3T3OA

Molecular basis for the recognition and cleavage of rna (cugg) by the bifunctional 5'-3' exo/endoribonuclease rnase j
Total Genus 162
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
162
sequence length
553
structure length
553
Chain Sequence
SQGGPQDHVEIIPLGGMGEIGKNITVFRFRDEIFVLDGGLAFPEEGMPGVDLLIPRVDYLIEHRHKIKAWVLTHGAEDHIGGLPFLLPMIFGKESPVPIYGARLTLGLLRGKLEEFGLRPGAFNLKEISPDDRIQVGRYFTLDLFRMTHSIPDNSGVVIRTPIGTIVHTGDFKLDPTPIDGKVSHLAKVAQAGAEGVLLLIADATNAERPGYTPSEMEIAKELDRVIGRAPGRVFVTTFASHIHRIQSVIWAAEKYGRKVAMEGRSMLKFSRIALELGYLKVKDRLYTLEEVKDLPDHQVLILATGSQGQPMSVLHRLAFEGHAKMAIKPGDTVILSSSPIPGNEEAVNRVINRLYALGAYVLYPPTYKVHASGHASQEELKLILNLTTPRFFLPWHGEVRHQMNFKWLAESMSRPPEKTLIGENGAVYRLTRETFEKVGEVPHGVLYVDGLGVGDITEEILADRRHMAEEGLVVITALAGEDPVVEVVSRGFVKAGERLLGEVRRMALEALKNGVREKKPLERIRDDIYYPVKKFLKKATGRDPMILPVVIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/rna
molecule keywords Metal dependent hydrolase
publication title Molecular Basis for the Recognition and Cleavage of RNA by the Bifunctional 5'-3' Exo/Endoribonuclease RNase J.
pubmed doi rcsb
source organism Thermus thermophilus hb27
total genus 162
structure length 553
sequence length 553
ec nomenclature ec 3.-.-.-:
pdb deposition date 2011-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07521 RMMBL Zn-dependent metallo-hydrolase RNA specificity domain
A PF12706 Lactamase_B_2 Beta-lactamase superfamily domain
A PF17770 RNase_J_C Ribonuclease J C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.580 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3t3oA03
3.40.50.10710 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Metallo-hydrolase/oxidoreductase 3t3oA02
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 3t3oA01
3RKKA 4P62A 3LVZA 2AZ4A 4GCWA 4RAWA 1JJTA 4WD6A 5AHRA 4J5FA 3KNSA 4J5HA 4UWSB 1WW1A 5A87A 5EV6A 2BG8A 1HLKA 4HKYA 4DILA 3IEMA 1WRAA 2XF4A 3T9MA 5K4NA 4HL2A 4F6HA 2WHGA 5A5ZA 1YCFA 3Q6VA 4XWWA 3I13A 1ZTCA 2XR1A 5K4KA 3VPEA 5FQAA 2BMIA 1VJNA 2GCUA 2Q42A 1BMCA 1VMEA 3X30A 3QH8A 4ZO2A 2I7TA 3RPCA 3F9OA 4TZBA 4UBQA 1ZNBA 2FU7A 4ZNBA 3FCZA 4EXSA 4PVOA 2Q0IA 3BK2A 4XWTA 2Q0JA 3X2YA 3T3OA 5ACPA 2QINA 1XM8A 5HIOA 1M2XA 5HH4A 3DHCA 4C1DA 4Z5ZA 4RL2A 3TP9A 4D1VA 2P4ZA 2ZWRA 3T3NA 2YNTA 1BC2A 1E5DA 3IOFA 2R2DA 3SRXA 5HH6A 4TYTA 3I14A 5LM6A 3VQZA 5ACUA 1YCGA 5EH9A 4ZEJA 2FU8A 5B1UA 2H6AA 3DH8A 4D1TA 2GMNA 4AX1B 3KNRA 2OHIA 3SPUA 4Z7RA 4FSBA 2BFLA 1KR3A 2HB9A 3SD9A 2WYLA 4TZFA 5AXOA 5LCAA 4V0HA 2NXAA 3AJ3A 5ACWA 5LCFA 1BVTA 3BK1A 4GYUA 2BR6A 3JXPA 2YNVB 5K0WA 4EXYA 3PG4A 2FU9A 1A7TA 2AIOA 3L6NA 5ACVA 4TZEA 2UYXA 2ZO4A 2QDTA 4ZO3A 2DOOA 3SBLA 2Q9UA 3I15A 4UWRB 3IELA 4YSLA 4H0DA 2M5DA 5HIPA 3R2UA 4NQ6A 3IDZA 1QH5A 1DXKA 4D1WA 2BC2A 5AXRA 4BZ3A 5LS3A 1L9YA 2FK6A 4O98A 1DDKA 4XUKA 4Z6XA 3IE1A 2P18A 5HH5A 3X2ZA 5B3RA 1JJEA 2FU6A 3S0ZA 4UA4A 1Y44A 2WYMA 4YSKA 1WUPA 2GFJA 5AEBA 5A0TA 4RL0A 1DD6A 2FHXB 5FQCA 4HL1A 2NYPA 4EFZA 5ACQA 5HIQA 4KEQA 5FQBA 3AF6A 5EHTA 3MD7A 3IE0A 1JT1A 4PVTA 3ZQ4A 2NZFA 1X8GA 2P1EA 4GYQA 3X2XA 4C1FA 5ACXA 4UAMA 4RAMA 3P2UA 3SFPA 3I11A 1KO3A 3KL7A 2BFZB 2YZ3A 5EWAA 2NZEA 2YNVA 3ADRA 5EV8A 3WXCA 4AD9A 2BG7A 4TZ9A 1WUOA 2DKFA 5ACSA 2BG2A 5KILA 5LE1A 4FEKA 3IOGA 5EVBA 2VW8A 1MQOA 2Y8BA 4KEPA 1YCHA 5ACTA 2QJSA 4C1GA 4EYBA 2GFKA 5B15A 4D02A 5EVKA 4BP0A 3BC2A 5EW0A 2BTNA 3FAIA 2WRSA 5EVDA 2E7YA 1VGNA 3IE2A 3SW3A 4EYFA 3BV6A 3G1PA 1SMLA 1X8IA 1A8TA 5DPXA 1QH3A 2ZNBA 4RM5A 2WYMC 3A4YA 5LMCA 2P97A 2QDSA 3DHBA 2BG8B 4F6ZA 3PY6A 1X8HA 4C1EA 2BG6A 2FHXA 4UWPB 4AWYB 4Z60A 2OHJA 5K4MA 5HISA 2YCBA 2Y87A 4EYLA 4U4LA 3I0VA 2OHHA 2YNWA 2GKLA 4FR7A 5LLDA 4B87A 5LSCA 1KO2A 2YNUA 3PY5A 1K07A 3RKJA 4DIKA 2CBNA 4Z5YA 2ZZIA 2BFKA 2BFZA 4NQ2A 3IEKA 2I7XA 2M5CA 3H3EA 4LE6A 5AHOA 2A7MA 2Y8AA 3DHAA 3ZNBA 4Z67A 2BIBA 4JO0A 2FM6A 4TYFA 4NQ4A 4EY2A 3ESHA 4C09A 5LCHA 4CHLA 5AYAA 4NQ5A 1XTOA 2I7VA 2QEDA 4C1CA 4UWOB 4YSBA 2BGAA 4D1UA 4RBSA 4C1HA 5ACRA 4AWZA 3ZR9A 3AF5A 4AX0B 1P9EA 5A0VA 5KIKA 2YNTB 5IQKA 1ZKPA 3ZWFA
chains in the Genus database with same CATH superfamily
3PCTA 3NNDA 2GEDA 3KZNA 4UPDA 2JBWA 1IHXA 3F8WA 2DNFA 3HGMA 3TSYA 4UAVA 5BP7A 3AL2A 1NQTA 2JCBA 5EHGA 5GXGB 5JAQA 1WVIA 5IPFA 2A78A 3VU9A 4I19A 1ULTA 2VRRB 3T3PB 2WQ7A 3OBIA 4Z3KA 4KP7A 1P0IA 6NULA 3I13A 1NUTA 4E71A 1RWOA 4YV1A 1JTVA 2EF0A 2ZRCA 2PSHA 3PA8A 3C5WP 3WB0A 2CB0A 2GCEA 3CPSA 1QFZA 3SDZA 4XOUA 1BNCA 3UB4A 5K09A 2JC3A 3ROGA 1FLNA 4F9TA 3R9KA 1ZMOA 1ONOA 3NZEA 4NNJA 4D80A 1NJ1A 4ECAA 2DX7A 1T1GA 3EHVA 5FEUA 2GYWA 1YL5A 1JIQA 5LM3A 5BOVA 3V00A 5ELXA 3LP6A 2JW5A 3HSYA 1EA5A 1QPGA 1U7ZA 3NRZA 2R48A 1N6LA 1X2BA 1LNZA 1CT9A 2IV3A 4UOZA 2EQAA 3IUPA 4WDQA 4TS3A 2ZAOA 4WW0A 4RLQA 1EIWA 4OUKX 4J3OD 3OI7A 4CQMB 1APBA 4ANFA 4C7VA 4IVPA 1VFNA 2IY1B 3Q8EA 4P82A 4Z7RA 1KR3A 5BMIA 3F6CA 4Q21A 4A1OA 1G8KA 4I4LA 4RPCA 2ZVJA 4EIWA 5AVUA 3JAWA 3TTUA 4GD3Q 1XRPA 1U8XX 1M5TA 5DOZA 4L76A 1TYEB 2WZBA 3EGIA 1W5TA 1JWUD 3CZ4A 2DLCX 4LMAA 2ZZMA 1G55A 2IHJA 4NPHA 4L78A 4L57A 1A9TA 4G67A 5LUAA 1HLDA 1Y9ZA 2Z9BA 4GLSC 1GRVA 2ILTA 2NM0A 4B0EA 4AJOA 9GPBA 2HTFA 4UTZA 4YUWA 5A5EA 3L8FA 1ZOSA 3IV9A 2B4AA 4C0XA 1WP4A 4OHCA 3O8QA 1ZN7A 1Y9EA 4M9QA 4DTIA 1O9GA 3G9UA 2PRSA 