4WU2A

Structure of the ptp-like myo-inositol phosphatase from selenomonas ruminantium in complex with myo-inositol-(1,4,5)-trikisphosphate
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
313
structure length
313
Chain Sequence
b'TVTEPVGSYARAERPQDFEGFVWRLDNDGKEALPRNFRTSADALRAPEKKFHLDAAYVPSREGMDALHISGSSAFTPAQLKNVAAKLREKTAGPIYDVDLRQESHGYLDGIPVSWYGERDWANLGKSQHEALADERHRLHAALHKTVYIAPLGKHKLPEGGEVRRVQKVQTEQEVAEAAGMRYFRIAATDHVWPTPENIDRFLAFYRTLPQDAWLHFHSEAGVGRTTAFMVMTDMLKNPSVSLKDILYRQHEIGGFYYGEFPIKTKDKDSWKTKYYREKIVMIEQFYRYVQENRADGYQTPWSVWLKSHPAKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myo-inositol phosphohydrolase
publication title Structure of the PTP-like phytase from Selenomonas ruminantium in complex with myo-inositol-(1,4,5)-trikisphosphate
rcsb
source organism Selenomonas ruminantium
molecule tags Hydrolase
total genus 110
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 3.1.3.8: 3-phytase.
pdb deposition date 2014-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14566 PTPlike_phytase Inositol hexakisphosphate
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1690 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4wu2A01
3.90.190.10 Alpha Beta Alpha-Beta Complex Protein-Tyrosine Phosphatase; Chain A Protein tyrosine phosphatase superfamily 4wu2A02
4JBCA 4JMKA 4QBEA 1PA9A 3S4OA 2J16B 4AZ1A 2FJMA 4QAPA 1PTTA 4NNDA 2QBSA 1BZJA 4PYHA 3O4UA 5I6VA 1NO6A 2Q05A 2PT0A 2HVLA 2OC3A 1OESA 2GWOA 3QCHA 4NWFA 3U96A 2HY3A 1Q6PA 1PTVA 3RZ2A 3S4EA 3F41A 2CFVA 3F81A 4YR8B 4GE2A 4ERCA 4MBBA 4HRFA 1U24A 2BV5A 2VEXA 3ZM3A 4WTYA 1I9TA 2CNFA 3V0HA 1OEUA 1OEOX 4PVGA 1ONYA 2QDMA 5MMZB 4IKCA 2Y2FA 1YN9A 4KYRA 4H34A 2BGEA 2J16A 5GTJA 4DGXA 3N0AA 1R6HA 3BLTA 3MOWA 3RO1A 3BM8A 5KA1A 2CMBA 1EEOA 2H4GA 4WU3A 1YWFA 4OHLA 1ECVA 2QBQA 1OHEA 1YFOA 2ZMMA 4J51A 1AAXA 2F6WA 1EENA 2H04A 2HNQA 2WGPA 1ZCKA 5BZXA 1PYNA 3F9AA 5K25A 5KA8A 3QCIA 3D1OA 1G4US 2F6YA 3V0EA 4OHEA 2NZ6A 1YTNA 3I80A 1NL9A 4GFUA 2I6JA 1SUGA 3QCMA 1Q6TA 4GFVA 4KI9A 2B4UA 2GP0A 3QCKA 3QCCA 2NT2A 2QCTA 1LQFA 3SR9A 2Y96A 4RI5A 4HJQA 2I1YA 5BZZA 1G4WR 3AWGA 4BJOA 2I6MA 4NWGA 4R0TA 2F6FA 5HDEA 2PSZA 1MKPA 2G59A 1NWEA 4ZN5A 2CNIA 3BLUA 4OHDA 2C46A 3QCEA 3V0JA 1C84A 2MBCA 1A5YA 2HCMA 2VEVA 3AWFA 3ZV2A 2OZ5A 4DGPA 3QCNA 1C83A 4S0GA 4D3QA 3LJ8A 5KADA 2QBRA 4Y2EA 2QCJA 4ZRTA 3D44A 3OMHA 1LYVA 4RDDA 5KA3A 4D3RA 2I75A 4QAHA 3D1QA 2HXPA 4KYQA 2CNEA 1OETA 4QUMA 5BUGA 3QCJA 5EHRA 1ONZA 3NMEA 1PA1A 1Q6NA 1XXPA 5KABA 2QEPA 1XBOA 2C7SA 3QCBA 3I7ZA 3EMUA 3CM3A 5J8RA 3EAXA 2HNPA 2GJTA 4R30A 4NX8A 1G7GA 4NYHA 2H02A 4JMJA 2B49A 1C87A 2PA5A 5EHPA 2JJDA 1LARA 1XXVA 1OEVA 1OHDA 1ZCLA 2A3KA 4B04A 3QCLA 2PI7A 2I42A 3O3LA 5KA2A 3V0IA 2R0BA 2B4SA 4GRZA 3RGQA 2PBNA 3O4TA 3CWEA 4GRYA 1PTUA 3GXHA 1YTWA 1PXHA 3SMEA 1T48A 3A5JA 2CNHA 1RXDA 3H2XA 2SHPA 1WCHA 1OEMX 1T49A 5AWXA 4RKKA 4RI4A 1Q6SA 4R0SA 3A5KA 3S3KA 1G1GA 2M3VA 4JNBA 2F46A 1RPMA 3F99A 1FQ1A 1YPTA 1L8KA 2P6XA 4QBWA 3OLRA 5K9WA 2Q47A 5KA7A 4RH5A 1PTYA 3EU0A 2HC2A 5IBSA 2NT7A 5M43A 4ZI4A 1G1HA 1Q6JA 2OUDA 5KA9A 5LXQB 4GS0A 2QDCA 2I6OA 1FPZA 2B3OA 2FJNA 2I3UA 3BRHA 3ZM2A 2RF6A 1U26A 2VEWA 2CNGA 2G6ZA 2F71A 1KAVA 2B07A 1U25A 1ZZWA 4TVVA 2F6TA 2I6IA 1KAKA 3ZMQA 3S3HA 5K22A 2QDPA 4WU2A 5KAAA 1G1FA 3QCDA 1WRMA 2CM3A 2IMGA 4D3PA 2VEYA 1P15A 1GWZA 5KA4A 1YGRA 2PQ5A 2NV5A 3V0DA 3S3EA 4WOHA 2CMCA 3MMJA 1OHCA 2J17A 4OHIA 2ZN7A 2OOQA 4QUNA 1FPRA 1QZ0A 5K23A 3D9CA 1BZHA 2E0TA 2HB1A 1JLNA 1YTSA 1L8GA 4H1OA 1I57A 2B4PA 4GE5A 2VEUA 1VHRA 2I6PA 3M4UA 2BIJA 4YAAA 1D5RA 2I3RA 2HC1A 5KA0A 3O5XA 3QKPA 1ZC0A 2F70A 3EB1A 3QKQA 2F6ZA 2H4VA 1WAXA 2CM7A 5BX1A 1C85A 2FH7A 2BZLA 4BPCA 1GFYA 1G7FA 3ZMPA 2I4GA 1J4XA 1M3GA 4Y14A 1BZCA 1XRIA 1Q6MA 1C86A 2CM8A 2I5XA 3F9BA 3ZM1A 1PH0A 4I8NA 3AWEA 3RGOA 3QCFA 1T4JA 1X24A 2ESBA 2QBPA 5K24A 1NNYA 3GXGA 2AHSA 3I36A 2H4KA 3PS5A 1YZ4A 3D42A 4RHGA 3B7OA 1Q1MA 1NZ7A 2H03A 3V0GA 4GWFA 2A8BA 5K9VA 1C88A 4RH9A 2AZRA 4ICZA 2I4EA 1NWLA 2NLKA 1YGUA 3V0FA 2CMAA 2YDUA 4HJPA 1XM2A 3MOZA 5IBMA 2I4HA 4OHHA 3EZZA 3ZM0A 3QCGA 4GE6A 2CM2A 2NTAA 2F6VA 2DXPA 1I9SA 2P4DA 1JF7A 2B4OA 3D1HA 2BGDA 3O4SA 5KACA 3S3FA 2CJZA 1QXKA 4Z6BA 1V3AA
chains in the Genus database with same CATH superfamily
3ET6A 4N47A 3VCDA 2E5HA 1REVB 5RUBA 2K7JA 1FDAA 1RTJA 2MKCA 5C24B 1FEEA 4DR1J 1QVFR 1HARA 5J1NA 4YR8B 2ZNYA 5KFRA 3MR7A 4N41A 4ERCA 2MZ1A 2OPPB 4MBBA 3FEXB 4HRFA 3CJ5A 3TR5A 4M5NA 4WTYA 4F4ZA 1HI8A 1OEOX 3V81B 1TU0B 4IKCA 1JLQA 1UW4A 1YN9A 3TYTA 1FDDA 3KK1A 3PHTA 3EWGA 4UW2A 2YX1A 4DR1F 3EM1A 4YR0A 4KE5A 2YTCA 2HBZB 3RO1A 4LR7A 4DR3J 2YWFA 4LSZB 3M8PA 2ZOMA 2VBYA 5ETOA 4O4RA 2ZMMA 5IC6B 4DX6A 1NM2A 2F6WA 2AD9A 2WGPA 2LQBA 3HD2A 1A7GE 4QW8A 1TKDA 3QCIA 4QIVA 2ROEA 2YWEA 3AT1B 4MIAA 4KGXB 5F8GA 2F8MA 4GFUA 1DHMA 4PXDA 3OXLA 3PYZA 1XMOJ 3H20A 3SV4A 4YFUA 3GZ7A 2J7KA 1JJ4A 4ZIWA 2A2CA 3MPVA 1YGYA 4OMFG 2DPIA 1M5VC 2VQEJ 1LW2B 1RBLA 4ZVUB 2VEVA 2BVZA 2NS1B 2BA9A 3QCNA 1C83A 1S1XA 1ZETA 3EXYA 1LYVA 1WEYA 5F8HA 2Z56B 2VZ9A 1TL3A 2OIHA 4ZJQA 4HR2A 3DLBA 2D41A 5KABA 2CQ3A 2IVMA 2ROGA 3UR3C 1UWBA 1I51B 4KKOA 4C0HA 4F3MA 1C87A 2GMHA 4RUBA 1ZCLA 4A8OA 2CWXA 3HKWA 5AXLA 