4WU2A

Structure of the ptp-like myo-inositol phosphatase from selenomonas ruminantium in complex with myo-inositol-(1,4,5)-trikisphosphate
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
313
structure length
313
Chain Sequence
TVTEPVGSYARAERPQDFEGFVWRLDNDGKEALPRNFRTSADALRAPEKKFHLDAAYVPSREGMDALHISGSSAFTPAQLKNVAAKLREKTAGPIYDVDLRQESHGYLDGIPVSWYGERDWANLGKSQHEALADERHRLHAALHKTVYIAPLGKHKLPEGGEVRRVQKVQTEQEVAEAAGMRYFRIAATDHVWPTPENIDRFLAFYRTLPQDAWLHFHSEAGVGRTTAFMVMTDMLKNPSVSLKDILYRQHEIGGFYYGEFPIKTKDKDSWKTKYYREKIVMIEQFYRYVQENRADGYQTPWSVWLKSHPAKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Myo-inositol phosphohydrolase
publication title Structure of the PTP-like phytase from Selenomonas ruminantium in complex with myo-inositol-(1,4,5)-trikisphosphate
rcsb
source organism Selenomonas ruminantium
total genus 110
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 3.1.3.8: 3-phytase.
pdb deposition date 2014-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14566 PTPlike_phytase Inositol hexakisphosphate
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1690 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4wu2A01
3.90.190.10 Alpha Beta Alpha-Beta Complex Protein-Tyrosine Phosphatase; Chain A Protein tyrosine phosphatase superfamily 4wu2A02
5IBSA 2QEPA 4WTYA 4GE5A 1R6HA 3SR9A 3S3EA 1PTVA 1G1FA 2J16B 4RKKA 2CMBA 1ZC0A 1RPMA 1T4JA 5KABA 2OZ5A 2NT7A 2PQ5A 2QDMA 2Q47A 3EU0A 1WAXA 2I6PA 2ZMMA 4H34A 3D44A 2PA5A 5GTJA 2VEVA 1V3AA 5KA7A 2CNHA 1FPZA 3F81A 4BJOA 1L8GA 1I9TA 5LXQB 4ICZA 2P6XA 2I4GA 2PT0A 2NV5A 1LQFA 4ERCA 4AZ1A 1OEUA 2MBCA 3F9AA 3V0DA 1U24A 1YGRA 2QBSA 3I80A 4OHHA 4GS0A 2I1YA 1XRIA 2Y96A 2PBNA 4PYHA 1PXHA 2HC1A 1ZCLA 2GJTA 1WRMA 5K9VA 3OLRA 4RI5A 4YR8B 2I3UA 2H4KA 4KI9A 3QCJA 4WU3A 1P15A 2I6OA 4KYRA 2BIJA 4GE2A 3F99A 2NZ6A 1Q6SA 2QCJA 2F71A 4JNBA 2Y2FA 1YGUA 2BGDA 4DGPA 1Q1MA 2DXPA 3O4SA 1KAVA 2VEUA 3EAXA 4QUMA 5KA4A 2I6JA 2RF6A 1OESA 3ZMPA 4RH5A 2B3OA 3RZ2A 2C46A 1Q6TA 1JF7A 2HY3A 1I57A 2G59A 3A5KA 3QCGA 2GP0A 2HVLA 4QAHA 4D3RA 1NZ7A 1Q6MA 2A3KA 4R0SA 2I3RA 4GRZA 2FJMA 2F6WA 3V0GA 2BV5A 3ZM1A 4OHLA 5KA3A 2I4EA 2H04A 3V0FA 1YTWA 2F46A 2H4VA 3AWGA 3S3HA 3QCCA 4NWFA 2NTAA 1BZCA 3EB1A 5BX1A 1YPTA 1EEOA 4OHDA 3EZZA 2WGPA 1YN9A 1YFOA 1GFYA 1BZHA 2CM8A 2H4GA 5J8RA 5KADA 1XBOA 2G6ZA 2CNGA 3S3KA 5KA1A 4TVVA 3B7OA 2B4OA 1LARA 4Z6BA 3ZM0A 1D5RA 1NWEA 3QCMA 5KAAA 3MMJA 1G1GA 4YAAA 4I8NA 1C86A 5K25A 1Q6PA 3QCIA 3ZMQA 2Q05A 2CM7A 2HC2A 2PSZA 2F6ZA 4PVGA 3BLTA 4JMJA 5EHPA 2I6IA 3O3LA 1U25A 3F41A 5KA9A 2AZRA 2CNFA 4D3PA 1JLNA 2B4UA 1GWZA 5K23A 4HJQA 2BGEA 2QBRA 2J17A 1MKPA 2F6TA 2QBPA 1G7FA 2I75A 4Y2EA 4QUNA 1G4US 2VEWA 5BZXA 2F6FA 3O4UA 3S4EA 1ZCKA 3RGQA 1PA1A 3D42A 1ONZA 2CM3A 4H1OA 2JJDA 4Y14A 4GRYA 4QAPA 2F70A 3H2XA 2PI7A 3QCDA 3AWFA 1SUGA 3MOWA 1C83A 4NWGA 2GWOA 2I5XA 4BPCA 5KACA 5M43A 5I6VA 2QBQA 1XXVA 2E0TA 2I4HA 5KA0A 5IBMA 1FQ1A 2H03A 3CM3A 3D1OA 3U96A 2OC3A 2C7SA 2NT2A 1NO6A 2CNIA 1PA9A 3SMEA 2I6MA 3EMUA 2HB1A 5KA8A 2SHPA 2VEYA 3D9CA 2H02A 3PS5A 1YZ4A 1OEOX 1Q6NA 1YTSA 2CNEA 1C88A 3V0EA 3O4TA 1ONYA 3GXGA 3QCNA 4GFVA 2B4SA 1G1HA 2VEXA 4IKCA 4ZI4A 1PTTA 4DGXA 2P4DA 1LYVA 3GXHA 3M4UA 1NWLA 1ZZWA 1C85A 3RO1A 3QCKA 1PTYA 1PTUA 3QCBA 2HCMA 2OOQA 3O5XA 1RXDA 3S3FA 2CMCA 4JBCA 3V0HA 5BUGA 2QDPA 1QZ0A 1T49A 3OMHA 4S0GA 5K22A 1EENA 1I9SA 5AWXA 2AHSA 2CJZA 4KYQA 1AAXA 1NNYA 5EHRA 3S4OA 1KAKA 2A8BA 5MMZB 1C84A 2B49A 1A5YA 4RHGA 1M3GA 4WOHA 3QKPA 4JMKA 3RGOA 1G7GA 4RI4A 1FPRA 1X24A 5BZZA 4GE6A 2R0BA 1OEMX 1C87A 1QXKA 2QCTA 2BZLA 2QDCA 4HRFA 4J51A 5KA2A 4WU2A 1XXPA 2CM2A 3ZV2A 2CFVA 4RH9A 2F6VA 1WCHA 1PYNA 3BRHA 1VHRA 3CWEA 4NNDA 5K24A 4NX8A 5HDEA 3F9BA 1J4XA 1OHEA 1NL9A 1L8KA 2FJNA 4D3QA 4QBEA 1Q6JA 1OHCA 3ZM3A 3QCEA 3V0JA 3BM8A 2IMGA 4MBBA 4ZRTA 1G4WR 4R0TA 4OHIA 4HJPA 1XM2A 4B04A 4GWFA 3LJ8A 2ZN7A 3ZM2A 2YDUA 2J16A 1YWFA 4NYHA 3I7ZA 4GFUA 2F6YA 3QCHA 3QCLA 2FH7A 1T48A 3AWEA 2CMAA 5K9WA 2M3VA 4R30A 1OHDA 3BLUA 4OHEA 2HNQA 1OETA 3I36A 4RDDA 1BZJA 3MOZA 1U26A 2ESBA 2B07A 2NLKA 1YTNA 3D1HA 3A5JA 3D1QA 2HXPA 3NMEA 3QCFA 2I42A 2B4PA 3V0IA 1PH0A 2HNPA 3N0AA 4QBWA 1ECVA 4ZN5A 3QKQA 2OUDA 1OEVA
chains in the Genus database with same CATH superfamily
4ZVEA 1RBOB 2DHGA 1WG1A 2IJNA 4K59A 1R6HA 2CZ4A 1G1FA 1T9UA 2IDLA 1KLMB 3RB4A 4EGLA 2VKRA 1IJEB 4ZS6A 1K47A 2DR8A 2R7OA 4OV1A 3KJVA 2FD2A 3F81A 3D9BA 3PDNA 2F65A 1O5ZA 1P3DA 1KN6A 3TVYA 4OMFG 1ZPWX 4CO4A 1NM2A 1TL4A 3D6TB 1OEUA 2ATCB 2HIYA 1OWXA 2J0QD 1VJWA 3MUTP 2I1YA 2W9BA 2Z0GA 4ILLA 1L3SA 1RZMA 3OJSA 3RW7A 2R3VA 1EHWA 4I68A 3OUYB 3T1HJ 2MKIA 1HNIA 1VJQA 2BIJA 3MM7A 5J2QB 2M70A 2C2NA 3SV3A 1UWAA 1QVGR 2DNMA 1RAEB 3QCZA 4NZ7A 5KFAA 1XIQA 4M8LA 3H5YA 4Q5VA 1X9WA 4X66J 5F8LA 1S1UB 4QAHA 4LBIA 5ETKA 3B4DA 2KXNB 2Y1IA 2EW9A 2I3RA 4Z37A 2VC1A 2FJXA 2QLWA 3K5LA 2EK1A 4TXSA 2CADA 4IO1A 2BR0A 1S7HA 2LU1A 4ECQA 3CD0A 1N8RT 2B5JB 1NK4A 4LFCF 4FDFA 1REVA 3KUEA 1WEYA 4C8MA 3HT0A 3NCPA 4MK9A 5C25B 1V3SA 1TL3A 3N5BA 4TU8A 2M4MA 1NEEA 5EWFA 3TZYA 2DR5A 5A8KB 1EP4A 5AE3A 4DL2A 3ZM0A 3PFOA 1Q81T 3UN2A 5D0RA 1FX2A 3HM9A 3QJJA 2MEWA 1Q6PA 1WD6A 4F26A 5F9NA 2F6ZA 1R31A 1K9MT 1IQTA 3BGRA 4TY9A 3PR4A 