4WTYA

Structure of the ptp-like myo-inositol phosphatase from selenomonas ruminantium in complex with myo-inositol-(1,3,4,5)-tetrakisphosphate
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
314
structure length
314
Chain Sequence
QTVTEPVGSYARAERPQDFEGFVWRLDNDGKEALPRNFRTSADALRAPEKKFHLDAAYVPSREGMDALHISGSSAFTPAQLKNVAAKLREKTAGPIYDVDLRQESHGYLDGIPVSWYGERDWANLGKSQHEALADERHRLHAALHKTVYIAPLGKHKLPEGGEVRRVQKVQTEQEVAEAAGMRYFRIAATDHVWPTPENIDRFLAFYRTLPQDAWLHFHSEAGVGRTTAFMVMTDMLKNPSVSLKDILYRQHEIGGFYYGEFPIKTKDKDSWKTKYYREKIVMIEQFYRYVQENRADGYQTPWSVWLKSHPAKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords MYO-INOSITOL PHOSPHOHYDROLASE
publication title Structure of the PTP-like phytase from Selenomonas ruminantium in complex with myo-inositol-(1,3,4,5)-tetrakisphosphate
rcsb
source organism Selenomonas ruminantium
total genus 110
structure length 314
sequence length 314
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14566 PTPlike_phytase Inositol hexakisphosphate
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1690 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4wtyA01
3.90.190.10 Alpha Beta Alpha-Beta Complex Protein-Tyrosine Phosphatase; Chain A Protein tyrosine phosphatase superfamily 4wtyA02
2I3UA 2F6ZA 3I80A 2CM3A 2J17A 2YDUA 1PTUA 3NMEA 2Q05A 5KA1A 1AAXA 3QCDA 4QAPA 2PA5A 1C88A 2F6FA 2J16B 4KYQA 2I4GA 1ZZWA 1JLNA 2G6ZA 3O4UA 4Y2EA 2PI7A 2VEYA 4GFUA 2NT7A 1YPTA 2CMAA 1A5YA 1OEUA 4RH5A 1MKPA 4WU3A 1LQFA 4ICZA 1I9TA 1VHRA 3F99A 4QAHA 4R0SA 3S3KA 1G7FA 2Y96A 4WTYA 1OHEA 1OESA 3OMHA 2SHPA 4JMKA 2B4UA 1ONYA 2NTAA 1FQ1A 4TVVA 3F9BA 5KA7A 4GE5A 1PXHA 2P6XA 1EEOA 2OOQA 3ZMPA 3QCEA 2I4HA 5KACA 2BV5A 1RPMA 4NWGA 1GFYA 1OETA 2Y2FA 1NNYA 3CM3A 5KA8A 4ZI4A 2I4EA 1NWLA 5MMZB 1C85A 1Q6NA 1OEVA 3GXHA 1QZ0A 4WU2A 2CFVA 2FJMA 2HB1A 3S3EA 3RGQA 3H2XA 5BX1A 1QXKA 1ZC0A 4GRYA 4ZN5A 2I6MA 1NL9A 3QCLA 2F71A 2HVLA 2CM7A 2I42A 2B3OA 4MBBA 4NNDA 2QCJA 3EAXA 4OHHA 3S3HA 4I8NA 2JJDA 1PYNA 5K25A 3QCBA 2H4GA 2NV5A 5K22A 4Z6BA 2F6VA 4KYRA 1WAXA 3QCNA 1PA1A 2F6WA 1YTNA 3O5XA 1FPZA 1YTWA 3EB1A 1T49A 2CNIA 4JNBA 4ZRTA 1BZCA 5KA0A 2B4OA 4DGPA 3QCFA 4BPCA 3O3LA 3V0HA 1U26A 3D1HA 2I6IA 1C84A 1XXPA 3D44A 1T4JA 1R6HA 2I1YA 4HJPA 2I5XA 4QBEA 2A8BA 1X24A 1G7GA 1G1HA 2B49A 1WRMA 4HJQA 5HDEA 3D9CA 2RF6A 1L8KA 4H1OA 4GFVA 2M3VA 2GP0A 3V0DA 2FH7A 4QBWA 3S4EA 5EHRA 4NYHA 1OEMX 2GJTA 3RGOA 3RZ2A 2H4KA 2I6OA 5EHPA 4PVGA 2I3RA 5IBSA 1I9SA 5BUGA 3MMJA 4GRZA 2ZMMA 4RI5A 2IMGA 5I6VA 3V0GA 1RXDA 1NZ7A 4D3QA 3F9AA 2QBPA 3ZMQA 1OEOX 2PQ5A 3I36A 1Q6TA 5KA4A 3ZM1A 1ZCKA 2G59A 2AZRA 2I75A 2MBCA 1YGUA 1U24A 3ZM3A 1T48A 1EENA 4NX8A 2OC3A 2F6TA 5LXQB 4JBCA 1P15A 1J4XA 2CMCA 4R30A 2HNPA 2ZN7A 3ZV2A 3V0JA 2OZ5A 4PYHA 5BZZA 5K23A 2B4SA 1SUGA 5IBMA 4ERCA 1GWZA 2VEXA 1YN9A 3RO1A 1NWEA 2QBSA 1G4US 1XXVA 2QDCA 1LARA 2FJNA 4DGXA 5J8RA 2CM2A 2QDPA 4IKCA 2A3KA 2BGEA 5K9VA 3V0FA 3QCCA 1WCHA 4D3RA 1XRIA 2HC2A 4B04A 1Q1MA 1JF7A 2H03A 5KA9A 2VEWA 3QCJA 4R0TA 3MOWA 3PS5A 1D5RA 1LYVA 1U25A 3F81A 1L8GA 3D42A 2HXPA 4OHLA 3CWEA 3EMUA 3V0IA 2QDMA 5BZXA 4YR8B 4J51A 4BJOA 3BLUA 4QUNA 2CNGA 2ESBA 2CNEA 3QCKA 4GE6A 1XM2A 4OHEA 2P4DA 3BLTA 1NO6A 1OHDA 1OHCA 4HRFA 2CNHA 2R0BA 3QCMA 3SR9A 2F46A 4YAAA 1KAKA 4WOHA 2HC1A 3QKPA 5GTJA 3QKQA 4JMJA 1M3GA 3I7ZA 4RDDA 2QBQA 2GWOA 1C87A 3QCHA 4KI9A 2HCMA 2BGDA 3V0EA 2H4VA 4AZ1A 2Q47A 3D1OA 2NZ6A 1PTYA 2PSZA 3BM8A 2F70A 1ZCLA 4RKKA 1YTSA 3A5JA 2CM8A 5KAAA 1BZJA 4Y14A 2H02A 2QEPA 4GS0A 3QCIA 1BZHA 2CJZA 4OHIA 1ONZA 5KADA 5M43A 1I57A 3D1QA 2OUDA 3OLRA 2AHSA 2QCTA 3U96A 1G1GA 3A5KA 2I6JA 2DXPA 1C83A 3EZZA 1Q6SA 3N0AA 3M4UA 2BZLA 2CNFA 2CMBA 2PT0A 1PTVA 4OHDA 1PH0A 2WGPA 5K9WA 1Q6JA 3O4TA 1FPRA 4GWFA 3GXGA 4GE2A 2BIJA 3B7OA 1KAVA 2HY3A 1PTTA 2B4PA 4RI4A 1Q6PA 2PBNA 3QCGA 2NLKA 4D3PA 1Q6MA 3O4SA 1PA9A 1ECVA 1YFOA 1YGRA 2QBRA 2VEUA 3AWGA 3BRHA 3ZM2A 3LJ8A 2B07A 3MOZA 3AWEA 3SMEA 2HNQA 3S3FA 3S4OA 4RHGA 4QUMA 3AWFA 4S0GA 5KA3A 2C46A 2E0TA 4NWFA 1G4WR 2F6YA 5KABA 1C86A 1G1FA 3F41A 2VEVA 4H34A 5K24A 2C7SA 2NT2A 3ZM0A 3EU0A 2H04A 1XBOA 1YWFA 5KA2A 2I6PA 2J16A 1V3AA 1YZ4A 4RH9A 5AWXA
chains in the Genus database with same CATH superfamily
3N5BA 1A9NB 1NSPA 1EHWA 3M8ZA 2W25A 3FFIB 1EETB 4LVNP 2KM8B 2KXHA 5KA1A 4J7CA 3QCDA 3T5LA 2DH9A 2M8HA 1AUSL 2V2KA 3O4UA 4UUXA 3MVNA 2V4RA 1MU2B 4DG1B 1WC4A 3EXCX 1Y9OA 3QZ7A 1OEUA 3MR3A 2B5JA 3DOKB 3PYGA 3DRXA 5CYQB 3AXKA 2Y96A 1S6UA 1RAHB 4ELUA 1UEKA 1KQFB 4K5SA 2UXBF 3F9BA 5KA7A 1PXHA 1CQMA 2KZZA 1FKPB 3CJ5A 4Z7YA 3FKBA 1VRQC 2DHGA 2EFVA 1NNYA 2P9EA 1NAQA 1K8AT 1Q6NA 1S1XB 1U8WA 5HMYA 3QJPA 1VIXA 2J0XA 1T9VA 2X1AA 3S3EA 2QA4S 2D69A 5EGYA 4LIWA 3EPGA 3HKZD 2I6MA 3RAXA 4ZPTR 4RW8A 3OJUA 2XWYA 3OPKA 3DLLQ 2BE7D 1VLOA 1F0XA 4I8NA 3H5XA 4XIUA 1Y5IB 4IQMA 1X5OA 2YH0A 3FEXB 4Z6BA 2HYIB 2VC1A 5A0YA 3VQSA 5DDRC 1PA1A 3K17A 3A8KA 3P5TL 4O0NA 4JI5F 1VQOS 1YJNS 4USMA 1JLQB 1X4HA 2CYYA 2OPPA 4NCGA 4DGPA 2K1RA 2B8QA 5KFBA 1W78A 4OZ1A 3BGOP 4OJHA 4EBCA 4PPDA 2UUBJ 1HHTP 2CJQA 2FZGB 4E8UA 3MCSA 1VLYA 5DG8A 2I5XA 2GC6A 2FUG9 1G7GA 3TAMA 1G1HA 2YWWA 4CCHA 2IIHA 5L39A 5C24A 3TJ8A 2GJTA 4X66J 3GV7B 2AV5A 3RZ2A 1N33F 3GE9A 2BXJA 3BQ2A 1RT3A 