3EXCX 4FVCA 5KA2A 2MZQA 2YWGA 5CYQA 3LUYA 4O3SA 2HK3A 3KLVA 3GE9A 2ZH9A 3QIDA 2RAQA 4DL6A 1T48A 3LGMA 4KRWA 3D6MB 1TVRB 2FDNA 2HHHJ 1J5EF 1XWLA 1P31A 3LA0A 1ZA1B 4WFZA 3QNWB 4U7CA 2XSFA 4DUTA 4I6WA 5C42A 4Q8FA 2HMIA 2WSEC 3FCHA 3B78A 3B4DA 2ZOFA 3IG1A 2BE2A 5K9WA 1W7WA 1S12A 3WX4A 1NHKL 3MI7X 1SC6A 1ACMB 1GX6A 2QT7A 4RBUA 4OL8A 3MM8B 5HMXA 1VRUA 2B3OA 5ETSA 2DISA 2FJNA 4Q5VA 1HW8A 5ETLA 5DLFA 4DV1J 2HSEB 2MQLA 4XO0A 1YJWS 5IT0A 3AFGA 1UAWA 1RHQB 3DDIA 5KAAA 5B0CA 3OHBA 2CZ4A 2W8LA 3GFHA 3RAMA 1TMJA 2XMJA 4U8YA 5IS2A 2ZBRA 2GAHC 4ZPCA 4CO2A 2DIUA 4G1IA 2LEAA 4MKVA 1TKTA 2B9WA 2QZ8A 1LK7A 1N34J 4DCPB 4WFYA 4DV1F 1Y7PA 1YTSA 3HSDA 2HHVA 2F5GA 2OLWA 3FQKA 5M2RA 3W2WB 5KFDA 2QSWA 1WG5A 3M6WA 4GO7X 3UNYA 2V5HG 3NRSA 1EQMA 4FPRA 1JIHA 2F70A 5M2PA 2FVPA 3ILIA 2CM7A 5MLCV 1VQ8S 4I2PA 5CYJA 2HFZA 1NU4A 2E5LJ 3ZM1A 3JYTB 3LP2A 4RU2A 4ER8A 1FJGF 3R6GB 4L6V3 3OVAA 4YB6A 3ET6B 1BQNA 1HKAA 3OT9A 3GIKA 2VPYB 3RGIA 2M0GB 2QMXA 3V0GA 3VV2B 5EUHA 5K9FA 4FNHA 2W25A 3V0FA 1S49A 2QLWA 5LSRA 4UY8T 5JMNA 2GQCA 1N52B 3IBFB 5A5EA 2F4FA 2CXEA 2P6TA 4Q8EA 4ENOA 4I67A 3PV8A 5AJ3J 3J81U 2AMCB 3SCLE 3O4SA 1SQGA 2XMAA 2CKWA 2OPRA 1JLQB 2XMMA 4QBEA 1OY9A 1ZAVA 3UWTA 2R7OA 4QAPA 2IVFB 2ZKUA 4W90B 3HFKA 4HDHA 1U1KA 2QL5B 2QTWA 4LF6F 2MKJA 1NO6A 2Y67A 1RAGB 1IBCB 2HY3A 2GC5A 2RT3A 4N56A 1NK7A 2XM3A 3L7PA 3IP0A 4YY3J 3NL0A 1YJ9S 2KHDA 4RUCA 3ICLA 1FK9A 4DQIA 1V9OA 2LDIA 4CCHA 4ED5A 3R7NB 1V3SA 4KC5A 3N5BA 6FDRA 5MMZB 2PMZD 4U7UD 2FUG9 4KO0A 2K7KA 3T3FA 2C28A 5GTJA 1K1QA 2PE8A 4WFAQ 1HQEA 3P96A 4U9RA 1N88A 2ERRA 2IPOB 4OYWA 5DG7A 2CPDA 1RAEB 4YY3F 3RYLA 2KXNB 4M5IA 1HNIA 3R97A 4RL1A 5F8NA 2VKRA 5KFCA 2X1GA 1RKJA 2DXEA 5FLXY 1MWZA 1S1XB 1YJ7A 4NCBA 1P6TA 2OAUA 1UVMA 2NYIA 4NPOA 2XGQA 1SUGA 2DK2A 2VPXB 1RYRA 2M8DB 5DS7A 1ZPVA 4NEYA 2GJIA 2L9NA 3FEZA 1H98A 1UWBB 4KKOB 3MFHA 2I6MA 3MR2A 4LFBF 1HWIA 5LJ5Y 1F5BA 3A8JA 2Z2LA 2IA0A 3KLIA 1JLFA 5C2GA 4ZVTB 4DGPA 1Z4UA 4OZNA 4S0GA 1U1QA 5CYQB 2MLXA 3QT6A 4JI5J 1WORA 2WHOA 1I1GA 4QAHA 4ZPAA 3FDSA 3QWPA 4CO4A 1M5SA 3BREA 3NCQA 1TK8A 2AGOA 2KVIA 4KGZB 5AE1A 1Y9OA 5D0GA 4M94A 4F26A 3SQGA 2HBQB 2ZWPA 3EZOA 4NX8A 2POKA 4Q2LA 2FLPA 2HMIB 4NYHA 1JLAA 2MKHA 1YIJS 2E9RX 4IDKA 4EBCA 3IG1B 2BE2B 3MD1A 2HHUA 3D28A 3AOAA 4ZPBA 1VFJA 3UI3A 1FE0A 4LIRA 3FC9A 1VRUB 5HI7A 3IS9A 3W5XA 1XMBA 3SFGA 2PN6A 2JC0A 1WCHA 2QA1A 3AJ2A 3NAIA 3DU5A 2FVRA 1Q16B 4OZ3A 2AP6A 2KZZA 2GX8A 4CLSA 2FPHX 5ETQA 3C6TA 2CNNB 1U4BA 3H59A 1CG2A 1T3NA 2BACA 2HC2A 2IA6A 4K0KJ 1TKTB 5D4NA 5E41A 2BJ7A 1PC5A 2I3UA 5IWAJ 2XWXA 1R27B 4TVAB 2F6TA 1NDCA 3TVKA 4DSLA 3R7SB 2CM3A 1ZA2B 1F2HA 3VTIA 2VEYA 2P9EA 1MG7A 4UUXA 4I2PB 3ILOA 4WOHA 1FXLA 1JWWA 1X60A 4EUVA 4OQJA 5L9XA 1UVKA 1UVNA 5K23A 5IT9Y 2VICA 2NYHA 2EK6A 1K44A 4LF1A 3JSMA 4FN5A 2OPQB 2RHSB 4K4YA 3CMES 1G3OA 3CJ2A 2J0SD 1F6TA 1MNEA 3M4UA 5KA0A 2IM1A 1B0TA 3HVWA 2UXCF 4IRCA 2OMOA 1P1TA 4P74A 5LOQA 5IM0A 3A3OB 5F3ZA 1CJVA 2XGPA 3K57A 2CM8A 1N54B 4I8NA 4C8KA 2BKOA 4JI3J 5CZXA 1OS5A 3DRPA 3OR2A 2FJDB 3PX6A 4ECVA 4DSEA 2XS5A 2OPRB 1YZ4A 4QYZK 1KR4A 3ZZTA 1R6YA 4RO0A 1JJCB 2UUCJ 2P8IA 5IV4A 4C4WA 2WW8A 1D9DA 4CLZA 4JI3F 3ISNC 4IUFA 2GVZA 4OI2A 2QLJB 2NTAA 2XNRA 1VQOS 1H6KX 2MQPA 3ZNJ1 2HYIB 2GHWA 1FK9B 4BC9A 1OY6A 1E0DA 2P4DA 2H1YA 2J0XA 4YR3A 3DU6A 2C2ZB 3FCWA 1V5VA 3ONQA 2DH8A 2MYFA 2HFSA 2N7YA 4KO0B 3ELHA 2OI2A 4OJHA 4JI4J 2FHJA 4IOBA 4NNDA 4IOCQ 5KFYA 2IY5B 2C2DA 3QCHA 3D2WA 2J7WA 1TK5A 1HNIB 1Q6PA 3F41A 4X4PA 1NHVA 3ZTQA 2PFDA 3L7UA 4DV2F 2HRTA 2IYGA 1S4EA 3V0HA 2YWWA 3SCJE 1U09A 1T05A 1R8AA 4JI4F 3TQ1A 2RDDA 3CXCR 2MQOA 3LOUA 1E6YA 2YQ1A 5HROB 1TL4A 4EU0A 4DPOA 5L39A 2VODA 3QSYB 3M9OB 3BGLA 2Z2YB 4P7VA 3CE8A 1UPMB 3MCNA 3BKUA 3KLIB 1JLFB 2G9OA 3D3BJ 3H2UB 1PYNA 2UAGA 5KA8A 4X62J 4OYIA 3D67A 1RWOB 4DG1A 4UZCA 3VHQA 1PO6A 5B0AA 3U02A 3R3TA 3H7HB 1SJ4P 5FDLA 3THPA 2B4UA 1T11A 2NT2A 4OZ1A 4K4UA 2HURA 2QC3A 4MT1A 4HJQA 2I1YA 2KXHA 3SQGB 5HDEA 4NA3A 2PSZA 3CJRA 1JLAB 2GCBA 2O67A 2B9XA 2DKOB 2FJWA 1LXJA 5GAGU 2UXDJ 3I96A 4IDKB 4Q44A 4PABA 2QV6A 1YHQS 3W9JA 3VR1A 3KMSA 2J76E 2BXJA 3QWUA 1WKKA 4ZRTA 3BO2A 3IS9B 2V8DA 3EDRB 5IOLA 3HHEA 4MH8A 2W4DA 2FC8A 4Y2IA 3EJMA 5BJRA 2YKNA 1H0HB 4OI4A 4RW6A 1G7GA 4ED2A 2H02A 4QIEA 3P3DA 3C6TB 5KOWA 2AGPA 2BRLA 3CDWA 2DEJA 3G96A 3IMQJ 2H48B 4CLWA 4LF9F 2HHPA 4DEZA 2LU2A 5EGYA 1NXIA 3T5JA 3HLUA 3PKMA 4LFAF 3ZTPA 3G8TA 1RHMB 4NI2A 1YKWA 1LEOA 3DCAA 5CYMA 5IFMA 4U95A 1RK8A 3UCUP 2E66A 5HL7Q 2KT3A 1QVGR 5KFVA 3EPGA 2M52A 3S3KA 1G1GA 2MQ8A 1LWFA 3NY0A 1OYDA 2CJKA 5KFQA 1B4SA 1URRA 4B3TJ 1DLOB 4QBWA 2A6MA 1IQZA 1SKSA 3MHYA 3FJ2A 4UOHA 2K06A 4A4JA 3J80Y 1F5AA 1FPZA 5F9NA 1WWHA 2C3UA 2MMYA 3BRHA 4FPIA 1NKBA 3JSMB 2VC0A 2B5JB 3LWLA 4TVVA 1RUSA 4J37A 4BWMA 2B7CB 2OSQA 3AOBA 4USTA 1X9WA 4WU2A 4RUHA 2MSSA 1N5SA 3VALA 3S7RA 3R2DJ 4PG4A 5KA4A 2FHJD 1YGRA 5IM0B 2YNIA 3V0DA 5HQMA 1UL3A 3ZO7A 1WKJA 3KJNB 2JVOA 3TZXA 5E5NA 4C98A 1DTTA 2DNMA 1X9SA 3WC2A 3HFVA 8AT1B 4I4BA 1N36F 1FPRA 3DRPB 3AD7C 1HWJA 1WNEA 4EFAC 4X66J 1JMTA 1VHRA 1D5RA 2I3RA 2DJWA 1ZC0A 4NLUA 2AM2A 4AL7A 2H4VA 3HSJA 3LAKA 4DUZJ 1HNZF 4MFBA 3JQKA 4ZLJA 4G1QA 4B3MJ 4HH0A 2GVZB 2IAJA 4K4ZA 4WBFA 2XCAA 3M32A 3MF5A 1IBMJ 1GT8A 3FCVA 3Q22A 4FVMA 4QU7A 