2WW4A 4DV5J 4CO3A 3QAEA 2HMIA 1DBDA 4NCGB 3GV8B 1N34J 1XK8A 1FNXH 5ETPA 3DOKB 1UA0A 1QAIA 1X5PA 1EZZB 3RGQA 1ONZA 4H1OA 1ZZFA 2A18A 3R5CA 1E6VA 2EC0A 1OO0B 3C15B 4YR0A 1VQ6S 3O44A 4RUBA 3M8PA 4B3OA 1FGSA 2I5XA 2FTRA 4KV8B 2Q43A 2HNYA 8ATCB 1XXVA 1JLGB 2BRLA 1RDRA 1C0TA 1TELA 2UUTA 3JB9k 4CVMA 2JVOA 3M2RA 1NKEA 1FERA 3MPWA 4C8NA 1CULA 4NA1A 3MMCB 1ZETA 3PS5A 4DBQA 1FDBA 1MU2A 1HHQA 1LWFB 3JS9A 4I2PB 1VHIA 1WSRA 2RF2A 4DGXA 3GXHA 5D77A 2GJFA 4TU9A 3KJQB 3BQ1A 2R8JA 2P9GA 1TUWA 3LAMA 3QZ8A 4DPWA 1JIHA 4B9VA 1UVIA 4M5KA 1G7CB 1PJ5A 2HFSA 1I9SA 1UL3A 1SH2A 4KAIA 3MM6B 4KYQA 1U1MA 2N82B 1N32J 1EAYC 1NJIT 1UFWA 1S1WB 1C84A 4A8OA 1A5YA 1HR0J 1NK7A 5L39A 5KFJA 1FPRA 5BZZA 1RT4A 2WONB 1QXKA 5EWEA 4O3PA 1HBOB 2IMWP 1FDAA 4QR2A 2LYVA 3N2AA 3PV8A 4JI6J 2HLUA 1T3OA 1CS4A 1LEOA 1NL9A 3FEYB 1GT8A 2DB1A 1RB0A 2FHJA 2R4FA 4OZLA 2KM8C 2H1YA 3BM8A 1S99A 3UFCX 3GR0A 5CABA 3RZAA 4JI8J 4B04A 5DDRC 5K8MA 3QLHB 1TKDA 3DRSB 4UOFA 2ZDOA 3R2DJ 5EHHA 1GTEA 4LT6A 4NYPA 5T14A 3G9CA 5KFPA 1U4BA 4QIEA 1BQMA 1HA1A 1D9AA 4GKJJ 3U1NA 1U26A 1K1SA 1TKXB 3NY0A 3KLGB 4RX6A 1FJEB 5E7OB 2HNPA 4U67Q 3NRBA 1RBAA 4IO9Q 2VB6A 2V2VA 3TZXA 4WTYA 3RBXA 4URGA 1DTQB 2JLFA 3S3EA 3H2LA 4DQRA 4MK7A 4C2MA 3JSBA 3JAMY 2LP4A 1T4JA 4X4PA 5KABA 4U95A 2Z2YB 2E5JA 3HMJG 2HKEA 4NI2B 1SXLA 2E7WA 3O2IA 4H34A 3D44A 3W2WA 2E5GA 2EK6A 3T5HA 1ELOA 2KXFA 4ICZA 5F9LA 4NLQA 3EXYA 4RNNA 1WKKA 4TYAA 5BR8F 3RUBL 1YX2A 1VISA 2OTJS 2NS1B 4CM0A 2HC1A 3ENAA 3CJTA 5A6PA 2OUGA 1HIYA 3R5GA 3QQCD 2I3UA 2XLJA 1Q95G 1SBRA 3ISND 3NAHA 5KFZA 1NJYA 1DTTA 2AGQA 4F8RA 2CQIA 4XTTA 4CH1A 2VASA 4Z7YA 1J2VA 3O4SA 5L9XA 3PRBA 3HZEA 4O0NA 2HY3A 5FDLA 1SL0A 3NGUA 1TQLA 2GP0A 3C14A 4D3RA 3PYGA 2E1AA 4DU8A 4IR9A 2FHJD 4L76A 1IKWB 3UDEA 2D3O1 1R7IA 2HZVA 3QCCA 3CIZA 2CG4A 2ZNZA 3CO9A 1EEOA 2IBOA 2HNDB 1YJNS 3PW2A 2CQ4A 2PD1A 2CQ1A 4NLVA 4B9MA 2MKKA 2RMLA 4A4JA 4LF4F 4LSLB 1YJ7A 4QZVB 2AEJA 5E3PA 1VLOA 1WKJA 3N28A 2ZM6J 1KP6A 2WSEC 3Q8VA 4OX6A 3O5TB 3US5A 2BVZA 2VPYB 4B08A 3AY0A 3HO1A 2AZ3A 1MMNA 1NWEA 1N88A 4K0KF 2LQJA 2FY1A 2GQ2A 3VALA 4J9SA 3MCMA 1N36F 4DR7J 1HBUB 1X9SA 1UVMA 1DRZA 3TUIC 5EHPA 3DRXA 4ZK7M 2MZJA 2QV6A 4ED8A 4EWTA 3CEDA 1UFLA 2DYAA 5A6WA 1C1CA 1G7FA 2UXDF 3TZZA 4UTGA 5BYQA 3D42A 3PYZA 4NEZA 2M8HA 1CJTA 2EC2A 2Z2MA 2JJDA 4P52A 1S9EB 5KFOA 3DGVA 4DV2F 3QT7A 2AW0A 3GFZA 5IFMA 1RT5B 4KGVB 4Y2MA 2VKZG 2W2QP 4FKYA 2D1CA 4PG6A 4CYUB 4OYIA 4YY3J 1VRUB 4IFYB 1VGYA 1M5OC 4LFBF 2ZH4A 2QE5A 2MSSA 3L09A 4J9KA 3W8GA 2I6MA 3DHXA 4DV0F 3Q8YA 3MM7B 2BX6A 5DQIA 1N33J 2F1FA 2KKHA 5DLFA 3VCDA 1J5EF 3KLFB 3PO4A 1Q6NA 3N5FA 3MR5A 4I7FB 2V8GA 3L4BC 4F4ZA 1JLCB 4ZPTR 4ECSA 4OYOA 3OTBA 2BM1A 4N76A 2OPPA 2IM2A 3I32A 3HJVA 4J90A 4OV6A 3VAFA 1ICEB 2RSQA 2PC6A 2HVEA 4KGKA 2UUCJ 1N5VA 1OIAA 1SB6A 3O5XA 3LP1A 1FKOB 2MMYA 2CG8A 2Y8YA 1SUQA 2CMCA 5LT5A 4B3SF 1RT3B 4USMA 1VQOS 5J2MA 5HANA 4OJ1A 3TZWA 2XGQA 4IRCA 1K0TA 4DV3J 3TX0A 1REVB 3OVBA 1R0BG 2XMUA 4P2SA 4WOHA 1IBLF 1FWPA 5D4NA 2YNGB 1YBUA 1X24A 3D67A 2NCKL 5K14B 1YRTA 2QDCA 2BZ2A 4U9RA 2CM2A 2RE1A 2F6VA 2GVZB 2MYFA 3KLIB 1FE0A 3CMES 3FGVA 3DLKA 3AA9A 2DNNA 4DSIA 2FJNA 2MKYA 1T05A 1OHCA 3CCES 4DR2J 3LP0A 4OZ2A 3KUHA 3HVAA 2OEJA 2YDUA 2CPJA 4DPTA 2KFYA 1HMVB 2UVVA 4C8YA 1L5UA 2HMIB 2KJWA 2J8SA 4GFUA 1CC7A 2F6YA 4M5GA 2FH7A 2VG6B 1YVFA 3EM1A 3V4IB 5ETVA 4PYAA 2NYHA 2OEMA 5K9FA 4WXWA 1KOOA 5HVFA 2MPUA 2KJVA 1YTNA 3D1HA 2N4CA 4C13A 4QWBA 2HAFA 1R8CA 4DUYF 4DG1A 1IBCB 3IRXA 1XMOJ 1MNEA 3QGPA 1GX5A 4QOTA 3VGVA 1ZC0A 3LAKA 2GFFA 3Q8QB 2W4CA 2PQ5A 1VK3A 2DGOA 3J7YU 3CVKA 4N77A 2MZRA 5DZ7A 2VEVA 3OV7A 1FFSB 1XC9A 2V63A 5LXQB 4ENOA 3TJ8A 2KG1A 2XG8A 2NXEA 1N6QB 3MAAB 3M30A 4M5NA 2AM2A 4ZP7A 4RW7A 3EPIA 2C2RA 4PWDB 2A10A 1JWWA 1Q53A 2R7UA 2BXJA 3D6MB 2KH9A 4DL6A 5DZ6A 4NCBA 4DL7A 3AQOA 2Y96A 3S6EA 1URNA 2YNIB 1NPRA 3BBCA 1YJRA 3RG6A 4O44B 3QAUA 2U2FA 3CNQP 4RW6B 2XYHB 2IHR1 1S10A 1F1BB 1IKXA 3TA0A 4IG3A 3ZNJ1 4JI1F 4ID5B 4PABA 4IUFA 1JXVA 3BYPA 2Y9HA 4NLOA 2XBPA 3G8QA 2FYXA 1RT4B 4ZHRB 1OESA 4WPAA 4WE1B 3GV7B 3S1TA 1I57A 2DJWA 1K8AT 1X31C 3IWXA 5K5MA 1FK9A 4CO2A 3GFHA 4R0SA 2WVCA 1SH3A 1IKYA 2DH9A 4WCEQ 1RSCA 4DV1F 4DL0C 2BE2A 3R7SB 2F46A 1NH7A 3NNHA 3VWSA 1BZCA 5BX1A 1VLYA 2ZHAA 1M0SA 1JLFB 4U6PA 4K4ZA 3M8QA 4J5OA 1ZOTA 1C1BA 4PQUB 3NS6A 3OL8A 5A5FA 3CMQA 3OW2R 3TARA 1S6UA 1QD1A 1HNVA 1S48A 4Q43A 4XO0A 2ACYA 2AT1B 2CJBA 4M5JA 4A8FA 2ASJA 3GG1A 2SXLA 2DGSA 3MWBA 4JI4J 3MEGA 2V6AA 3UCZP 1P1TA 3R5AA 5AXLA 3AFGA 3UR3C 1RKJA 4GVBB 4WP3A 4JMJA 1KVJA 3ADAC 3NBPA 3RRKA 1K1QA 4ATNA 1NRKA 3CCRS 2YKQA 3TWZA 2JLEA 2Y1RI 4HEA9 3CJ3A 1HWJA 2BGEA 2QX0A 1V6HA 4AXJA 2FJVA 3D0HE 1U1PA 5EN1A 3G86A 1RABB 2B3TB 3H2XA 2F00A 1ZBTA 1IXKA 1RTIB 5I3PA 5BXIA 4BWJA 4RNHA 2VPZB 4BDPA 1RWXB 3DLLQ 3V81B 3HSGA 4FF3A 2Q3PA 5IWAF 1SQGA 3RRGA 2OC3A 1F6TA 2C7SA 3FBBA 4PWWA 1R0AA 3W64A 1HYSA 1I3OB 2H4WB 1U48A 4FPIA 2FUG9 3E8OA 2HB1A 1NB2A 3DGPA 1NK0A 5A0YA 4PG7A 1HARA 4P2XA 4KGXB 3ETOA 3WIUA 2EWHA 3JSMA 1U0HB 1WI8A 2NPIA 1OYDA 3IS9B 5I3QA 1W7KA 2O67A 2P4DA 1LFWA 3FK4A 4DXLA 4WFZA 5B09A 2HCMA 2Y67A 4X64F 2HQGA 3IWLA 3QT6A 4QWDA 2ZBQA 4RW4B 2BANB 1N4LA 4ZCKA 3EXCX 1GXLA 2B49A 2K06A 2B8QA 4JMKA 3RGOA 4CLFA 4PKDB 2EPIA 2PO4A 1JJ4A 