4WU2A

Structure of the ptp-like myo-inositol phosphatase from selenomonas ruminantium in complex with myo-inositol-(1,4,5)-trikisphosphate
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
313
structure length
313
Chain Sequence
TVTEPVGSYARAERPQDFEGFVWRLDNDGKEALPRNFRTSADALRAPEKKFHLDAAYVPSREGMDALHISGSSAFTPAQLKNVAAKLREKTAGPIYDVDLRQESHGYLDGIPVSWYGERDWANLGKSQHEALADERHRLHAALHKTVYIAPLGKHKLPEGGEVRRVQKVQTEQEVAEAAGMRYFRIAATDHVWPTPENIDRFLAFYRTLPQDAWLHFHSEAGVGRTTAFMVMTDMLKNPSVSLKDILYRQHEIGGFYYGEFPIKTKDKDSWKTKYYREKIVMIEQFYRYVQENRADGYQTPWSVWLKSHPAKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myo-inositol phosphohydrolase
publication title Structure of the PTP-like phytase from Selenomonas ruminantium in complex with myo-inositol-(1,4,5)-trikisphosphate
rcsb
source organism Selenomonas ruminantium
molecule tags Hydrolase
total genus 110
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 3.1.3.8: 3-phytase.
pdb deposition date 2014-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14566 PTPlike_phytase Inositol hexakisphosphate
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1690 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4wu2A01
3.90.190.10 Alpha Beta Alpha-Beta Complex Protein-Tyrosine Phosphatase; Chain A Protein tyrosine phosphatase superfamily 4wu2A02
1PTUA 3QCGA 1FPRA 2I6OA 2PI7A 2OOQA 3EU0A 2FH7A 4ERCA 3CM3A 1JLNA 4NWGA 1QXKA 2I3UA 4ZI4A 5K9WA 2I4HA 5K22A 1G7FA 1M3GA 2ZN7A 2HVLA 1OESA 3QKQA 4OHDA 2I6PA 2PT0A 1XM2A 2SHPA 5J8RA 2VEYA 1YZ4A 2HY3A 2H03A 2CJZA 2F71A 4MBBA 1ZC0A 5KA1A 1PYNA 4WTYA 2I4EA 3CWEA 3QCHA 2I75A 1OEUA 5K24A 1Q6PA 1NWLA 2H4VA 1T4JA 4ZN5A 1OHDA 1G4US 2Q05A 1X24A 2CM3A 5BZXA 3RZ2A 1XXPA 2QDMA 3QCBA 5I6VA 2OZ5A 4GE5A 3ZM3A 4NWFA 1Q6NA 2MBCA 2F6FA 2I3RA 4Y14A 3QCNA 1FQ1A 4RKKA 3NMEA 3ZM1A 4DGPA 4JMJA 3EB1A 1LARA 4WU2A 4I8NA 1I9TA 3QCLA 2I42A 2P4DA 3S3HA 1GFYA 5KA3A 2BIJA 2IMGA 4B04A 3A5JA 5BZZA 1C87A 2VEXA 2Y2FA 3S3EA 2CNGA 3MOZA 2CM8A 1P15A 4RH5A 2FJNA 2F70A 2QDCA 1RXDA 1SUGA 3N0AA 2QBSA 3O4UA 4GS0A 4GWFA 2I5XA 4GE2A 3MOWA 4OHLA 3F41A 1ONYA 4QAHA 2BZLA 1C83A 2G59A 1OHEA 1R6HA 4S0GA 1YGRA 4H34A 2I6JA 1LQFA 2B4UA 1G4WR 1V3AA 1YN9A 3QCFA 4GE6A 3D42A 1WAXA 1Q6JA 5KA4A 1D5RA 3SMEA 1PA9A 5AWXA 2NTAA 1ZZWA 5EHRA 2OUDA 3BLTA 4D3QA 2CFVA 2GJTA 2CM2A 3BM8A 5IBMA 1LYVA 1U26A 4RH9A 3ZMPA 1QZ0A 2B49A 2GP0A 2I1YA 2CNHA 4GRZA 1KAVA 5GTJA 2PSZA 3BLUA 3H2XA 4WOHA 5IBSA 5M43A 3O4TA 4KI9A 1ZCLA 4OHIA 3D9CA 4Z6BA 2Y96A 3QKPA 1T48A 2H04A 1XRIA 3EZZA 4WU3A 2H02A 4JBCA 1C84A 1NO6A 1XXVA 2BV5A 1NNYA 5BX1A 4R0TA 2HC1A 2C46A 4PYHA 1G1GA 4TVVA 2A3KA 2F46A 4RI5A 1FPZA 3M4UA 4QAPA 3I7ZA 4R0SA 1ONZA 1A5YA 3MMJA 4PVGA 2QBRA 2AHSA 1C85A 3GXGA 3S3FA 4GFVA 3O5XA 2CNIA 5KABA 2QCJA 5KACA 2PQ5A 3I36A 4NX8A 5KA9A 4KYRA 4R30A 1PTYA 3ZM2A 3ZV2A 2QBQA 4J51A 3S4EA 2F6YA 1OEOX 4QUNA 3D1HA 2VEUA 5KADA 2NT2A 3BRHA 3LJ8A 2CMAA 1YWFA 2B3OA 2I6MA 3I80A 1PTTA 2QDPA 2I4GA 1G7GA 2AZRA 3PS5A 3O3LA 5KA2A 3RGQA 2VEVA 1WRMA 2NV5A 5K23A 1EENA 4HRFA 2NT7A 2QBPA 1BZJA 3QCDA 1OEVA 4YR8B 2CNFA 4D3PA 3V0EA 2RF6A 3U96A 3QCIA 4DGXA 1C86A 4OHEA 5KA0A 1BZHA 2M3VA 1YTWA 4RDDA 2FJMA 2BGDA 3B7OA 3V0FA 2CM7A 4KYQA 1Q6TA 3QCEA 2B4OA 5KAAA 1L8GA 2QEPA 2CMBA 1L8KA 1YTNA 1MKPA 1BZCA 1XBOA 3S3KA 3AWFA 3V0HA 4Y2EA 2B4SA 2BGEA 2GWOA 3ZM0A 3A5KA 3F99A 1C88A 2HNPA 3F9BA 1U24A 4RHGA 4OHHA 2HCMA 2ZMMA 2VEWA 4ZRTA 1Q6SA 1PXHA 5HDEA 4D3RA 2ESBA 1OEMX 3F9AA 2P6XA 1PH0A 3V0JA 3OMHA 2B07A 1KAKA 1NL9A 1ECVA 4GFUA 4QUMA 5EHPA 1NWEA 2QCTA 1WCHA 1I57A 4AZ1A 2DXPA 2HB1A 4IKCA 2CNEA 2F6TA 2H4KA 4RI4A 2J17A 4H1OA 3O4SA 3S4OA 4ICZA 2R0BA 3QCKA 1RPMA 3D1QA 2J16B 2F6VA 1PTVA 3OLRA 4NNDA 4QBEA 2WGPA 2YDUA 5K25A 4HJPA 3QCCA 4JMKA 2C7SA 4GRYA 2JJDA 4QBWA 2CMCA 2I6IA 2Q47A 1OETA 2NLKA 4YAAA 1YPTA 4HJQA 4NYHA 3V0IA 2F6ZA 1OHCA 2HNQA 3RGOA 2G6ZA 1YGUA 1VHRA 3V0GA 1YTSA 1PA1A 1EEOA 1ZCKA 3EMUA 2F6WA 3SR9A 2H4GA 3F81A 3AWEA 3GXHA 1J4XA 1G1HA 2A8BA 1GWZA 4JNBA 2HXPA 2B4PA 1Q6MA 1AAXA 3RO1A 4BPCA 1JF7A 3AWGA 1YFOA 2E0TA 2OC3A 1U25A 2PA5A 5K9VA 1T49A 4BJOA 5KA7A 2HC2A 1I9SA 3QCMA 2PBNA 3D44A 2J16A 5BUGA 5LXQB 3ZMQA 5MMZB 1G1FA 3V0DA 5KA8A 1NZ7A 3QCJA 3D1OA 1Q1MA 3EAXA 2NZ6A
chains in the Genus database with same CATH superfamily
1G3OA 4CTAB 2C3UA 2CDRB 2ZITA 2I4HA 5K22A 2D74B 4ZVGA 4PZVA 4DX8H 3J7YU 3IWNC 5B0CA 1W7KA 3KK1A 1KOOA 5LT5A 2HY3A 3MXHP 1RTIA 1S59A 4AL5A 2IVYA 5IQ6A 2C3MA 1PYNA 2I4EA 3QCHA 4OZJA 2MQPA 3GONA 1XC9A 1X5PA 3RBZA 3RR7A 3KNGA 2CPHA 4WYLA 5DG8A 4B9VA 1X24A 3R8YA 2QSFA 3KDNA 1NNDA 5A8WA 2EKYA 5L39A 1N36F 5IC6B 1JK9B 3BS9A 4J7CA 4PCQA 1T8EA 4WU2A 4ZHRA 3HHLB 3CDBA 4P73A 2B9WA 3HDSA 3J7ZT 1TVRA 2D9PA 2EG2A 3TOQA 5BZZA 1MWYA 3FDSA 2VEXA 4DFMA 1S1XA 3KMSA 3K5OA 2ZH3A 3PRBA 1RHJB 1EAYC 5AJ3F 1SC3B 2R8HA 1QD1A 2KFYA 1N56A 3O4UA 4MFBA 2XNRA 5L8RC 1VC6A 1KTQA 3MM6B 3FGVA 3KJVB 3G4SS 3MR7A 2X5OA 2FHJA 4I7FB 1YBAA 1TL7B 1SUQB 4QDIA 4GE6A 3EM1A 2KT5A 2GCAA 4CVMA 1LEOA 3MEDA 2EFNA 2HRYA 2YBVA 2L9WA 2HAFA 2M88A 3R5DA 1T94A 4J9VA 1LYVA 1MWQA 2AJ4A 2J9DA 2XLKA 1KAVA 3VGUA 1F5BA 2FHMA 5HP1A 4QIWD 3H25A 4OHIA 5F8GA 3V6HA 1SH3A 3EDQB 1XXVA 3SCJE 4WP8A 4CLKA 2C46A 1RABB 1TELA 1QY7A 2KRBA 