2BEWA 1T2UA 3VA7A 1O4WA 5GV8A 4K2AA 1SE9A 5FA5A 1YMHE 1NVGA 1B8VA 1P2DA 3OY7A 3G88A 3FOWA 2FR1A 1MFPA 4YTMB 1LI4A 1AUPA 2I80A 1AXRA 1AUVA 4J7AA 4WCFA 5IAKA 5H1YA 4ZU3A 2ZAMA 3FLEA 2HRCA 3KFVA 3VR8B 1K06A 1U9IA 3E03A 2AZDA 1J56A 4Q4AB 3RFXA 4XKJA 4F38A 2OAGA 1K7YA 2OCLA 2Z8YM 2SCUA 4ZP1A 1TI7A 4Y67A 2Y1WA 1O58A 1E3WA 3NQ41 3G9ZA 4HRXA 2YLMA 5E3HA 3DL2A 5K0GA 4K9OA 4BQEA 3WIVA 3NW9A 4M0PA 5ADUS 1FP4A 2QUIA 4IKEA 1X8IA 4E70A 4HX5A 3TI9A 1KK2A 5G0SA 4FFMA 4W6QA 3MTGA 1YO6A 4A16A 1HA5A 1XQXA 5KTMA 1XZQA 5BWLA 3G0DA 4F72A 1SPXA 3CLSD 1RXVA 2OGUA 2JD0A 2PD3A 3LOPA 2RB4A 3MC9A 1Z28A 3DCGA 1MRNA 2OBNA 1PR3A 3AU9A 3NM5A 3B6IA 2PT9A 2DUWA 2VRNA 3B53X 4LE6A 4HDOA 3WG9A 1C79A 5CGZA 4BZQA 1OPXA 4JEMA 1S7GA 1HYGA 2QD2A 5ERXA 3FI9A 5KC9A 4YN3A 4YI3A 3I5XA 1ONNA 4DM7A 4F6LA 3QYAA 1Y8QB 2BHTA 4Q24A 2KFJA 3U48A 4LNIA 3RARA 4ZO4A 4C1CA 4GECA 2WYUA 1K6XA 4CQLB 1HH4A 5FR1A 2JI4A 5IUKC 1E9FA 1CS0B 2EEPA 5JLAA 3PZ7A 2FPPB 4BZZA 1GQFA 2R3SA 4LTDA 3THOA 3L7KA 3EH1A 4R8MA 5TS2A 2A4ZA 2DHEA 3D7SA 3T1YB 5JNSA 5CT6A 4WLOA 1KYQA 2JLVA 3BZBA 5C31A 1PR2A 3T7IA 1L4DB 3AFOA 1KF0A 2ORWA 5G4KA 4LV8B 4DMFA 3DD1A 4BPRA 4HDQB 1QYDA 4FDUA 3GBPA 3L43A 2D2EA 2FW1A 4K87A 2UVDA 2A84A 2XCQA 1GGMA 2EKPA 3SNKA 1QZZA 4M7RA 2LJIA 4UOEA 2JHFA 4YAFA 4D79A 4X60A 4UQLA 1JW9D 4UNIA 5FWNA 2JFWA 2RGFA 3HCWA 2OOBB 4BNKA 3RPCA 2JJYA 2D06A 1UAGA 1YRAA 1Q7BA 1M0WA 2UDPA 4X1YB 2YOHA 4R9NA 1Z4NA 2TYSB 2I6QA 1K8XB 3FPAA 4YHBA 3STWA 3BBPA 1N75A 4TKNA 1XLPA 2IEGA 2REOA 4DA4A 5G5HA 1V37A 1VLHA 1PFDA 1IGCA 5IJ9B 5GPBA 3FPLA 1QWSA 5FD8A 1M8GA 5K4GA 4KR2A 2XT0A 4KPGA 4Y6LA 1J0XO 3QHPA 4MQMA 4MIYA 3DUWA 3KC2A 1X1RA 2OHIA 4IZHA 2TMYA 2O0LA 3GN1A 5IEBA 2R7MA 3IBCA 1ECPA 1WKVA 1X42A 3GDHA 2SKDA 4IF6A 4HDRA 1U4SA 2Q3BA 1KYVA 2YWFA 4MRRA 2RHDA 3M6AA 5BNFA 3GH1A 5AT1A 4CF7A 2ZJ4A 4LBZA 2GFHA 2ZSKA 2WTMA 3IGFA 3Q0TA 3ZBPA 4I6JA 1R5NA 4UEWA 2JY6A 1N34B 1KOTA 1M2GA 3L0ZA 3PFFA 4MGEA 4ZCSA 2EL9A 3O4GA 3IXMA 1TYZA 5HJ7A 2ZIGA 3GRYA 1JCKB 5CG2A 2FK6A 4MYHA 1W9HA 1RPTA 2J0MA 1OLSA 5CFNA 4DV2B 1TY2A 1FDWA 1STEA 3QE2A 4KXNA 1Z22A 2FRDA 4IO0A 5FXMA 1WXHA 3UFBA 4HTAA 1HNWB 3H1TA 5G3ZA 2DBYA 3BFKA 3B1KA 2Q21A 3ZLTA 3JS5A 1BDHA 1R4ZA 3C39A 1C30B 3LT0A 3LZCA 1H9CA 4MDFA 3CZRA 5EJ5A 1XOIA 2QM3A 2VTEA 5E6SA 4UHHA 1QQ5A 3EXEB 1QYCA 4HQFA 3AESB 1G7SA 2NZEA 4ZVKA 2XDQB 5IJAA 3OIDA 3IR5A 2YXPX 1CHDA 5F1YA 2PUJA 2WV9A 4MTCA 1QE5A 2AA3A 2FDXA 4GLLA 2H2DA 1QDLB 3DE7X 2H0QA 4NBSA 4IHKA 3RCZA 4OGLA 4C5CA 4PIPA 2KZRA 1SU4A 2HV9A 4URZR 3RSGA 2XE4A 4D5GA 1WCWA 4TT3A 2PU5A 1ZJJA 2HC9A 3AKDA 3DT9A 3VPCA 1GRNA 3L5OA 1UPCA 1C4XA 3O8OA 1BXGA 3F98A 2FF5A 4LZLA 1KPHA 2E1RA 4Y6PA 3MD9A 2WX0A 4JWSC 1AK9A 4B2IA 5DP2A 1F0KA 1XVVA 5DW3A 4DXFA 1ZD1A 2FMXA 3BY4B 3HB1A 4JJFA 1ENZA 5CCDA 3HFSA 3KYBA 5EJAA 2A58A 1CC1S 3H0KA 2DQSA 2P27A 4IJQA 4EJ0A 3TUZC 4WNCA 4JJIA 5BMHA 5EYPA 3ZHQA 3UAXA 3TQQA 1B42A 1DRKA 2PSDA 5KHAA 4XDYA 3IUJA 3W04A 4Z9XA 1HPLA 3BVZA 5LWHA 5AUIA 1K3FA 4KFRA 1J1ZA 1EQUA 3TLJA 5BQ3A 1TFUA 1SXJD 4CWAA 1N9ZA 3BB1A 2ZTMA 4JH0A 3UKJA 2KVRA 1IQ0A 4LDTD 2R8BA 4NBNA 2YJTD 1XTRA 2B92A 4DNPA 3H2HA 5BQPA 1Q3HA 5KHOA 2H88B 2QY6A 3Q0IA 1KETA 2NU8B 2F1JA 1Y4UA 1TW3A 1Q0HA 2Z2IA 4U1RA 2Y3IA 4K1LA 2WXRA 2CEKA 4O02B 2JZZA 3R7QA 1M94A 1E9AA 3IEMA 2EYQA 4QPDA 2CXRA 1TY0A 3ICPA 1W5FA 1VSQA 4AWXA 2MDTA 1WMFA 2WU0A 1SQ5A 2GBLC 4YCAA 4AJEA 1JEQA 4G84A 3IURA 3MA0A 1LDYA 1GADO 5JYEA 4R1UA 1EFAA 3O83A 1EKXA 1KSGA 1IIBA 1PKEA 1D1SA 1I2CA 3RRMA 2PX3A 4W82A 2HD5B 1N2BA 3NHRA 3ILYA 3Q7RA 3ED1A 3EFCA 4I6NB 4JT9A 3VI3B 5ER6A 4BO7A 2Q0JA 3JZFA 2OO3A 4ZCTA 4B3HA 3B85A 4BYGA 4AN1A 2CXTA 4HJXA 1G9XA 3F9RA 1NI3A 3KSZO 2F43A 1UDWA 3QQ5A 5F9FA 3FPGA 1EVJA 4KN8A 1QLHA 2F1HA 1NIPA 2O3UA 2DY1A 2BFBA 5BN4A 2VT2A 4ZVVA 1OIXA 3P7MA 4HNAB 4MGIE 3GY0A 3DBLA 1JU4A 1PNTA 3ZDYB 2WDTB 5I9BA 4MVJI 1X70A 5KKAA 2KSQA 1BD4A 4MP8A 1BHQ1 4JJAA 1BTOA 3VJKA 3L4BA 2GAIA 1DAGA 4D8WA 1LBEA 1RAAA 3GI1A 2X86A 2KC1A 2YFYA 5HFJA 2WTNA 3R6WA 3UB2A 2BR6A 2FH5B 1B14A 5HVNA 5KHLB 3W5VA 3O82A 4FC7A 4RTOA 1K50A 1GPNA 1SBIA 3U26A 3C87A 5I3CA 3L3BA 3K1AB 2DWUA 4BFVA 1R18A 3UWKA 3E2PA 1Z0FA 1NXTA 1LWOA 3DLTA 4FBLA 5TJHA 3RHSA 3MWLA 1VG9B 1SE2A 1J9ZA 1LK7A 1U0JA 3GU3A 5L53A 1V39A 3OPYB 1H05A 3L0BA 1OMOA 5A4KA 1PFVA 3URYA 1QPBA 1Y3IA 4BVBA 3OFSA 5LZ2A 2RBKA 3DVLA 3KQYA 5EKSA 4QOSA 4TXLA 4TV8F 3VMMA 1RJEA 3E5HA 2YJZA 5DM4A 1JWBD 4US8A 4Z4HA 2BKAA 2ZTUA 1ULBA 4GH5A 1MW9X 4PK1A 3R9XB 4FOTA 4KQIA 1Q1BA 3AEGB 5CIQA 4HC4A 4DCUA 1Q10A 1UK7A 3DBSA 4GKVA 4A3SA 1HDZA 1A5TA 2XZLA 3UB3A 1REQB 2H9IA 2JBAA 2XZPA 1D09A 4AP5A 3Q2OA 4YRSA 3ECCA 5B1IA 3OLZA 4D0GA 3CB2A 4HATA 1B1CA 4D26A 2IHBA 1TM7E 2ZJZA 3OF5A 3ICWA 4AOFA 2MYNA 3OIWA 4A91A 1DELA 3NZUA 3I63C 3P2JA 1T9CA 2CVOA 2VYFA 3C48A 3KR0A 1Y34E 4DQOC 3SHQA 4R8SA 8GPBA 5JNRA 3BE5A 1JXMA 3H9EO 4HAVA 1NXSA 1GCAA 4B3SB 5D7NA 3RTGA 4YTNB 5I01A 4D44A 3MTDA 1DL5A 3F4BA 3IMEA 3PRHA 5TR5A 4J7CA 1T2NA 1JSXA 2X8BA 4RHXA 1V0JA 1OC4A 2ZK7A 5T4FA 5FBZA 2ZYAA 1ADCA 4C4AA 3QVUA 3I83A 4GX0A 3NXSA 2PUFA 4J0FA 4Y8VA 3U09A 4FFPA 3GH3A 3EVDA 4FLMA 3OPXA 1KEPA 3R0VA 4YLEA 4MQFA 1MW8X 1XRJA 5CX3A 4YROA 4JO0A 3ELUA 1C3XA 1XALA 4QRDA 2QEDA 2OGSA 1C1YA 3JYOA 3PRZA 1S89A 4C08A 5D84A 2H59A 4EMUA 3ZJ5A 1YBAA 3A8TA 1HF3A 4BP3A 2E6XA 