1F9FA 3OL7A 2AHOB 1C87A 3PEHA 1Q7YT 1AW0A 4WU2A 5KG1A 4G3IA 3M8SA 4C98A 2QZ8A 1WCHA 1VHRA 3A8EA 4DFJA 2H5EA 2XEXA 3BZQA 2OIHA 1SVDA 4UZBA 5KG5A 2HBZB 3I55S 1S4EA 1IM4A 3OTOF 4J9NA 3UW1A 4GKKJ 2HBYB 3SQGB 3OTEA 4DX8H 4HDHA 1AB8A 3MPVA 3LWMA 1GEHA 3Q8SB 4ZP9A 4O23A 1OPZA 3M9OB 3AWEA 3MECB 1Q8KA 2A2DA 4V1Ak 2XY7A 3B4MA 2AIRB 4HV4A 2FVRA 1IM6A 1CJTB 2B07A 5F8GA 5KG2A 1YHQS 2HXPA 2B4PA 4RBUA 5L1IA 3DDIA 1IWAA 2ILYA 1TL1B 1Q86T 3ZZ0A 2VTDA 4QU7A 2CXEA 2WSFC 4OYWA 2A2CA 1PIEA 4KO0A 5DRKA 4ZPVR 1XQIA 2KM8B 4C8KA 1VI7A 3BSCA 5DQGA 3RBEA 2NT7A 2ZOGA 2F9DA 1TAQA 1Y10A 1JXEA 5GTJA 1JLQB 2OSRA 2DRDA 2AYBA 1L8GA 5HP1A 4Z7CA 4KPCA 2XSJB 4PG4A 2P6XA 3CJ8A 2FVSA 6AT1B 5I3UA 2NV5A 4OX9F 4AZ1A 1RLCL 2QL7B 4LF9F 3NS7B 4J37A 3TA2A 3HVTA 2DNHA 2HZAA 2DY9A 1UKUA 1QSLA 3B78A 3R6GB 1TTHB 1XRIA 4ALZA 3IBCB 4DR5F 3HHNB 2XULA 2LFVA 3OVSA 2AZ1A 2V4JA 1AZSA 4KHPF 1SC3B 5LMUF 1T95A 4FZVA 4OZ3A 1KD1T 1P15A 2RKIA 5KAKA 3HJFA 1TR0A 4LF1A 3H98A 2Q6BA 3BYRA 2XI3A 2FHKA 1HNXF 1NDPA 4JNBA 4WKRA 4OI4A 3PACA 1N5YB 2VFUA 2DHHA 4EYHB 3Q24A 2VC0A 3MHYA 3SQOP 2RF6A 2C46A 1RTHA 5LJ3Y 5GAEI 4QJVA 2HQDA 1JMTA 2BV5A 3ZTQA 1VBXA 1HW8A 3LP2A 4ILRA 2R8HA 4FYWB 4MFBA 5BR8J 4QU6A 1UETA 1PAUB 4Y65A 1TVRA 3ET6B 4O3RA 3F44A 3IN5A 5EX0A 3AA8A 3PW4A 2DXFA 4C0BA 3H7HB 2CVEA 1MWZA 1WDTA 3S3KA 3W1YC 2ROPA 4H4KA 2H65B 5B0DA 1VBYA 3DNCA 4FYVB 2QLFB 3RAXA 4QIWD 4YEAA 3MMJA 4CNYA 5HO4A 2RIJA 1D8YA 3QCIA 4P74A 1U8SA 1L3KA 4EO8A 4X62J 5HI7A 3DOLA 3CJSA 3KUGA 4MKAA 1OY8A 2M8DB 2C3PA 3R97A 1GWZA 2MLYA 4X4VA 2BEFA 2N4DA 2F6TA 2VG7B 2KFZA 4DLEA 3F73A 2IYGA 2ASLA 2KTQA 2VEWA 2UV8A 3E51A 4C11B 2R8IA 3M30B 2EFVA 5C7PA 3QRPA 4LF4J 1H38A 1KVKA 3NAIA 4LSNA 1D3WA 2Z2LA 2GWOA 3NRSA 3FBEA 2W4PA 3SMZA 5I6VA 1KBRA 2I4HA 2Y1JA 4PG8A 1R43A 3CM3A 4KQZA 5KFUA 5H9FK 4F7VA 3RR7A 3SMEA 2OHDA 1B7YB 5HSPA 3OXFA 1N36J 4DR6F 2EKYA 3KMSA 1YTSA 3V6KA 2R9LA 3O4TA 4YB6A 2DNZA 4OI0A 1CJUA 4OI3A 4XDDA 4LRCA 1HHSA 3PG9A 4NA3A 4L3KA 3J7YI 1OSCA 5HBMB 3RO1A 4J9OA 1XMQJ 3FSIA 1OJ4A 3A13A 2FC9A 4LRFA 2ZHOA 5KT3A 1IKYB 2LEBA 1YK9A 5BUGA 2UU9F 2QDPA 3R6LB 3MAQA 3SBMA 5IV3A 4Q2MA 3VGTA 2VICA 3FRZA 2DCUB 4DX7A 5DM6Q 3EUNA 3A3PB 1FRJA 2I5JA 4Q0BA 2NSCA 1BD6A 2QCTA 1XN9A 4DV0J 3L7UA 1RAOA 2QLJB 2M2BA 2DH7A 3M8RA 2CQGA 1TL7A 2C3OA 3QO9B 4NNDA 5B0GA 4OJ3A 1OHEA 2M0GB 3HD2A 4NLWA 2PA8D 4R8UA 1QLNA 1KEKA 2GGPA 1RTJB 1SQFA 2K1RB 4NYHA 2GQQA 3UE2A 1U8WA 4HDGA 3UO0A 3KHHA 4CO0A 2ALYB 2OMOA 4UZCA 1TZ0A 2H3EB 4DF4A 2DGWA 4R25A 3CC7S 3MOZA 1H98A 4P2MA 4NEYA 2AU0A 1NPKA 2W7OA 3FMBA 4B9NA 3QIDA 4HACA 1IBLJ 2CQHA 3T1YF 2EFOA 5KG0A 1UZDA 2FC8A 2VOPA 1YJUA 2HIQA 3ZZRA 2L3MA 3NS5A 2GMLA 5K8OA 2VL1A 3FC9A 4CT8A 1HI1A 4QWCA 1VQPS 1ZTTA 3Q8PB 2YVSA 3BF4A 2FDNA 3THVA 2CYYA 1Q8IA 2JFFA 1GQEA 3OVAA 4ED3A 3PEJA 2HHTA 2NQPA 1S6PA 3I0RA 2IFXA 2OLWA 2YPZA 1X4CA 3R7BB 4ECVA 3HHDA 1RTDA 3CCWA 3V0DA 1M5HA 2QBSA 1S72S 1C2PA 2HSEB 2VOSA 5D0GA 2UVWA 5CD4A 2HWTA 4HHHA 3MEEA 3V6DA 5IS2A 1PSDA 1T11A 3GWCA 1E6YB 2OAUA 1Y0HA 2NXNA 2H9ZA 5RUBA 3N79A 3DYAA 1RA7A 2BJEA 2VQFF 4QPXA 1GFWB 1UWBA 2ZC3A 1ZS6A 1JBVA 2Y68A 4HLBA 1KDNA 3RTVA 1NKCA 1RU1A 4RW8A 4K4SA 2XO6A 4DS4A 3WC2A 4PXEA 1UVLA 2GW8A 2D3UA 3U1MA 1U2CA 5DDPC 2FQQB 1S0OA 1RAGB 3RGIA 3V0GA 3CE8A 1RHQB 4LREA 1FWLA 1HBNB 2LEPA 4K4VA 2PFDA 4YS2A 2QMXA 3S3HA 3QMQA 3OL6A 4EEYA 3X3UA 3TAQA 4Q8FA 2G2YA 3R1LA 2HFZA 4X4OA 1F3VA 1PAEX 1BZHA 4OHZA 1FNOA 2CM8A 1Q79A 2RRAA 1R8AA 3HFKA 4ELTA 1S1XB 1KS2A 2OO4A 5LSLA 1RACB 5C42B 3B7OA 4MYUA 4JI3F 4KTQA 4JI1J 4DR1F 2Z2ZA 3W66A 3QCMA 3HFVA 1CQMA 3R27A 4Y6IA 2JL9A 3ITHA 2QG9B 4BLGA 1R89A 2J7UA 2B4VA 4R5PB 2MTLA 4C0OC 4C8LA 2Q1LA 3UVJA 2VPXB 2MQOA 5HN0A 4ILMA 3ZTSA 2QBRA 3KK2A 4KE5A 1MKPA 1LK5A 3BO4A 3P96A 1GQYA 2VPWB 4NRUA 1SJ1A 2CM3A 1WF2A 1J6UA 5C24B 5GAGI 3Q83A 2W25A 2CUYA 3MMBA 2VJUA 1IVZA 3K5PA 4Y0FA 2W2MP 1SH0A 2E0TA 4EMDA 3M1VA 2MKCA 2XY5A 4YB1P 4JYAF 4DDFA 3GJTB 3LO3A 2V4JB 2FVQA 3CCSS 1N5TA 2UUAF 2ZVSA 4DN9A 1NAQA 2QMWA 3OR1A 2NT2A 4ZN1A 4DJBA 5EDWA 1HL6A 4U7UD 3CW2C 2VEYA 4JUZA 2UP1A 5HJYA 1VCTA 1Z4UA 3CCUS 1ONYA 3GXGA 3T1HF 3HSJA 2IRUA 1G1HA 6FDRA 4OI2A 3OD2A 1TK8A 3VR1A 2JFKA 1YJWS 1HPZB 3M4UA 1NWLA 2UXCF 3QRRA 4PXBA 1HKAA 3PYDA 2WTFA 3D3BJ 4DPYA 2PMWA 4ZP8A 3QZ7A 2M5YA 4BCAA 2W7PA 1EENA 4GVLA 1YITS 4FVCA 2R7SA 3CPWR 2FVPA 1XERA 5IWAJ 3H2VE 4RI4A 2C28A 1O8BA 4DR4J 2CFXA 1X4BA 1YDLA 5G0RB 3TUJC 2CJXB 1U1KA 3VTIA 1QUPA 1B7FA 2ZKTA 1HBMB 1Y11A 4LIWA 4N5SA 2V5HG 1N0VC 2CQDA 2HHHF 3DOMA 2P5VA 2B0GA 5KG4A 2B9WA 1F9HA 2VG5A 1EX8A 1LW0B 3I7ZA 3BPDA 5K9WA 1QJHA 2IJFA 2M3VA 2E1PA 5J2NA 2XMWA 1HI0P 3EGNA 3AODA 3LANA 3H42A 3I36A 3Q0AA 2ASDA 4HT7A 1TV6B 1HQEA 2BOAA 3NOGA 4OHWA 4KFBA 1Y4ZB 5H9FJ 4ZN5A 2XMVA 3CCZA 1N0UA 3BB5A 3T1AA 2QTWA 4MIWA 1SKSA 3SR9A 4RKKA 4HHUA 2CMBA 2I9SA 3LGNA 2A3JA 4UT4A 1VQ8S 4QW9A 3CJKA 3E3XA 2V94A 2G13A 2QSWA 4LRDA 2XQCA 1NH8A 2YH0A 3SCIE 2CPYA 4EBEA 1A7GE 2GCFA 1H7WA 4LJMA 4O4GB 1S6OA 1WC5A 2WB4A 4NMLA 3PXGa 1T03B 2IJRA 2P6TA 1RWPB 2R2UA 1WDDA 3TAMB 1C0UA 1JLAA 1WUUA 1HNZF 2CQPA 3VHQA 3ILJA 2DXEA 1H0HB 1RT7A 4YR8B 2QFIA 1HD1A 1SV5B 1QTMA 1LNQA 3VZIA 6FD1A 2AJ1A 3BS9A 4W92B 4X4RA 3OFEA 1YJTA 4JI5J 2QCJA 1DLOB 3BM7A 2BGDA 2NXUA 4KR0B 2I6JA 5J2PA 2MLZA 3V2UC 