1DD6A

Imp-1 metallo beta-lactamase from pseudomonas aeruginosa in complex with a mercaptocarboxylate inhibitor
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
216
structure length
216
Chain Sequence
LPDLKIEKLDEGVYVHTSFEEVNGWGVVPKHGLVVLVNAEAYLIDTPFTAKDTEKLVTWFVERGYKIKGSISSHFHSDSTGGIEWLNSRSIPTYASELTNELLKKDGKVQATNSFSGVNYWLVKNKIEVFYPGPGHTPDNVVVWLPERKILFGGCFIKPYGLGNLGDANIEAWPKSAKLLKSKYGKAKLVVPSHSEVGDASLLKLTLEQAVKGLNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords IMP-1 METALLO BETA-LACTAMASE
publication title Crystal structure of the IMP-1 metallo beta-lactamase from Pseudomonas aeruginosa and its complex with a mercaptocarboxylate inhibitor: binding determinants of a potent, broad-spectrum inhibitor.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 64
structure length 216
sequence length 216
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 1999-11-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 1dd6A00
4TZEA 2NXAA 4ZNBA 3VPEA 2YNVA 3I0VA 2M5CA 1KO2A 4FEKA 5LSCA 4EXYA 3VQZA 2BFZA 4U4LA 2YNVB 2ZO4A 4AWZA 5EH9A 2AZ4A 5ACSA 2FU7A 4Z7RA 3DHBA 3MD7A 2ZNBA 2I7XA 3SBLA 2M5DA 4JO0A 1A8TA 5LCFA 5EVKA 5ACTA 1A7TA 1JJEA 3AF5A 4ZEJA 4EYFA 2BG7A 4AWYB 3WXCA 2GFKA 4CHLA 1KO3A 1SMLA 2Y8BA 5ACVA 2DOOA 3QH8A 4H0DA 3A4YA 4TZFA 3PY6A 5FQBA 3X2XA 2GKLA 2CBNA 2NYPA 2WYMA 4UAMA 4EXSA 2UYXA 4C1HA 4ZO3A 5AHRA 4B87A 4UWSB 4C1FA 2BC2A 3S0ZA 2QEDA 2P18A 1VMEA 3IOFA 3IOGA 4Z60A 3TP9A 3G1PA 4EYLA 4HL2A 2GCUA 2FU9A 4TZBA 5HH5A 5B3RA 5B15A 3L6NA 3ZNBA 1QH5A 4GCWA 1XTOA 4PVTA 3T3NA 2HB9A 3X30A 3KNRA 4C09A 4TZ9A 3KNSA 5LLDA 1YCGA 5EWAA 3P2UA 5K4NA 4NQ4A 2H6AA 5EV6A 5ACRA 4TYTA 4KEPA 4EFZA 2YZ3A 2E7YA 3JXPA 2XF4A 3X2YA 3I15A 4Z6XA 4YSLA 4RAWA 5AYAA 3FCZA 5HH4A 2YCBA 4F6ZA 3T3OA 4BZ3A 4DIKA 5HH6A 2WRSA 2BR6A 2GMNA 2OHIA 4C1CA 4NQ6A 2Y8AA 4Z5YA 1DXKA 3BC2A 4D1VA 4FSBA 2BFLA 3SPUA 1YCHA 5HIQA 5AXRA 2I7TA 1DDKA 2BTNA 1XM8A 3ZWFA 3RKKA 2FM6A 4BP0A 3AJ3A 2QJSA 1DD6A 3ZR9A 1BC2A 4RL0A 5IQKA 4D1UA 3SW3A 5KILA 4UWOB 2FK6A 1X8GA 5EV8A 4AD9A 1X8IA 2FU8A 5LCHA 3IE1A 4Z67A 5HIPA 2BFKA 1L9YA 2QDSA 5LMCA 2QINA 3BK2A 3PG4A 5A5ZA 2A7MA 4YSKA 5AHOA 3ESHA 2FU6A 2YNWA 3DHAA 2YNUA 5HISA 4C1GA 1QH3A 3IEKA 4WD6A 1WUOA 5K4MA 5ACQA 2P97A 2BIBA 4RM5A 1E5DA 5EHTA 5EW0A 