1EP4A 4DU7A 4L74A 3D2WA 4C9DA 3UWTA 4USVA 1RT4B 4PWWA 1M1GA 1OMSA 4F04B 2C2MB 2P2CB 1S72S 4GFVA 3G71S 2XC9A 3U02A 2VUGA 4RW8B 3OBIA 2ZUAA 4HT7A 3DRPB 2OPQA 1UJ4A 3KK2B 5C2CA 2CQIA 4RW4A 2I4GA 2Q66A 5KFXA 2XMUA 3JQMA 1ROFA 4WIQA 1S1VB 4USIA 2JLGA 2GQCA 3C3LA 2RKIA 1U1MA 3MECA 1YIJS 2R2SA 2FD2A 2AGQA 1HYSB 2G2ZA 5L9XA 3PG9A 4ZOSA 5ETNA 4LF8F 4OZ1A 2NXUA 1NH8A 1IBCB 1GNKA 2CWXA 3FRZA 4QIEA 2F3JA 1YJRA 3NGKA 1Z4UA 4NLOA 2VDIA 1KNZA 2AKWB 2DR9A 3EPGA 2QL9B 3AWFA 2MZSA 1KQGB 5HLFA 1C88A 4KHPJ 2LA4A 4CO3A 4OHHA 4EBEA 2HCMA 2ZMMA 4R25A 1DLOA 5J1EA 4I2PA 2J5AA 1FK9B 3R5AA 2NREA 1CLFA 3V81A 3ONQA 4X66J 4PUOB 3DOMA 2LQ9A 2A6OA 1I57A 1Q8KA 2K7JA 5ETOA 1S7IA 1FESA 4DPOA 3D1QA 4C97A 2WGPA 2KFNA 4B3SJ 1WEZA 1QVFR 4JMKA 4GRYA 4C3MA 2DNZA 3G87A 1OHCA 1RLCL 4MTPA 4K2XA 3NY0A 3BO2A 3AY0A 1UVKA 2MPUA 3CIZA 4RX6A 1I6JA 3OL7A 5F8MA 3K5PA 2CJBA 1PYSB 4IG0B 4WK1A 2D3OR 1VRTA 3BSAA 4NLUA 5D77A 2OTJS 4KH0B 2IHR1 4OYXA 2FB0A 3H0PA 1DTQB 2CA9A 2ATLA 2CQBA 3P45B 4F4WA 1CEZA 2BKOA 2KRRA 1HKAA 2I8EA 5B0DA 4Q0BA 5ETLA 3DFEA 4A46A 3VWSA 1KKHA 2JEFA 3QJJA 4KGKA 3M30A 1AROP 1JLNA 1LWCA 1EJ7L 2EWHA 1FFGB 1G7FA 2GC5A 3IRXB 1AT1B 1JLCB 2BXJA 1KQKA 3EMTA 3CJ8A 3AXKA 3TVKA 4YHHF 4KKOA 4QU7A 3X1LB 1N5TA 2OELA 2ILYA 4RUAA 5LM7E 3QSYB 3CJ4A 2CG4A 2MQMA 4HTIA 3LW5C 4B02A 3DLJA 1FJGJ 4LF4J 1RBOB 2J0XA 2W9BB 3DLEA 4KT0C 1YJNS 3J7A1 3MM8B 2M8DB 4ALZA 1RT1A 2EC2A 3UQSA 1VLYA 3MTKA 2PA8D 2N4CA 2MLXA 4XIUA 3ZM5A 4IH6A 2Z56B 1I9TA 2FJXA 4DR4F 5K14B 2CPEA 2XSFA 3M4XA 2I38A 2XYGB 2FPHX 1GFYA 3JB9k 3GYGA 3RB6A 3HULA 1SVDA 2AWZA 3GB0A 5DLGA 2VPWB 1FERA 4ANEA 4DR5F 2GHPA 4I0WA 2BACA 4YMEA 4P2XA 3F73A 4KY3A 3US5A 2ZE2B 2BJ8A 4ICLA 3ZZOA 2C2ZB 3DLHA 2FJWA 1RHQB 2RRAA 4CLLA 3QRRA 2VHGA 2GGPB 2XMMA 1TUWA 4YQWA 2Z4PA 4X4PA 1L3SA 2B4UA 4PABA 2NYHA 1IBKF 2PEHA 4LFAJ 3ULHA 2CJ9A 3UFCX 5K8PA 3QBCA 5E2QA 5D15A 3MEGA 2UXBJ 1PBUA 4UF4A 5IBMA 2F8EX 1DAXA 3NCQA 2WB1D 3V6KA 2JH3A 4KV8A 3FZBA 2I1YA 3AFGA 3RW7A 3FSIA 1RU2A 2PSZA 1T05B 1B0PA 4QW8A 4Q44A 4Z6BA 3D9CA 3LA0A 2QC3A 3DU6A 3GV5B 2YPZA 3IRWP 1VQLS 1K1SA 4NZ7A 4ZPBA 3AOAA 4PG6A 3MAQA 1HQ2A 1IR2A 1G6BA 1KEKA 1L3KA 2XQCA 4ZCKA 4RI5A 3KLGB 1U1OA 2MY8A 2KHCA 1RA6A 1P9QC 2BE7D 2EEYA 1UL3A 3BEGB 2QBRA 1FDDA 1VIOA 3SCKE 4I69A 1W7WA 2ABYA 3GP9A 2O01C 3ZM6A 1OPIA 1GTEA 1TTHB 4MJKA 4NEYA 5KADA 4DV0J 4DL0C 4U95A 4X4UA 1FE0A 2IVFB 3V5RA 2NSBA 5EGYA 3T6BA 1AA1B 3EGVA 5HO4A 3G86A 3SI8A 2WVFA 3WBZA 3O3LA 2OPSA 2V94A 4W4MA 5C24B 3AD7C 5FD1A 2OPRB 4K4XA 5EUHA 1LWFA 4D3PA 3B4DA 4NCGB 1UZDA 2XYHB 4DV1J 3BGRB 3TP2A 4P6QA 1YTWA 1YITS 3KYLA 5KOXA 2CAJA 1VK8A 2QL5B 4DQQA 4N56A 1DY3A 2NUUG 1UCNA 1SC1B 4UOHA 5L1JA 2MQNA 1S49A 5I3UA 1U2FA 2CDQA 5D78A 1VS3A 3F99A 4Y28C 1F1BB 3A8KA 1LNQA 5F8NA 1TK0A 3M6VA 2RUSA 1P1LA 2HHPA 3BQ1A 2KG0A 2CPDA 5T14A 1C1BA 4Y2CA 3ZNUA 4V19J 3D9BA 4JI8F 3KJQB 3EWGA 4Z7CA 2ZH9A 2J17A 4H1OA 3LWMA 2VH7A 3GCXP 4IG3B 1VQPS 1XNRJ 1TL1A 2BV3A 1SKSA 2J6UA 2WOMA 4F4ZA 2JJDA 5ETQA 2Q47A 3IN5A 3M8SA 4OI2A 2AM1A 4KBIA 4N47A 2O1PA 5D0HA 3BH7B 2B3TB 2F1FA 4I56A 1YRTA 5KT7A 4BBYA 2BDPA 3EMUA 1CSJA 2QFIA 2IVMA 1UJ6A 3QO9A 5DO2A 1N0UA 4JI2F 5KFEA 2FLLA 1F0XA 3GFZA 3NWRA 5F8HA 3GSIA 5FDLA 2BJEA 2ASJA 4DCOB 1C4CA 4GKKJ 5K9VA 3MM5B 2HC2A 4QPXA 5DLFA 2UVWA 1FWLA 3BQ2A 4BUBA 5IOLA 1G1FA 3D6FB 4Y3CA 1J6UA 3PR5B 3VGVA 4K59A 1EETA 1CJUA 3G2XA 1NJIT 4LQ9A 1LWXA 4DX6A 4DL6A 2HHHJ 1HPZB 3LP1B 1M1KT 1NPPA 2KJWA 2KZMA 2ZN7A 4C8MA 3PIPQ 1XM2A 1DURA 3BH6B 2HLUA 4IQXA 1YZ4A 1C2PA 3KHHA 2KB2A 2OIHA 5HMZA 3CJTA 4J9QA 2VPXB 1C0TB 2F65A 1NK9A 2K2PA 1U6BA 5BYSA 2ROEA 1C1CA 2RMLA 4PKDB 2L08A 2QDMA 5AE1A 4NASA 4DCPB 2BQRA 2VFRA 4KTQA 3NMEA 1UFLA 4BS2A 4FKYA 5I42A 3JQJA 3Q8VA 3BR9A 1KN6A 2MZQA 3LANA 2XG8A 1JLFB 4DPYA 2HVEA 4ZA1A 2I6WA 4DSLA 3OSNA 1DHMA 1C87A 3MMAA 4LF7F 1OQ6A 4OYOA 2QX0A 1JQGA 1JJ4A 1HNVA 2HMIA 1Q53A 3DU5A 3W2VA 4GS0A 3JYTA 4KGVB 3L7PA 1YJVA 1JKHB 2A1BA 1CPZA 4DV7F 2PD1A 3KOAA 1ZZFA 2K1RA 1M5HA 3GIIA 3MVNA 1V3AA 2HFNA 2W1BA 4IRDA 1VQ9S 3MFHA 4ZVEA 1KBRA 2WSFC 3WIVA 2LDIA 1PCAA 1UEUA 4B9MA 4DDFA 1W26A 4DN0A 1XMQJ 4DR7F 1YJUA 3G6YA 2FGCA 4R5PB 2CNHA 4JV5J 2ZZMA 2OD4A 4P2FA 5LJ3Y 2ZBQA 5B0EA 5HANA 5M43A 3UDEA 4JI3J 1Z2LA 4ID5B 1FKAF 1XRIA 3EZZA 5KFGA 3BJYA 2VQEJ 3VZHA 5KG7A 1X8DA 2NXJA 2W4PA 4H4OB 1G7CB 1FD2A 4R0TA 2PEBA 4HI1A 2A3KA 3GFYA 3CCJS 1IKVB 1IKWA 4DPTA 3MMCA 3BBBA 3FMWA 1XWLA 2BRLA 4PVGA 3QQCD 4B9LA 1YTYA 4YB5A 2QCJA 1U0SA 2KYZA 4LR8A 2ZDOA 4DV5J 2C3PA 4R30A 4FF1A 2N4DA 4EO6A 4HH1A 2YWHA 5A8RB 3A12A 4TU9A 1OEOX 3HVWA 3LJ8A 4Y2MA 3FEXB 1YWFA 2XS5A 3D6TB 2XS2A 5GAGU 3GIKA 4N41A 3ENAA 3I6PA 4EUVA 1EHWA 4PRFA 4F02A 3PS5A 1YK9A 3EICA 3WQPA 1S9GA 1WORA 3ZTPA 4LJMA 1PBAA 4EK2A 5ETPA 4K4VA 1VFJA 2FYXA 4NLVA 2FLPA 4MT1A 4ILLA 1OEVA 4L6V3 5L38A 1UMJA 3FFIA 4AXJA 4RKUC 1GXUA 3IG1B 3CMAS 2WK4A 3VQSA 3GIMA 3S8SA 3THTA 1HWKA 1KLMA 4IQMA 4WFZA 3WX4A 5ETSA 3SFUA 1N6QB 1X0PA 2VG5B 2OI2A 3RG6A 3LGMA 5KG4A 5E7OB 5J2NB 3UDCA 1DARA 2GWOA 1UFKA 4Y2IA 1Q79A 2N7YA 4B3MF 2C3YA 4YUDA 3BKUA 1S0NA 4OI6A 1PH0A 2BRKA 3LPEA 2HQDA 2EXUA 2B07A 2H9ZA 3HO1A 5K20B 1HQUA 2Y1LB 1WC1A 4URGA 3J80Y 2QCTA 4ECWA 1QSYA 2KXNB 2R0BA 1V5VA 1RAGB 4CDIA 3H42A 3OHBA 2QG9B 3EYZA 4X4OA 3OLRA 3K5LA 4WWSA 