4WU2A

Structure of the ptp-like myo-inositol phosphatase from selenomonas ruminantium in complex with myo-inositol-(1,4,5)-trikisphosphate
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
313
structure length
313
Chain Sequence
TVTEPVGSYARAERPQDFEGFVWRLDNDGKEALPRNFRTSADALRAPEKKFHLDAAYVPSREGMDALHISGSSAFTPAQLKNVAAKLREKTAGPIYDVDLRQESHGYLDGIPVSWYGERDWANLGKSQHEALADERHRLHAALHKTVYIAPLGKHKLPEGGEVRRVQKVQTEQEVAEAAGMRYFRIAATDHVWPTPENIDRFLAFYRTLPQDAWLHFHSEAGVGRTTAFMVMTDMLKNPSVSLKDILYRQHEIGGFYYGEFPIKTKDKDSWKTKYYREKIVMIEQFYRYVQENRADGYQTPWSVWLKSHPAKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myo-inositol phosphohydrolase
publication title Structure of the PTP-like phytase from Selenomonas ruminantium in complex with myo-inositol-(1,4,5)-trikisphosphate
rcsb
source organism Selenomonas ruminantium
molecule tags Hydrolase
total genus 110
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 3.1.3.8: 3-phytase.
pdb deposition date 2014-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14566 PTPlike_phytase Inositol hexakisphosphate
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1690 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4wu2A01
3.90.190.10 Alpha Beta Alpha-Beta Complex Protein-Tyrosine Phosphatase; Chain A Protein tyrosine phosphatase superfamily 4wu2A02
1G7GA 1U25A 1Q1MA 2HVLA 2NT7A 3F9AA 1BZJA 3QKQA 2CM8A 2I6IA 2I4EA 3SMEA 3QCHA 5IBMA 4WTYA 4RKKA 2I6PA 2QBPA 2Q47A 4BPCA 3O5XA 4ICZA 2CM3A 2BIJA 2I6JA 4GRZA 2H04A 1V3AA 2Y2FA 1RXDA 1L8KA 2ESBA 2I6OA 1A5YA 1Q6TA 1Q6MA 2RF6A 3I36A 3V0DA 5K23A 1AAXA 2I4HA 1C88A 1I9TA 5KACA 4GWFA 1P15A 2C7SA 2PA5A 4NX8A 1MKPA 1C86A 3OLRA 1YPTA 2F46A 2FJNA 1KAVA 1RPMA 1OEVA 4YAAA 3EU0A 1NL9A 3BM8A 4OHIA 3MMJA 4J51A 2GJTA 1XRIA 1QZ0A 2B4UA 1WRMA 1OHCA 5EHPA 3ZV2A 3A5JA 3QCGA 3D1QA 2CFVA 3D1OA 2VEYA 1NZ7A 3QCEA 4WOHA 2QEPA 2Q05A 1G1FA 4QBEA 1PTVA 3AWGA 1FQ1A 5K24A 2F6VA 2HCMA 3RGQA 4RI4A 5K25A 2J16A 1L8GA 3ZMPA 3QCCA 3BRHA 1LYVA 2I42A 1QXKA 3V0IA 2BZLA 3S4EA 3ZM2A 1Q6SA 1BZCA 1YTWA 2GWOA 2CNHA 1OESA 2F6WA 2QCJA 3QCBA 1PA9A 2HXPA 3D9CA 1FPRA 5KA8A 1KAKA 1G1HA 4OHHA 2OZ5A 3SR9A 2QBRA 4GFVA 2JJDA 3RO1A 3ZMQA 1X24A 2OOQA 3AWEA 2CJZA 3S3FA 1G4US 2G6ZA 2QBSA 1EENA 1VHRA 1M3GA 1T48A 4H1OA 1PA1A 2HNQA 3OMHA 2BV5A 3QCDA 3V0EA 3F81A 2H4VA 2QDPA 5KA1A 4KI9A 1I9SA 2QCTA 2VEXA 4Y14A 5GTJA 4OHLA 1SUGA 2QDCA 3QCIA 4QAHA 4JMKA 1PH0A 2I4GA 2F70A 2VEVA 3S3KA 4H34A 3BLTA 4AZ1A 2H03A 1XM2A 2H4GA 5K22A 2CMBA 2E0TA 4Z6BA 4D3PA 1GWZA 2NTAA 4GFUA 4GRYA 2CMCA 5EHRA 4RDDA 3QCFA 2I6MA 4HJPA 5LXQB 4YR8B 1ONZA 4OHEA 3S3EA 3V0FA 5AWXA 1U26A 1ZC0A 3MOWA 1G7FA 3S4OA 1PYNA 4RI5A 3S3HA 2QBQA 4TVVA 1I57A 2GP0A 1XBOA 3RGOA 2B3OA 2I3UA 4NWGA 5BX1A 2NT2A 3ZM3A 1C85A 2B49A 1C87A 1NNYA 3RZ2A 3EB1A 4KYRA 2DXPA 1PXHA 5BUGA 5KA7A 3A5KA 4JBCA 2FH7A 3V0JA 1PTUA 2PI7A 4R0SA 1Q6PA 4DGPA 2VEUA 2B4SA 3LJ8A 1YTSA 4HJQA 1Q6JA 5KA9A 3F41A 2WGPA 4Y2EA 1D5RA 1LARA 2NV5A 5MMZB 4S0GA 1OEMX 2I5XA 4RHGA 1ZZWA 2SHPA 4GE2A 2F6TA 4MBBA 2BGDA 3ZM1A 3I7ZA 4ZRTA 3D44A 1YFOA 3F99A 4QUMA 1JF7A 4GS0A 4NYHA 1WAXA 4DGXA 1ONYA 5M43A 1WCHA 2Y96A 4NWFA 5KADA 2HY3A 3V0HA 4ZI4A 4D3RA 5IBSA 3I80A 4ZN5A 2YDUA 5BZZA 2P4DA 2QDMA 3GXHA 1T4JA 1ZCLA 1U24A 3QCMA 4JNBA 3ZM0A 2CNEA 2F6YA 5KA4A 3O4UA 4I8NA 3AWFA 2IMGA 4RH5A 1YGRA 5KA2A 4BJOA 1OETA 2G59A 1YZ4A 5K9VA 1YWFA 2MBCA 4JMJA 2F71A 1BZHA 4B04A 5KAAA 4ERCA 1C84A 2PSZA 5K9WA 3O4SA 3H2XA 4R30A 4WU3A 4D3QA 1NWEA 1OEUA 2I1YA 2HC1A 5BZXA 2ZMMA 4HRFA 1JLNA 2A3KA 4WU2A 1Q6NA 2J16B 2PBNA 3U96A 3QCLA 4IKCA 1OHDA 2F6FA 2R0BA 2BGEA 1G4WR 2CM7A 2CMAA 4R0TA 2J17A 1FPZA 3EMUA 5KA0A 1PTTA 1LQFA 1YTNA 3M4UA 2P6XA 3PS5A 2I75A 1XXVA 2B4OA 3GXGA 4KYQA 2PQ5A 2HNPA 2CNIA 2B07A 4OHDA 1PTYA 1G1GA 1NO6A 3BLUA 4QAPA 5KA3A 1GFYA 4NNDA 3D42A 2ZN7A 5KABA 2CNGA 3EZZA 4QBWA 2B4PA 2A8BA 3CWEA 2OUDA 5I6VA 2CNFA 2NLKA 1EEOA 3F9BA 3N0AA 2AZRA 3EAXA 3V0GA 5J8RA 2M3VA 3QKPA 3QCNA 4GE5A 2VEWA 2FJMA 3D1HA 1C83A 1ECVA 1R6HA 1YGUA 1ZCKA 4PVGA 1J4XA 3QCKA 4PYHA 4QUNA 2HC2A 4RH9A 2HB1A 1T49A 2AHSA 3QCJA 5HDEA 3MOZA 2CM2A 2I3RA 3O3LA 1OHEA 1OEOX 4GE6A 2OC3A 2C46A 2H02A 1XXPA 2NZ6A 3NMEA 3O4TA 2F6ZA 3CM3A 1YN9A 3B7OA 2PT0A 1NWLA 2H4KA
chains in the Genus database with same CATH superfamily
3J7YI 2R7UA 1FWPA 2EPIA 2L9NA 2OPPB 2PEBA 2XCPA 4JI1F 5D0HA 4WYWA 4ECUA 4RKKA 5KG2A 4BPCA 1REVA 1S0MA 1RWVB 2WHOA 2KHCA 4EYHB 2CZ9A 1N5QA 4I2QB 4DPTA 1JLFA 4ZHRB 3KHHA 2QV6A 1VQNS 1NSPA 2E9RX 5KACA 5HAOA 4OV6A 1HNVA 1WC0A 4X62J 3JYTB 1S1UB 1GQQA 3BBBA 4GWFA 1F1BB 4I2PA 3T5JA 2UXDF 1QSSA 2FB0A 4YAAA 1ZM2A 4B3RJ 4LF9J 2WAQD 3A4TA 3E2EA 2QA4G 4DSEA 1OJ4A 3EXYA 3TOQA 4BCAA 1WRMA 3GYGA 2KRRA 4OYAA 2P5VA 3I0SB 2QSWA 4ZVTB 1TK0A 2AJ2A 1Q95G 1DURA 2A1BA 1G1FA 2C2ZB 4JI5J 3RB0A 2WB4A 3BRHA 1N34F 4Q45A 4ZKAA 4H4KA 1LOUA 2DGXA 3PX6A 1BZCA 2DIVA 2GWOA 4K4UA 1E0DA 5T7LA 3KJFB 4O3SA 1WF2A 1JK9B 4JI3J 2R2RA 3H7HB 5E41A 3LAKA 3UDLA 1HBNB 5D0GA 4ZCLA 3ZC4A 1QUVA 3FEYB 4B3TJ 2ZHOA 3NRBA 1VHRA 3RBDA 3OMHA 1WC1A 3Q22A 3V0EA 3DXSX 2H51B 2GNKA 4JI6F 2GCAA 2D7SA 2JEFA 1RT3B 3QZ7A 5HL7Q 2I4GA 1WSRA 1JXVA 4EZ9A 3J81Y 1B3TA 3IM8A 3ZNJ1 3ISNC 5B0EA 4ZLJA 2V67A 2J7KA 4IG0A 1S1WA 4WJBA 2LLZA 