1M2VB 2IS4A 4J3JA 4XYEA 2WJYA 1KRWA 3V1KA 1DPGA 1ZG3A 2CDAA 1DEHA 4PN3A 4TLEA 1SCUB 5C35A 1UQTA 1KFCB 3FCXA 2JK1A 2O8FA 4BE4A 3LKZA 1UPTA 2QN1A 3OQHA 4R1TA 2WKRA 3SE7A 2HMTA 5ALPA 1JJ7A 3CVJA 2O0HA 2P1RA 1AXGA 3ZKJC 1XIVA 3I1IA 2OG2A 2AGVA 1KL7A 2UVPA 3T3GA 3V6LA 4KHPB 1PL8A 3WLEA 1C1DA 1L0VB 2GN6A 1SG9A 1RI5A 1EAMA 5AKIA 3GT0A 4ZQFA 1G291 3FNEA 3LLUA 1VB5A 5TEWA 4RX1A 3KETA 4I50A 3OY2A 3EEIA 4RK4A 1QIGA 2YICA 4FZVA 1CP2A 2GZ3A 1D7OA 3X2YA 3NHMA 3T3OA 1KZGB 2G4LA 1UD7A 1LBSA 1CBUA 2RG7A 5EIBC 4MV0A 4RQAA 3KQNA 4W9GA 3LTNC 2ORED 5KAMA 5AUPB 2F4VB 2AS0A 1JQEA 2O2IA 1PEDA 2HLPA 2W70A 2G8NA 3PKJA 4BRSA 3RUAA 4BO6A 5IVHA 5K0NA 2QTVA 4W9RA 4D1TA 2A0FA 4ATNA 3BGIA 2KN5A 1L7QA 3WIEA 4RNAA 1H9BA 4TQ0A 3ROZA 2R65A 4OIMA 5AJTA 1EO6A 5IA7A 1YR9A 3KXIA 2Y1EA 4NBLA 1GYPA 1XMQB 1IUNA 4YGXB 1XZEA 1F17A 3CEJA 3C3PA 3PKZA 4K3CA 1T3ZA 3TQTA 3EW7A 1D03A 3U9LA 3ZTCA 4HSEA 2GN9A 3T9DA 4FGKA 4QXAA 4DK5A 4QU0A 4H27A 2E49A 3ABSB 5ACVA 2D3GA 2IXDA 4N5NA 2ZSIA 3OJWA 3S8YA 1EFLA 4CLEA 5EPEA 3MW8A 3HDQA 4L0QA 3X1KA 3Q8AA 1IJKA 1Y7IA 4Q3DA 4DA8A 1FDVA 1Z62A 3OZEA 1W59A 3MWYW 4TROA 3ZWWA 2G80A 4Q05A 2VPYA 2VKQA 3G8YA 4PRLA 4GYYA 2VJYA 4BNDB 4RCVA 4WLVA 2D74A 3PPAA 1P4JA 5AI0A 3D6FA 2QQFA 3NUZA 2B20A 3E22B 5CX1A 3K0CA 1I3KA 1FS6A 2OCBA 2N9UA 2MSWA 5LZ5A 1FU4A 5CDFA 1U0TA 1I4TD 1WCIB 1AGYA 4Y9TA 1JSZA 2QL7A 1UPXA 1W85A 2WMDA 4UU0A 5EWLA 3BEOA 1GV0A 2HLNA 4AF7A 3R3VA 3BCSA 3AX6A 4E2ZA 2FX2A 2WPDA 3BJZA 4QBGB 5C4IA 3ID6C 5ACSA 5B1YA 5KTOA 3DAYA 3M2PA 3VVMA 1SJED 2DH6A 4DSAA 2V1XA 4AKSA 3TRDA 3TRHA 3EYWA 1JRPA 1Z45A 5D7BA 1K68A 1IQUA 2PGNA 5AJUA 1E4EA 4LNUA 3G2HA 3KALA 3E84A 3EGXA 1E9CA 1M6VB 2ZULA 3TEXA 1JEJA 2HT6A 2J3KA 5ICFA 2LTAA 3B48A 2Y0BA 4YWJA 3KKOA 2A3RA 2VZ9A 4CM6A 4L73A 4XI9A 2OV3A 2HL6A 3T5TA 1L1QA 3S5JA 2WI8A 4BNFA 2OVBA 2UXDB 4HZIA 1L6VA 3K31A 3RYIB 2DAFA 2HTME 4WOKA 4Z60A 4OQLA 3SBXA 3G79A 3VGPA 4LFCB 2WE8A 4WA8A 1QHIA 1SE3A 2CF6A 3HM9A 3D6VA 2ESRA 2VYCA 3K9FC 4ARBA 4JENA 4DIKA 1JWLA 2ZRPA 3AI3A 3FGPA 2NTYC 2C3YA 4Q3KA 1NNI1 3A4LA 5JS6A 3RG2A 2QIPA 2HYIC 4KKJA 2LBPA 3KYDB 1IUOA 2IXEA 4EGJA 1QZEA 1CUYA 3C2QA 2IY0B 2WYIA 1HT2E 4KNYA 1WS6A 4MX8A 3KJIA 5F7XA 3AO0B 1VIAA 4JB2A 5KYYA 2NSHA 2P65A 4XFDA 3N8NA 1ZDXA 4I1OA 2IOYA 1PI3A 1DC4A 4KL8S 1HTBA 1E7PB 3U7FB 2F9LA 4X45A 4HJRA 1OBCA 1V25A 5K2MA 2BR4A 4K6CA 3ELWA 1FO4A 4Q12A 3HY3A 1CQVA 3OM8A 3ELYA 2I87A 4M49A 4LSGA 2TSYB 4F4HA 3U44A 3BK7A 1Z47A 2MX2A 3FOCA 3TSAA 2YUIA 4KQ2A 2PW9A 3GFGA 3WBFA 2BKEA 1MG5A 4H7FA 4PHTA 1O87A 3BXGA 2XUIA 2I2AA 3NIDB 2WOJA 1MV5A 5DPRA 4ZKEA 4DHZE 4IUYA 2XUPA 4HCNB 3UJ9A 1NYRA 1ENFA 4B4KA 4XLTA 3OOJA 1AS2A 4RGTA 4CIVA 4TZBA 5JHBA 5KNCD 2RGGA 4BVKA 3I76A 3A1QA 1JX6A 4MMYB 4QM7A 2XMQA 1FOEB 8ADHA 5AVKA 5FPPA 1MENA 2KKCA 4UREA 2WIKA 4UXJA 1D2NA 4A5OA 3SF8A 2AEFA 3LFHA 5K0JA 4YRDA 4BO8A 3M3PA 5TVKA 4YJ2A 2PH3A 3C8YA 4UCXA 3BWCA 3VKWA 2KDEB 1E6CA 2Y76A 4LTUA 5EL0A 3L82B 2O4CA 3U17A 2VHJA 2DU8A 1Y1QA 1D2MA 4XTRA 4AX4A 1X7YA 1DNPA 1E2GA 4I8XA 1IHYA 5G2OA 5FA6A 4H60A 3KUUA 2Y68A 1N5RA 3V61A 2ZUBA 1BVTA 4DBVO 4EG7A 1I6WA 2JX5A 1PNOA 3QLEA 3DVGX 1QONA 1TUIA 4A8JC 4D9JA 3AY6A 5K0WA 3Q7TA 4JLMA 1U28A 3UXMA 5AVTA 5DN6A 5F9HA 1QVVA 2QB5A 4Q9NA 1KOFA 2C7VA 3KE8A 4UWRB 3ESXA 3DLIA 5L3RA 2C4WA 3F4KA 1F2TB 3M1LA 3NTQA 3W8EA 2MU1A 2GARA 4EKYA 3B1XA 4F46A 1NSTA 1QHNA 3DXYA 3WI7A 1WUIS 4JMLA 3GZNB 1HMYA 3QGMA 4PCAA 4U8HA 5IZCA 3ZVNA 2F55A 3PE4A 2XYRA 4FPXA 3ULKA 3D4OA 4S2UA 3Q40A 1XLQA 5AI9A 1SZPA 1LFAA 1H1LA 1B0ZA 1Z15A 2NYPA 2M0XA 3CE9A 1J5EB 4PANA 3CBGA 3QKSB 1AXEA 2PWZA 4DHZB 1H22A 3WOVA 4CIYA 4PPFA 1KY5A 2PPVA 5HXAA 4M4SA 4QXQA 1HX7A 4LSWA 3LP5A 3ZDZB 4D9GA 1YULA 3VUWA 2CMKA 4LK3A 5BWBA 1GU7A 4NBTA 3WQBA 1MOQA 4HG2A 4FJYA 1TF5A 5JNLA 4YRRA 4GP9A 1ZC3A 3CU5A 5HIMA 4KOEC 2JPHA 2LHDA 1QG4A 2EKDA 2AMVA 3JATB 2WNIA 2K87A 3LIIA 3IODA 4Y1RB 3S5UA 2WSSD 4KDLB 4NEGA 4C1GA 3LLSA 5AHKA 3J81k 2VP9A 2WWIA 4G0PA 1ZGHA 2CL7X 4NZPA 4DBLE 1P2SA 4AG5A 1QDEA 1K7EB 2XSZD 5FNVB 5E4JA 2LVOA 1RC0A 3UUWA 3KIPA 2IXFA 3ROQA 4P8RA 3QOWA 1BYIA 3MFQA 4E1BA 4Y2TA 1ECLA 2BG6A 4Z1OA 2ZUVA 2H7CA 2FHPA 1VPWA 3DXZA 1I4DD 1K5GA 1O95D 2BD0A 3A4NA 4EYLA 2ONCA 1C78A 1T0PA 4RHCA 4M22A 1V48A 2B4QA 2E3JA 3DMFA 2GBLA 1PJLA 5DTQA 3AHJA 1C2YA 3I9FA 3DHYA 1CQJA 1VKNA 3GMTA 3I58A 1KEKA 4IDBA 4AQDA 1C3JA 4HZUA 3MRXA 3B2QA 4K46A 2AX4A 1CRQA 1ID1A 3KE9A 4P4GA 3UJNA 2AR0A 5D86A 3EQ6A 5BN3B 5SV2A 4AXBA 2PQMA 3HEMA 4AXXA 3GIWA 2FF7A 2FSIA 4NYIQ 3EXAA 2VSXA 1JG1A 4N03A 4FMDF 4F86A 3REQB 2OSBA 1KGDA 4BVUC 2XB9A 3TN7A 2Q49A 1N77A 5C8YA 1QZ3A 4QIHA 5F33A 3P96A 4M0DA 2AG8A 3Q8KA 4WBNF 1D7AA 1OQQA 3MHPA 2A5JA 3VYSB 5CGQB 1GGJA 2YUTA 3ZUNA 4X0EA 3N7UA 1BJRE 3BA1A 3K30A 2X15A 1KK1A 2WDZA 1QIMA 1QFXA 1JEEA 2GN0A 2BKRB 4FP9A 1J2UA 3KG2A 5IJ0B 5TB5A 1M9NA 1I2BA 3O2QB 3V6EB 2O8CA 1NT4A 3PQEA 4D0RA 3EPHA 2IX3A 1OBOA 3MRTA 5FPYA 1SD1A 2A4KA 2KBEA 3O8RA 5TC4A 2QRQA 2VP6A 3ZRFA 4KUGA 4NCNA 3FKJA 2NTSA 2RGWA 4OZAA 5TIIA 2W8BB 1WF6A 4CN8A 3T1OA 4ZJUA 5JAPA 2DUNA 3IPLA 4EG8A 4R31A 2QIEB 5COAA 7ABPA 2HEIA 4YJ3F 1RI1A 3BWBA 4RZ3A 4FB5A 4GWLA 2FN4A 2Y8EA 5DBIA 4K6OA 1PWEA 4Y9DA 4ZVRA 1P33A 3K32A 4QTXA 4OHXA 2P4QA 3EQ8A 3ZV7A 3SZ3A 4WK4B 1AVTA 3N32A 3GC6A 5IMBA 3ZE9A 1S9HA 1P9OA 2O3TA 3LHKA 1K8QA 1PDOA 