2BQUA 5M2RA 4GC6A 1FKOB 2VZ9A 2QV6A 1TQLA 2HNZB 2J0WA 3OR1B 1ZYQA 2ROGA 3FVYA 1FRXA 1ZM2A 2BJ7A 2IIHA 4UY8T 2ZM6F 2BW7A 5HROB 4LFCJ 3QGPA 3MR2A 2UU9J 4F4AA 2QE5A 2VASA 4JB8B 1U09A 1F9HA 2U2FA 3M2VB 4UZBA 4USUA 3A13A 4CP5A 2WTZA 4FBUA 4E98A 3TARA 1Y3KA 4DG1B 2J0SD 4B3TJ 3OTDA 3HX9A 2DNGA 3UAGA 1UWBA 1WDTA 4F0MA 3THPA 3DXBA 3LGHA 1FD8A 4FBTA 4USJC 3TA2A 1KFSA 3QCJA 3DRXA 5GAHI 3ZZYA 2O3DA 4ETXA 3MUMP 1MG7A 4DN9A 3R27A 1DRZA 3GU0A 3DRRB 3CDEA 1VQMS 3HMJG 3I87A 1N33J 2AX0A 2GMLA 2UXDJ 4UTGA 3V6DA 1KSPA 3MEEA 4DSEA 5DZ6A 3LUYA 1X0FA 2V68A 2HBZB 2ILZA 1S1UA 3I5CA 1HNWJ 2DBBA 2HZVA 2AJ2A 3LALA 1GG4A 4DR1F 4DR3J 1BD6A 2V2VA 4TXSA 1CJTB 1I3OB 3Q23A 4ZN5A 4NLTA 4O4GA 3CCZA 3K8WA 4JI4J 2VIHA 3JSMB 3H5UA 3QLHA 2JRSA 4NLYA 1NPKA 1S6QA 1VRUA 3BF4A 3UN5A 5DG7A 1VBKA 4LT6A 2IC3B 5CAAA 5A0YA 3IAS9 1BQMB 2LP4A 3B8HA 2XY5A 4OI3A 3SSQA 4G65A 1C0UA 3UVJB 1EARA 3PX0A 2ZJRQ 4EWTA 2KG1A 2HNYA 3R5CA 2GC6A 1RUSA 4Z2XA 2E5LJ 4OI4A 2R7TA 3MURP 4IKAA 4GVLA 2BZLA 1K44A 3PKYA 3OQ2A 4NZ0A 1LWEB 1LW2A 4L3KA 3SXLA 3UO0A 5L1KA 1KONA 3W8GA 2XSJB 1RLDA 5DDRC 4FKXA 3PW5A 3I0SB 3RR8A 3MD1A 1QSSA 4B9SA 3N6MA 5EHRA 2E9ZA 4M5GA 1BLUA 1YHQS 2ZFHA 3PYGA 3ZMPA 3T5HA 4KO0A 4K2JA 1VQYA 2CPJA 2RAQA 2WVDA 2G13A 4KI9A 1T48A 5KG6A 5AXNA 2DPJA 3CCMS 2X1BA 3HD2A 2FDNA 2V8VA 3PXGa 4F4XA 2QEXS 1FPZA 1T9VA 2G4BA 1DQAA 3ET6B 4NPOA 3SV3A 2CZ9A 1F6TA 1VLOA 2O66A 2W9AA 4O44A 2HVHA 2BJ3A 2CNIA 4IR1A 4K4TA 2IJFA 4KYRA 2WSEC 4DWIA 3ZV2A 3K57A 4Q2LA 5LMNJ 1ELOA 5F8IA 4F4YA 3NCRA 3I4PA 1FX4A 3DDKA 4OX6A 2QDPA 3C6TA 5CD4A 2VFUA 3AXMA 1QJHA 4ECTA 3M2UA 3M2RB 4HL9A 1GQQA 2BKNA 1ZAXA 3SDEB 3IR5B 1JJHA 3A4TA 2MGZA 2E1AA 5G0RA 3ENVA 4W98A 4PQUB 3X3UA 2R3VA 2EKNA 5KFAA 3SSSA 4NMXA 1PGZA 1Y4ZB 1VQ8S 3MUTP 1FXLA 1W25A 2AYBA 2H5IB 1U4BA 1K47A 4KGZB 1RDRA 4K0KJ 3TUPA 1FVQA 4M5DA 3FCHA 1X4FA 2CMBA 4EBDA 5HVGA 1YTNA 1P3DA 3GR0A 1GX5A 3EXCX 1IM4A 3F56A 3DOLA 4CLFA 2MZRA 3HKWA 4EBCA 4ES2A 4X84A 4G1QB 2W24A 2DCUB 3FBFA 4YOEA 2G9OA 4LUBA 4ZCLA 2DHXA 1H7WA 4OYPA 4NXMF 4ZVSB 1D9FA 5KFBA 3TX0A 3GJQB 1KQSR 1XMBA 2UUAF 2EFPA 3DLBA 2CRLA 2V63A 2W2NP 3CW2C 4NLSA 3QCKA 4HT5A 2DR7A 2AYMA 2DNLA 2FJVA 2FVQA 4B3RJ 2ASYA 1SL1A 3GFHA 4QIFA 2RDIA 2QMWA 5K25A 1SI9A 5KFHA 3PDNA 4I2QA 4ZP7A 3D0HE 1CC8A 3I55S 1HNXJ 4LMZA 3RGOA 4ID8A 2PFFB 4QPTA 3DHXA 4ZIYA 3CVKA 2F6WA 3D66A 4NI2B 2FHKA 2FJBB 4FXWA 2DVIA 4HVZA 1NBEB 3ADAC 3ENWA 4ZMMA 3NBPA 1ZETA 3OT9A 2Q1LA 2OGUA 1T9WA 1WHWA 3KKFA 3Q24A 2ROPA 1X9WA 2YWFA 4C11A 5CXTA 4JI6F 3U7JA 5CABA 4OFZA 1V6HA 2X1GA 2J16A 4O4RA 2YNHA 1H72C 2J7UA 2XHCA 2OH2A 1KTVA 1FXRA 2HRUA 5B08A 3C8YA 3M32B 3PW7A 1FRMA 1RWXB 2I6OA 3BKFA 3GFXA 1U45A 4J9MA 4GVBB 1V3RA 4DV6J 2JFKA 5KFUA 1M3GA 3M6UA 4JI0J 4I64A 2WVCA 4DUTA 4AL7A 1N5VA 1FWPA 3LWLA 3CJKA 2OP5A 2MXYA 2HNDA 2DD8S 2YKMB 3KG1A 2PO4A 1F5CA 3W2WA 4OX8A 3HSDA 2B8QA 2UXCJ 4Y00A 2F4VJ 4U8YA 4Q45A 1Q6PA 1JLGA 3FNNA 4CLWA 4HDHA 2POKA 3RRKA 3DGPA 2MZ1A 1M1HA 2O67A 3RGIA 3CE8A 4XO0A 3C66A 4M5LA 4DGPA 1UW9A 3NNAA 4DFPA 3NKYA 1DTTA 1ZM9A 3B6BA 3A3PB 3QCLA 1D9DA 1X4AA 3OJSA 1UVLA 3RTVA 4X62J 3ZZUA 3BSNA 3IXQA 1RWNB 3ZZTA 2GHVC 1KVIA 2CNGA 2HPUA 3S6EA 3VAGA 2EFVA 2GX8A 2CFXA 4ECVA 5J2PA 3R7NB 3CJ3A 3GIJA 5D4OA 4NYOA 1TKTB 3KWMA 5D4PA 3F41A 1JBWA 3H5XA 2E1RA 3CD0A 1YVFA 4S0GA 1YGRA 1UETA 4H4KC 3CWJA 1YN9A 4GKJJ 1KWMA 3VAKA 3D42A 2AF6A 4F2SA 4QWBA 1AW0A 3IR7B 4Q7AA 1PA9A 2YKPA 2NTAA 1S0OA 2YNIB 3PZPA 1N32F 2GP0A 1FNXH 1XMOF 1OPZA 2DKOB 2HVZA 1N34J 3O4TA 2DT9A 1JLAB 1ZCLA 2CQ0A 4MYUA 4FPRA 1C84A 4ZP8A 1Q8BA 2UV8A 1OSDA 1NNYA 4FVMA 2GVZB 3M4UA 1EX8A 4KAIA 2HS4A 2EK6A 1IBMF 1VCTA 1RGVA 3DDIA 1ITPA 4HACB 3RAQA 2ZH5A 1RAEB 3LP0A 5DDPC 2XMAA 4NRUA 3HVRA 3NGRA 3Q89A 1RQ0A 4R0EA 1ZH5A 1RYSA 4ZPCA 3MPDA 3UR0A 4IDKB 3CB4A 2W2OP 2I6MA 4TU8A 3CEDA 4ZN3A 3MCOA 1RWVB 3MM7A 1N36J 5CH7B 3MM9A 5KFVA 1SJFA 5MAOA 3NMRA 5A76A 1WOSA 3P96A 2MJNA 2VEVA 4HRFA 3U27A 1D9AA 1LKZA 4NXNF 1BQXA 3KK3B 2RF6A 3T41A 3QCIA 3TEGA 2MSSA 1N0VC 1X4HA 4CWBA 2OPPA 2BJ9A 5AJ3J 3DI6A 3OR2B 4X4NA 3SQGB 3IS9A 3KLFB 4P71A 3UCGA 2P9CA 4KYQA 3VAJA 2KJVA 1L8GA 3GMGA 1VQ6S 4OLPA 4DFKA 1IR1A 2GJ2A 3D67A 4LSLB 2ZHBA 1G2EA 1XNQF 2CQ1A 1HHTP 3H5SA 4MK7A 3QFHA 1XQIA 1UA0A 3C15B 2HB1A 1RACB 1P27B 1LW0B 7FDRA 4TY8B 3T9ZA 3LTOA 2F6VA 3R3TA 1UEKA 3J7Z5 4MMOA 2JSXA 2C7SA 3G8SA 1YKWA 2DRDA 2SXLA 2GCBA 3OJUA 3V4IA 3ILOA 1XJWB 1YPTA 2ALYB 1RTDB 3LO3A 4L76A 2W9CB 4TLRA 5K8NA 3ILJA 1DQ8A 3TAMB 1Y11A 1VJQA 2G0JA 1EEOA 3AJDA 4LR7A 5J2QA 1QVGR 1IKYA 3BKTA 4RU2A 2XULA 4WJBA 3KDOA 5HQMA 1OYDA 5F3ZA 2B4PA 2QLBB 1HA1A 4OQJA 2WJPA 3PKMA 2AGPA 2L48A 5DDOC 1Q7YT 2I9SA 4CO0A 1WEXA 4DS4A 4DQPA 2PA5A 1GAOA 2JC1A 4A47A 1WJ9A 3MCNA 2H51B 3VAFA 2V8HA 4R8UB 1S9EB 3I4HX 4F25A 4EZ9A 3JTPA 4H4MA 3BDEA 1FPRA 4DX5A 3GILA 1QUPA 4LF8J 4WF9Q 1RU1A 4FDFA 4HEA9 2BOAA 1OESA 1IWGA 1PILA 3TAPA 2Z8QA 5AE3A 5IQQA 2ZOMA 4J5OA 4OX7A 2VORA 2QYGA 1HBNB 2C22A 4XPEA 4KR0B 1ZC0A 3BSCA 2UVRA 2NSCA 2L3MA 2B4VA 2J7KA 2LYVA 3FKBA 2QSWA 3HSJA 4Q8EA 1PJ5A 3ZTQA 1T03B 4C8ZA 3IWLA 1OJ4A 5GMEA 2Q05A 4MYTA 1U0HB 1S1TB 1HWUA 3AODA 3E8OA 2J6TA 4DSFA 1T95A 4RPFA 3BPSP 4K4YA 1TUVA 2XPCA 1HBUA 2QJ3A 3CIMA 3PRDA 5F3TA 2GAGC 4DQSA 3QRQA 2I42A 1HQEA 1S76D 2CPZA 3HFKA 1KHWA 5I3QA 