3CJRA 2CQGA 2FHMA 4DJBA 4MYUA 4B3OB 1XNRJ 2J76E 1RTJA 3ICLA 3C3LA 1AT1B 3P8BB 4X65F 2GP0A 1EZZB 4ZMMA 3DCAA 1X7VA 3U7JA 4DR4J 2KZMA 1XBWA 4LR9A 4DXLA 3A5KA 2HNDA 2DY1A 1EKRA 2HS4A 3I32A 4ED2A 3EE3A 1AB8A 3DOLA 1FT8A 4YMEA 4LF4J 1S6QB 4ZPVR 2KXHA 2CFXA 2CG8A 1F3FA 1NKCA 3LP1A 2EFVA 5D4NA 4ZPCA 4DX6A 1YIJS 1NAQA 3SCKE 4RWWA 3MAAB 2H1YA 4M5DA 2GGPA 2SXLA 2K3IA 2ASLA 1EEHA 2DHAA 3KXDA 3FCVA 1M90T 4KY3A 2OLWA 4RW4B 2HY3A 2XSJA 1M5HA 2ASDA 1HBMB 4J9PA 1TUGB 1S7HA 2PC6A 1E8CA 2V2ZA 2EG2A 4LF6J 3QCMA 4HHUA 4JNBA 5A76A 3ZM0A 1Q0NA 5IV4A 4UTGA 2HS3A 5ETRA 3H20A 3IC1A 1Q8LA 2R7QA 3NCPA 1KDNA 5AE3A 2F71A 6FDRA 2BR0A 3O4SA 2PA8D 1HQUB 5HVHA 2FDNA 2HFOA 4DF4A 1S57A 1RT7A 1OEUA 1RWKB 2ZBPA 3L7UA 4KYZA 1T95A 3N0VA 3OTOJ 5U47A 4LRDA 4J9KA 5LM7E 3VGUA 3D6TB 3MURP 2J16B 2MJNA 1NH7A 2O5DA 1U1LA 3LP2A 5CD4H 5CYMB 4KR0B 1GMUA 1GMVA 2BABA 3DLHA 1WJ9A 3S8SA 2RKIB 4CM2A 2GS8A 2QL5B 4X62F 2BDPA 3WX4A 4UY8T 5DDPC 2Q66A 2UVVA 2AT1B 4B3RF 3ENQA 4Q8EA 5CQGA 4NLWA 3FRZA 3IFEA 4N8OA 1WOOA 2LFVA 3MAHA 4X4VA 5EHHA 1D9DA 4L6V3 3IMQJ 1SC6A 4RO0A 2R3VA 4TLRA 1F0XA 2P9GA 2BQ3A 4DDFA 3BPSP 2ZH5A 5E7OB 2CM2A 1U8WA 2IHR1 5C25B 4DL0C 4JV2A 2XHWA 1K8AT 1GXTA 1Q5VA 1QD1A 2W7OA 1YDLA 1RWNB 1XIQA 2MGZA 2HS0A 2UVUA 4AUKA 2LCWA 4B3TF 2QMWA 2QBPA 4PXEA 3SSSA 5ETQA 1UEKA 1NRKA 4K4WA 2F40A 3D4JA 3TAPA 4ZN1A 2FVPA 5GAEI 3DM2B 4OI1A 1FRLA 1A5YA 3PW7A 1SV5B 2KZZA 1KWMA 2AHOB 1HWLA 3ETOA 4USVA 2O3DA 3AY0A 4P2SA 3GJQB 2FLOA 3P5TL 2GVZB 5IM0A 4DWIA 2GJTA 2GCFA 4YY3J 2Y68A 3R5DA 4FBUA 4HDGA 4WOHA 4M5JA 1XNRF 1NK8A 3CJKB 4A8WA 2WJPA 1R8HA 2JVOA 2F9DA 5ETPA 2CPZA 5KG3A 2N82B 1IKVB 3NCQA 4NLXA 5D77A 4DR4F 3MM5B 4M5KA 3VGVA 3OBIA 3CMQA 1Q6SA 1T9UA 5KFRA 1XR6A 1WTBA 1FNOA 2IMOA 3HVWA 4DX7A 2MY7A 3DOMA 2MB0B 3KLGA 2VU5A 4LF4F 2GW8A 4J9RA 2Z2MA 3LQVA 3K8WA 2WOMA 2FJAB 4CLSA 3LAMA 3OL6A 2QN6B 3CCZA 4FVMA 2XWYA 5H9EK 1UFWA 3OTDA 4U7CA 3TX8A 1MROA 3HJFA 4Y14A 5GTJA 3N79A 2UAGA 1F5AA 5DETA 2OUGA 2GMJA 4CT9A 1LWCB 2UXBJ 4B9MA 2AZ3A 3PKYA 2RS8A 3SV4A 1J27A 2CMCA 3OL9A 3TAMB 1CJKA 1FKOA 4G1PA 3A1YG 3MPWA 3FFIB 3WX8A 1SUQB 2VICA 2LQ5A 4A8SA 2FC8A 2DCUB 4G1QB 5EN1A 2I3UA 4KKOA 4CTAA 3T3FA 1TVRA 4DU7A 2YWEA 5BUGA 3MEEB 1F5BA 2VFUA 1SBRA 1JJCB 1R8CA 5BYRA 2X5OA 5B09A 3R5BA 1T03A 4QIVA 3N5FA 3FQLA 3BYRA 2R42A 3JTNA 1NBEB 1TUVA 2OI2A 3F41A 3C15A 3OTOF 3Q83A 3QGHA 4KPCA 1YBTA 2HHHJ 3BEGB 2MXYA 1GMWD 4ZIVA 4GE2A 2BYCA 1JBVA 2K06A 2KRBA 4H4MB 3D67A 4ZRTA 1GX5A 4ECQA 1VRQC 2JFFA 2RILA 1ZA1B 1ONYA 4WXWA 1GXLA 2B8PA 2FC9A 5HROB 4D3RA 5H9FK 3I5BA 2OPSA 3G6VA 3M1VB 3BB5A 1RT5A 3D5MA 4L74A 3BR8A 4G1IA 1T3NA 3I0RB 2XM3A 3QO9B 2J6SA 3PRVA 4OYZA 2HHSA 1VRTB 2IIHA 3PR5B 4YDDB 1SJQA 3ADAC 4PXDA 4ZVOB 3VV2B 2HAIA 2C3PA 3KLEA 4F8RA 4OLPA 3MCNA 2Z8QA 1HBUA 3HULA 1OETA 5K9VA 1KLMA 2DYAA 4MK9A 4KGKA 3PRDA 1N4LA 3ZZPA 4PG6A 1FRXA 3HCXA 3AJ2A 5A8KA 2ZBCA 4NYZA 4KHPF 2NXEA 2ZMMA 4OMFG 1NPPA 1I3OB 4WZQA 2WVCA 3QCLA 2WTZA 5C2CA 2BGEA 3RBZA 1V5VA 3MM9A 2CM7A 3TVZA 4PQUB 4QF5A 3TNVA 2DR5A 3G86A 1DLOA 2I6WA 3QGPA 2GCBA 1RSCA 2J9CA 4WKYA 4DSKA 1F2GA 3MM7A 2R7TA 3FBEA 1GH8A 4A4JA 5KABA 3AA8A 2XGQA 3SQGB 1Q8KA 4ZCKA 4PG5A 7AT1B 3A8EA 4Q44A 2GX8A 3KWMA 4YY3F 2GHVC 2WBMA 1EEOA 4LBHA 3IRXB 2J8AA 5D78A 1U0SA 2IC3A 3WHIA 4ZIYA 2NXCA 1RA6A 2P8IA 4MKVA 1C1BB 5IZHA 2DNNA 1YGUA 2HK3A 4OI2A 4PYHA 4ID5B 1ZS6A 2JFDA 1KQKA 3V81B 5A2QU 4ANDA 2XS7A 2ZH3A 5B08A 2POKA 1YN9A 3WIUA 5HO4A 1VQ9S 2HVLA 2NT7A 4RUCA 1Q5YA 3PR4A 3I82A 4OHXA 3VZHA 1UWBB 2XCAA 4OJHA 1WI8A 2HQDA 2QMUB 1ZM3A 5KFZA 3CDEA 3I36A 2BRKA 1RWOB 1S48A 2JVRA 2G2OA 4NOHA 3G8TA 1WHYA 2UXBF 4DPYA 2I5JA 1Y10A 1FRJA 1RAJA 2F46A 1UPPA 3CJ0A 4AL6A 4IFVB 4DG1B 1S1XB 1MWQA 3D54A 3DU5A 3QAEA 4X4PA 1FF2A 2W2MP 3TZXA 1PCAA 3A5JA 1X9MA 4ILMA 2CFVA 1U1QA 2YKPA 1O5JA 4OX7A 1HL6A 3HN7A 4DSFA 4RW8A 4M5GA 3KG0A 4V1Ak 3BH6B 1L3KA 4JI2J 4LIWA 4RI4A 5LT5A 2M70A 4OYWA 3V6KA 5F8NA 3OLAA 1B0PA 3V0IA 1FX2A 4YOEA 2FJEB 5HVFA 5LSOA 3BDEA 4DL7A 4QPTA 5M2PA 3GYNA 4GFVA 2FVSA 4PQAA 1FJGF 2HHHF 1IR2A 2NSCA 3FMWA 1LW2A 3MM6A 4C7QA 2BKNA 3NNHA 2L3MA 2KM8C 4CVLA 3FSYA 3CJ2A 3FEXB 1PA1A 2D3O1 2F7VA 5CH7B 4JV5J 3CB4A 2RRAA 3QGIA 1Y5NB 4A46A 2UP1A 1XNQJ 1KOHA 4YB7A 4KPYA 2LA6A 5D4PA 2VEVA 2ZHBA 1Q53A 1M5PC 3NOGA 2RDDA 2DXEA 6FD1A 2L41A 4LR8A 3KMQA 4WIIA 3PVXA 2M3DA 2ZH1A 1JLQA 1H7WA 3S4OA 4RI5A 4HH0A 1FRKA 1M5VC 1T9YA 3RBEA 1NHKL 2QC3A 4PR6A 2OPPA 3CD5A 1TELA 4J91A 4CO0A 1PXHA 1SQGA 4ETXA 3ELHA 3FCWA 3M9NB 5LJ3Y 4K2JA 4I2QA 4J9NA 3Q2TC 3SMZA 1WHWA 2KFNA 4ZHRA 4DGPA 3QFWA 5A8WB 4JI4J 2A0FB 4DFMA 3RW7A 4ZDNA 4IO1A 3JYTA 1S1UA 3HVTB 5F8JA 2AGQA 2XMJA 2R8KA 2I5XA 1VHFA 2DHXA 2DR8A 4URQU 4KTQA 1NMEB 1JLEB 3W65A 3BREA 3GQCA 2F8EX 3GR1A 3I0SA 5D4LA 3FK4A 2VTDA 3NGUA 3TI0A 4NYHA 2XZTB 4K7QA 4BC9A 4USUA 1APSA 4ZN5A 2LVWA 2F4VJ 1VK3A 2XY5A 4JUZA 3BSOA 3OUYB 3ZTSA 4DV3J 4LIRA 1C4CA 4YHHJ 5E3AA 1HBNA 1YGRA 4BJOA 1MMDA 4WTOB 3NAHA 1VR6A 3CCUS 1UETA 2RQKA 1UTAA 4PXBA 1BZHA 1CJTB 5F3ZA 4ILRA 4RNOA 2PMHA 1S76D 3W2VB 5DJBA 1RT3A 3IWXA 2I1YA 2DH9A 2LQ8A 4K4ZA 4DBQA 1B99A 4F3QA 1RHKB 4OQJA 3A8JA 4CP5A 3K59A 2UVRA 1IBLJ 4H4OB 1V3SA 3DLGB 4O3NA 1AFIA 1FFGB 2B5JB 1LQFA 3FSXA 4B3OA 2YNGB 5AE2A 2AW0A 4KYQA 1FDDA 2IBKA 3IWLA 4NLOA 2E5IA 3D28A 