4KSEB 1F60B 3PY8A 4ED6A 4I6AA 2IMOA 4FN5A 1CJKA 2YKNA 3QQCD 2ADCA 3RBZA 5CH7B 3BBFA 3MD3A 1OEOX 4C13A 2YWEA 1OYDA 1YX2A 4DJBA 2FC8A 4EBEA 3ZM3A 3T6JA 1NK9A 1EENA 4PG5A 2PMZD 3H98A 2O66A 1S7HA 3MDFA 1UKUA 5CXTA 4USWA 4CQ1A 2RS8A 3B78A 2E9RX 4X64J 3CO0P 1YJWS 2D9PA 1NHKL 3UD5A 4FF4A 3R5GA 1FE0A 3NGKA 1GWZA 1C0TB 4EUVA 3VAFA 4K4TA 1QAJA 1FA0A 1U1QA 4LF6F 4DN0A 4NMXA 3MR7A 4NLSA 2UU9F 1HQUA 3E2EA 4LREA 2IJRA 1XR7A 1FNOA 3HXMA 2C2RA 5AXMA 2IVFB 3WIUA 2H03A 3HMJG 3MMAA 2I5JA 5DRKA 1LYVA 1S9EB 4EGLA 4ECTA 3MFIA 2W7OA 1ZAWA 3KTQA 4OHLA 4A48A 3PR5B 1IKXA 2Y66A 1WEZA 4QUNA 1SUQA 2P4DA 1YJTA 1F5AA 1Q79A 4M5IA 1HYSA 4J9MA 2JZ5A 4DSJA 2VFRA 1C1CA 1HMVA 2HS4A 3QKPA 3J7A1 3QKQA 2KRBA 5GAHI 2YH1A 3PFEA 2JJ4D 2LCWA 5DQGA 5JJBA 2Q47A 1DTTB 1PTYA 1N56A 4CYUA 3KLFA 2VG7B 1XC9A 4Y14A 2G1DA 2CADA 3AXMA 2VODA 1X4DA 5EDWA 2QL5B 3QJJA 4WP3A 4DSFA 5D15A 3BSOA 4HDHA 4R8UB 2ZZMA 5HMZA 3G6YA 4ZJQA 1QJHA 2SXLA 4DF8A 2WCXA 1W2BR 4GWFA 1LFWA 2W7AA 3IG1A 4V19X 4LF4F 3NOCA 4LF7J 3AOAA 2VIHA 2NLKA 1HR0F 1YFOA 5BYSA 2UP1A 4O3QA 2PE8A 3V4MA 3LJ8A 4MKBA 3EVWA 2CPIA 4U96A 1HNIB 3Q8SB 4LRBA 3GIKA 1TAUA 3NY0A 3CJ0A 2BW2A 3ILJA 3H7HB 1URRA 2FY8A 3RBEA 1QUPA 3VZHA 4C98A 2B7BB 1OPZA 3ZM0A 2VG5B 2ZH2A 2CQ4A 3GG1A 3M2RA 1YIJS 4C8NA 4BBYA 4ZVRB 2IC3A 1PAEX 1PTUA 5I3UA 1V3SA 2W4DA 4GKJJ 1HNZJ 2IM3A 1KEKA 4YB6A 3DGPA 3FGVA 1CG2A 1RA7A 3QLHA 1EIYB 3N79A 2PI7A 2RRAA 3N28A 2NQPA 2BDPA 2MQNA 3K57A 4OYWA 1A5YA 1L3TA 2N82B 3R7NB 3CCVS 4Y00A 4K4SA 1VHRA 4QAHA 3S3KA 3FK4A 2MY8A 1ULRA 3MUMP 5D8HB 2CJBA 5HVGA 3LP2A 4PKDB 1NK4A 4NWGA 1TVRA 4IRCA 4KY3A 3D0GE 4F7VA 2CQGA 1UETA 2KXNB 2M70A 1H73A 1BY9A 1TL3A 3BBCA 4KHPJ 1WOSA 1IR1A 3FNNA 1GTEA 3LF0A 3AD8C 4WYLA 4UZCA 2ZBRA 3SCLE 3A8IA 3V81A 5CQGA 1TP7A 4I1TA 1S7IA 3QCLA 4CT8A 3D2WA 1B99A 4HH0A 1HWLA 1QSLA 1NRKA 4O44B 1RHQB 2W2PP 1RAJA 2W4PA 3RB3A 1NJXA 3ZTSA 1TFYA 3IR5B 3UVJB 2B0GA 4ZA1A 3GIJA 4I0WA 2ZM6F 4K5RA 1DJ0A 4CM0A 1SJRA 3U7JA 2V67A 4PUOA 4Z37A 1Z1ZA 5GAHU 1RU2A 2IM2A 5E2QA 2HG4A 2OUGA 3TX0A 1TK8A 2DXEA 2XY7A 4ICLB 3QNWB 3QRPA 3DRYA 2W8LA 5KOWA 4U8YA 4NYHA 2D9OA 3SQOP 3KK2B 3M1VA 2E5LF 5HK4A 4PVGA 4JV0A 4AQYF 3CDBA 2FPHX 4RI5A 5I6VA 2ALYB 5J2NA 4ZP9A 2UZAA 3DDIA 4KKOB 1UVMA 2YTCA 3LW5C 1P3DA 3P4UB 1JXLA 2MBCA 3W9HA 3D6MB 5IM0A 3JXOA 2MKSA 4AXIA 3KLHB 2H65B 4ZP6A 4CVLA 5AJ3J 3RB4A 1P1TA 2B51A 1RBLA 3HO1A 4NZ0A 4ECZA 5IFMA 2CQDA 3UFCX 3LANA 2XMTA 3OLAA 2KG1A 1SJ4P 1QSSA 2VB6A 1MW7A 2NXJA 1RCXB 2OIHA 2P6TA 2QBSA 5JMNA 2EW9A 4IKCA 2MZ1A 1JLAB 3V0FA 3MFHA 3UI3A 1U0HA 1C0UB 3CC2S 4BS2A 5ETLA 3BM7A 3AAWB 4NMLA 4R0TA 4X62F 4DR2F 5EUHA 2BBEA 4UQGA 4MFBA 3PRVA 3M8PB 3KXDA 2DNKA 4JI2F 2DNLA 3ZZOA 4X4PA 2HXPA 3D5MA 4DBQA 2BQ3A 3CJ2A 1NKCA 2HKEA 4IFVB 4UUWA 2GX8A 2HRTA 3CB4A 2RRNA 4UY8T 2RKIA 3WX4A 2K8GA 1S1UB 1RT6A 1I94J 3BLTA 1NO6A 2FJAB 4HRFA 4Q45A 3CD6S 3DRRA 4EZ6A 4ALZA 4NA2A 3RAQA 2OPRA 4KBIA 3M9NB 2XYPB 4O3PA 1K47A 3H20A 2F70A 4XO0A 5KT4A 2GMHA 3F73A 4HLBA 1LK7A 1B0VA 4DQRA 1F2HA 2MEWA 2M3DA 3FRZA 4O4GB 2CG8A 2GS8A 2HHUA 2AJ4A 1U1RA 1RTHB 4KGXB 2N7YA 1NO8A 3FEZA 5A76A 2AYBA 3LALA 1KVJA 2XLKA 1X5SA 4PWWA 2V8GA 3V6KA 1LWEA 1HL6A 1RT5B 2X51A 1KD1T 4YMEA 1Q6MA 3BKUA 3SQGA 2CA9A 3OR2A 2HZCA 3RB6A 1FT8A 3J80U 4CM2A 2PEHA 3V2UC 2AYEA 3IXQA 1Q7LB 1N32F 3S4OA 3AWFA 4X65F 5KT5A 1I51B 2F6YA 5KABA 2YBVA 1C86A 3CSKA 4E2FB 4RR5A 3CJ4A 1JJHA 4DR6J 4ED7A 2X3DA 3R5DA 5CD4H 3F44A 1VK8A 1RT7B 3MAQA 2XYGB 2E1CA 3IWLA 5HMXA 2QG9B 2ZE2A 3W60A 5A5EA 4NZ7A 3CCES 1QM9A 1JLNA 3GIRA 4I2PB 1T05A 2WZ1A 2YKOA 5J2MB 1Q8KA 4K2XA 2WONB 5EWEA 1K73T 2MJNA 3IC1A 2Q66A 4ZPBA 2W7PA 4ZPCA 4WTYA 4JV5J 2SHPA 3WDOA 2F00A 1WKLA 2B4UA 2NTAA 1WC5A 2NUHA 4GE5A 2IAJB 2P6XA 3H42A 3DOMA 1XBWA 1HKAA 1SQEA 1GFYA 4NXMF 4JI0F 5FDLA 2F1FA 3KYLA 1YQHA 2OJ3A 4QF5A 4LJMA 4P75A 4ZVEA 1FGSA 1QAYA 3T6BA 4HEA9 1X60A 1N54B 3I0SB 4LR9A 1I5OB 3CJKA 1JLCB 1HI8A 4LBHA 1DQAA 4X4UA 1T9WA 3JSMA 4ILMA 5BXIA 3IMQJ 4CH7A 2B6AB 4A8SA 4KYRA 3Q2TC 3QCNA 3AFGA 3H25A 3TAQA 3PHEA 2GJFA 4F67A 3FJ2A 4OHWA 4B9LA 1HNVA 1R89A 3OVSA 3TA2A 2YQ3A 4KC5A 5DQHA 2I6IA 1T4JA 3PKYA 4NLPA 5CAAA 2A8BA 1XIQA 3GJRB 5HP1A 2YNIA 4EEYA 1U1PA 3GFHA 5J2QA 4HACA 3ITHB 2PMHA 3KK3B 4J9VA 4NX9A 3FCVA 4RW6B 2GIQA 2HQIA 1HHSA 2D74B 2E5IA 3ISZA 1RWNB 2FHJA 1FEEA 3CNQP 2Q6BA 4IOAQ 2BVZA 2DNGA 2YNGB 3CC4S 3KDOA 4CLKA 4ZN1A 4L3KA 4M5NA 1F9HA 3I36A 3DKDA 1ZCKA 3TYTA 2QFIA 2CPYA 3IBFB 5B09A 3DLKA 4DV4F 1SPBP 1NSAA 3B6BA 4TYBA 3ZV2A 2F7VA 2MQLA 4DV2F 2VU5A 5K23A 4F3QA 4ERCA 3WHIA 2FJVA 2C2NA 4CLZA 3WZ0A 1RWOB 3OHBA 2DXFA 4BUBA 4DGXA 5J8RA 1IKWA 2ZH1A 3MPVA 3KLGB 2FHMA 2XULA 1FKOA 4D3RA 3HFVA 3ETOA 4NLXA 4YB7A 3AQOA 3I31A 2M5YA 3Q22A 3ZTQA 1ZA2B 1Y0HA 5F0UA 1D5RA 1KQKA 4HHUA 2J9CA 1VQNS 2GMLA 4Z2XA 1FNXH 1LKZA 1VQYA 2A6MA 1SV5B 5LMUF 1VRTA 2CVEA 3GONA 4GE6A 1RK8A 2NZCA 2LDYA 1LWFA 1FNMA 2JFGA 2DO0A 1YKWA 5HANA 1HIYA 2IBOA 2F46A 1PBUA 4WOHA 1NSKL 4MAKA 2UXCF 1M3GA 2QO3A 4RJVA 4LFAF 3AY0A 2WSCC 1JLFA 3QYYA 3OL7A 2W24A 2YKQA 4KPYA 1A7GE 3BDEA 4IR9A 4G3IA 4ZHRA 3HJVA 4RUAA 1OQ3A 1UVIA 2MLZA 3EGZA 4OQJA 4ES2A 3OSPA 3P3DA 2D7SA 3PEHA 1RHJB 3PFOA 4B3MJ 1APSA 1RWUA 1UA0A 5J2PB 1Y5NB 3NL0A 2PO4A 5CYMA 3HD2A 3MAHA 5KFIA 4C3MA 5AT1B 5G0RB 5T7LB 4RX6A 