4TYFA 4P62A 4F6HA 4KEQA 1YCFA 1Y44A 1BMCA 3H3EA 5DPXA 1WUPA 5HIOA 2BG8A 1HLKA 5LS3A 1KR3A 4RAMA 2FHXB 1WRAA 2Q9UA 4C1DA 2P1EA 2Q42A 2BG8B 3KL7A 3LVZA 5KIKA 5AEBA 3BV6A 3ZQ4A 2OHJA 5LCAA 1K07A 4XUKA 2Q0JA 3AF6A 1X8HA 3RPCA 1JT1A 5ACXA 2BG2A 2NZFA 5EVBA 4UWRB 4O98A 5EVDA 3RKJA 5AXOA 1M2XA 3SFPA 2R2DA 4UWPB 4UA4A 1ZKPA 5A87A 3FAIA 2BG6A 2BGAA 5LE1A 3IEMA 1ZTCA 4XWTA 2OHHA 3SRXA 1MQOA 2BFZB 4AX0B 3PY5A 3T9MA 4EYBA 2ZZIA 4XWWA 4D1WA 4C1EA 2WYLA 2BMIA 2WYMC 2Y87A 2NZEA 1P9EA 4FR7A 4J5HA 1JJTA 4D02A 2YNTA 3I14A 2DKFA 3DH8A 5K0WA 4PVOA 4RBSA 2I7VA 3BK1A 4YSBA 4V0HA 2YNTB 3SD9A 4LE6A 2GFJA 4HKYA 2Q0IA 4NQ2A 3X2ZA 4DILA 4UBQA 2XR1A 4GYQA 2VW8A 3R2UA 3DHCA 5FQCA 4ZO2A 5A0VA 1VJNA 4AX1B 1BVTA 3ADRA 2QDTA 3IE2A 5ACPA 3I11A 5ACUA 4Z5ZA 3IE0A 4HL1A 4RL2A 2FHXA 5LM6A 4GYUA 5K4KA 4NQ5A 3I13A 2P4ZA 3IELA 5ACWA 2AIOA 2WHGA 3IDZA 3F9OA 4D1TA 1ZNBA 5B1UA 4EY2A 1VGNA 1WW1A 5FQAA 4J5FA 3Q6VA 2ZWRA 5A0TA
chains in the Genus database with same CATH superfamily
4TZEA 2NXAA 4ZNBA 3VPEA 2YNVA 3I0VA 2M5CA 2YHEA 1KO2A 4FEKA 4AV7A 5LSCA 4EXYA 3VQZA 2BFZA 2CFUA 2YNVB 4U4LA 2ZO4A 4AWZA 5EH9A 2AZ4A 5ACSA 2FU7A 4Z7RA 3DHBA 3MD7A 2ZNBA 2I7XA 3SBLA 2M5DA 4JO0A 1A8TA 5LCFA 5EVKA 5ACTA 1A7TA 1JJEA 3AF5A 4ZEJA 4EYFA 2BG7A 4AWYB 3WXCA 2GFKA 4CHLA 1KO3A 1SMLA 2Y8BA 5ACVA 2DOOA 3QH8A 4H0DA 3A4YA 4TZFA 3PY6A 5FQBA 3X2XA 2CBNA 2GKLA 2NYPA 2WYMA 4UAMA 4EXSA 2UYXA 2CG3A 4C1HA 4ZO3A 5AHRA 4B87A 4C1FA 4UWSB 2BC2A 3S0ZA 2QEDA 2P18A 1VMEA 3IOFA 3IOGA 4Z60A 3TP9A 3G1PA 4EYLA 4HL2A 2GCUA 2FU9A 4TZBA 5HH5A 5B3RA 5B15A 3L6NA 3ZNBA 1QH5A 4GCWA 1XTOA 4PVTA 3T3NA 2HB9A 3X30A 3KNRA 4C09A 4TZ9A 3KNSA 5LLDA 1YCGA 5EWAA 3P2UA 5K4NA 4NQ4A 2H6AA 5EV6A 5ACRA 4TYTA 4KEPA 4EFZA 2YZ3A 2E7YA 3JXPA 2XF4A 3X2YA 3I15A 4Z6XA 4YSLA 4RAWA 5AYAA 3FCZA 5HH4A 2YCBA 4F6ZA 3T3OA 4BZ3A 4DIKA 5HH6A 2WRSA 2BR6A 5AJLA 2GMNA 2OHIA 4C1CA 4NQ6A 2Y8AA 4Z5YA 1DXKA 3BC2A 4D1VA 4FSBA 2BFLA 3SPUA 1YCHA 5HIQA 5AXRA 2I7TA 1DDKA 2BTNA 1XM8A 3ZWFA 3RKKA 2FM6A 4BP0A 3AJ3A 2QJSA 1DD6A 3ZR9A 1BC2A 4RL0A 5IQKA 4D1UA 3SW3A 5KILA 4UWOB 4PDXA 2FK6A 1X8GA 5EV8A 4AD9A 1X8IA 2FU8A 5LCHA 3IE1A 4Z67A 5HIPA 2BFKA 1L9YA 2QDSA 5LMCA 2QINA 3BK2A 3PG4A 5A5ZA 2A7MA 4YSKA 5AHOA 3ESHA 2FU6A 2YNWA 3DHAA 2YNUA 5HISA 4C1GA 1QH3A 2CFZA 3IEKA 4WD6A 