3RAMA 3NWRA 3HT3A 4F4WA 4QAPA 5KFXA 3HHLD 3GWCA 3HKWA 5L1LA 2ZN7A 4MKYA 2ZH8A 3CJ4A 2HHTA 2B4PA 1C0UB 4EEYA 1RT2B 2I9SA 4ZP7A 1OYDA 2CNFA 2ZE2B 3R7NB 3O44A 4NLRA 1S6QA 3AD8C 2L9DA 2ROEA 1NK7A 4OZ3A 4JI2F 4HLBA 2VQEJ 2KN4A 5CXTA 2VEWA 4XDDA 2X3DA 4KC5A 4KGVB 5K14B 3KK1B 3MAAA 1ZCKA 4OYXA 3P6YC 2EBEA 2HC2A 3OR2B 2QFIA 1UJ5A 3MOZA 4PXCA 3T19A 3V6DB 7FDRA 2H02A 2YWGA 3GV8B 1LWEB 1NM2A 4NLGA 4RW4A 2W9BB 2YWKA 2P9EA 1HBMA 3G6ES 3CCVS 2CM8A 2JEGA 2R7RA 1R31A 2DNOA 2C28A 4LRCA 5FJ4A 4JV5F 1N54B 2QSFA 2ZDPA 4IFYB 5HMZA 4GC6A 4GRZA 2NPIA 4B3SF 4K0KJ 1L8KA 1SI9A 1XNQF 2VPXB 1NK0A 1N8RT 1RP5A 4LF7J 1C88A 3LUYA 4QYRA 3BN7A 4LMZA 1ICEB 4YB6A 5AE1A 1ZZNA 2FZCB 3BQ2A 2QE5A 3PW2A 4X4RA 4NLDA 2KJVA 1LV5A 1RADB 4A47A 1T7PA 1HWIA 1HQUA 4WFYA 2BKPA 3VQSA 5HI7A 4M5LA 3D1QA 2ZHAA 4Z7CA 4GO5X 3QWPA 1DQAA 1U6BA 3QGGA 1P3DA 2AM2A 3KMSA 5HJYA 2F6VA 4OZ0A 1U49A 2J16A 3HD1A 4M8LA 4X4SA 5CYMA 1D9AA 1YTWA 4R0EA 1RTZA 3DN9A 3LWMA 4JI4F 2RKIA 5IT9U 1GXUA 1FRHA 4OHHA 2IMWP 1L3UA 3KDNA 4G65A 2GC6A 4M5HA 3E8OA 3H5SA 4ZLLA 1NHUA 2HK2A 1X0PA 4TY8B 2HNQA 4M94A 3PW4A 4I4BA 4MKAA 1XR7A 2CVEA 1FDBA 5K8NA 3MTJA 2DH7A 1QSLA 4Z7YA 3VQTA 3K8VA 2N4CA 1IWAA 1NCLA 2H03A 5HP1B 2HAFA 3PIPQ 1LK7A 5KG6A 3CDAA 5HK4A 2IVMA 3ZL8A 5E3CA 2F4VF 2OELA 5IFMA 4F0KA 5C25A 4DV3F 5L39A 5B7WA 3HHNB 3MOWA 2DBBA 2VL1A 2PD1A 4DFPA 4YHHF 3RGOA 1QE1B 1QTMA 2Y9HA 1C85A 1SJ1A 1N5SA 4LREA 1T02A 4JBCA 5BXIA 5K5MA 3VVUA 2BJDA 3DM2A 2CJAA 4EU0A 3T5KA 3M6WA 1SV5A 2NYHA 4C8ZA 2V63A 5A8RB 3MPUB 1PJ5A 5KG5A 2FIUA 4M63A 4RHGA 1R89A 4IR9A 4KB7A 1SH0A 3UNGC 2GVZA 2WVBA 3QJJA 3CPWR 3CXCR 4NE9C 3M9OB 4OHWA 3TA2A 2V8GA 1N5TA 3BKFA 1WAXA 3CJKA 1LFWA 1HLWA 1NSQA 4DN9A 1IKVA 4DLGA 3QSYB 3MM5A 3H5UA 4NLSA 1VC6A 2WSFC 3I9ZA 2CQPA 2Y1LB 1M5SA 3GXHA 4UUXA 4FXWA 2NPFA 1GG4A 1VQKS 1JXEA 2DRAA 3AXMA 3W7BA 3HI9A 4WFZA 4C97A 1FO1A 5IV3A 3AD7C 2M88A 2VQEF 4ANEA 2OMOA 1CQMA 2LKZA 4QIWD 3J7ZT 3FKBA 2HVZA 2QLFB 5EX0A 3QIDA 3JSMB 1KSPA 1KOOA 3FZ2A 4DFKA 1DRZA 4O23A 3VWSA 3HK2A 2BOAA 3MAQA 2JEJA 1S99A 2BM1A 1CULB 1HNXJ 1LWCA 2LA4A 1SC4B 2RDIA 2VJUA 2V50A 2DHSA 2IJNA 3KNAA 1CC7A 4DQIA 3TAMA 4C8MA 1QM9A 3DOKB 1KQGB 4TNOA 1HBOB 4BDPA 1TL7B 3OFGA 5CD4A 4CO4A 1KVKA 4OI0A 2J0XA 3FFIA 1VBZA 1SUQA 4LF7F 2GVDB 3OJSA 4G1QA 2WB1D 2XQCA 4LF1A 4ZLNA 3OSPA 4NNDA 1RYRA 3MEEA 3MEKA 2C22A 3MR5A 3W2WB 3EZ5A 3UO0A 2EXUA 5CYJA 1RJJA 3VCDA 2CNKB 3TEGA 3OXLA 1RACB 1ZETA 4ZLPA 1TQLA 3MTKA 2R2TA 4QIGA 2CQ2A 4WYLA 1TV6B 3DLLQ 4DQRA 1KONA 2R7VA 3HZGA 4H4MA 3GV5B 3RZAA 1SQEA 4PVGA 1WG5A 2RDJA 2HB1A 4AE5A 2VTEA 3DHXA 1KEKA 1R3NA 3FRYA 4GE6A 1XXPA 3CW2C 2B56A 4OX9J 1NWLA 1K47A 1OIAA 1U25A 2D41A 4B9SA 5HROA 5KFAA 2AQ4A 2I38A 3M1VA 4ED1A 4O3RA 4WTYA 1AXQA 2HPUA 1BQXA 5CA5A 3I0RA 3QO9A 2G4BA 2Y2FA 2K8GA 2WONB 4N8NA 1VRTA 4BUCA 2FGCA 1REGX 3B82A 2RU9A 2ADCA 4WK3A 1HW9A 4DV7J 3PYZA 2PA5A 1SIZA 4LRFA 1WSVA 3DGPB 1X9SA 1H72C 3HHEA 4TQSA 1DJ0A 1WKLA 3CO9A 5JVGQ 4Y2KA 2ZC3A 5GAGI 1CG2A 5EGYA 4YUDA 2CKWA 2MMYA 3LOUA 4BBYA 2FLLA 2CG4A 3VAIA 4U8VA 4XDCA 1IM6A 1FQ1A 2WSEC 2E5LJ 1P8GA 1CEZA 4WFXA 1SJRA 2KDOA 3ZM2A 3ILIA 2EKYA 1GT8A 4PQUA 1SH2A 3GIMA 3W61A 2CNHA 2HNZB 1E6VB 2QCJA 5CCMA 4B08A 2YX1A 2MTLA 1G1HA 4DQPA 3GONA 4LJMA 5C2GA 5CZXA 2QBRA 2VV5A 3SQGA 5AJ3J 4KT0C 1XERA 1R7IA 1YJUA 2E1PA 2C2EA 3F81A 4NA3A 4DV2J 4B9UA 4BC7A 5GADU 1LW0B 2QCTA 3HVAA 1Q7LB 3IRXA 5HJXA 2XMWA 2GIFA 5JXSA 5HN0A 2KVQE 1C1BA 3IO1A 3R6GB 1WHVA 3LK7A 1WKJA 3VAJA 3BBFA 4ID5A 5THWA 3QCFA 2GFFA 3BO3A 1B0VA 3V81A 1WEYA 3M8WA 2D9PA 2ZZNA 3G8SA 4DX8H 3DNCA 3HX9A 1RHJB 5KT4A 4NXNJ 2E9TA 2WSCC 1S9FA 2KXNB 3HXMA 4TVVA 1TTHB 2B3OA 1NXIA 5IQQA 1F3VA 3ZXWA 1UWBA 5KFVA 4DZ6A 1BMQB 5LL6d 4FDFA 1BWVA 4N56A 3EDRB 1O6XA 1YG0A 3AA9A 1YK9A 4HJQA 1JX4A 5J2QB 1HNXF 3AJDA 4ZPTR 2QLWA 4S0GA 4JV0A 4IFVA 4DG1A 1S1XA 5BYSA 1HPZB 2BGDA 1RI7A 1SB6A 3KLVA 4F4ZA 3QRRA 4C6AA 2IRYA 5DG9A 4GS0A 3RR8A 2OAUA 1OPZA 1N48A 1RBOB 2J0SD 3LA0A 4UOHA 3PO4A 1JMTA 2OH2A 2H5JB 1H98A 2V94A 2W1BA 2XMKA 4Q2LA 2Z57B 2D3ZA 2V4JB 3ZZTA 1FD2A 3EGWB 3W9IA 1RQ0A 5IT0A 1ELOA 2C3OA 2ZWPA 2OHDA 2FLPA 2HKEA 3HKZD 2C42A 2HMIB 4ERCA 2MPUA 3H2XA 4R30A 3TJAA 1HD1A 4D3HA 3QYYA 1NWEA 2EKNA 4C3LA 3H2UB 5A6PA 4HT7A 1S4FA 1OSDA 4U9RA 2M8DB 3GFHA 1OWXA 4A48A 5K8MA 2UXCJ 3IA0A 1ITPA 2OEJA 1S1VB 4LR7A 2DD8S 1EHWA 1UPMB 4NA2A 4R0TA 3EYZA 1TKDA 2XSFA 4WXOA 2B4OA 2HURA 1OY9A 2A10A 4DV7F 5H9FJ 1ROFA 2YQ1A 3CCRS 2VB6A 1GFYA 1QY7A 3OTBA 4FKXA 2VOOA 5D15A 1S9GB 4QYZK 3T41A 2FJBB 1RBLA 4L73A 4CLTA 2OUDA 1IBMF 5DO2A 4UOGA 5A8WA 4K4TA 2EI5A 3HVTA 2O01C 2PMZD 2E7XA 3QCNA 4HVZA 4RW7B 2E5LF 1B0TA 1FKPB 3O2IA 4ED0A 1KTVA 4I67A 3GZ7A 1JLEA 5ADZA 1C83A 1X4BA 1BY9A 1J4XA 3CJSA 3HVRA 4KAIA 5HDEA 1RU1A 3OR1B 2C3MA 3GSDA 3OVAA 2QLXA 3O4TA 1IBKJ 5HVGA 2XMAA 1UAWA 3I4HX 1TAQA 2C3YA 3DLKB 2J7WA 5KFDA 2EFPA 4TU8A 4CLYA 5AJ3F 3QCHA 2DNMA 3R8YA 4O44B 4TYBA 4O3QA 3I9V9 4DUTA 3OUYA 4LF5J 3JSRA 5CAAA 1HNZF 4FP9A 1Q6MA 2N3LA 2HQFA 3V2UC 1KHWA 2DO4A 1ZAVA 1P15A 2IA6A 4AQYJ 2AU0A 1W26A 5EUHA 3CCTA 1VIXA 1XC9A 2AYBA 3KHRA 2IVFB 2W8LA 1CJTA 2E29A 2Z58B 4O3OA 3W2VA 1FD8A 4DSLA 1HWJA 3A8IA 3CCQS 2AGOA 2NLWA 3CUNA 2VEYA 1O5ZA 4O0IA 4OFZA 3AHPA 2MKCA 3R7BB 2HCMA 1TUWA 2GO8A 5E0OA 4H4OA 3IGVA 3DLGA 