1S6QB 1SKSA 2HBYB 2UUWA 1QY7A 4RW7B 5KT6A 1ZAXA 4Q0BA 1WHVA 1T03A 1U7LA 3NS5A 2XSJA 2W9BB 5HJYA 1KTQA 2RU3A 4RBVA 5HQMA 2U1AA 2HHQA 3PIPQ 2AZ3A 3FMWA 3KLVA 3T19A 3I4HX 1IBLJ 1XN9A 3KG0A 3H5YA 4NYZA 2Y3YA 3BYPA 1FJCA 2GVZB 1VQSA 3GR0A 2RUGA 1RAIB 3PJXA 1SBRA 1Q8LA 3IP0A 3V4IA 2XSFA 3NBPA 1REGX 1C88A 4CWBA 2J16B 4HI1A 1KOOA 3P6YC 5E41A 4NCBA 2MQMA 1JLGA 2QZ8A 3MTJA 1X4CA 4TU9A 1C1BB 1YPTA 4K2JA 4ZPAA 1HBNB 7FDRA 4PYDA 4ELTA 1RADB 2CUYA 3G96A 4QYZK 1FKPA 1QE1B 1YZ6A 1G7FA 4F3OA 4IRKA 4FF1A 1R8PA 1NDCA 4Y65A 3W64A 1RTIA 2KM8C 1KC8T 2JSXA 3TEGA 1IQTA 3ZMPA 4GO7X 4ZI4A 1UJ4A 1NWLA 3MEEB 2J6TA 5MMZB 5KT2A 1TKTA 2BM0A 1GMWD 2MY7A 5BX1A 2HFUA 1H74A 2GIRA 2Y1JA 2BV3A 3BH7B 3LUYA 2VFSA 1L3VA 1R8CA 3S3HA 3WQPA 5HQ8A 1JLQA 4BWMA 1VQ5S 2H4GA 2BJ7A 1UEVA 2ZBIA 4I64A 4WKRA 2F6VA 1N5YB 3C6TA 4DUYJ 4WFBQ 2KZMA 5KFZA 5HN0A 9RUBA 1EQMA 3U27A 1UFKA 2WHOA 4B3TF 1T49A 4JYAJ 3T9NA 2XZDB 1KLMA 3O3LA 1RLDA 2MSTA 2UUAF 3GIIA 1R6HA 2I1YA 4ZITA 3OL9A 2V50A 2DRAA 4DV3F 3EZUA 3CULA 1BQXA 5A8WA 3QGGA 4PPZA 3FVYA 2RQ4A 1S48A 3G6ES 4OYPA 1KQSR 1T9TA 2X1GA 3D6TB 1CJVA 4IO1A 3S01A 4TYAA 4ED0A 3NGSA 2HFOA 1M5PC 1O6XA 2ZMMA 2DH7A 3BN4A 2IMGA 1KRPA 4IG0B 3GB0A 4RO0A 2CZ4A 3QT5A 1ZPWX 3CUNA 1RXDA 1S1VA 3I0RB 5K8NA 4Y2KA 1YRXA 3KLEB 3KKFA 1T0TV 4LFCF 1HD0A 2KT2A 4TN2A 4JUZA 3OTDA 2C2ZB 2FLLA 1N34F 3CJRA 3JQKA 1WC1A 4JBCA 3SBMA 3LWMA 2PN6A 4PQAA 2DNPA 1WDTA 5E33A 1U1NA 3Q2SC 2CIMA 2BUNA 2N7CA 1FXLA 1U49A 1GEHA 3B4MA 3W9JA 5DZ7A 5KG4A 1RYSA 3HZGA 4OI3A 1MROB 2Z56B 3DXBA 1NWEA 1KWMA 2OHDA 3MMCB 1TAQA 2K3KA 2Z2YB 4F26A 4IFYB 4OJ3A 3W62A 4QOTA 3C15A 2AWZA 2FB0A 3R6GB 5IT0A 3D6FB 4ZPWR 4QYZJ 2OPSB 2GVDB 3PACA 3OTCA 3PS5A 1KLNA 2NXEA 2JEFA 3DMJB 4J91A 1RKJA 2DB1A 4F04B 3IAM9 2VDHA 3CWEA 2CJ9A 4W98A 2D3O1 4AT1B 1NH8A 2Y8YA 1NKEA 2VG6B 3LPEA 2UAGA 1LXJA 3W66A 2MZQA 4WK3A 4USJC 2ZDPA 3SCIE 1JB0C 4OHZA 1DTTA 2EK6A 4NASA 2GA7A 1RHRB 4HTJA 2O1PA 3GSIA 1VI7A 3ENQA 3GV5B 5D0GA 3QCHA 2BGDA 3EM1A 2VPXB 4DR4J 4P2MA 3NLCA 4IH5A 1GXUA 3Q83A 2Y1IA 1RT4B 2A6OA 4B3SF 2ZBPA 1L5UA 2H02A 2V8PA 3M8YA 3L9ZA 3PYZA 1KOHA 4CLWA 2J6SA 2WW8A 4EO6A 2PT0A 4YN3B 3FBCA 3I6PA 3FSIA 3PTWA 3C8YA 2GHWA 3B7OA 3CIZA 1SJ1A 3OL8A 4C6AA 2VKZG 1HBOB 4RNMA 3FC9A 4QWEA 2QIFA 1Q6PA 4K4UA 3MCMA 1M90T 4A47A 4YHHJ 4UW2A 4ZLPA 4Y34A 2VG5A 1CJTB 3UW1A 4DX7A 2HNYB 3CJQA 4PABA 3U1LA 3QAEA 4L74A 2DCUB 3D6HB 1IKVA 4OZJA 2P5VA 4LSNA 1HW8A 2VEVA 4WIQA 3I5BA 4PQUB 3FZBA 1RWVB 4Q43A 1YJ9S 2PC6A 5T14A 3HFZB 3VTIA 2BE2B 2JFDA 4ED2A 3OVBA 3VAHA 1FKAF 2Q1LA 4K0KJ 1R8HA 1ZH5A 1RSCA 2C2EA 4KRWA 4KGKA 3KFWX 2QJ3A 1NHVA 4QIWD 4DS5A 4DCPB 3I5AA 3BGRA 2E5HA 1UWBB 2GO8A 3M2UA 3H8YA 4OZNA 5ETNA 3H2LA 3T3FA 3TNVA 3RYLA 2K06A 2HRYA 2RDDA 2W2QP 3J81U 1F3VA 2CJXB 3MM9A 3WIVA 4L76A 2FYXA 4I2QB 1ELOA 2WK4A 3EX7B 3T41A 1I1GA 3LAKA 5F8NA 1WF0A 5C2GA 1X9WA 2JFHA 1F9EB 3NXZA 1FFWB 1R27B 3UVJA 2B3OA 3EAXA 4AD6A 3C16A 1TV6A 1J5EJ 3W8PA 1VQKS 1SC6A 3PV8A 2H4WB 4FDFA 2XI3A 3PW4A 4H4OA 2RF2A 1NUEA 2HFNA 1AA1B 3E3XA 3EUNA 5GAGI 5C5JA 2KFZA 2UXBJ 3AQPA 2CNIA 1FERA 4CO3A 1M5KC 4RWWA 2DHAA 4IRDA 5SUHA 1S59A 3ISNC 2HW3A 1NDLA 2JFFA 3D1HA 3R5BA 3AD7C 3UN2A 1Z4UA 1CC7A 1YGYA 3ET6B 4HJPA 4NYPA 1XR6A 3Q8VA 4WK1A 4CO2A 3HFKA 3RU0A 4G65A 4ZN3A 1DLOA 2QLFB 4CH0S 5K14B 1S9GB 4FYXB 3CIMA 3IS9A 2GP0A 3ADAC 4DV6F 3S4EA 2XMUA 4OI0A 3IA0A 1UVKA 2MQOA 3HSJA 2ZOFA 2I3RA 4N8OA 2W8KA 4ATNA 2DNMA 5C25B 2HQDA 2BKNA 1HBMB 4OX7A 3TZWA 1NZ7A 4QWAA 4JI5J 2HEKA 4P7VA 3IO1A 3KLHA 5FD1A 4KO0B 2YPZA 1FDNA 2DNRA 1SC4B 2DY9A 2MKCA 4CZCA 3PIOQ 4YB5A 1VISA 2AZRA 2I75A 2MLYA 2DIVA 2GC8A 1DTQB 4J9OA 4B9VA 1Q53A 5C2CA 2C3OA 2F6TA 1RHKB 1EP4B 4B9MA 3G8SA 2ZH3A 5D4PA 1M5OC 2DNYA 2ZN7A 4FYWB 2DGQA 3CMAS 5BZZA 2PFDA 4TNOA 3VHQA 1WACA 2IJNA 4Q5VA 3PO5A 5HMWA 1TTHB 2WB4A 1C0UA 2BRKA 2DNNA 1YTYA 1SL2A 4NWBA 3HHLA 2RB7A 5LMNJ 2HHHJ 3DLGB 4M1KA 1MN9A 5CCLA 5ETRA 1AYEA 3G82B 3OUYA 2OSQA 2QYCA 2LECA 3DFEA 1PSDA 2V6AA 1SH3A 2D41A 1XMQJ 5T41A 1RJJA 2VBYA 4E0DA 1X0FA 2AEJA 4IFVA 1W7KA 1PIEA 1VQ6S 4ZVTB 1S1UA 2ZKTA 5E5NA 1H2TZ 3HVTB 5BYRA 4QYRA 1VIOA 2AJ1A 1C4AA 3TQ1A 2UVWA 1S10A 2O5DA 4KGMA 3BLUA 1VC0A 4LR7A 1OHCA 2RQKA 3QMQA 3PW0A 2E66A 2DNQA 2FY1A 4LF6J 4J9SA 1XTZA 2E9ZA 4FBUA 1VQ8S 2XLJA 2XQCA 3M6XA 5KFKA 4C8OA 1M5SA 1YTSA 2CM8A 3ZTRA 4QIVA 4G1QB 2L9WA 2KN4A 3T1YF 4DR3F 2QSWA 1IBMF 2OUDA 3C19A 1LW0A 5DM6Q 1U6BA 3B8HA 5I42B 4ECQA 3UE2A 4ZVHA 1URNA 3EZZA 3MURP 4URSA 5F8HA 5E0OA 1RT5A 4ITSA 3K89A 4NRTA 3GLJA 5GAGU 3J7AN 3K5MA 1YJVA 2FVSA 3UO0A 4NLOA 5DG9A 4DV0F 1L3KA 3OFEA 2JRSA 2ZH5A 1FDBA 3SZ2A 4D3PA 2XHWA 2VA3A 5EX0A 1RP5A 2XYHB 1ECVA 4X4QA 3DLEA 2RQCA 2N4CA 4CVMA 3MF5A 5AE3A 2DR9A 4I6WA 4F0MA 2ZZNA 1RT1A 3HCXA 2DVIA 1N5QA 3H5SA 2CDRB 2E0TA 1NK8A 4N76A 4I69A 4O3OA 3CJ8A 4H34A 2E1RA 2NT2A 4JI8F 3EU0A 1X4AA 4PG7A 3ZZRA 1XEZA 3HT3A 1V3AA 3HHDA 2DNZA 1ZZNA 3NWGA 4RNNA 2F6ZA 3I80A 2GMJA 3M32A 4URQU 1IKYB 4X4RA 2EK1A 3EJMA 4R25A 5LOQA 3UPFA 2D3ZA 1NH7A 4LF4J 3D3CJ 2C2MB 1MG7A 2XJAA 2Z2LA 1NPPA 3CWJA 4ZPDA 1HR0J 2XC9A 5EX3A 4JV2A 4Y2AA 3ZNJ1 2QEXS 1J2VA 4F36A 2H5EA 4DZDA 1U1LA 2ZH4A 4LQ9A 3W3SA 4QPXA 1UEUA 1FJ7A 3DDNA 1V3RA 2B3TB 4CLLA 4J9LA 4JMKA 1RZMA 1UZHA 4MMOA 3K0JA 2YQ1A 2OOQA 2V4JB 3D66A 1O5JA 