3T3OA

Molecular basis for the recognition and cleavage of rna (cugg) by the bifunctional 5'-3' exo/endoribonuclease rnase j
Total Genus 162
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
162
sequence length
553
structure length
553
Chain Sequence
b'SQGGPQDHVEIIPLGGMGEIGKNITVFRFRDEIFVLDGGLAFPEEGMPGVDLLIPRVDYLIEHRHKIKAWVLTHGAEDHIGGLPFLLPMIFGKESPVPIYGARLTLGLLRGKLEEFGLRPGAFNLKEISPDDRIQVGRYFTLDLFRMTHSIPDNSGVVIRTPIGTIVHTGDFKLDPTPIDGKVSHLAKVAQAGAEGVLLLIADATNAERPGYTPSEMEIAKELDRVIGRAPGRVFVTTFASHIHRIQSVIWAAEKYGRKVAMEGRSMLKFSRIALELGYLKVKDRLYTLEEVKDLPDHQVLILATGSQGQPMSVLHRLAFEGHAKMAIKPGDTVILSSSPIPGNEEAVNRVINRLYALGAYVLYPPTYKVHASGHASQEELKLILNLTTPRFFLPWHGEVRHQMNFKWLAESMSRPPEKTLIGENGAVYRLTRETFEKVGEVPHGVLYVDGLGVGDITEEILADRRHMAEEGLVVITALAGEDPVVEVVSRGFVKAGERLLGEVRRMALEALKNGVREKKPLERIRDDIYYPVKKFLKKATGRDPMILPVVIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Metal dependent hydrolase
publication title Molecular Basis for the Recognition and Cleavage of RNA by the Bifunctional 5'-3' Exo/Endoribonuclease RNase J.
pubmed doi rcsb
source organism Thermus thermophilus hb27
molecule tags Hydrolase/rna
total genus 162
structure length 553
sequence length 553
ec nomenclature ec 3.-.-.-:
pdb deposition date 2011-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07521 RMMBL Zn-dependent metallo-hydrolase RNA specificity domain
A PF12706 Lactamase_B_2 Beta-lactamase superfamily domain
A PF17770 RNase_J_C Ribonuclease J C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.580 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3t3oA03
3.40.50.10710 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Metallo-hydrolase/oxidoreductase 3t3oA02
