1DD6A

Imp-1 metallo beta-lactamase from pseudomonas aeruginosa in complex with a mercaptocarboxylate inhibitor
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
216
structure length
216
Chain Sequence
LPDLKIEKLDEGVYVHTSFEEVNGWGVVPKHGLVVLVNAEAYLIDTPFTAKDTEKLVTWFVERGYKIKGSISSHFHSDSTGGIEWLNSRSIPTYASELTNELLKKDGKVQATNSFSGVNYWLVKNKIEVFYPGPGHTPDNVVVWLPERKILFGGCFIKPYGLGNLGDANIEAWPKSAKLLKSKYGKAKLVVPSHSEVGDASLLKLTLEQAVKGLNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IMP-1 METALLO BETA-LACTAMASE
publication title Crystal structure of the IMP-1 metallo beta-lactamase from Pseudomonas aeruginosa and its complex with a mercaptocarboxylate inhibitor: binding determinants of a potent, broad-spectrum inhibitor.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Hydrolase
total genus 64
structure length 216
sequence length 216
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 1999-11-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 1dd6A00
1XM8A 1WUOA 4PVTA 1VMEA 1VJNA 4UAMA 2R2DA 2M5CA 3SFPA 5AXRA 3DH8A 2QEDA 3ESHA 4BP0A 4D1TA 4RM5A 4YSKA 3BK1A 2BR6A 4NQ2A 4Z67A 4XUKA 5HIQA 4CHLA 3PY6A 1KO3A 3P2UA 4RL0A 4AWYB 2Y87A 5EH9A 4D1VA 4XWWA 2WHGA 5ACSA 5FQAA 1JJEA 4RBSA 4U4LA 3DHAA 2WYLA 3TP9A 3WXCA 3RPCA 5HH5A 2GFJA 5HISA 1ZKPA 3IE0A 4EYBA 1DXKA 1DD6A 4ZEJA 5LMCA 3IDZA 4GYUA 5LS3A 1YCFA 4EFZA 4PVOA 4C1GA 2NYPA 4AWZA 3JXPA 4DIKA 4C1FA 3ZWFA 1XTOA 2YNTA 4C09A 4C1CA 3SRXA 3DHBA 4AX1B 3MD7A 2QDTA 1JT1A 4JO0A 4TZEA 5B15A 5EW0A 4NQ6A 4XWTA 4HL1A 3PG4A 4Z60A 5LCAA 4F6HA 2YNTB 1YCGA 5HIOA 3T9MA 4Z7RA 5LLDA 3RKKA 2XF4A 2H6AA 4BZ3A 2BG8A 4Z5ZA 2BMIA 3IOGA 3KNSA 2DKFA 2WYMA 4RL2A 5DPXA 1A7TA 3IE1A 4NQ5A 2HB9A 3FAIA 2GCUA 4TZ9A 3ADRA 1ZNBA 4TZFA 3X30A 4ZO2A 4NQ4A 3AF6A 5ACUA 5FQCA 5LE1A 1K07A 2BFKA 1M2XA 3AF5A 3F9OA 2BTNA 2BG8B 5B1UA 3SW3A 1E5DA 4V0HA 5ACRA 1QH5A 2FK6A 2BG6A 3ZR9A 5AEBA 3IEKA 1YCHA 4C1HA 2P1EA 5HH6A 3SBLA 1SMLA 2XR1A 5EWAA 2QJSA 5EVBA 3I14A 2VW8A 4EXSA 5EV6A 1P9EA 4FEKA 2I7XA 4LE6A 4FR7A 4D02A 5ACQA 5A0VA 4TZBA 2WYMC 2Q0IA 5EHTA 2FU8A 4D1WA 3BK2A 1HLKA 4YSBA 3A4YA 1WW1A 5IQKA 5LCFA 2P97A 2WRSA 4Z5YA 3H3EA 3I15A 2AIOA 2BG7A 5HH4A 2CBNA 2GKLA 4FSBA 2OHHA 4RAMA 5LSCA 1BVTA 5FQBA 3PY5A 4ZNBA 3IELA 4KEQA 4C1EA 5AHRA 3QH8A 3SD9A 4F6ZA 