3S7RA 1AT1B 4EZ9A 1UPMB 1N6QB 3N6NA 1WHYA 2VJVA 3DU5A 2QMUB 1PGZA 2UVUA 4YR0A 2GFFA 3P49B 4IYQA 4ZIYA 1ZC0A 1RI7A 3RAMA 1TK0A 2LLZA 1TL4A 1GK8A 2QCJA 3BYRA 4UTGA 2NLWA 4OHHA 5F3ZA 4WFZA 1S6PB 2F5GA 1FFGB 1O0PA 4WBFA 5DDOC 4QIGA 4QIFA 2LEBA 1PBAA 4G1PA 1GG4A 1ZM9A 4MKYA 4ID8A 3LAMA 1ZS6A 2IHR1 3UAGA 3D67A 2NPIA 3A3PB 2R7RA 1JLEB 2OD6A 3KK3A 1U02A 4JV1A 1LQ9A 3W5XA 2AJ2A 3THTA 1WRMA 1WNEA 2AJ0A 1NK5A 4LFBF 4YY3F 1ZTTA 1KTVA 2JX2A 2ZD1A 2YNGA 4WIIA 2OSRA 1WEXA 2QE5A 2GNKA 3KG4A 3VWSA 2AQ4A 3UNYA 5L1IA 2V2ZA 4EWTA 5BUGA 3KHHA 1CS4B 2HBQB 3MMJA 2GQQA 3GFZA 3M6UA 3JSBA 2DBBA 2OGUA 5B0CA 3TA0A 2U2FA 1JLBA 3MEGB 2W2MP 3TJAA 2KVIA 4KFBB 3QO9A 3ZM1A 3MPWA 2UUBF 4ANEA 3CMES 4X4NA 2CNNB 4LT6A 3C6UB 3BZQA 1CULB 3CCMS 2WVCA 5D3GB 4BHQA 1B0TA 2X1BA 3QT6A 2V8VA 4JI4J 3TAPA 2HNPA 3D0IE 1X4GA 4WZMA 4M95A 2Z2ZA 3KLGA 5JUMA 2LQ8A 3LP0B 2FQQB 3CCLS 4X66F 4ED4A 3EGWB 4CNYA 4ETZA 3MMBB 3EDRB 4CDIA 4MH8A 2KT5A 2ZNYA 1T3OA 3PKMA 3B4DA 4ZCKA 4ILLA 3RRHA 1KDNA 3LP1B 5K9VA 3DNCA 4Y6IA 2EBGA 4PG6A 4C0OC 4ZVQB 2GGPB 5AXLA 1SV5A 4FS2A 4NRUA 1HPZB 1SXLA 3NWRA 4MYUA 3CDUA 4F2SA 2RAQA 3D42A 3OFGA 2LVWA 3RTVA 1JXVA 4HHJA 4OYBA 4HYKA 4PXDA 3KJQB 4XDCA 2XO7A 3KHRA 1MMLA 3M8QA 2CNGA 1Y3KA 2MZJA 2IYGA 2DR7A 1XNQF 4A8QA 1AFJA 5M2PA 2XTJP 1K0VA 5B0GA 2VUGA 1N4LA 4OYAA 2NREA 4YAAA 3BREA 5GTJA 4RDDA 3AB4B 1KKHA 3DM2A 2R8IA 4A8MP 3D1OA 2PSZA 2ZNZA 1IBKJ 1E6VB 1RB0A 1FTCA 3MM5B 2KRRA 3HPOA 3K5NA 4TKTA 5DDPC 2AHSA 3OTBA 5J2PA 5KG7A 4H4MB 1WSRA 1FTRA 3VF0B 5LSOA 4C8YA 1G1XA 3N01A 2EWHA 3WBZA 4U7CA 4LSLA 2GW8A 5HLFA 3X1LB 1ROFA 2UXDF 2W9BA 1ZOTA 2H51B 5KG6A 2LEPA 2CNOB 4KIAA 3I96A 2CJAA 4L75A 1QDUB 4OYIA 5A2QY 2QBRA 2KDOA 3M9MB 3QGPA 1N5TA 2WVEA 2ZH9A 3SMEA 2GCAA 2AF6A 2GVZA 4TQSA 4NI2B 5GADI 3KUGA 3ZZPA 2WVFA 2LEAA 2YNHA 2OEJA 2FTRA 2C7SA 1N8RT 4N47A 1BMQB 1YWFA 4FXVA 3OXLA 3QZ8A 1X0PA 2I6PA 2J16A 1K1SA 3TZZA 3MPDA 4ED5A 4FVMA 1FK9B 5FLXU 1MMDA 1D9FA 4Y3CA 1C1BA 2CQBA 5THWA 3QBCA 4KHRA 4P73A 4O4RA 1WOPA 4KYQA 2ZFHA 1AB8A 2FZCB 3OR1B 2WTFA 1CJUB 2C2KB 2CMAA 3C66A 3NCPA 4DOZA 2HK2A 3AHPA 1R31A 1SJ3P 3ISND 1H98A 1PCAA 3FCWA 5KG5A 2O01C 2WSEC 2DJWA 3NEKA 3CMQA 3J80Y 1OSDA 2M2BA 4ID5B 2ZDOA 2I2YA 2R7SA 3IGVA 1XERA 3I32A 2FVPA 3M2VB 4UZBA 2XY6A 1QZ0A 2CFVA 3EWGA 3CJTA 4CO5A 2OPQB 4GKJF 4IH7A 2O67A 1T94A 2YWGA 5DGBA 3W7BA 1FJGF 4TXSA 1PG5B 4I7FA 2J5AA 2CM7A 3ILLA 1YLXA 4HI2A 2GZOA 4MBBA 1EZZB 4AUKA 2HS0A 5ETMA 4YDXA 2WB1D 5E3PA 5HSPA 2HHVA 4P7TA 4Y2MA 1VFJA 4R5PB 1UA1A 3G86A 5LL6d 5F9LA 3I9V9 1MN7A 2F65A 3JYTA 2ZH7A 2Y8WA 2BJ8A 4NXMJ 1FI4A 4JI0J 2IM0A 2RVJA 1S4FA 4N5SA 2HVZA 3SIPB 1Q78A 2QX0A 1RXOB 4QWBA 1LWXA 4UOCA 3U02A 1S0NA 1CEZA 3MCNA 4ECVA 3D9CA 3JQMA 2DGOA 2OEMA 4PWDA 3I56S 3OD2A 2I1RA 2M3VA 4IG0A 1Y4ZB 3SFUA 3LOUA 1JIHA 3I0RA 5KFXA 2L48A 2PGCA 4HDGA 3NKYA 3MR5A 2Z8QA 5EHPA 5A6PA 3KLEA 2HFVA 2LP4A 4F02A 1I9SA 4DLEA 2W2OP 2XMMA 2LYVA 4CRJA 3OBIA 3GTYX 2XBPA 3THPA 4NLUA 2QBPA 4OZ3A 2B5JB 5KFUA 3TX8A 4IDKA 3PXGa 2DPIA 3Q23A 3A3OB 4MIBA 1T48A 3RR8A 1E8CA 2KG0A 2PI4A 4OI6A 1J4XA 2VQEF 2VTDA 1H3DA 3V0JA 2OZ5A 5GADU 5DDQC 2BJ9A 1RHMB 3A4TA 1AUDA 2KB2A 5KG3A 3KWMA 1WD6A 1V3ZA 1XXVA 2GVDA 3ZZ0A 3LK7A 1JNZB 2BGEA 1S9FA 2V94A 4RW8B 4RLEA 2MLXA 1RWXB 4C0BA 2XMKA 2V4QA 2GJIA 5MAOA 1U6FA 4DCJB 1FWKA 2VG6A 3RW7A 3QCJA 2AW0A 5A0YB 2IRXA 3BSNA 6FD1A 2ADBA 2V8HA 3L7UA 3NGTA 1KFSA 4DV4J 3G6VA 3TA1A 2OPPB 1TL7B 4NCGB 3ZZUA 1RTJA 2W1BA 4BJOA 4DV2J 4C4WA 2RU9A 4F4KA 1B7YB 3C14A 2VL1A 2CRLA 3LGHA 4X2BA 1VQ4S 1TL1A 1Y7PA 3OL6A 2VTEA 4G6VB 1F9FA 1HARA 1R8BA 2EBEA 3LO3A 4Y0FA 3VVTA 1DAXA 1U2FA 1S4EA 4JMJA 3GV8B 2GWOA 1C87A 2RHQB 1UW4A 5C24B 4FF2A 3UN5A 1HI1A 1X4EA 3BM8A 2KO1A 1BGXT 1CQNA 2LDIA 2GO9A 4EU0A 1SC1B 2OFGX 1RT3B 2VC0A 1SQFA 1GQEA 1EKRA 1RLCL 5KFQA 2YKNB 2Q6CA 1X5PA 3GCWP 5GMKa 2YPYA 1LWCA 5HATA 1C83A 1E0DA 4F3MA 4ZVSB 1BUXA 5LMUJ 3QSIA 3K7RA 4WPAA 3L7PA 1LW2B 5K9WA 4RKUC 3X3UA 3FCHA 5KFWA 3GPAA 3SFGA 1IUJA 2Y1OA 4YFUA 2BYCA 2F8MA 2AYGA 1KAVA 3EZ5A 5F41A 4AXJA 4RUHA 2UXCJ 4DSIA 2XCAA 1BQMA 4ENOA 3KLIA 1HLWA 2BE2A 2RT3A 3N0VA 4B9SA 1HQUB 1VMBA 2MKIA 1V9OA 2LU1A 4K8RA 1VQ9S 1MLAA 5M2RA 3VQTA 2E7XA 1QLNA 1ZA1B 4C3KA 2EC0A 2I5JB 4H54A 1SI9A 4GVBA 1WG1A 2IYIA 3GMGA 4RNHA 2YDUA 2L41A 1Q81T 2UVRA 2MQPA 3TI0A 3S1TA 4QAPA 4OV6A 4ZVUB 5L46A 1IKXB 1NK0A 4OI2A 2LKZA 2VICA 2AX0A 4RNFA 4AFFA 1YITS 4NLYA 2AEMA 1UP1A 3R5AA 4QR1A 3VCDA 4M5JA 2AD9A 4AL6A 1C1CB 1HNXF 1RWPB 1NJWA 4CVKA 3H2UB 4WJBA 2HFZA 1AW0A 1KQGB 1IJEB 4CYUB 2DEIA 3KLFB 4DR6F 5IT4A 4Q2MA 1L3SA 2CJKA 5HO4A 4FS1A 4CO1A 3CCRS 3CM3A 2KJVA 4U8VA 2Q79A 2RMLA 1C85A 1HQEA 4XTTA 1SQGA 2G0IA 1M1HA 4A8OA 1DHMA 1X4BA 4IO9Q 4RW9B 2UUPA 2BM1A 3BO2A 1NDKA 3GYNA 4TY8A 3CCTA 3CW2C 4NLDA 1S0VA 2XHCA 1UAGA 4ZKAA 4LF9F 1NM2A 4F4YA 5IXUA 2G2OA 5A5FA 2R42A 4J37A 4JV5F 3VALA 4F4ZA 2R7XA 3HKWA 1YTNA 4I4BA 4KYZA 1YTWA 3ET6A 3TUZC 2F9DA 4W92B 3CD0A 1ICEB 4YS2A 3ILIA 4OHVA 4CTAB 1AFIA 3SI8A 3V0HA 1FDAA 1U26A 4OYXA 5K14A 2L08A 3H4DA 1S9GA 3HHLC 2XGPA 2JEIA 3EZOA 4PXEA 8RUCA 5C25A 2MYFA 1FXDA 2B7CB 3KJVA 2WAQD 3SCKE 2JVRA 2IC3B 4ECRA 2DHXA 5I3UB 2R7TA 3BQ1A 2BQUA 1OEMX 2RDJA 1IXKA 4DL3A 1GH8A 2H4KA 1DRZA 1AZSA 4KT0C 1RHUB 5AE1A 3DGPB 3FSXA 3V5RA 5CD4A 3M30A 