5KT7A 3RAQA 1HR0F 4ES1A 2OD6A 2E7XA 5FIIA 4TQSA 4F04B 4OYPA 5KA3A 2I4EA 3V0FA 5KG3A 2NZ4A 1H7XA 4IFVA 4USVA 2GGPB 4JOUA 4I64A 1L3UA 1D0EA 2Q79A 2KT2A 1DARA 3OHAA 2WGPA 2QGFB 4JI6F 2ZFHA 1G1XA 4IH7A 1GFYA 1TKZB 4WK1A 3MAHA 4KHPJ 1S1VA 2ZH5A 2H51B 5CYJA 5LMUJ 2G6ZA 4X4SA 4ECRA 3QIPA 4YDDB 4ELUA 2CNOB 3BQ2A 2X51A 1HNXJ 4FNHA 2ZE2B 5T41A 1FRXA 2UUPA 5J1NA 5IM0B 2KHCA 3CXCR 1PBAA 4ZOSA 1VQSA 3GYNA 4UOCA 1R8HA 3NP5A 4K2JA 1SC1B 1JLEA 3W2VB 2YNFA 2Q05A 5LSOA 2I1RA 1NBEB 3EE3A 5KFIA 5L1KA 1PJ7A 5ADZA 2J76E 2G0CA 4FPRA 3AJDA 1JLNA 3JQJA 4P2FA 2CJYB 4CTAB 4ZJLA 2QBPA 3E01B 2WJPA 1G4US 3LPYA 2VBZA 1RAIB 1Z2ZA 1ZCKA 1WC4A 4NLGA 1LQ9A 3PO5A 4KB7A 4DSJA 2E5HA 1SUGA 3PIOQ 1YSJA 3N4WA 4FXVA 4RU2A 2GHWA 4QYZK 4ZIVA 1VQNS 2DRAA 4KT0C 3MMAB 2XNRA 1RT2B 2IDEA 3U7JA 5F8MA 3V6DB 3K5NA 3AOAA 2MQ8A 3AD7C 3D6HB 2AKWB 4NLTA 1U49A 2FHMA 4ERDA 1FDDA 4WFNQ 2ZOMA 3EDQB 5D4PA 1UAWA 2B43A 4DQQA 1RK8A 3RRHA 1C88A 4USHA 3EX7B 3IFEA 5GMKa 1JKHA 2FJEB 3MEKA 4U96A 3CDBA 4M5DB 2VEXA 3I9V9 2HVDA 4HVZA 3BGOP 3BPSP 1PTYA 5C2GA 3NG8A 5DG8A 2ZBCA 2M52A 3DMJB 3M32A 4JBCA 1QAYA 5HROB 5HMWA 1VC5A 4L6V3 4EUVA 4MKBA 4L72B 1CJVB 2AGPA 5K20B 2BW2A 4LUBA 3BGFA 3QGGA 5AXKA 4LR8A 5F8JA 4LR9A 1X4AA 2BQRA 5GADI 4RWWA 2V69A 3DLEB 3DLGB 3RYLA 2BZLA 2JC0A 2D9OA 3S7RA 1SKUB 2IBKA 4DR6J 1XXPA 4XIUA 4CLUA 1CEZA 5L38A 1G6BA 1KOHA 2Z30B 2E5LF 3M7VA 3CJ2A 3AHPA 5D8HB 3HD1A 3ZM3A 5F3ZA 4CH0S 4NLXA 1DQ9A 1R27B 2WVFA 3IG1B 2ZM6F 2B8PA 4LF2A 4A48A 1RWUA 1X5SA 1XNRJ 4F25A 1V5VA 2MHNA 2YQ1A 2AJ2A 1JNRB 3C6UA 3HSDA 4NXMJ 3KNAA 3DM2B 2IAJA 2LXIA 4USIA 2YNHB 5DS7A 3OR2A 4A8SA 1SPBP 4HI2A 2UU9J 2J8AA 3F56A 4RNFA 3BKTA 4B3MF 3GE9A 3Q23A 5KFRA 1W26A 1Y5IB 1NSQA 3SFUA 2OPSA 1PH0A 2WZ1A 1F2GA 3HCXA 1CQNA 2O1PA 3HHEA 3ZZZA 2QEPA 2CWKA 4BUBA 2F8EX 2PDAA 3L3CA 1U1NA 1P8GA 1WF1A 2ROGA 5ETSA 2OZ5A 2Q47A 1T0TV 3KLVA 4RLEA 3PX6A 2ZMMA 2PMHA 4ZJQA 2KVIA 1V3AA 5LMNF 3MCOA 3JYTB 5IOLA 3D5MA 4OYAA 4NE9C 3OBIA 3OQ2A 5HL7Q 3VF0B 3T3FA 1RHJB 4L3NA 5HLFA 3IAM9 1KR4A 4OYMA 3F9AA 4E2FB 3FZBA 1YGRA 1N33F 2CQ0A 2IVFB 1J27A 5HMXA 3PJWA 4ED6A 3MGJA 1RCXB 4Q44A 4CNZA 3EVWA 2B9EA 2F4VJ 5D3GB 3NEKA 1IBKJ 2GJTA 2J0WA 2YWHA 1R8PA 1FKPA 2CZVC 4RW9B 2J6UA 2XLIA 5KFEA 1Q16B 4D3HA 2HHWA 1CVJA 2HFVA 4YP3A 3TI0A 4KKOB 2UUCF 2NZ6A 4H4OA 1T8EA 3SSSA 3RR8A 1YGUA 1Q1MA 4Z2XA 5CZXA 2RT3A 4RH5A 3RZ2A 2MGZA 2N7YA 4DV3F 1NZ7A 1X4EA 2UAGA 2JJ4D 3FEXB 4PXCA 1MWYA 3DCAA 4DL5A 1HWLA 3P3DA 3AWGA 4IR1A 3EB1A 2ZJQQ 1LW2B 1YFOA 5ETQA 1YN9A 1HLWA 3OFFA 1WOOA 2DO0A 5BYRA 4CLSA 5J8RA 4CLPA 2NUUG 3ZZYA 4DR2F 5E2QA 2HRYA 5CYMA 5HATA 1MSWD 4H4MA 4ZPWR 2BJ9A 1S6QA 1VC6A 2RB7A 1FXRA 3KK3A 2LQ8A 4DX6A 3BN7A 1NNDA 1D5RA 2GJ2A 4KFBB 2F5GA 1FTCA 3FFIB 2KO1A 4FN5A 4UQGA 1RUSA 2HPUA 5E3AA 2NUHA 3O3LA 4MKVA 1XR7A 5KT6A 2BE9B 4DI6A 3CJKB 1XR6A 5K23A 2EFGA 2OPQA 2RQCA 3EVOA 5A8WA 3RW6A 3PKMA 3MEDB 2VBYA 1XMOF 3LGHA 3OJUA 2QSFA 2BA9A 2FJBB 2YKNA 3W62A 3TJ9A 1VR6A 4QPTA 4G65A 4OQJA 1PYTA 4Y14A 2GA7A 3ZM5A 1FJ7A 3CCLS 5AJ3F 3R5JB 4DHVA 5HJXA 3NGDA 1UPPA 4F2SA 2EFNA 4L75A 3C3LA 1H74A 4FF2A 4JI3J 4LF8J 4WWSA 3UDCA 3K59A 1IR1A 2WB1D 2N3OA 1IKVB 3R8YA 5D78A 3U02A 4P71A 2GC5A 3PY8A 4X65J 4UW2A 3M6VA 5I42B 1GQQA 3V0EA 2V8VA 3QCNA 2QA2A 5CXTA 4LR7A 3M2UB 3V6HA 4ICLA 1U1LA 4ZN3A 2B6AA 5I4MA 1ZZWA 4KHMA 4KH0B 4USKA 2N3LA 2CPIA 3ISNC 3HFZB 4HH0A 3KK1A 3UDLA 4I2QA 2Z58B 3PX4A 4QIFA 5G4DA 2OPRA 3OMHA 2KVQE 2ZZTA 1PYOB 2DITA 3QJLA 1YG0A 1HNWF 2E9TA 2AWZA 3HP6A 1QM9A 3AAWB 2EI5A 4JYAJ 2KG0A 2UUAJ 1QSYA 3N9UC 2GZOA 4OHXA 3MZIA 1S0VA 5DM7Q 4IYQA 4FF1A 2MZQA 1L3VA 3G6VA 3OHBA 3OPKA 2WSCC 5HDEA 2PMZD 1G3OA 2CQ2A 4IKAA 4D3QA 1H73A 1JLEB 4LIRA 1NO8A 2G4BA 4PRFA 4O3NA 4MBBA 3C6TB 1WORA 1G4WR 4OHIA 2K7KA 4HR2A 4N7TA 2UXCJ 2J16A 1B0PA 4JI4F 2M9KA 2KU7A 3A8JA 2J9DE 2HVZA 2ZOFA 3GMGA 1T48A 1MW7A 5E41A 4FBTA 1O0PA 4AL6A 2HLTA 2V8HA 3C66A 2BJ7A 2NLKA 1S0MA 2FZCB 1CSJA 4W98A 1RWNB 1XJWB 2ABYA 4ED1A 2V9WA 2GAGC 5L9NA 2V2QA 5T7LA 4JV5J 2VODA 2ZBRA 2R7QA 4LVNP 4B9LA 2NXCA 1PGZA 4ZLLA 3QFWA 4ZPBA 3DLHA 2VFVA 4URSA 1FXDA 3P45B 3ELHA 2BABA 3FCVA 1BLUA 2HHHJ 3NKYA 2CNHA 1X7VA 3SXLA 5HK4A 1MMLA 4JP8A 2MZ1A 2O3DA 2R2TA 5KFQA 2F7VA 2HHQA 2XCAA 1RGVA 1RT1A 2ATLA 1LWCB 2ZUGA 4DFPA 3D0GE 4LQ9A 3R9LA 4RR5A 3UD4P 2LA4A 1I5OB 4PYHA 4HHJA 2YKMA 4YDXA 2LCWA 5CYQB 3OLRA 1NLKL 4HI1A 4DV7F 1ZM4A 3DRPB 1BQNB 1IWGA 1RCOB 1S1TB 3MTKA 2GMHA 2C22A 3MM8A 2GVDA 3Q8RB 1Q6SA 1E0DA 4DWIA 3LF0A 2MQLA 2WTZA 5AT1B 4J9QA 4AYBD 1HQ2A 4LF5F 1KAVA 2VEUA 2RU9A 3EAXA 2V2ZA 2WOMA 5H9EJ 2DNLA 1S49A 4C4WA 5KFFA 3LW5C 1SL2A 1M1GA 3ZFVA 1H2UX 2R8GA 4ZIWA 4GRZA 2HFNA 4RO0A 3MCNA 3ILOA 4QCLA 4OHLA 1CG2A 4NWFA 2W9CB 4IH6A 2D3OR 1Q1KA 1CLFA 1MROA 1Y5LB 1WC1A 3MUMP 3R5DA 2ASYA 5F41A 1HNZJ 1RWKB 3EZUA 3WZ0A 4CIOA 1LWEB 1TUVA 4B9SA 2H4GA 2DNPA 4PCQA 3HHLD 1U0SA 1NDCA 2PEHA 1JJHA 1TKTB 4LRBA 4GKKF 3W9IA 4ED2A 2W8KA 3CWJA 5DGAA 3A8IA 2ROEA 2A6OA 2PGCA 4BC9A 3HXMA 1LXJA 2QEXS 3IXQA 4DF8A 1KQSR 4C8OA 2DIUA 3ZMQA 3BLTA 3H5UA 4G6VB 2W7AA 1FDNA 3UWTA 5KA9A 2CNFA 1KTQA 2Q6CA 4LF6F 5DJBA 2F63A 3GQCA 2QRRA 2PI4A 2G1DA 3POTA 1DZ5A 3BEGB 3O4UA 3CGIA 2PN6A 3M2VB 3HZGA 5KOWA 1NSAA 4WJBA 4GRYA 3KFWX 2YWKA 1QAJA 2ZH6A 5E33A 1FNMA 5GMDA 3FUYA 3GCXP 1EETB 