4A5SA 4R0MA 3LRTA 4IM0A 3PDHA 4AV7A 2XH8A 4LYEA 4K9QA 4JBLA 2KS6A 3JXPA 3BDIA 1CK1A 1WQ4A 2QTGA 4B33A 2W6ID 3RS2A 1YZ3A 2L0FA 2P9EA 1O5TA 5D3IB 3EXIB 2IGTA 1FCJA 4XX5A 1H0KA 2OAP1 2PUBA 3LRPA 1PT5A 2DOOA 1KEZA 3T99A 4B46A 4DLAA 1MHHE 1PZFA 4FTWA 1II9A 1EK6A 4DC1A 2NCNA 2YBDA 3COPA 4OVUA 5FI0B 5CA1B 1DTWA 2W48A 1BMFA 4XZ4A 3ZDXB 2EFGA 3HFGA 5B3RA 1HRDA 3N6XA 1MBZA 4IUCS 5ARBA 3EECA 4QT0A 1BE1A 2QRKA 4W5HA 2DFLA 2UAGA 5KTKA 3G9TA 4LI0A 4WDRA 1G2PA 3FD8A 4GI2A 4WNAB 4F84A 3OHMA 2HRZA 3UWOA 2FP3A 3D8UA 2WP9B 2ERYA 1D4ZA 1CXZA 3H97A 2XUHA 2OYCA 1DHTA 1J8DA 4G25A 2HMSA 1CJVC 1VRAB 1BDJA 2HU5A 2ZPAA 3SKXA 1KH1A 2YHEA 2E37A 2B9VA 3DFIA 1H2RS 1BN6A 2R96A 2C00A 4MNTA 5LLIA 4IMPA 4UFOA 1PJCA 5DM0A 1JNYA 3T61A 1L4EA 5K3OA 3BQMB 4NZLB 5BV2P 1CR4A 4ENQA 2AD5A 1ZITA 5B6IA 5K6RA 3AR9A 3EXHC 2WXIA 1M1NA 3BTSA 2B8JA 5BUQA 4WOCA 4MV6A 2WSLA 3QEBZ 2KDMA 2R8ZA 4IYRA 1PR1A 4G4SO 3BOSA 1G6Q1 4L75A 4HB2A 4E5KA 2F1IA 4MKFA 4MRVA 2QSUA 4NYJR 3AKCA 1JLSA 4AFNA 4FWTA 1J8VA 5FIUA 1AHPA 2OTCA 3IUQA 5LN1A 5EZQA 3H9QA 4QUEA 1BYUA 4GZ3A 1YASA 1J2RA 4M00A 1HR0B 4CDGA 4UHKA 1BDMA 1U0RA 4Z0TA 4V1CA 2V58A 4L9SA 4Y98A 2WDRB 2X6RA 3KSDO 3H87A 1DOHA 3KAJA 4PZYA 3SLKA 3MT0A 4KO4S 2J6CA 4C87A 3VUXA 5CCEA 5JSFA 5E8RA 1ULSA 4L3OA 2GA8A 4UEJA 3E82A 4ZXPA 4C7YA 5DNWA 4MIKA 1OXSC 1P4GA 4ZHPA 1UEJA 2Z30A 2W7TA 1X8XA 3TRKA 3R2TA 3FLBA 4ARZB 4IOKA 1J0AA 3B6EA 3COWA 1Y1TA 3DH0A 3QWZB 3N3AC 4D0NA 1BEEA 3U62A 2J5BA 3WS7A 5TE9A 4TMWA 3VH4A 4FZJA 4HNSA 3IHPC 2SKEA 3PUKA 3QUSA 2JJ2A 1Q15A 2PXCA 1O96B 3X0WA 3RKSA 3L0IB 3TPCA 1JEYB 3I5AA 4KN9S 3VPAA 3DDNA 4ER6A 2VF4X 1W48A 2A59A 3KH0A 3DUFA 4CMKA 3CN9A 2P0EA 5DX8A 1NBMD 3B2GA 3PX7A 3F9IA 2VNKA 2AQ2B 1LLFA 1MZPA 1JDUA 4AJLA 2JLSA 2IPAB 4KREA 4IIXA 5DB4A 3TXXA 2HXYA 1ECCA 4YRIA 3LVBA 1HL7A 2NBUA 4K7WA 1FYVA 5IKOA 1LSUA 4KYVA 4DHJD 1Z5GA 2DFTA 1C8VB 1CUGA 2P2ZA 4MCJA 2DAJA 2Q5IA 4G2NA 4L0CA 4DNOA 3TF5A 2VF8A 1TJ5A 4ZHOA 2DYBA 1ZBQA 2PGLA 1XN1A 4AJNA 4Z5ZA 1KR5A 2XGJA 2GM5A 1C14A 1VBMA 1K92A 3VH2A 4GWGA 1XEAA 3CZ9A 5JO0A 3W79A 4JITA 1L4HA 4MS3A 5FLYA 2ZI3A 1PFKA 1Y98A 4QOEA 1PR5A 1G4UR 3FHTA 3BC1A 4A4DA 4LKOA 2IS1A 4OHRA 2FPKA 1JWAB 2H1FA 4YRKA 1T8TA 4C00A 1PJAA 2POQX 2KQ4X 4CL3A 2VYND 4XFJA 2GPWA 1QOZA 1V80A 5EXDA 3V1UA 1UQRA 2AZTA 4Z86A 2GN2A 4P92A 2ZKLA 1XPOA 5K6TA 3UNXA 2LHEA 4UM8B 1FQWA 2QQ5A 4OL0A 2KD0A 3D8SA 4C7OB 1Q19A 1GAQA 3K0SA 2XXAB 4BNYA 1O8CA 1ADJA 3L0OA 3IC5A 1PDXA 4Q93A 1N5LA 4BB6A 5D5QA 3ML9A 1J8CA 1P1HA 3G6WA 3IP5A 5MN6A 1MF7A 3EQZA 3KZ1E 4PQEA 3S0ZA 1PCXA 3WNQA 5JAIA 4DV6B 4N3NA 2ZI7A 1T9AA 4N6GA 4XM0A 2XLBA 5ICSA 1UFRA 3LPDA 4IVRA 2EDCA 3RVQA 2LVQA 1CEQA 5A6VA 2V7QA 2CXNA 2F3UA 5K0TA 5EHTA 1ATZA 2Z0DB 5MGNA 4UVEA 5AJVB 3X1YA 3H8VA 1JZSA 1RYJA 2DEUA 2X8LA 4ZAVA 1GXSB 5FK9C 4R5HA 2PNFA 2HXGA 3SMVA 4EPRA 3T9EA 3WIUA 2AFIB 2NIPA 3PRKE 4Z99A 4NLLA 1R4NB 3KV3O 2JFUA 2X8XX 1VLVA 2QNIA 4KVFA 3L9WA 3PJGA 3MWDA 4XD7D 4NWIA 3K9NA 1FCLA 4W9FA 4US9A 5IH3A 4RFSA 3ZV4A 3EGOA 4BFTA 1ZBDA 4WKGA 1CLUA 1DEKA 3PVCA 4CMGA 3ADOA 1T3QA 4NXNB 3ACCA 1L5YA 1XZIA 3Q41A 4BHTA 1YQGA 4UU7A 5JZVA 1BO6A 1XROA 2VG8A 1EXMA 5KB3A 4P31A 3NVYA 1UBCA 5IM4A 4EMBA 4QQKA 5DYGA 1XTZA 5J2UF 4QO8A 4G6ZA 3QKRA 4RZQA 3RHZA 3ZVMA 1G16A 2JGDB 4WGFA 3TM5A 1Y82A 1X1BA 2H4XA 5DM70 3CEAA 3IEKA 4DJDC 5LXIB 2G17A 2WTAA 4JBNA 2KAJA 1EGAA 4IM2A 5DNCA 4H0NA 4KH1A 4JLJA 5HG0A 2CMFA 4OD0A 3QJ5A 1QIDA 4HJGE 1DP4A 2XUJA 1NUPA 2W4IA 1XZFA 2ZT5A 4CHLA 2HSZA 3JQGB 1IE3A 3KB2A 3MJDA 2HF8A 1HMPA 4HQOA 3CT4A 3TZEA 3O13A 1Z13A 3AJRA 3AZPA 4NJ6A 4FVTA 4FEYA 4X20A 4EG3A 3RRFA 4JBHA 4D4MA 3SVLA 2FP4A 4W9KA 3ADCA 1T9HA 3QI7A 1P7WA 1JJTA 4OZBA 3A3YA 1GGHA 2YMPA 1Y7HA 1EJ2A 4NIMA 4G56A 1EE9A 1VYHA 4WEQA 5EFZA 1Z0SA 1RR6A 3CZPA 3OFJA 4BNJA 5F64A 2GO7A 5JUWA 1VHLA 5FO0A 2QRLA 3DZFA 3ZY2A 3WICA 2HA6A 3P27A 1ZHHA 1ZX1A 4A8JA 2NZWA 4JASB 4AZ3A 1QQTA 4OFXA 3L02A 3PFGA 3F47A 1VHTA 2XUZA 3WFIA 1IOVA 1J0CA 1U80A 1XA3A 3ZH9B 1KYIA 4G5HA 3MWEA 4MGIR 5AW8A 4I5FA 5M29A 4KE7A 2QTRA 2A0YA 4D96A 3EGEA 4LE1A 1TFRA 3WJ1A 2JJMA 3HKEA 4E07A 2QLNA 1QFMA 1M34E 1AUOA 3DZGA 2P7HA 3A4VA 3DHVA 4OHPA 1TPYA 2A14A 2BHRA 1DWOA 2OAEA 4DJEC 4NENB 1V47A 4FOOA 3C85A 2ZR7A 1UJ6A 2R00C 4EFNA 3PA6A 4JL8A 2V9CA 3KYJB 4CRWB 3ICVA 1WXXA 3TKAA 4N9QA 1TKYA 4TLDA 1USGA 1UMBB 2CLKB 1ZW1A 4ZYNA 2VQFB 2Q3CA 5FLXA 3GOEA 1VHDA 1ESFA 1UDCA 4U0KA 4XRRA 4QPZA 5B1UA 4Y6RA 3H9CA 4P3NA 2LR0A 5HK8A 2KDFB 3W5DA 1J4AA 1DJLA 2BFLA 4EYQA 1VECA 4GZ5A 3GA7A 4NOKA 2R60A 4J0JA 4Q47A 3DA8A 4HXEB 3NCHA 4MUYA 4MSQB 5FWXB 2Z6VA 1GL9B 3B5IA 2BN4A 4ZEVA 4S04A 5JMOA 5B7NA 4JWUC 1F14A 1YTLA 4EEXA 2P9BA 4BAZA 3VO9A 4HS9A 4YRMA 5IEJA 5D5HA 3G5UA 3TBKA 3U3OA 4W5OA 4GF5A 2RBEA 2XUFA 5CB4F 4N8EA 4BMDA 1QH5A 4ZODA 4ZEWA 2UUAB 4O25A 1X8LA 5LS3A 3WMEA 3OOYA 1LJLA 3W7AA 3SEZA 1QC5A 3PWSA 2QUBA 3L40A 1OX4A 4GKAA 1PTJC 3FVWA 5KYXA 2DPHA 1ZH6A 3DDZX 4F1WA 1GUBA 2B4TO 2GPTA 4ZVPA 4TSRA 4C6RA 1KHHA 3CWIA 2W9NA 3U3KA 1Q7GA 2I1JA 3KPYA 3O6VA 3PFIA 1M74A 3I34X 5DPMA 3QUBA 2WSMA 3AI7A 4TRRA 2YCLA 4YMTA 4I9GA 1E7YA 4BUJA 4XE5A 3FKQA 3M3DA 4WZAA 4G0NA 3KLPX 3T54A 3TDMA 1XYVA 4U2EA 5CH3A 3TPZA 3RUIA 4EL5A 1FNVA 4PQFA 4I6LB 4BO0A 4Q2JA 4MRMB 5KILA 4JI1B 3DMRA 4WHMA 1B1ZA 4IYJA 2G9NA 4AO6A 3GRKA 3Q8MA 4KEPA 2BBOA 