3HZEA 2V0NA 3GJTB 5KFAA 2M7SA 3CCWA 2WJPA 3F9AA 1S72S 4B3TJ 4OZ5A 1T9YA 2Y1LB 1J5OB 1Q6TA 2A1BA 5IOLA 2UUAJ 2F4VF 2AM1A 2AYMA 5K20B 4EYIB 3LP2B 3IRXB 1JKHA 2OC3A 2XMAA 4J9NA 3DLGA 3NGDA 3GYXB 5F8MA 2DH8A 1TVRB 3RR7A 1VC6A 4QWCA 2I38A 1TL3B 5HVHA 3KHGA 1CBKA 3OSNA 1U0SA 2QDCA 2I6WA 3V81B 4ZS6A 1G6BA 2FJWA 4F4WA 5KFTA 4OYMA 4ZVPB 1N0VC 5ETKA 2G9OA 4M5DA 1HNWF 1Q1MA 4ANDA 3N4WA 4K50A 2FVQA 1R6YA 1U25A 2G1HA 4B9TA 1Q1KA 1N34J 4GC7A 4GO5X 5DQIA 5IZHA 2G13A 4PUOB 2W01A 1TKZA 1WI8A 2FC9A 2V68A 5L1JA 1S1WA 4DPOA 1RAGB 2V8DA 4NLTA 3P5BP 2KXFA 1JJ4A 3SR9A 3A3NB 2Z57B 2MPUA 3M4XA 4G1QA 3PW5A 4AZ1A 5I42A 3SDEA 4YEAA 2AJFE 4HH1A 4USKA 3M1VB 2R7VA 4A46A 5IT9Y 4B3RF 3PNIA 3VAJA 3T5JA 4DR7J 5IV3A 1ONZA 2UUCJ 3U96A 2QA2A 3V6DA 3MM8A 3LPYA 4F8RA 2J0SD 2BZ2A 2WGPA 3O4TA 2BANA 4FYYB 2CZ9A 1NU4A 2LU2A 2XI2A 3OXGA 2HY3A 3F0NA 1WWHA 2CAJA 4GKKJ 4ZMMA 4ED3A 4NE9C 2HURA 5DM7Q 1N5VA 5KFVA 4KJIA 2HBZB 3AWEA 2HNQA 2WRMA 3IWXA 4B3SJ 4ECXA 1GMWA 4CI0B 1IKYA 2A3JA 4DSKA 2VASA 2F40A 1U0HB 3KJNB 5KG0A 2DGTA 3QATA 5AWXA 3MM7B 1U45A 1ZM4A 4CP5A 4MFBB 2EVZA 1M5VC 4XDDA 2JEJA 2GC5A 5ETVA 3AB2B 2Q05A 2UVVA 2DR5A 5AE2A 2Z2MA 3ZZYA 1MSWD 1ZZWA 1P31A 1OY6A 4DL5A 2RKIB 3LGNA 4A8YA 4KB7A 2V2VA 4RH5A 2XZWA 3VAMA 3DRRB 4TY9A 1I9TA 2EFNA 4OLPA 3ZTOA 2C3PA 2DY1A 2OPRB 5KFJA 3G8TA 3QGIA 1CLFA 3OJSA 3BPDA 2FJDB 1ONYA 2IVMA 3O44A 2CPZA 3HN7A 4LQ3A 4B08A 4GMKA 1QVFR 1OIAA 1OETA 4LRDA 1M1GA 2ERRA 4FKXA 4C8MA 3R27A 3GQCA 2HB1A 3RGQA 4LIRA 1Q86T 4ZN5A 3DN9A 2X7IA 5H9FK 4C48A 3BDPA 5D4OA 1IM4A 1OO0B 2KVQE 1UCNA 2I42A 4TLRA 3D68A 3G71S 2MQQA 3FMBA 3EPIA 3DI6A 5I4MA 3OXFA 1FX2A 1HWJA 3O8WA 3SQGB 3OR2B 1T7PA 1HFEL 2F6WA 3L7OA 3BKTA 2P2CB 2LQ5A 2KTQA 1BZCA 2H54B 1P1LA 3JAMY 2XO6A 4I56A 4HR2A 1VCTA 4U67Q 1TKXA 2XWXA 5KFNA 5KT7A 1C84A 2QRRA 3NOGA 3TEHB 1HI0P 2LQ9A 3QT7A 2ROEA 2MTLA 5F0WA 2YWFA 3HVAA 2CQIA 5EHRA 4M63A 1NLKL 2MJUA 4LF8F 2CWKA 3GSDA 3Q0AA 1BQNA 2HZVA 1IBCB 4KFBA 4DWIA 4R0JA 4LBPA 3DYAA 2IM1A 1QD1A 1T05B 4NLGA 2BW7A 4DUYF 2E1AA 1U2CA 2DK2A 3H2VE 4PWUA 4ZP8A 3C6UA 1CULA 1XNRF 4ZVGA 1SB6A 1OQ6A 3E01A 2C22A 4CLTA 4IR1A 2NCKL 3GIMA 1YGUA 3CDWA 2VFTA 3BKFA 1B3TA 1U1KA 5LXQB 3MMBA 2BOAA 3MGJA 3DOMB 1F5BA 1MMNA 2M4MA 2H5IB 1C4CA 2OKQA 2HAFA 4GRSA 5CZXA 4DV6J 2H4YB 2H1YA 1LARA 4FVCA 4NYOA 1HPZA 1DARA 1OWXA 2VA2A 1VOMA 2G0JA 3JSMB 1SIZA 2MKJA 1XJWB 4YR3A 1X31C 3CCSS 4KGVB 4QW8A 4O3RA 2CKWA 2BJDA 3ETMA 3WX8A 4B3OA 3HD1A 1JWWA 2L9NA 3BS9A 5KFLA 1N48A 1HNVB 1R0AA 5BZXA 1YZ7A 2HGLA 1FRKA 3JQJA 2CNEA 3EGVA 2GHPA 5IQQA 2KH9A 2CNHA 4DPXA 1RAOA 3QCMA 4ZVOB 3TUIC 2IBKA 2BEFA 5H9FJ 3AODA 4H4KC 2HNZA 1E6VA 1A6LA 5HP1B 3BV8A 4DQIA 4Q7AA 4WP9A 2ASDA 2YNFA 5KFEA 2R2UA 2QBQA 4EO8A 1VBYA 2B9WA 2DEJA 1PYTA 2QL9B 4J90A 1W25A 1YJRA 3RJMB 1REVA 2APOA 1T11A 2ZZTA 3T1HF 2YKMB 2FZKB 3ENAA 5M43A 2R8GA 6FDRA 3A5KA 4LR8A 3DOLA 4OI4A 5A8RA 2YVSA 2DTJA 5KFHA 3G4SS 3VV2B 1EJ7L 1RAAB 2EG2A 5D0RA 4ZCMA 2XM3A 3NGUA 5A8KA 1RTDB 5ETOA 3DLKB 3MM6B 4RW4A 1XMOF 4JI3F 2PDAA 3FDSA 4CO0A 4PXBA 3IR7B 4B17A 3Q24A 3FUYA 1PA9A 2PA8D 1NHUA 4DV7F 3CJ3A 2R2RA 2KYZA 1F5CA 3T1YJ 1I3OB 4DR3J 2DGUA 5EHHA 3KMSA 4Y28C 1FHTA 1IBMJ 1FKOB 1G1FA 1LFPA 3AJDA 4FPRA 2N3OA 4X4VA 2AIRB 1FDDA 3HHNB 5L8RC 3TRGA 2VF3A 1J6UA 3G6XA 1SC3B 2CM3A 4FPIA 1VHFA 1LOUA 3EMTA 1A0OB 1H7WA 4CLSA 5GMDA 2NS1B 3NMEA 4KV8B 5DO2A 3I55S 3HHEA 4DV0J 2E29A 3UR3C 2Q3PA 3K5PA 4C11A 1VRTB 4P6QA 1U1OA 4CT9A 2KFNA 2VEYA 4GFUA 2JEGA 2HWHA 3M9OB 1LWFB 3MEDA 4JI1F 3W2WA 4ID5A 3CGIA 1KR4A 1VDHA 1S76D 1DBDA 4QWDA 3H59A 2KT3A 3P96A 3KHLA 1IN0A 3HHLD 4IG3A 4TVAB 5I3PA 5CZVA 4TVVA 2OPQA 3CT9A 4JI8J 4PAAA 4X4OA 3QPIA 3DGVA 4ZHRB 5J1EB 2XS2A 3G9CA 3HT0A 1UL3A 5CYJA 5G4DA 2VPZB 1YRTA 2C2OB 4ELVA 4K0KF 2R8HA 3O2IA 4O3SA 3HJFA 1PO6A 4NZ6A 4R5PA 4MYTA 2VOSA 2KI2A 3QCZA 4JI6J 5SZTA 2BOPA 2K3IA 5C42B 2QLWA 4FNHA 4DCOB 5K25A 4WKYA 1IJFB 4L73A 4CIOA 1WAXA 4U6PA 1MNEA 3NS6A 4UOFA 1SKRA 4Q0BB 1IWGA 5E7OB 2ZWPA 3A1YG 2QYGA 1T03B 2ZJRQ 3DLBA 3QCFA 4D3HA 3ELHA 1UW9A 1S99A 2FIUA 1X4FA 1X9MA 3DXSX 4MKVA 5D4NA 5KFYA 1WEYA 2EEYA 3OFFA 1X24A 2CFXA 4XPCA 5HDEA 2X5OA 1U09A 1VC5A 1UVJA 4PCQA 3A8EA 1J5EF 3HSZA 2KHCA 1KNZA 4USIA 3V4IB 3NBPB 2BR0A 5LM7E 4Q2LA 1JLGB 2HNDB 1CC8A 2MHEA 5J1PA 1S49A 3SV4A 3K8WA 4OLOA 3PX4A 4K4YA 2PQ5A 3SEOA 2G59A 1IVZA 1RTIB 4DX6A 2OELA 2YX1A 2HWTA 3BN7A 1P9YA 1N36J 2HHSA 1SL1A 5KFFA 1T8EA 4OX9J 5D77A 3A13A 1KVIA 2ACYA 1P15A 3PYFA 2Z30B 4K4WA 4LFBJ 3SYZA 4YY3J 1UMJA 1SUGA 4N8NA 1XQIA 1TKTB 5CA5A 3PDNA 2ILYA 4BC9A 5M2UA 1VQMS 4J5OA 4OYOA 1EKSA 1WCHA 5B0FA 4CLFA 2RUSA 4B04A 1GX5A 5IWAF 3GWCA 2AGOA 3TQEA 1GAOA 1TL7A 3CVKA 4Y2IA 4I68A 4UT4A 4OHXA 2ZUAA 2R2SA 1YBTA 3C6TB 3FFIA 1EETA 1UPPA 4OZLA 2WW4A 4C7QA 4RWXA 3EMUA 2MSSA 3EDQB 1VJWA 4J51A 4NEZA 4DUZF 1KLMB 1MU2A 4DG1A 1NDPA 3MTKA 4DFPA 4ECYA 3AJ1A 2GIFA 3DOKA 5CYQA 1K44A 1H0HB 3D9BA 5LMNF 2HHHF 3DDKA 5A8WB 1G3OA 1KAKA 3I7ZA 5I3QA 2RQMA 1XMQF 4M94A 3PO4A 1R8AA 1CJVB 1SL0A 4A8FA 1NK6A 4CLUA 4KQZA 1V6HA 4J9UE 2QC3A 4DPUA 1J27A 2JL9A 1BZHA 1LW2A 2CJZA 1I57A 1SCJB 3ZM6A 1S1XA 4NXNF 1BWVA 1S1VB 2QCTA 1GMVA 1FVSA 2IFXA 4U7UK 1QVGR 2CNFA 2CMBA 1PTVA 4OHDA 2FLPA 5J1NA 3SCJE 3PW2A 3JSRA 1XNQJ 4PR6A 5DLGA 1NBEB 4ECUA 2YWKA 3RZAA 