3GYGA 1WKLA 3C19A 3SIPB 4HH1A 2ZUAA 3PZPA 2EFQA 2R42A 2QT7A 4CO1A 2C1EB 2R7VA 2C3UA 1UVKA 2D3ZA 2ZH9A 2FVCA 2NYIA 2DR7A 2YH1A 3NCRA 2SHPA 2H02A 2P2CB 3EZOA 2H48B 4KIAA 3MM9B 2CNEA 3W5ZA 5D4LA 2W4DA 5GMEA 2VOOA 2RDDA 3WX8A 2ADBA 4TVAB 5M2UA 3DI6B 3CJQA 3RB3A 2AP6A 4IQXA 1JB0C 2LECA 3ILLA 4TY8A 2HNZA 3QCKA 5KT2A 4RL1A 1CC8A 3R5BA 1QE1A 4V19X 5K22A 3SCJE 8AT1B 2CJZA 3GIIA 4NLSA 1T3NA 1FJCA 2YBVA 4F4AA 2R2RA 2MZTA 1TAUA 4F4WA 5KFTA 5ETNA 2HAIA 1NU4A 1FRMA 3QKPA 3H2UB 2WRMA 3RB0A 3I0SA 2D7SA 3BGUA 5J1EB 3PJXA 2HGNA 2FY8A 3QATA 4RUHA 4AD6A 2CQCA 3IGVA 2HFOA 2RVJA 1ZPVA 1JQGA 2HW3A 1PYNA 4JI7F 2YWGA 1WF0A 5KT4A 4IDKA 2BJDA 1HHTP 3Q2SC 5A8RB 4FS2A 5LSRA 4QIGA 2HHXA 2E9ZA 1RI7A 4CQ1A 1RT6B 2KHDA 1VHFA 3BBFA 3W9JA 2H4YB 4X84A 3A3NB 1KLMA 1X4DA 2DO4A 4AQYF 3GJRB 1YJVA 2JFGA 3N6MA 2CPDA 2PFFB 1B64A 3CD7A 3CTRA 1U6BA 4X62F 3ZTPA 1FT8A 4ECWA 3J7A1 4GC7A 3NMEA 3QCFA 3DRRB 4QBWA 2WCXA 1ECVA 4ANCA 3SCKE 2OUDA 3RBDA 2I38A 1JLBA 2VU5A 3C16B 3GP9A 2C2OB 2E5LJ 1WTBA 2R7XA 2VHGA 1J5OA 3D54A 3OUYA 3PJ9A 3NGTA 4EO6A 4WK3A 2L41A 2XMKA 4OZJA 4RKUC 5J2QA 2Z4PA 1NJWA 1NJXA 4QQBA 4ERCA 4JB8B 2AGOA 3PW7A 5LXYA 4C9DA 4C3KA 1U24A 4GS0A 2BV3A 2FJWA 1S1UA 4B3MJ 2J9EA 4RUCA 1X0FA 2P9EA 4A8WA 1RAAB 2G2OA 1LXNA 4KI9A 3N01A 3GJSB 2HQCA 4F36A 2RNEA 3KJVB 3HLUA 2RU3A 3I87A 4MT1A 1XWLA 1UFKA 3UN5A 1XMQF 1AFIA 2B5JA 2DHSA 2ZBIA 3HN7A 3SSQA 1NZAA 2YPYA 1SKRA 1FRKA 3HULA 5C25A 3I5BA 1FO1A 3ZMPA 5IC4B 2M7SA 2CPZA 2B3OA 2RQMA 1P31A 2W9BB 1BHNA 5B7WA 2NSBA 5LMNJ 4BWMA 2XMJA 1RADB 3BSOA 5A8KA 2G1HA 3A12A 3K8WA 1SJ4P 3K7RA 3QWPA 1P27B 1HNIB 3AJ1A 5KFSA 1DJ0A 3RBZA 4NLYA 3TO8A 2FIUA 4UY8T 5A5EA 1N5SA 4FBUA 4I6WA 4NCGA 5B0BA 2BJ8A 4Y2IA 1MMDA 4NWBA 2ZJPQ 1VDHA 2XM3A 3SI8A 4ED0A 2DPIA 4XPCA 3BN4A 2LQBA 3TUZC 1C86A 3C15A 4L73A 3V4MA 1ZZNA 2RS2A 4KPYA 4O4RA 4KV8A 5SZTA 1JLGA 1RAJA 3GIJA 2W9AA 2GMJA 1TL3B 4CLLA 5L1LA 1UJ4A 2FGCA 3D2WA 3SZ2A 1IJFB 3M8ZA 1OYEA 4ZVUB 1TP7A 4Y2EA 2VFSA 5U47A 1YKWA 3PIPQ 3OSNA 1EP4B 2MHEA 3MMCA 2OMLA 1GTHA 2XI2A 1R3NA 4P73A 3THTA 1LWFA 2COLA 1FFWB 4I2PA 3LA0A 2GJIA 3UNYA 1X4FA 5KG6A 2QN6B 1D1UA 3BGRB 2JEFA 5IBMA 4FKXA 4DX5A 2KXHA 2CKWA 2R8KA 4ZVHA 4ZVPB 4MIAA 2CNIA 1RISA 4R0EA 1WWHA 2CNKB 2Q66A 2W2OP 3ZZTA 2DNGA 3AB2B 3MM6A 1YZ4A 3IR5B 1OEOX 5B08A 3H25A 4CM2A 3GR1A 2DIVA 2FPHX 3SDEA 1S1WA 1E6VB 3CMAS 5F0WA 2VIHA 1UMJA 5E3QA 4GFVA 1SCJB 3M8PB 5CQGA 2WOMB 3DU6A 4LQ3A 3B6BA 4B3OB 3MD1A 2UXBF 4NASA 2GCBA 2WONA 5IXUA 1HBOA 3Q8UA 2HNYB 1LV5A 4TLRA 1C85A 1C0TB 3CT9A 2E5IA 2WHOA 3OXLA 3AB4B 3M2RB 2BM0A 1ROFA 2DGQA 2MKHA 4HT5A 3FVYA 4DEZA 2X1AA 1HW9A 1ZAVA 1MG7A 3KHRA 5AJ3J 1QZ0A 2IVYA 1CULB 1GAOA 1UZHA 4MH8A 3G96A 3HI9A 3QLHA 3DRSA 4K4TA 4I0WA 4XDCA 1MU2B 1G7GA 3NNAA 2RF2B 4IG0A 1FWKA 3H59A 2GO8A 5KFVA 2C2ZB 2IC3A 1KHWA 2IA6A 1Q7LB 1YIJS 3VV2B 5HQMA 3TANA 1TKXA 4OHYA 3KLGA 2FLLA 2E7VA 2GNKA 2GIFA 3ENWA 3W5XA 3LJ8A 2DBBA 4DCJB 1DTQA 1NHKL 2QLBB 5CCMA 2ZDPA 3SYZA 2AD9A 1JBWA 4NI2A 4OYBA 1U2RA 3POTB 1QSSA 5KFWA 3VZHA 1FXLA 4GRSA 4RDDA 2FGOA 4QYRA 4OI6A 1HNWJ 3MOJB 1Z2LA 2V50A 4J9LA 1CS4B 4I6AA 3CIMA 3BJYA 3QKQA 4MIBA 4OZ0A 4C48A 4GE5A 2MQPA 1BMQB 2L9WA 1Y9OA 4J9UE 2APOA 2HQIA 1PCAA 1NHVA 3CD6S 1HI8A 5KFLA 3D0IE 2I6PA 3C8YA 2H5IB 1BQMB 3HK2A 5F8NA 5FJ4A 3IBFB 3MCSA 3J81U 1BGXT 4PWUA 4M95A 3GU0A 3GSIA 1WEXA 3ETMA 1AUDA 3I80A 1BXNA 1IBMJ 2JRSA 2HHUA 2YTCA 3IR7B 5HAOA 1OS5A 4OZ1A 1PXHA 1VYAA 4USWA 2JWNA 2W2PP 1AXQA 3KHGA 3W2WB 2NR0A 4WU3A 2I6OA 1IKWA 1RKIA 2XWYA 1LKZA 4PXDA 4PUOA 1O6XA 4I67A 4HL9A 2HBRB 2HNDA 3FKBA 4BBYA 2HFUA 3D66A 3GB0A 4LSLA 4F4YA 4B3RJ 1U45A 2A1BA 1FVSA 1MWQA 4MKYA 2J0SD 4B17A 3BSAA 1P1LA 4W4MA 4DR4F 1XR5A 2BOPA 3M6XA 3BO3A 5LJ5Y 1HBUA 2ZH1A 1DTTB 2QL5B 1S7IA 3R2CJ 1EKSA 1SJFA 4DV7J 4H4KC 4P6QA 1FF2A 1VIOA 5E0OA 5FDLB 5KA1A 2ZZNA 2GHPA 3C14B 1Q8LA 1WACA 3UDVA 2B4OA 4Z6BA 2UV8G 1NMEB 1EJ7L 4ANDA 1S9EA 1G1GA 4M94A 4LF5J 2W24A 5K25A 3CD5A 1RT5A 2XY6A 2CM7A 2Y1OA 3W60A 4RZRA 4CCHA 1JLBB 5A2QY 4CYUA 3RJMB 1VRUA 4IFYA 4P72A 3F41A 2MKSA 4F67A 1BQXA 1FD2A 3GTYX 2AZRA 1W78A 4JI0F 3BBBA 3K89A 3PNIA 1J5OB 5B0CA 4QR0A 3BKFA 4TYBA 2VA3A 3VAJA 3AXKA 4ZVQB 4QUNA 3P4UB 1N56A 3S4EA 3KLFA 2K7JA 4I7FA 1TK5A 1JLCA 1S79A 4NCAA 4DFKA 1C83A 2EBEA 4AL5A 1LFPA 2ZVIA 3Q2TC 3QGHA 1TMMA 1BUXA 1WOPA 1W2BR 2RH3A 2ZD1A 3GCWP 2HRTA 1G2EA 3CJ5A 2E66A 4DV6F 1FKOA 1YGYA 1NO6A 3E2EA 1C1CB 2W01A 2RILA 1RT3A 2VQEF 3IAS9 3UCUP 4MMOA 2PI5A 4MK8A 3TJAA 4IH5A 2YNGA 2JEGA 1KQGB 4LF6J 2GAHC 4NPOA 5DDOC 5K14A 3VVTA 2KT5A 4JI5F 3KLEA 1PTUA 2JH3A 4M5HA 2GVZA 3KLIA 3S3FA 1WI6A 4NXNF 4DZ6A 2CQ3A 1RE1B 4AXIA 3LWLA 3T5LA 1NPPA 1Q78A 1T49A 4EI2A 2I6WA 3AOBA 1KWMA 2OD4A 4EU0A 1M5KC 1KAKA 1HMVA 1ZAWA 2CJ9A 3N6NA 3M9MB 3NMRA 4CWBA 1BE4A 4ECYA 2OPPB 2ZEJA 2VG6A 1QAXA 3GFYA 1KSPA 4J51A 2CPFA 1WNEA 3PCOB 4MAKA 3V4IA 1H2VZ 1Y7PA 3K0JA 2CFVA 2LXFA 1X9MA 3LP1B 4FNIA 3S8SA 1UTAA 1SUQB 2CNLB 1L8KA 4B3TF 4J9MA 3ZC4A 5J2MB 2AEMA 2XMTA 1VIXA 3A3OB 3FBCA 3W3SA 2ZJRQ 2K3KA 3CO0P 2QYCA 3W7BA 4LSZB 3CDWA 2CPEA 1I6JA 2ZH7A 2XTJP 2E29A 4K50A 3DLKB 3MPYA 3PVXA 1VQKS 1N6QA 2NREA 4E0DA 3MAAA 1T05B 1NK5A 1ACMB 2CRLA 3LP0B 5IBSA 1SIZA 4PWDA 4WYLA 1M5VC 4DUZF 4DR3F 1U47A 3ZZUA 1D9DA 1JX4A 3T41A 4DSLA 2YNIA 4JI7J 2KYZA 