2V4JA 3R5CA 1WG1A 2EBGA 2DGVA 3UN2A 1FNMA 1C88A 4RH9A 1S9GA 3H5XA 2L48A 1RSCA 1RBOB 1L3VA 3MOZA 2W4CA 3GJSB 5J1PA 2Y1LB 5DDRC 4P71A 2PMWA 1VBKA 4F3QA 3QZ8A 1RCOB 2HIYA 3ZTOA 2CQ4A 1ZTWA 2XYHB 1O6XA 1BC6A 2CJZA 5L9NA 5M2UA 1T05B 4NMXA 4WE1A 1SH3A 4LF5J 1W78A 2CJBA 1VYAA 3CF5Q 1T9YA 3CCRS 1E6YB 4DS5A 3CJ3A 5I6VA 3CD6S 4PG7A 3A8IA 1HWLA 1OMSA 5EWGA 3A1YG 3MMAA 4KTQA 4NL5A 3N28A 2QFIA 1R0BG 4WTOB 4AYBD 4UT4A 4WIQA 1ZPWX 1X0PA 2F65A 4RU9A 3TUJC 3VWSA 2ZZMA 3KLHA 2R7WA 2XMWA 2DHSA 1MN7A 2ILZA 3SZ2A 1RAAB 2ZHAA 1U1OA 3DFEA 2FQQB 4IRDA 4DG1B 4LF5F 3LP1A 3JAMY 2Y2FA 3MM5A 2Z58B 1RWKB 2V2KA 2HVHA 3T5KA 5FDLB 4TLRA 1SIWB 1VI7A 5J2MA 3G82A 3NWRA 2QIFA 2V34A 2XHWA 4KQZA 2BZ2A 4M5KA 2IMWP 3PFOA 1NKEA 1SI9A 2VFSA 4B9UA 3SYZA 4GFVA 4YMEA 2Q43A 2BX6A 4C48A 2PC6A 3PNIA 5F8IA 1LQFA 2YKNB 1OY8A 2ZH7A 3JQMA 2KM8B 1H7XA 2XLJA 1G4WR 2GGPA 2CPEA 1D09B 4RW6B 3DLJA 4JYAJ 4C9DA 5I4MA 5JVHQ 3W5YA 2VBWA 3TNVA 1N5QA 3DLGA 4GVLA 3FBBA 1VC5A 1RT1A 1KLMA 3PM9A 2HCMA 5KOXA 2E29A 1HL6A 5KG2A 4ES3A 3FRYA 2R2SA 3BR8A 4QR0A 5KA3A 1A0OB 2ZH3A 1NJWA 4U6PA 4NI2B 4QIFA 4TYBA 5CYMB 1NK9A 5BUGA 2KT2A 5EHRA 2QE5A 3DM2A 2NXJA 1FJEB 3ZM5A 1O5JA 2RH3A 5K14A 5HVGA 1XBOA 4JYAF 4LBPA 3PW0A 2LU1A 1LWFB 3GJTB 4GO5X 5HVHA 4RUAA 1EIYB 3EZ5A 3NNHA 4DF8A 3QCLA 3G8SA 2CNLB 2ALZA 3Q2TC 3G86A 3OQ2A 1GX5A 2OEMA 4EO8A 2Y8YA 4ETZA 2BJ3A 3A5JA 4OI1A 3TI0A 2LYVA 3J7Z5 2VJVA 4XDCA 3QRPA 5HBMB 3A5KA 1RABB 2UP1A 1X7VA 6FD1A 1CC7A 1LXNA 3OLRA 2Q66A 2LEPA 3H40A 2YKAA 5LMUJ 1X31C 2FZKB 3EVOA 1DTTB 1FESA 5K8NA 3CJSA 3MCSA 1HA1A 3K5PA 3H42A 2ZNZA 4WP8A 1U6BA 4C8OA 4KPCA 4P75A 3KOAA 1SH2A 4PQAA 2CPIA 1RTIA 1T9UA 2W1BA 1Y5NB 3MTJA 2WB1D 2D3UA 2MKYA 1ZM9A 3S01A 4MFBB 4G1QB 1TKZB 1PJ5A 2IAJB 3MMJA 2KFYA 3KG0A 1RTDA 2IRXA 3BN4A 2XWYA 4DR4F 1PIEA 4CNZA 2VDHA 1FVSA 3H8YA 2E0TA 1UEUA 1TQLA 4HTIA 4B3RF 5GADI 4Z2XA 1C1CB 1JB0C 4H1OA 4DDFA 1Y11A 2VFRA 2FLLA 1WDDA 2DNKA 4MK9A 7FD1A 1S1UA 3ULHA 3C46A 2YPZA 2IM0A 2IRUA 4WP3A 2R7SA 4OIXA 4KHPJ 3QKPA 1J6UA 1S9GB 2MZSA 4HACA 2R8IA 2NREA 3HHDA 5CZVA 3QGHA 1X5OA 2MZTA 3I5CA 3VQSA 2XPCA 3CCLS 1VQ7S 1FRJA 2QX0A 2E5JA 4HDGA 2BQRA 1YG0A 4C0OC 3VQTA 1UVJA 2CVEA 5KG4A 2KKHA 2ESBA 3EVWA 2GVDA 4DSIA 2QL7B 4DL7A 4WE1B 1X4BA 4A48A 4KHPF 2EK1A 4RPFA 3QPIA 3Q8YA 1SXLA 1WKLA 2E7XA 3HCXA 2ZH1A 1YRTA 1WC5A 4A8SA 4ZA1A 4DQSA 4YUDA 3NG8A 1FGSA 4FXVA 2C3MA 3AA8A 3RUBL 5BXIA 2GS8A 3F0NA 3OSNA 3KLHB 3QCGA 2X3GA 1S72S 4ZHRA 4PYDA 2YKMA 3D1HA 5KACA 3BSAA 4UUWA 3LP1B 5L1JA 1N5TA 3WZ0A 2GMJA 4AZ1A 2MEWA 2MKIA 1UA0A 1QTNB 4BLGA 4F36A 3L95X 3M2UB 2HVLA 2QLXA 3ZXWA 2AYMA 3G82B 2Z2MA 1J2VA 3QJLA 1R89A 3CIZA 4AXIA 2F00A 5L1LA 4ECXA 1TL7A 5CXTA 1P9QC 1L3SA 4URSA 3TVZA 2K1RA 2VEXA 4JI2F 1Y00A 1DFDA 1TL5A 1X4FA 1Y5IB 2B8QA 4ECQA 4DFKA 2WJPA 1JXVA 3CDBA 1IUJA 3N0AA 4NLTA 4RZRA 1AA1B 5A8KB 2XHCA 3K17A 2WW4A 3NGUA 2GGPB 1PYSB 1W2IA 1O51A 2RJZA 5GADU 1P3DA 2B3TB 3DLGB 4X4NA 4CLPA 1RT1B 1U1MA 5KFWA 1M1HA 5BZXA 1KLMB 4X65J 1EQ0A 2OUGA 5L1IA 3T1YF 2F6YA 1FEHA 3DGPA 2D9PA 3PYDA 1KQGB 3QZ7A 1NL9A 2DCLA 3OXGA 3O1LA 1AFIA 3DM2B 1WSRA 3CO9A 2VBZA 3MGJA 1X5PA 4OYPA 1NSPA 1YRUA 2OELA 4QU6A 2GW8A 4EO6A 1PSDA 2XQCA 3CT9A 1JK9B 1HNWJ 4YB7A 3BLUA 3EUNA 3QCEA 1WUUA 2UXBJ 1RADB 3AXMA 3KXDA 3DLEA 3FGVA 2Q6BA 2VTEA 1IVZA 4HHHA 3CMAS 2G0IA 2CPFA 3PX4A 2HNYA 4M8LA 3BBBA 1S9EA 3SSSA 4F2SA 2DXDA 3CNQP 1XXPA 4CYUB 1HWUA 5F0UA 5I3UA 2ZBCA 3WIVA 2GJTA 5IT9U 2CPHA 3KUGA 1OSDA 5HVFA 2P9GA 2LQ9A 2PI7A 3AD9C 5DDPC 3KNAA 4GRZA 1Z1ZA 2YY3A 2VPWB 3CWEA 5F41A 4Z37A 3UDCA 3M8QA 2YQ3A 1VQ6S 2CJYB 4ZDNA 1IKYB 3KDNA 2SHPA 3R5DA 1DURA 3NGSA 3PXGa 2DXFA 3BS9A 4N7TA 1RTIB 1ZS6A 3GV8B 2LQ5A 3OV7A 3MPDA 1S0OA 1MU2B 2D3O1 1RJJA 3AAWB 3T1HJ 4OYAA 4ERDA 2QFJA 1WF2A 3CD5A 5HMYA 4J9RA 1RAJA 2EWHA 1RTDB 2B9YA 2HS4A 1D0EA 3KFWX 1U26A 4F4WA 4AUKA 1TELA 3K58A 2IM2A 2BOAA 2I6WA 3I87A 2O3DA 1S1UB 3AD8C 1FERA 2EKYA 1RWWB 1U2CA 4UOGA 1EB0A 1MMNA 4HACB 1HYSA 3CPWR 2KDOA 4DSJA 3MFIA 2WONB 4KT0C 2RU3A 3MAQA 4JI6F 3ZZRA 4OHYA 1C4AA 3DOKA 2ZN7A 1VC0A 2VF3A 4J9MA 5L8RC 3D9CA 1GNKA 2GVDB 5KFIA 4OYXA 2HB1A 5HLFB 2MSTA 1PBAA 2LXUA 1VRTA 4LMZA 4C12A 1L3TA 4DR6F 3DKDA 1TL1A 4I56A 4LF8J 3EB1A 4IKAA 1OQ6A 3FSIA 1JNRB 2LECA 2AYGA 4DV4J 2BZLA 1G7FA 3CSKA 1M3GA 5U47A 1WELA 1NBEB 4FKXA 4USWA 1KOOA 3E01A 4ZHRB 1JLEA 2XMVA 1RAIB 2YKMB 4LF2A 1GXLA 2H4KA 2K8GA 3MOJB 3AJDA 3BSCA 5KFPA 1UVIA 1NZ7A 2VC1A 4LF8F 2J0WA 4GWFA 1LNQA 4FYWB 2A8BA 2EFGA 2Y8WA 1H74A 3AOCA 4PKDB 3Q23A 3QJJA 4DPTA 4ZCLA 3BO4A 1IBKF 4YEAA 2CUYA 1JJ2R 2LLZA 2W9BA 1NDKA 3K7RA 3LGNA 4JOUA 2GJFA 5GMDA 4F2RA 1TL7B 2HWIA 3FMWA 4RNNA 2K1RB 1CULA 4USIA 1SJ3P 5E7OB 4NLSA 2BGDA 4C8MA 1YZ7A 3B6BA 2OKQA 1HQUA 1PA9A 5LJ3Y 3S4OA 1RT5B 2M70A 4PWUA 5ETMA 4I7FA 4M63A 1NSKL 5KG0A 5EWFA 3W60A 2R7UA 4EGLA 1VQYA 1YBUA 3K0JA 4BUBA 4KHRA 3RZ2A 2J0QD 3O5TB 2WVDA 5A5FA 3UN3A 1R7IA 2CPJA 2VJUA 2ZM6J 4BDPA 2J6TA 3PCOB 5KFFA 3M30A 2SXLA 5A6PA 5KG1A 5C25A 3LWMA 1WI6A 4FDFA 2OPSA 5E3QA 4B3SJ 4MIWA 1NLKL 3TA1A 3QO9A 1PYOB 4JI8J 2XBPA 3P5TL 1G6BA 5DETA 3D5MA 1FX4A 1LOUA 2CDRB 5KAKA 4GC6A 3K5OA 3BLTA 1PC4A 3RG6A 3TARA 1XERA 3G9CA 1KP6A 4K4VA 3AA9A 1VLOA 2ADBA 2UUPA 1JLGB 2R7XA 4PUOA 4MKBA 4FYXB 3HMJG 2CPYA 3I9V9 4B3SF 2DGWA 2EVZA 3DOMA 