3AKEA 4YRTA 2V5UA 3KPJA 1PFYA 4YJGA 5E0KB 1R6VA 4RYLA 2GJ4A 3QEOA 1HEYA 2PJDA 3GEBA 2VCYA 4LJ4A 4BGDA 1SBQA 3DKRA 4PIMA 3WIBA 5SZIA 3FFWA 2O7NA 1I4EB 2IHUA 5E1OA 3T1HB 1KO8A 1U3GA 1XCLA 2FSVA 1PJBA 2P1ZA 3I6IA 3PNBA 3GIDA 4TXMA 2ZXUA 3N9IA 3GUVA 4MO9A 3A3KA 2C42A 2W2KB 3TGPA 2B6HA 4WBXC 1KMMA 1XLTC 2B83A 1Z4PX 3TFOA 4QDOA 4N6NA 5HGXA 5IC6A 2FPGA 4D9FA 1Y6FA 1RPNA 1P6QA 4MVJH 2V6FA 3PPIA 2GJAA 2B0CA 4FDLA 3WAGA 5KPJA 3WMFA 3UI3A 3K6SB 1HV8A 1Y5LA 4MW5A 1E5WA 1MNQA 4WECA 4C6TB 3ZWOA 1NKVA 3OE4A 3REOA 2GILA 3RV3A 2LP4Y 1E92A 4JOCA 4INOA 4AS1A 3F3KA 1IP9A 2ZUSA 4FX5A 1E3MA 2ADOA 4MGHA 4LYFA 4V0LA 1EBFA 1NXPA 3K96A 4GPAA 1NVKA 1Z6ZA 3AEXA 5M04A 1JVNA 3I53A 4L4ZA 1WP9A 2J3MA 2P6OA 3W4IA 3KELA 3A6PC 2OKCA 3WALA 3I1JA 3LBIA 4OLHA 1F0NA 1NVBA 1BEUB 2QF7A 4BJ6A 5TQ0A 4C4VB 2PPHA 2NMVA 2D4AA 4GMHA 2KLGA 4S1TA 4PQGA 5IVDA 2VVTA 1SHUX 1L4ZB 3K1TA 3KQOA 3EZXA 4YUXA 1BVRA 3SGLA 2I6TA 4W9EA 2EFDB 3B3FA 2WU5B 1VKZA 3ZBUA 2EX0A 1QFYA 3WAMA 1BVYF 3IP7A 2FPXA 4MARA 3A1UA 3K2IA 4YXFA 1NY5A 3OLQA 1VJ5A 4PS7A 3RABA 3FKYA 3H1BA 3N8KA 3IV7A 3L7OA 4JUBA 2VDLB 1HUQA 3I6QA 3SD7A 3KQWA 2IU4A 4E12A 4C7BA 4LRQA 3GAMA 1E2JA 1G7CA 1GQ2A 1LQTA 3STHA 3N3BC 1GG3A 4U7WA 1W0CA 2BYFA 4BPBA 3PLAE 1H3NA 2V8BA 4CLOB 1XEXA 2HWWA 4YMSA 4XQ0A 4BQSA 3THSA 4M38A 3E8SA 3ZHOA 4KAAA 1ZAYA 2ZIXB 3N75A 4MJ7A 3BSWA 3HY4A 1P2BA 3EXHA 2Q3MA 4NQ6A 2HNAA 3Q8FA 2IL1A 2JGLA 3MQ2A 4YT2A 4AYTA 2RG1A 3OT1A 3HVZA 2DT5A 4LQ4A 1FFCA 1FTWA 1JQLB 2AEJA 4FYWA 2LCIA 2X3YA 1CR6A 4H31A 4N0EA 1GM5A 2BE7A 4M0FA 2AX3A 1GKUB 2QT0A 1JKJB 1Z82A 1J5PA 3KR2A 4OHYA 3B9QA 1NGSA 1IEWA 4CMAA 4RPLA 4EPXA 1CIVA 4LS3A 2FAXA 1WHSA 2YJNA 3I11A 5EJ4A 1B26A 4IV0A 5IYZA 2HDEA 1GNVA 1NRJB 2W00A 2W43A 4CG0A 3GFOA 1V3TA 2Y1KA 2K1FA 3Q98A 1C7ZA 1P5RA 5L4NA 1QORA 1XJQA 3M81A 5AJZA 2MYUA 3SPXA 3B5JA 3AHDA 5G0WA 3FCUB 5AM2A 1TA0A 5ADVA 4XQCA 4UZSA 1DC6A 3HL0A 1K0FA 3TMAA 5AXDA 1YNTE 4L95C 1SR8A 4XEUA 4D3YA 3WIOA 1OFTA 5A04A 3FAIA 2JJ8A 4IH1A 3Q7SA 4HNHA 5EVDA 1E9EA 3EAQA 1IH8A 2F1KA 1DOYA 4MROA 2W2NA 3OA0A 1HTWA 3MMPA 3K15A 3FZQA 3PI6A 4H7KA 2FSUA 1MNAA 4ZDJA 2P41A 1ECBA 5HIJA 1I7SB 4OB7A 3MXOA 1K3TA 3CMCO 3WRWA 5JDIC 1H8ED 1ZGZA 2X7HA 4LNOA 2A1IA 2DUMA 1E8DA 2QTHA 4B87A 1UDAA 5PNTA 1YVRA 5EESA 1P5FA 2D7CA 1KHTA 1XP8A 2GBRA 3GJ3A 1PN3A 3EFHA 4NNOA 3T7SA 3LBYA 2WS3B 2ZYHA 3UWPA 3B8HA 4PLZA 3H1FA 4E74A 1YCDA 2M5CA 4RD6A 4C7JA 5KX5B 5BO5A 1MEEA 2A7MA 4BLTA 4NU6A 3DLBA 4MGZE 3H75A 4RESA 3UT5A 2O8DA 1TKCA 4ZICA 4NMHA 3FTQA 4Q4LA 3ETHA 1PZGA 3QAQA 5DTMA 5IS2A 2QVGA 2FUKA 3ZUGA 3N39C 4OM8A 3DVRX 1UH5A 3U1TA 1LFDA 4FZ3A 1NP7A 1H85A 3HLYA 2WOOA 2CXOA 5GONA 1IOWA 4KDEA 5K99A 2IPOA 5AWFC 1XZDA 1LXDA 4J0HA 3VR4H 1WETA 1YNOA 3A3PA 1TM4E 5FA8A 2A1TR 1X1CA 3LPAA 1ZFNA 1T0UA 3WWZA 5MFZA 4L4RA 5CD9A 2OCAA 1TKGA 2RKBA 4P7IA 5HCNA 3IOBA 1PX0A 2VHTA 1RE0A 2K5PA 2GYVA 3AU5A 3IQDB 4R2IA 5I8PA 1TRHA 4FILA 2I6SA 1OU0A 3GMDA 4QDUA 4EHAA 3H83A 4RCOA 2R7LA 4YPOA 4Y2PA 4N1AA 3S2IA 4D92A 2Y99A 3UHPA 3ZHRA 3GRUA 4NH4A 2MSDB 4BLWA 2V7PA 1IBMB 4PINA 3Q8XB 3DE6X 4DEXA 3PQ7A 2RGEA 1OILA 2W6JA 3DGEC 4QICA 1I5OA 1RWPA 3PSEB 2YIMA 2QM8A 5LM6A 4G9GA 3T7EA 3PS6A 1XZKA 5JD5A 2FEKA 4D9IA 3SPUA 1V16A 1F8XA 5CP8A 5ACWA 3X1MA 2PMCA 1WABA 3PLUA 1XZNA 2IYEA 4QGSA 4ERNA 1JHDA 1O6BA 4KC0A 1JRLA 2ZXFA 2O7RA 3UIOB 5HF6A 3RYCB 3FSJX 4IDHA 3PUXA 3UH0A 3K9GA 3HUFA 3L0WB 2RHWA 2ZU6A 1S8OA 5LP6A 2NO7A 3K9HA 4U3JB 4GIVA 2XMRA 5L51A 3LHDA 1TMOA 5AM0A 4ALNA 5TPZA 1KEUA 1PK9A 1OPRA 3QWAA 1M1YE 2FSFA 1K7CA 4MW7A 2L1AA 5FHRA 3A7EA 3QNMA 1CQIB 2E2WA 1W4AA 2ZBFA 1SIFA 2ZGVA 4I6GA 2V45A 4C06A 3JD0A 3L9XA 2R86A 2XA1A 1TJEA 1EZ4A 1OWNA 3KB1A 1Z0ZA 2AUMA 4ALIA 1WUPA 3HXLA 4D6YA 3O65B 3CNOA 4LLGM 4CKWB 1HOTA 4ZT4A 2MJLA 3AF6A 1ILEA 1OA1A 2XYGA 3W3AH 2QQEA 2NZXA 1DS6A 4MQ4A 1YJ8A 3UGKA 2XNDD 2ZBPA 1PYOA 2J48A 5ALWA 2MINA 3FOBA 2IOHA 5ADWA 3IJEB 4AJ4A 3RS0A 4OLBA 3QY9A 1L2NA 1OZAA 2I6UA 2XNJA 4AG3A 3AB5A 3ZKWB 1SAYA 1VG0B 4KN6A 1WYGA 4C0JA 3NU1A 2BDEA 2IZ6A 1EQ2A 3QCAA 2FQQA 3K1JA 2BGKA 2VSOA 3CX4A 4AF8A 2HOQA 4O2BA 3L8ZA 1KI6B 4UARA 1H2HA 4YXDB 5EP4A 2DOKA 3OX3A 4FR2A 3SW3A 5CLIA 4CKBA 2JLZA 5DCUA 3CKMA 4IRUB 1M2HA 4ZOLB 1R7RA 2R9VA 2VFAA 2W42A 3GAFA 4FLEA 1JILA 5JTUA 1P3DA 5CYOA 3V2IA 4EKEA 3C3DA 1NF2A 1EZZA 4QAJA 3I12A 2QZSA 4L4SA 3C1AA 3UC5A 1M1YB 1V9JA 2FUCA 5TT0A 2GFQA 4GEKA 4RSMA 2EJWA 1TNDA 2XVXA 3F46A 4J49A 3ZZMA 2FPSA 1G64A 4Q02A 1RADA 2WXKA 2DCMA 3D5QA 3B3QA 2TSSA 4OREX 1RRMA 1WY8A 4HN9A 3PL1A 4NH0A 5EJMA 5DLEA 4L08A 2V65A 3L7NA 5I5GA 1E2QA 3NBFA 3WRVA 1QP7A 3CJTA 1Z0UA 2CUZA 1MB3A 1RCTE 1ZZGA 2R00A 3AEKB 3QK0A 2ZJ3A 4XWAA 4WWOA 2Q8QA 4LXYA 5IW8A 2ZS8A 1EDDA 2YWRA 4H3SA 3DB1A 3P4XA 3E58A 4F2DA 3P9NA 4E4YA 5C4GB 2GOYA 4PPGA 2O07A 4FWBA 4MR9A 3RU3A 2LFIA 2YKGA 4W5RA 3D3NA 1E9SA 3WQSB 2OENG 3HN7A 5T5QA 3NS8A 1IN5A 2FSSA 2VQSA 4QOIA 5ARCA 4X95A 4AJ1A 1NUAA 3PZBA 2P35A 1TU3A 1SK8A 3VKUA 1MTOA 3L01A 4DMKA 1ZHOA 2CB9A 4RCYA 4JP5A 1VKHA 4AD8A 3EE6A 1USUA 3HK2A 2Z57A 3EGDA 4QVGA 5DHTA 4CT5A 4F56A 4RH6A 1C7EA 1YRLA 3C1UA 5EDSA 4PTYA 4XGKA 4MS1A 3P97A 1PTJA 3VFKA 4WSOA 1WEHA 4WASA 1AZSC 2UXCB 4ID9A 2GHQA 3P4UA 2O5CA 2NS5A 1I35A 1E8NA 1P98A 2F3SA 2IPXA 2HB9A 1D5WA 3FYHA 3FTFA 2GK7A 1L2TA 1XVIA 3PYLA 3H3XA 1EINA 4FHFA 1JKMA 3FOAA 