1WUOA 5K4MA 5ACQA 2P97A 2BIBA 4RM5A 1E5DA 5EHTA 5EW0A 4TYFA 4P62A 4F6HA 4KEQA 1YCFA 1Y44A 1BMCA 3H3EA 5DPXA 1WUPA 5HIOA 2BG8A 1HLKA 5LS3A 1KR3A 4RAMA 2FHXB 1WRAA 2Q9UA 4C1DA 2P1EA 2Q42A 2BG8B 3KL7A 3LVZA 5KIKA 5AEBA 3BV6A 3ZQ4A 2OHJA 5LCAA 1K07A 4XUKA 2Q0JA 3AF6A 1X8HA 3RPCA 1JT1A 5ACXA 2BG2A 2NZFA 5EVBA 2CG2A 4UWRB 4O98A 5EVDA 3RKJA 5AXOA 1M2XA 3SFPA 2R2DA 4UWPB 4UA4A 1ZKPA 5A87A 3FAIA 2BG6A 2BGAA 5LE1A 3IEMA 1ZTCA 4XWTA 2OHHA 3SRXA 1MQOA 2BFZB 4AXHA 4AX0B 3PY5A 3T9MA 4EYBA 2ZZIA 4XWWA 4D1WA 4C1EA 2WYLA 2BMIA 2WYMC 2Y87A 2NZEA 1P9EA 4FR7A 4J5HA 1JJTA 4D02A 2YNTA 3I14A 2DKFA 3DH8A 5K0WA 4PVOA 4RBSA 2I7VA 3BK1A 4YSBA 4V0HA 2YNTB 3SD9A 4LE6A 2GFJA 4HKYA 2Q0IA 4NQ2A 3X2ZA 4DILA 4UBQA 2XR1A 4GYQA 2VW8A 3R2UA 3DHCA 4NURA 5FQCA 4ZO2A 5A0VA 1VJNA 4AX1B 1BVTA 3ADRA 2QDTA 3IE2A 5ACPA 3I11A 5ACUA 4Z5ZA 3IE0A 4HL1A 4RL2A 5A23A 2FHXA 5LM6A 4GYUA 5K4KA 4NQ5A 5AIJA 3I13A 2P4ZA 3IELA 5ACWA 2AIOA 2WHGA 3IDZA 3F9OA 4D1TA 1ZNBA 5B1UA 4EY2A 1VGNA 1WW1A 5FQAA 4J5FA 3Q6VA 2ZWRA 5A0TA
chains in the Genus database with same CATH topology
4TZEA 2NXAA 4ZNBA 3VPEA 2YNVA 3I0VA 2M5CA 1KO2A 4FEKA 5LSCA 4EXYA 3VQZA 2BFZA 4U4LA 2YNVB 2ZO4A 4AWZA 5EH9A 2AZ4A 5ACSA 2FU7A 4Z7RA 3DHBA 3MD7A 2ZNBA 2I7XA 3SBLA 2M5DA 4JO0A 1A8TA 5LCFA 5EVKA 5ACTA 1A7TA 1JJEA 3AF5A 4ZEJA 4EYFA 2BG7A 4AWYB 3WXCA 2GFKA 4CHLA 1KO3A 1SMLA 2Y8BA 5ACVA 2DOOA 3QH8A 4H0DA 3A4YA 4TZFA 3PY6A 5FQBA 3X2XA 2GKLA 2CBNA 2NYPA 2WYMA 4UAMA 4EXSA 2UYXA 4C1HA 4ZO3A 5AHRA 4B87A 4UWSB 4C1FA 2BC2A 3S0ZA 2QEDA 2P18A 1VMEA 3IOFA 3IOGA 4Z60A 3TP9A 3G1PA 4EYLA 4HL2A 2GCUA 2FU9A 4TZBA 5HH5A 5B3RA 5B15A 3L6NA 3ZNBA 1QH5A 4GCWA 1XTOA 4PVTA 3T3NA 2HB9A 3X30A 3KNRA 4C09A 4TZ9A 3KNSA 5LLDA 1YCGA 5EWAA 3P2UA 5K4NA 4NQ4A 2H6AA 5EV6A 5ACRA 4TYTA 4KEPA 4EFZA 2YZ3A 2E7YA 3JXPA 2XF4A 3X2YA 3I15A 4Z6XA 4YSLA 4RAWA 5AYAA 3FCZA 5HH4A 2YCBA 4F6ZA 3T3OA 4BZ3A 4DIKA 5HH6A 2WRSA 2BR6A 2GMNA 2OHIA 4C1CA 4NQ6A 2Y8AA 4Z5YA 1DXKA 3BC2A 4D1VA 4FSBA 2BFLA 3SPUA 1YCHA 5HIQA 5AXRA 2I7TA 1DDKA 2BTNA 1XM8A 3ZWFA 3RKKA 2FM6A 4BP0A 3AJ3A 2QJSA 1DD6A 3ZR9A 1BC2A 4RL0A 5IQKA 4D1UA 3SW3A 5KILA 4UWOB 2FK6A 1X8GA 5EV8A 4AD9A 1X8IA 2FU8A 5LCHA 3IE1A 4Z67A 5HIPA 2BFKA 1L9YA 2QDSA 5LMCA 2QINA 3BK2A 3PG4A 5A5ZA 2A7MA 4YSKA 5AHOA 3ESHA 2FU6A 2YNWA 3DHAA 