1OWXA 4JI8F 5DZ6A 1S9EB 4P73A 3RBZA 4QW9A 4YOEA 1WSVA 3HPOA 2WVEA 4RI5A 5I3UB 3CCUS 4Y2AA 3THVA 3T5HA 3J80U 2KT5A 1C84A 2HNDA 2A10A 2YKPA 5BR8F 1RU1A 3HZGA 3RRGA 4L74A 4DBQA 1QUPA 3CDEA 1NAQA 3PDNA 2UUAJ 2GV1A 3DXBA 3N6MA 2JHEA 3M8QB 5CABA 2HHTA 4E8UA 1UJ6A 4F4YA 1Q6NA 1DQ8A 4ZP9A 5KFEA 4ICLA 4PWDA 4TU7A 1N48A 4NYOA 4KPYA 4NYPA 4J9QA 4JV0A 2VONA 1S5ZA 4JMJA 2NSCA 1OSCA 1M5PC 2JJDA 3MR6A 4R0EA 4DL5A 1HBMA 3B8HA 5A6WA 1S6OA 3D0GE 1X0FA 3O4TA 4QWDA 4FYDA 4GRYA 4ZVQB 2B6AA 3PYFA 4BBYA 1PTUA 3GXHA 2N82B 3CJTA 3CJQA 3R27A 2V2ZA 3TZZA 2AM1A 3G6XA 1S99A 1Y5LB 4KV8A 1XNQJ 1SV5A 2ZUAA 4MK8A 5KT6A 1U6FA 2I38A 3VAKA 1HYSB 2MY7A 4PWWA 2I2YA 1SCJB 2ZC3A 3RRKA 4OI6A 4PG6A 5EX0A 4MIBA 1HR0J 1BQMA 2F7VA 2MDAA 3DOKB 5CAAA 3C2PA 5KA9A 4LT6A 1T9TA 2XEXA 2CJAA 4OYZA 3LPEA 3WC0A 3HF5A 3WQPA 1VRTB 2VFVA 2JEJA 3TAMA 3QCZA 3M6UA 3R6LB 1TL1B 4DI6A 3O44A 2C2NA 1S7IA 2PEBA 4ZVPB 1UFKA 2GZOA 1QTMA 1H2VZ 2NV5A 3ZTRA 2HVIA 2CMCA 2NPIA 5G4DA 2HKEA 4OHXA 2J9EA 1XJWB 4OLPA 1JLEB 1BLUA 4UOFA 2A18A 1Z2LA 3H5SA 2ZITA 2VIHA 4ECZA 1KLNA 3US5A 2CQHA 2ZUGA 4GE5A 1O5ZA 4LSLA 2QSFA 3IWNC 1S6UA 2M88A 1NO8A 3RW7A 1T7PA 3ZZUA 2M8HA 4USJC 3C16B 4BPCA 2VL1A 2D9OA 2Z4PA 2W9BB 1IKVA 1F5CA 1Q1KA 2VQFF 4CVKA 2A6OA 5B09A 4O3NA 3D68A 3D6TB 2MXYA 1RACB 3H2LA 5BYRA 1PCAA 9RUBA 3GXGA 4JI7J 3I36A 4LRBA 1N6QA 4W4MA 1HQUB 4OZ2A 1Q5VA 1HNXF 2V4RA 4JI0J 4J9VA 4DCOB 1F1BB 2R8GA 1H7WA 2CQGA 3GIJA 4I7FB 1NMEB 1UVLA 2IBOA 1GMUA 1IBLJ 1SJFA 3OFGA 4QYRA 3C6UA 5IBMA 3R2CJ 3HO1A 3MMBB 5HSPA 1D8YA 3MCOA 3HT0A 4I0WA 1XK8A 4ZCMA 1FT8A 3RB4A 3M30B 2BR0A 2XMTA 1XTZA 2C3OA 3Q0AA 4CWBA 1X8DA 4A8MP 4J7CA 4D3GA 5D77A 4KB7A 3V6KA 2OPSB 1UP1A 3I0SB 1V3AA 5DGAA 3QO9B 3FSYA 3VAIA 4WP9A 1BGXT 3Q8VA 4B17A 4C3LA 1PTTA 4TN2A 1NJXA 2AEFA 4C13A 2QYCA 1C2PA 2CAJA 1OESA 4EK2A 1WACA 3DI6A 2V63A 3FBCA 4UZBA 2AZ1A 4PUOB 4CLLA 2FY8A 3ITHA 3MURP 3V6JA 3DOMB 5H1SV 3BGOP 2QDMA 4OV1A 5DRKA 4C3MA 2KH9A 3MR5A 1N4LA 3M8WA 1Q79A 4X64F 4ED1A 3MAHA 3KLGA 4ECRA 4F0MA 3A8EA 4USKA 2NLWA 1YWFA 4X4SA 2MJNA 1RGVA 1KTQA 4URGA 4X4VA 1OHEA 1RLDA 3CCZA 4FS2A 2HNDB 4OLOA 1RT7A 5E3CA 3HK2A 2O01C 1A6LA 3GIMA 1UTAA 1TMMA 4XAKA 1YLXA 3GIRA 2XLIA 5IQQA 2AWZA 3HX9A 1YITS 4KGKA 4ICLB 2UU9F 4PWDB 4CLUA 3G8QA 3O2IA 3CC4S 4KAIA 2UUBJ 3CMQA 2NXNA 2KG1A 3OL8A 3H0PA 4ZN5A 2CJQA 3CCES 4DV5J 2RDJA 2G0JA 2RUGA 1XNRJ 1HBMB 1LKZA 1FRHA 3NWGA 2VH7A 2APOA 4RW4A 3MAAB 4DFJA 3ZZOA 3ZZYA 2IC3B 1UJ5A 2B6AB 1JBVA 2Q3PA 2CNEA 4CP5A 4LSNA 3QT5A 2HRYA 2YWHA 3GPAA 2ZHBA 1PG5B 5HJYA 2UUBF 2GO8A 2C7SA 3I7ZA 4OHVA 2IRYA 3EMUA 1YQHA 1FFWB 4DV5F 3IBCB 4R30A 2X1FA 2BABA 4ELVA 1RLCL 3CW2C 3PR4A 4USUA 1KSPA 1F60B 4GRSA 1OHDA 3QLHA 3NAHA 2FVQA 1FFGB 1BQMB 1FWPA 2ABYA 4DV6F 1R6VA 3KYLA 2EFPA 5EN1A 2O66A 1RISA 4PXBA 4FP9A 3BYRA 2CQ0A 2Q79A 2J6UA 4RWXA 4ITSA 3FZ2A 4RI4A 3TAMB 1XC9A 3IRWP 7FDRA 1QE1A 2CQPA 2GHPA 2UUOA 4KH1B 4B02A 1QSLA 3EZUA 3M8SA 1BE4A 5A8WA 1QUVA 2L41A 2MHNA 1NJZA 2D7SA 2DPJA 5E0OA 2JRSA 2V8GA 3PX0A 5B0EA 2MQNA 1JLBB 5IC4B 1S6QA 2ZZNA 4AFFA 1GQQA 2JH3A 3D66A 5J2QA 2G6ZA 2F71A 2HZCA 4F4AA 4OX6A 5DDOC 1LQ9A 2WTZA 4IFYA 4PXCA 3W7BA 2OGUA 3R1HA 1HD0A 2F40A 3CULA 4BCAA 2UV8G 2MLYA 4DQPA 1IKVB 2YVSA 4TKTA 4Y34A 1I94J 5LSOA 3W66A 1Q78A 1RWUA 3BB5A 1SKRA 3Q83A 1QZ0A 4QDIA 3RU0A 2LXFA 3TZWA 3DRXA 4TY9A 4OX9F 1N6QB 5ETRA 1KVJA 4XDDA 1B64A 3K2YA 2KFZA 2BIJA 2O1PA 3O5XA 4Q0BA 2RD5C 4H4KA 1MROA 4K8RA 1LWXA 3C6UB 2XB2D 3K5LA 1OPIA 4NZ6A 2C3PA 5D8HB 2Y1JA 4ECTA 3C19A 5KFGA 1UAGA 2ZHOA 3EGNA 5KFZA 3HN7A 4NLPA 2GNKA 5KFKA 2QJ3A 4DV3J 5KT5A 2QEXS 1GFWB 2N4DA 1WF1A 3D42A 4J90A 2HAFA 3CCVS 2OSRA 2X3DA 4CI0B 3IAS9 4DUYJ 3KK2A 4ICZA 4GVBA 2YDUA 4QZVB 2I0XA 3ZL8A 3DI6B 2IHR1 4ZP6A 1SUQA 2ASJA 1KVIA 4DR3F 1EETA 4K4SA 4FF2A 4DV3F 2V2VA 3ITHB 4TU9A 2DRDA 1RI7A 4IFVA 4CM0A 3VAFA 2IM3A 3PRVA 4MYUA 3MEEA 2FD2A 2Y1IA 2OD6A 4J9NA 2IIHA 3NNCA 3HDSA 4TNOA 3GILA 3KLGB 4DL3A 4ZPTR 1SJRA 2C1EB 4HTJA 1XMOF 2WZ1A 1IM6A 4K7QA 1CJTB 1LWCB 1RT7B 2E1MC 3AY0A 2MJUA 4ID5A 4NRUA 2DGUA 2VQEF 1GAOA 2COLA 1Q81T 1S0MA 2V9KA 1NK5A 2DNOA 4DZDA 2AHOB 2VFUA 2K3IA 3KG4A 4F50A 3DNCA 2J16A 3MDFA 1R6HA 2GFFA 4RW7B 1VJWA 4DPYA 4HT7A 4K4TA 2L08A 3TP2A 2HWHA 1FRLA 2QBQA 3C14A 4J51A 1Y4ZB 1EENA 2BUNA 3M2RA 2JEIA 1Q53A 3M1VB 2VOPA 2CG8A 3LW5C 4CT8A 2E9TA 2GC6A 4RW4B 1Q8LA 5FJ4A 3MTKA 2F1FA 1QJHA 4PAAA 5I3QA 4DQRA 3I80A 4HL9A 1X4GA 5D0RA 4LSNB 3CCQS 1T9XA 3P49B 3CD0A 4HT5A 2Y68A 5D15A 1TKXA 4KSEB 1Y3KA 4ZCKA 2J6SA 4OZLA 2F9JA 2F6FA 3IGVA 5AE2A 2HHHF 3CEDA 2CNKB 4R25A 4YB5A 2O5DA 4M5LA 1M1GA 3QLHB 4HVZA 5HJXA 3SDEA 4QWEA 3GR1A 4G65A 3CUNA 1N33J 2L3MA 4OX8A 3UW1A 4KFBA 2HXPA 3MMCA 3DLLQ 3WX8A 1PA1A 2BE9B 4WCEQ 1WD6A 4M5MA 1YDLA 2QEPA 2HQGA 1YI2S 3EAXA 1QE1B 2BKPA 4N8OA 4DLEA 3VAJA 3TZYA 5LT5A 1P9YA 3C8YA 5A8WB 1BQXA 2YWKA 3GR0A 3EGVA 4C2MA 1A9NB 1JKHA 1N0UA 3BO3A 4IOAQ 1S6QB 2YXLA 4JB8B 5J2QB 2KVQE 1FI4A 1N34F 2DNZA 4LF4J 2BOPA 3KLFA 3GSDA 4IFYB 2HAIA 2KL8A 4Y0FA 1FQ1A 5CCLA 4OZ0A 5D0HA 5MAOA 2OPQA 2ZC4A 1TAQA 2RIJA 4RKUC 2XCPA 2P2CB 2DNGA 1GG4A 1YSJA 4NCGB 5J1EA 2QDCA 2I6OA 1T02A 2G2YA 1NJIT 1UKUA 1Q8IA 2E5LF 2DY9A 3DOLA 1REGX 2HLTA 1C4CA 1C0UA 4ZVOB 3I82A 2UVWA 4I68A 3GV7B 4Q0BB 3L3CA 3BBFA 3I4HX 4L3KA 1GWZA 2PDAA 2OMLA 