM8B 3L9ZA 2LA6A 3CJ4A 2YWFA 3FK4A 1U25A 4TYAA 4CO5A 3O6QA 1S6PB 3HHLD 3MEDA 5EDWA 2XYHB 1S1UA 1IXKA 4F2SA 4NRUA 4H4OB 2W25A 1EJ7L 1VDHA 3SIPB 3FNNA 3GILA 2HVHA 2ACYA 1U24A 1WRMA 1H7WA 2V4RA 1D0EA 1DTTA 1CJKB 2MQQA 1FJ7A 4QW8A 1VQYA 2Z30B 1FDAA 4M95A 2ZH9A 2CNGA 1W78A 1T9VA 2RRBA 4QWDA 4F4XA 1UVIA 3BRHA 1WG4A 4MBBA 2ZKUA 2IRXA 4RWXA 3HJFA 1V3AA 2MYFA 3JSMA 1SKWA 1I9SA 4CH1A 2O1PA 2HQIA 4A8XA 1EX8A 3MPYA 3V0FA 2Y0SD 1N5QA 4L73A 4WBFA 4B9VA 2HG4A 2I38A 3V0DA 3MTJA 2VKRA 5HDEA 4PG7A 2L08A 1FFSB 1KLMA 1ZBTA 2D69A 4RBTA 4YDXA 4HDHA 5DDPC 5AJ3J 1IKVB 1RHMB 2LVWA 2ZC4A 3NAHA 1N0VC 1O5JA 4ZVFA 5A8RA 3T9ZA 4ES3A 3RRHA 2B6AB 3PS5A 2QGFB 2VFVA 2X51A 3NG8A 4F2RA 4YR3A 1IQTA 2AJQA 3PRVA 1CJTB 4V1Ak 5I6VA 2I8EA 2U2FA 1IKXB 1K47A 4DFKA 3W5ZA 5IWAJ 2CMBA 3RR8A 4X2BA 1M3GA 3P5BP 2V8GA 4ALZA 1XMBA 3AJ2A 2P4DA 4DPTA 2F46A 1DQ8A 1ZAXA 4EYHB 4RI4A 2NREA 2EKNA 3ONQA 1TL5A 5M2RA 3TZYA 4LF9F 1BQNB 5E3AA 1I3OB 1RBAA 2DHAA 3PFEA 3OLBA 6FDRA 3D1OA 5KOXA 2VJUA 2XJAA 4DQRA 4C13A 3D6TB 7AT1B 1RUSA 3MUVP 5LSRA 3MZIA 4ZVSB 5LOQA 1OQ3A 1WI6A 2MQMA 1HQEA 1J27A 4K5SA 2ZH4A 5EX0A 2DO4A 1QSSA 2JLFA 2AZRA 2WTZA 1QM9A 1S1VA 5C2GA 3QCJA 2DIUA 3CIMA 4MIAA 2DH7A 3G6VA 2E9TA 4RH9A 3A8KA 3EYZA 3HVTA 3N2AA 2ZH3A 1T4JA 4J9UE 1LKZA 1WC0A 2R7OA 2WZ1A 4TQSA 3OTOF 4B02A 2KM8B 1KNZA 3R5JB 1KVJA 1BQXA 1S99A 4UOGA 1CULB 3V81B 3GSDA 2P9EA 2ZDPA 2RQ4A 3CJKB 2XS5A 3O4UA 1A9NB 1DFDA 1PSDA 4KRWA 5KFOA 1Q16B 2UUCJ 1UVLA 1R8PA 1X4GA 5HLFA 1XM2A 2FVPA 4QPXA 2UVUA 3OHBA 2V69A 1CJKA 3IG1B 3MEGB 3QATA 1RWUA 1VISA 1IBKF 3KLVA 3PTWA 5KG0A 1VQ8S 5KAAA 3FMBA 2QCJA 1S6PA 5LSOA 2H5EA 3MPDA 2BBEA
chains in the Genus database with same CATH topology
5HMZA 1YJNS 3B78A 3F56A 1TL3A 3MM8A 4DS5A 2R7SA 1J5EF 2OMLA 1IKWB 4QU7A 2KTQA 5HMXA 4B3OA 3ZV2A 2RF2A 2VEYA 3MOJB 4NZ7A 1J5OA 1L8GA 1Q86T 2GX8A 2JJDA 2QA1A 4R8UB 5KFMA 3EPIA 2EW9A 2HGLA 1LOUA 4IQMA 4L72B 2C2RA 4KYQA 1DURA 1S10A 4WZMA 1G1FA 4C8OA 3SV4A 1IKYB 3FRYA 2BE2B 2IM3A 3CWEA 4HEA9 3THPA 3UW1A 2CZ4A 4KHMA 1YGYA 2ASYA 3HDSA 4JOUA 4ZA1A 3ZM3A 2BR0A 4ZI4A 1REVB 4FVMA 1IBMF 3OR2B 1PA1A 2U1AA 3J7A1 1X8DA 2ZN7A 1LWFA 1VLYA 4NYPA 4C0OC 2XB2D 1KHVA 2GHVC 4IH5A 3QCHA 2ZH6A 4NA1A 