3N2AA 1T0TV 4J5OA 1HYSB 2YKAA 2B5JA 3G6XA 2VA3A 4WP3A 2YNGA 3D68A 2DHGA 2VOPA 4TYAA 5J2NB 2RMLA 1WKKA 3T6BA 5KAKA 2QA2A 1X5TA 1HW8A 4PG8A 4K4XA 4RNFA 5M2UA 1T48A 2BZ2A 1C0UA 2ZJQQ 4PUOB 1RT2A 2DNGA 3GFZA 2ZE2A 7FD1A 2PEHA 1HI1A 2UZAA 1U1KA 3MGJA 2XTJP 2VBXA 1MU2B 3H40A 4N5SA 1KVIA 4ZCMA 4QIEA 5C5JA 4EWTA 3KK1A 1XMBA 3AB2B 2HHXA 3OR2A 2FTRA 3KK2B 1YRUA 4PYDA 3B78A 3V6DA 2HIQA 5DQGA 2Z30B 4PABA 4PEOA 1LWEA 2MQNA 1P1TA 2W9BA 3JAMU 2VG6B 1WF1A 1D0EA 3G8QA 5B0DA 2AMCB 4RR5A 2ILZA 5C24B 2DNLA 1WUUA 4J90A 4RNMA 2WVEA 3D6MB 1FTRA 1KVJA 4IFYA 4CH1A 4FYXB 5J1EB 1A7GE 3OHBA 3EVMA 3CE8A 4ED5A 3BGRB 4R0SA 1C0TB 2FHJD 2LEPA 4C8KA 1T9VA 1VQ8S 1EQMA 3IR6B 5L38A 4FF2A 4CRJA 2LQ9A 1G2EA 2UXCF 1IR1A 1NB2A 2ABYA 1K73T 3KLHB 5D0EA 4Z37A 4IUFA 3MVNA 1QJHA 1L5UA 4QUMA 2XZDB 2XEXA 2W2NP 2XI3A 5F8MA 3GTYX 2ZC4A 2PI4A 3FJ2A 2VUGA 2ASJA 2KTQA 2FLNA 4MT1A 2CZVC 3LP0B 3O8WA 2W4DA 3CD6S 2YWHA 3EWGA 1MN7A 1HWKA 4C8OA 2DK2A 1N36J 2Q6CA 4F7VA 2V6AA 2GZOA 2RD5C 2RUSA 4J9VA 3V4IB 3M4XA 4BLGA 4CLPA 4XTTA 5CYQB 4QCLA 2UUBJ 2OMLA 2PE8A 2HBZB 3UVJB 3A3NB 3IP0A 4TY8A 2DKOB 5IQ6A 3V6JA 2HG4A 1IBKF 2MJUA 9ATCB 3J80U 4O4GB 2KI2A 2A3JA 4HEA9 3I6PA 5DRKA 5BZXA 1TKXB 5HP1A 4YFUA 4OHVA 2HRUA 3MCSA 1X0FA 4BUBA 3EMTA 1T05B 4ES3A 2LDIA 4LF5F 5FLXU 4DL5A 2OD4A 3UN3A 3JQJA 3UCUP 2F63A 2MKHA 5DLGA 1X5PA 2CPYA 2EW9A 1QE1A 4AQYF 1TKTB 3FQKA 1X4HA 4WF9Q 2F1FA 3ZTRA 3EZUA 4HHHA 4DPWA 5HBMB 3HP6A 1R8PA 2HWHA 3D0HE 3M8YA 3M32B 2J0WA 2H54B 3HJVA 4L3KA 4ZVHA 5A8RA 4USTA 3NRSA 1H7XA 2LU2A 5EX3A 2GQQA 2YKMB 2J9DA 3DKDA 1QVFR 3KG1A 3H25A 3GJSB 4J9QA 2DPJA 5KFMA 5F8IA 1R6HA 5H1SV 2H48B 4W98A 2E5JA 2BKOA 5LXRA 3AOBA 1U45A 2NS1B 3NMEA 1T9TA 1FNXH 4L72B 3W5XA 1HQ2A 1JLCB 1BZJA 3PJ9A 2XWXA 3RGIA 4QW9A 4F04B 4HYKA 1W2IA 4ICZA 2BIJA 1N56A 2C2DA 2APOA 1M5OC 2RS2A 4C13A 5E5NA 2VZ9A 2CXEA 2JZ5A 2BW2A 3DYAB 3OLRA 4IRKA 3AB4B 3CCSS 2DGQA 5MLCV 5L46A 1NU4A 4DEZA 1KBRA 4C9DA 3JSMA 4CH7A 2V5HG 3ZZYA 4ENOA 2EFNA 3D7SB 2C1EB 3JB9k 1WEZA 4AXIA 1OHCA 1KQFB 2B0GA 4JB8B 4ERDA 3FUYA 3N01A 1CULA 4KJIA 2I8EA 4W92B 4QBEA 3D3BJ 2B43A 1V6HA 3RGQA 2CUYA 4YR2A 4DV5J 1D8ZA 1NEEA 3K0JA 3DOKA 1S0NA 1HBOA 3S4EA 2HBYB 1TL7A 4K4YA 3W64A 2GVDA 2L48A 2Q1LA 3MMBB 3SR9A 5GAHU 3NL0A 4M1KA 3J7YU 3BQ0A 4JI8J 2BE9B 5E3RA 1BGXT 3W2WA 3ZZZA 3DDIA 5C7PA 4UW2A 3QCDA 4AD6A 2J6TA 1IJFB 3BPDA 4NXMJ 2CPXA 3T5HA 4PG7A 2JDJA 4HT5A 1VLYA 2ZITA 2GMLA 4YB1P 2NXUA 1VQLS 1TV6A 4JMKA 2DGOA 4ER8A 5JUMA 2M8HA 4AZ1A 2H4GA 3N4WA 4KV8B 2Z2YB 1N36F 4RU9A 1DFDA 4OYPA 3J7AN 3G87A 1HARA 4L75A 3VVTA 3EPIA 4DI6A 4W90B 2B7BB 4CO1A 3Q86A 2J6UA 2MKIA 2UUBF 5L1IA 4MYTA 2NT2A 3GU0A 4QWEA 3NWGA 5F8HA 3TVKA 2U1AA 4X66J 4DR5F 4U7UK 2JWNA 1YI2S 3I87A 2FJWA 3UQSA 2KXFA 2M5YA 1V3RA 4DR3J 2WONA 3ILJA 1R27B 3MR3A 4NMXA 2IYGA 3M6VA 2JOQA 2GMHA 3DGPA 1VMBA 2VG7B 3J7A1 5F9LA 2EVZA 4XIUA 2XGPA 4USKA 1SKSA 2C2OB 2SHPA 2GC8A 4I56A 5FDLB 2CQ4A 1UWAA 3UDVA 5KFIA 3AQPA 3VAHA 4FPRA 1VBKA 4XPCA 2R7XA 2DNZA 3H8YA 4DGXA 5HMXA 4LQ3A 5JMNA 4NWFA 2DXFA 3V0HA 2RRNA 1IKWB 4ZI4A 1X5SA 2MQ8A 4FPIA 2HNZA 1E6VA 2QDMA 1FE0A 4DZDA 2HQ3A 3SYZA 2RSQA 3SSQA 4USJC 2OFGX 2V8VA 2ZD1B 2IJFA 2OPQB 4IKAA 2YQ0A 1UMJA 1UFKA 2HWIA 3PW0A 1TAUA 4P2FA 4U67Q 3GG0A 3D2WA 1LW0A 2VFRA 2R9LA 4NCGB 3Q2SC 5EDWA 4D3QA 2DNRA 4BHQA 2XYPB 4DPXA 2CWXA 2CIMA 4J9MA 4TLQA 4ZITA 1UW4A 2BE7D 3HMJG 4KQZA 4ZVGA 3KFWX 2R8GA 3CCJS 2AJQA 4OX6A 1TK5A 5KFNA 4RX6A 3VALA 2HGLA 1WWHA 1XN9A 2VBZA 3TVYA 2DVIA 2I75A 3UW1A 2HBQB 2X1GA 3SBMA 5KT5A 3R3TA 4YR0A 5E33A 1Q1KA 4C8LA 4Y2CA 1NK5A 2M2BA 3ENVA 5KFQA 2IAJB 1QAJA 3TANA 1HHSA 5J2QA 1H73A 3DRSB 4EO8A 3M6UA 4PZVA 1S6PB 4DFJA 3KG4A 4A8YA 2DR7A 2BQUA 1HPZA 1B70B 1D3WA 1ECVA 2G1DA 1ZM4A 3AT1B 1FGSA 3MEDB 1B4SA 4RH9A 1NPKA 2MZTA 3FMBA 2ATLA 2G1HA 1F6TA 1OEOX 2YKNB 2IM1A 2LP4A 2DRDA 3NGRA 3CM3A 4Y0FA 1U2RA 4ECYA 5A5EA 1U0HB 3AJ1A 1X9WA 4JI8F 3U1LA 2F5GA 4RW6B 2V4JA 2CNNB 2PDAA 1V3AA 4NXMF 4IH7A 4ZVSB 3RYLA 3FC9A 1N52B 2X7IA 1YJTA 5K23A 4GMKA 3QFHA 1IQZA 3KUHA 3RG6A 1I5OB 1RPMA 2HMIA 1VBYA 3EU0A 1YVFA 1N88A 4JOUA 1QZ0A 3IM9A 4OYIA 5JJBA 4DS4A 1KRPA 3IBCB 1VLOA 4CVKA 1KD1T 2ZFHA 1G6BA 3MMAB 1S1VA 4X66F 2BJ3A 1HA1A 1UVJA 4CLLA 3PEJA 1GAOA 3ZZUA 3N6MA 2GQ2A 2HXPA 3CDWA 4KO0B 3HSJA 3Q8QB 4LSLB 3Q23A 2AYMA 4IDKB 4HACB 3RO1A 3AWEA 5F0WA 1S9GA 2F00A 3LF0A 1RGVA 3TEHB 2CQ0A 5K9FA 4QJVA 5GMDA 1I51B 4IRCA 5AXMA 1T8EA 2VJVA 4KI9A 4CLKA 5BYQA 2KG1A 1LK5A 5GAEU 3CJ8A 4RW7A 1FKPA 3TRGA 1VISA 3MCOA 1ZA2B 3QBCA 5K22A 4RBUA 2E0TA 1ZH5A 2VG5B 2AV5A 4NWBA 3OHAA 3OR1A 4LUBA 2B8QA 5HATA 1FVSA 4HR2A 1ZC0A 3DLKA 1PYNA 1FK9B 1EKSA 1XBOA 2P6SA 4Q7AA 5BX1A 2CWKA 1KN6A 2R8HA 3ZM3A 4O44A 3EB1A 3H5YA 5ETKA 5KA7A 1J5EJ 2KYZA 1R6VA 1NHVA 3CSKA 2EC2A 3ITHB 3HDSA 2G2ZA 3RRHA 2JEIA 2MKYA 3GIIA 1I1GA 3OXGA 4OZ1A 2NREA 4Y2EA 1VQPS 2KVIA 1S59A 2K3KA 2W9CB 2H9ZA 1PJ6A 3NP5A 3RB6A 4DUYJ 1ZAWA 3TAQA 4MBBA 1HI8A 4FF1A 4WWSA 1PC4A 3OL7A 3DMJB 2R8IA 3I7ZA 2V0NA 4LF9F 4CM0A 1U1RA 2HHVA 2KYXA 2WW4A 2VPWB 4RUAA 2DEIA 3E3XA 3GILA 4KGXB 3A8KA 2EK6A 4IYQA 4NZ7A 1WNEA 3F44A 1HFEL 2P9CA 4JI5F 2QYGA 3CNQP 3I80A 2FZGB 2E1MC 3SQOP 3CC7S 1HYSA 3EVOA 5KFEA 3OLBA 4PKDB 4ED7A 3MPYA 2KO1A 3ZM6A 4E8UA 1H2UX 4KIAA 2ALZA 2CRLA 3PIOQ 5J2NA 1ZOTA 4JI3F 