4EYFA 5ACTA 4B87A 2OHIA 3S0ZA 3T3OA 2P18A 2E7YA 4YSLA 5K4MA 4UA4A 2AZ4A 1WRAA 4GYQA 5A5ZA 4WD6A 3ZQ4A 3ZNBA 1X8GA 2YNWA 2BGAA 3Q6VA 5AYAA 1KR3A 4AD9A 2YCBA 5KILA 5ACWA 5EV8A 4Z6XA 2GFKA 3IEMA 4UWRB 3LVZA 4UWSB 3VPEA 2Y8AA 2ZWRA 2Q42A 1MQOA 2NZFA 1WUPA 1L9YA 5B3RA 4C1DA 2M5DA 3X2YA 3T3NA 1QH3A 2I7TA 5A0TA 4UBQA 2YZ3A 2A7MA 3L6NA 4UWOB 1JJTA 3KNRA 5ACVA 4HL2A 2BFZA 2NXAA 5K0WA 2FU6A 4J5HA 2ZZIA 4EXYA 4KEPA 5EVDA 4EY2A 5ACXA 2Q9UA 3SPUA 1DDKA 3I11A 4UWPB 5K4KA 3I0VA 2GMNA 2YNUA 3G1PA 3BV6A 5HIPA 5AXOA 5LM6A 5A87A 2BFZB 2FU9A 2Y8BA 1ZTCA 2QDSA 3AJ3A 1BMCA 2ZNBA 4D1UA 4AX0B 2FHXA 1KO2A 2ZO4A 2QINA 5EVKA 4EYLA 1BC2A 2FM6A 2FU7A 5ACPA 4HKYA 4TYTA 2DOOA 4J5FA 3RKJA 2YNVA 2Q0JA 2I7VA 1A8TA 2BC2A 1X8HA 3X2ZA 4RAWA 3FCZA 3I13A 1VGNA 2FHXB 3BC2A 4DILA 2BFLA 4H0DA 2NZEA 3VQZA 4GCWA 5LCHA 4TYFA 5AHOA 5K4NA 2YNVB 3IOFA 1X8IA 2P4ZA 3DHCA 3R2UA 2BG2A 5KIKA 2BIBA 3KL7A 2UYXA 3X2XA 4P62A 2OHJA 4ZO3A 1Y44A 3IE2A 4O98A
chains in the Genus database with same CATH superfamily
4PDXA 1XM8A 1WUOA 4PVTA 1VMEA 1VJNA 4UAMA 2R2DA 2M5CA 3SFPA 5AXRA 3DH8A 2QEDA 3ESHA 4BP0A 4D1TA 4RM5A 4YSKA 3BK1A 2BR6A 4NQ2A 4Z67A 4XUKA 5HIQA 4CHLA 3PY6A 1KO3A 3P2UA 4RL0A 4AWYB 2Y87A 5EH9A 4D1VA 4XWWA 2WHGA 5ACSA 5FQAA 1JJEA 4RBSA 4U4LA 3DHAA 2WYLA 3TP9A 3WXCA 3RPCA 5HH5A 2GFJA 5HISA 1ZKPA 3IE0A 4EYBA 1DXKA 1DD6A 4ZEJA 5LMCA 3IDZA 4GYUA 5LS3A 1YCFA 4EFZA 4PVOA 4C1GA 2NYPA 4AWZA 3JXPA 4DIKA 4C1FA 3ZWFA 1XTOA 2YNTA 4C09A 4C1CA 3SRXA 3DHBA 4AX1B 2CG2A 3MD7A 2QDTA 2CG3A 1JT1A 4JO0A 4TZEA 5B15A 5EW0A 4NQ6A 4XWTA 4HL1A 3PG4A 4Z60A 5LCAA 4F6HA 2YNTB 1YCGA 5HIOA 3T9MA 4Z7RA 5LLDA 3RKKA 2XF4A 2H6AA 4BZ3A 2BG8A 4Z5ZA 2BMIA 3IOGA 3KNSA 2DKFA 2WYMA 4RL2A 5DPXA 1A7TA 3IE1A 4NQ5A 2HB9A 3FAIA 2GCUA 4TZ9A 3ADRA 1ZNBA 4TZFA 3X30A 4ZO2A 4NQ4A 3AF6A 5ACUA 5FQCA 5LE1A 1K07A 2BFKA 5A23A 1M2XA 3AF5A 3F9OA 2BTNA 2BG8B 2CFUA 5B1UA 3SW3A 1E5DA 4V0HA 5ACRA 1QH5A 2FK6A 2BG6A 3ZR9A 5AEBA 3IEKA 1YCHA 4C1HA 2P1EA 5HH6A 3SBLA 1SMLA 2XR1A 5EWAA 2QJSA 5EVBA 2CFZA 3I14A 2VW8A 4EXSA 5EV6A 1P9EA 4FEKA 2I7XA 4LE6A 4FR7A 4D02A 5ACQA 5A0VA 4TZBA 2WYMC 2Q0IA 5EHTA 2FU8A 4D1WA 3BK2A 1HLKA 4YSBA 3A4YA 1WW1A 5IQKA 5LCFA 2P97A 2WRSA 4Z5YA 3H3EA 3I15A 2AIOA 2BG7A 5HH4A 2CBNA 2GKLA 4FSBA 2OHHA 4RAMA 4AXHA 5LSCA 1BVTA 5FQBA 3PY5A 