2YNUA 5HISA 4C1GA 1QH3A 3IEKA 4WD6A 1WUOA 5K4MA 5ACQA 2P97A 2BIBA 4RM5A 1E5DA 5EHTA 5EW0A 4TYFA 4P62A 4F6HA 4KEQA 1YCFA 1Y44A 1BMCA 3H3EA 5DPXA 1WUPA 5HIOA 2BG8A 1HLKA 5LS3A 1KR3A 4RAMA 2FHXB 1WRAA 2Q9UA 4C1DA 2P1EA 2Q42A 2BG8B 3KL7A 3LVZA 5KIKA 5AEBA 3BV6A 3ZQ4A 2OHJA 5LCAA 1K07A 4XUKA 2Q0JA 3AF6A 1X8HA 3RPCA 1JT1A 5ACXA 2BG2A 2NZFA 5EVBA 4UWRB 4O98A 5EVDA 3RKJA 5AXOA 1M2XA 3SFPA 2R2DA 4UWPB 4UA4A 1ZKPA 5A87A 3FAIA 2BG6A 2BGAA 5LE1A 3IEMA 1ZTCA 4XWTA 2OHHA 3SRXA 1MQOA 2BFZB 4AX0B 3PY5A 3T9MA 4EYBA 2ZZIA 4XWWA 4D1WA 4C1EA 2WYLA 2BMIA 2WYMC 2Y87A 2NZEA 1P9EA 4FR7A 4J5HA 1JJTA 4D02A 2YNTA 3I14A 2DKFA 3DH8A 5K0WA 4PVOA 4RBSA 2I7VA 3BK1A 4YSBA 4V0HA 2YNTB 3SD9A 4LE6A 2GFJA 4HKYA 2Q0IA 4NQ2A 3X2ZA 4DILA 4UBQA 2XR1A 4GYQA 2VW8A 3R2UA 3DHCA 5FQCA 4ZO2A 5A0VA 1VJNA 4AX1B 1BVTA 3ADRA 2QDTA 3IE2A 5ACPA 3I11A 5ACUA 4Z5ZA 3IE0A 4HL1A 4RL2A 2FHXA 5LM6A 4GYUA 5K4KA 4NQ5A 3I13A 2P4ZA 3IELA 5ACWA 2AIOA 2WHGA 3IDZA 3F9OA 4D1TA 1ZNBA 5B1UA 4EY2A 1VGNA 1WW1A 5FQAA 4J5FA 3Q6VA 2ZWRA 5A0TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TZE A;  2NXA A;  4ZNB A;  3VPE A;  2YNV A;  3I0V A;  2M5C A;  1KO2 A;  4FEK A;  5LSC A;  4EXY A;  3VQZ A;  2BFZ A;  4U4L A;  2YNV B;  2ZO4 A;  4AWZ A;  5EH9 A;  2AZ4 A;  5ACS A;  2FU7 A;  4Z7R A;  3DHB A;  3MD7 A;  2ZNB A;  2I7X A;  3SBL A;  2M5D A;  4JO0 A;  1A8T A;  5LCF A;  5EVK A;  5ACT A;  1A7T A;  1JJE A;  3AF5 A;  4ZEJ A;  4EYF A;  2BG7 A;  4AWY B;  3WXC A;  2GFK A;  4CHL A;  1KO3 A;  1SML A;  2Y8B A;  5ACV A;  2DOO A;  3QH8 A;  4H0D A;  3A4Y A;  4TZF A;  3PY6 A;  5FQB A;  3X2X A;  2GKL A;  2CBN A;  2NYP A;  2WYM A;  4UAM A;  4EXS A;  2UYX A;  4C1H A;  4ZO3 A;  5AHR A;  4B87 A;  4UWS B;  4C1F A;  2BC2 A;  3S0Z A;  2QED A;  2P18 A;  1VME A;  3IOF A;  3IOG A;  4Z60 A;  3TP9 A;  3G1P A;  4EYL A;  4HL2 A;  2GCU A;  2FU9 A;  4TZB A;  5HH5 A;  5B3R A;  5B15 A;  3L6N A;  3ZNB A;  1QH5 A;  4GCW A;  1XTO A;  4PVT A;  3T3N A;  2HB9 A;  3X30 A;  3KNR A;  4C09 A;  4TZ9 A;  3KNS A;  5LLD A;  1YCG A;  5EWA A;  3P2U A;  5K4N A;  4NQ4 A;  2H6A A;  5EV6 A;  5ACR A;  4TYT A;  4KEP A;  4EFZ A;  2YZ3 A;  2E7Y A;  3JXP A;  2XF4 A;  3X2Y A;  3I15 A;  4Z6X A;  4YSL A;  4RAW A;  5AYA A;  3FCZ A;  5HH4 A;  2YCB A;  4F6Z A;  3T3O A;  4BZ3 