2E44A 4ECZA 3BV8A 5J2PB 3HFZB 5KA2A 4OZ5A 1XK8A 1PKUA 3IAM9 2OTLS 2G59A 1YZ4A 1FWLA 4G6VB 4PUOA 1FRIA 3MWBA 4B04A 4E2FB 5K9WA 3T9NA 2K1RB 3TJ9A 3IN5A 1SKWA 1DQ8A 4ZP9A 1TZ0A 2A2DA 2XI2A 5ETVA 4C0BA 2H65B 1MU2A 2DNHA 2IM2A 1SL1A 2QLJB 4CZCA 5DQIA 2XC9A 2QL9B 4RU2A 3BDPA 1RTDB 2Z56B 1NLKL 3C46A 3KK2A 4L3NA 2HVHA 4IKCA 1RWMB 2ZH7A 2YWFA 2VG6A 3DU6A 3HSZA 4CYUB 1VIOA 4IG3B 4YDXA 1PTYA 5C24A 3E51A 4HHJA 4P74A 3D42A 1FEHA 3C6UB 2GHPA 4CI0B 3W9JA 6AT1B 5J1EA 3KDOA 1RUSA 3BGRA 3NEKA 1C0TA 3M8ZA 2W2PP 1BXNA 3F9BA 2AZRA 3WC2A 1U1OA 2MSSA 4J37A 2V4RA 1XR5A 1AW0A 3QKPA 3M2RB 2HZCA 2WVDA 2FJMA 2DIUA 3W5ZA 4QBUA 3KLHA 1LFPA 3I4PA 2MKSA 1WG1A 3UFCX 3H59A 1U1PA 3C8YA 3LP0A 5HQ8A 1VQMS 3QKQA 2NYIA 2HQCA 3AFGA 3CO0P 3US5A 2IM0A 1LWFB 3O5XA 1RABB 1S12A 2DT9A 3L4BC 2H04A 4EFAC 2Y0BB 4LF6F 3V4IA 4ETZA 1URRA 1PYOB 1N6QB 1KS2A 3HHLC 1MLAA 5CYQA 2W9AA 3UVJA 2F8HA 5KFKA 4QR1A 2DB1A 1KAVA 2JLEA 3E01B 1DZ5A 3MHYA 3ZFVA 2ZH9A 1Y4ZB 1U1MA 4X4UA 2NQPA 3QT7A 3MMJA 2XG8A 3M8PB 1G1XA 3OXFA 3SZ2A 2DNQA 2BW7A 2FJVA 5EWGA 4O4GA 8ATCB 4F67A 1XMQJ 3CDBA 3UD5A 3G4SS 4M5NA 4NLTA 3QCEA 2XZWA 3KUEA 1TKXA 4Y34A 4ECWA 3ENAA 1Q79A 1TL4A 1RHQB 4Y65A 2XNQA 1L8GA 3KNGA 3GLJA 4LFAJ 1TFYA 2GO9A 3P49B 4J9UE 1T05A 3G71S 2PFFB 3WQPA 1JBWA 1FPRA 1GFWB 1ULRA 1BHNA 2VC1A 2QLBB 1TKTA 4EGLA 2HQIA 3K5OA 3FZBA 3DFEA 4DUYF 1SJFA 4N47A 1G4US 2G6ZA 2CNLB 4EYIB 5F8GA 2D3UA 5HBMA 2RT3A 5I42B 4EO6A 3M32A 2FVRA 3GSIA 4ELUA 1PAEX 4IOBA 5KG4A 2WVFA 2GAGC 3VGTA 2YKMA 4QU6A 2G9OA 2F70A 2W24A 3J81j 4NLQA 5DDOC 2Y1IA 4Z6BA 4D3PA 4Y28C 2NTAA 4ZVQB 4GRYA 3HPOA 1JKHB 3VAMA 4FVCA 2HFVA 3SCIE 1RTIB 3TA0A 3NOCA 5F41A 1CPZA 1JLCA 1IVZA 2L08A 4ZA1A 5F8LA 3I56S 2ZH6A 4DV0J 3R5GA 1VK8A 1NKEA 2FH7A 2CPEA 3KLFB 5IS2A 1GNKA 3ETMA 4ID8A 2XULA 3RUBL 4KFBB 3DYAA 1WDTA 3F73A 1CS4B 2N7YA 4P7VA 5MMZB 1FJEB 1KP6A 2X1FA 2UUCJ 4F3MA 4HL9A 3PEHA 3PYDA 3TA1A 1ZZWA 4MJKA 3Q8YA 4P73A 4X4QA 5A2QY 4P6QA 1OS5A 1IBCB 4YB5A 3QZ8A 1YHQS 2X1BA 5HANA 2IJRA 3R5JB 1NO8A 4M5MA 1NJWA 3NCRA 3MI7X 2RB7A 4JI1J 4MAKA 4HTJA 4JI0J 2Y1RI 1FTCA 1VHIA 4AFFA 5BR8J 2AX1A 5KFYA 3MUVP 1EP4B 2UU9J 2CJKA 2E1RA 2XJAA 2YDUA 2P4DA 3SDEB 4U8YA 2MQQA 3U1NA 1HQEB 3MMBA 3NGKA 2CNEA 1IM4A 3O4UA 4I8NA 2IDLA 3CDUA 4ZP8A 1JQGA 2Z4PA 3CGIA 5G0RB 2MBCA 4KGMA 3TR5A 1HNIB 1RLDA 4I6AA 2GQCA 2HNYB 2MEWA 3ILLA 2CQCA 1X4FA 2RF2B 1RKJA 4OI4A 1IN0A 4X64J 4OI3A 2HFNA 4PG4A 3DDKA 4OV1A 1N34J 5AXKA 3ULHA 1M5KC 5DM6Q 1JLNA 4KV8A 1FDAA 1OHDA 5KFUA 1GEHA 2BANB 2CPDA 2AF6A 2RJZA 1HHQA 3GP9A 5KFBA 1S6OA 2P6XA 2QMXA 3GXGA 3OJUA 2YWWA 2MZQA 2J9EA 3BN4A 1G1GA 2V9WA 2OKQA 4IQXA 4GKJJ 3IG1B 5E2QA 3GIJA 2IFXA 1Q16B 5HQLA 4QQBA 3RAXA 5I6VA 3GJRB 1XMQF 5DG7A 4PWDB 2VG7A 1RAOA 3N0AA 3ET6B 4ECTA 1FXLA 1OY6A 1Q82T 5KG0A 4LFAF 3D9BA 2GC5A 5FDLA 3QQCD 3D1HA 4E98A 4J7CA 2MQOA 4FZVA 2AKWB 3EX7B 3QCJA 4ZPDA 1UFLA 4USHA 2YPYA 1Y9OA 3F0NA 1IKWA 3R5AA 2CJXB 3NNAA 4UOFA 2R4FA 2J9DE 2H5EA 1JJ2R 1YX2A 4M5IA 1RZMA 1N0VC 4LRAA 2JJ4D 3RJMB 1OQ3A 4ZCIA 3W8GA 1U09A 3V0DA 1NDKA 3OV7A 1U6FA 1W78A 5ETTA 2EWHA 2ZD1A 1I9TA 2NZ4A 4MK7A 4DLEA 1DARA 1J6UA 2OPQA 1Y7PA 1NZ8A 5EWEA 2VD3A 3K5PA 4HH1A 4RNHA 4DL2A 4MIAA 4C98A 1XRIA 3VGSA 4NCGA 1TL3B 3R97A 1JLAB 4NI2B 3VR1A 5IOLA 2QEPA 3MXHP 3K2YA 2VODA 3H4BA 4I7FB 3CCWA 1VGYA 4YS2A 3LALA 1FKAF 1EARA 2KFZA 5HSPA 2B4VA 2MZSA 4DR7J 1OESA 3W8PA 4F0HA 1WHXA 2VBYA 4TN2A 3HSDA 3HZEA 1K0TA 4ZP6A 4ZPBA 1T11A 4D3GA 1EENA 2R7OA 2IAJA 2I2YA 3MMCB 4NL5A 3QSIA 1LXNA 1VS3A 2R2UA 4K50A 3A3OB 4KHMA 3DRSA 1NH8A 3SCJE 2J8SA 2BX6A 1U8SA 1WD6A 2QDCA 4DOZA 4OZLA 4QAHA 4QR0A 2YBVA 1S6PA 2F3JA 4JI0F 1R43A 5BR8F 2UU9F 3MEDA 3Q89A 5EHRA 2LXIA 3POTB 2OP5A 4NLPA 4YR8B 2CNOB 2YKNA 4DMZA 2ZBRA 1NKBA 1RCOB 4WFNQ 2MKJA 4X4OA 3ZTPA 1U0HA 3P4UB 2QBQA 3PDNA 1U02A 5I3PA 4RW6A 2E7VA 4TKTA 1KR4A 4CLWA 1K9MT 4W4MA 4MIWA 2XO6A 1YSJA 2YX7A 2DR9A 2WTFA 2B4SA 4X64F 1YTSA 5KG1A 1Q6JA 1SJ3P 2VC0A 2HFSA 4OHZA 1IUJA 4DV4J 2B9WA 1W7WA 4YP3A 2EFOA 4IR1A 1WI6A 2XHCA 3AXKA 4RL1A 3ZM1A 1XMOJ 1GK8A 4J9LA 1LKZA 1UJ4A 2ZUAA 2AP6A 3NAIA 1JF7A 4ZPAA 4DPUA 4KRWA 3EM1A 2LEAA 2MQPA 4GKJF 3MMAA 4JI7J 5DS7A 4FNHA 3WC0A 2HHPA 1K44A 1GTHA 2UV8A 2CQBA 5BZZA 2NR0A 1L3SA 3GMGA 5LJ5Y 2FUG9 5KFFA 4KO0A 2Y66A 2FY8A 2WK4A 4LSLA 1DY3A 3W5YA 3NGDA 3VAGA 4CH0S 3TUPA 2QJ3A 4IDKA 4HACA 3LPYA 1S97A 3AWFA 4NEYA 1WELA 4ELVA 4WE1B 2HYIB 2Q79A 4K59A 3KKFA 4GRSA 3DLBA 4K4VA 1CJUB 3UR3C 2YKQA 1RU2A 2YH0A 1C84A 2AM1A 2CPHA 3DLEB 5RUBA 1F9HA 3UN5A 1XEZA 5KOWA 2E7WA 4I6YA 5KFJA 3L09A 2G0CA 1NSAA 5AXLA 2X1AA 2W7PA 4TU7A 2ZH4A 2VG5A 3IR7B 2QA1A 2A3KA 1Q7YT 2KU7A 4EUVA 3P45B 3J81U 5KOXA 1QVGR 5IT9Y 1HR0J 3CF5Q 3C14B 2HHUA 3B8HA 2XLKA 3PS5A 1R8BA 3R2CJ 1FK9A 3U1MA 2CNIA 2B07A 5HLFB 3FBCA 1DTQB 5SZTA 3UCZP 1N33J 1X4AA 2OEKA 1UVKA 4QWDA 2ZKTA 3ITHA 4KBIA 3HT0A 4FNIA 4FF3A 5F0UA 1RHUB 1BWEA 2NLKA 1WC5A 4KE5A 3Q0AA 2W9CA 3RTVA 2KG0A 2FVQA 2M3VA 3EXCX 3F56A 1XJWB 4C8NA 1RLCL 1A0OB 3OD2A 4WK1A 2YNIB 3DMJA 3C66A 5L9NA 4DR7F 1LQ9A 2MYFA 3O3LA 3MEGB 2V8DA 2NZ6A 4URSA 4HKQA 2RE1A 3VTIA 2ZJPQ 3MD1A 1MMLA 1G7GA 1Q1MA 4R0JA 3F9AA 4ANCA 4ATNA 2I4EA 4M95A 4ZVRB 3CJQA 3HHLB 1I94J 1SVDA 1P27B 3NNCA 1VCTA 2RF6A 4IH6A 2AD9A 3H98A 1AAXA 5J2PA 3ZM5A 3RB4A 1J5OB 1C86A 1NB7A 