4ZNBA 3IELA 4KEQA 4C1EA 5AHRA 3QH8A 3SD9A 4F6ZA 4EYFA 5ACTA 4B87A 2OHIA 3S0ZA 3T3OA 2P18A 2E7YA 4YSLA 5K4MA 4UA4A 5AJLA 2AZ4A 1WRAA 4GYQA 5A5ZA 4WD6A 3ZQ4A 3ZNBA 1X8GA 2YNWA 2BGAA 3Q6VA 5AYAA 1KR3A 4AD9A 2YCBA 5KILA 5ACWA 5EV8A 4AV7A 5AIJA 4Z6XA 2GFKA 3IEMA 4UWRB 3LVZA 4UWSB 3VPEA 2Y8AA 2ZWRA 2Q42A 1MQOA 2NZFA 1WUPA 1L9YA 5B3RA 4C1DA 2M5DA 3X2YA 3T3NA 1QH3A 2I7TA 5A0TA 4UBQA 2YZ3A 2A7MA 3L6NA 4UWOB 1JJTA 3KNRA 5ACVA 4HL2A 2BFZA 2NXAA 5K0WA 2FU6A 4J5HA 2ZZIA 4EXYA 4KEPA 5EVDA 4EY2A 5ACXA 2Q9UA 3SPUA 1DDKA 3I11A 4UWPB 5K4KA 3I0VA 2GMNA 2YNUA 3G1PA 3BV6A 5HIPA 5AXOA 5LM6A 5A87A 2BFZB 2FU9A 2Y8BA 1ZTCA 2QDSA 3AJ3A 1BMCA 2ZNBA 4D1UA 4AX0B 2FHXA 1KO2A 2ZO4A 2QINA 5EVKA 4EYLA 4NURA 1BC2A 2FM6A 2FU7A 5ACPA 4HKYA 4TYTA 2DOOA 4J5FA 3RKJA 2YNVA 2Q0JA 2I7VA 2YHEA 1A8TA 2BC2A 1X8HA 3X2ZA 4RAWA 3FCZA 3I13A 1VGNA 2FHXB 3BC2A 4DILA 2BFLA 4H0DA 2NZEA 3VQZA 4GCWA 5LCHA 4TYFA 5AHOA 5K4NA 2YNVB 3IOFA 1X8IA 2P4ZA 3DHCA 3R2UA 2BG2A 5KIKA 2BIBA 3KL7A 2UYXA 3X2XA 4P62A 2OHJA 4ZO3A 1Y44A 3IE2A 4O98A
chains in the Genus database with same CATH topology
1XM8A 1WUOA 4PVTA 1VMEA 1VJNA 4UAMA 2R2DA 2M5CA 3SFPA 5AXRA 3DH8A 2QEDA 3ESHA 4BP0A 4D1TA 4RM5A 4YSKA 3BK1A 2BR6A 4NQ2A 4Z67A 4XUKA 5HIQA 4CHLA 3PY6A 1KO3A 3P2UA 4RL0A 4AWYB 2Y87A 5EH9A 4D1VA 4XWWA 2WHGA 5ACSA 5FQAA 1JJEA 4RBSA 4U4LA 3DHAA 2WYLA 3TP9A 3WXCA 3RPCA 5HH5A 2GFJA 5HISA 1ZKPA 3IE0A 4EYBA 1DXKA 1DD6A 4ZEJA 5LMCA 3IDZA 4GYUA 5LS3A 1YCFA 4EFZA 4PVOA 4C1GA 2NYPA 4AWZA 3JXPA 4DIKA 4C1FA 3ZWFA 1XTOA 2YNTA 4C09A 4C1CA 3SRXA 3DHBA 4AX1B 3MD7A 2QDTA 1JT1A 4JO0A 4TZEA 5B15A 5EW0A 4NQ6A 4XWTA 4HL1A 3PG4A 4Z60A 5LCAA 4F6HA 2YNTB 1YCGA 5HIOA 3T9MA 4Z7RA 5LLDA 3RKKA 2XF4A 2H6AA 4BZ3A 2BG8A 4Z5ZA 2BMIA 3IOGA 3KNSA 2DKFA 2WYMA 4RL2A 5DPXA 1A7TA 3IE1A 4NQ5A 2HB9A 3FAIA 2GCUA 4TZ9A 3ADRA 1ZNBA 4TZFA 3X30A 4ZO2A 4NQ4A 3AF6A 5ACUA 5FQCA 5LE1A 1K07A 2BFKA 1M2XA 3AF5A 3F9OA 2BTNA 2BG8B 5B1UA 3SW3A 1E5DA 4V0HA 5ACRA 1QH5A 2FK6A 2BG6A 3ZR9A 5AEBA 3IEKA 1YCHA 4C1HA 2P1EA 5HH6A 3SBLA 1SMLA 2XR1A 5EWAA 2QJSA 5EVBA 3I14A 2VW8A 4EXSA 5EV6A 1P9EA 4FEKA 2I7XA 4LE6A 4FR7A 4D02A 5ACQA 5A0VA 4TZBA 2WYMC 2Q0IA 5EHTA 2FU8A 4D1WA 3BK2A 1HLKA 4YSBA 3A4YA 1WW1A 5IQKA 5LCFA 2P97A 2WRSA 4Z5YA 3H3EA 3I15A 2AIOA 2BG7A 5HH4A 2CBNA 2GKLA 4FSBA 2OHHA 