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 3t3oA01
2ZZIA 2Q0IA 2BG2A 2BGAA 5HH5A 1YCGA 1WUPA 1DD6A 2WYMC 2DOOA 4FR7A 4F6HA 5LLDA 5A0VA 4V0HA 4ZEJA 2A7MA 4AX0B 2QJSA 3X2YA 2BG7A 3I15A 4AX1B 1L9YA 4GCWA 1A7TA 1VGNA 1X8GA 3DH8A 5AHRA 4UWSB 5AXRA 5LE1A 4LE6A 4KEPA 4GYQA 5B1UA 5EH9A 2FHXB 4RM5A 1E5DA 5IQKA 2XF4A 3X2XA 2Y87A 4NQ2A 2XR1A 4XWTA 1VMEA 3IEKA 4CHLA 3MD7A 1ZNBA 4GYUA 4NQ6A 3SD9A 5HIQA 2BR6A 1SMLA 2I7TA 4UWRB 3I13A 5B3RA 5HIPA 5KILA 2UYXA 3WXCA 4AWYB 3DHBA 4U4LA 4EY2A 1YCHA 4D1WA 3H3EA 3RKJA 3X2ZA 1JJEA 2BFLA 4EYFA 2FK6A 4UA4A 4ZO2A 5EWAA 2YNTA 1QH5A 3IE1A 1BC2A 4WD6A 3A4YA 5ACPA 4H0DA 3T3NA 2BFKA 1WRAA 2NXAA 1WUOA 5ACQA 4Z60A 2GKLA 4DILA 5K4NA 5FQAA 4HL1A 1P9EA 5FQCA 2NZFA 3P2UA 3RPCA 2YNUA 5HIOA 3TP9A 2BG8B 2AIOA 3IDZA 5HH4A 5LCHA 3PY5A 4EFZA 3G1PA 3SRXA 3T9MA 2I7VA 2OHJA 2Y8BA 4XWWA 3AF5A 2OHIA 3F9OA 2ZNBA 5B15A 4C1CA 5ACVA 3Q6VA 4J5FA 2AZ4A 1MQOA 5ACWA 2QEDA 3VQZA 4EXSA 4JO0A 2YNVA 3I11A 4YSKA 3RKKA 3QH8A 5K0WA 3I14A 4RL2A 2BFZA 2BTNA 5AHOA 5AXOA 4YSLA 4HL2A 4Z5YA 4UWPB 4Z6XA 2Q9UA 4XUKA 5EW0A 4UWOB 1QH3A 5ACTA 1DXKA 1JT1A 2YCBA 1KR3A 3IEMA 5LM6A 4D1VA 3ESHA 2P18A 1DDKA 4O98A 5EV6A 4C1HA 4BP0A 4YSBA 4TZBA 2DKFA 2QINA 5LCAA 4AD9A 4F6ZA 3R2UA 3AF6A 2QDTA 5ACXA 1X8IA 1WW1A 4TZEA 4EYBA 5A0TA 1XTOA 2FM6A 2M5DA 2NYPA 4TZFA 2ZWRA 5LS3A 3LVZA 2FHXA 2VW8A 4C1DA 3L6NA 4B87A 2GCUA 4BZ3A 2P4ZA 1K07A 3X30A 2WYLA 3BC2A 2QDSA 4HKYA 5EVBA 4C1FA 4UAMA 5LSCA 3IE2A 3SBLA 4EYLA 4ZNBA 5EVKA 4P62A 3IELA 4ZO3A 5AYAA 4RAWA 1BMCA 1X8HA 3BK2A 3BV6A 3KNRA 5ACSA 2FU9A 3PG4A 1JJTA 2M5CA 5AEBA 3IOGA 4PVTA 2YNWA 3ADRA 1KO3A 3S0ZA 3KL7A 4FSBA 4C1EA 3ZNBA 3SFPA 1M2XA 4C1GA 2CBNA 3BK1A 3AJ3A 3ZWFA 2H6AA 4PVOA 2BG8A 1BVTA 3PY6A 4D1UA 2BMIA 3I0VA 1Y44A 2YNTB 4DIKA 2Q42A 3IOFA 2BC2A 5FQBA 2E7YA 3VPEA 