3K59A 1L5UA 3QNWB 3DM2A 1SH2A 3QIDA 1MROA 1ZTTA 2IRXA 1FRKA 3UD5A 2VODA 4CIOA 1VDHA 3T5JA 3NLCA 4DV3F 2QRRA 1R8BA 3FBCA 4A8KA 3CJSA 4PG8A 4A8XA 5HBMB 3NRSA 2DGUA 3FMBA 2RF2A 1OHEA 1FRHA 3GZ7A 4DZ6A 1GK8A 1WI8A 4B3OB 4ZJQA 4ZLLA 1D5RA 2ZH7A 4ED0A 1NXIA 2A18A 2VC0A 1FHTA 2OUDA 4D3QA 2HQFA 2CM2A 5CYQB 2ALZA 2DB1A 2MKIA 3PNIA 4Y65A 4M63A 1ZPVA 4NLWA 4LF9F 3SBMA 4WOHA 3TJ9A 3G8QA 5IBSA 4JI1J 1E6VA 2DNMA 2G2YA 5F41A 2H04A 3PR4A 4PXCA 4I1TA 1LOUA 4XDDA 2G1HA 2B5JA 5ETMA 3OVAA 4LIWA 2F46A 2AQ4A 4QAPA 5J2MA 3ZL8A 5C42A 1KRPA 1R89A 4LSNA 1MU2B 3AOCA 3ZTRA 3HLUA 3UD3P 4MH8A 4ZKAA 4PWDB 1F5AA 2PQ5A 1RT3A 1Z1ZA 1RHUB 2OJ3A 4J51A 4F0HA 2F6YA 1UVMA 3BRHA 4RWWA 5JMNA 2LCWA 1Q1KA 4ZVOB 2DITA 2GFFA 3BBFA 4QYRA 4MK9A 1KFDA 5HQLA 4OYZA 5A5FA 3BV8A 6FDRA 5AXMA 4DR4J 5D3GB 3M1VB 4RW9A 3K17A 5IV4A 4WCEQ 2XI3A 4YR8B 5A2QY 4C8YA 3W9IA 1UVJA 2DGQA 2DNOA 2GO8A 3MCMA 2ASDA 5CZVA 4F8RA 1EZZB 3HVTA 3OUYB 1GMWD 3W3SA 1UAGA 2BANB 3GE9A 4WP3A 1MKPA 1FKPB 3PVXA 1JLFA 5F9LA 1GQYA 3G6VA 3AD9C 1B4SA 4USWA 1WG4A 3B82A 1JXEA 3QGHA 3TX8A 5KG3A 2FVSA 5HVFA 1QDUB 1FO1A 3R7SB 2VG6A 1CBKA 1IBKJ 5M2UA 1RT5B 3QCZA 2JZ5A 1TFYA 1T0TV 4WFBQ 4AXIA 3UDLA 2YX7A 4P7VA 1NHVA 4PYDA 8RUCA 3QT7A 1Q4RA 2DISA 2E1PA 1BQNA 1BGXT 1L3TA 3O1LA 2FHOB 1OETA 3CPWR 4U9RA 2IPOB 1R31A 3K7RA 3HJVA 3DKDA 4TU7A 3TW0A 2UP1A 1YTSA 3M8QA 3KK1B 3NXZA 1PA1A 1ZCKA 1RTIB 2ZWPA 4R5PA 4EI2A 2KHDA 3G8TA 4K4UA 2KXFA 5D0GA 2OEKA 2HURA 1AAXA 2NXEA 3P3DA 3R5JB 4ED2A 3AWGA 2YQ1A 1YFOA 3PIOQ 4J9OA 3HT3A 3AA8A 5A8WB 1I9SA 4P9SA 2JEJA 2YNFA 1HI8A 2DXEA 3ZTSA 1NAQA 4ZN1A 5LXQB 3ZMQA 2GHWA 3PW2A 2B8PA 3AB4B 3TZXA 4ZHRB 2XCPA 3IM8A 2QL7B 4V1Ak 3EAXA 1V3ZA 2C1EB 4KIAA 2WCXA 4ERDA 4ERCA 1TVRB 4A4JA 3UE2A 1RWMB 3H2UB 1S1XB 2JEGA 3PYDA 4Q43A 1HI1A 4ES1A 2JVRA 2SHPA 1SJQA 1SV5A 2BJDA 3FRYA 3GWCA 4MFBB 2ACYA 2E7WA 5G4DA 3H20A 3U1MA 1IJEB 4EO8A 2I75A 1RT2A 4M5MA 1T4JA 3WIUA 3HFZB 3BO4A 4YEAA 9RUBA 1RA7A 4R0JA 2NCKL 4QQBA 4USMA 3D0GE 3MEDB 4PG4A 7FD1A 2V4JA 4ES3A 5ADZA 3ITHA 3GCWP 3HSGA 4TLQA 1NPRA 4AYBD 1Y7PA 3WC2A 3S3HA 4MKVA 5D0EA 3TA0A 3D28A 1RYRA 1IKXA 5HP1B 3FC9A 1VBYA 4O3PA 1X4EA 4LF2A 3MOZA 1YJTA 2E5IA 2CNOB 3B78A 4NL5A 2F70A 4ZVPB 4PG7A 1VBXA 6FD1A 4LFAF 3N0AA 2N7CA 2PMHA 3K8VA 5D8HB 1EP4B 3TEHB 2ADCA 1QE1A 2RU3A 4J9SA 3WC0A 2AV5A 3AT1B 4JV0A 3T3FA 5C5JA 3J7AN 5LMUJ 1T11A 4JI2J 1BXNA 2PMWA 4CNZA 2MMYA 2V4QA 2QA4G 3FK4A 3T9NA 3JTNA 3R1LA 3T1YF 2ZH8A 2OPQB 2GJTA 4F3OA 1HR0F 4RW4B 4HI2A 1J5OA 5KT4A 2BW2A 2AU0A 2KDOA 2RQMA 1GMWA 2FVCA 5GTJA 2XY6A 1MMDA 3H2XA 5A8KB 2RKIB 4QWAA 1SIZA 1RK8A 3MFIA 2AZ1A 3TJAA 4W92B 2HGLA 3BQ0A 1K9MT 1GFWB 4DCJB 4OI0A 3S1TA 4QU6A 3TI0A 1NSKL 1OWXA 2ZC4A 4OHZA 2AT1B 1TP7A 2ZD1A 3KLEA 2QLJB 5KFDA 3QT8A 1C85A 5F8LA 2F8MA 4C12A 3MPVA 2EK1A 1RWOB 1B64A 4ELVA 2XMWA 5E5NA 4ECZA 5HLFB 3NNHA 3Q8UA 4QUNA 3EZOA 2WBRA 1DLOB 5J1EB 2QYCA 3W60A 4I2PB 2XZDB 4I6AA 3V81B 2DRBA 1NHKL 3DOMB 4BC9A 2UUPA 3FSYA 4WBFA 1WRMA 1EENA 4DLGA 4CO1A 3H7HB 3D6MB 3DLGA 4P72A 4I68A 4CM2A 2I1RA 2VKZG 3HK2A 3SZ2A 2CNFA 4PXDA 2GAHC 1BZHA 4LF7J 4ECQA 1VGYA 3DRSA 2J7WA 3A3OB 3VZIA 4RDDA 2GC8A 1F60B 1GEHA 4L73A 2K7KA 4K4WA 1M5KC 2DNHA 4CYUA 3W5XA 1GXTA 4FS1A 3S3KA 2I5JA 2B4SA 4DSKA 2XO7A 1RTJA 2QMXA 4DSIA 4JI7J 2MTLA 1U1NA 1UAWA 4DV7J 3UPFA 1XNRF 1H74A 2CQCA 4TQRA 3J81U 3QAEA 5JUMA 3D3CJ 2Z58B 1VRTB 4RUCA 3HVAA 5EHHA 4A8OA 2F9JA 3BBCA 3P5BP 4JV1A 2DCLA 2VA3A 3I82A 4M5HA 2YXLA 2B43A 5FLXY 4DR7J 2H4KA 1REVA 2G0IA 4NA2A 4ICZA 1RPMA 2W2MP 2FC9A 1Q95G 4Q0BB 3CCWA 1CJKA 1T02A 3FQLA 3TUIC 1P1TA 1NSAA 2AD9A 3M30B 1RHKB 1LWCB 3GV7B 4HJQA 4F3QA 1P6TA 4OIXA 1T9YA 4DL7A 2LA6A 4MKAA 4RW7A 4E2FB 4GKKF 4DL3A 1X9MA 1WC0A 5D4NA 1TKZA 4DPWA 3PYZA 4KKOB 4HYKA 1J4XA 5L46A 3AJ2A 2RSQA 1HNZF 2HQ3A 1YRUA 3W65A 4ZLNA 3HHDA 5LJ5Y 2HHHF 3DLEB 2M0GB 4DL2A 1HFEL 4H54A 2MLZA 1RT1B 2HVIA 2MB0B 3D44A 2KN4A 3OPKA 2HK2A 1NZ7A 3KHRA 4YB7A 3N5BA 1SL2A 2V9KA 3CC7S 3C16A 2YTCA 3PM9A 3GTYX 3OL9A 4ZI4A 4JI5F 3IBCB 1QLNA 2NLWA 4UOCA 2EVZA 3FZ2A 2HHQA 4N77A 2DJWA 5KT3A 3MZIA 3T1HF 3MPUB 3L09A 1TKXA 4ICLB 3VVUA 3W5ZA 5DQIA 4WTYA 3TZZA 3UNYA 1IQZA 1ZS6A 1WKLA 5K24A 1R0AA 2CQ3A 1VC0A 2BYCA 3O5TB 4B3MJ 2CM3A 5E41A 2FIUA 5DGAA 2CXEA 4NWFA 5IS2A 1JXVA 1WD6A 3QFWA 2I3RA 3PO4A 1JNZB 3R97A 4UOFA 2PC6A 3MEGB 4JMJA 3D6HB 4HR2A 3DNCA 1WUUA 4ZJLA 4KV8B 2W25A 1U2RA 1Q5VA 2IMGA 1FNMA 4CRJA 2IYIA 2VPYB 3H59A 2LXFA 1RBLA 2CM8A 4WKYA 3ZZPA 3M9OB 2GIRA 4CO2A 4NCBA 2E7VA 3DOKA 2XMKA 2UUCJ 2ZC3A 2XWYA 2QA2A 5CYMA 1R8CA 2NS1B 3CD7A 4J9RA 1S0MA 1O0PA 1MNEA 1R27B 1ZM3A 3RB0A 5H1SV 3CCSS 3PHTA 1NJXA 1C83A 3P6YC 3JSBA 4JV5F 2WZ1A 1EQ0A 4HV4A 2V8GA 2CPYA 4AE5A 3SCIE 2P9EA 4C6AA 2RQ4A 4JI3F 2ZWOA 4C2MA 4S0MA 3FSXA 5IWAJ 1RE1B 1TL3A 4M5NA 1IWAA 2D3UA 1FFSB 5KFWA 2RU9A 2HHTA 3QIPA 1YJ9S 1RWUA 4MK8A 3TRGA 4CO5A 4MIBA 3N6LA 1S4FA 1V9OA 1XR5A 1YRXA 4KHRA 2ZH1A 4J9NA 4UW2A 2DTJA 2RS2A 1Q86T 2FGOA 3TA1A 1ZM4A 2DEIA 3ISND 3FQKA 1O51A 3I9ZA 1LWFB 5JVHQ 1NO6A 2ASLA 2Q3PA 2Q79A 5A2QU 1OO0B 2KZZA 1BE4A 2X1FA 5GAHU 3D68A 2K3KA 5E33A 1H73A 4CT8A 2IM3A 5DETA 1Q8LA 2JDJA 1N54B 3GXGA 3B54A 3S3FA 5FIIA 2MYFA 2RE1A 3RBEA 5KABA 1XBWA 5I3UB 4NX8A 4EZ6A 2QBQA 1S6PA 3S4EA 2V2KA 4UAGA 1OY6A 2JHEA 2VPZB 4OYBA 1UA1A 1FTCA 