4RAMA 5LSCA 1BVTA 5FQBA 3PY5A 4ZNBA 3IELA 4KEQA 4C1EA 5AHRA 3QH8A 3SD9A 4F6ZA 4EYFA 5ACTA 4B87A 2OHIA 3S0ZA 3T3OA 2P18A 2E7YA 4YSLA 5K4MA 4UA4A 2AZ4A 1WRAA 4GYQA 5A5ZA 4WD6A 3ZQ4A 3ZNBA 1X8GA 2YNWA 2BGAA 3Q6VA 5AYAA 1KR3A 4AD9A 2YCBA 5KILA 5ACWA 5EV8A 4Z6XA 2GFKA 3IEMA 4UWRB 3LVZA 4UWSB 3VPEA 2Y8AA 2ZWRA 2Q42A 1MQOA 2NZFA 1WUPA 1L9YA 5B3RA 4C1DA 2M5DA 3X2YA 3T3NA 1QH3A 2I7TA 5A0TA 4UBQA 2YZ3A 2A7MA 3L6NA 4UWOB 1JJTA 3KNRA 5ACVA 4HL2A 2BFZA 2NXAA 5K0WA 2FU6A 4J5HA 2ZZIA 4EXYA 4KEPA 5EVDA 4EY2A 5ACXA 2Q9UA 3SPUA 1DDKA 3I11A 4UWPB 5K4KA 3I0VA 2GMNA 2YNUA 3G1PA 3BV6A 5HIPA 5AXOA 5LM6A 5A87A 2BFZB 2FU9A 2Y8BA 1ZTCA 2QDSA 3AJ3A 1BMCA 2ZNBA 4D1UA 4AX0B 2FHXA 1KO2A 2ZO4A 2QINA 5EVKA 4EYLA 1BC2A 2FM6A 2FU7A 5ACPA 4HKYA 4TYTA 2DOOA 4J5FA 3RKJA 2YNVA 2Q0JA 2I7VA 1A8TA 2BC2A 1X8HA 3X2ZA 4RAWA 3FCZA 3I13A 1VGNA 2FHXB 3BC2A 4DILA 2BFLA 4H0DA 2NZEA 3VQZA 4GCWA 5LCHA 4TYFA 5AHOA 5K4NA 2YNVB 3IOFA 1X8IA 2P4ZA 3DHCA 3R2UA 2BG2A 5KIKA 2BIBA 3KL7A 2UYXA 3X2XA 4P62A 2OHJA 4ZO3A 1Y44A 3IE2A 4O98A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XM8 A;  1WUO A;  4PVT A;  1VME A;  1VJN A;  4UAM A;  2R2D A;  2M5C A;  3SFP A;  5AXR A;  3DH8 A;  2QED A;  3ESH A;  4BP0 A;  4D1T A;  4RM5 A;  4YSK A;  3BK1 A;  2BR6 A;  4NQ2 A;  4Z67 A;  4XUK A;  5HIQ A;  4CHL A;  3PY6 A;  1KO3 A;  3P2U A;  4RL0 A;  4AWY B;  2Y87 A;  5EH9 A;  4D1V A;  4XWW A;  2WHG A;  5ACS A;  5FQA A;  1JJE A;  4RBS A;  4U4L A;  3DHA A;  2WYL A;  3TP9 A;  3WXC A;  3RPC A;  5HH5 A;  2GFJ A;  5HIS A;  1ZKP A;  3IE0 A;  4EYB A;  1DXK A;  1DD6 A;  4ZEJ A;  5LMC A;  3IDZ A;  4GYU A;  5LS3 A;  1YCF A;  4EFZ A;  4PVO A;  4C1G A;  2NYP A;  4AWZ A;  3JXP A;  4DIK A;  4C1F A;  3ZWF A;  1XTO A;  2YNT A;  4C09 A;  4C1C A;  3SRX A;  3DHB A;  4AX1 B;  3MD7 A;  2QDT A;  1JT1 A;  4JO0 A;  4TZE A;  5B15 A;  5EW0 A;  4NQ6 A;  4XWT A;  4HL1 A;  3PG4 A;  4Z60 A;  5LCA A;  4F6H A;  2YNT B;  1YCG A;  5HIO A;  3T9M A;  4Z7R A;  5LLD A;  3RKK A;  2XF4 A;  2H6A A;  4BZ3 A;  2BG8 A;  4Z5Z A;  2BMI A;  3IOG A;  3KNS A;  2DKF A;  2WYM A;  4RL2 A;  5DPX A;  1A7T A;  3IE1 A;  4NQ5 A;  2HB9 A;  3FAI A;  2GCU A;  4TZ9 A;  3ADR A;  1ZNB A;  4TZF A;  3X30 A;  4ZO2 A;  4NQ4 A;  3AF6 A;  5ACU A;  5FQC A;  5LE1 A;  1K07 A;  2BFK A;  