1YBUA 4U9RA 2VOPA 1Q8IA 3PX6A 3QCGA 3RGIA 3O4SA 2J9DA 1VGYA 1RKIA 1RAFB 4IUFA 5ITHA 3AWGA 5LXYA 4Q8EA 4KPCA 2DGXA 3PRBA 2Q43A 2CJYB 3ICLA 5IC4B 4S0GA 1K0TA 3C15B 4DPWA 2R7OA 1P27B 1AROP 4HL9A 3T5KA 3W5YA 3J81j 2QMWA 3RRKA 1ITPA 2QSFA 3CO9A 4BCAA 3JTNA 2AMCB 3RB0A 4F0KA 4EFAC 5KOXA 2UXDJ 1S77D 3W61A 4M8LA 2IA0A 3OTOJ 7AT1B 4M5GA 3ZC4A 2RDIA 4DR5F 5KFMA 2ROGA 3O6QA 2OD4A 2R7QA 2J0QD 1LQFA 2NR0A 2VHGA 3F99A 4R0SA 2JLGA 3OFHA 5IQ6A 3BO3A 1FWLA 3VZIA 4C8ZA 1BD6A 4WFYA 1WI6A 1Q5VA 3M6VA 3MHYA 3BB5A 1KS2A 2J8AA 3W2VB 4RW9A 1YK9A 1WTFA 4DS4A 3O5TB 2VQFF 4WU2A 2HHTA 1C0TA 2VBXA 4USVA 4GRYA 5D4LA 4DPTA 3MECB 3P45B 5FLXY 1QSYA 2DNOA 4ECWA 5F8GA 3O1LA 4NNDA 1CVJA 1WUUA 5DGAA 3IBCB 3KDNA 4WE1B 4QPTA 4K59A 4CTAA 3W9IA 3CEDA 2EKYA 1S9EA 2Z0GA 2KU7A 3OV7A 2Y0BB 1FJEB 3TR5A 3HSGA 1BLUA 2QA1A 4JNBA 1PJ5A 2B4VA 2CNKB 2CQ3A 1RWKB 1IKVB 2MGZB 2HIYA 2KKHA 4LSNB 2F9JA 5IS2A 2BMBA 4C12A 2BKOA 1NJYA 1WC3A 2BX6A 2VFVA 3QAUA 3MI7X 2JHEA 2ASLA 4HTIA 3THVA 1FJGJ 1L8KA 1JBVA 2OO4A 5K8MA 4EBDA 2MB0B 9ATCB 4LF5F 4A4JA 3DRPB 2BA9A 2VG7A 3LTOA 3UDVA 4TQRA 1J5OA 3IGNA 1TELA 3TUPA 4PG8A 4NL5A 1RU1A 3BGRB 3IRXA 2XB2D 3M2UB 2HMIB 3QGHA 2CQ2A 3U1NA 3TZYA 4R8UA 2GCBA 3ILOA 2AJQA 1WKKA 4P2XA 2MHNA 2R8JA 2J0WA 3W65A 4DR1J 2BACA 3HF5A 3KNGA 2ZVIA 3MM9B 5KFCA 2AP6A 4ER8A 4J9PA 1KFDA 4Y2CA 3NMAA 1YG0A 2V5HG 2NZ4A 1HNIA 2JH3A 2K7JA 3I9ZA 4WFAQ 1JJ2R 5KFGA 2XS5A 2HGMA 3AT1B 4K4XA 1R43A 4KAIA 3C16B 1TV6B 1FE4A 5L9XA 1YWXA 4DFMA 5HBMB 2NXUA 2V69A 2MQ8A 4H4OB 3L95X 2RF2B 2FLNA 2DGVA 1AXQA 1NZ8A 2CPXA 4QQBA 2VQEJ 2HBRB 1EAYC 1VRUB 4JI4F 3K59A 2UV8G 1WG4A 1NNDA 1WORA 4OHEA 1Q0NA 4O0IA 1HA1A 2GAHC 2ZITA 3G2XA 3RUBL 2IY5B 3MD1A 4WWSA 1DLOB 4DV5F 2FLOA 3IS9B 3UD4P 4S0MA 2FD2A 2HQGA 4WZQA 4DQPA 4C3LA 2MMYA 1CPZA 1JBWA 1S1TB 1R7IA 4OHIA 2R7UA 4QDIA 4JOUA 3SSSA 5B0BA 3EGNA 2ATLA 3G8QA 2DXPA 4ANCA 2QMXA 4KHMA 1D1UA 3M4UA 5KFSA 4B9UA 2FHKA 3MCOA 3BH6B 4Q44A 2BJ3A 3HI9A 4OZ0A 1RT2B 4RU9A 4O44A 6AT1B 4B02A 3CD7A 4DXLA 2B4PA 4RI4A 2R2TA 1FVQA 2YKAA 1Y10A 3VGUA 3D7SB 4P74A 2R9LA 1KN6A 1WF2A 4DL4A 1WELA 5L38A 3BRHA 1U48A 3ZM2A 3MEKA 2RHSB 4F4AA 3R97A 1ZM3A 2ZC4A 4OV1A 2HSEB 3HHLB 3R3TA 1IBKF 3MM7A 5E3AA 3US5A 3OUYB 2YKPA 4LRCA 4DV1F 4ICLA 4WYWA 1XBOA 1PC4A 1S97A 1Y3JA 2G0CA 3BQ0A 5F8LA 1FD8A 2ZWOA 3C3LA 5L1KA 1LV5A 3FQKA 1I6JA 5A2QU 3KK2A 2PA5A 1X7VA 2I0XA 4CNZA 5JVGQ 5CABA 1X5TA 2G6ZA 3SSQA 4M5LA 1HBUB 1JXEA 2DT9A 2QA4G 2V9WA 2Z4PA 2NT7A 2Y68A 2XZTB 2NYIA 4KKOA 1MKPA 4BDPA 4BC7A 4ZIWA 3OMHA 1QTMA 8AT1B 1FQ1A 2E5GA 2F63A 1PILA 3MAAB 1IQZA 5F8IA 1U8SA 4O3NA 3NRSA 4QJVA 2Y2FA 3N5FA 5KA8A 4DL2A 3PR4A 1LW0B 3Q86A 4UY85 2XS7A 4RUBA 3BR8A 2W9AA 4I67A 3EYZA 4OJ1A 2VONA 3ENWA 2HVLA 2X3GA 1S0MA 1JLAA 2LA4A 3M6WA 5ADZA 1VHIA 1SJFA 1N33J 4YQWA 3QCBA 2NV5A 4GC6A 1HNXJ 2CQPA 4LRAA 3M8PA 5BR8F 4M5HA 1SH0A 4CH1A 2F8HA 1LEOA 3T5HA 3DLEB 4QR0A 3GJQB 4AL7A 1FO1A 1HWIA 1TK5A 1B0PA 2WBRA 1RT1B 2HHWA 1D9DA 1WDDA 4MJKA 3IR6B 2B49A 4FYDA 3CC7S 2VD3A 4DSLA 2DRDA 1XMBA 3M32B 4H1OA 3V0DA 3PM9A 5KG1A 2R3VA 2ZBQA 3IBWA 2HHPA 1FCAA 2F8EX 1TZ0A 3RGOA 3AJ2A 2I6OA 4DLGA 1D8ZA 1VQ7S 5IBSA 4LF9J 4X4TA 1YBAA 3JB9k 2UU9J 4M5KA 1YDLA 1VQPS 1KP6A 1B7FA 4FNIA 4DEZA 5B08A 2AU0A 3IWNC 5F8JA 4O4GA 1DQ9A 3KK1B 2X1FA 4JI7F 3BJYA 1H7XA 1RTHA 2HS3A 4C2MA 5DG7A 2E1PA 5FJ4A 5HI7A 1E6YB 3R8YA 2DCLA 4DL7A 4DFJA 2XNQA 1VQLS 2E7WA 1N5SA 2Y67A 1NMEB 2C3UA 5LSLA 2CM2A 5ETTA 2HQFA 3CD5A 3QCCA 4FKYA 4AE5A 1S6OA 2ZHOA 3FBFA 2PI5A 2GHVC 1NPRA 2HRUA 3HVWA 2VEWA 2JVOA 1RT7A 3NNAA 3H40A 2F4VJ 3PEJA 1K1QA 1ACMB 3F81A 2WTZA 2QV6A 1VBXA 1GX6A 4XPEA 3V0IA 1VBKA 2LXUA 4OI1A 2QDMA 1RYRA 3HDSA 4I2PA 2E44A 2A0FB 2ESBA 2PA3A 2XNRA 5J2MA 1TFWA 2WONA 4DSEA 5H9EK 1S57A 3EVMA 2CPJA 3JTPA 1RE1B 4DF4A 5A6WA 4HVZA 2IVYA 3LGMA 2YKMA 4P9SA 2ZHBA 2HCMA 2ZD1B 3V0EA 3JS9A 1HNWJ 2IAJA 4L3NA 1O8BA 1ZCLA 2ZVSA 3GILA 4ED1A 1Y00A 1BZJA 1FRJA 2QEPA 4GS0A 3LA0A 3UD3P 3QCIA 2LMIA 5GVQA 3I82A 4NOHA 3BGFA 1RTDA 2OAUA 5CCMA 3MM6A 1JLBB 3I0SA 1PYSB 1VBZA 3Q8RB 2OH2A 1JLCA 3QO9B 1Q6JA 2N3LA 3ZFVA 1UVNA 4GE2A 2JLFA 2B6AA 2NPFA 2GAGC 1NK7A 4N77A 2DNHA 4PG4A 3NAIA 2QT7A 2FGCA 2BKPA 2VORA 1D09B 3ZNUA 2LXIA 4DZ6A 4DX5A 1PJ7A 4J9QA 3BPSP 1N88A 1YHQS 3ONQA 2VOOA 4B3RJ 5BJRA 4KV8A 1IR2A 2GCFA 1DURA 3EVOA 3IAS9 3V6HA 2RS2A 2LQBA 2ATCB 2I3UA 1EQ0A 3OT9A 2XGQA 2E1MC 3ITHA 2LA6A 4C0HA 4F50A 1Q8BA 2KFYA 2F4FA 2ZC3A 4RW6A 1JMTA 1SJQA 4DX8H 1RGVA 3UDLA 3M8QB 4A8XA 4RU2A 2KYXA 4ECSA 1BWEA 5EWFA 3JTOA 4ZLNA 4RBTA 1Q7YT 4LBIA 5DZ6A 2R8KA 5J1EA 2FJEB 3R2DJ 4O23A 2PMWA 3DM2B 3MUVP 2ZM6J 1QUVA 2DIUA 2VDIA 1RCOB 1WOOA 1FEHA 4NEYA 4NPOA 3QCEA 1R0BG 5KACA 2BV5A 1RPMA 2I4EA 3GXHA 4OL8A 5C42A 2C2DA 2OTLS 1NEEA 2DHHA 3CCJS 4K7QA 3DRSB 4DPYA 2DR8A 5H9EJ 4W4MA 4LSLB 3QFWA 5HLFB 3NNHA 3VAIA 3OHAA 3B82A 2E5LJ 1YRUA 5K22A 3BSCA 4CLPA 4AQYJ 1JNRB 3UQSA 1FESA 1MWYA 3HX9A 5KTQA 4ZRTA 1S5ZA 5KA0A 2XY5A 2B4OA 1YI2S 3FBEA 5DLFA 2ZUGA 5E3QA 2ZOMA 1XXPA 3NMRA 1T02A 1GTHA 4MIWA 2YNHB 3D4JA 2CPEA 2RIJA 2DKOB 2HZAA 1G4CA 4X64F 2HNDA 2W2NP 1UZDA 3NP5A 3TVZA 3PVXA 4OFZA 2FH7A 3PRDA 1LNQA 3BF4A 5GMEA 4TU7A 3NAHA 1ZM2A 1PJ6A 2OEKA 3N6LA 2KJWA 1W2IA 3K5OA 3V0GA 2OTJS 1TUVA 1M1KT 4OIXA 4MK9A 3KJFB 2MKHA 5KT3A 3RW6A 