1YGYA 3OHAA 1C1BB 2L9NA 3M8YA 2P6TA 2A0FB 2K06A 2VA2A 2NPIA 2KU7A 3LP2A 4RW6A 4YB6A 1TL1B 2DR6A 2DH9A 2WOMB 3HP6A 4OHEA 1O6XA 2C2OB 2JC0A 2B6AA 4ZDNA 3EGZA 3JSYA 2CWKA 3QT6A 2B4OA 2ZZNA 2QEPA 3I56S 2C2RA 1AXQA 4M5KA 1VMBA 4O0NA 1WHXA 1U1RA 4GC7A 3QO9B 5JXSA 4O3RA 3NOGA 4ZVTB 1RAFB 2H5JB 4OJHA 2P6XA 3VHQA 3OMHA 3GYNA 5FDLB 5KFZA 1SIWB 4K4ZA 4L75A 4M1KA 3KTQA 3CJQA 4DL4A 2HG4A 3E01A 1X5TA 3CCUS 1WCHA 1VOMA 4NA3A 3HPOA 1TU0B 1TKTA 2Q43A 1CS4A 2ZBCA 5HI7A 3WDOA 2CNNB 1T3OA 3ICLA 1IXKA 1EETB 2CMCA 2I6IA 1CJUB 1FDBA 2DGVA 3D5MA 1U1KA 4B3TF 3ZZRA 1S99A 1AFIA 3NRBA 4ZPTR 3SR9A 2V67A 4X65J 4K4SA 4ZPAA 4ELTA 3GR1A 2HGNA 2A8BA 4DX7A 3NOCA 2W8LA 3RO1A 3OFEA 5GMKa 2M4MA 1N33F 1RT7A 1HBOA 1UPPA 4ZJOA 1NDPA 1C1CB 1GX6A 3PX4A 3I31A 5KA7A 1B0TA 4LFBF 4KC5A 4QWEA 2CG8A 2OLWA 4I6YA 4ED3A 3A1YG 2OFHX 2H65B 1GH8A 5I42B 4FF4A 4CQ1A 3C14A 2UUBF 2NZ6A 5HL7Q 4IFYA 4DR3F 2DY1A 3OLBA 1YZ6A 2EPIA 2RRNA 3MMAB 2GVDA 4ZCIA 4FYYB 2ZUGA 1NK5A 2HVLA 2FC8A 1F9EB 5GMDA 1HNVB 3TZWA 4PAAA 2HMIB 3W2VB 3OTOF 3JYTB 5IM0B 2XWXA 3DLKA 2Y0BB 2VBYA 2R7OA 2WAQD 2J9DE 4QR2A 3CWEA 4Y2AA 3O6QA 4TYAA 2LKZA 4DZDA 2ZHAA 3CO0P 2FY1A 2K1RB 4HTJA 3RU0A 4C0BA 2BVZA 5BZXA 3Q83A 1VC5A 1PYOB 2MKYA 4FVCA 3CULA 1Q6NA 2BQ3A 3ISZA 4NXMJ 2E9RX 2MBCA 2F6FA 2YKQA 2OD6A 4HHUA 2VONA 4RKKA 2UUAJ 1IBLJ 2CIMA 3KJFB 1B0VA 3H4DA 2CUYA 4CH1A 2IA6A 1VQ5S 4B04A 3A5JA 3R2CJ 1QAYA 2VICA 4RH5A 2VC1A 1CJVA 2Y1IA 4AD6A 4Z37A 2HQCA 2PIIA 4P75A 4PXEA 4BWMA 5DGBA 2I5XA 1EKSA 3DMJA 4NWBA 3W9HA 1IKWB 3RAXA 4NOHA 3MMCB 3G82A 4QCLA 1HD0A 2CJYB 3MDFA 2DGTA 3M05A 4GO5X 1TMJA 3NGSA 4RUHA 1U47A 1WAXA 1S97A 1Y00A 2DNKA 1WC3A 3VVTA 2Y9HA 4JI6J 1NZAA 1RP5A 2PI5A 3DYAA 1WSRA 3GPAA 1AZSA 4B08A 1S9GB 2JNJA 3GG0A 2ZEJA 1U6ZA 2BKPA 5GVQA 3U1NA 2XBPA 3ETOA 4IRCA 2UV8G 3FFIB 5CCLA 2HK3A 2AMCB 5BYRA 4HDGA 2BV5A 1NJYA 4RL1A 3L7OA 1G1GA 4Y34A 4F26A 5C7PA 4F67A 1KLMB 3I7ZA 2J8SA 1ONZA 1A5YA 2UVUA 1F2HA 1JLBA 3KJNB 2H3EB 4C8KA 3VAIA 2WONA 5KFJA 1RI7A 4OZ3A 3SIPB 5KA9A 4L3NA 2UVVA 3ZM2A 2YQ3A 2MDAA 2OAUA 2VEUA 1XTZA 4QWDA 1PJ7A 4KE5A 1NB7A 4RJVA 2VV5A 3LK7A 2B7BB 2BE2A 1HQUB 4WP9A 4DV2F 5KFLA 3CXCR 3CF5Q 2R9LA 4QW9A 2NV5A 2HHVA 1BZJA 1ULRA 2HYIB 1WWHA 4WFXA 5FLXU 5IT9U 1PIEA 2ZBIA 3G6ES 5EWEA 1XR7A 3M8PA 5KFPA 2GJFA 1QSLA 4RBTA 3QAUA 3TUJC 3RB4A 2A6MA 3B7OA 3V0FA 1X4BA 3TNVA 2HKEA 3DC2A 1DBDA 1RSCA 3ZM0A 1FNOA 1SCJB 1IM6A 1FI4A 5BR8F 2HNPA 4B3RF 2I0XA 1U8WA 3C6UA 1WHYA 2VEWA 5DDQC 1WF2A 4FZVA 1WOPA 2KXHA 1U1LA 3V0JA 4BLGA 3OD2A 3V2UC 2OUGA 3FBEA 1TV6A 2P8IA 1NWEA 3CCES 1UWBB 2V6AA 1WC6A 3MF5A 2HS3A 2RIJA 2KT3A 4WE1A 1Y0HA 1RTHA 3OTBA 1XMOJ 4FNHA 4A8FA 5E3QA 3CCTA 4ANDA 1S1WA 1X60A 4C8LA 1YDLA 3GV8B 3P49B 4ED6A 1JLQA 2QLWA 1BWVA 2HNQA 2HWTA 1RZMA 2FZKB 4AQYF 3V6DB 4JYAF 3MEEB 2XMVA 1EQMA 3PEHA 1HMVA 2HFSA 4L72B 1S1UB 3W62A 1B7YB 2AYEA 4K7QA 3R7BB 3OXGA 1N5YA 3I0RA 4DXLA 1JF7A 3H40A 2IA0A 4O4GB 1WOOA 1U25A 4JI0F 2IY5B 4KSEB 1T49A 3K0JA 4CZCA 4QZVB 2MKSA 4DQIA 1FGSA 3QLHB 3VQTA 3NWGA 4ETZA 1CULA 1JMTA 1S6QB 5BUGA 1WKJA 2APOA 1VRUB 2F9DA 1K8AT 3Q2TC 2E1MC 3JXOA 1KS2A 1Q1MA 2UXCF 5A0YB 2DPIA 1RTZA 4F7VA 1FXDA 4NXNJ 2Z0GA 1C0UB 4J9UE 3ZXWA 2AEFA 4OX9J 1E8CA 4CNYA 2NR0A 2XLIA 1HBMA 2HNYB 2KL8A 4J9KA 2ZVSA 1J27A 4E0DA 3R1HA 4O3QA 2Y1RI 4P74A 2M70A 2OMOA 3H8YA 3L7UA 2JVOA 1H0HB 5HQ8A 2VFTA 2N3OA 1LW2B 3WX8A 1OEUA 4X62F 3DCAA 3GLJA 3ETMA 2WHOA 1OHDA 2JFGA 3MMBA 2H5EA 2GMJA 2IAJA 2HBRB 3N79A 1JLEA 3KUHA 4IH5A 3FJ2A 2ZJQQ 4IUFA 2HIQA 1IN0A 2ZDPA 4BC7A 2BR0A 5F9NA 2QGFB 4IFVA 5HN0A 2PMZD 2QO3A 1H7XA 1M5VC 3DGVA 4KO0B 1GQEA 5KFMA 1FWKA 2BIJA 3NEKA 1J5EF 1D0EA 1VK3A 3K89A 2JJ4D 2J0QD 1NZ8A 4IOCQ 2HLTA 1QAXA 3N0VA 1RXDA 3VCDA 4NZ6A 2ACMA 2KVQE 4K50A 1Y5IB 2D3ZA 3MOWA 3KFWX 1T9UA 3CSKA 4LBIA 4O44B 1CQNA 1LQFA 4ECUA 2FLNA 2LQBA 3NNCA 4ZPWR 2W8KA 2IYGA 1FFWB 1Q6JA 4DR6J 1WC4A 1U1QA 3HHEA 3BLTA 3O44A 2GJIA 1L3VA 4ELUA 4RH9A 3C6TB 4WFAQ 1NKCA 3P5TL 3QYYA 2VQFF 1DFDA 3AQPA 4MAKA 3M2UB 4M94A 2CJQA 4JV2A 2LU2A 1H2UX 3PRVA 2MGZB 5G0RB 1SKRA 1I51B 2QT7A 5C25A 1OQ3A 4GMKA 4ZIVA 3Q8PB 2G0CA 4DEZA 4NLRA 5J1NA 2YKNA 4RNMA 4I67A 2ZH2A 1WG1A 4DF8A 3CCQS 5CA5A 3UCZP 2WW8A 4KFBA 2CADA 4M5DB 1M0SA 4A8QA 2PI4A 3DOLB 5KACA 4QOTA 3I36A 1X5OA 2QLFB 2IRYA 3EUNA 1S12A 3EVMA 2X7IA 3A8JA 1H3DA 1VRQC 5LSLA 4DQRA 2CNKB 3MHYA 1PAEX 3KUEA 3T5LA 1AYEA 3TYTA 2VBWA 2DK2A 4X64J 4TVAB 2AZRA 3HKZD 1NK6A 1GTHA 1YX2A 1D09B 2ZKTA 3NAIA 2OMLA 4CH7A 5KT2A 3UW1A 1HNIA 5L9NA 5F8JA 2VTDA 1S9FA 3U96A 5IT4A 2P6SA 1C86A 4HLBA 4I2QB 4ER8A 3HM9A 3H4BA 3HHLD 1XN9A 2UZAA 1N8RT 2FJMA 2BM0A 1IUJA 3DXSX 4CVLA 4DV3J 4N8NA 2E9TA 5L1IA 1B99A 5K9FA 3TR5A 1F3FA 1Y9OA 2DNPA 6AT1B 1FDAA 3OXFA 3V0HA 4LSZB 2YNGA 2VJUA 5K8OA 1R3NA 1G4CA 1GT8A 3OV7A 4UUWA 4IRKA 4LQ3A 3NBPB 4D3RA 2ESBA 4RWXA 1OEMX 2H48B 3N28A 3ZNJ1 1RT6A 4C11B 3BN7A 1ACMB 3IBFB 3POTA 3IO1A 3JSRA 2DXPA 2CNEA 2H4WB 3UN2A 3M7VA 1NMEB 2HZCA 2J16B 2YNHB 1RAOA 3KLIA 3PJWA 3E2EA 4LF9J 1KHVA 4NNDA 5T7LA 1TMMA 1WHVA 5ITHA 3QCCA 2HBQB 5LSOA 2F8HA 2CJXB 3CD6S 4RLEA 1SQGA 3HHKA 3TAQA 4DUZJ 4NYHA 5K5MA 4MIWA 3MUVP 4C0HA 1WTFA 5KTQA 2V8DA 2QZ8A 5IC4B 3CJKB 1SPBP 2HNDB 4CI0B 4OZ2A 4NYPA 3BGOP 3W2WB 2DY9A 3GXHA 4DV4F 3HHNB 5A8KA 2F5GA 4EEYA 2R7XA 3IGNA 3LPYA 