A;  4DIK A;  5HH6 A;  2WRS A;  2BR6 A;  2GMN A;  2OHI A;  4C1C A;  4NQ6 A;  2Y8A A;  4Z5Y A;  1DXK A;  3BC2 A;  4D1V A;  4FSB A;  2BFL A;  3SPU A;  1YCH A;  5HIQ A;  5AXR A;  2I7T A;  1DDK A;  2BTN A;  1XM8 A;  3ZWF A;  3RKK A;  2FM6 A;  4BP0 A;  3AJ3 A;  2QJS A;  1DD6 A;  3ZR9 A;  1BC2 A;  4RL0 A;  5IQK A;  4D1U A;  3SW3 A;  5KIL A;  4UWO B;  2FK6 A;  1X8G A;  5EV8 A;  4AD9 A;  1X8I A;  2FU8 A;  5LCH A;  3IE1 A;  4Z67 A;  5HIP A;  2BFK A;  1L9Y A;  2QDS A;  5LMC A;  2QIN A;  3BK2 A;  3PG4 A;  5A5Z A;  2A7M A;  4YSK A;  5AHO A;  3ESH A;  2FU6 A;  2YNW A;  3DHA A;  2YNU A;  5HIS A;  4C1G A;  1QH3 A;  3IEK A;  4WD6 A;  1WUO A;  5K4M A;  5ACQ A;  2P97 A;  2BIB A;  4RM5 A;  1E5D A;  5EHT A;  5EW0 A;  4TYF A;  4P62 A;  4F6H A;  4KEQ A;  1YCF A;  1Y44 A;  1BMC A;  3H3E A;  5DPX A;  1WUP A;  5HIO A;  2BG8 A;  1HLK A;  5LS3 A;  1KR3 A;  4RAM A;  2FHX B;  1WRA A;  2Q9U A;  4C1D A;  2P1E A;  2Q42 A;  2BG8 B;  3KL7 A;  3LVZ A;  5KIK A;  5AEB A;  3BV6 A;  3ZQ4 A;  2OHJ A;  5LCA A;  1K07 A;  4XUK A;  2Q0J A;  3AF6 A;  1X8H A;  3RPC A;  1JT1 A;  5ACX A;  2BG2 A;  2NZF A;  5EVB A;  4UWR B;  4O98 A;  5EVD A;  3RKJ A;  5AXO A;  1M2X A;  3SFP A;  2R2D A;  4UWP B;  4UA4 A;  1ZKP A;  5A87 A;  3FAI A;  2BG6 A;  2BGA A;  5LE1 A;  3IEM A;  1ZTC A;  4XWT A;  2OHH A;  3SRX A;  1MQO A;  2BFZ B;  4AX0 B;  3PY5 A;  3T9M A;  4EYB A;  2ZZI A;  4XWW A;  4D1W A;  4C1E A;  2WYL A;  2BMI A;  2WYM C;  2Y87 A;  2NZE A;  1P9E A;  4FR7 A;  4J5H A;  1JJT A;  4D02 A;  2YNT A;  3I14 A;  2DKF A;  3DH8 A;  5K0W A;  4PVO A;  4RBS A;  2I7V A;  3BK1 A;  4YSB A;  4V0H A;  2YNT B;  3SD9 A;  4LE6 A;  2GFJ A;  4HKY A;  2Q0I A;  4NQ2 A;  3X2Z A;  4DIL A;  4UBQ A;  2XR1 A;  4GYQ A;  2VW8 A;  3R2U A;  3DHC A;  5FQC A;  4ZO2 A;  5A0V A;  1VJN A;  4AX1 B;  1BVT A;  3ADR A;  2QDT A;  3IE2 A;  5ACP A;  3I11 A;  5ACU A;  4Z5Z A;  3IE0 A;  4HL1 A;  4RL2 A;  2FHX A;  5LM6 A;  4GYU A;  5K4K A;  4NQ5 A;  3I13 A;  2P4Z A;  3IEL A;  5ACW A;  2AIO A;  2WHG A;  3IDZ A;  3F9O A;  4D1T A;  1ZNB A;  5B1U A;  4EY2 A;  1VGN A;  1WW1 A;  5FQA A;  4J5F A;  3Q6V A;  2ZWR A;  5A0T A; 
#chains in the Genus database with same CATH topology