3BHNA 1G8MA 2B4KA 3GUZA 3HXKA 1Y8AA 1GPWB 3O8NA 3MPUA 4RLHA 1SUWA 2Y1OA 3CUVA 3MVEA 3X1XA 3OLYA 5ERYA 4Q1VA 5DIZA 2QUAA 5C8ZA 4RDXA 3JR7A 2ZSAA 2Y5PA 2P2SA 2MYTA 4U4AA 5HBRA 5HJ5A 3PC7A 5A1TA 3LXMA 3FYUC 4FCVA 2HA2A 4BWFB 3TIXA 4DLYA 5DXJA 3SIWA 1W96A 1DAFA 4QBKA 4LOLA 3DMGA 2R79A 3R3ZA 5HKOA 1B8UA 3KTFA 1LPMA 1JA1A 2HTHA 4FYHA 1K8RB 2FWNA 4XPIB 1G5QA 1IVYA 2D2IA 3RBVA 5B30A 2ZIZA 3R6DA 4P81A 2BTEA 5LMNB 1XLTA 2BFZB 1PL0A 2QRVA 4CM8B 1K66A 4BTVA 2BSXA 4CZ2A 3UEOA 2ZB8A 4CKYA 4WXYB 1D2GA 4PG4A 1SVUA 5F35A 2J59A 4D7AA 1P2TA 2NV2B 3E2IA 3EWNA 2HHJA 4D02A 1J42A 1W29A 1P7CA 5C8VA 2G25A 3DKVA 1TEXA 3EISA 4I9HA 4WH4A 4KCGA 1S5PA 5A4AA 5LQJA 3ZDCA 1ISMA 3PNSA 4EZEA 4KXQA 3VX4A 2OCIA 4MQEA 4JB0A 4G81A 2BKUA 2PUDA 1NN0A 1MJHA 1XDUA 1JJBA 2EFHB 5DI9A 5GADl 1FNBA 4M60A 1WF9A 1RRVA 1DIGA 2Y87A 2VPQA 3SP1A 1AS0A 2N9PC 3RS9A 2FDCA 1KRXA 1L1EA 4K9PA 1E1RD 3OD1A 4XUCA 5EUBA 5KOHB 2Q7OE 1Z29A 1EMDA 3C1OA 4EJSB 3KKPA 1Y1PA 3KKEA 1R0YA 2PZAA 2XWPA 4ZYZA 2FZCA 3ZTTA 2KWCA 1J22A 3P0FA 4DSOA 1YS4A 3EC2A 5AH0A 2GJ8A 1GPKA 4PHHA 4KPUB 4HYTA 4RPKA 4CKEA 4B7XA 1QIEA 5CTJA 5JY6A 4U8GA 4NQ5A 2W6ZA 4PGMA 4LXIA 4Z53A 2ACKA 4U9IS 2FWBA 4WESA 2W2OA 3VNUA 3NONA 2PWAA 4QDJA 1PWYE 1JIJA 1X8KA 1MJNA 1JFFB 6REQA 5JAMA 5DLYA 2R6HA 1I2AA 2GK6A 3DT6A 3ENEA 3AVQA 1VMAA 2ZNVC 2Z2JA 4ER7A 1VE7A 3KSRA 4UBOA 1L8AA 1OH5A 1Q1NA 1QYVA 4NEQA 2XF8A 4R5MA 1XZPA 3PU6A 3SVTA 1GNRA 4BAUA 1NDHA 2OQVA 4QT4A 2CMGA 5EJ7A 3N59A 3OETA 2PR7A 3H6KA 3TAXA 4MUHA 2EX1A 2QJOA 3NHEB 4IM7A 3DTVB 1IM8A 2AN1A 4HS4A 3FPCA 1GFZA 2BS3B 4FNMA 2E85A 2ZYDA 2QP4A 1I7LA 1YAHA 4GDFA 3QH8A 3RANA 3U4DA 3L4PA 2QLFA 3EIHA 4YDRA 5EXXA 4N3GA 4MYRA 1GRQA 1RSZA 1K1EA 1W35A 3H9BA 1U2PA 5DK4A 3VQIA 1V4NA 4ZO6A 4LY0A 4LFBB 1T5XD 3IDFA 2VWPA 1CG6A 5D5PA 4DCVA 1T24A 4M9SA 3TTVA 4OBEA 2FNJB 2VWHA 4QHTA 5J1SB 3CX3A 3MTAA 1Z8HA 13PKA 1FDUA 3LQRA 4LJSA 2FPWA 2VPIA 4P33A 4UVHA 3WXMA 3NBKA 3MHTA 3HJNA 1J1UA 5AK4A 2I54A 2QBYB 2X1VA 2NVWA 5CNMA 4Q66C 3S8EA 3OPNA 4OHBA 4QGGA 5JQGB 2GZ1A 3EC7A 1IJFA 4IDGA 4HGRA 2JHGA 2R6ZA 4BN4A 1DI0A 1N6KA 1IK4A 3T7TA 3VPHA 1MPEA 1NG9A 3IIKA 4RL4A 3SDBA 1FYFA 1Y63A 4K7UA 2VPXA 1WNFA 1YHYA 3Q87B 5FUBA 1LJUA 3ESYA 1V4BA 3M5WA 3NEJA 2LXCA 2CLMB 4YT8A 1SZCA 5KSZA 2HK7A 3NIFB 3DDCA 1DBWA 4KSCA 3Q3OC 5AK3A 1Z3CA 2OLKA 2LDXA 3PXDA 1BU8A 2O3JA 4MYCA 1UT6A 5MPOA 5JDIA 1YOVB 4Q4CA 5IWAB 5JZEB 3OFND 4J76A 1JYEA 3TXAA 4ARAA 1ZQ9A 3UV7A 4DLKA 1RYNA 3K5HA 4KQMA 3TNDA 4LAFA 3OKAA 1VA5A 3RO7A 4JLWA 3PJRA 5F4ZA 1CZKA 4UHBA 1N78A 4J9VA 1E2LA 2VDRB 4EKGA 1R6AA 1QV7A 3HGTA 1G21E 3M0EA 3OCXA 3Q3JB 5DM2A 2OP1A 3CE6A 1T6BY 2OXEA 1HQRD 1E2EA 2DPGA 2R8OA 3PHHA 2GH1A 1ID8A 3EULA 5IX8A 4B8ZA 3DTTA 1UANA 3THWA 5AW0A 3HVHA 2MSED 5J43A 3G2QA 2ZJBA 3IG3A 3IDQA 2V6BA 5BNZA 1Z07A 4NFHA 4GGQA 1NW4A 1ZEMA 3AY7A 5ALTA 1XZHA 2C03A 2PTHA 4MDHA 2Q1WA 1JLLB 4FULA 4EDHA 3GFQA 4PSCA 3IUSA 2I6GA 5A5FA 2GAFA 2V7VA 3EMDA 4WK6A 1S4QA 5L8VA 4MVJA 3P42A 3Q5EA 3U7ZA 2PFGA 1US8B 3G0CA 5IP5A 4B7UA 3INRA 3L6EA 4LZOA 1N5MA 2CT8A 2BRUC 3V2UA 2HCFA 1OXMA 4B09A 2YNUA 2R7NA 4AJKA 5KKNB 4KIKA 2JLAA 2CNDA 1L5HA 2N9LA 1RJ9A 4QU9A 4M02A 1UC4B 5IXJA 1YT5A 2IO0B 1KZ6A 2VJQA 2ET6A 3N2YA 4HXGA 2UUPA 2Y71A 3RVPA 4MXDA 3DV2A 1GLNA 5BYRA 4Z0HO 1YJAA 4KMMA 4FCWA 1JIIA 5EPUA 5JAOA 2QDXA 1NM5C 2W9XA 4ZU6X 4R0VA 4M37A 2I3GA 4RZSA 4CJXA 3EVGA 4HR7A 4NAHA 4YONB 1IY1A 3H5RA 4H7EA 1EF5A 1S2MA 4S0ZA 1L4UA 5AHRA 3AIIA 3P2IA 5TPWA 2Q1YA 2AOTA 3V97A 3WGIA 4NJCA 4YRAA 1U9JA 3L1UA 4FX2A 1YFKA 3DF9A 3OLCX 2OHFA 4CG3A 2RGBA 1LF5A 4MUIA 1E20A 1U31A 3M83A 3OKCA 5F52A 2RKWA 3Q6VA 1YJIA 1USKA 2IU3A 4EFOA 4HH4A 5CA0A 2Q07A 5AHXA 4J43A 5DYIA 1K5HA 3GN2A 2KPOA 2ZZKA 1A98A 4RKRA 1SC4A 4PWYA 1FYXA 4OQEA 2BFEA 3DO8A 4K05A 4ALLA 2XGOA 2IUUA 2P9JA 4ARCA 4BX2A 2PWYA 1L5RA 3G0GA 2AG1A 3FNGA 3RVKA 2DFVA 4EUSA 4DL9A 4LDNA 1P45A 2GD1O 1J06A 1KTVA 5CDHA 4HBZA 2OLJA 1QAOA 5CXXA 5CDGA 2C0QA 3KEMA 3NIBA 4GVLA 3H9UA 3JTEA 1KQPA 4TSFA 3ZDFA 1D8TA 1COWD 2XYPA 1Y7TA 3G6KA 4OBWA 2ZJOA 2H8GA 2ZRKA 1TVEA 3HABA 4HXYA 1UBEA 1DIAA 4BE7B 3BN3A 2ATVA 1F8UA 2IIPA 3TJMA 1L8XA 2X5OA 3PUWA 2D5BA 2J53A 4N0DA 4BNGA 2BFCA 3AF3A 1UEIA 3FSGD 4RPJA 4UTRA 1E5LA 2PO7A 1EU1A 5A2GA 2IIBA 5IKCM 1N5KA 3JSVB 2AVNA 3RYFB 4I9NA 1C77A 1E9VA 3RAPR 4B3IA 1MQ9A 1ZI8A 4HFJA 2C7QA 1M1UA 4TN5A 1T4CA 2KB0A 2WIFA 4XX0A 3O1HB 3E6AA 5CXUA 4CYMA 2MH7A 1VIYA 2FWIA 2LNDA 3PFBA 2BWFA 2G5TA 4DOMA 4W9JA 1YZVA 2J4FA 4GGPA 4WOJA 4HMPA 4CV3A 1O77A 1C9YA 3AF0A 3EDYA 3TDNA 4EUFA 5E7IA 3UMFA 3L10B 3GLIE 3UANA 1IN8A 2R25B 4IHJA 4DDTA 4QUAA 3VQTA 4L8WB 2WFZA 5DULA 4O2LA 5JTTA 2ZWIA 4FONA 4HDSA 1ZONA 1WM1A 2RPQA 3LDGA 4PYNA 3QX1A 4LX8A 2JAHA 5K8VA 4R84A 4ZEOA 2PGXA 4RU1A 3IE0A 5ALSA 4LCBA 3KEQA 3HRHA 1W44A 3NP9A 4RHEA 3NDBB 3KOWA 3RFFA 2L42A 3MT7A 2PUVA 4BBZA 4EP1A 3KL7A 1ETUA 2ZJ1A 3TQHA 3P94A 4OJKA 3W4KA 3SC2B 2BEVA 4OF4A 1MC4A 1Q1QA 4MUJA 1YQBA 4YJDA 2YNMD 5A9TA 3C5CA 1NWCA 1L7VC 1CYDA 3N0TA 1UBUS 1I8TA 5DBGA 2YYZA 3QLJA 3RNOA 1WOYA 1N5WA 1HG0A 2DWPA 2XCUA 2ADMA 5CG1A 1CD5A 3ODGA 4RSGA 3ET5A 1X7WB 1OFHA 4EFKA 5JS1A 3AE5B 4OHZA 3EY4A 4RF5A 2F8TA 4X64B 2O0KA 3OP1A 5A3SA 2CD7A 3QW2A 1MABA 4IIFA 3BXXA 3KHUA 3DZJA 5EJ9A 1CJUC 4GSKA 1KJ9A 1AHHA 4ZTUB 4MQ5A 3F7NA 1LS6A 1JKFA 4UUBA 3AY3A 