3NGUA 3BGFA 4BPCA 3EZUA 1JLGB 1E6YA 1J2VA 1R8PA 1QTNB 1R43A 2PFDA 5HVHA 2OC3A 3DGPB 4I4BA 4XK8C 2VG7A 1IVZA 2GNKA 1GXLA 3CMQA 1B70B 3PY8A 2HS0A 4ED7A 1NCLA 3V0DA 2KM8C 1DTTB 2E29A 4FF2A 2HSEB 4X4VA 1KDNA 5FJ4A 1OY9A 2ZBPA 3TQ1A 1N5QA 4RBVA 2XZTB 1TL5A 3T19A 4PEOA 4RO0A 1UKUA 1Q0NA 4C3KA 1ZOTA 2KH9A 2VEYA 2W2QP 4M8LA 5J2PB 1NJZA 2CVIA 3KLHA 3W61A 2CJZA 2HHWA 3MAAA 3Q8QB 1Q5YA 2XGQA 2MKCA 3LOUA 2RDDA 2QTWA 2DGWA 2H4VA 1JNRB 3CO9A 3RZ2A 4OLOA 3QZ7A 3EX7B 2LVWA 3OSPA 3QMQA 1LARA 2NYIA 3OL6A 1QTMA 5KA3A 1BUXA 4XPCA 4CTAA 2Y2FA 4QYZK 5IFMA 2WRMA 8ATCB 4KJIA 2C2EA 5AT1B 3ENQA 1S7HA 2OSQA 2QBSA 4ZLPA 1P31A 2AZ3A 5BYQA 1TZ0A 4M5IA 4QBUA 1HLWA 3SMZA 2GQQA 3JAMU 1HW9A 2G59A 2FUG9 1WF1A 3DDNA 1RAJA 3Q0AA 3HI9A 2DNQA 3LP0B 4JI1F 1XR6A 2GW8A 3KMQA 2KT2A 2NXNA 3P8BB 4J9LA 1JWWA 3S01A 1KD1T 2R7SA 2HFUA 1YLXA 3MM7B 1U26A 3CC4S 2CPFA 3HHLA 3CJ0A 2RJZA 2NQPA 5C2GA 3MM9B 4YFUA 2B9EA 3MR5A 5KG5A 1WKKA 2OEJA 3MPWA 2WB4A 4BWJA 2C2KB 2MLYA 2DNRA 2VF3A 1WC5A 1M90T 2OPPB 2Z30B 3R6GB 3DI6B 1VQ4S 3MM6A 3DN9A 4ED8A 1PC4A 3KJVA 3IS9B 4P10A 4WYWA 3CT9A 3PW4A 3K5NA 4I7FA 2AHSA 3AB2B 4DR2F 2HFVA 3PHEA 1TL7A 2E5GA 1SUQA 1VHIA 5CCMA 2QA1A 1NH7A 2M7SA 2IJNA 2UAGA 4EU0A 1Z2ZA 4M95A 1TUGB 1CVJA 2MKJA 1NEEA 2PN6A 3BR8A 1RCXB 4WZQA 3PEJA 3E51A 4K5RA 4FF3A 1I94F 5KFOA 1RISA 2YKOA 2JFFA 2XYPB 4IOBA 2V9WA 3TQEA 3MPYA 4N8OA 2R7VA 3BN4A 4ECYA 5KA0A 2X51A 3V4IB 2W7PA 1H98A 4X2BA 1R0BG 2VDHA 1RT4A 2W7OA 5KAAA 1E0DA 4MKYA 1L8KA 1D3WA 3LGNA 2EBEA 1XBOA 3I96A 4A8SA 1RWKB 5J2QB 4Y2EA 4RW8A 4LF6F 2BGEA 1UVIA 3M8ZA 3IC1A 1IKYB 3MD3A 2HW3A 1LK7A 1TR0A 2LDYA 1HL6A 5IXUA 2YX1A 5EN1A 1D8YA 3DRPA 4WPAA 5T41A 3KK2A 2RQKA 3D4JA 2OO4A 3LAKA 3SEOA 3SYZA 1VBZA 3T1YJ 4QUMA 1S1VA 1TAUA 4CO4A 1HR0J 1D8ZA 2R7WA 2AJ1A 4Q2MA 1HYSA 2R8GA 3CD5A 1RWWB 1YJ7A 2V2ZA 1U1PA 2BMBA 2JL9A 2RQCA 2RVJA 2DO4A 4YY3J 2VOOA 4H4MB 5B09A 4KGMA 3D3BJ 1SJ3P 2EFQA 2NZCA 2Y1OA 5EX0A 1NHUA 1VHRA 4NMLA 4OHXA 3VF0B 4C48A 2E44A 2DGXA 1K0TA 4ATNA 2FY8A 2OEMA 4P7TA 5M2PA 4F2RA 3QJLA 2QFJA 2VTEA 1YBTA 3G6XA 1GWZA 3KXDA 2R2RA 4ENOA 1SB6A 1NU4A 1FK9A 2JLFA 3UN3A 4NLGA 1V5IB 3QT5A 1NB2A 3BPDA 4PUOA 3PYFA 1NK4A 3BM7A 1HBUB 4C8OA 2AW0A 4PQAA 3NS7B 2HBYB 5H9FK 2DR8A 1HQEB 1FF2A 3QCGA 1RAAB 5DM6Q 5I4MA 3DM2B 1MROB 2Y3YA 2VBZA 3AH6A 4ZP6A 5GADI 1Q78A 4X4SA 4DPUA 4F4KA 2AX1A 4F50A 4DI6A 4GO7X 3QGGA 1KLNA 3L3CA 2JFHA 2LLZA 3R5GA 4KRWA 2J9CA 5F0UA 4IG0A 1ZAVA 2RF2B 1APSA 1JJCB 2AJ0A 3BGUA 3IBWA 3B4MA 1W2IA 5SUHA 1X4CA 1YJWS 2KM8B 3MAHA 3QCBA 1DTQA 4GE5A 3GQCA 5GAEU 2E7XA 2K8GA 2MQLA 2JX2A 5A6PA 3GG1A 2VL1A 1S5ZA 5B0AA 1E6VB 5DQGA 3IRXA 4YR3A 5LMUF 3V4MA 2KYXA 1JLCA 2JWNA 4CLYA 2QDCA 2B5JB 2YWWA 2W4CA 3MI7X 5DS7A 4GWFA 1RKJA 1VISA 4RZRA 1KVJA 5J2MB 5C42B 2F63A 4QIVA 4LSNB 2PA3A 5F0WA 1M5OC 1FJ7A 3R9LA 2BABA 3CC2S 2F7VA 2W9BA 1QUVA 1RT3B 1HNZJ 1NKEA 3MM8A 1VHFA 4U7UD 1VQOS 1RJJA 3WZ0A 1H2TZ 1RWPB 2CQPA 4YN3B 4HHHA 1SJ1A 5K14A 4DU8A 2GS8A 4RW9B 2Y96A 5HAOA 4C7QA 4LF5F 3R6LB 2H02A 4JI5J 2UUOA 1X31C 2FLOA 2Y1JA 2V8PA 4PYHA 2ZOGA 4TVVA 3N6NA 1FCAA 4UQTA 2ZE2A 4O0IA 2LU1A 3HVTB 3T1HJ 4DSJA 2CVEA 1N4LA 4LVOP 2GGPA 2M8HA 3NAHA 3I5AA 2HIYA 1HWLA 2AJFE 4ZK7M 2LEBA 4DUYF 3SFGA 4BHQA 4QF5A 2NT2A 4YB1P 2VG6B 2VFSA 2DXFA 2YH1A 2FVRA 1R6VA 3J7YI 5U47A 3J81Y 3H90A 3HSZA 5IM0A 1T05A 1ZPWX 2BEFA 3GJTB 3THVA 2IJRA 4RR5A 2IM1A 4JI7F 1BQNB 4Y0FA 2PDAA 1Q8IA 2MJUA 3KLGA 3KLVA 4KH1B 2AM2A 2WBMA 4O23A 2CM7A 1ZBTA 4URQU 3PCOB 1BMQB 4V19X 3CJ5A 1QAJA 5ETTA 3M8QB 1Y5LB 4WKRA 1X9SA 4DMZA 5D0RA 3BGLA 4OJ3A 2OTLS 4O3SA 4P2SA 3F9BA 3K58A 5HMWA 1Q6SA 4WFYA 3QRPA 4UQGA 4KYZA 5KG0A 5CHCB 2G2OA 1KAKA 4OJGA 2E5HA 5EHPA 5A6WA 1YSJA 3ILIA 4AZ1A 4P2MA 4DPXA 4A48A 4RI4A 2XMTA 2YNFB 5C24A 1VQKS 5HK4A 2MSTA 1ICEB 2OPRA 3RUBL 2GMHA 2B56A 4NCGA 4DF4A 4HJPA 3BGRA 2CNLB 3W5YA 1I1GA 4D3HA 3RBXA 1CQMA 3PW0A 1K0VA 1SQFA 3BREA 4USTA 2F00A 3M6WA 4HKQA 3V0GA 4LRDA 1SV5B 2BBEA 1A6LA 3CMES 2R7QA 3RRHA 2AEMA 5E3PA 3PV8A 3HXMA 5JJBA 3RRGA 2V50A 4CCHA 4LRAA 3SV4A 1URRA 5H9EK 2YKAA 2YH0A 4JNBA 1HARA 2O5DA 3CTRA 1RT2B 3MTJA 2BUNA 2EFGA 3EPIA 4NCAA 2FJAB 1T9TA 3QCMA 1PJ6A 3VAHA 4X4RA 4KHMA 4OYMA 3FBBA 2V4JB 1UP1A 1NSQA 5DG9A 1Q81T 4CLSA 5MMZB 4IG3A 4ZP9A 3ITHB 3UDVA 3D1OA 2PE8A 1OY8A 1PTUA 3IAM9 4NE9C 2PI7A 4YR0A 1IKXB 1WEYA 4NWGA 2UUWA 3QWPA 3NGTA 5K9WA 4LVNP 4Y6IA 2XLJA 1LK5A 1VQ7S 4OHDA 2JLEA 2X3GA 2I6PA 2PT0A 5J8RA 2GV1A 1MN9A 3E3XA 1SQEA 3OXLA 1QE1B 2J8AA 4ILMA 4UOGA 2EFOA 3H5YA 3BDPA 4ECXA 3BB5A 4K5SA 3SSRA 2Z2LA 3MM5A 2OZ5A 1KR4A 4CH0S 4AFFA 4C0OC 4YHHJ 2BOPA 4ED4A 2UUCF 2Z57B 3ZM1A 1SKUB 1OSCA 1PG5B 4LR9A 2HHXA 3EB1A 1J5OB 3VV2B 2RH3A 3PO5A 2C42A 2P4DA 3VALA 1ZZNA 3CCRS 1MMLA 2LQ8A 4K8RA 4XAKA 4B9UA 1HPZA 3LP1A 2QMUB 4F0KA 1NK7A 1TKDA 1P15A 5A5EA 4ZVUB 1NUEA 3H2VE 2P9GA 5IWAF 1SKWA 3VTIA 4FNIA 4FN5A 1S79A 1C0TA 5CD4H 4GE2A 1Q7LB 2ZD1B 3KLEB 4QAHA 4WIIA 1YZ7A 4O3OA 4BCAA 3NCPA 4FXDA 4KHPF 3IGVA 4OI1A 2I6JA 2XS7A 2WSCC 2VJVA 2ZNYA 4DR5J 2IDLA 4Z7YA 3GJRB 3BSOA 1S57A 4G3IA 1M5SA 1HIYA 4X66F 3BM8A 4LFBJ 2A10A 2H4YB 1Y10A 4C13A 2B49A 4F3MA 1NRKA 2V4RA 1PSDA 2Y68A 4ZITA 4FP9A 4TYBA 2AEJA 4B3SF 2UUBJ 2CPXA 1MSWD 3LAMA 4C4WA 3DLGB 5L1LA 4ZVFA 3PFOA 3SCLE 3NGDA 3KG0A 2YVSA 3I9V9 4IO1A 2Y8YA 