5LMCA 3ZQ4A 2R2DA 2FU8A 2GFKA 4EXYA 3FAIA 3SW3A 2WRSA 2BIBA 5LCFA 4Z5ZA 5A5ZA 2I7XA 2WHGA 4D02A 1KO2A 3ZR9A 5ACUA 4RBSA 2YZ3A 4TYFA 2Q0JA 4NQ5A 1HLKA 2Y8AA 4KEQA 2HB9A 3IE0A 4C09A 2P1EA 4NQ4A 5EV8A 5EVDA 1A8TA 5HH6A 4Z67A 2FU6A 3DHAA 5K4KA 4AWZA 5ACRA 4J5HA 1YCFA 2ZO4A 4TYTA 3T3OA 2GFJA 4UBQA 2P97A 1ZKPA 5DPXA 2YNVB 3FCZA 2FU7A 1XM8A 3SPUA 3KNSA 5HISA 2WYMA 5KIKA 2GMNA 5K4MA 4D1TA 3DHCA 4RAMA 4Z7RA 4RL0A 3JXPA 2OHHA 5A87A 2BFZB 4FEKA 2BG6A 5EHTA 1VJNA 4TZ9A 2NZEA 1ZTCA
chains in the Genus database with same CATH superfamily
4ZI2A 3N07A 3Q7PA 4WZBB 4Y1FA 4R4JA 4LSWA 5B3JA 4D0SA 1S1QB 1NZJA 3P97A 4IS3A 4MS3B 1RM0A 4A2CA 5AK3A 1YI1A 2Q5HA 1PV2A 2ZWAA 4N6NA 4MUGA 3A4RA 3VISA 3QLVA 4DHJD 1BOFA 1GB4A 4RIEA 3IG3A 3QFRA 3KU1A 1VMAA 3JQGB 3GHHA 2SKDA 4UE2A 1M54A 2QRKA 2BR6A 1RPTA 4G8BA 3CRRA 4TUYA 1LWNA 4IWQA 3RNOA 4BMXA 2VUIB 1VZ8A 2WV7A 2VUSA 4KR6A 2PYDA 2X3UA 3AK4A 3EW7A 1YCHA 3WNBA 4HC4A 4FDTA 2VSOA 1EFPA 2BGTA 5J18A 1B6GA 2KQ7A 3AM1A 1FFGA 1J6UA 3U7GA 3HK2A 4HNAB 2FPUA 3L6OO 5F23A 2FCAA 4MRPA 3ZHSA 2CBZA 4YR9A 1F77A 3LUJA 3ZWVA 4A27A 2Z5LA 1CRWG 1TAGA 1HT2E 1OMOA 5HFNA 2WAOA 3L04A 5JSUA 3HO8A 2LGDA 3O03A 2V58A 4GDFA 4WZBE 4HQ0A 3TTWA 1Y4ZA 3AG6A 5AO9A 1F4VA 3CTMA 4YHHB 1JFLA 5DX8A 3R3SA 2YYZA 1WDKA 3TLMA 3IR6A 4N0MA 3CUSA 2RG1A 4MJLA 3E7DA 1IBLB 1HNXB 2RMKA 3ZHZA 1GFZA 2WHPB 1JQ5A 5C8YF 5J1SB 2VR1A 2YIMA 2A5UA 2PPLA 3AP3A 3LCCA 3C3KA 4IAOA 1IBRA 4MWEA 3LWNA 3D3EA 1E0SA 4ENUA 2VPTA 3DB1A 4DT1B 5ISMA 4AKIA 5FI0B 4BTLA 4WZBA 2FPXA 4Q2JA 2L69A 4ZK6A 1KR3A 3A1SA 3INRA 3RUAA 3HHEA 4GKVA 2QVCA 4Z4GA 2UYZB 4UATA 2DR2A 5C7LO 3RNAC 1H1DA 3FMGA 5CFRA 2COUA 3URKA 4CL0A 1GEGA 4KWCA 5BUQA 3CRW1 3DVRX 4JJ8A 4AD9A 3NOVA 4F12A 4RJLA 3SQXA 3ZWYA 4EYBA 4FLEA 1ZKMA 4L4UA 4FDVA 