1M2X A;  3AF5 A;  3F9O A;  2BTN A;  2BG8 B;  5B1U A;  3SW3 A;  1E5D A;  4V0H A;  5ACR A;  1QH5 A;  2FK6 A;  2BG6 A;  3ZR9 A;  5AEB A;  3IEK A;  1YCH A;  4C1H A;  2P1E A;  5HH6 A;  3SBL A;  1SML A;  2XR1 A;  5EWA A;  2QJS A;  5EVB A;  3I14 A;  2VW8 A;  4EXS A;  5EV6 A;  1P9E A;  4FEK A;  2I7X A;  4LE6 A;  4FR7 A;  4D02 A;  5ACQ A;  5A0V A;  4TZB A;  2WYM C;  2Q0I A;  5EHT A;  2FU8 A;  4D1W A;  3BK2 A;  1HLK A;  4YSB A;  3A4Y A;  1WW1 A;  5IQK A;  5LCF A;  2P97 A;  2WRS A;  4Z5Y A;  3H3E A;  3I15 A;  2AIO A;  2BG7 A;  5HH4 A;  2CBN A;  2GKL A;  4FSB A;  2OHH A;  4RAM A;  5LSC A;  1BVT A;  5FQB A;  3PY5 A;  4ZNB A;  3IEL A;  4KEQ A;  4C1E A;  5AHR A;  3QH8 A;  3SD9 A;  4F6Z A;  4EYF A;  5ACT A;  4B87 A;  2OHI A;  3S0Z A;  3T3O A;  2P18 A;  2E7Y A;  4YSL A;  5K4M A;  4UA4 A;  2AZ4 A;  1WRA A;  4GYQ A;  5A5Z A;  4WD6 A;  3ZQ4 A;  3ZNB A;  1X8G A;  2YNW A;  2BGA A;  3Q6V A;  5AYA A;  1KR3 A;  4AD9 A;  2YCB A;  5KIL A;  5ACW A;  5EV8 A;  4Z6X A;  2GFK A;  3IEM A;  4UWR B;  3LVZ A;  4UWS B;  3VPE A;  2Y8A A;  2ZWR A;  2Q42 A;  1MQO A;  2NZF A;  1WUP A;  1L9Y A;  5B3R A;  4C1D A;  2M5D A;  3X2Y A;  3T3N A;  1QH3 A;  2I7T A;  5A0T A;  4UBQ A;  2YZ3 A;  2A7M A;  3L6N A;  4UWO B;  1JJT A;  3KNR A;  5ACV A;  4HL2 A;  2BFZ A;  2NXA A;  5K0W A;  2FU6 A;  4J5H A;  2ZZI A;  4EXY A;  4KEP A;  5EVD A;  4EY2 A;  5ACX A;  2Q9U A;  3SPU A;  1DDK A;  3I11 A;  4UWP B;  5K4K A;  3I0V A;  2GMN A;  2YNU A;  3G1P A;  3BV6 A;  5HIP A;  5AXO A;  5LM6 A;  5A87 A;  2BFZ B;  2FU9 A;  2Y8B A;  1ZTC A;  2QDS A;  3AJ3 A;  1BMC A;  2ZNB A;  4D1U A;  4AX0 B;  2FHX A;  1KO2 A;  2ZO4 A;  2QIN A;  5EVK A;  4EYL A;  1BC2 A;  2FM6 A;  2FU7 A;  5ACP A;  4HKY A;  4TYT A;  2DOO A;  4J5F A;  3RKJ A;  2YNV A;  2Q0J A;  2I7V A;  1A8T A;  2BC2 A;  1X8H A;  3X2Z A;  4RAW A;  3FCZ A;  3I13 A;  1VGN A;  2FHX B;  3BC2 A;  4DIL A;  2BFL A;  4H0D A;  2NZE A;  3VQZ A;  4GCW A;  5LCH A;  4TYF A;  5AHO A;  5K4N A;  2YNV B;  3IOF A;  1X8I A;  2P4Z A;  3DHC A;  3R2U A;  2BG2 A;  5KIK A;  2BIB A;  3KL7 A;  2UYX A;  3X2X A;  4P62 A;  2OHJ A;  4ZO3 A;  1Y44 A;  3IE2 A;  4O98 A; 
#chains in the Genus database with same CATH topology