1MROB 2CADA 1RU2A 3SEOA 1GXTA 2DNHA 3TWZA 4A8WA 5KT2A 3QT7A 4AQYJ 4C3KA 1TUVA 5AJ3F 1IKXA 1X9MA 1FTCA 2V8VA 4ZN1A 2N3OA 2GIFA 3NCPA 1YJUA 2XI3A 1FWLA 1VQ9S 1OJ4A 2ZBQA 2RQKA 3KK2B 4GVBB 4ZLLA 1T0TV 2V9WA 1SUQB 4RNFA 4F3OA 3ETMA 1GK8A 1EETB 2RMLA 2CZ9A 1RT3B 1VQ5S 2I5XA 2DGXA 3F9BA 1PH0A 3UR0A 4IFVB 4C7QA 3MEEB 4M5DB 5LXYA 2DCUB 5LXRA 1NH7A 4ES2A 3T9NA 2DITA 2IJNA 2KM8C 2CQ1A 3B4MA 2Y1OA 4DSFA 1SQEA 3D3CJ 4V19J 2CA9A 5HROA 3OTCA 4ID5B 3UFCX 2V69A 2H65B 2UV8A 1HI1A 4Q7AA 3JSBA 4Z6BA 1ZAXA 1AB8A 4ED3A 2X5OA 2P6SA 1CC8A 4YQWA 2J16B 4PQUB 2DD8S 2EG2A 3AXKA 3QFWA 2FJMA 5L46A 1QDUB 3PY8A 2J9CA 3QRRA 5KFHA 2IFXA 4GKJJ 2ZH5A 3PVXA 3C14B 2QGFB 3F81A 1UCNA 1R8BA 4RW8A 2ZJRQ 3M2RB 1VBZA 2AX0A 4OYOA 1W26A 3QBCA 2RUSA 1I9TA 3BN7A 4KGMA 1VJQA 1I5OB 3PIOQ 4DR2J 2KRBA 1X4EA 2OD4A 3FK4A 1N32J 4JI5F 4CTAB 1TKXB 3J81j 2H5JB 3TOQA 3ZZPA 1EEOA 3BSNA 3KJFB 2VD3A 5EHHA 3MWBA 1WEZA 2J8AA 2YNFA 3L09A 3TJ9A 1URNA 2FC9A 5DJBA 1MMLA 3HVAA 4NEZA 3SDEB 3PYEA 3PTWA 5DLGA 4OHEA 2R7TA 3RB6A 1YTNA 2ZH6A 4KFBB 2RQCA 3E8OA 3MMCB 1M5KC 2JFDA 2FHMA 2W9CA 1IXKA 4WK1A 2DBBA 3LAMA 2E1PA 2RQMA 4N8NA 4NWGA 1M5OC 1YZ6A 2F4VJ 3UPFA 1MKPA 3W3SA 1VQPS 2GQQA 4H4MA 4YDDB 2HNZA 4PR6A 4E2FB 1O0PA 1TTHB 2CQ2A 2M7SA 1U0HA 3KG1A 3BQ1A 1JKHB 3HHLA 1DLOA 4G3IA 4K59A 1Q8KA 3OJUA 4K0KF 2NR0A 2XO6A 3HHNB 4DL0C 2H51B 5DDQC 3PRBA 3KLFB 2Y3YA 2X1AA 5J8RA 3L7OA 4NLDA 2QMUB 1ZM2A 5IWAF 2P5VA 4RNOA 1FRMA 5HQ8A 2HS0A 1JNZB 1LWEA 4QR1A 1LARA 2B5JA 3V2UC 3KNGA 2XY5A 4Q2MA 1PAUB 3TAQA 4J91A 3D4JA 3P5BP 5J1EB 4LBIA 2UVUA 1PXHA 2OO4A 3DOLB 1ZBTA 1FXDA 2RS2A 1C0UB 3BBCA 3MPWA 3G6YA 4CLKA 4R0SA 3H5YA 3BKTA 2KJVA 2OH2A 5DGBA 3PEJA 4EMDA 5GAGI 2RRAA 4KY3A 3D6HB 1NHUA 4MKAA 2A0FB 2WB4A 5HP1A 1R8HA 5IBSA 2ASYA 2ZH2A 1Q6JA 3BJYA 5E3PA 5F8MA 4G1PA 4GS0A 2RKIA 3VZHA 1WHVA 4QIWD 2BJDA 4C8YA 2Y1RI 2UVVA 1IKXB 3ZM2A 2RF6A 2VEWA 1QM9A 2YX7A 5ITHA 1U2FA 4YS2A 2LDYA 1IR2A 1N5VA 2CIMA 4A8YA 1V3RA 3NNAA 5A0YA 3EMTA 3S3HA 4V19X 5K22A 1RTZA 3R5BA 4CH0S 2HQCA 3OJSA 2Q1LA 4CZCA 1S7HA 5HMWA 1DTQA 5KFUA 1MMDA 2BW7A 4DS4A 4DOZA 3SCKE 2UUCF 3MEGA 1AYEA 4NCAA 1OHCA 2BANB 4OJ3A 2JOQA 3I0RA 2OOQA 2HFOA 4ZVRB 4X84A 1APSA 5CHCB 3NGDA 3D0HE 3GIIA 4QOTA 1I57A 5LMNJ 3E2EA 3V6HA 3KHGA 2AYEA 2AGQA 3BSOA 4DJBA 4AD6A 3A3NB 2H4WB 1CJKA 4ZJLA 3MM9A 2F6ZA 3HKZD 2N3LA 1FCAA 1WAXA 5BX1A 1C85A 3BH7B 4RX6A 3D7SB 3B82A 4GKKJ 2RDIA 4Y14A 4ZLNA 3BQ2A 1C86A 2DNYA 4NLWA 1J27A 3RGOA 3TEHB 3BF4A 1HIYA 2W24A 1X24A 1BXNA 1FFSB 2HBYB 1NNYA 1D3WA 3N4WA 2C22A 4QF5A 2GIQA 2QRRA 1VQMS 3B7OA 2V2QA 4DZ6A 1B7FA 2DH9A 3HP6A 2H03A 4JV5J 2RF2A 3KLEA 1AUSL 1DY3A 4ZVSB 2WVFA 3TUZC 3FBFA 1UJ4A 2HPUA 4HJPA 4N77A 4GKKF 1M90T 1XM2A 2J8SA 2BBEA 1RWNB 2CG4A 1HQ2A 3M7VA 5A76A 1WC1A 4RW8B 1EP4A 4JI1J 2ZH4A 1I9SA 1G1XA 5SUHA 3GLJA 1LW0A 3IM9A 1QXKA 2GHVC 3GONA 4X62F 2MKKA 4JV5F 4DV0J 3MM7B 3HHLD 4NLGA 2ILYA 4QQBA 4LBHA 2EPIA 1AZSA 2RS8A 3O4UA 2DGTA 4ZN3A 2Q05A 2PT0A 2C2OB 1NCLA 2DIVA 4LF7J 2CWKA 3NMRA 2KZMA 4YHHJ 4HHJA 1MWQA 3GG1A 2MZRA 1PTVA 3TEGA 2CFVA 3T1AA 2YNFB 4NE9C 1F3VA 5IQ6A 3CDUA 3TRGA 4DR5J 1YJNS 5EX3A 3ENWA 4DN9A 3Q8PB 4ZIVA 2UXDF 4DX8H 2XS2A 4PVGA 3FNNA 1YX2A 4ED0A 2GA7A 3DRRA 4OI3A 3V4MA 2HGLA 2W9CB 4LF7F 2ZBPA 4NLVA 3ZZZA 3MOWA 1C1BA 3QMQA 3A13A 2CMBA 2DEIA 2BQUA 4K2JA 3MM6B 2JJ4D 3OW2R 4HI1A 3NGTA 2PMHA 4DR5F 4DCJB 4A8FA 4H4MB 4IH7A 5JXSA 3RZAA 2HNZB 3FRZA 4BHQA 1U0HB 4ED7A 4MTPA 2VHGA 3ZM6A 3CCSS 2HK2A 3KWMA 1VS3A 2QYGA 2G1HA 3C66A 3HHLB 3POTA 3PW5A 2MQMA 3A3PB 3N2AA 4B9SA 1KONA 1OYEA 4QBUA 1ELOA 1I3OB 1Y0HA 3ISZA 4L3NA 1D8ZA 2FHKA 3NGKA 3UD5A 4DX7A 1FNOA 2XI2A 3AWGA 4OZ5A 2VU5A 2CNIA 4Z7CA 4OHDA 1LWEB 1NK4A 1UWAA 3MPUB 3H98A 3QRQA 4IR9A 5HBMA 2OZ5A 1VDHA 4HEA9 3LJ8A 2F3JA 3DHWC 4B3TF 3BR9A 2NCKL 1S0VA 3MD3A 1OETA 4QUMA 2NSBA 3ENAA 3EVMA 3NEKA 3UD4P 3Q8UA 3PW2A 4C11A 6AT1B 2XYPB 4ZK7M 3P8BB 3OTDA 3MEKA 1S9FA 3I31A 4P7TA 4B9TA 2U1AA 2OFHX 1FX2A 1OEVA 3T19A 3DRSA 5EWEA 5DQGA 2W9AA 5HP1B 3K59A 3HJVA 2Z30B 3RGQA 3OTOJ 3T6JA 2RKIB 2HG4A 2RQ4A 3JSRA 2LVWA 5JUMA 1TKZA 4CNYA 3THTA 4L75A 2RRNA 5AWXA 5A0YB 4MK7A 3WIUA 2IMOA 2V4QA 1U02A 4TY8A 4ZVFA 4WPAA 2F46A 3HXMA 3F99A 5D3GB 4X66F 1L8KA 2G1DA 1C1CA 1DTQB 2VBXA 2HWTA 4EBEA 2FTRA 4ZITA 3OTOF 3MEGB 3K8WA 2ZE2A 2HHQA 2V50A 1NK8A 3CJ8A 2NT7A 5M43A 3I0RB 4NXMJ 5LXQB 4DUZF 3AQOA 1Q7YT 2AJQA 5KFJA 2B9EA 4B3MF 2E7VA 1FDBA 4ETXA 4N76A 1U25A 1RT4A 1F9HA 2B0GA 4B9MA 1IBMF 2AEMA 2XYGB 1E8CA 2F8EX 2FLNA 1CJKB 2WAQD 3VVUA 1KS2A 3MM9B 3B54A 3EGZA 2HQ3A 2YNHA 2R8KA 4ZMMA 4NXMF 1VHIA 4P2XA 1S79A 2LKZA 1S48A 1J5EJ 3O8WA 1UZDA 5HK4A 3AB2B 5KT7A 2JLFA 4EYIB 2B4PA 2VEUA 5HANA 2C2MB 1JXLA 4ZPDA 2ACYA 2RF2B 3KLEB 3Q2SC 3OL6A 1F9EB 3GMGA 2FJAB 4AE5A 1HBOA 1FKPA 2R42A 1EP4B 1XRIA 3OD2A 3M2UA 4USVA 2D1CA 3FSXA 3MUVP 1LW0B 4WYWA 1EARA 3BKFA 4RHGA 1M0SA 4CLYA 5EDWA 3SQOP 1AZSB 1SKUB 4ZLPA 1WF0A 3Q24A 2MLZA 1NWLA 2NLKA 1VLYA 2B56A 1NJYA 5D4LA 2K2PA 2I4HA 4P72A 3HM9A 3Q86A 4USMA 5A8KA 4M5GA 3NS7B 3UVJB 2F6VA 3PO5A 3CO0P 1CSJA 1H73A 8ATCB 8RUCA 1W2BR 1ZAWA 3S3FA 2KU7A 3N5FA 3TANA 3DRRB 3UCGA 1QY7A 1DAXA 2OTJS 5KFAA 4RNMA 2BJ1A 1IWGA 2EEYA 1FDNA 2QBSA 4PYHA 1C1BB 1N56A 2E1AA 4YN3B 2GWOA 3NS6A 2R3VA 1AROP 4NWFA 3OFHA 1UFWA 4OJGA 1YWXA 4TU8A 