1JFRA 1YZHA 5JJIA 4ISCA 1AD2A 2L2QA 2CK3A 2EATA 2SAKA 2UVQA 4BDTA 2O2GA 2WHYA 1AT1A 5T7BA 4NAVA 2FFJA 4MHSA 3ME5A 4UTOA 4K7SA 2OLJA 3DLIA 1FIQA 3AJ9A 1Z36A 1GZDA 3ELBA 1KOLA 3DMRA 2WZCA 2IPOA 3L7YA 4HKYA 4LX8A 1ZA1A 3M0EA 4BP9A 5FLXA 3CF6E 3MQ2A 4CG1A 3FA2A 3JVIA 4NF2A 3ET5A 3MMSA 1F17A 4POOA 2XXJA 1FX1A 1QRSA 2GZSA 4EDHA 1G5PA 2K7ZA 2ZPUA 2TSYB 4EKNB 1DOAA 2JLBA 5JC1A 3WRYA 1N9GB 1J8CA 2DGDA 4KQWA 1JP7A 3HXOA 4KLNA 1XLNA 3K5WA 1Y8RB 1EK5A 4X7RA 1YR7A 1FUUA 2G9ZA 4KKXB 1YFJA 5DFAA 4Q9DA 4X8MA 2QVXX 1VHLA 4FFDA 3KL4A 3FDIA 1XDGA 2P6UA 1TM5E 4AFNA 2AYXA 4HQFA 4E3ZA 4UTNA 3UMCA 1NVTA 3ZU5A 5AZGA 2FSVA 3NLLA 2VNHA 2RB4A 3QWHA 3RIXA 2HIGA 1WE7A 1BE6A 1IG3A 2V3PA 4UPVA 1MQSA 5JRZA 2ZI5A 3BTUA 1EXVA 3ZRFA 4V24A 5JWOA 4I50F 3WKDA 2E0IA 5BSEA 4TYTA 4WBXC 3WLAA 3DDNA 2P97A 4P7KA 4WNIA 4UUQA 3UAWA 4ZCSA 2WTAA 4OW0A 2UYYA 2VHTA 3M9WA 4ENWA 4AZSA 2FTKE 2OHHA 2A7XA 1QZ3A 3N6XA 4NQLB 1RM4A 4WA8A 5BNFA 4C4AA 1K86A 1RP1A 4I9FA 1OGWA 3NJTA 2A84A 1GXSA 4EO7A 3MMNA 1SQ0A 4S1TA 2BFCB 2FRVA 4TMWA 3L3BA 3HK0A 1NENB 2J0MA 3NYQA 1NVFA 1TEHA 2KVRA 2JFVA 1LV7A 4RHFA 3R3YA 1USGA 1F6DA 3UUEA 2W6MA 2PL3A 5A04A 3LWBA 1U4AA 1OWNA 1KJZA 3TSSA 4TKVA 2HDNB 2G88A 3RIEA 1SBHA 4M1ZA 1I2DA 3KG2A 4WY8A 4JYCA 1HNZB 3VR0A 2CVQA 3MT8A 3F97A 3ASZA 4IH1A 1OIWA 4B76A 3VU3A 1LDMA 4BVAA 4YFVA 2YYSA 1TMOA 4M37A 3ORYA 3T5DA 3G2PA 1PR5A 2B36A 4BVJA 2EKQA 4M0DA 2R44A 4JLUA 3L01A 3X2SA 3AN1A 3ITNA 3Q7TA 5LMNB 5BO4B 1G42A 3WGMA 3AJAA 5ACPA 2YH2A 4MQMA 3MHSD 2WWTA 2GJ4A 4NYIQ 1FTSA 1K52A 3IO3A 3ZWMA 4DJ5X 4WMLA 5AW9A 1J19A 5JAHA 4F04A 3VGPA 2INCC 3VRBB 5DX1A 2R6HA 3EDQA 4GRAA 1MJGM 3TOCA 3DOEA 3RFVA 4J16C 1E1RD 2FIFA 1DKOA 1IJFA 1TEXA 3KUXA 4Q93A 4X8OA 1ISIA 1S2LA 4RLSA 4PWZA 4ZAWA 1UANA 3OPMA 3OQ1A 1BHO1 