3R2CJ 2D3OR 5FIIA 4X62J 3CJSA 4DR2J 2FHOB 2A2DA 2ZJPQ 4JI2J 3WC0A 5F9NA 4P52A 1OPIA 1FX4A 4UAGA 2J7KA 1BC6A 2AGQA 3RG6A 4P10A 4Z7CA 3VAKA 3M7VA 2HVEA 5G0RA 2ASJA 4ES3A 4PYHA 5T7LA 1KBRA 1ZPVA 1S6QA 1F2GA 2C1EB 2B4SA 5IBMA 4V1Ak 4RW7A 2WVBA 4LF8J 3RO1A 1NJZA 5AXNA 3GP9A 2ABYA 2RSQA 3BGUA 4I7FB 4K4VA 3K5LA 4F4XA 1XRIA 4UOGA 2RD5C 2HC2A 3A8JA 4N7TA 4BWJA 1XNRJ 2I8EA 3RRGA 3ENVA 3MOWA 4DDFA 2YQ0A 5IC6B 2LQJA 1L8GA 1XK8A 2A18A 2XMVA 1H72C 4XAKA 1ZAVA 2C28A 1UFLA 3JYTB 3OTEA 2JFKA 1EARA 3NRBA 3Q8UA 4WP8A 5RUBA 4FZVA 2V63A 1T3NA 1OHDA 1OSCA 1HBNA 4HHHA 3UCGA 4LMZA 1NKBA 4AYBD 1QE1A 3MWBA 4LF7F 3FZ2A 2NXNA 1UFWA 4P2FA 2HC1A 4WFXA 4PWDB 4JB8B 1RUSA 2IMWP 2H4VA 2J7UA 3OQ2A 2J76E 2OFHX 1TU0B 1MWQA 1N32J 3CE8A 3NGRA 4X65J 3MEEA 1UTAA 5KFRA 3W63A 3HM9A 1G1GA 4WF9Q 1WC0A 2RRBA 2CPDA 1Q6SA 1RWMB 2FVCA 2CDQA 1N52B 1P9QC 5F3TA 4IDKB 2DITA 3QIPB 1X9SA 3ZO7A 5D0EA 1WHWA 1PH0A 2MKYA 1RQ0A 3PZPA 2Y9HA 3POTB 3MZIA 1DY3A 2VJUA 3R1LA 2HVHA 1FPRA 4WCEQ 2VPWB 4QIEA 1HNZF 2P9GA 3HHKA 3GZ7A 1BHNA 1GFWB 5IT9U 1Q5YA 3Q89A 5GAEI 1N5YA 2A10A 2IRYA 5HROB 3L3CA 4DI6A 2ZOGA 4QR2A 4ETXA 4ES1A 4P71A 1RACB 3T1HJ 5KA3A 4DR7F 2UUCF 3BGLA 3UCUP 3DC2A 1S0OA 2H04A 1KHVA 2VKRA 5L1LA 5KA2A 1VJQA 3MR6A 1YZ4A 4RH9A 3AOBA 2J8SA 2ZBCA 4DN9A 1PC5A 4M5MA 2J17A 2W9CB 2EFOA 5EN1A 2EI5A 1H6KX 5AXKA 2WOMB 4KHPF 3KUHA 1L3UA 1XMOJ 4JI3J 2ROPA 4YB1P 2KL8A 1RTJB 5HAOA 2HWIA 2K7KA 4ZVFA 4EI2A 3PW7A 4Y2EA 2NUUG 3C14B 4GKKF 2ZKUA 3BSAA 1OY8A 4DV7J 2Z58B 1TL1B 2QTWA 2HGNA 2ZJQQ 4ICZA 3VR1A 3W2VA 3PJWA 2RJZA 3V6JA 4FXDA 4C9DA 5KFDA 3EICA 1DQ8A 2CNLB 2M9KA 4YR2A 1KHWA 1EEOA 5L9NA 3MECA 2DGWA 1SIWB 1TKDA 2DHSA 4QW9A 3KUEA 3RBDA 4B9NA 3H5UA 4HT7A 1MROA 1LWCB 4DFKA 4LSZB 3H2XA 4FYVB 2K2PA 1OYEA 3PCOB 1BE4A 4WE1A 4CO4A 3H4BA 3MMCA 2FJBB 3RBXA 1O5ZA 4HT5A 1GQYA 3GFXA 4IFYA 5H1SV 4JI1J 5K5MA 3GJSB 1T9UA 2OPSA 2R7WA 1NB7A 3VGTA 2D3UA 1HWUA 1NZAA 5U47A 2H3EB 1OY9A 2W4CA 4EMDA 1HWKA 5BYQA 2EFGA 2MGZA 4Q8FA 2RILA 5LJ3Y 3DMJA 3GU0A 3EB1A 1BQMB 1EEHA 3KLIB 4DL0C 2OI2A 2N4DA 1Z2LA 2COLA 4BPCA 5DJBA 3SSRA 2G2ZA 3DRPA 1U4BA 4A8WA 5AJ3F 3NCQA 1C2PA 2K1RB 2RF6A 4OJGA 4GVBB 5KG2A 4EYHB 1H38A 3I5CA 3EE3A 4GFVA 1QAXA 2POKA 2B9EA 2HMIA 1TL5A 3TAMB 4DQSA 4RPFA 1TMMA 1RT4A 3JAMU 3R5CA 3Q8QB 4DU7A 1D0EA 1RWWB 2VFUA 3ZMQA 3M05A 1M5HA 3NCRA 4LF2A 3VGSA 2XEXA 4USHA 1ZTWA 1FFSB 3UR0A 1Z2ZA 5GAEU 2WVDA 4KGZB 4NLVA 1CJKB 4OZ2A 3B54A 4ZOSA 2CMCA 1QAIA 1WF1A 1HBOA 3ZXWA 1I94F 2P9CA 1HQEB 2J9EA 1TUGB 3QIDA 3R5JB 2DD8S 2VEXA 3KNAA 1GMUA 2YWHA 5LJ5Y 3OW2R 1KSPA 1CJTA 1G7CB 2HNYA 2CXEA 3AH6A 5HBMA 1YSJA 2PEBA 1JX4A 2G4BA 3IN5A 3FRYA 3CCQS 4LFAJ 4WFNQ 2CPHA 1DFDA 5KFPA 4TY8B 4PQUA 1OJ4A 4NLRA 1VRUA 2CG4A 4UOHA 2AX1A 3GR1A 3L09A 3J7YI 4ZLJA 2MZSA 3D0HE 2FHJD 3NNCA 1GNKA 1TUWA 3ZL8A 3MMAB 2V2QA 4F0HA 1R6VA 3H0PA 1XM2A 2AZ1A 3PG9A 3TJ9A 2ASYA 2PIIA 2QFJA 4U95A 3KOAA 3QFHA 4OX8A 3TO8A 1UWBA 2R0BA 4V19J 1GT8A 2BQRA 2IDEA 2XG8A 2V34A 1S1TA 3KJVB 1SUQB 2HLTA 3QRRA 1RA6A 3E8OA 1HYSB 1U6ZA 4ZPVR 2EC2A 5IWAJ 1U47A 1AZSB 1V5IB 2NSBA 1TR0A 1GXTA 4AL5A 1HMVB 3M30B 2AGPA 3AA8A 3N6MA 4I2QA 5KADA 3PX0A 2BJEA 1VK3A 1RT2A 5E3CA 4K4ZA 3N0AA 3M8WA 3HK2A 4J9RA 1EB0A 1NSQA 3VVUA 3N9UC 1FRIA 4DUZJ 1S79A 4KE5A 2CQ1A 4ZLLA 2HFSA 3MPYA 4FP9A 4NA1A 1JKHB 1F3FA 2OP5A 4YDDB 2BIJA 3ULHA 5JXSA 1KONA 4PRFA 4MKAA 5B0DA 4W90B 1YGRA 3JSYA 2VEUA 3UCZP 3IG1B 2B07A 5LT5A 3GYGA 1VR6A 4CLYA 3IM9A 3I87A 2HVIA 1BXNA 2G2YA 2B43A 3WC2A 4RHGA 4LF1A 2C46A 3MUTP 2A2CA 3F41A 4NXNJ 5K24A 4M5DB 3CCUS 2L3MA 4X84A 4RUCA 3QRQA 1HW9A 2EFQA 1HBUA 2NSCA 3Q8YA 1EX8A 3TWZA 3DLHA 1B64A 3R7BB 4MK8A 1FRXA 3DU6A 4DU8A 2XLIA 2F6FA 3M2RB 2I4GA 1TKZB 3N2AA 1S1WB 3HP6A 1WJ9A 1HBMA 4ZK7M 5MLCV 2WSFC 3H90A 4DQQA 3ZTPA 4KO0A 2GQ2A 3MAAA 4KH1B 4MT1A 1R3NA 3BEGB 3QLHB 2XMJA 1OESA 3BO4A 1DZ5A 3KMQA 2QN6B 1DTQA 2JLEA 3SDEB 1R0CB 1U1MA 2ZHAA 1NB2A 1EP4A 5B7WA 5KAKA 2FVRA 3DLJA 3NG8A 2HQ3A 2UUTA 4IOBA 3K58A 3V6DB 4DV3J 3T9ZA 3MM8B 1QXKA 2GV1A 3G82A 1NL9A 2EKNA 4KH0B 4DR5J 3SV3A 2JNJA 2BANB 2VV5A 3J7YU 2YX7A 2BE9B 2JJDA 1PYNA 4LRFA 2DPJA 4ZDNA 4F2RA 2DISA 3HVTA 1FPZA 1WG5A 3W5ZA 4KTQA 2RNEA 4FXWA 5D0HA 4L6V3 4A8KA 4N56A 1HD1A 4LFCJ 1TQLA 3E51A 3LWLA 3D44A 3HSDA 2VQFJ 2AHOB 1LXNA 2J9DE 1GQQA 2MZTA 1O51A 4HJQA 1UJ5A 1OMSA 1PAUB 1W26A 3PYDA 4ZJLA 2NXCA 4U7UD 1RISA 4NLQA 2JDJA 4JI6F 3BBBA 3F56A 4DMZA 3KK1A 1OS5A 4I6YA 4WTOB 1SKUB 2HAIA 4RNOA 4GRZA 2JC0A 1WKJA 2CQHA 1P6TA 4D3QA 4QU7A 2V9KA 3QJLA 1D3WA 3J7ZT 3TVKA 3MR2A 1YJUA 1E6YA 2E7VA 2DR6A 3D28A 4ILRA 4RZRA 5D6GA 1B4SA 4D3GA 4MIAA 3DHWC 1U24A 2QLXA 2QGFB 5J2NB 1Q95G 2ALZA 3NS7B 1RTZA 3TW0A 2B9YA 2MKKA 1UJ6A 1FRLA 3OLBA 1Q82T 4R30A 5HQLA 3SMZA 4WXOA 1G2EA 4QU6A 1KVKA 5IM0B 3HLUA 2HK3A 4LF5J 1S12A 3QSYB 4NLWA 3KG1A 7FD1A 2A3KA 4IH6A 2CQ0A 4IOCQ 2Y0SD 5HVFA 1B70B 3M8RA 3DI6B 1JF7A 5HL7Q 4DHVA 3CXCR 4PEOA 3C46A 3J7Z5 5KA9A 2GJ2A 2D1CA 4BLGA 1N36F 4C8KA 3UWTA 4OX9F 1V5VA 5D78A 2FGOA 2HHXA 1JQGA 4YR8B 2JWNA 1YVFA 4B3MF 3GFYA 1TKXB 1FRHA 1F6TA 1TMJA 1SH2A 4E98A 4USTA 2B9XA 1M0SA 2VZ9A 3TP2A 1WC6A 1WTBA 4URGA 1IR0A 1RT6B 3DCAA 4JP8A 3HULA 2CQCA 2YXLA 2NZ6A 1RDRA 2HLUA 2J7WA 2EXUA 4RBUA 2V4JA 1BQNB 4RKKA 3VAGA 3DYAB 3FBBA 3LQVA 3MPUB 1N6QA 3D1QA 5DS7A 