1OEVA 3DDNA 1QAIA 2K1RA 3EGZA 2BACA 2JLFA 2XNRA 3PCOB 2D3OR 3FVYA 3QPIA 4Q5VA 3RW6A 1SCJB 1IKYB 4XK8C 1RK8A 5DLFA 4PAAA 4DHVA 4P71A 3GJTB 3AWGA 4KHRA 4DQSA 5K24A 2ACMA 1RTDA 2BM0A 3BF4A 1S49A 5L1KA 4P7TA 2M52A 2RUGA 1IBLF 1WORA 3QCBA 1AUSL 1EJ7L 5KA8A 4CYUA 1QAYA 1S0OA 4IG3A 2ZOFA 3OT9A 4DV4F 2JJDA 5IT4A 4RNNA 1SKUB 2J0QD 4B3MJ 1RAFB 4LT6A 4F36A 3C6UA 5A6WA 3IBWA 4CNYA 2QBSA 2Y67A 2JRSA 1VQ7S 1XMOF 3IXQA 2LU1A 1YKWA 1EETB 2K2PA 2VEXA 1Y0HA 4KHPJ 3PJXA 1SUGA 4NYPA 3CJTA 3PJWA 1SPBP 3M2RA 4JI7F 1X60A 1CSJA 4LRBA 1SKRA 1XM2A 1GWZA 2B6AB 4GFUA 2AIRB 4ZJLA 4FYYB 5GAGU 1X4CA 3UI3A 1HNWJ 5AWXA 1GTEA 1S6UA 1UZDA 3AODA 3S3HA 2ERRA 1FFWB 3M30B 2QIFA 4NWGA 2R7SA 1LWFA 2DXPA 1O8BA 1UP1A 1FESA 1IR0A 1K0VA 5A0YB 2XB2D 1JWWA 4A8OA 3PYFA 1X31C 1N6QA 1SC3B 3LJ8A 3BYPA 4K0KF 1CC8A 4RW9B 4C12A 2HSEB 3OTCA 3OW2R 3E01A 4R25A 1F60B 1N5VA 3M8PA 1ZTWA 1YRXA 3TW0A 1HMVB 2YKOA 2V68A 3DRYA 4LSNB 1HR0F 4F50A 1IKXB 2NUHA 3F99A 4ES2A 5KFCA 1F2HA 2DITA 1N0UA 1YJRA 2HRYA 1IJEB 4NRTA 1N33F 2MLYA 2W8KA 3PTWA 3BGLA 3K58A 1KFDA 3I96A 2CQ1A 2ZVSA 5KG7A 4GKKJ 2DCLA 4ZJOA 1LNQA 3O6QA 4PRFA 2NZCA 4RH5A 2G0IA 3HSGA 1KHVA 2N3OA 2MQLA 1YWFA 1SL0A 5DZ7A 4TVAB 4XO0A 5I42A 2BVZA 5KAAA 4OI6A 3KJVB 1NDCA 1TR0A 4G3IA 4MIBA 4OLOA 2U2FA 3SCLE 3SXLA 1H0HB 2ZUGA 2GJFA 3LGNA 3QIPB 1BC6A 1RCXB 4QIFA 2VH7A 3NG8A 1S7IA 2LMIA 1XQIA 4OZNA 2ZM6J 1JKHA 1VFJA 3JTPA 1VI7A 2JL9A 5DZ6A 2E9ZA 1UAGA 1I94F 1RTIA 1PC5A 3VF0B 2JC0A 4CLZA 4EBEA 4F4AA 5DGBA 2RQCA 1XXVA 1BQMB 1WOSA 2PQ5A 3RR7A 3W1YC 2XS5A 1FJGJ 3SV3A 3PM9A 3UPFA 3GG1A 3TQEA 3H5XA 4ECRA 1L3TA 1FDNA 1VYAA 4H54A 4DR1J 3KLFA 1KC8T 4P9SA 3CWEA 2IA0A 3H4DA 5D4OA 2QYCA 3PNIA 1UW9A 2LXUA 2DH8A 1YZ6A 4KH0B 4OJGA 3ZTQA 4KFBA 2ZOGA 2CQDA 1CS4A 4F0MA 3H2VE 3EAXA 1PGZA 5J8RA 3B6BA 1NJXA 2YPZA 2AGPA 1U1NA 4QR2A 4GO7X 4F26A 2MZRA 2BXJA 1D9FA 3UAGA 1H2VZ 2N4DA 3TJ8A 4UZBA 3BR9A 2PFDA 3R7SB 3WIVA 3D6FB 3GPAA 2HHWA 1KKHA 2R2SA 4B3MF 4U95A 1EP4A 4A8FA 3SMEA 5JVHQ 1TP7A 1J2VA 4R8UB 1PBAA 3SDEA 3OVSA 2HLUA 3SFGA 2ZJRQ 3Q8PB 1B7YB 1HQEA 3FSIA 1VQ5S 3KLIB 2GIQA 4Q8FA 3TYTA 2C7SA 4F2RA 1MKPA 1Y3JA 1UCNA 4NEZA 5G0RA 3NS5A 1R6YA 1EQ0A 2V9KA 1HNIA 1O0PA 2HNYA 3BM8A 3TWZA 5C42B 1GMWA 4PPDA 3ISND 2RF2A 3CULA 3BH7B 1HNWF 4CT8A 3QCGA 4LBPA 1OPIA 2WBRA 2C3UA 2BA9A 1PTVA 3Q8VA 4ED6A 5K25A 4DV6J 4DF8A 2BANA 4QWBA 4R5PB 4ZIWA 4F02A 3S1TA 3RRGA 4CNZA 5J2MB 5H9EJ 3LANA 2F6WA 1NJIT 5CHCB 5GMEA 3IR5B 3R27A 1VQOS 1KAKA 2AJ4A 4QOTA 5FIIA 1C1CB 4ZS6A 2F4FA 3H2LA 2OZ5A 3R5CA 3ZNUA 4ILLA 3IG1A 3DXBA 3DRPB 4DR2J 3TQ1A 2OOQA 2ZH2A 4P72A 1S4EA 3CC2S 3TP2A 2RHSB 3FDSA 4NCBA 5F9NA 1YITS 4H1OA 3FCHA 1V9OA 4I64A 3AD9C 1I9SA 4PWDA 4PYAA 1V3ZA 4OHLA 3ET6A 4ELTA 1PH0A 2G2YA 3AH6A 1HIYA 4RKUC 1EX8A 2NUUG 2BMBA 2MQMA 4LBIA 1GQEA 3UD3P 1PG5B 2FY1A 2BUNA 2AWZA 3A3PB 1RHMB 1FCAA 3DLJA 5KFOA 2K7JA 3HD2A 2ZZMA 4GKKF 3T1AA 1PILA 3GIRA 5KFPA 3QRQA 4NYOA 3S01A 5LSRA 3L7PA 4ITSA 1Y5LB 4OX9F 3PV8A 3M05A 3ILOA 1RT4B 2CA9A 2HW3A 4DS5A 3GIKA 1C87A 1FNMA 5HQMA 3QAUA 2C2MB 1VOMA 2Y1OA 4X4NA 2DISA 3V0JA 1PTUA 2YVSA 1T9WA 4ALZA 5B0BA 4Q0BB 2VEUA 4OL8A 3KYLA 3WBZA 1OMSA 4CO2A 1DQ9A 3NLCA 2UUAJ 3UE2A 2CJYB 5T41A 2E5HA 2W4CA 2ZM6F 2R8JA 1OQ6A 2VBWA 3O5TB 4CLUA 1TL3A 2BRLA 1N32J 5I3QA 1KNZA 3ZZOA 2AEMA 1ZPWX 3PFOA 1JLAA 4NI2A 2FGOA 3Q8UA 2IM3A 4I7FA 4EMDA 3UN2A 1ZTTA 2UVWA 2BE2B 3AOAA 2X3GA 2UUOA 3LWLA 4JP8A 4AL5A 3M9MB 4GVBB 1NJYA 4DR1F 3MPVA 1S77D 1WG4A 2PN6A 2Z2ZA 4B3SJ 1IWGA 1U48A 2FJXA 3P3DA 4P10A 4YQWA 1BLUA 4DN0A 1MMNA 4RWXA 4B9VA 2VOSA 4KGZB 5D0RA 1Q81T 5LMNJ 4LF2A 2DGVA 2MKKA 1OY8A 3MMCA 3S6EA 3JSBA 2W2OP 4Q43A 2V2VA 3K57A 3GE9A 3MFHA 1R0AB 4V19J 4WU3A 3W9HA 3C2PA 1NUEA 2Y3YA 4DV2F 4EK2A 3I55S 2NXJA 2HC1A 1Y5IB 1ZM9A 2RVJA 1JJ4A 2YQ3A 2YTCA 4TY9A 2HVIA 5KFWA 1YJWS 3POTA 2IPOB 1X4DA 3CVKA 1FERA 5LSLA 2JFHA 1UL3A 1H6KX 2DNYA 1X5OA 2DNKA 3W62A 5KT6A 4AL7A 2XMTA 3OFHA 4OYOA 2Y0SD 4H4KC 3KUGA 2JFKA 4NXNF 2GA7A 1RE1B 3IS9B 3V5RA 1UVLA 1V5IB 2A2CA 3CD7A 1AFJA 2ZZTA 1WC6A 1AZSB 2ZNZA 3N9UC 5IC4B 2OO4A 3EPGA 3CMES 2YY3A 1PYTA 4HI2A 2GHWA 4WFBQ 3T9ZA 1SQFA 3G2XA 3R1LA 4MMOA 2V8HA 3PYEA 1MWZA 1PJ7A 4TU9A 3CIZA 4L76A 4B17A 1TK8A 3N5BA 4DV6F 4GE5A 2OSRA 2BQRA 3PY8A 1VRUB 2RQMA 1TMJA 4FYDA 4QUNA 4DCOB 1S0VA 1RAHB 3FGVA 3JAMY 4QWCA 3D3CJ 4NZ6A 2C46A 2OC3A 2HFUA 4F3OA 4DR2F 3BSNA 4C0OC 4IOCQ 1S5ZA 3KTQA 1AROP 4AXJA 2RHQB 2W2QP 3PYGA 2ESBA 3C16B 4DPOA 2I6OA 1Q6TA 2AEFA 4NX9A 2GAHC 4Y2IA 3KJNB 4WE1A 5D3GB 2OJ3A 2EK1A 1ACMB 1CJUA 2AZ1A 1CJVB 3W66A 3DLEA 3PHEA 3K7RA 2VIHA 2B4UA 2CDQA 1A6LA 1RWXB 3G82B 2AYGA 3LGMA 3D1OA 5AXNA 5BJRA 2Q05A 3BJYA 4CLFA 2OTJS 3IGNA 2GV1A 2OEMA 3CCLS 3QCCA 3EVWA 2E1CA 2QRRA 1FRMA 1DTTB 2UV8G 3NKYA 1QXKA 2BZLA 1AYEA 4HI1A 3C14A 4MK8A 2FYXA 3QT6A 2DHHA 2FJDB 3D9CA 4TXSA 2UUAF 3S7RA 1HWUA 5HLFA 2CQIA 1DTQA 1BQNB 4DX5A 3HFVA 3ZMQA 1M1KT 3N6LA 1X24A 4XPEA 3C6TB 2N7CA 3W63A 2KB2A 3TUJC 4ED4A 1NK4A 2H5IB 4CIOA 1N32F 2HZVA 3GV7B 3J80Y 2PA3A 3TUZC 3PW5A 2QDPA 1HI0P 2EFQA 1FVQA 2V2KA 2DPIA 3NY0A 3H0PA 1JXLA 1QDUB 3KOAA 2V69A 4BWMA 4RBTA 1EIYB 4C2MA 2YNIA 5FLXY 3OQ2A 3QT8A 4ECSA 3HO1A 4HJPA 1PO6A 2O66A 3X1LB 3MEGA 4OHEA 1F9FA 2HIYA 1OO0B 1F5CA 1G7FA 4DU8A 2K7KA 5IWAJ 4Y2MA 4B02A 3K5MA 1JLGB 3P5BP 