3IQFA 3OIGA 3NALA 1VZ3A 5K4AA 3QELB 4P35A 1ISGA 2WU2B 1YIAA 4Y9RA 1XKLA 1TEZA 5TQVA 1UM9B 3ASVA 4G3XA 3TZQA 3HO6A 3RT3B 3AK4A 5DPSA 4RTQA 1TPZA 3CO0S 1NXQA 3GLIB 1M6YA 3DHAA 1YX5B 1QJCA 3N1UA 3N2LA 4QPCA 5A23A 2NU9A 5COBA 4TYNA 4YPFA 3CRVA 3WJ2A 1ESDA 2QLBA 5L9AA 1Z39A 1M2OA 2OCGA 1D1TA 2V4LA 4Q1CA 1L5PA 1X1SA 5BR1A 3FBTA 1D0VA 3W2HA 5KQSA 4PHCA 1MOZA 4ZRJA 2JD2A 2H65A 4ZO7A 1OOEA 3B7PA 1UUPA 1I1NA 3TLEA 1B6TA 4BNZA 3M4YA 3OLWA 3K4QA 1WPQA 4AUNA 4UJ5A 3TSZA 1X9IA 3GLKA 5KVCA 4A55A 5BW8A 4M1TA 1CNMA 3FETA 4EA8A 1D0SA 4LUCA 4O08A 1OT5A 3HM2A 4PX9A 2I66A 4LHXA 4FYVA 3AEDB 5C53B 1PDVA 1PLJA 2FPIA 5J9FA 3LL7A 3LPNA 1KERA 3OJ3A 3FE2A 2INNE 1X7DA 4DDHA 1ZNBA 3EUEA 3A1WA 2NN3C 5AUQA 2O14A 4EXSA 1WXMA 2H7XA 4TKUA 2G1EA 1MO2A 3EF0A 4KLZA 1QIJA 3BFJA 3SEFA 3PHJA 3MTIA 4UBKA 5HH4A 2Q3JA 3TGLA 3LJKA 2WXOA 3L1VA 1G7RA 3OSZA 4E7OA 1L1RA 5C32A 5EE3A 2Q8NA 2ZWPA 3EUB2 2RE8A 3EMBA 3RUEA 5FOUA 1Z2EA 4CDMA 2DUUA 2PWBA 3UJBA 1VKRA 3TS1A 3SD9A 3ICEA 5A7FA 1ND6A 1K97A 4PZDA 4J4TA 3QF4B 1XU7A 2J5RA 5IK2D 3UMYA 1V1PA 2XDAA 2GPSA 2WZQA 2EZ4A 2V74B 4UDUC 2P5TB 2TRSB 4IDPA 5CRIA 4UBNA 4P3OA 1Y3AA 2E4ZA 1A8UA 2Q9UA 4N18A 1KAOA 3HZRA 3VZDA 4R6XA 3TEJA 4E5VA 4KFCA 4CI9A 2A7XA 4C80A 3OC0A 3H3JA 1S7CA 1FPMA 1L7MA 5BMVA 4EKDA 1H2XA 3WO1A 5KINB 1QHXA 5FPTA 1QFJA 1TKAA 2M98A 4M1MA 4PZZA 3LHIA 4TT3D 1CPYA 1E4VA 1KOJA 4K3VA 4DDMA 2DJIA 1VIDA 1P9DU 3JQ8A 2ZJYA 3EG5A 1NE7A 2N1WA 1TUGA 2Q3EA 4LJ9A 2RKOA 3T5DA 3SWWA 2ZYSA 1MC1A 3T9AA 4YRJA 3P0IA 1XQ6A 2VNJA 1QGUB 3DEJA 1DX4A 2BW0A 3KD3A 4AUEA 4D42A 5JASA 3L8GA 1GSOA 4DR6B 1S2NA 4F3TA 1EWTA 4BASA 4A8TA 5JANA 3DBRB 1LBQA 4HQLA 3BB3A 4LF7B 1G5TA 4FGJA 2GTIA 4HFMA 4R40A 4D56A 4GDLA 3UMJA 3R0JA 3QVLA 4DJAA 3HG7A 1KM7A 3PNPA 2HMAA 3ZI0A 3R8BA 3G82C 1QM5A 4MGZR 2B5VA 2GJSA 3AR6A 3QLVC 2Q6IA 2P77A 3KTOA 3DHBA 4BLPA 2P6RA 2ZDGA 3JQCA 4IWYA 5JG7A 1Z8NA 4YQYA 3UMVA 4OV6B 4H6XA 4NJMB 4E31A 2L7RA 3DHNA 3ZGYA 4B0OA 5EEHA 1A7UA 3BXHA 3AW8A 5LL6P 1C0EA 4KQGA 3V60A 5AW4A 4N5IX 3HHEA 4E2FA 3RBXA 4GO1A 1L7BA 2ZCBA 3HEAA 2D0DA 1QRUA 4BO3A 4EG1A 3VOBA 4BB0A 4YS6A 1C4CA 1EE2A 4I99A 2OD9A 4C7KA 2IH4A 1C3TA 1ZI9A 3ETNA 4R81A 2V6MA 2ZWAA 4V2IA 1FIUA 2CNWA 3R2JA 1G3MA 2R44A 2VKTA 1J7BA 4LYDA 3ZZNA 4UTPA 4P62A 4MUEA 4HGOA 3CNLA 1WE7A 4YGYA 2QGNA 2QL9A 2BBSA 2ZOSA 1JFSA 1C0IA 5ITZB 2O8BA 2A0UA 3HUUA 4RC9A 1ZSVA 1NRIA 4C4XA 5JXGA 2GNPA 4YH1A 4JLDA 5CNJA 1L5NA 5FTLA 1F12A 3EVEA 5CMLA 5CFZA 3H2ZA 1RIIA 121PA 4FQ8A 1F2UA 1YVUA 4PONA 3WWCA 2GAOA 1HE4A 1V2HE 1M0EA 4HOYA 2ARKA 1Y6ZA 4FSXA 1TMYA 3EXFB 2FJUA 3OEHA 2ZB3A 1XMOB 2J45A 2KTFA 1XEWY 3KQKA 3C24A 2X7XA 4UFPA 1WVMA 1HYBA 1HE2A 1XJ5A 1BA3A 3OZGA 4YAWA 2YWBA 1V11B 3B89A 1JQJC 5JZBA 5HSGA 3KOUA 3UV3A 3SX4A 3NS7A 4OAOA 3IOFA 3HGQA 1M34B 5BSKA 4CCSA 3IOCA 1MVKA 4DN6A 3NM6B 1NF3A 2H4ZA 2Q99A 3CZ5A 3HKDA 1S3SA 4PDXA 1P1FA 3QVGA 3IO3A 4KKIA 3MLEA 1Q1OA 3C7KA 1P7ZA 4JC8A 5E4TA 2VOJA 3TEWA 3TZHA 3K8YA 1U0EA 3JYHA 3MUOA 3CWZA 5L3SA 2YL2A 4A0QA 1FNWA 4IRXA 4RA6B 1MOSA 1N2XA 4NK4A 4M76B 4IJVA 2MMCA 1I7NA 3D3EA 3MQ4A 2QI9F 4B71A 1Y3CE 5DT9A 1YIOA 2FUEA 4KTVE 1ZGGA 3AE6B 3KB6A 2ZI9A 4RV5A 5ELMA 2VYVA 1V3QE 2Q5JA 3Q88A 2WWHA 2BFWA 2A9OA 2IY7A 3A1VA 1YDFA 4PN7A 4MK4A 2A9QA 5LWQA 3EA6A 5FOQA 5BVHB 3RIHA 4ZIRB 4WLNA 3MILA 4DHWA 4JJZA 4J07A 3QMWA 4DV7B 4WUTA 3AH7A 4BN0A 5H8YE 4MCIA 5GOTA 2WD7A 2ZIAA 3F74A 4PZCA 2ONKA 1OLXA 4M1QA 4AWAA 1OYVA 2XBUA 2NXCA 2VF2A 4MW2A 5IBRA 3P9PA 3SFPA 2O6LA 2FMHA 1MDFA 4RFLA 3ND7A 3RVJA 4XUDA 1HLFA 1VRVA 4HF7A 4QGFA 4TZTA 5HCUA 3ZIMA 4UTNA 5DH9A 1UKAA 1N1MA 4WLFA 5DTJA 2BR3A 3T9LA 3RS5A 4K9RA 2FFAA 2GD6A 1N5OX 2WF7A 4PVDA 2ZE8A 1V8FA 2W0SA 4NF2A 4JELA 2NG1A 3FUXA 1WM2A 4JI0B 4IILA 1NM5A 1RLOA 3PK0A 5LYJA 5A1JA 3A2NA 4NI5A 2YXDA 4NE2A 4H4DA 2V6JA 2YJ3A 5CU7A 3G1PA 4LZJA 1QUEA 1SUEA 1ES9A 4D3DA 1HDEA 3EUAA 2A9JA 3V3TA 1Q6ZA 1LDBA 2OG1A 4G4SP 4A6QA 3ZCPA 3GP3A 5JPDA 1BW9A 2J3QA 1R50A 4RA9A 1OBFO 2PKOA 5L3VA 5TGDA 5AW9A 2HU7A 4NS1A 1NSYA 2VP3A 1BFUA 3NHFA 2XKAA 4Y0AA 4YACA 2KQSA 4ZQHA 5IM4F 2AEHA 4OI0A 1TO2E 2YW9A 1NYTA 3OJLA 2D3TA 4DIOA 2BT4A 1LZLA 4LECA 1ZGAA 2EG5A 4BLRA 3DVQX 5I7WA 4R1MA 3JQ9C 1Z5WA 4I1SA 2W3RA 3UWMA 5K01A 4UBLA 3U19A 3LUGA 2J5QA 3G1WA 1KKMA 3OEWA 3Q14C 2JU6X 2PU7A 2IT1A 2QVYX 3I64A 4KEAA 4XGQA 2QVLA 3BGSA 4B40A 2DFKB 1UWMA 4R8VA 4XDGA 2X4DA 4FXOA 3RJMA 2PH1A 3BRSA 1U5BB 3D43A 3GQBB 3N8HA 1RJDA 3D1LA 1UBSB 4AKIA 3R2IA 3FYTA 5CAEA 2BG8A 1ZINA 4I1VA 3IAS6 4ASWC 1RQGA 3G5TA 4V0KA 1NVVQ 1HZ6A 3T5BA 5GIPE 4G5RA 1V71A 2PRYA 3H2JA 3RSHA 1JWSD 1AWDA 1E9BA 3SCZA 4PG6A 3TINA 4DNFA 2OSVA 1XT9B 1T3TA 4WGGA 2X23A 1P81A 2G3YA 4U63A 3U7HB 2GLSA 2WUDA 3GRCA 3NIWA 1PGPA 5T4BA 2AXQA 4ZTBA 2TMGA 2YDYA 2NZJA 1Z6PA 3U4GA 3C8HA 3IQEA 5TR9A 4IS2A 1DX9A 1JE0A 1AG9A 3BD7A 1QQBA 4HNRA 1C9DB 4MO2A 1TGZB 4ND1A 1T3SA 3OCWA 1VLQA 1BJTA 1Y80A 1PS0A 2I4RA 1SJ9A 5K3CA 3RIYA 3OWHA 5C1IA 3JWHA 1P73A 3Q3GE 3CRZA 3GUUA 3WSWA 4J0QA 4KOAA 3T0GA 4RHFA 2VNHA 1GAEO 1EXNA 1XNRB 1XXHA 4F4IA 3ZD9A 2PZJA 2WYLA 3U4HA 4TQ9A 3NAZA 1J97A 1HTOA 3KQMA 4RY8A 3ZNPA 2WIAA 2YTZA 1T34A 1TYAE 1PGXA 1RAIA 3KYCA 3VBEA 5KU1A 5FV4A 5AI8A 1N2EA 1BWPA 4AC9A 1JMVA 1XNHA 5BSTA 5AW1A 1BCRB 4A9AA 3MCVA 2J41A 3SQOA 1EM8A 3SKVA 2CV1A 3AN1A 5AKHA 1FPYA 2PMKA 3ZIAD 2WIDA 5HIPA 