8ATCB 4OHYA 1T9XA 1IBLF 4FBTA 3S6EA 1FRMA 3K2YA 4N41A 3CTRA 3E01B 1K9MT 2BZLA 1YJ7A 3IFEA 2OMLA 4ZCIA 1NXIA 2O3DA 4QBUA 3VGVA 2FDNA 2I9SA 1S6PA 4DV5J 3S8SA 3R1HA 2WBMA 1P8GA 2AKWB 3FSYA 2C42A 3C2PA 1PKUA 3U1MA 3TOQA 4UQTA 4RL1A 1LWEB 1WHXA 3CF5Q 1UWAA 1JK9B 1JLEA 2DGSA 2IRUA 2IA6A 1G4WR 2UV8A 4ERDA 4C8LA 1PYOB 2B8PA 2EFPA 2E9TA 2ILZA 3TVYA 4OYZA 4B3OB 2H5JB 2XCPA 1AAXA 3J81Y 1R0AB 1HQ2A 1CS4A 5DETA 3IM8A 4YUDA 4C97A 4USUA 3IRWP 4WU3A 2ZE2B 1UAWA 2HNZB 3MEGA 4PYAA 1OHEA 3CDAA 2YNFB 2E5JA 4GVLA 2PD1A 3R6LB 4QZVB 3CPWR 5CHCB 4DV1J 1N0UA 4JYAF 5D3GA 3ZZZA 4J9KA 3OVAA 1REVB 2I4HA 1XWLA 3DRSA 1RBAA 2XMWA 1QTNB 2UUOA 1OEVA 2R4FA 4MK7A 4KR0B 3LP0A 3UDCA 2FJMA 2BABA 3DOLB 5A8RB 1W7WA 3OTOF 5B0EA 3FQLA 2F71A 3LP1A 5FDLB 2HQCA 2HPUA 2DO4A 2JC1A 2ZH8A 5A8KB 2BRLA 3UNGC 4RW4B 1RBOB 2GGPA 3AD9C 5C7PA 3CJKB 4F25A 2QL7B 1WSVA 4H4KA 4ZCLA 4ZIVA 3BR9A 4P72A 2CWXA 3O5XA 2ACMA 2DYAA 2C3MA 2BJ1A 2IPOB 4LUBA 3AOCA 5LSRA 3W1YC 1D9AA 2AT1B 2MDAA 3P8BB 2HIQA 2MZRA 3HVRA 2P6SA 2HVDA 4QBEA 4NCAA 4NA3A 1VYAA 1NCLA 3AA9A 3EXYA 2H9ZA 4DUTA 1UVLA 4QCLA 1NPKA 5IV4A 4QBWA 3Q8PB 3G87A 2XPCA 4HV4A 2M0GB 3CCZA 1ZETA 3TUJC 4X4SA 1X8DA 1FF2A 1SVDA 5B0AA 4C11B 2YNIB 3I4PA 3MM5A 5J2QB 4HACB 5BR8J 2DXDA 3PYEA 1RABB 3MEDB 4H4MA 3UN3A 2VPYB 3W2WB 1VS3A 4MTPA 3TARA 2C3YA 3ZM5A 5KA4A 4DL6A 1Y11A 1NJIT 2VH7A 3UDEA 4IG3B 4OMFG 4NX8A 2RH3A 3QWUA 2VBZA 5HJXA 4IQXA 2IJFA 4XK8C 1XR5A 2OLWA 2YY3A 1ZZFA 4ED8A 1ZYQA 2Y1RI 5EWGA 2NYHA 3ZZTA 1YN9A 1F1BB 3D3BJ 2MXYA 2QLJB 1CSJA 1G4US 2JOQA 2FJNA 3MXHP 2QDPA 1GXLA 1ZBTA 4NI2A 2F3JA 2EPIA 4BUCA 4ZJOA 2AEFA 1D8YA 4DR4F 1Y5LB 5ETSA 1IM6A 2GQCA 1H2VZ 5KFOA 4JI7J 1IKWB 2KHDA 4EK2A 1FK9A 1IWAA 1U2RA 1RAEB 3R7SB 2PFFB 2LFVA 3LH2S 2CZVC 4P2SA 2H48B 4DR1F 1T95A 4FF3A 3QCKA 3OR1A 2VBWA 1CJUA 2DRBA 1Q4RA 2M52A 5E3RA 2P8IA 4OX6A 3QWPA 4G1IA 5K8PA 4L72B 3SXLA 4IKAA 3GG0A 4KI9A 4YHHF 2EG1A 2B56A 3D54A 5ETPA 3L4BC 1FD2A 4YOEA 4PZVA 3A5JA 3R9LA 5KAAA 1HHQA 3QIPA 3M2VA 3POTA 4ZP7A 3OLRA 1JLFB 1H2UX 5LXRA 2I6JA 1SKWA 3TZXA 2CVIA 2OMOA 1LK5A 2YX4A 2M8DB 3PJ9A 3PHTA 1Q16B 3W8GA 1FXRA 2QLBB 4TLQA 2M88A 3QT8A 5HROA 3GXGA 4HKQA 3GCXP 5K8OA 2IDLA 5K9FA 1MWZA 2CPFA 1PTTA 2L9DA 2J6UA 3A12A 2PBNA 4LVOP 5ETQA 2FJXA 3M8SA 4PXCA 3TANA 2LXFA 5CYMB 3FEYB 3MOZA 4UF4A 3T1AA 3S3FA 2ZH6A 4TU8A 4QUMA 2W9CA 4NWFA 3CDEA 5JVHQ 4YP3A 1JJCB 2RE1A 3MOJB 3K8VA 2AM2A 3DHXA 2WOMA 4WXWA 1FWPA 2XSJB 4R0EA 2ZEJA
chains in the Genus database with same CATH topology
2BE2B 2LQBA 3N5BA 1U45A 2I3UA 1A9NB 1ZM4A 2XGQA 2JFDA 4MFBB 2EVZA 2W25A 2E1MC 3ITHA 1M5VC 2LA6A 4ED2A 4C0HA 3FFIB 1EETB 4LVNP 3OVBA 4F50A 1Q8BA 4XDDA 2KM8B 3VAHA 2KFYA 2JEJA 3AB2B 2Q05A 2KXHA 1FKAF 2Q1LA 2ZC3A 2UVVA 4RW6A 5KA1A 1JMTA 2DR5A 5AE2A 3QCDA 3T5LA 2DH9A 1R8HA 2M8HA 1ZH5A 1SJQA 2Z2MA 4DX8H 2C2EA 1RGVA 4KGKA 2V2KA 4KRWA 3ZZYA 1MSWD 3UDLA 1ZZWA 3KFWX 3O4UA 4UUXA 1NHVA 3M8QB 4QIWD 2V4RA 4DS5A 4DL5A 2RKIB 4A8XA 1MU2B 3LGNA 4DG1B 4A8YA 3I5AA 4RU2A 4KB7A 2KYXA 3BGRA 2E5HA 3EXCX 1Y9OA 4ECSA 1UWBB 3QZ7A 1BWEA 1OEUA 2GO8A 3M2UA 5EWFA 3MR3A 3H8YA 3V0GA 2B5JA 3DOKB 3JTOA 4RH5A 4OZNA 3DRXA 4RBTA 5CYQB 2XZWA 1Q7YT 3VAMA 3DRRB 4TY9A 1I9TA 2R8KA 2EFNA 4OLPA 5J1EA 2C3PA 3H2LA 3T3FA 3TNVA 2Y96A 2FJEB 3RYLA 1S6UA 2OPRB 5KFJA 4O23A 3G8TA 3QGIA 1CLFA 4ELUA 3DM2B 3OJSA 2HRYA 3MUVP 1ONYA 2FJDB 1KQFB 4K5SA 1QUVA 2IVMA 2UXBF 2DIUA 3F9BA 3O44A 5KA7A 1PXHA 2CPZA 1CQMA 1FEHA 2KZZA 1FKPB 4LQ3A 4B08A 3CJ5A 4GMKA 4NPOA 3QCEA 1QVFR 5KACA 2BV5A 1RPMA 3MM9A 2DHGA 1OIAA 1OETA 2EFVA 1NNYA 2P9EA 1NAQA 1K8AT 2I4EA 4I2QB 1ELOA 2ERRA 1Q6NA 3GXHA 2WK4A 1S1XB 3EX7B 5HMYA 3QJPA 1I1GA 3LAKA 4OL8A 1VIXA 4C8MA 2J0XA 5C42A 3R27A 2X1AA 3GQCA 2HB1A 3S3EA 2C2DA 5F8NA 3RGQA 1WF0A 4LIRA 2QA4S 1Q86T 2OTLS 5EGYA 4LIWA 4ZN5A 1NEEA 3DN9A 1X9WA 3CCJS 3BDPA 3DRSB 5D4OA 3HKZD 3EPGA 2I6MA 1IM4A 1OO0B 3RAXA 4ZPTR 1R27B 2DR8A 4TLRA 2B3OA 2I42A 4RW8A 5H9EJ 3OJUA 4LSLB 2XWYA 3OPKA 3EAXA 3DLLQ 1TV6A 3G71S 2MQQA 5HLFB 3FMBA 3NNHA 3VAIA 1F0XA 3EPIA 3OHAA 3DI6A 1VQKS 5I4MA 3B82A 4I8NA 1SC6A 3OXFA 3PV8A 3H5XA 1YRUA 2XI3A 3PW4A 4XIUA 3BSCA 5K22A 1Y5IB 4IQMA 1X5OA 4H4OA 2YH0A 3FEXB 1HWJA 4Z6BA 1JNRB 2HYIB 2RF2A 2VC1A 5A0YA 3UQSA 3VQSA 5DDRC 2HFNA 3O8WA 3SQGB 3OR2B 1T7PA 1HFEL 1PA1A 2F6WA 3E3XA 3EUNA 3P5TL 5GAGI 1FESA 5C5JA 1MWYA 3HX9A 3L7OA 3AQPA 4JI5F 2KFZA 5KTQA 2LQ5A 1VQOS 2CNIA 4ZRTA 1YJNS 2KTQA 1BZCA 1FERA 5KA0A 4CO3A 2XY5A 1JLQB 1P1LA 2B4OA 1X4HA 2CYYA 2DHAA 2OPPA 4NCGA 4RWWA 3JAMY 1YI2S 4DGPA 4IRDA 2K1RA 5SUHA 5KFBA 3ISNC 2HW3A 4OZ1A 5DLFA 4EBCA 2ZUGA 4I56A 4OJHA 4PPDA 5E3QA 1HHTP 3D1HA 3R5BA 2CJQA 1TKXA 4U67Q 2XWXA 5KFNA 5KT7A 1C84A 2ZOMA 1XXPA 4E8UA 2QRRA 1T02A 1GTHA 3NMRA 4MIWA 2YNHB 1Z4UA 1CC7A 3MCSA 1VLYA 1YGYA 5DG8A 2I5XA 4HJPA 4NYPA 1XR6A 2CPEA 4WK1A 4CO2A 2FUG9 3HFKA 2RIJA 3TAMA 1G7GA 1G1HA 3RU0A 1HI0P 2LQ9A 2ROEA 4CCHA 5F0WA 4X64F 1DLOA 2HNDA 3NP5A 4CH0S 5K14B 3TVZA 1S9GB 2YWFA 3HVAA 3PVXA 3CIMA 3IS9A 4OFZA 5L39A 5C24A 2GP0A 2FH7A 3PRDA 3S4EA 2CQIA 4DV6F 5EHRA 2GJTA 3GV7B 2AV5A 4M63A 2XMUA 4OI0A 3BF4A 2MJUA 4LF8F 3IA0A 3RZ2A 3GSDA 1UVKA 3Q0AA 1N33F 1BQNA 2MQOA 4TU7A 2ZOFA 2I3RA 4N8OA 3GE9A 2W8KA 4KFBA 2BXJA 3NAHA 4ATNA 1ZM2A 2DNMA 4R0JA 5C25B 4DWIA 3DYAA 2IM