 4PDX A;  1XM8 A;  1WUO A;  4PVT A;  1VME A;  1VJN A;  4UAM A;  2R2D A;  2M5C A;  3SFP A;  5AXR A;  3DH8 A;  2QED A;  3ESH A;  4BP0 A;  4D1T A;  4RM5 A;  4YSK A;  3BK1 A;  2BR6 A;  4NQ2 A;  4Z67 A;  4XUK A;  5HIQ A;  4CHL A;  3PY6 A;  1KO3 A;  3P2U A;  4RL0 A;  4AWY B;  2Y87 A;  5EH9 A;  4D1V A;  4XWW A;  2WHG A;  5ACS A;  5FQA A;  1JJE A;  4RBS A;  4U4L A;  3DHA A;  2WYL A;  3TP9 A;  3WXC A;  3RPC A;  5HH5 A;  2GFJ A;  5HIS A;  1ZKP A;  3IE0 A;  4EYB A;  1DXK A;  1DD6 A;  4ZEJ A;  5LMC A;  3IDZ A;  4GYU A;  5LS3 A;  1YCF A;  4EFZ A;  4PVO A;  4C1G A;  2NYP A;  4AWZ A;  3JXP A;  4DIK A;  4C1F A;  3ZWF A;  1XTO A;  2YNT A;  4C09 A;  4C1C A;  3SRX A;  3DHB A;  4AX1 B;  2CG2 A;  3MD7 A;  2QDT A;  2CG3 A;  1JT1 A;  4JO0 A;  4TZE A;  5B15 A;  5EW0 A;  4NQ6 A;  4XWT A;  4HL1 A;  3PG4 A;  4Z60 A;  5LCA A;  4F6H A;  2YNT B;  1YCG A;  5HIO A;  3T9M A;  4Z7R A;  5LLD A;  3RKK A;  2XF4 A;  2H6A A;  4BZ3 A;  2BG8 A;  4Z5Z A;  2BMI A;  3IOG A;  3KNS A;  2DKF A;  2WYM A;  4RL2 A;  5DPX A;  1A7T A;  3IE1 A;  4NQ5 A;  2HB9 A;  3FAI A;  2GCU A;  4TZ9 A;  3ADR A;  1ZNB A;  4TZF A;  3X30 A;  4ZO2 A;  4NQ4 A;  3AF6 A;  5ACU A;  5FQC A;  5LE1 A;  1K07 A;  2BFK A;  5A23 A;  1M2X A;  3AF5 A;  3F9O A;  2BTN A;  2BG8 B;  2CFU A;  5B1U A;  3SW3 A;  1E5D A;  4V0H A;  5ACR A;  1QH5 A;  2FK6 A;  2BG6 A;  3ZR9 A;  5AEB A;  3IEK A;  1YCH A;  4C1H A;  2P1E A;  5HH6 A;  3SBL A;  1SML A;  2XR1 A;  5EWA A;  2QJS A;  5EVB A;  2CFZ A;  3I14 A;  2VW8 A;  4EXS A;  5EV6 A;  1P9E A;  4FEK A;  2I7X A;  4LE6 A;  4FR7 A;  4D02 A;  5ACQ A;  5A0V A;  4TZB A;  2WYM C;  2Q0I A;  5EHT A;  2FU8 A;  4D1W A;  3BK2 A;  1HLK A;  4YSB A;  3A4Y A;  1WW1 A;  5IQK A;  5LCF A;  2P97 A;  2WRS A;  4Z5Y A;  3H3E A;  3I15 A;  2AIO A;  2BG7 A;  5HH4 A;  2CBN A;  2GKL A;  4FSB A;  2OHH A;  4RAM A;  4AXH A;  5LSC A;  1BVT A;  5FQB A;  3PY5 A;  4ZNB A;  3IEL A;  4KEQ A;  4C1E A;  5AHR A;  3QH8 A;  3SD9 A;  4F6Z A;  4EYF A;  5ACT A;  4B87 A;  2OHI A;  3S0Z A;  3T3O A;  2P18 A;  2E7Y A;  4YSL A;  5K4M A;  4UA4 A;  5AJL A;  2AZ4 A;  1WRA A;  4GYQ A;  5A5Z A;  4WD6 A;  3ZQ4 A;  3ZNB A;  1X8G A;  2YNW A;  2BGA A;  3Q6V A;  5AYA A;  1KR3 A;  4AD9 A;  2YCB A;  5KIL A;  5ACW A;  5EV8 A;  4AV7 A;  5AIJ A;  4Z6X A;  2GFK A;  3IEM A;  4UWR B;  3LVZ A;  4UWS B;  3VPE A;  2Y8A A;  