1VDHA 2M4MA 1CVJA 4ES1A 5LMNF 3M6XA 1S1TB 2PI5A 1YJ9S 1KQSR 3HHLA 2NSBA 3M2UB 5KFHA 4ICLB 1VQSA 1Q4RA 1R8AA 2Q6BA 5KA9A 3ZZRA 4I69A 3T1YJ 4E0DA 3Q8RB 1UA1A 1J5OA 3BKUA 1LARA 5I3UB 2YNFB 5K8PA 1FFSB 1WDDA 1OEMX 4DR6J 5DG8A 3NGTA 1S10A 3D0IE 2QEXS 1YFOA 1IKYA 1FJ7A 4ZVEA 2YNHB 2IYIA 2QGFB 4YN3B 1WCHA 2Y96A 3MM8B 2IVYA 4UAGA 3KK3B 5D6GA 4C11B 2VASA 3QJPA 4ZOSA 3N6NA 2KT5A 3NS6A 2D9OA 1T4JA 4FXVA 5ETMA 3ONQA 3ZZ0A 1U24A 4P2XA 2HEKA 1SJ4P 3SFUA 4NASA 1YJNS 3JXOA 3D6HB 4NLUA 3MECB 1FWKA 4OJ3A 2M0GB 3CWJA 1EETA 4NMLA 2CPJA 5GMKa 1UEVA 3IWNC 4J9SA 4O0NA 3GYXB 3EGVA 2AEJA 2VQFJ 4NZ0A 3SEOA 5K20B 1QSYA 1PYSB 3FEZA 2B6AA 4WU2A 3U96A 1HHTP 2EEYA 1MG7A 3LGHA 3MOJB 1E6YB 4F4KA 1FEEA 3EMUA 3V4MA 2ADBA 4B9TA 3U27A 2KT3A 3B4DA 3PO5A 4HV4A 3M30A 4LVNP 1L3VA 1NO6A 2HFZA 2JFGA 5F3TA 4WFAQ 1Z1ZA 1K1QA 5EWFA 2WZ1A 5KFGA 4DCJB 4QBWA 1XTZA 5A0YA 3HHDA 9RUBA 2OSQA 5L9XA 4Y00A 4V19X 4EZ6A 4WP9A 1MN9A 1JJHA 1XWLA 1YRTA 4RW9A 2CJQA 2W25A 3V0GA 2H4YB 1RWPB 1S79A 3I5AA 1ZZFA 2RIJA 1Z2LA 4RBVA 2VFSA 3DGVA 4F25A 1HMVA 1B64A 4LSNA 2HRTA 4NA1A 1IKXA 1NZAA 1U2FA 1JLBB 4LVOP 2AHSA 4C48A 1OHEA 1TKZB 2IY5B 4Q2MA 2F6ZA 3M8QB 1NNDA 1RTHB 3B7OA 2PT0A 3TO8A 4AT1B 1RKIA 3CCES 2VA2A 3DHWC 4CO5A 3NBPB 2I6IA 1ZYQA 4UY85 1TFWA 5IBMA 2XMVA 1Y11A 4ZN3A 2I6PA 5DDQC 1IXKA 3TX0A 4X2BA 1FJCA 2I6JA 3EICA 4HDHA 2QZ8A 2RH3A 3M7VA 4KH1B 1TL1B 3FNNA 2WRMA 2GJ2A 1KLNA 3HFKA 3R6LB 1Z4UA 2LDYA 4NX8A 2F9JA 4ECXA 3MFIA 2CAJA 1UEUA 2KJWA 1RT6B 8AT1B 2DGWA 3CJ5A 3BBCA 3KJVA 4N41A 2ASYA 4X84A 4J51A 3FBBA 3GFYA 2ZKUA 1KFSA 3ZV2A 1WC3A 2MHEA 5IWAF 4UQTA 4K4SA 1LXJA 3MZIA 3QIPA 1MW7A 1FI4A 2CPFA 3OSNA 1W7KA 4A8QA 1VQYA 2XLJA 2E66A 3K89A 2OGUA 4MTPA 2C2KB 2NXNA 3UWTA 3GFXA 5J1NA 4O3PA 3T5LA 4UF4A 2CZ4A 2R7WA 2DGUA 4J9OA 4FS1A 2COLA 1PA9A 3A13A 1SIWB 1BQMA 4C8YA 2MLZA 1N5YB 2DGTA 3T1YF 2AJFE 1WTFA 3AAWB 1BUXA 2ACYA 3MUMP 1S9EB 5KTQA 4ZK7M 2CPIA 3DRRB 2CJZA 2ALYB 4MKBA 4DR6F 1M1GA 3T6JA 1RYSA 4C4WA 3EGNA 1UVIA 3BKTA 2VHGA 1IQTA 4OYMA 5KFLA 4UUWA 2RU3A 2VKZG 3L9ZA 2OPRB 2JLGA 2P6TA 3BLTA 3VHQA 2Y1JA 2J5AA 5CABA 2DO0A 3M2VB 4CQ1A 4I6WA 3QLHB 4WZMA 4LQ9A 2FZKB 2VPZB 5LXQB 2AJ1A 2BEFA 1T94A 3V0FA 1U26A 2ROGA 5CCLA 1HD0A 1UVMA 2AJ0A 3P96A 3W3SA 1X4GA 1RAIB 4URGA 3CC4S 2QA4S 4R8UA 3K5LA 1Q78A 4KYRA 3UNYA 1IBMJ 4GVLA 3LPEA 1RDRA 2HHQA 1Z2ZA 1Q6PA 1P9YA 3KLIA 2C2NA 5LXYA 2BJ7A 2FHOB 3NS7B 2OD6A 2VQFF 4RZRA 1RT1B 4Z2XA 2WGPA 1DHMA 1D5RA 3WDOA 1UZHA 5C42A 4MFBB 5HMWA 2M9KA 3DI6B 2B3TB 3EDQB 3GCXP 2KM8B 2WW8A 5B0GA 5M43A 1NPRA 1YTYA 4OZ2A 1ZBTA 2BJ8A 5J1PA 5IBSA 1H3DA 4R5PA 4I0WA 5E3QA 5J2MA 4DV5F 2HVEA 3ISZA 2DTJA 3OTEA 1HNZJ 2DNPA 1REVB 2G0JA 4USMA 4CVMA 1C1CA 2MLXA 1JLFB 1NJZA 4CDIA 3GCWP 3DRPA 2D74B 1HNVB 2PIIA 3I31A 4I2PB 4NCAA 1O51A 3ENWA 1U2CA 1YJVA 4JMJA 2P2CB 2PSZA 2YX4A 2QO3A 2E1AA 4U96A 2DJWA 2WCXA 2BV3A 1RAAB 2V2QA 1X4EA 2MZJA 4IH5A 3KJQB 2BJ1A 1GX6A 3PFEA 3UDCA 2MSTA 2F6FA 2CMAA 2FPHX 2L9WA 1FPZA 5KA0A 4TQRA 3ZTOA 2V8PA 3BQ1A 3PKMA 5T7LB 1YTNA 1RAEB 3LW5C 2HNPA 1RT4A 3HM9A 1H38A 4QU7A 2I0XA 2VFTA 4DV1J 5KA3A 2CJBA 2W01A 5B0CA 3RB3A 1K1SA 1U4BA 1OSCA 4USWA 2A8BA 3QMQA 4Q0BA 4DR3F 5DM7Q 2LYVA 3UD4P 3CT9A 4KSEB 3B4MA 3QATA 1QTNB 4Y6IA 4FXDA 4K5RA 3NMRA 1EAYC 3M8RA 1FX4A 3D66A 1WEXA 2LQJA 3R2DJ 4IG0B 2ZBQA 1S1WB 2ZWOA 1W25A 4XAKA 2BJ9A 2BE2A 2LECA 3PXGa 3LO3A 1RTJB 4GVBA 4EBCA 3MR6A 1FXDA 2B9EA 1YBAA 2A6MA 2CM3A 5GADI 2OIHA 2XO7A 2HNDB 4RPFA 5L1JA 4B9LA 5DDRC 2QTWA 3PX4A 1D09B 2ZOMA 3DOLB 1NK6A 2XBPA 4RUBA 2VONA 3UR0A 3N28A 5KFTA 4DL3A 2J7UA 4P2MA 3SIPB 1YPTA 3L7OA 3LP1B 2PGCA 3BGOP 2D1CA 2MDAA 5CZVA 2JC1A 5KT2A 4WIQA 1NL9A 3QJLA 1UA0A 2FQQB 3CIMA 1R0AA 3X3UA 2XY7A 5DGAA 5EHPA 2CQHA 4FYVB 4M5DB 2GGPB 4YR3A 3D0GE 3DC2A 3BSAA 1VQ4S 3B54A 3R1HA 2XS2A 2ILYA 2XSJB 2QG9B 3ZMPA 1R0BG 1LWXA 4Y3CA 1LYVA 2I42A 5IC6B 4OYBA 1AA1B 2ZEJA 3TZWA 2DRBA 1JNRB 1TU0B 2KHDA 1RA7A 1P1LA 2NCKL 1GQYA 3IS9A 2VDIA 1AZSA 1NDLA 2CQ3A 3QNWB 2DEJA 4NRUA 2UUTA 2QL7B 1T9XA 1M3GA 3O1LA 3OL8A 4DL4A 2Q43A 2BV5A 1FHTA 3IAS9 2D69A 1RHRB 5HMYA 2H4VA 1RISA 5KA1A 5M2RA 3MF5A 2ZVIA 3BZQA 4K2XA 2QFJA 1RT7B 4NLYA 2QT7A 4H34A 4N77A 1VRUA 3JQMA 4FN5A 1W2BR 2FHKA 4F2SA 3WZ0A 2I6MA 4PPZA 3LP2B 1ONZA 1LEOA 3K5NA 1PIEA 4OIXA 1Q8IA 1PAUB 3S3EA 3TARA 3MCMA 2V34A 2A6OA 1MWYA 3PACA 3HHKA 5E3PA 2BOPA 5KFSA 2CADA 1I57A 3AOCA 1H2TZ 1UJ6A 2B49A 4F4XA 3RZ2A 2I1RA 2DGSA 2HGNA 1SL2A 3CMAS 1DBDA 1BE4A 2Y8WA 2B9YA 3C16A 4P52A 4IO9Q 1U7LA 3JQKA 4GC7A 4WP8A 3M8SA 5D3GA 3QT5A 3PZPA 3PG9A 4RUHA 1G7CB 4ZPWR 2H4WB 4ECVA 3TZYA 2CYYA 4C3MA 1CJVA 2HWTA 2F6TA 2RNEA 2Z2LA 3L3CA 2VDHA 3D44A 3G82A 2F8MA 4U6PA 3GB0A 1PBUA 3H90A 4O4RA 5ETLA 1NDPA 2VKRA 5KADA 3KHLA 4DV1F 2XLIA 3LH2S 2KFYA 2MHNA 2MGZB 3T1HJ 1URNA 1SXLA 1S72S 3Q8SB 1DTTA 2LEBA 4ZJQA 2KH9A 4C3KA 1FXRA 1WC4A 4ZVUB 2IRXA 2HLTA 4IQMA 4K8RA 4ZVFA 1ZCLA 5KT3A 2DR6A 4DSIA 4FF4A 3OVBA 4F4YA 2ROPA 5B0FA 1M1HA 3SSRA 5KA4A 1BQNA 5K14A 2IMGA 1HKAA 3W60A 3CEDA 3C6TA 2W7AA 1VJQA 2JHEA 3ZO7A 1I6JA 5AT1B 3I5CA 3QWUA 4DUZJ 3UDEA 1AUDA 5IM0B 2XPCA 2KT2A 5B0AA 4OX8A 3BO4A 3K17A 3A12A 5ETOA 4OZJA 1RWWB 3TUIC 3IBFB 3OFEA 4A8MP 1Q6NA 5T14A 2PBNA 2Y8YA 1G4WR 4QYZJ 3MD3A 1YBUA 1WF0A 2PO4A 2YH1A 1CBKA 1PTTA 3M4UA 2W4PA 3DOMB 1JLGA 3BGFA 