4P2SA 4GC6A 1TL1A 1VFJA 5F0WA 4IDKB 4EGLA 3T1HF 4YR8B 2BV3A 1NJZA 1XBOA 1BQMB 2DXPA 1LW2B 3OR2A 3SCKE 4WYWA 1O51A 3WX4A 1ZTTA 2VA2A 4IRKA 4JI0F 1Z2LA 3M4XA 1VHRA 2AJFE 3HMJG 3BN7A 5GADU 3MUMP 2X1FA 1NWLA 4RDDA 2BE2A 3SZ2A 3S01A 3PEHA 2JRSA 2UVRA 1SJQA 2W9AA 2DGXA 5AE1A 1SUQA 4F4KA 3CTRA 1LQ9A 3GXHA 3VAIA 5EHRA 2VUGA 2CQ2A 4QIWD 2GMJA 2NR0A 3PKYA 2ZNZA 4CO2A 3GG0A 1VQSA 5GTJA 1UVNA 2KXHA 5ADZA 3TR5A 3OV7A 3OFGA 4GRYA 3ZM1A 2CPZA 4I56A 5BYRA 5I3UB 1YJ9S 2BANB 1NK4A 1NK8A 3MM5A 3F99A 4RW6B 1Q53A 5JXSA 2XNQA 4LQ9A 2AGOA 2OPRB 4NLPA 1AUDA 3ZM2A 2GMLA 2VZ9A 5F8MA 4YEAA 2NYIA 1HBNB 3M2UB 4HT7A 3V6DB 5KT7A 5GADI 1S6OA 2RD5C 1C87A 5KFGA 3F73A 4K4YA 2HC2A 3UCZP 4PXBA 4Y2IA 3OLAA 2HHVA 4NCGB 4DQSA 3OR1B 2LU2A 4DL3A 2I4GA 4DSJA 1FCAA 2ROPA 3KJVB 1ONYA 1YJRA 1G7GA 5E3RA 3SR9A 2OO4A 1X4DA 3UI3A 4AE5A 2XLIA 4Y6IA 3QCNA 1N5VA 2OPQA 3KLHA 2YKMA 5BYSA 3MM9A 4IRCA 5C24A 3F81A 4ED1A 5MAOA 1KQSR 2CFVA 3RW6A 3HT3A 4ZCMA 2VV5A 2BM1A 2ADCA 2HIQA 2I6JA 3SEOA 3RZ2A 5J2NB 1QUPA 4RW4B 1M1KT 1FKAF 4TVVA 1Q6SA 4B9TA 2DGWA 1G7FA 1TKTB 2CYYA 2J9EA 3D44A 3QCIA 2EWHA 4ZS6A 1YITS 1IM4A 3N6LA 1SIWB 3BGUA 3G71S 5CHCB 3K5NA 3OTCA 2KT5A 2XO7A 2BGDA 4C8NA 4QIEA 2E7XA 5D3GA 2PA3A 2RQMA 4CH7A 3JSYA 5DDQC 2D74B 4FS1A 2E5LF 4RNMA 2C28A 1M5SA 1TKTA 1ZPWX 3B4MA 2I1RA 2YKQA 4KR0B 2OUDA 1DLOB 4RX6A 4UQTA 3VQSA 1OESA 4HJPA 2RSQA 1CSJA 1H98A 2HAIA 5DO2A 3MMJA 5D4OA 2G0CA 1YRTA 3D0HE 3QAEA 4NRTA 3B82A 1R0AB 2LMIA 2WSEC 3MOZA 2YKMB 4IG3B 4IG0B 3A5KA 1S1WB 3H4DA 3BR9A 2UV8G 2R7VA 2JC1A 1FHTA 2XNRA 1ZCLA 1ZOTA 4OI6A 4RLEA 3LW5C 3D28A 2HXPA 2PBNA 3AY0A 1PC4A 3C46A 3I4PA 4YAAA 3FQLA 3KK2A 4N8OA 3MMCB 5CZVA 1HNVB 2Q6BA 3CDAA 5T7LA 3BJYA 1U2FA 1KFDA 1WTBA 2DTJA 2UUWA 4EU0A 5A8WB 2VFRA 1N8RT 3MAHA 4HL9A 3JSMB 1XTZA 3O5XA 1WHWA 1D1UA 3E8OA 2DRBA 4IQXA 1VBZA 1HD1A 4HH1A 2YY3A 2DNYA 1RJJA 2UP1A 3KNGA 3ZMPA 2EBGA 1QLNA 3MR6A 4RW4A 3I5BA 1S1UB 4RKUC 1OHDA 1F60B 3N9UC 1FXLA 1LK5A 5LMUF 3SYZA 3MMBB 4OJ3A 3IRWP 1XNQF 1K0TA 4O3RA 4RZRA 3BREA 4ZCKA 5D6GA 1SBRA 1VQ5S 3MAQA 1IR0A 4NZ6A 2YVSA 2J0XA 3SQGA 2YNHA 1HI0P 1QTMA 2OJ3A 1VS3A 3I9ZA 2UUBF 2KG0A 3V0EA 4ZP8A 3QO9A 1WNEA 4RU9A 2IM2A 4ECTA 3M9OB 2XSJA 1IJEB 2J17A