2ZWR A;  2Q42 A;  1MQO A;  2NZF A;  1WUP A;  1L9Y A;  5B3R A;  4C1D A;  2M5D A;  3X2Y A;  3T3N A;  1QH3 A;  2I7T A;  5A0T A;  4UBQ A;  2YZ3 A;  2A7M A;  3L6N A;  4UWO B;  1JJT A;  3KNR A;  5ACV A;  4HL2 A;  2BFZ A;  2NXA A;  5K0W A;  2FU6 A;  4J5H A;  2ZZI A;  4EXY A;  4KEP A;  5EVD A;  4EY2 A;  5ACX A;  2Q9U A;  3SPU A;  1DDK A;  3I11 A;  4UWP B;  5K4K A;  3I0V A;  2GMN A;  2YNU A;  3G1P A;  3BV6 A;  5HIP A;  5AXO A;  5LM6 A;  5A87 A;  2BFZ B;  2FU9 A;  2Y8B A;  1ZTC A;  2QDS A;  3AJ3 A;  1BMC A;  2ZNB A;  4D1U A;  4AX0 B;  2FHX A;  1KO2 A;  2ZO4 A;  2QIN A;  5EVK A;  4EYL A;  4NUR A;  1BC2 A;  2FM6 A;  2FU7 A;  5ACP A;  4HKY A;  4TYT A;  2DOO A;  4J5F A;  3RKJ A;  2YNV A;  2Q0J A;  2I7V A;  2YHE A;  1A8T A;  2BC2 A;  1X8H A;  3X2Z A;  4RAW A;  3FCZ A;  3I13 A;  1VGN A;  2FHX B;  3BC2 A;  4DIL A;  2BFL A;  4H0D A;  2NZE A;  3VQZ A;  4GCW A;  5LCH A;  4TYF A;  5AHO A;  5K4N A;  2YNV B;  3IOF A;  1X8I A;  2P4Z A;  3DHC A;  3R2U A;  2BG2 A;  5KIK A;  2BIB A;  3KL7 A;  2UYX A;  3X2X A;  4P62 A;  2OHJ A;  4ZO3 A;  1Y44 A;  3IE2 A;  4O98 A; 
#chains in the Genus database with same CATH homology
 1XM8 A;  1WUO A;  4PVT A;  1VME A;  1VJN A;  4UAM A;  2R2D A;  2M5C A;  3SFP A;  5AXR A;  3DH8 A;  2QED A;  3ESH A;  4BP0 A;  4D1T A;  4RM5 A;  4YSK A;  3BK1 A;  2BR6 A;  4NQ2 A;  4Z67 A;  4XUK A;  5HIQ A;  4CHL A;  3PY6 A;  1KO3 A;  3P2U A;  4RL0 A;  4AWY B;  2Y87 A;  5EH9 A;  4D1V A;  4XWW A;  2WHG A;  5ACS A;  5FQA A;  1JJE A;  4RBS A;  4U4L A;  3DHA A;  2WYL A;  3TP9 A;  3WXC A;  3RPC A;  5HH5 A;  2GFJ A;  5HIS A;  1ZKP A;  3IE0 A;  4EYB A;  1DXK A;  1DD6 A;  4ZEJ A;  5LMC A;  3IDZ A;  4GYU A;  5LS3 A;  1YCF A;  4EFZ A;  4PVO A;  4C1G A;  2NYP A;  4AWZ A;  3JXP A;  4DIK A;  4C1F A;  3ZWF A;  1XTO A;  2YNT A;  4C09 A;  4C1C A;  3SRX A;  3DHB A;  4AX1 B;  3MD7 A;  2QDT A;  1JT1 A;  4JO0 A;  4TZE A;  5B15 A;  5EW0 A;  4NQ6 A;  4XWT A;  4HL1 A;  3PG4 A;  4Z60 A;  5LCA A;  4F6H A;  2YNT B;  1YCG A;  5HIO A;  3T9M A;  4Z7R A;  5LLD A;  3RKK A;  2XF4 A;  2H6A A;  4BZ3 A;  2BG8 A;  4Z5Z A;  2BMI A;  3IOG A;  3KNS A;  2DKF A;  2WYM A;  4RL2 A;  5DPX A;  1A7T A;  3IE1 A;  4NQ5 A;  2HB9 A;  3FAI A;  2GCU A;  4TZ9 A;  3ADR A;  1ZNB A;  4TZF A;  3X30 A;  