2NTJA 3PX2A 3QEMB 3KCNA 5J4HA 3MHTA 1WETA 4U2KA 3W5BA 3MMZA 3D8HA 1XRPA 4AJIA 2Z6VA 3DLAA 1Z4KA 3U60B 1DQSA 1OFUX 4Z0NA 4UCFA 2ZYAA 4KDCA 2PVGC 1ZGGA 4YMTA 1O95C 4M54A 3B9PA 4QFBA 2D3WA 4EOYA 1T4CB 2JRHA 2VWQA 3MJCA 1OBOA 3DOUA 4F96A 1SBTA 2Y1EA 2FAXA 5C7IO 3CCCA 2ZWRA 4Z4CA 1JRPA 4EBFA 3GUHA 1TF5A 4CQLA 3IHPC 1GTMA 3A2LA 4Q3NA 5A4JA 3V4LA 2ORYA 2HCFA 1T8YA 3ZNPA 4LHEA 4R2MA 1SIBE 4WKGA 1E4YA 3CWZA 4IDEA 3IELA 4EHHA 2GNAA 1PSDA 5AIBA 2W43A 2PMKA 1UZAA 3DF7A 4FYHA 1M0TA 4BFSA 1R4MA 4F8YA 4OZAA 2P3OA 4L16A 2XUKA 2DYOA 4BQOA 2ODQA 1YACA 3V62A 1SA0A 4G2NA 4Z6KA 5C4IA 5E1BA 1FS4A 1VRCA 2OJWA 3SVZA 4Y6PA 5DLDA 1JPJA 1SVNA 4JROA 1FMJA 2FUKA 2JVIA 5CTRC 3SDLC 1GCGA 1XJQA 5ER9A 1OX4B 2JCVA 1H9BA 3BWBA 2W2LD 2XUJA 3STVA 1RCUA 3MFQA 3E0QA 4B31A 4O29A 4HDMA 3IOBA 3DPSA 3ZGVA 3NDJA 4EY4A 5AVTA 3LB8C 2CWWA 2AGVA 2BCJQ 1SOUA 4FZVA 1NT4A 1T6BY 4NQ4A 5EJ6A 1M73E 4A23A 4L8WB 3JQ7B 2EYQA 1Z07A 1KA9H 3I72A 4JEHA 4Y98A 2PEZA 4BLOA 1RI3A 1UFOA 4Q9AA 3U4HA 1JA0A 4CCWA 1XVAA 1MB3A 3C87A 3ZEIA 4UAUA 1TKGA 4EKIA 2XODA 1TYCA 5TMEA 1T4CA 1FW8A 4TV8B 3WKCA 1N7JA 1E79D 5JSHA 3H2HA 4URHA 1V9SA 2C5EA 1GDHA 1FFDA 3SG0A 1V5IA 4IQFA 2YWHA 1AN9A 4A10A 2I2BA 1L7AA 3VSDA 1LLCA 1C7FA 1WCWA 4HNRA 1R0KA 1V1JA 4DSAA 1W96A 3CVVA 4ZK2A 2JI9A 4IDBA 3ADDA 3DDCB 1T34A 3BSYA 1PG2A 2PS0A 3S7ZA 2HYIC 3LDAA 1WCYA 3KNZA 3TX2A 1C1XA 1NUQA 2NU7A 4NICA 1NJFA 1BA3A 4GYUA 4QASA 2ZRPA 3R5KA 2ZIWB 5JD5A 1XV5A 1AC5A 3WXCA 3JQBA 4RL4A 1RMQA 2YC4C 1RU3A 1T6BX 4DKJA 1TXGA 1A8UA 4MPPA 1P2TA 1EVKA 3ONFA 1NE2A 1GSHA 1ZZGA 2J3QA 1CUZA 1CUDA 1RJGA 2A88A 2IDYA 1IONA 2VJQA 4AKSA 3CF4A 1AKUA 3UKOA 1IC6A 2XVMA 4K28A 3N74A 2N7JA 4L50A 1PGXA 1HY3A 3DL2A 4BTEA 4JV5B 2JZPA 3FY4A 1PX2A 3I83A 3JQ7A 3MMXA 2JS7A 2BBCA 5D3KA 1QO0A 2IY0B 