 4TZE A;  2NXA A;  4ZNB A;  3VPE A;  2YNV A;  3I0V A;  2M5C A;  2YHE A;  1KO2 A;  4FEK A;  4AV7 A;  5LSC A;  4EXY A;  3VQZ A;  2BFZ A;  2CFU A;  2YNV B;  4U4L A;  2ZO4 A;  4AWZ A;  5EH9 A;  2AZ4 A;  5ACS A;  2FU7 A;  4Z7R A;  3DHB A;  3MD7 A;  2ZNB A;  2I7X A;  3SBL A;  2M5D A;  4JO0 A;  1A8T A;  5LCF A;  5EVK A;  5ACT A;  1A7T A;  1JJE A;  3AF5 A;  4ZEJ A;  4EYF A;  2BG7 A;  4AWY B;  3WXC A;  2GFK A;  4CHL A;  1KO3 A;  1SML A;  2Y8B A;  5ACV A;  2DOO A;  3QH8 A;  4H0D A;  3A4Y A;  4TZF A;  3PY6 A;  5FQB A;  3X2X A;  2CBN A;  2GKL A;  2NYP A;  2WYM A;  4UAM A;  4EXS A;  2UYX A;  2CG3 A;  4C1H A;  4ZO3 A;  5AHR A;  4B87 A;  4C1F A;  4UWS B;  2BC2 A;  3S0Z A;  2QED A;  2P18 A;  1VME A;  3IOF A;  3IOG A;  4Z60 A;  3TP9 A;  3G1P A;  4EYL A;  4HL2 A;  2GCU A;  2FU9 A;  4TZB A;  5HH5 A;  5B3R A;  5B15 A;  3L6N A;  3ZNB A;  1QH5 A;  4GCW A;  1XTO A;  4PVT A;  3T3N A;  2HB9 A;  3X30 A;  3KNR A;  4C09 A;  4TZ9 A;  3KNS A;  5LLD A;  1YCG A;  5EWA A;  3P2U A;  5K4N A;  4NQ4 A;  2H6A A;  5EV6 A;  5ACR A;  4TYT A;  4KEP A;  4EFZ A;  2YZ3 A;  2E7Y A;  3JXP A;  2XF4 A;  3X2Y A;  3I15 A;  4Z6X A;  4YSL A;  4RAW A;  5AYA A;  3FCZ A;  5HH4 A;  2YCB A;  4F6Z A;  3T3O A;  4BZ3 A;  4DIK A;  5HH6 A;  2WRS A;  2BR6 A;  5AJL A;  2GMN A;  2OHI A;  4C1C A;  4NQ6 A;  2Y8A A;  4Z5Y A;  1DXK A;  3BC2 A;  4D1V A;  4FSB A;  2BFL A;  3SPU A;  1YCH A;  5HIQ A;  5AXR A;  2I7T A;  1DDK A;  2BTN A;  1XM8 A;  3ZWF A;  3RKK A;  2FM6 A;  4BP0 A;  3AJ3 A;  2QJS A;  1DD6 A;  3ZR9 A;  1BC2 A;  4RL0 A;  5IQK A;  4D1U A;  3SW3 A;  5KIL A;  4UWO B;  4PDX A;  2FK6 A;  1X8G A;  5EV8 A;  4AD9 A;  1X8I A;  2FU8 A;  5LCH A;  3IE1 A;  4Z67 A;  5HIP A;  2BFK A;  1L9Y A;  2QDS A;  5LMC A;  2QIN A;  3BK2 A;  3PG4 A;  5A5Z A;  2A7M A;  4YSK A;  5AHO A;  3ESH A;  2FU6 A;  2YNW A;  3DHA A;  2YNU A;  5HIS A;  4C1G A;  1QH3 A;  2CFZ A;  3IEK A;  4WD6 A;  1WUO A;  5K4M A;  5ACQ A;  2P97 A;  2BIB A;  4RM5 A;  1E5D A;  5EHT A;  5EW0 A;  4TYF A;  4P62 A;  4F6H A;  4KEQ A;  1YCF A;  1Y44 A;  1BMC A;  3H3E A;  5DPX A;  1WUP A;  5HIO A;  2BG8 A;  1HLK A;  5LS3 A;  1KR3 A;  4RAM A;  2FHX B;  1WRA A;  2Q9U A;  4C1D A;  2P1E A;  2Q42 A;  2BG8 B;  3KL7 A;  3LVZ A;  5KIK A;  5AEB A;  3BV6 A;  3ZQ4 A;  2OHJ A;  5LCA A;  1K07 A;  4XUK A;  2Q0J A;  3AF6 A;  1X8H A;  3RPC A;  