2PXAA 1SUDA 1KFKB 1CUSA 4X94A 4NTZA 2XCSB 1J25A 1B6RA 1QVZA 3AUUA 4HMOA 3QM1A 4QLBA 4BU1A 3BTUA 3U40A 4BLVA 5G02A 4UCQA 4UA4A 3UXYA 1LNSA 3EZ2A 4OIFA 4MUAA 4QYIA 3EASA 3P9QA 3ABIA 2G06A 4OQFA 3TYXA 5K20A 3V8MA 1ZR2A 1WULS 1DIRA 1X13A 2CZQA 1VBNA 5LMZA 1GL6A 2VJNA 3V5NA 5AVJA 3KU4A 1OKKA 5D3DA 1DBQA 3A6DA 2O4UX 4NZYA 4Z4CA 4JQYA 1M8PA 4GOOD 1VZ8A 4PYIA 4M7PA 1JDVA 5HZKA 2O1EA 4HPXB 4PO1A 4JT2A 3N2IA 3HJCA 3WMWA 1RFLA 1T25A 4NOMA 4OHKA 3EARA 4FHCA 3E8MA 3NTVA 3S1AA 1FNMA 2EFJA 1NXWA 2JFYA 4CM1A 1UZUA 4WV3A 2QJSA 4QLAA 1YZNA 5BSFA 4I1PA 1JDZA 1GDTA 2B98A 1UEXC 2JFQA 2GHIA 3ZKAA 2GCPA 1EF1A 3G68A 2NO9A 4HAWA 2DE0X 2WJVA 2FA9A 2P9CA 2M0AA 1AQ6A 1KQ3A 3BWEA 2GUWA 3ROMA 4OQYA 2X1LA 4IXMA 5KOJA 3JQFC 1S1QB 2G7MC 4YJFA 3TQFA 1RM5A 1E7WA 4DS3A 4TKLA 1RRKA 5KTYA 4BUZA 1X77A 3R8XA 3HCPA 4HDNA 1U0BB 1E1LA 2IXTA 3ABOB 2VT6A 3PNVA 3OX2A 3ICQB 3TNYA 3MRVA 4I2NA 1O5IA 4LXGA 1VLBA 2XBMA 2PJZA 5GMVA 3ZH2A 10MHA 3NEAA 4FQ7A 4MWBA 3ZNBA 3L77A 1P91A 1GGEA 4MKIA 3IHKA 3DDHA 3CW8X 3ESHA 4KR7A 3HA2A 4EHBA 4YCSA 5CLHA 1O6CA 1L0XB 3GD5A 1F4VA 2BC9A 1MJDA 1B6GA 3ZJTA 4P54A 2LXAA 4BWGA 4F5YA 1RVDA 1T0SC 4B3RB 4N40A 1E3TA 2GAJA 3M6VA 2J7PA 4KWIA 1YDGA 1FM0D 4QPJC 3U0VA 5F51A 3ZCVA 1STOA 3H5TA 1Q7CA 1TS5A 4IDIA 2LIVA 1QVRA 2EFEB 1T1EA 1T35A 3WNDA 2KHWB 3MWFA 3HRDD 2UZAA 2KM1A 1YCFA 4O0LA 2WUFA 1WZ3A 3SC4A 4UM5A 3E3MA 3PF8A 2HBZA 4ZYSA 3SC6A 4DXHA 5C52B 2JH9A 2ACEA 3RTAA 3H65A 1BQ3A 1F8FA 1TLLA 3JVVA 3KXPA 1ZD4A 5KJ1A 2Q5LA 1C8LA 1YJBA 2AJTA 2QOEA 4RKEA 2ZJAA 4F1JA 4FQ5A 3BK2A 3P4RB 1LF0A 2EQBA 3U7EB 1J9EA 2VSNA 3PUVA 3QVOA 2EZ9A 4XWTA 1XQVA 4U5QA 1FBNA 4M2LA 2C82A 1UPAA 1ZMRA 3FKSA 4FGWA 4O4LA 3M62B 2OBYA 5JT1A 2ZITA 221PA 2PEYA 3ADKA 1QE0A 2PSJA 1EFPB 3IXLA 2K25A 1C4WA 3CLUD 1QRAA 5ED4A 2Q3FA 1XHEA 2YQZA 2FDRA 5K7SA 5FYQA 5H80A 4N3BA 2I03A 4D8TA 1AMNA 3QUTA 1RQXA 4XWKA 3MSXA 4PG5A 3NH6A 4F5DA 3FMVA 1JW9B 1SCAA 3FYCA 1EIZA 4YREA 5BSUA 2ATEA 4HTFA 3F8SA 1L4YA 2J9RA 2I4IA 2ZUCA 3BMOB 2H16A 2PX6A 1U8TA 5DNVA 4YAKA 5CLGA 2PV7A 4FE3A 4B74A 2YQ5A 1NXXA 1Q17A 3CRRA 1UBMS 2EHJA 2WJIA 1XCOA 4X3PA 3VYUB 2OFOA 1N2OA 3FW1A 3NXKA 3G0OA 2J4CA 3ESRA 1Z3IX 3LC7O 1F60A 4MUBA 4NYIR 2ZAYA 4JHXA 2J30A 4LPSA 1DIOB 2XY4A 3H2IA 3R1IA 5DTIA 1Q12A 1HQYE 4DLRA 2ZWVA 1E61A 3DEHA 2AC7A 4EO7A 1ZOLA 2O48X 3T5GA 3KU1A 4LQLA 1XAIA 5FADA 4QOGA 3AP3A 1RHJA 5TSSA 1ZRMA 3E3NA 4RJKA 4JI6B 2HQBA 2EKBA 3T5CA 5BPHA 4AIIA 1GU0A 3UJ7A 4ZJYA 5HYVA 2ZI4A 4LRWA 5IYZF 4BBNC 4IDDA 1TIFA 2M56B 4CXMA 4KODA 4WINA 4LVCA 4H1HA 1E7VA 4WADA 2AYXA 4CMIA 3U7JA 3G8BA 1FF9A 5BORA 1VJ1A 3KFLA 3L7BA 3HWWA 4JGIA 1KARA 5IXSA 2P9FA 2NVUB 1RWWA 4QJ4A 3CQ9A 4C0LA 4DXDA 1SXJE 2H48A 4KPYA 4I0WB 1ZK3A 3GRPA 4TWJA 4MLZA 1YHNA 5KTRA 1TECE 2A1TS 3AP1A 4V3BA 2YIVX 2X4LA 4Z9FA 3C70A 4N8DA 5DPTA 3RKJA 2WINI 2REQA 2VRWA 1LPPA 2BQQA 4BN5A 2ONQA 2HRDA 1ZIXA 3LT5A 4FFLA 3LZDA 4QG3A 1NI4A 2WG1A 1WD7A 4AY3A 5BW5A 1E6EA 2P9ZA 4C0WA 3O31A 3JD4A 1YIDA 3G2KA 2JDIA 4JLNA 2D0OB 5ANRB 3KPWA 4WCDA 4IXNA 4MHOA 1JEAA 3G2MA 2VJMA 2XX3A 4KVZA 3AFGA 4CGYA 1YJ1A 2SKCA 1SHTX 5ACRA 4YMWA 2WXHA 1CDDA 1U3DA 4ZAGA 1NMQA 1ZKPA 3TNLA 3ENNA 4EQ6A 2FMIA 1HT3A 3MCWA 4BB9A 4GMVA 4OVKA 1WMHB 2XOKD 3L05A 3F5MA 2OFFA 3ND9A 3X2EA 1N92A 3K7EA 3ZLBA 5DYNA 1U7XA 5BVGA 2RR9A 2ONZA 1NBIA 2O2XA 4I5DA 5GONF 2FOLA 5DZSA 4EYEA 1D1PA 2XWSA 4MYSA 1CR2A 1D5ZC 5C9ZA 4YPVA 2BMJA 2QUHA 4QUHA 4I9UA 3ZU3A 3JXEA 3TE6A 1JHQA 1BDIA 2QYSA 5JEEA 4JYAB 4ZWNA 2YY6A 3PQ6A 1NUQA 4FB4A 4NCAA 1XD2B 3ORHA 3HI6A 4MB0A 1T8WA 2ISCA 1NU6A 5D3ZA 4ND6A 2J3LA 2V59A 1D2CA 1ZP6A 3AGPA 4X62B 3CUWA 3W2GA 2F59A 3AF1A 3W9UA 1UXHA 3E5RA 3FOZA 2QDKA 4LDTB 4EF5A 4RL2A 2X19A 4BFWA 1EVLA 1PAUA 3H2KA 4RGMA 1D2HA 1E9DA 1JR3A 2M6RA 4YCNA 1BMFD 3H7SA 4ACAA 5IKMA 2CV0A 1P18A 3DQVA 3QBJA 2VRCD 3C6XA 3K70C 5FTKA 3C7AA 4ZYTA 2CXSA 4HEJA 3P4SB 2KYWA 4GYUA 3K0AB 4MT5A 3GCDA 4UPEA 4FR5A 5DHAA 4LHZA 1XAJA 4C03A 2CYCA 4FM9A 2EAUA 1E5TA 1FL9A 4EATA 1AKTA 3HKCA 2QILA 4I3GA 1VB3A 4IGIA 2XCLA 1DWUA 1AIPA 2OCXA 1LCIA 3HZOA 4RMIA 5EJEA 3TLBA 1J99A 5LP6F 4EFLA 2MYPA 1UBQA 2CJWA 2CUNA 3R20A 4UNRA 3LUFA 1XCMA 4MP6A 3K0FB 1RRBA 1SXTA 1GNTA 2QLTA 2V3NA 3J80A 4PF1A 1PT9A 5KCMA 2Z0MA 3LY5A 2J3JA 1R88A 3WK5A 5JAZA 3A6EA 4QARA 4E22A 4E5NA 4X57B 1V5GA 3SHOA 1ICEA 1N57A 3N7AA 1KLUD 3V9AA 2X0DA 3SJUA 3MGKA 1QHGA 2JI8A 4AP9A 4UUPA 4B35A 3RGWS 3GRVA 4KFSA 2W6PA 1OHHD 4S1OA 3VC2A 1RHQA 2A6PA 1XNQB 3O75A 2GBCA 4DGSA 1HG1A 4WLEA 2PD4A 2VHEA 5JCXA 3ZXRA 3HUTA 3UK2A 2QX7A 3LM8A 1FMLA 1LGRA 3RVBA 1EUVB 2YIDA 2LIPA 1L7AA 3HU1A 1Z4QA 5FUMA 3U1VA 1HEZE 1LLCA 2FEPA 3D81A 4HDMB 2GCNA 5EZYA 3FVRA 3OCJA 3WHIA 1JWBB 4TMTA 4D4IA 4O2BF 2XTNA 2AI3A 5K8JB 1JQ3A 2LRWA 2E89A 2H4WA 4Y1GA 4RD2A 3GDOA 3JVZX 3MP9A 2Q3HA 2BS4B 3KWJA 1I1OA 3T3EA 4DARA 1YD8U 1N33B 1KJWA 4LPKA 2PG3A 3WWEA 5B58T 3GJZA 4FFNA 3S1LA 2HT1A 4GPBA 5HMMA 3VOAA 1RXYA 1Y3BE 5IP4D 4ZVNA 3MJEA 4H0FA 3QW4B 4MVJM 4PZLA 3N5KA 1U7UA 2O5EA 4NU8X 3R3WA 1GAWA 1OYOA 2QUKA 2MBEA 1QGDA 1YB6A 1RCFA 1PR0A 4IJ6A 4IKPA 3ZQKA 3TM4A 3KSBC 2XKBA 4I50F 1JF8A 4NBWA 1CZHA 4UWOB 3PXEA 1DHRA 3QXGA 4FYPA 5CYGA 3DEFA 2ECPA 1F0ZA 3DCJA 2HIMA 5AJWA 4M8NE 1A9XB 1UXOA 2BTOA 3RSFA 2V4IB 3GARA 2FOXA 5IULC 3NKLA 1VJCA 3W1YA 2J0UA 3IVAA 3U4AA 2NPOA 1KVQA 4A6XA 1PYW