2EFOA 2HGNA 5KFOA 3PW7A 1H2UX 1FJGJ 2VOOA 1FRIA 3J7ZT 4R8UA 1BY9A 1WC3A 3NOCA 2CNFA 4NZ0A 3POTB 3NCRA 4O3PA 3OL9A 2MQQA 1SC3B 2GJ2A 5KFLA 4ZJOA 1QAYA 4N5SA 4RBTA 1T03A 1C0TB 3UDVA 2UUWA 1NZ8A 2EG1A 1M5HA 3UCZP 4OHLA 1NK6A 2VG6A 4CYUA 1ZCKA 5K25A 2Q6CA 1O8BA 1RTJB 1G4US 1PKUA 2JSXA 2HZAA 2MZJA 4DQQA 3HVTA 4LF6J 4X2BA 3ADAC 2FY1A 1RAFB 4PEOA 2MB0B 3J7AN 4F0HA 3OUYA 4KI9A 4AT1B 1GQYA 4K4XA 3GWCA 4DFPA 3PRDA 4RWWA 4C11B 3M6VA 4DX5A 3NMAA 3IR5B 4CDIA 1NWEA 1IKYA 2NZCA 3KK1B 3GCXP 2ALYB 3DRSB 3D0IE 2WVBA 3WBZA 3AWFA 3KUEA 4D3HA 3LPYA 5H9EJ 2XS7A 2VTDA 1U6ZA 4E98A 4D3QA 1ZYQA 4UY85 4WZQA 3GG0A 2QCJA 1SBRA 4ANEA 2EI5A 4J9UE 4C0BA 4RDDA 1MU2A 3N6NA 3M8PB 1PYTA 5LMUF 1N8RT 1SQFA 3QCJA 5K8MA 4AXJA 4NA1A 4AL5A 1KNZA 1K0VA 3BYPA 4QWBA 2HNPA 3GCWP 4TY8B 5I3PA 1WHWA 5KG7A 4K5SA 1Q86T 4WKYA 3U27A 4WWSA 2B51A 3M6XA 3UNGC 4O0IA 2ZE2B 4IG0A 3O3LA 1AUDA 5L1KA 2HRUA 4P2SA 2PI5A 5BYSA 4ZVEA 3OR1A 1YTYA 2DNPA 2WONA 4LFBJ 1RT4B 2JEGA 2EC0A 4CO5A 2BE7D 1T8EA 5IT4A 3V6DA 5HLFA 2W2NP 3JB9k 3TAPA 4HI2A 2P6XA 1TL3B 4I64A 1OPZA 2YNHB 3GV5B 4RH5A 4Q43A 2W2MP 1PGZA 5KFSA 1U2RA 2V67A 4OHZA 4ZCIA 4F04B 1S1VA 3N9UC 4DLGA 5FLXU 2RILA 1GTEA 2NUUG 1JBWA 1X4DA 1XMQJ 3LO3A 2YBVA 3DN9A 3EE3A 4L76A 4LR9A 2B07A 3PYGA 4IYQA 4IRKA 3GFZA 3RW6A 3VVTA 4IR1A 2HQFA 4F02A 1EEHA 3M2VA 4LRDA 1TUGB 1KD1T 1H2TZ 2QO3A 1UA1A 4UTGA 3IXQA 1HBOB 1FKPB 1RHRB 4F67A 1JX4A 2G2OA 1K0TA 1GEHA 1XR6A 2AEJA 2M3DA 1BD6A 1TV6A 4PZVA 1KKHA 4LIWA 4JV2A 1XMQF 2CVIA 4WFXA 1VQ4S 5C42B 4H4OA 1KBRA 1JLNA 4ZKAA 1F0XA 3CC2S 3KTQA 3PKYA 4EYHB 3QGPA 4F0KA 2J9DA 3NBPA 2A3JA 2XULA 4KIAA 3QKQA 2G0CA 4OYMA 2AJFE 2A1BA 2FH7A 4O3QA 2ZFHA 1J4XA 2XMUA 4J9SA 1QSSA 1RT5A 3VAHA 1VCTA 2IJRA 3FQLA 1QLNA 2CFXA 2QBPA 3MR3A 3K89A 2KHCA 5KG5A 3V5RA 4PCQA 2E1CA 2C2KB 2BJEA 1WDTA 2G13A 1EKSA 2AZRA 2KN4A 3W8PA 3D6FB 4GC7A 1WC6A 3GQCA 2R2RA 4A8QA 2V8HA 3EZZA 4YR2A 3PO4A 4LQ3A 1RA6A 2G2ZA 3CB4A 5E2QA 1VQKS 1BWEA 4R8UB 1FF2A 1XN9A 1KFSA 1JF7A 5J2NA 4X65F 1JLGA 1OQ3A 2UXCJ 2HVDA 1NDLA 1U1LA 4PPDA 1T03B 3P45B 5T41A 3PZPA 4NA2A 3RR8A 3PEHA 2KXFA 3TA2A 3LP2B 2JNJA 5GMKa 3QATA 2XLKA 2ZEJA 3HFZB 1BQNB 1FE4A 3ENQA 3OSPA 5KT4A 4GE2A 3NOGA 2VG6B 2FHOB 2PA3A 1LFWA 3W61A 5C5JA 1HNWF 1WC0A 3IO1A 1EZZB 3QT8A 2UXBF 5F8LA 2RE1A 1KDNA 3HVTB 4U96A 4EZ9A 1S97A 1NB2A 2Y66A 1SC1B 2AW0A 3OUYB 2AJ1A 3R9LA 3BGUA 3G6ES 4ID8A 1L3UA 3F73A 2MHEA 1U47A 2DRBA 4HH1A 3U1MA 2AIRB 1BHNA 5A2QY 2WK4A 5IZHA 4KHMA 3HT3A 3F9AA 4DPUA 2EBEA 1UEKA 2V6AA 1DZ5A 3FFIA 2CNOB 3Q8SB 1SVDA 1T95A 1HPZA 3X1LB 1RWPB 1Q6TA 3OFEA 2GP0A 2X51A 2XJAA 1R43A 1N5YA 2RSQA 5HAOA 4HKQA 1RKIA 5BZZA 3DDNA 4OV6A 4DV2J 4IO9Q 2JFGA 5BYQA 3I56S 2KFNA 3DGVA 1K1SA 5KT3A 3F56A 2E5GA 3DMJA 2MBCA 1X5TA 1GH8A 1HQEB 4IG0B 1UPPA 2ASDA 2NZ4A 2HW3A 5A8RA 3RB3A 3T1HF 3OMHA 3A12A 3D1QA 4P52A 1RAHB 3OR1B 3NMEA 3Q8QB 1K47A 1QSYA 2XG8A 2W2OP 4DR7J 2ACMA 2B4VA 1WOOA 3V6DB 2XNQA 3GSIA 4NLOA 1FD2A 3NXZA 4O4GA 3WDOA 4UOCA 4QWAA 4MJKA 5EHPA 4DPXA 2BEFA 5DQIA 3DYAA 2HQIA 2N7CA 3N0VA 3LQVA 1S1WA 3I6PA 1S1VB 1XEZA 2IDEA 1G2EA 3H2XA 5CD4H 5ETNA 3GYNA 1IQTA 4DR7F 2NXCA 4LREA 2GAGC 4ZPWR 5GAEI 1HBUA 2HQDA 3M2VB 4O3RA 3CCWA 2NUHA 3KKFA 1YPTA 3MEDA 1Z2ZA 4H54A 2IYIA 5KA7A 1G7CB 5DM6Q 1DQAA 2PEHA 2W2PP 2YKQA 1TV6B 9ATCB 3SCIE 2OUDA 4DV4F 4W92B 3RB0A 1G4CA 4WK3A 3C16A 1YK9A 4H4OB 1R31A 2GIRA 4PRFA 5FD1A 2E44A 1U0SA 3A8KA 3M8YA 4WJBA 2QDPA 4OX7A 3RBEA 1G1FA 3QCDA 4OYBA 3SIPB 2I8EA 1RXOB 3NBPB 3ZC4A 3R5JB 3BEGB 2L9WA 4LF9J 4B9LA 2XTJP 1NSAA 4K2XA 3GFYA 1U48A 4DU8A 2DNQA 3P6YC 1ZM4A 2JC1A 3SMZA 3S8SA 2FJXA 4LFAJ 5LM7E 2VORA 3S3EA 2DY1A 1U1RA 2JFFA 1U8WA 4P6QA 2VUGA 3PG9A 3LH2S 3N79A 1YJTA 2OTLS 4HYKA 2HFNA 1XBWA 2ZDPA 2B7BB 1PBUA 4C8LA 3MMBA 2Y9HA 1L8GA 1WTBA 1IWAA 2C42A 2FGCA 3T5LA 4YAAA 2HC1A 1CBKA 3E3XA 3HULA 5DG9A 4FZVA 2VB6A 3L9ZA 4O44A 3I0SA 4U8VA 1ZTTA 2C2EA 2X1BA 3SBMA 2WOMA 1BZCA 4Y2CA 1TZ0A 3DC2A 5IV3A 1XR5A 3QCFA 3ZZ0A 1FJCA 2XMKA 4GMKA 1VGYA 1ZOTA 5J2NB 3MPYA 2HS3A 2ZM6F 3U1LA 2IBKA 4M5JA 4MAKA 3NP5A 4B9NA 1PILA 4HHUA 5ADZA 2EFNA 4WF9Q 3W65A 3NRBA 5K5MA 5KFXA 4RBVA 1FKOA 1NNDA 1VOMA 4CVMA 3G2XA 3H4DA 4IO1A 4FBTA 3M05A 1HD1A 2C3YA 2BW2A 2XZWA 1N36J 4ECYA 4OHHA 2ATCB 1U8SA 1S10A 1I6JA 3ZM0A 2Z2ZA 2CM2A 5GAEU 4C8ZA 4Y00A 2B4OA 3ENVA 4X4OA 3JTNA 5AE3A 5THWA 2M9KA 1CJVB 1YVFA 3X3UA 1MWYA 2D3ZA 1HNZJ 3IAM9 4ELTA 4F4XA 2F9DA 2V0NA 2OC3A 1HNVA 1EHWA 2DB1A 2HZVA 3OR2B 2EKNA 3U96A 1U45A 2M5YA 1UFLA 4WYLA 1XQIA 4U7UK 4BWJA 3OXFA 5LSLA 2WVCA 3FFIB 3F44A 4FF3A 2KO1A 4BC7A 2EFQA 4WKRA 1OEUA 4NLYA 2RB7A 1VMBA 3CCMS 4KYRA 3TJAA 1HPZB 4ZP8A 4KJIA 4PG8A 2LQ8A 3J7A1 1X4AA 5J2PA 3I9ZA 2UUAF 3H90A 1N5YB 2DHXA 2PFFB 2BV3A 3GB0A 3VGTA 3MAAA 1NEEA 2W01A 3CVKA 5GAHI 4PPZA 4TQSA 1KC8T 2IC3A 3VF0B 3IWLA 3QQCD 2RRBA 3G4SS 1NSQA 1AAXA 4TYAA 1XR7A 3K8VA 2LFVA 3DLKA 4I6YA 4ALZA 2PA8D 3DMJB 2OEKA 3HD1A 2DTJA 4WXOA 3V0EA 3VGUA 1VK3A 5A8RB 2DR8A 2BM0A 2BJ8A 2DYAA 3O6QA 3TA0A 2B8PA 3CJ0A 3ILLA 4NRTA 1NDPA 3QCKA 4L73A 3QCCA 1RT6A 2AKWB 1P27B 1NPPA 2H5IB 4O0NA 1CLFA 3HHKA 2LA6A 4O4GB 2G59A 4H4KC 3E51A 4QIGA 2CZVC 5CCMA 4MYTA 1WG4A 1XNQF 2F8HA 2XC9A 2N4CA 2FLOA 3W1YC 1EKRA 3DYAB 2CJXB 5KFBA 1S1WB 3JTOA 1RHUB 4D3RA 3LALA 1HR0F 5K8PA 4KYQA 1VQSA 4Z7YA 