3MTJA 1UVNA 4LF7F 4O44A 2V4QA 2HRUA 4RW6A 4NLPA 2NLWA 3G71S 1Y3KA 1X5OA 1QUVA 3SDEB 1UJ5A 4ID5A 2DCLA 4AQYJ 2MBCA 2WBMA 4DG1B 4P7VA 3KLHA 1XBWA 4ZVGA 4ZHRA 3RAMA 3IRXB 4WE1A 4F4XA 5THWA 2V2KA 3OFHA 3TQ1A 4DQPA 2VFTA 1RHRB 3TQEA 4GC6A 2IMOA 3PRDA 1NHUA 3UPFA 4YMEA 3HHKA 3W8PA 4UOHA 3QCJA 1ZM3A 2QC3A 4HTIA 2WVEA 2A0FB 4K8RA 5AE1A 2E1RA 1QTNB 1JLFA 2BKNA 4CDIA 2XC9A 4YFUA 4IQMA 2A6MA 4RW7B 2DXPA 4N8NA 5KA4A 4I56A 4IG0B 4PQUA 2FHOB 1DHMA 4ZDNA 2J9CA 3R7NB 3MVNA 1NDLA 1U1OA 1Q4RA 2IC3B 1T94A 5CAAA 5MLCV 2IM0A 1YTWA 4AL7A 4OZNA 2GQCA 4GVBA 1IKXB 1F2HA 2OGUA 4WF9Q 1YPTA 1S76D 4IG3B 3G8SA 4OZ5A 4ZCIA 1N52B 4DFMA 1H3DA 3J81Y 1XBOA 3DLJA 3AT1B 3P5TL 4OIXA 1XNRF 1FK9B 1RU2A 4NXMF 3WC0A 3VQTA 2RHSB 5KAAA 3PM9A 4FP9A 3AJ2A 3UD3P 1KKHA 4ZLJA 3AH6A 2BE2B 3FNNA 1RTIA 2PIIA 4ZLNA 3KJFB 4ELVA 4JV0A 3I4HX 2AJFE 3V81A 2ILZA 3J80U 1H72C 4WIQA 3M8QB 8RUCA 1C1BB 3PHEA 5KOXA 4ZA1A 4HJQA 4Q45A 5L46A 2VDIA 1RWMB 1NCLA 2GC8A 1HNVB 2DHXA 3FZ2A 3EDRB 1EARA 4NZ0A 1SKWA 1RHUB 3HPOA 2DISA 3GIMA 3MEGB 2RDJA 2GO9A 1U0HA 3DRYA 1JXLA 4X4QA 3AWFA 3U1LA 1S9FA 3TW0A 4RNOA 3MOWA 2J6SA 3IS9A 2I8EA 3F0NA 3NBPB 1WEZA 3KOAA 2AQ4A 2KT3A 4KHRA 2QA4S 3A1YG 4RW4A 1PA9A 2BANA 4QDIA 4AE5A 2ZBPA 1IN0A 4TNOA 3CCVS 4PUOB 3H0PA 1ZA1B 3BH7B 3SFGA 4QIVA 2F4VF 3HF5A 1IBKF 4F2RA 5IQQA 2H54B 2B4SA 2WAQD 4GO7X 2OOQA 1MLAA 1R0AB 2ACMA 4EZ6A 3OL9A 1HYSB 3BSNA 1VOMA 4S0GA 3DGPB 5AWXA 3LTOA 3NCQA 2AJQA 5A0YB 3SQGA 3TP2A 1FESA 2B7BB 3JSMB 3GLJA 4IOCQ 3GG0A 2X1FA 1W2IA 4GE6A 1GK8A 4NZ6A 4GO5X 1NXIA 3MECA 3BREA 4B9UA 1APSA 1WHXA 4C6AA 5CHCB 4IRDA 1IUJA 2G9OA 1QDUB 2PA3A 4ZVTB 3QCEA 1TL1A 1X0PA 2UXBJ 3PR5B 4R0TA 4MJKA 3H4DA 3T5JA 3ZM2A 3LGMA 1OPIA 3NXZA 1YWFA 1M1HA 4EZ9A 3KDOA 1MN9A 3DHWC 3SSRA 2IIHA 1Q0NA 2M3DA 3LK7A 3LOUA 3Q86A 2DPJA 2GCAA 3M05A 2MXYA 1JLQA 4G1QA 5GAEU 5EX3A 2HNQA 2NZCA 1F3FA 3K2YA 2XSJA 4Y28C 4CP5A 2X1GA 3D1QA 2O66A 2V34A 2MJNA 1HWUA 2XHCA 5JJBA 2X7IA 2E44A 3AOCA 2JLGA 4A8YA 1YZ7A 1BWVA 2V0NA 1FEHA 1UPMB 4ECZA 4F50A 2ZD1B 2QLXA 2WVBA 2HGLA 4NA2A 4U7CA 2YWFA 3AQPA 1U6ZA 4HTJA 3KG0A 2BYCA 5KA7A 3D28A 2IPOB 4LMZA 1JNZB 4CRJA 1GH8A 2EXUA 4S0MA 4LF8F 3S01A 2VBXA 3L7OA 2IY5B 1K0VA 2KN4A 1D8ZA 5GVQA 5LXRA 2B9YA 2XWXA 3P5BP 4ZCMA 1VRTA 1N5YA 1S77D 4KO0B 2GHVC 1I51B 1WELA 1YRUA 4X65F 2FZKB 4LFAF 1FX4A 2JDJA 3KLEB 1V3ZA 2MDAA 5BJRA 4ZLPA 5KFHA 4RI5A 1AT1B 1SL1A 5KFBA 4GE2A 5HP1B 4KY3A 1EB0A 2VFRA 4OJGA 4F02A 4I69A 3ILIA 3WX4A 5I3UB 4E8UA 2VBWA 3ET6A 5IZHA 3QYYA 2F9JA 3IGNA 1TL5A 3HVTB 3MI7X 3KXDA 2HVIA 2G59A 1PYSB 3KDNA 4LVOP 3CJ4A 1BC6A 9ATCB 2D74B 5KTQA 4OI1A 1AZSB 4KGMA 3TYTA 2EG1A 3M6WA 3SCLE 3ZM1A 4YB5A 4DPUA 2RKIB 1V3RA 3AXMA 5ETRA 3THPA 3IP0A 1OMSA 1FEEA 4PAAA 5KFDA 1KHVA 2DGXA 2X3GA 3QSIA 3HKWA 3D3CJ 5D4OA 2CIMA 4KSEB 1RTHB 2AX1A 2VG7A 1S5ZA 5DO2A 3GJQB 4P10A 3DXBA 2QA4G 4C11A 2R7WA 1GNKA 3LP2B 2JEJA 4LRAA 3G87A 1RQ0A 4MFBB 2HC2A 1RAFB 2LMIA 3GILA 1TVRB 4WBFA 2I6IA 1N54B 2UUBF 2JFHA 1KQFB 3FCWA 4CLYA 1ZH5A 3QRQA 5F0UA 2EVZA 4JV5F 2OI2A 4NYZA 3ZL8A 2B51A 3JQMA 2F6FA 2H5JB 1TUGB 4TKTA 3ICLA 4Y2KA 1VRQC 3PKYA 4DV4F 2PI7A 3KLHB 1MN7A 3OSPA 3EMTA 1D09B 2VONA 4X4TA 4ZVSB 1OY9A 3BR8A 2QBQA 3DOLB 5HBMA 2Z8QA 2VH7A 3VVUA 3T6BA 1E8CA 2HGMA 3U96A 4OLOA 2KL8A 1GMUA 2CJAA 1VQ9S 5D15A 4OHVA 1WHYA 4OYXA 3ZZOA 3OXGA 1SC4B 3FRYA 2AJ4A 3JTOA 4ZPAA 2HS3A 3I4PA 4JI0J 4LSNB 1LOUA 3DDNA 4ZMMA 4ZI4A 4USJC 1Y00A 4CI0B 3PRVA 2R7TA 2ZWOA 2YWWA 1GMWA 1DAXA 3MPDA 3O8WA 3QCBA 3QO9A 2VJVA 4F0MA 4WFAQ 3D68A 3J80Y 3V0HA 4BC7A 1WG4A 1F0XA 3WQPA 1U1RA 1HQUA 1RHMB 3I5CA 3T9ZA 2G0IA 2A8BA 5DQHA 1RTJA 5CCLA 2K1RA 5GAHU 4JV2A 1T9YA 4DV6J 1CJKA 1CJUB 2R0BA 2AYEA 1M5SA 1RHKB 3BV8A 2WBRA 4NLUA 2VQEJ 4M63A 3EZ5A 2JOQA 3CWEA 4LFCJ 4NX8A 4I4BA 2K2PA 1Q6JA 4DPOA 1NJZA 3V0JA 1XM2A 4GWFA 2OTLS 3VAMA 5B0EA 2BJ3A 5A76A 3L9ZA 5C2CA 4F0HA 4XPEA 2DEJA 2I5JB 4TQRA 4QF5A 4NXNJ 4Q0BB 3W63A 2CMAA 2VORA 5ETMA 4ECUA 2AYGA 4U8VA 3BLUA 1PJ6A 1TL7B 3ZNUA 4PG5A 4TU7A 2DEIA 5JVGQ 2AM1A 1P9QC 3JXOA 5IV4A 2POKA 2N7CA 4R8UB 3X1LB 1HWIA 3GYXB 2LVWA 1I94F 2LDIA 4FF4A 1I1GA 5F8IA 3T6JA 1PKUA 3EICA 4OL8A 1RWWB 3TNVA 2RUGA 4B3TJ 1E6YA 4C7QA 1YI2S 1Q82T 3CULA 1T7PA 1KNZA 2PA5A 3KMQA 4MYTA 4IOAQ 1B0TA 4HACB 2V8PA 3QFHA 1IR0A 3A8KA 1FKAF 2K3IA 1C4CA 4J9PA 4ED7A 2XYGB 2R7RA 2DVIA 2C2KB 2PBNA 5F8HA 1GMWD 3NWRA 3TRGA 2XZTB 4Y2AA 2E9RX 5K9VA 1RTZA 5AE2A 4ECXA 1B70B 1Y5NB 2XNQA 2RQ4A 4URQU 2HWHA 4N41A 1X60A 3K57A 5JXSA 5AXNA 4WZQA 1HBNA 3F99A 4DUZJ 1S6PB 4DR3J 1DQ8A 4DUTA 3I0RB 2QL9B 2ZWPA 3KKFA 4A8QA 3UN3A 5GAGU 3ONQA 1RYRA 2HHPA 3MR7A 4UAGA 4JV1A 1RTDB 4NLDA 1S1XA 4LF7J 5HVGA 5DG9A 3DKDA 1Q6TA 2PEBA 3MR3A 3QJPA 3NGRA 4CZCA 2Y0BB 3WHIA 2JVRA 5C42A 1GMVA 4ES2A 1JJ2R 3MEEB 4YN3B 2HZCA 2A3KA 1P6TA 2GIRA 3CC4S 5AXMA 2DGVA 2FJMA 3MD3A 1WHWA 3HSZA 2J7WA 3DYAB 2ZH3A 3P6YC 1UWBB 3IBWA 1FTRA 3EZZA 3OLBA 4R5PA 4JI2F 2IA0A 4NX9A 4Q7AA 3PYEA 4RW8B 1QY7A 4C97A 2BDPA 2JX2A 5HQLA 2CNGA 2AYMA 4G1QB 3PX0A 2HQFA 3FEZA 1B99A 5D0EA 1LARA 5KFXA 2X1BA 1OY6A 2F8MA 1FFGB 1V9OA 5C24A 1Z1ZA 1XNQF 1WC6A 3CDEA 1SIWB 2EBGA 2CJQA 2L48A 1Q5VA 3NMAA 1S97A 3VGSA 4ID8A 4L74A 4IOBA 1SJRA 2VA2A 1UP1A 3QWUA 7AT1B 5BZXA 2HWIA 4DZDA 1PA1A 3MPUB 1UJ6A 2CPXA 1VRTB 2AF6A 2I0XA 1UAGA 