3DRSB 5DQHA 2RT3A 3UI3A 5KFNA 4N7TA 4ZPDA 3QSIA 3JQKA 3OTOJ 3MMJA 1JKHA 3OL8A 1Y5NB 4CYUB 2ZJPQ 3O5XA 1I5OB 4B9NA 2I5JB 1RTJB 5LXRA 4P52A 2CMAA 3PJ9A 4J9PA 1IR0A 3M9NB 2DIUA 2M3DA 4YS2A 5IT0A 3FCWA 1S0VA 2GIQA 3ZC4A 5HJYA 5IV3A 1FTRA 4EYIB 1UPMB 4NA1A 5ETKA 4KQZA 1REVB 1WDDA 3IP0A 3EDRB 1MN7A 1R8HA 4ID5A 1N5SA 5D4LA 2FZCB 3V0EA 2IBKA 1UZHA 1CJKB 3D0IE 2OKQA 2IMWP 2MQQA 4H4OA 2WVEA 1B3TA 2W7AA 2AGOA 1IKVA 1MWZA 3T1AA 2R7RA 4RNHA 2A2DA 3IM9A 1SL0A 1Q6TA 2MEWA 4RW7B 5K8MA 2V2QA 4OYWA 4J91A 1TKZB 4WXOA 3U1LA 1FJGF 4WFNQ 5A8RA 4LF4F 1UJ5A 2AIRB 4LRBA 1U24A 2NPFA 1NM2A 2YWEA 4ZRTA 4DLEA 2RRBA 3PTWA 2LQ5A 1K73T 3KNAA 2RHSB 3F9AA 1UW4A 2D1CA 5KG1A 1NL9A 2RD5C 4WXWA 4GFUA 1RHMB 3N9UC 1K1QA 5EWFA 3BO3A 2F6TA 3D7SB 1FE4A 4ZVQB 2DHHA 2ZNZA 3BZQA 3O2IA 1PTVA 4OHWA 4E8UA 1U48A 3R2DJ 4X65F 3W9JA 2HRTA 3ISNC 3IG1A 3HN7A 1U02A 2C2DA 3C16B 2NLKA 4URSA 1R6YA 4O3NA 4FS2A 1N6QA 2VG5A 3WHIA 4JI8J 1SBRA 3EGNA 1LFWA 5J2NA 3HF5A 2Y66A 5KFFA 4OJ1A 3ZTOA 3BYRA 1S6UA 3MCSA 1Q82T 2H4GA 1TKXB 1WG5A 2KFZA 2H1YA 2HGMA 1MW7A 2D7SA 1R0AB 1XK8A 4EYHB 2MKHA 1LXNA 2E0TA 1M5PC 1OYEA 1SC6A 2UXBF 4LBHA 1DZ5A 5DM7Q 4KB7A 4DV2J 4G1PA 3CNQP 2FQQB 2HZAA 4U6PA 3W63A 4J90A 2D69A 1WI6A 1FKOA 2RHQB 1R0CB 2HNZA 3CM3A 3OR1A 2HQGA 1RBAA 4TN2A 2CYYA 3S7RA 5HROA 4C98A 3QKQA 2YWGA 3DOKB 4OHYA 1EB0A 4CM0A 4IO9Q 4IOAQ 5CYMB 4A8MP 4IR9A 4G6VB 1U49A 3M2VA 2K3IA 3CDUA 3EJMA 3MECB 1IBLF 2JFDA 1F9FA 2NZ4A 5KA1A 4Y2KA 4TKTA 2L41A 4DG1A 4MIAA 5BR8J 5ETRA 1NWLA 5HJXA 5KT6A 2MQ8A 1G4US 4DV0F 4OV6A 1RADB 2LEAA 4OZLA 2HWIA 4U7UK 4X4TA 5I6VA 1O5JA 1EIYB 3TO8A 4EMDA 3IMQJ 3C46A 4Y14A 1TL3B 2B9YA 3PJXA 3QIPB 1VQSA 1P8GA 4AUKA 1AFJA 1X5SA 4OMFG 4UZCA 3DRRA 2VKRA 2XO6A 4B9TA 2GIFA 5CQGA 4DV1F 2XGPA 5B0BA 3IR6B 4OZ0A 3IA0A 1N48A 4LREA 3CJRA 1SUGA 3OVBA 4NLQA 4CVKA 4AQYJ 1HWJA 4JYAJ 2V69A 4Q8FA 2RS8A 4OHLA 1R6HA 1CJTA 4AT1B 1FDNA 5RUBA 2VBXA 1FJCA 3QCFA 1JX4A 3VR1A 3JSMA 1S6PB 5KA4A 3AHPA 3HZGA 3QATA 5AWXA 2KI2A 4ZCMA 3JTOA 5GAEI 2RB7A 2ZZTA 2MZJA 1WF0A 3OTEA 3MWBA 1EEHA 2IDEA 2IC3A 3DLLQ 2R2TA 2NUHA 1BQMA 2KTQA 1TK8A 2GQ2A 1X7VA 3OFFA 3UVJA 3QKPA 4IYQA 4ZPVR 1HI0P 2B51A 4YDDB 3LP2B 1GMVA 4RW6B 5MLCV 2DHAA 2FVPA 5KFRA 4KPCA 2KO1A 3ZFVA 2B6AB 2NXCA 2FTRA 4U8VA 5IT9Y 4UT4A 2CQ4A 4IH7A 2ZKUA 1AUDA 2GO9A 1OS5A 2MY7A 1LWEA 2VB6A 3QZ8A 2Q6CA 1PC5A 4EFAC 2XSJA 3NMAA 4N5SA 3I0SA 3AJ1A 2W01A 3W1YC 1URNA 4NRTA 3D1HA 2LMIA 2JEIA 3HJFA 3K5MA 4NX9A 2U1AA 2PGCA 2AHOB 5E3AA 4USHA 3BYPA 2E66A 1G7GA 3W66A 2VD3A 3E01B 4CLPA 1PYTA 3RGQA 3RAMA 3W64A 1UFWA 3QCDA 2D9OA 2AYGA 2HAIA 1CS4B 3FEYB 1LFPA 1XEZA 2D41A 1VR6A 2XY7A 1J5EJ 1HHSA 4QYZJ 2E1CA 2LXIA 2I2YA 1XIQA 1O5ZA 2ADBA 1HWIA 2XB2D 2BGDA 2VOSA 3ET6A 2CJAA 4W90B 3GYXB 2OHDA 1BZCA 2WW4A 1RHRB 4U67Q 1O8BA 1QM9A 3NS6A 3RJMB 3A5KA 2BZ2A 5HATA 2HHSA 2DNYA 2N3LA 2IRUA 3F44A 4C8NA 4RHGA 1TL4A 2X1AA 1LQ9A 3TVYA 2A3JA 3DRYA 1PXHA 4ZIWA 1P9YA 3J81j 4DFJA 1IJFB 2DNNA 3ILLA 1RT7B 1RAHB 1HBOB 3HD1A 4MKBA 3ELHA 1RCOB 1HHQA 4IKCA 4LRCA 1BC6A 3O4SA 3M2RA 3O8WA 4ZVRB 2R8IA 1N52B 3SDEA 2FJEB 4QBEA 2DH8A 2XJAA 2VQFJ 5BJRA 2YDUA 3C14B 4PQUA 2RILA 8AT1B 2LEPA 4QBWA 4IFYB 2QIFA 5LXYA 3VAMA 2GVDB 3H98A 5J1PA 2DR5A 4GRSA 1ZA2B 1KP6A 5DRKA 4NYZA 2M52A 4QWCA 1YG0A 3DLKB 4G1QA 3F81A 2E5JA 2GZOA 2QN6B 3HCXA 2HXPA 3J80U 4LF1A 1Q6MA 2FJDB 5DZ7A 1HW8A 4DL5A 2CQHA 2ZM6J 3RYLA 2YPYA 3FCVA 2IMOA 3NP5A 2B9XA 4OX9F 4BJOA 4HH0A 5I3PA 2CQ2A 1XMQF 2PBNA 1NJWA 1FRJA 2R7UA 2EI5A 5IZHA 3OFGA 4YDXA 2OOQA 2FH7A 2VQEF 3CDAA 1QXKA 2I3UA 2J9EA 3P4UB 2C3OA 2ZOFA 1CJVB 2XI2A 4ED5A 4KPYA 3NS5A 2H03A 1EKRA 2M9KA 5GAGI 2HHUA 4JOUA 1WSVA 4NI2A 3RW6A 1JXLA 4MBBA 3AOBA 3DMJB 2OPSB 2LXUA 1NDKA 2XCAA 4USKA 5KFCA 1LXJA 3G82B 4DV5F 1T9XA 2R8KA 2QA4S 2A2CA 2X3DA 4F36A 3Q8RB 3V6JA 3MOJB 3OVSA 4UY85 1XXPA 3Q8SB 4UUXA 4KGXB 5KFQA 3K2YA 3TJ8A 4RUBA 3QCNA 4OV1A 2ZBRA 3RBDA 1PKUA 2COLA 3DYAB 4LBPA 1AZSB 3M32A 2DHSA 1H2VZ 3KG4A 4DR1J 1B7FA 3N2AA 4CLUA 2C28A 2XZWA 4RU9A 4FYWB 5EX3A 4GVBA 1FA0A 1DJ0A 1R7IA 4JP8A 4DR6F 3N01A 2YKMA 4OL8A 1U2CA 3L95X 3DHWC 1SC4B 1H38A 3IWXA 1ONYA 2FZGB 1JLBB 1FX2A 3PYEA 2B0GA 2VU5A 5B0FA 1CC7A 5DJBA 4DV4J 2Z2YB 2WONB 3G96A 1G4WR 3QPIA 2KVIA 4FYVB 1ZA1B 3MR6A 4J37A 3EE3A 1PAUB 3SMEA 1L3UA 1ZZWA 1BY9A 4NLPA 3T6JA 5EWGA 5EDWA 2BE2B 1FEHA 1QAIA 3UNGC 3NG8A 3C19A 4ILRA 3BLUA 5H9FJ 1SJRA 1V3SA 1LV5A 2Y67A 4M5JA 5CYJA 4WU3A 4RNFA 5ETVA 4JBCA 3AQOA 5BXIA 3M8PB 3PFEA 5BX1A 2HC1A 4LFCF 5E0OA 2UU9F 2DO0A 4X64F 1PO6A 4FPIA 1SXLA 3CDWA 2XHWA 2F4FA 4RNNA 1GMUA 2DGOA 3RZAA 2V5HG 1FVSA 1REGX 2ZH6A 2Z2MA 2LECA 1PTYA 3TWZA 1WNEA 2CZVC 3CCLS 4QJVA 3C6UB 3I5BA 2B3OA 3I32A 1RB0A 3EZ5A 1D1UA 5SZTA 2HFZA 2HQIA 5D6GA 2YNIA 1VYAA 2KKHA 1PTTA 2ZH4A 3TVZA 2DXDA 3FUYA 1FRLA 1TV6B 2MHEA 4FYXB 2LFVA 1X4DA 1W78A 2EG1A 2H54B 5KFTA 5K23A 1JLAA 4EGLA 2NT7A 2QBPA 4WE1B 3C2PA 1RTHB 3GJSB 1R8AA 3A3NB 2JOQA 3L4BC 3TZYA 1SJ4P 2IBOA 5AXKA 4PPDA 2UXDF 1S1WB 2GVZA 5KG2A 3QWUA 1JLQB 1HD1A 4RNOA 3CCVS 3IFEA 3F0NA 1HNWF 4HACA 1YBUA 1A7GE 3ZZZA 2CJKA 2IM2A 4NLDA 1HMVB 5THWA 2EC0A 4ECSA 1FRIA 4IDKA 1N5YB 4JI4F 3I0RB 2RUGA 3A8IA 2MHNA 4DUZF 2CQDA 2HWHA 3AD8C 1TK5A 4WZMA 2W2PP 3SQOP 4X4QA 2HVDA 1CULB 3QJPA 4U7CA 4OZNA 1JBVA 2EBGA 4AL6A 3M9MB 1NKBA 1T7PA 