5AT1B 4W98A 3FUYA 1IR0A 2BQ3A 1K9MT 2W2QP 1RDRA 1JLBA 1D9FA 1JJHA 3EYZA 1HBUB 1CEZA 2PGCA 2RVJA 4BS2A 4RNHA 4OZJA 5C7PA 2B49A 4CO0A 3TJ8A 1U1PA 3MEDB 3WHIA 3MCMA 2M4MA 1DRZA 5D4PA 1NUEA 3UQSA 1S1TA 3V0IA 2DO0A 3H25A 4QWCA 1RCXB 3TX0A 2OP5A 2HHWA 3QGGA 2MGZA 4B3OA 1RWXB 2H3EB 1RTHA 2DR9A 3JAMU 1ZM3A 1J5OA 5H9FJ 1T49A 1Q6SA 2NQPA 1VIXA 3ZNUA 4K5RA 1VC6A 3IR6B 3OPKA 3JS9A 1L5UA 3GJRB 2YH1A 1S57A 5AXNA 1MLAA 2JZ5A 2NXEA 2KYZA 4F25A 1R3NA 3EX7B 4ELUA 4RR5A 2W8KA 4ED6A 5GAHU 3EICA 4OI0A 2FB0A 4CLFA 2R9LA 1SH0A 2CNGA 3CC7S 1P8GA 1KAVA 3CIMA 2ZH8A 5ETTA 3BDPA 4FF1A 1F2GA 1KAKA 4JI7F 3ZMQA 2ADCA 2R2UA 4D3PA 2VA3A 4O44B 4K4WA 4E0DA 1LK5A 4JI0F 2H54B 2PQ5A 2DHAA 5K20B 4RJVA 1ITPA 3W8GA 4ATNA 2WOMB 3MUTP 1IBLF 2ZVSA 4OHWA 3VAGA 3HZEA 1OO0B 4QUNA 3VGVA 2QN6B 2VASA 4X4RA 2JFHA 3V4IA 2ASLA 1ZZFA 5DO2A 3BQ0A 1VR6A 4FBUA 1LFPA 1WHYA 2QLFB 4ANDA 5FIIA 4AL6A 4ZVGA 4ANCA 1Q4RA 1FKOB 3UO0A 4ED4A 2Y0SD 1S6PA 1OIAA 2NPFA 1UW9A 4ES1A 2V94A 4I2QA 3N01A 1GFYA 3ZMPA 3A4TA 1DQ9A 2DT9A 2PO4A 2U2FA 2YH0A 1T4JA 3P4UB 3IC1A 4CH7A 5F3TA 2YNIB 4CT9A 4M95A 1CJTA 1LWCA 4UQTA 4K50A 1RAOA 3R8YA 3IM8A 1ZZNA 5ETKA 2W7OA 1WHXA 2I4EA 1HNVB 3N6LA 1YGUA 1R0CB 1FO1A 4ILLA 4DFMA 3M8RA 2E5IA 4DR4J 1ROFA 1T94A 2MY8A 4RW7A 4B3RJ 2BRKA 3RBXA 4NOHA 1DARA 2ZJPQ 4B9VA 5GMEA 3I55S 4J9PA 2L9DA 3M1VA 5J2PB 2YKOA 3HSGA 1K8AT 2HVEA 2K3KA 5SZTA 1X5SA 3M32B 5B08A 3BZQA 3BDEA 2XZTB 1NH8A 4TLQA 1V5IB 1KQSR 2QMWA 2JLEA 2V4JB 3DLKB 3AH6A 2WBRA 4A8XA 5H9EK 4YDXA 2BV5A 3R7BB 4ZVHA 3ISND 1FWKA 4DL2A 3ZM3A 1GXUA 1CVJA 1XNRF 3D54A 3U7JA 3BM7A 1JQGA 2I1RA 3NGRA 4H34A 1UETA 1VRQC 2LCWA 4FF4A 2CJ9A 2ATLA 4NLRA 5T7LA 2DR6A 1L3KA 5HMZA 2HFUA 1RT6B 2YNGA 2XZDB 2HBRB 1VQLS 1WJ9A 4NZ7A 1YFOA 3IRXA 2FVCA 2H04A 4C6AA 5KFMA 1S77D 2FVSA 4TQRA 3GYXB 4DSKA 3OTBA 2H5EA 2LXIA 3NS5A 5KG6A 3OVBA 4P10A 1H38A 1B99A 3IN5A 3MMAB 1N0VC 2ZWOA 1NPRA 5LL6d 3KHLA 3PJXA 4ECUA 2PI4A 4ECSA 3QAEA 3SR9A 2Y96A 3HI9A 3RR7A 1TUWA 3RTVA 3AB4B 4BJOA 4NX9A 4R0TA 5B0BA 4JI2J 3MM5B 3EPIA 4PYAA 1IKWA 4JUZA 1A5YA 3ZV2A 5DQHA 1S1TB 3Q8RB 3W2VA 2XY7A 4LRCA 2AJ4A 4Y2EA 4R5PA 5J2MB 2MGZB 3D44A 5E3AA 2AT1B 2Z8QA 2VG7A 4B3OB 1RTHB 2R7QA 5GVQA 2D3OR 1ONZA 5I42A 5IXUA 5DM7Q 3H5UA 5F9LA 1J5OB 1BWVA 2QA2A 5E3RA 1PAEX 3KMQA 3QCBA 4EBDA 2KB2A 4LRAA 4NCGA 1KHVA 4NASA 4EI2A 5HN0A 5K8OA 3T1YJ 4HV4A 1HBNA 3GYGA 2A3KA 4B04A 4KH0B 1R8PA 1RE1B 5HATA 2R0BA 1FTRA 1EAYC 4PXEA 5C2CA 2FZCB 3D9BA 3T41A 1GTHA 2WTFA 4ILMA 3FVYA 1YTWA 1I94F 2ZJQQ 2D69A 3KK3A 5KTQA 1VK8A 1SKWA 1RBAA 3ETOA 1VHFA 2EFVA 3M9NB 4JNBA 1RPMA 2MKSA 2QG9B 4TXSA 2DH7A 2DRAA 1IM4A 4UF4A 1RYSA 3I4PA 2PD1A 3TW0A 2DHGA 2DGOA 2Q47A 1W7KA 2BJ9A 2AQ4A 5K14B 1TFWA 1FXRA 4MKYA 2M2BA 1HI0P 1G1HA 3QJPA 1B70B 1TFYA 3PJWA 2R4FA 2VG5A 3V4IB 4IH6A 2EC2A 1GQEA 4DWIA 1ZZWA 1RT3A 2I6IA 2GO9A 2IDLA 1RWMB 2R2TA 1Q8BA 4R0JA 2IJFA 2LP4A 3KJVA 2VA2A 1KEKA 2VKZG 4OFZA 4DN0A 2XO7A 2CQDA 1S6PB 4CRJA 4M5DA 4C97A 4I2QB 3FZBA 1HHSA 4DUYF 1RHJB 2AJ2A 4F7VA 3DDKA 1CJUA 5L38A 2J17A 1JXEA 3VZIA 3I5BA 4OHIA 1UMJA 3HSZA 4IH5A 2DGSA 1HHQA 3I32A 1BZHA 7AT1B 4DHVA 3IWXA 4LJMA 4BUCA 4CM2A 4DXLA 1ICEB 1Q7LB 5HO4A 1UZHA 1GMWA 3MUMP 3BV8A 1KFDA 2CQBA 4QJVA 1AXQA 3MZIA 3PIPQ 2AYBA 3IR7B 1HLWA 3SXLA 1NK0A 1Q82T 4J9LA 2I4GA 3UAGA 4URQU 4PQUA 2W4PA 4RW9A 4YB1P 3UN5A 1SJ1A 1VBXA 1T9WA 1NB7A 2R7VA 3HHLC 4B08A 2CPXA 4DV7J 1QD1A 3C3LA 2Y0BB 5A2QU 1FNXH 2EXUA 3M9MB 5K9VA 2XY6A 4O3OA 4F4KA 3NKYA 1V3ZA 2DVIA 3W5ZA 4JI6J 4L72B 3EGWB 4QR2A 1VQNS 1V6HA 4CLTA 4CTAA 2H9ZA 3G87A 4LVOP 3U1NA 2R8JA 4CIOA 4U67Q 4DR6J 2JWNA 1RB0A 4DV7F 2LQJA 2PIIA 4JBCA 3TUPA 4JMKA 3UDLA 5T7LB 3ILJA 1BZJA 2YNGB 2CPZA 4ED8A 2BYCA 3IRXB 3S4EA 2F63A 3M8ZA 3AODA 4I69A 5B0GA 3G6VA 1XIQA 2YQ0A 3PACA 1ONYA 2WRMA 5D0EA 2G4BA 2BGEA 4QCLA 3QYYA 2DGQA 4FYYB 4F8RA 4DGXA 3QIPA 2VDIA 1N33F 1IBKJ 5AXMA 2OHDA 3CCJS 3FBEA 4J9OA 3BM8A 5KA1A 3CJKA 3DXSX 2H4YB 2HGMA 3NLCA 2QA4S 4WU3A 2DHHA 1S0NA 3GTYX 3SSRA 1X4CA 3W9HA 4DL4A 2HNQA 4I1TA 2JVRA 1IKWB 5E33A 2XSJA 2ROPA 3W2VB 1SPBP 3S6EA 4A8KA 4EWTA 4R5PB 2NZ6A 1SB6A 1KRPA 1YBTA 3ZTSA 2VG7B 4QPTA 2AV5A 2I6JA 3QCMA 3J81Y 1QAJA 3W64A 3TUIC 5I42B 1Y10A 2AF6A 5DZ7A 2OEJA 2UVRA 1F9FA 3GFXA 1W25A 4I6AA 3LGHA 3C15A 4S0MA 5ETVA 3OTEA 3TX8A 4LRFA 4LF4F 5ETPA 1HBNB 3V0JA 1KWMA 4WFBQ 2KG0A 2E1RA 1YRXA 4P2MA 4FKYA 3SI8A 5KADA 2QBRA 4Y2MA 2BKNA 4CH1A 1CS4A 4A46A 1TAUA 1RP5A 3W62A 3KK3B 1QAIA 2J7UA 5KFTA 3CJ4A 4FXDA 4KYZA 5B7WA 2Z57B 4DF4A 4UAGA 3DGPB 1KOHA 1KHWA 1Q95G 2UUTA 1XXVA 3QAUA 4KBIA 3CCTA 1GMWD 4MMOA 2AZ3A 5F0WA 4Y2KA 2I42A 2HIQA 1FA0A 4G6VB 2BM1A 1H3DA 2PBNA 3CWJA 5D78A 2KJWA 1U7LA 1NPKA 2OFGX 3SMEA 2VG5B 4FYVB 4ILRA 1VBYA 2BANA 4AQYF 4RKKA 3CDAA 2J9DE 4CO1A 4NYZA 3KJVB 5BR8J 1HFEL 3DLEB 1D9AA 3DHXA 4ECWA 2M3VA 3BGRA 2HNYB 2E7WA 4CQ1A 4NMLA 2KTQA 1CJUB 1PTYA 3LF0A 3EU0A 1YJVA 4ZI4A 3KDOA 1VISA 4WIIA 3IFEA 2JX2A 2VFTA 2ZBIA 3OBIA 3FEYB 2BDPA 2OJ3A 4IG3A 2KRRA 3R5GA 5CD4A 1FVQA 4JV1A 3BH6B 3OFFA 2C2RA 1M1KT 4LQ9A 2IMGA 3RAXA 3LANA 3LK7A 4IQXA 1ZH5A 2ZVIA 3PHEA 1D1UA 2LA4A 2V68A 2LMIA 2HHSA 4RW9B 1E6VA 1FRKA 3DRYA 3FKBA 1KVKA 3PJ9A 4LUBA 3M4XA 3H2VE 2AJ0A 1Y3JA 4XIUA 3W9IA 2I6PA 4XPEA 1FHTA 1S76D 4ZS6A 2J5AA 1SL2A 4J5OA 1S4FA 1IJEB 2I5JA 3CD7A 