1NK9A 3ITHB 2ADCA 1UVJA 4C3LA 4O3OA 1NK6A 5MAOA 2HK2A 1HPZA 1TFWA 5D6GA 3KG4A 3UVJB 3D1OA 2Z57B 1NUEA 3KJNB 3KK2B 2MY8A 1VMBA 1ZAXA 3EMUA 3MXHP 4RBTA 2VDHA 4V19J 3TVKA 2Y1LB 4Y3CA 3IM9A 3D9CA 1R6YA 3T5KA 3GSDA 1R0CB 2Y66A 2OSQA 1VQ5S 2XZDB 3M8WA 4UUWA 4QW8A 3O1LA 3JTPA 2DGTA 3FBFA 2J7KA 3H20A 1YBTA 5IT9U 4X4NA 4ZP6A 4DSKA 3MMBB 2MJUA 4GMKA 4DU7A 4IKCA 5G0RA 4WXOA 3GFXA 2QFJA 3M1VB 1KRPA 1S4FA 3ENQA 3IR6B 2DT9A 1RXDA 1HBMA 3OR1B 1HWKA 2ZZMA 5HMYA 4RU9A 3A4TA 3CCQS 5L1JA 3CCTA 4CLKA 4K5SA 1WTFA 2XO7A 5BYSA 2ZKUA 2DR6A 5EGYA 4N8OA 4B02A 4ZVOB 3FDSA 4CLZA 2J9DA 3G8TA 4ZCLA 3P8BB 4UQTA 1LW0A 1M3GA 2L9DA 2JSXA 2OEKA 2CZ9A 4E98A 2QIFA 2Y0SD 4ETZA 5KA2A 2BQ3A 3ZV2A 3DFEA 4RH9A 3G6YA 3BRHA 2RJZA 1O51A 1TV6A 3K5MA 3KTQA 3UR0A 5LOQA 2UZAA 1ZYQA 4QBEA 2LDYA 3M6UA 1K73T 4ZRTA 2ZH8A 3JQKA 3AD9C 1U2FA 2MKJA 3HHLC 3VAHA 1EKRA 2DKOB 4WZMA 5LM7E 4K0KJ 2FLOA 4R30A 2HK3A 4USTA 1F60B 1VS3A 4OHEA 1BZJA 2J6TA 1YLXA 1D9FA 2EFPA 4O4GA 2M88A 3V0IA 2PE8A 2DH8A 2DY1A 2DNOA 5JMNA 3OFGA 1OEVA 1T03A 1WOSA 3DOMB 1FJGF 3G82A 4H54A 2UXDJ 2MY7A 3KYLA 3TAMA 2VG5B 2NXJA 2UVRA 4A46A 4QWEA 5KFNA 1G4CA 2C42A 1NZ8A 5D0HA 1WAXA 4DV2J 3DN9A 1WG5A 5J2NB 1T9WA 3EJMA 1SV5A 2F8HA 2C3YA 2IM1A 2FJAB 1EQ0A 3RB6A 2F3JA 1HQEB 4ZPCA 2I4GA 3TVZA 2HURA 3GPAA 1DLOA 4LFBJ 2XMAA 3IM8A 1UA1A 3CCMS 1O5JA 4X2BA 2KRRA 3TX8A 3CF5Q 4OHHA 2RQKA 1KVIA 2D41A 2XS2A 1J5EJ 1VBKA 2QJ3A 1RYSA 4G1PA 5M2RA 5K8PA 1FRLA 1WRMA 2LXUA 3GZ7A 2O5DA 3GIRA 2HBQB 1U1QA 1HQUB 2P9CA 4KYRA 2JFDA 1WSVA 2V4RA 2F71A 4Q2LA 4YR3A 2HS4A 2CJKA 1TKZA 1T9VA 5FLXU 1TU0B 1CJKB 4QUMA 2ZNYA 1FRIA 4B3SJ 3DXSX 1REGX 3W9HA 1C0UB 5ETLA 1JLAB 4F3QA 2FJDB 3OTDA 1RXOB 1YJ9S 2HEKA 2E1MC 4YHHF 2F6WA 2JNJA 1RT7B 2AJ0A 2ZE2A 5H1SV 3TEGA 4F3OA 5IM0A 1YBAA 2ZH2A 4TLQA 4Q8EA 2H4VA 1PBUA 2BBEA 1NKBA 3W2VA 2NTAA 5FD1A 4LFAJ 3BQ0A 4A8KA 3FJ2A 4A8MP 3NOCA 3FSYA 4PZVA 2YX1A 3ZM6A 2BQUA 2UVUA 5KFYA 1U7LA 5J2PB 5KADA 3VAGA 3QT5A 4J9RA 4ZVRB 4CTAA 4BS2A 3EGWB 3E01A 4U7UK 2DD8S 4G1IA 4OX8A 1U6FA 2VD3A 3I31A 4PQAA 2OFHX 5CH7B 4IFVB 5GAHI 1A0OB 1SC6A 3EGZA 5ITHA 4PR6A 4WYWA 3MMAA 1FA0A 1RT2A 4EFAC 5GADU 4K7QA 3MUVP 1S1VB 2B4UA 4TN2A 2XMMA 1UEVA 3QIPB 2CDQA 1WC0A 2FB0A 3TOQA 4CO5A 3IWNC 1FVQA 4M5IA 4DUYJ 1VQLS 4ANEA 4EBDA 3Q22A 4ZITA 2KYXA 3MDFA 3L7PA 1FD8A 4C0HA 2ZHBA 3H5XA 2F70A 4XAKA 4NWGA 2LLZA 2YNFB 3M8YA 4UF4A 4DPXA 4M5DA 2CDRB 5M43A 3UCGA 3R1HA 1AROP 3VAKA 4P7TA 3J7Z5 2QO3A 3N6LA 2DRBA 3PW5A 2YX7A 2DNYA 2LU2A 3HHLA 3DMJA 4ES3A 1IBMF 2BJ1A 1DY3A 5HROA 2XYPB 1ZTWA 1NDKA 2C2DA 4KC5A 4DCPB 1CJVA 1S0NA 4DN0A 1GXUA 4QYZJ 2FLNA 1XEZA 4WFBQ 3BGLA 3T9NA 2UUBJ 2XHWA 2AV5A 3DLEA 3DLGA 2FZGB 1ULRA 2MSTA 4OJHA 5JVHQ 2LKZA 3KWMA 1W7WA 3JTNA 1SJ3P 2OJ3A 2B56A 2XLKA 2G2ZA 4DV4J 4KRWA 4B3RF 2AHSA 3IG1A 4RUAA 3S4OA 3H8YA 4M5MA 4UOGA 1JKHB 3CDUA 3DM2A 2YKPA 3MM5A 5CD4H 2YNHA 1UEKA 3NWGA 1FI4A 4DV1J 1OQ6A 4A47A 2HS0A 3M4XA 1S57A 3KG1A 1C4AA 1WHVA 2DHAA 5JUMA 3GONA 3M32B 4YR2A 1BY9A 2QA1A 2W2NP 3G2XA 5KFKA 4HJPA 4ER8A 3R3TA 1R6VA 2DNRA 2IVMA 3UQSA 3ZTRA 3OLAA 2ZC4A 1LWXA 3OT9A 4YOEA 3TUPA 2RUSA 3QCLA 3J7ZT 3UNGC 1PG5B 3H90A 2VUGA 5J1PA 5IT9Y 4X4UA 3ZXWA 2WW8A 1OETA 1S9GA 4DOZA 2MQQA 3JYTA 3JSRA 5B0AA 2EG2A 2RRNA 1N48A 4QWAA 2IRXA 1XTZA 5KFGA 2KI2A 2BKOA 3LPEA 5HQ8A 4N56A 3LH2S 3C6UB 4XK8C 4DCOB 1RPMA 1PC5A 3NL0A 2IAJB 4D3GA 5D3GA 3OR2B 3MFHA 2Y3YA 2V9KA 3MR2A 2QDMA 4MTPA 1N5QA 4DQSA 4RW9A 2BMBA 4EYIB 2D69A 2VF3A 4ZIYA 2DNKA 2IM3A 4KKOA 4X66F 4BJOA 1B3TA 3LQVA 5EUHA 1T9TA 2PT0A 1L3TA 3W61A 1X4HA 2OPSB 3D6FB 4PEOA 4BUCA 2NPFA 4FS1A 1PC4A 3K17A 3I82A 3V6JA 1ZCLA 2BUNA 1UW4A 5F3TA 4DQIA 1T9XA 4IRKA 1F5BA 2H4KA 2CVIA 1U09A 2RS8A 1I94J 3BDEA 4J7CA 4KYZA 1LW2A 5HLFB 4AT1B 3W65A 2CAJA 2JC1A 4X64J 4DGPA 2KB2A 4I6YA 3CJ0A 1JF7A 4YUDA 1VQMS 2KDOA 3A5KA 2F40A 2DR9A 2BW7A 1Q6MA 1AA1B 4DV5F 1FKPB 2LQ5A 3J81j 3CB4A 1N34F 2P8IA 2H04A 3BO2A 4DSFA 5KFMA 3FFIA 3IC1A 4H4OB 4FXWA 4HKQA 3L95X 4OHDA 1HD0A 1PILA 4OX7A 1X5TA 5DGBA 3I5AA 5KG7A 2MQNA 2WK4A 4FYYB 4CVKA 5HMZA 2DXDA 1RJJA 4WIIA 2MGZB 3MEDA 3W5YA 1YQHA 1H2TZ 3OTOJ 3BH6B 3QGIA 4YQWA 3CDAA 1ITPA 3DLBA 3CCJS 4WKYA 4WTOB 1PO6A 3BDPA 1B4SA 4RNMA 1VK8A 3G82B 4M1KA 2PSZA 3ISZA 4PVGA 2BKPA 2X3DA 2XCPA 1GX6A 1SI9A 4K4YA 3TR5A 1U25A 3ZTOA 4O3SA 1W25A 4C12A 2J17A 4PYDA 5CYMB 4H4MB 3HVRA 1S6QB 1M90T 1VQYA 2YQ3A 4NOHA 1IKVA 5FLXY 3KK3B 3GIKA 5IT4A 2GV1A 3QBCA 2OH2A 4Y00A 2XGPA 2GS8A 4JI2J 5I42A 2C3MA 1A9NB 1DQAA 4N47A 1KFSA 4QAPA 1URRA 1T02A 3QCDA 3UD5A 5DLGA 1RWOB 3ENVA 1F5CA 2XPCA 4NLRA 3BKUA 3M2UA 5K8NA 3DC2A 5KACA 1N32F 4LBPA 3NGSA 4EK2A 2E1CA 5KA0A 4O0IA 3Q89A 2H03A 1Q5YA 4OX9J 2OPQB 1VQ4S 2O01C 5A8WB 1FHTA 2DNQA 1XNQJ 3PTWA 4LF9J 2RAQA 2OP5A 1UEUA 2VZ9A 2YKNB 4DR5J 3KHLA 3VAIA 3NNCA 2HG4A 4NYOA 3LALA 2C2MB 1EEHA 1PTTA 2ERRA 2I2YA 4JI8F 4KBIA 4FVMA 2RRBA 4DLGA 2Z56B 1JJCB 1V5IB 5ETOA 3CJRA 4J9VA 4UY85 4RWXA 2CQBA 2V8DA 5E5NA 3V5RA 2BACA 1KFDA 2FLPA 4LBHA 1RAHB 2G0JA 5DDQC 5HVHA 2BRKA 2JZ5A 5LL6d 1AAXA 3C6TA 1NNYA 5EHRA 1AFJA 4GKJF 5MMZB 3B8HA 2QMUB 3MURP 4RHGA 3WDOA 3CUNA 4WP9A 1OSDA 4F0KA 3MR6A 2LEAA 1UW9A 1OEMX 4HRFA 4ICLB 3O6QA 4ZJOA 3K8VA 2K8GA 2B6AB 5C5JA 1RBLA 5K24A 3OTCA 4AFFA 4ZVFA 3F9BA 1VBZA 3KK1B 5ETTA 1J4XA 4I2QB 1RA6A 