1JT1 A;  5ACX A;  2BG2 A;  2NZF A;  5EVB A;  2CG2 A;  4UWR B;  4O98 A;  5EVD A;  3RKJ A;  5AXO A;  1M2X A;  3SFP A;  2R2D A;  4UWP B;  4UA4 A;  1ZKP A;  5A87 A;  3FAI A;  2BG6 A;  2BGA A;  5LE1 A;  3IEM A;  1ZTC A;  4XWT A;  2OHH A;  3SRX A;  1MQO A;  2BFZ B;  4AXH A;  4AX0 B;  3PY5 A;  3T9M A;  4EYB A;  2ZZI A;  4XWW A;  4D1W A;  4C1E A;  2WYL A;  2BMI A;  2WYM C;  2Y87 A;  2NZE A;  1P9E A;  4FR7 A;  4J5H A;  1JJT A;  4D02 A;  2YNT A;  3I14 A;  2DKF A;  3DH8 A;  5K0W A;  4PVO A;  4RBS A;  2I7V A;  3BK1 A;  4YSB A;  4V0H A;  2YNT B;  3SD9 A;  4LE6 A;  2GFJ A;  4HKY A;  2Q0I A;  4NQ2 A;  3X2Z A;  4DIL A;  4UBQ A;  2XR1 A;  4GYQ A;  2VW8 A;  3R2U A;  3DHC A;  4NUR A;  5FQC A;  4ZO2 A;  5A0V A;  1VJN A;  4AX1 B;  1BVT A;  3ADR A;  2QDT A;  3IE2 A;  5ACP A;  3I11 A;  5ACU A;  4Z5Z A;  3IE0 A;  4HL1 A;  4RL2 A;  5A23 A;  2FHX A;  5LM6 A;  4GYU A;  5K4K A;  4NQ5 A;  5AIJ A;  3I13 A;  2P4Z A;  3IEL A;  5ACW A;  2AIO A;  2WHG A;  3IDZ A;  3F9O A;  4D1T A;  1ZNB A;  5B1U A;  4EY2 A;  1VGN A;  1WW1 A;  5FQA A;  4J5F A;  3Q6V A;  2ZWR A;  5A0T A; 
#chains in the Genus database with same CATH homology
 4TZE A;  2NXA A;  4ZNB A;  3VPE A;  2YNV A;  3I0V A;  2M5C A;  1KO2 A;  4FEK A;  5LSC A;  4EXY A;  3VQZ A;  2BFZ A;  4U4L A;  2YNV B;  2ZO4 A;  4AWZ A;  5EH9 A;  2AZ4 A;  5ACS A;  2FU7 A;  4Z7R A;  3DHB A;  3MD7 A;  2ZNB A;  2I7X A;  3SBL A;  2M5D A;  4JO0 A;  1A8T A;  5LCF A;  5EVK A;  5ACT A;  1A7T A;  1JJE A;  3AF5 A;  4ZEJ A;  4EYF A;  2BG7 A;  4AWY B;  3WXC A;  2GFK A;  4CHL A;  1KO3 A;  1SML A;  2Y8B A;  5ACV A;  2DOO A;  3QH8 A;  4H0D A;  3A4Y A;  4TZF A;  3PY6 A;  5FQB A;  3X2X A;  2GKL A;  2CBN A;  2NYP A;  2WYM A;  4UAM A;  4EXS A;  2UYX A;  4C1H A;  4ZO3 A;  5AHR A;  4B87 A;  4UWS B;  4C1F A;  2BC2 A;  3S0Z A;  2QED A;  2P18 A;  1VME A;  3IOF A;  3IOG A;  4Z60 A;  3TP9 A;  3G1P A;  4EYL A;  4HL2 A;  2GCU A;  2FU9 A;  4TZB A;  5HH5 A;  5B3R A;  5B15 A;  3L6N A;  3ZNB A;  1QH5 A;  4GCW A;  1XTO A;  4PVT A;  3T3N A;  2HB9 A;  3X30 A;  3KNR A;  4C09 A;  4TZ9 A;  3KNS A;  5LLD A;  1YCG A;  5EWA A;  3P2U A;  5K4N A;  4NQ4 A;  2H6A A;  5EV6 A;  5ACR A;  4TYT A;  4KEP A;  4EFZ A;  2YZ3 A;  2E7Y A;  3JXP A;  2XF4 A;  3X2Y A;  3I15 A;  4Z6X A;  4YSL