3KLGB 1G4CA 3CCMS 1RXOB 4LFCJ 1S1TA 2WOMB 3EZZA 1P9QC 2QX0A 2IBOA 3M2UA 4ICLA 1J5EF 1UKUA 1YWXA 5LOQA 4NPOA 4I1TA 1JB0C 3PHTA 4IOAQ 1MROB 5I3UA 4QW8A 2YNFA 2CVIA 1QUPA 2PMWA 3H42A 2OFHX 1Y3KA 4WBFA 3V6HA 4I68A 1FA0A 3QCKA 1F9EB 1TL5A 1TMMA 1D1UA 1T49A 1Q8BA 4UZCA 2I3RA 2YNHA 1CJKB 1FKOB 3MM8A 3KK3A 4C11A 2H4KA 1ZAXA 2AX0A 5MAOA 4DR5J 4KKOB 4P75A 4PWUA 4CTAB 5DQHA 5I4MA 5ETNA 1TVRB 4DCPB 2Q47A 1BD6A 4FBTA 1A9NB 4DSJA 2XY6A 2JX2A 1RXDA 2CDRB 1UVNA 1P31A 3G6YA 1T03B 3THPA 2I4HA 4PWWA 2FHJA 3MECA 2CJ9A 3UCGA 2EFGA 4WKRA 3C15B 2FJNA 4CCHA 2VFVA 2M7SA 2LXFA 5A5FA 2JH3A 4OHIA 1RBAA 4B9NA 1EB0A 4LFBJ 2ZBIA 4QZVB 5ITHA 1NZ7A 2FVCA 3NGSA 2VPYB 1KTQA 3CJ3A 3VAFA 5LMUJ 3AQOA 5L8RC 2BBEA 4EBDA 2B9XA 1X8DA 2VF3A 3RU0A 2OPSB 3G9CA 4LF8J 4FS2A 2IRUA 1E6YA 1RT5B 4ED8A 1CQNA 3RBXA 1NK9A 4Y2AA 2FD2A 4JYAJ 3DRXA 4UT4A 1YJ7A 8RUCA 2YXLA 2XYGB 3R9LA 3KLEB 3MUTP 3S3FA 1VC0A 1HBUB 2HGMA 3BGUA 5K8OA 2VORA 1FE4A 1NSKL 1KLMB 3OPKA 1U6ZA 5SUHA 2XMUA 2DXDA 3VAKA 1CLFA 2RRBA 3QCIA 5A8KB 4U7UD 1SH3A 1YQHA 3S3KA 4BS2A 3T1HF 4C0HA 3BM7A 3TZZA 2CMBA 2XMMA 2UXDJ 2F65A 4OHYA 1JLBA 4RDDA 2ZNYA 3JSYA 1TKZA 3NXZA 3MM9B 2MZ1A 3M8QA 1RTHA 3VZIA 4ED3A 2HBRB 1SC1B 2H3EB 3BSCA 3QRPA 1DLOB 1R0CB 3NBPA 4AYBD 2EC0A 4LSZB 4RLEA 1B7FA 2UUWA 3RAQA 3HF5A 1RWUA 1ZPVA 3MM7B 4CO3A 2MY8A 1NNYA 4HTIA 2KKHA 4DUZF 1G3OA 2ATCB 1TL1A 5KT7A 1VJWA 4K5SA 5D8HB 2PI7A 2GJIA 3MDFA 2O1PA 3EUNA 3MR2A 3JTOA 4A8XA 3KHGA 1YGYA 1DAXA 3FBFA 1Q86T 3IRWP 4BWJA 2NV5A 3CTRA 2RAQA 1T3OA 2IC3B 1OYEA 5ETSA 2V4QA 4N76A 3Q24A 1RT6A 4JV1A 3BS9A 4PCQA 4NLVA 4DQQA 1QAXA 2Q3PA 4UOCA 1H74A 1VC5A 4EI2A 4JI6J 3JS9A 3THTA 4QWAA 4USIA 1JIHA 4LFCF 4DL6A 1C4AA 1Y00A 4CWBA 2HQGA 3EJMA 4WCEQ 1YLXA 5GVQA 3NMAA 5FD1A 3G96A 1MSWD 1N5YA 3THVA 1M0SA 2Z0GA 2F6YA 1D8YA 4S0MA 1S9EA 4OJ1A 2LQBA 3DRRA 4X65J 2KL8A 2ZDOA 2I5JB 3HLUA 3CD0A 1VQ6S 2A18A 3U02A 1PSDA 2AYEA 1P6TA 4QPXA 3PX0A 4UQGA 1RAGB 3LTOA 2OPRA 2IDEA 1JNZB 3RRKA 2XYHB 2B7CB 3BO2A 1WACA 1QLNA 2HZAA 4RJVA 4RW8B 4HRFA 2B51A 3M2VA 1RB0A 3PRBA 3QLHA 2BJEA 2RQ4A 4ZVPB 2DY9A 2O67A 2R0BA 2EG1A 2J17A 1VBXA 3QCZA 3SI8A 3OFFA 5IXUA 2JSXA 4N7TA 4OHDA 3BLUA 4A8KA 2EBGA 3MPDA 1LW2B 3MM6B 2CNGA 4FYWB 1WOPA 4WPAA 3J7Z5 4IRDA 4DV0F 4LFBF 2HVDA 2E5GA 3MR7A 1U47A 2X51A 2UUPA 2JNJA 1RT1A 1YZ7A 5LMUF 3C19A 5G4DA 3GR0A 4YEAA 2UUCF 4MFBA 4LF8F 4X4TA 3DI6A 3L95X 2G13A 2C2RA 2GIRA 3EZOA 4QDIA 4JYAF 4FKYA 1C2PA 5GAHI 1JLQB 4MH8A 1MNEA
chains in the Genus database with same CATH topology
2D41A 1OIAA 1U25A 4B9SA 3C8YA 4DR2F 3J7YI 5HROA 3LP0A 2R7UA 5KFAA 2EPIA 5HQ8A 1VQMS 3BSNA 3QKQA 2L9NA 4C0OC 2AQ4A 2OPPB 4IOCQ 2I38A 3M1VA 2NYIA 2XCPA 4JI1F 4WYWA 4ED1A 3KTQA 4ECUA 1AROP 4O3RA 4AXJA 4WTYA 4RKKA 3US5A 1AXQA 2IM0A 5KG2A 2HPUA 1LWFB 4BPCA 3O5XA 1BQXA 2DT9A 1REVA 5CA5A 3I0RA 1S0MA 3QO9A 2H04A 2G4BA 2Y2FA 4EFAC 2K8GA 2WHOA 2KHCA 2WONB 4EYHB 4N8NA 1VRTA 4LF6F 2ESBA 1N5QA 2FGCA 3V4IA 4I2QB 4DPOA 4ETZA 1JLFA 2I6OA 1Q6TA 1URRA 4ZHRB 3B82A 3KHHA 2QV6A 1N6QB 2RU9A 2ADCA 1KS2A 4NX9A 4WK3A 3HHLC 1VQNS 1HW9A 5CYQA 2E9RX 2W9AA 5KACA 4GWFA 3JYTB 1HNVA 1S1UB 4Y2IA 2PA5A 1SIZA 4WE1A 5D3GB 1X9SA 4I2PA 3T5JA 2OJ3A 2F8HA 5KFKA 3HHEA 2EK1A 1DJ0A 4QR1A 4TQSA 2UXDF 2DB1A 1KAVA 1QSSA 2JLEA 3E01B 2FB0A 3CO9A 4Y2KA 2ZC3A 5GAGI 5JVGQ 1DZ5A 4YAAA 1CG2A 3MHYA 3ZFVA 2ZH9A 1ZM2A 1Y4ZB 1U1MA 5EGYA 4X4UA 2NQPA 3MMJA 2XG8A 3M8PB 3DLEA 3PHEA 2CKWA 4YUDA 2MMYA 2WAQD 3LOUA 3K7RA 2QA4G 4DSEA 3E2EA 1G1XA 3EXYA 3TOQA 4BCAA 2B4UA 3OXFA 1WRMA 2CDQA 2KRRA 3SZ2A 2DNQA 2P5VA 4BBYA 1A6LA 2FJVA 2FLLA 5EWGA 4O4GA 3I0SB 2AYGA 4F67A 3LGMA 3CDBA 3D1OA 2CG4A 2QSWA 3G4SS 1TK0A 4NLTA 3QCEA 2XZWA 3VAIA 5AXNA 1DURA 4XDCA 1TKXA 4Y34A 2A1BA 5BJRA 4ECWA 1G1FA 3BJYA 2Q05A 2OTJS 1Q79A 3IGNA 1FQ1A 1TL4A 3RB0A 2GV1A 4Y65A 2WSEC 2XNQA 2WB4A 1L8GA 1P8GA 3CCLS 3KNGA 1CEZA 3BRHA 3QCCA 2E1CA 1TFYA 1N34F 2QRRA 2GO9A 3P49B 1FRMA 4WFXA 4Q45A 1DTTB 2UV8G 1SJRA 4ZKAA 3NKYA 2KDOA 1LOUA 4H4KA 1GT8A 2EKYA 1T05A 4PQUA 3G71S 1SH2A 2PFFB 2DGXA 3GIMA 3PX6A 2DIVA 1BZCA 2GWOA 4HI1A 2CNHA 2HNZB 1E6VB 4MK8A 5CCMA 4K4UA 2QCJA 2FJDB 5T7LA 3D9CA 1FPRA 4TXSA 4O3SA 4B08A 1WF2A 2YX1A 1JK9B 1G1HA 2R2RA 2UUAF 1ULRA 4DQPA 3S7RA 2VC1A 5E41A 4LJMA 1HWUA 5HLFA 2CQIA 1DTQA 1TKTA 5CZXA 2QBRA 4EGLA 2HQIA 1BQNB 3FZBA 3K5OA 3LAKA 3ZMQA 3UDLA 3N6LA 1M1KT 1X24A 3DFEA 4DUYF 4XPEA 1HBNB 2VV5A 1SJFA 4N47A 3SQGA 4ZCLA 1G4US 4KT0C 3ZC4A 3C6TB 4EYIB 2G6ZA 1XERA 5F8GA 1QUVA 2N7CA 2D3UA 1R7IA 3FEYB 2KB2A 3TUJC 2ZHOA 5HBMA 1YJUA 3NRBA 1VHRA 1NK4A 4CIOA 3RBDA 2C2EA 1N32F 2RT3A 3OMHA 5I42B 3Q22A 3V0EA 4EO6A 3F81A 3GV7B 3J80Y 2PA3A 3M32A 3TUZC 3PW5A 3DXSX 4NA3A 2FVRA 2QDPA 1HI0P 4B9UA 4ELUA 2GNKA 4JI6F 1LW0B 2EFQA 1FVQA 4IOBA 3HVAA 1Q7LB 2V2KA 3IRXA 5KG4A 2QCTA 2D7SA 2JEFA 1RT3B 2YKMA 4QU6A 3QZ7A 2XMWA 5JXSA 2DPIA 5HL7Q 2I4GA 2G9OA 2F70A 5HN0A 2W24A 4NLQA 1JXLA 3KOAA 1C1BA 4EZ9A 3IO1A 4BWMA 1WHVA 4RBTA 5DDOC 3J81Y 2Y1IA 4C2MA 2YNIA 4Y28C 4D3PA 4Z6BA 2NTAA 3ISNC 3VAJA 5B0EA 5FLXY 3OQ2A 4GRYA 4ID5A 5THWA 4ECSA 3HPOA 1JKHB 3HO1A 3QCFA 4HJPA 2GFFA 3BO3A 3VAMA 1B0VA 2J7KA 4FVCA 4IG0A 1PO6A 2O66A 3SCIE 3V81A 1WEYA 3MEGA 3X1LB 4OHEA 1RTIB 1S1WA 1F9FA 2D9PA 2LLZA 4WJBA 3TA0A 4DX8H 3DNCA 3HX9A 2CQGA 1OO0B 2FHMA