3KK3A 3AA9A 2F40A 3EVOA 3HFVA 3ZO7A 3OR2A 3H2LA 3SQGA 3KLFA 1YI2S 1KQFB 2F6ZA 2G6ZA 1YGUA 4NLXA 4QR1A 2E5LF 1HBMB 2HFOA 3VGSA 3T5KA 3A8EA 5HMYA 2IM0A 3N4WA 1UVNA 4OYIA 4DR2J 4WTOB 1UTAA 1S10A 2ZVIA 1G1HA 4LSLA 2R4FA 4DOZA 4WK3A 3M8RA 4YR2A 3ZZ0A 1NDLA 3MMBB 3N5FA 4PYAA 2IAJB 4CLTA 1JLEB 3C15A 5KFYA 2L9DA 4DS5A 1LW0A 2DEJA 4C3LA 4TY8A 2RDJA 5LL6d 4IFVB 5KA8A 2ATCB 4ZS6A 1WACA 2ZHOA 1S4EA 4PPZA 1I94J 4R0SA 3EU0A 3L9ZA 4PR6A 4B17A 1RTDA 3M8WA 1F3VA 1NO8A 2OSRA 2W9CA 3HHLC 1NK8A 3TAMA 1AUSL 5KOWA 4N76A 1WELA 4U96A 3HZEA 2MQOA 4TQSA 1YQHA 3MR3A 3KUGA 3KHLA 4ITSA 3PX6A 3LQVA 2V34A 1JJ2R 2F71A 1X4GA 1SH0A 4LF6J 2P5VA 4ZLJA 5LMNF 4DJBA 2OFGX 2BX6A 2YWKA 1ZTWA 3EXYA 3JAMY 5AXLA 1RKIA 4NEZA 3TANA 2R42A 3ZM3A 1U6FA 2M2BA 2R2UA 1A9NB 2XNQA 1FQ1A 4R8UA 1S9EA 1DQ9A 2ERRA 4I8NA 4HHJA 2DIVA 3QGIA 3OFHA 3S3EA 2FJNA 2XM3A 4XTTA 5LOQA 9ATCB 5C25B 2EW9A 2YX4A 4K0KF 1HBNA 2YKNB 4CLZA 4KFBB 1KOHA 1T03A 1JIHA 5H9EJ 4H34A 1U0HA 1S1TA 2IFXA 3KHGA 2N82B 1NLKL 2J6SA 3LF0A 1UWAA 3FEZA 1RXOB 2CFVA 3Q22A 2VOPA 2DGSA 1QZ0A 2XTJP 4GRZA 3JS9A 4D3GA 1FT8A 2CPIA 7AT1B 3VGTA 3UD4P 4OYAA 5B7WA 1FJEB 3D54A 1HNIB 1MLAA 1N88A 2G1DA 2DRAA 4I6WA 1HNXF 1XERA 4YP3A 4BUCA 1NDCA 3GSDA 1N32J 1VIXA 2C2NA 5HBMA 2XEXA 4RBUA 4LIRA 3G9CA 4XDCA 2GCFA 1NK0A 2Y0SD 2YNGB 4B3OA 1S6OA 3CGIA 2Q6BA 5GADU 4ED1A 2V0NA 2HEKA 3CUNA 3Q2SC 4TY9A 5CYQA 4JUZA 3I80A 2CZ4A 1ZAWA 1RT6B 1KVKA 1IBMJ 2FHJD 5E3RA 1FEEA 3POTB 5CZXA 3W8PA 1CG2A 2YY3A 3LH2S 5KA2A 1JB0C 3CJ2A 2YQ0A 2W4DA 1U7LA 3KLIB 4FXVA 5T7LB 1S48A 1H6KX 5HMXA 1TFWA 4DV6F 4QR0A 4DGXA 1BWEA 4DBQA 2M3VA 2Z2ZA 3EGWB 4H4KA 2DH7A 4LRFA 1TAQA 1W2BR 3QCEA 2GA7A 4CT9A 4PG5A 1MU2A 1F2GA 3W7BA 1UEVA 2F4VF 2CKWA 4PWDA 3M6XA 1OIAA 2BE9B 5JVGQ 1WTBA 2AP6A 5E3CA 2DHGA 4PXBA 4QIGA 3HT0A 3OTCA 1S77D 4YY3F 4ANCA 5HDEA 1NSPA 4BDPA 1MMNA 1E6YB 1ECVA 2CQGA 4Q5VA 5KFSA 5KT5A 2LQJA 2DYAA 2QLXA 2BA9A 2VG7B 3Q8YA 3S4OA 5D3GA 1IQTA 3M1VA 2RNEA 1G1XA 3GIRA 2B7CB 3R5BA 3OW2R 1VQNS 5HSPA 2BM1A 4FYDA 2Y8WA 4ZVHA 3RB3A 1YWXA 1XNQJ 5KFKA 1RAIB 4LF5J 3PACA 4YAAA 3UCUP 4DHVA 2D3O1 1VJWA 3OLAA 1A0OB 3V0IA 3OUYA 3NL0A 2AJQA 2BANA 1BHNA 1Y3JA 1FKPA 3AAWB 4TNOA 3UR3C 4ECRA 3KLHB 2J76E 4OHVA 3MAAB 3AWEA 5KAKA 1AB8A 2R8JA 2M5YA 4OZ5A 2WTFA 2MKKA 1T3NA 3EVWA 1KC8T 4GKJF 3MEKA 3MGJA 5AE2A 5LSRA 4DUYJ 1Q16B 1RT5A 4A8YA 1U8SA 1VI7A 4A8WA 4PWUA 2BJ1A 2MZTA 4G1IA 1C4AA 3Q86A 5B0GA 2WVBA 3TUZC 2VFVA 5KFIA 2XMJA 1N34F 2UUTA
chains in the Genus database with same CATH topology
1PTUA 1FRMA 3IAM9 5HL7Q 2I6OA 2PI7A 4IFYA 1G3OA 4YR0A 4DR3F 3GFXA 4CTAB 2C3UA 1IKXB 1WEYA 1U45A 4J9MA 4NWGA 2UUWA 2ZITA 3QWPA 1V3RA 5K9WA 2I4HA 2JFKA 3OLBA 5KFUA 5K22A 2EPIA 2D74B 4ZVGA 2RRNA 3MMAB 4LVNP 4Y6IA 3M6UA 2XLJA 1M3GA 4DX8H 4I64A 1LK5A 4ZCIA 2ZUGA 1NK5A 2HVLA 3J7YU 3IWNC 2FC8A 1VQ7S 4OHDA 2JLEA 5B0CA 2X3GA 2I6PA 4AL7A 2PT0A 1N5VA 5J8RA 2GV1A 3KK1A 1KOOA 1HNVB 3LWLA 2HMIB 3CJKA 2OP5A 5LT5A 2MXYA 2HY3A 3W2VB 3OTOF 3MXHP 2HNDA 1RTIA 3JYTB 2DD8S 2YKMB 3E3XA 4AL5A 5IM0B 2XWXA 3KG1A 2PO4A 1F5CA 1SQEA 3DLKA 3OXLA 3W2WA 4OX8A 1QE1B 2IVYA 2VBYA 2J8AA 2R7OA 4Y00A 5IQ6A 2WAQD 2J9DE 2C3MA 4ILMA 1PYNA 4QR2A 2I4EA 3CWEA 4Y2AA 3O6QA 3QCHA 2EFOA 4OZJA 4TYAA 4Q45A 2MQPA 2LKZA 2ZHAA 3H5YA 3BDPA 1Q6PA 1XC9A 1X5PA 4ECXA 2FY1A 1JLGA 3FNNA 3RR7A 2K1RB 3BB5A 2CPHA 3KNGA 4HTJA 4WYLA 5DG8A 4K5SA 3RU0A 4B9VA 4C0BA 1X24A 4HDHA 2QSFA 2BVZA 2POKA 3SSRA 5BZXA 3RRKA 1VC5A 3DGPA 2Z2LA 2MZ1A 1NNDA 3MM5A 2EKYA 4FVCA 1KR4A 5A8WA 5L39A 4CH0S 3CULA 2OZ5A 4AFFA 4C0OC 1Q6NA 2O67A 2BQ3A 3ISZA 1N36F 2E9RX 2MBCA 2F6FA 2YKQA 2BOPA 2OD6A 3CE8A 1JK9B 3BS9A 3C66A 4XO0A 2UUCF 2VONA 4RKKA 3ZM1A 4DGPA 4PCQA 1OSCA 2HHXA 1T8EA 3NNAA 4DFPA 3NKYA 3EB1A 1DTTA 1ZM9A 4WU2A 1J5OB 4ZHRA 3HHLB 2CIMA 3QCLA 1B0VA 2RH3A 1D9DA 3CDBA 1X4AA 3PO5A 3H4DA 3OJSA 2C42A 2P4DA 2B9WA 3HDSA 1UVLA 3VALA 1ZZNA 3J7ZT 3RTVA 3CCRS 1MMLA 4CH1A 1TVRA 2IA6A 2D9PA 2EG2A 1VQ5S 3ZZUA 3TOQA 3BSNA 4B04A 3A5JA 4XAKA 3IXQA 4B9UA 1QAYA 1HPZA 3LP1A 1MWYA 3FDSA 2VEXA 4DFMA 1S1XA 5BZZA 3ZZTA 2GHVC 3KMSA 1NK7A 3K5OA 2ZH3A 1KVIA 2HPUA 2CNGA 1TKDA 3PRBA 3S6EA 1P15A 4RH5A 2VC1A 5AJ3F 2R8HA 3H2VE 2P9GA 3VAGA 2Y1IA 2EFVA 4Z37A 2GX8A 2CFXA 2KFYA 4ECVA 2PIIA 1N56A 5IWAF 4PXEA 5J2PA 4BWMA 3VTIA 5DGBA 1SKWA 3O4UA 4MFBA 2XNRA 5L8RC 1VC6A 2I5XA 4FNIA 1KTQA 4FN5A 3CJ3A 3MM6B 1S79A 3FGVA 1C0TA 3DMJA 4NWBA 3KJVB 1IKWB 3GIJA 5CD4H 3RAXA 4GE2A 5D4OA 3G4SS 4NYOA 4NOHA 3MMCB 1TKTB 3KWMA 5D4PA 3F41A 1Q7LB 2FHJA 2ZD1B 3KLEB 4QAHA 4WIIA 4QCLA 3H5XA 4I7FB 1HD0A 2E1RA 1YBAA 4O3OA 3CD0A 4BCAA 1YVFA 3MDFA 3NCPA 2DGTA 4S0GA 4FXDA 4KHPF 3IGVA 3M05A 4GO5X 4OI1A 1YGRA 1UETA 4H4KC 2I6JA 1SUQB 3CWJA 2XS7A 2WSCC 1YN9A 4RUHA 4GE6A 3VAKA 2ZNYA 3D42A 2AF6A 1U47A 1WAXA 4F2SA 2KT5A 1S97A 4QWBA 1AW0A 3IR7B 1Y00A 4Q7AA 1PA9A 2YKPA 3MEDA 2DNKA 2NTAA 3BSOA 1S0OA 2EFNA 4G3IA 2HRYA 1NZAA 1M5SA 2L9WA 1RP5A 4X66F 2M88A 3R5DA 3BM8A 1T94A 1LYVA 2A10A 2YNIB 3PZPA 2PI5A 3DYAA 1N32F 2B49A 4B08A 2AJ4A 1NRKA 4F3MA 2GP0A 2V4RA 2J9DA 2XLKA 1FNXH 1KAVA 1S9GB 3GG0A 1F5BA 1PSDA 2FHMA 1OPZA 4FP9A 1XMOF 2HVZA 5HP1A 4TYBA 4QIWD 1U6ZA 3H25A 4B3SF 3O4TA 2DT9A 1JLAB 1ZCLA 4OHIA 2CPXA 5GVQA 1MSWD 5F8GA 3V6HA 3U1NA 3LAMA 4C4WA 3DLGB 5L1LA 2XBPA 3ETOA