3WIVA 5A2QU 2OPRB 1IQZA 4RBVA 2F4FA 3SEOA 1YWXA 2OKQA 3IMQJ 3C2PA 3H5SA 3EYZA 3HVWA 2QYGA 2EKNA 1DFDA 3HT3A 3UI3A 3I6PA 2UUOA 2KFNA 4U8YA 1OHDA 1GXTA 3KNGA 1CPZA 2GIQA 1S59A 2CNNB 4CLTA 3CC2S 4YB7A 3N0AA 1EIYB 4OLPA 5L8RC 2XS7A 4K2XA 1DURA 4W90B 1FCAA 5E3CA 1KLNA 2B9XA 1LWCA 2CPHA 2HHSA 1PTVA 2J16B 1YTYA 3GV5B 5CYQA 1XMBA 4FXDA 3HHLB 2XS5A 3EU0A 3RU0A 3IRWP 3SV4A 3DRPA 1BQNA 2J5AA 1UCNA 4DMZA 1S1TA 3I9ZA 3FSXA 3DOKA 4P75A 2RDIA 1FPZA 4CH7A 1Y3JA 1I9TA 2MZSA 1AYEA 1KTVA 3QNWB 1CBKA 1LQFA 2L9NA 5IC6B 5T7LB 1Q8BA 3K5OA 5DETA 4WFYA 1AUSL 2MLXA 1VC0A 2HYIB 4M5LA 2Y8WA 4OYZA 2CWXA 4A8XA 3H4BA 5H9EK 1RLDA 4NL5A 2WVDA 1FJGJ 2EEYA 4C3MA 1ZM2A 1ZA2B 1A6LA 2W9CA 4Y34A 2HHVA 4RPFA 4F3MA 3C46A 3N0VA 4WFXA 2Y2FA 2IRYA 3MM5B 2ZITA 4DL3A 1LWEA 1NK8A 2RD5C 1VFJA 1JK9B 1RT1B 2YKOA 3J7AN 4DR7F 1TFYA 1B0VA 1TKTA 4BHQA 2MQMA 3QCGA 2HVLA 4J91A 2YKMB 4P9SA 1KQKA 4DL4A 3I56S 3H40A 1BWEA 3QPIA 2LA6A 5IQ6A 1QVFR 5B0FA 4NMXA 4OFZA 1P9YA 3MM8B 2GVDB 7FDRA 4WP8A 2KRBA 4B9TA 1S12A 9RUBA 3HDSA 4ITSA 3AD8C 2JEIA 2GC6A 2YY3A 1R8BA 2IYIA 2YKAA 3IO1A 5KFCA 4C8ZA 4PPDA 3ULHA 1RWVB 2LQ9A 4TVVA 2DGUA 1S9GB 3TAPA 2HVHA 1U02A 4YY3F 2MB0B 2W8LA 2L08A 5IT0A 1F9EB 3TA1A 2XSFA 3M2VA 2ALZA 1IR2A 3EGVA 4YAAA 3ZZPA 4I8NA 4K4WA 3DDKA 3PYFA 4ED5A 3VQSA 1MROB 3FQKA 1EETA 3FQLA 2V68A 1SJQA 3G6XA 5CZVA 4D3PA 4YHHJ 2OELA 2U1AA 3T1YJ 2I75A 2D9PA 3B82A 2YWEA 3PHTA 7FD1A 3MM9A 5M2PA 4FYXB 2JHEA 2DK2A 1OQ3A 3DI6A 1NSKL 4BPCA 3EWGA 2BE7D 5EWGA 2YX4A 5E3RA 1VQ7S 1FQ1A 3U27A 4CLWA 3FMWA 2YXLA 4CVLA 5CA5A 1YRXA 5KA8A 2P6SA 3K58A 3WBZA 4K4XA 1M5PC 4DS5A 2YQ0A 4RJVA 3IA0A 1WJ9A 4UUXA 2GX8A 1KONA 5KT5A 3JSYA 4I1TA 5J1EA 1X4GA 2VQFJ 1LYVA 1NSPA 4ZPDA 2XZWA 2B7CB 4F4KA 2OFGX 3NGKA 2AX0A 2V67A 4CT9A 3VGUA 4ETXA 3PFEA 4KH1B 1LK7A 5A8RA 4HYKA 1M1KT 4PPZA 3JAMU 1RT6A 3QT8A 5DG7A 3PW0A 4ECTA 3BR9A 3FCHA 4QBUA 2CA9A 3TEHB 4DSEA 3CSKA 2HQ3A 2AEFA 3ZO7A 3B54A 3LUYA 3QSYB 4O3QA 2KZZA 1FE4A 2XJAA 3MFIA 2X5OA 3UAGA 4QR1A 1HFEL 4ED4A 2W1BA 4TY8B 2HNZB 2UUWA 1SQEA 1NB7A 1WC3A 2C2EA 4KJIA 3G4SS 1QE1B 4USUA 3HX9A 2VV5A 4NRTA 4R0JA 1YZ6A 3DRRA 4K4UA 2AMCB 3D7SB 1TK0A 4K5RA 3T19A 3DU5A 2IMGA 3D4JA 2ZN7A 4KGZB 3C16A 3I96A 5SUHA 4AUKA 1X8DA 3I0SB 2KZMA 3QCHA 1RP5A 4DR1J 2VTEA 1KC8T 2J0XA 3G6ES 3EVMA 4Y2CA 2RHQB 4EBCA 1FRHA 4FYDA 1TMJA 2R2SA 3HKZD 1H6KX 1GG4A 1EQMA 4ZKAA 3EPGA 3P49B 2ESBA 2DTJA 1F5AA 3A5JA 2I42A 4IDKB 3M9NB 2XB2D 1K44A 1ZM9A 3MF5A 3NLCA
chains in the Genus database with same CATH topology
5KG0A 3X1LB 4ZVEA 1HWIA 2FC8A 2VOPA 3GYXB 1YJUA 3RBDA 2HIQA 2DHGA 3ZZRA 1WG1A 2IJNA 2LVWA 2L3MA 3NS5A 2I38A 4K59A 1JLBA 2CZ4A 2GMLA 1R6HA 1I94F 5K8OA 2VL1A 1G1FA 2LDIA 4CT8A 4FF4A 1HI1A 1I1GA 4QWCA 5F8IA 1KLMB 3T6JA 1VQPS 1ZTTA 3Q8PB 2YVSA 3BF4A 4OL8A 3TNVA 2FDNA 3THVA 2CYYA 3RB4A 1Q8IA 1WTBA 2RUGA 4EGLA 1GQEA 1IJEB 2VKRA 1E6YA 2R7XA 4C7QA 1YI2S 1Q82T 3CULA 1T7PA 1J5OA 4ZS6A 3D54A 3OUYA 1KNZA 3OVAA 2PA5A 2DR8A 4EO6A 4WK3A 2L41A 4ED3A 3KMQA 4MYTA 2R7OA 2XMKA 3PEJA 4OV1A 4OZJA 3KJVA 4IOAQ 2FD2A 2HHTA 3F81A 2NQPA 3PDNA 4RKUC 5J2QA 2Z4PA 1S6PA 1B0TA 3I0RA 1NJWA 1KN6A 3TVYA 1NJXA 2IFXA 4QQBA 4OMFG 1ZPWX 2OLWA 4CO4A 1IR0A 1X4CA 4ERCA 4ECVA 2AGOA 1TL4A 3HHDA 1OEUA 3PW7A 1RTDA 3CCWA 5LXYA 2K3IA 1FKAF 4C9DA 1C4CA 3V0DA 1M5HA 1OWXA 4C3KA 1U24A 2QBSA 4GS0A 4J9PA 4ED7A 1C2PA 1S72S 1VJWA 2J0QD 3MUTP 2I1YA 2R7RA 2DVIA 2W9BA 2BV3A 2FJWA 2UVWA 2Z0GA 2HWTA 2PBNA 5F8HA 1S1UA 4ILLA 3TRGA 1L3SA 3MEEA 3V6DA 4Y2AA 5IS2A 3OJSA 2J9EA 1PSDA 3RW7A 2E9RX 5K9VA 4RUCA 5AE2A 3GWCA 1X0FA 2P9EA 4ECXA 4A8WA 1Y5NB 1E6YB 2XNQA 2OAUA 1Y0HA 1LXNA 2H9ZA 2RQ4A 4URQU 2HWHA 3N79A 4I68A 3DYAA 3N01A 3OUYB 4N41A 4KI9A 1RA7A 2BJEA 2MKIA 3K57A 2VQFF 2RNEA 1HNIA 4QPXA 5JXSA 3KJVB 3HLUA 5AXNA 2QDMA 4WZQA 1HBNA 2RU3A 2BIJA 3MM7A 3F99A 5J2QB 1UWBA 2M70A 3I87A 1S6PB 1DQ8A 3SV3A 1XWLA 3I0RB 2ZC3A 1XMQF 3KKFA 1AFIA 2B5JA 4A8QA 2DHSA 2ZBIA 1QVGR 3SSQA 4HLBA 2DNMA 5GAGU 1NZAA 3ONQA 1RYRA 1SKRA 1FRKA 2HHPA 3RTVA 1NKCA 4JV1A 4RW8A 1RTDB 4K4SA 4DS4A 5C25A 4NLDA 3WC2A 4PXEA 3I5BA 1FO1A 1S1XA 2D3UA 2GW8A 4NZ7A 2M7SA 4M8LA 2CPZA 5KFAA 3U1MA 2RQMA 5DG9A 5DDPC 3H5YA 1Q6TA 4Q5VA 2W9BB 2B3OA 3MR3A 1S0OA 3QJPA 1X9WA 5B7WA 4CZCA 5F8LA 2NSBA 4BWMA 1S1UB 2JVRA 5C42A 2XMJA 3BSOA 4QAHA 5A8KA 4ES2A 1JJ2R 3B4DA 3MEEB 2HZCA 2A3KA 2KXNB 2Y1IA 2EW9A 1P6TA 2GIRA 3CC4S 5AXMA 2I3RA 2DGVA 3K8WA 4Z37A 1SJ4P 3MD3A 2VC1A 2FJMA 3V0GA 1WHWA 3K7RA 3QWPA 2FJXA 3CE8A 2J7WA 1P27B 3DYAB 2ZH3A 2QLWA 3P6YC 1HNIB 1HBNB 2LEPA 3K5LA 2EK1A 4K4VA 3AJ1A 4TXSA 5KFSA 4IO1A 1UWBB 2QMXA 3S3HA 2BR0A 3QMQA 1S7HA 2LU1A 3OL6A 4ECQA 4EEYA 3CD0A 1N8RT 2B5JB 3IBWA 3X3UA 1DJ0A 1NK4A 1FTRA 3TAQA 4Q8FA 3EZZA 4LFCF 3OLBA 3R1LA 4NLYA 3TO8A 2HFZA 1REVA 4R5PA 4X4OA 4JI2F 2FIUA 2IA0A 4NX9A 4Q7AA 1WEYA 4C8MA 4RW8B 1QY7A 3NCPA 4MK9A 4OHZA 4C97A 1FNOA 2BDPA 1BZHA 2CM8A 1Q79A 2RRAA 4UY8T 5C25B 1R8AA 1V3SA 1TL3A 3HFKA 1N5SA 2JX2A 4ELTA 4FBUA 1S1XB 4I6WA 4NCGA 5B0BA 3N5BA 4TU8A 1KS2A 2OO4A 2M4MA 2AYMA 4Y2IA 2CNGA 5LSLA 1MMDA 4NWBA 2ZJPQ 4G1QB 3PX0A 1NEEA 5EWFA 5C42B 2DR5A 3B7OA 4MYUA 5A8KB 3FEZA 4JI3F 3SI8A 1EP4A 5KFXA 4ED0A 4KTQA 2DPIA 2X1BA 1LARA 2F8MA 4XPCA 5AE3A 4DL2A 3BN4A 3ZM0A 3PFOA 1V9OA 4DR1F 1Q81T 3QCMA 5C24A 2LQBA