3MVNA 3MECA 1IN0A 3SV3A 4X4TA 3MM7A 2WBMA 3JQJA 1SL0A 4GKJF 1TP7A 3VGSA 3JSYA 4FS1A 1HHTP 2IVYA 1FD8A 3KJQB 5K24A 1Q5YA 2AHSA 5G0RA 2I9SA 4M1KA 1KN6A 3KHRA 3OL7A 1Q1MA 1H72C 2JLGA 3JXOA 3PFEA 1NRKA 2DR7A 4DR2F 1KTVA 1JLCA 4IQMA 2CMAA 2KI2A 3K5NA 3QFHA 1N32F 1HMVA 4DMZA 3PW4A 4DPWA 2JFKA 4GE6A 1RQ0A 4V1Ak 1WI8A 3LP0A 1BMQB 3MM6A 1U49A 4Y28C 1CPZA 1WEXA 2VV5A 4LVNP 2YPYA 2VPZB 2CQIA 3G71S 1FJ7A 2GC8A 3IGNA 3JTPA 3OVSA 1MSWD 3QIPB 5T14A 2LEBA 4Y6IA 3Q89A 2AX1A 3E01B 3CJKB 1DJ0A 1LV5A 2VQFJ 2ZD1A 3IBWA 2VOSA 1RT2A 2KYXA 2F4VF 1TK0A 2XSJB 1FRXA 3TVYA 5KFNA 1U24A 4Q45A 2Z0GA 3W63A 4YP3A 3T9ZA 5DG8A 1R0AA 1HNXJ 3BPSP 2YX4A 1B0PA 1X4HA 4WXWA 5JJBA 1K73T 4QYZJ 2RU9A 1REVA 2DO4A 1SIZA 1NKCA 4RLEA 1AW0A 5C24A 4EZ6A 3DLHA 1IR1A 3UDEA 5AXKA 1CULB 3C15B 2H4GA 4O23A 4X4QA 3AHPA 1ECVA 1S59A 2HLUA 1CQNA 2DNRA 5D4OA 1R8CA 2OPPA 2FIUA 3D1OA 2X7IA 3S1TA 3CGIA 2ZKTA 3V81A 3GP9A 1GMVA 3ZFVA 1CS4B 4Y3CA 1AFJA 2JL9A 1SL1A 4EEYA 3OLAA 5H9FK 3RRHA 1ULRA 1WOPA 4ZP7A 2DNNA 1IJFB 1SC4B 3AJ1A 2QCTA 1MW7A 3K5MA 3GJQB 3TQEA 5CH7B 1BUXA 5C25B 1RA7A 2GQ2A 3GU0A 2C46A 2UZAA 1YJRA 4M5HA 2WSFC 4CVLA 5CA5A 2R8HA 2ZZTA 4X64J 2CQCA 1HW9A 5D3GA 2WSCC 4A47A 2I75A 1T9VA 1CQMA 3H4BA 4USHA 3CTRA 1RWVB 1AT1B 3UE2A 3OLBA 4FXWA 2GCFA 5F8JA 3CM3A 3BPDA 4DU7A 1SJQA 2CYYA 3BGRB 1PJ6A 3J7YI 1LW2A 2PA5A 1WOSA 3QGIA 4XPCA 2RNEA 2GMLA 1DBDA 2HEKA 2HVZA 1EX8A 2B4SA 4XTTA 2UU9J 1WC4A 1UEVA 4X4UA 4IG3B 3HVRA 2CNHA 1RXDA 3KHHA 3RBDA 1B3TA 1OEMX 3SSQA 3R5AA 4NXNJ 3MXHP 5LMNF 4ZIYA 1U1NA 4WZMA 2D74B 2FJVA 4ZOSA 4KR0B 5B0FA 2W7PA 3PR5B 2FJEB 2QL9B 3OHAA 1E6VB 2MPUA 4HLBA 1T3OA 4QPXA 4UQGA 4WFNQ 2EW9A 4LFCJ 5HQLA 4P9SA 1EJ7L 2JDJA 5JVGQ 1TVRA 4NXNF 4P2FA 2ZDOA 4XK8C 1F3FA 1P1LA 3R1LA 2R7RA 2FZGB 1WRMA 2DNLA 1HWKA 2ZOGA 1P15A 3T6BA 4LR8A 2I5JB 4DV6J 3TO8A 3MECB 1RHKB 2W7AA 4J9KA 5CQGA 3BGFA 2MTLA 1RZMA 2FJBB 4Y65A 2CDQA 2NXUA 2QLBB 1NZAA 4LFCF 3MM8A 4KV8B 1YBAA 2WCXA 1FKAF 1SV5B 1PJ7A 2A2DA 3RAQA 3QSIA 2GCAA 4ZPVR 1B7YB 1MN9A 4C8NA 2QA4G 5G0RB 4JI1F 3L4BC 3UVJA 2AU0A 4JP8A 2RHQB 1JLCB 1Q0NA 4DV0F 2CRLA 3AQPA 3LTOA 1HMVB 2HHXA 4NWBA 3I5AA 1Q6MA 4YHHF 3AWEA 3LP0B 3IA0A 4KGVB 4NLXA 4OJ1A 2FYXA 2BMBA 2JEFA 2P9CA 4NLQA 3J7YU 5D6GA 3PS5A 4CO3A 3W2WA 2HFVA 5B0DA 3EDQB 4PG5A 1KQKA 3VAMA 2V8PA 3FMBA 3KUHA 2FGOA 2DR5A 1VIOA 2E9ZA 5KG3A 1WTFA 2ZD1B 4FNIA 1QAXA 3RJMB 2B43A 1TR0A 1C0TA 1B0VA 3UD3P 4OX9J 1RT2B 4LSLB 3JYTA 2DXPA 3SFUA 3HJFA 1KQFB 1R0AB
chains in the Genus database with same CATH topology
5L1JA 4ED3A 4N47A 3VCDA 5AE3A 1N5TA 2E5HA 5THWA 3WZ0A 2P6SA 1CC8A 1REVB 2M9KA 2GMJA 4YQWA 1YVFA 2J16B 4AZ1A 4PQUB 2DD8S 2EG2A 2K7JA 3X3UA 2MKIA 2FJMA 1FDAA 1MWYA 1RTJA 2MKCA 1UA0A 2D3ZA 3PY8A 5C24B 1FEEA 2J9CA 3IAM9 4ELTA 3L95X 3M2UB 4F4XA 2F9DA 5KFHA 2HVLA 2IFXA 2V0NA 2QLXA 2OC3A 1HNVA 2DB1A 3OR2B 2AYMA 3U96A 1U45A 2Z2MA 2M5YA 2ZH5A 3PVXA 1QVFR 1HARA 1UFLA 1J2VA 3QJLA 1R89A 5J1NA 3CIZA 4AXIA 3F81A 1R8BA 4RW8A 4YR8B 2ZJRQ 5L1LA 4WYLA 3M2RB 2ZNYA 5KFRA 4ECXA 1VBZA 4U7UK 2AX0A 4N41A 4BWJA 4ERCA 5CXTA 2MZ1A 3OXFA 1P9QC 1L3SA 5LSLA 2OPPB 4MBBA 3FEXB 4URSA 3TVZA 4HRFA 2K1RA 3CJ5A 3TR5A 2VEXA 3FFIB 4JI2F 3F44A 4FF3A 1Y00A 2KO1A 4WTYA 1I9TA 4BC7A 2EFQA 3BN7A 4F4ZA 4WKRA 1HI8A 4KGMA 4NLYA 1DFDA 1OEUA 1OEOX 1TL5A 1X4FA 2RB7A 3V81B 1VMBA 3CCMS 1Y5IB 4ECQA 4DFKA 4IKCA 1JLQA 1UW4A 3PIOQ 1YN9A 4KYRA 1HPZB 2KRBA 4ZP8A 3TYTA 1FDDA 4PG8A 3CDBA 1IUJA 3KK1A 4KJIA 4UW2A 2YX1A 3J7A1 1X4AA 4DR1F 5J2PA 3I9ZA 1X4EA 2OD4A 2UUAF 4YR0A 4JI5F 4CTAB 3N0AA 4NLTA 1TKXB 4RZRA 4KE5A 2DHXA 1N5YB 5A8KB 2PFFB 2BV3A 2YTCA 3GB0A 3RO1A 1NEEA 3CVKA 3TOQA 3ZZPA 4PPZA 5GAHI 2GGPB 1EEOA 2YWFA 4TQSA 3BSNA 3M8PA 1KC8T 2IC3A 3VF0B 2ZOMA 3IWLA 1W2IA 1O51A 2VBYA 2VD3A 2RRBA 4O4RA 3G4SS 5EHHA 2ZMMA 2RJZA 3MWBA 5GADU 1AAXA 1WEZA 4TYAA 2J8AA 1XR7A 2YNFA 2AD9A 3K8VA 2F6WA 3L09A 2B3TB 3DLGB 1URNA 2WGPA 2LQBA 2FC9A 4X4NA 5DJBA 3DLKA 1RT1B 1MMLA 1U1MA 4I6YA 5KFWA 3HVAA 5BZXA 1KLMB 1A7GE 4QW8A 2PA8D 3DMJB 4ALZA 1TKDA 5L1IA 3T1YF 3SDEB 3QCIA 4QIVA 2F6YA 2DTJA 2ROEA 4WXOA 1FEHA 2YWEA 3DGPA 2D9PA 5DLGA 4OHEA 3V0EA 2R7TA 1VK3A 4MIAA 1KQGB 5A8RB 2DR8A 5F8GA 3RB6A 1YTNA 3QZ7A 2ZH6A 1NL9A 2BM0A 2F8MA 4KFBB 2DCLA 2RQCA 3E8OA 3O6QA 3MMCB 1M5KC 3OXGA 2JFDA 3TA0A 4GFUA 3O1LA 1DHMA 3CJ0A 4PXDA 1AFIA 2FHMA 3DM2B 3OXLA 2W9CA 1IXKA 3CO9A 2VBZA 4NRTA 2DBBA 4WK1A 3MGJA 3QCKA 3LAMA 3QCCA 1X5PA 3H20A 1YRUA 3SV4A 4QU6A 1RT6A 4YFUA 1P27B 2GW8A 2RQMA 2J7KA 3GZ7A 4EO6A 1JJ4A 1PSDA 4N8NA 2A2CA 3MPVA 4NWGA 1CLFA 3HHKA 2LA6A 1M5OC 1YGYA 4OMFG 3UPFA 3CT9A 1M5VC 2DPIA 1JK9B 4O4GB 1MKPA 2G59A 4H4KC 3E51A 4QIGA 1LW2B 2CZVC 4YB7A 3BLUA 3W3SA 1VQPS 3EUNA 2GQQA 3QCEA 4H4MA 5CCMA 4MYTA 2HNZA 1WG4A 4YDDB 1XNQF 4PR6A 1O0PA 2CQ2A 2F8HA 2VEVA 2XC9A 2BVZA 2N4CA 2M7SA 3KG1A 2NS1B 2BA9A 3DLEA 3FGVA 3QCNA 1C83A 2FLOA 1S1XA 2Q6BA 3DYAB 3BQ1A 5KFBA 1ZETA 1JKHB 3HHLA 3CMAS 3EXYA 1S1WB 3JTOA 1LYVA 1WEYA 5F8HA 4D3RA 3LALA 2CPFA 1HR0F 1DLOA 3PX4A 4G3IA 2VZ9A 2HNYA 4K59A 1TL3A 5K8PA 4M8LA 1VQSA 2OIHA 4KYQA 1S9EA 3SSSA 3OJUA 4K0KF 4F2SA 2NR0A 3HHNB 3DLBA 2D41A 1IR0A 4DL0C 2BQ3A 1XXPA 5KABA 1K9MT 1HWUA 2CQ3A 2IVMA 5DDQC 1RDRA 2ROGA 3PRBA 1JLBA 3UR3C 1D9FA 1UWBA 3KLFB 1JJHA 5F0UA 2X1AA 3EYZA 1HBUB 3L7OA 4NLDA