4ZO2 A;  4NQ4 A;  3AF6 A;  5ACU A;  5FQC A;  5LE1 A;  1K07 A;  2BFK A;  1M2X A;  3AF5 A;  3F9O A;  2BTN A;  2BG8 B;  5B1U A;  3SW3 A;  1E5D A;  4V0H A;  5ACR A;  1QH5 A;  2FK6 A;  2BG6 A;  3ZR9 A;  5AEB A;  3IEK A;  1YCH A;  4C1H A;  2P1E A;  5HH6 A;  3SBL A;  1SML A;  2XR1 A;  5EWA A;  2QJS A;  5EVB A;  3I14 A;  2VW8 A;  4EXS A;  5EV6 A;  1P9E A;  4FEK A;  2I7X A;  4LE6 A;  4FR7 A;  4D02 A;  5ACQ A;  5A0V A;  4TZB A;  2WYM C;  2Q0I A;  5EHT A;  2FU8 A;  4D1W A;  3BK2 A;  1HLK A;  4YSB A;  3A4Y A;  1WW1 A;  5IQK A;  5LCF A;  2P97 A;  2WRS A;  4Z5Y A;  3H3E A;  3I15 A;  2AIO A;  2BG7 A;  5HH4 A;  2CBN A;  2GKL A;  4FSB A;  2OHH A;  4RAM A;  5LSC A;  1BVT A;  5FQB A;  3PY5 A;  4ZNB A;  3IEL A;  4KEQ A;  4C1E A;  5AHR A;  3QH8 A;  3SD9 A;  4F6Z A;  4EYF A;  5ACT A;  4B87 A;  2OHI A;  3S0Z A;  3T3O A;  2P18 A;  2E7Y A;  4YSL A;  5K4M A;  4UA4 A;  2AZ4 A;  1WRA A;  4GYQ A;  5A5Z A;  4WD6 A;  3ZQ4 A;  3ZNB A;  1X8G A;  2YNW A;  2BGA A;  3Q6V A;  5AYA A;  1KR3 A;  4AD9 A;  2YCB A;  5KIL A;  5ACW A;  5EV8 A;  4Z6X A;  2GFK A;  3IEM A;  4UWR B;  3LVZ A;  4UWS B;  3VPE A;  2Y8A A;  2ZWR A;  2Q42 A;  1MQO A;  2NZF A;  1WUP A;  1L9Y A;  5B3R A;  4C1D A;  2M5D A;  3X2Y A;  3T3N A;  1QH3 A;  2I7T A;  5A0T A;  4UBQ A;  2YZ3 A;  2A7M A;  3L6N A;  4UWO B;  1JJT A;  3KNR A;  5ACV A;  4HL2 A;  2BFZ A;  2NXA A;  5K0W A;  2FU6 A;  4J5H A;  2ZZI A;  4EXY A;  4KEP A;  5EVD A;  4EY2 A;  5ACX A;  2Q9U A;  3SPU A;  1DDK A;  3I11 A;  4UWP B;  5K4K A;  3I0V A;  2GMN A;  2YNU A;  3G1P A;  3BV6 A;  5HIP A;  5AXO A;  5LM6 A;  5A87 A;  2BFZ B;  2FU9 A;  2Y8B A;  1ZTC A;  2QDS A;  3AJ3 A;  1BMC A;  2ZNB A;  4D1U A;  4AX0 B;  2FHX A;  1KO2 A;  2ZO4 A;  2QIN A;  5EVK A;  4EYL A;  1BC2 A;  2FM6 A;  2FU7 A;  5ACP A;  4HKY A;  4TYT A;  2DOO A;  4J5F A;  3RKJ A;  2YNV A;  2Q0J A;  2I7V A;  1A8T A;  2BC2 A;  1X8H A;  3X2Z A;  4RAW A;  3FCZ A;  3I13 A;  1VGN A;  2FHX B;  3BC2 A;  4DIL A;  2BFL A;  4H0D A;  2NZE A;  3VQZ A;  4GCW A;  5LCH A;  4TYF A;  5AHO A;  5K4N A;  2YNV B;  3IOF A;  1X8I A;  2P4Z A;  3DHC A;  3R2U A;  2BG2 A;  5KIK A;  2BIB A;  3KL7 A;  2UYX A;  3X2X A;  4P62 A;  2OHJ A;  4ZO3 A;  1Y44 A;  3IE2 A;  4O98 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...