A;  4RAW A;  5AYA A;  3FCZ A;  5HH4 A;  2YCB A;  4F6Z A;  3T3O A;  4BZ3 A;  4DIK A;  5HH6 A;  2WRS A;  2BR6 A;  2GMN A;  2OHI A;  4C1C A;  4NQ6 A;  2Y8A A;  4Z5Y A;  1DXK A;  3BC2 A;  4D1V A;  4FSB A;  2BFL A;  3SPU A;  1YCH A;  5HIQ A;  5AXR A;  2I7T A;  1DDK A;  2BTN A;  1XM8 A;  3ZWF A;  3RKK A;  2FM6 A;  4BP0 A;  3AJ3 A;  2QJS A;  1DD6 A;  3ZR9 A;  1BC2 A;  4RL0 A;  5IQK A;  4D1U A;  3SW3 A;  5KIL A;  4UWO B;  2FK6 A;  1X8G A;  5EV8 A;  4AD9 A;  1X8I A;  2FU8 A;  5LCH A;  3IE1 A;  4Z67 A;  5HIP A;  2BFK A;  1L9Y A;  2QDS A;  5LMC A;  2QIN A;  3BK2 A;  3PG4 A;  5A5Z A;  2A7M A;  4YSK A;  5AHO A;  3ESH A;  2FU6 A;  2YNW A;  3DHA A;  2YNU A;  5HIS A;  4C1G A;  1QH3 A;  3IEK A;  4WD6 A;  1WUO A;  5K4M A;  5ACQ A;  2P97 A;  2BIB A;  4RM5 A;  1E5D A;  5EHT A;  5EW0 A;  4TYF A;  4P62 A;  4F6H A;  4KEQ A;  1YCF A;  1Y44 A;  1BMC A;  3H3E A;  5DPX A;  1WUP A;  5HIO A;  2BG8 A;  1HLK A;  5LS3 A;  1KR3 A;  4RAM A;  2FHX B;  1WRA A;  2Q9U A;  4C1D A;  2P1E A;  2Q42 A;  2BG8 B;  3KL7 A;  3LVZ A;  5KIK A;  5AEB A;  3BV6 A;  3ZQ4 A;  2OHJ A;  5LCA A;  1K07 A;  4XUK A;  2Q0J A;  3AF6 A;  1X8H A;  3RPC A;  1JT1 A;  5ACX A;  2BG2 A;  2NZF A;  5EVB A;  4UWR B;  4O98 A;  5EVD A;  3RKJ A;  5AXO A;  1M2X A;  3SFP A;  2R2D A;  4UWP B;  4UA4 A;  1ZKP A;  5A87 A;  3FAI A;  2BG6 A;  2BGA A;  5LE1 A;  3IEM A;  1ZTC A;  4XWT A;  2OHH A;  3SRX A;  1MQO A;  2BFZ B;  4AX0 B;  3PY5 A;  3T9M A;  4EYB A;  2ZZI A;  4XWW A;  4D1W A;  4C1E A;  2WYL A;  2BMI A;  2WYM C;  2Y87 A;  2NZE A;  1P9E A;  4FR7 A;  4J5H A;  1JJT A;  4D02 A;  2YNT A;  3I14 A;  2DKF A;  3DH8 A;  5K0W A;  4PVO A;  4RBS A;  2I7V A;  3BK1 A;  4YSB A;  4V0H A;  2YNT B;  3SD9 A;  4LE6 A;  2GFJ A;  4HKY A;  2Q0I A;  4NQ2 A;  3X2Z A;  4DIL A;  4UBQ A;  2XR1 A;  4GYQ A;  2VW8 A;  3R2U A;  3DHC A;  5FQC A;  4ZO2 A;  5A0V A;  1VJN A;  4AX1 B;  1BVT A;  3ADR A;  2QDT A;  3IE2 A;  5ACP A;  3I11 A;  5ACU A;  4Z5Z A;  3IE0 A;  4HL1 A;  4RL2 A;  2FHX A;  5LM6 A;  4GYU A;  5K4K A;  4NQ5 A;  3I13 A;  2P4Z A;  3IEL A;  5ACW A;  2AIO A;  2WHG A;  3IDZ A;  3F9O A;  4D1T A;  1ZNB A;  5B1U A;  4EY2 A;  1VGN A;  1WW1 A;  5FQA A;  4J5F A;  3Q6V A;  2ZWR A;  5A0T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...