4GGMX 1EQ2A 2V9ZA 1KBZA 1GU1A 3BJZA 1I1NA 2DBYA 1UC8A 3RAFC 3OLXA 4P1CC 4BC0A 4YCMA 1ISSA 2RAVA 5LMUB 1N4DA 2AE2A 2MSCB 5FDFA 1OQAA 4TS1A 1F1JA 3ZU4A 1UBTS 3R7RA 1B3RA 4LYYA 2PWAA 2PD6A 5GJVC 4B3GA 3NORA 2DFVA 3R44A 3I9V6 1M33A 3SJZA 5TB5A 4IOLA 4PLGA 2ZDGA 2JFHA 4C05A 5F5NA 2ZT6A 5BWNA 1CDZA 4R8KA 2QIPA 4OKIA 4J3JA 1DDGA 2E87A 4QDXA 5TRTA 4X85A 1JHVA 3K8YA 5EZYF 3Q3OC 4G26A 3DDCA 2MLBA 4XUCA 5CGZA 1Z7EA 2NQTA 2QTLA 2I3BA 1WXGA 4C03A 4EY7A 3JWIA 1ML3A 1DC7A 2GCUA 2J52A 1R12A 1D07A 1V1PB 2RGCA 4GWGA 3CB2A 2BWFA 4YMIA 2QQGA 3QJ5A 2N9KA 1SXHA 2J9FB 3Q8BA 4F0JA 3WLIA 4M88A 2D4HA 1P33A 4ZZ0A 1N8NA 3AFIA 5FH9A 3BD6A 1OQRA 4OH1A 5AHWA 4BO9A 3DVAA 3LHIA 4B6WA 4J3OD 1UBGA 2WTUA 2ZSIA 4DSUA 1GPXA 3V7NA 2Z98A 3VTVA 1FVXA 2EJVA 3HCOA 1H8HA 4XUEA 2YIJA 2H31A 4YECA 2ZJ3A 4R2WA 4Y2QA 1VIDA 4ZCMA 2HWWA 2ICAA 3BTOA 5KOYA 4NCIA 2C7VA 2BQQA 1B41A 2C9DA 3VYVA 3BGVA 3UKJA 1KDVA 5A4FS 1EFKA 4PIVA 1JSCA 2I7XA 2WJYA 4I4NA 1QO9A 4KZPA 1T9AA 4ZHQF 3N76A 4HLNA 1L3BA 5KJ1A 2D2QA 4ZALA 3I9NA 1NV9A 2UZ3A 1NVKA 3Q3JB 4FS8A 2QZPA 3LUAA 3RRBA 1FFVA 4JYBA 4FYVA 2G4VA 4YRJA 2BUBA 3VAZA 3P9SA 1RI4A 1T1GA 5A4DA 2DR0A 3A3KA 1IK6A 1L4BA 2I34A 1ZUD1 3GGPA 4RMJA 1UXIA 1N5MA 2DHCA 2CXUA 3MELA 2HCBA 3N05A 4R1TA 2ORIA 2IZ6A 1Z74A 3L7DA 2H29A 4EFNA 1ST3A 1P7CA 3C8HA 4X0EA 3OIFA 2EGGA 4DM3A 4OHMA 2O54A 1VBNA 4KGVA 1V1PA 1JI0A 1XJ5A 5CEEA 1KRXA 1CJUC 1A69A 4I4LA 4H9GA 5DTIA 4O4IA 1L9YA 3PWZA 4HXGA 1GNPA 2RDMA 5JNLA 1IZYA 2ZRAA 3HPQA 3KUCB 4RSGA 2YV5A 5CDGA 1CUFA 1U8ZA 1R9MA 2ZFUA 1SCAA 3HJNA 2C2HA 1SHUX 5FAKA 5I9IA 3CJRA 1URPA 1I3KA 1W52X 3TLXA 3QW4B 4LG1A 1YTUA 3M6WA 5ELMA 4NV3A 3VU9A 2EHJA 2JJ1A 1EDBA 5IDVA 1AF4A 4D45A 1AY0A 1QHGA 3ZNQA 2UYXA 2OP0A 3I01M 1XMPA 4PHHA 4NPNA 1OHHA 3W1WA 4LOAA 5HTOA 4LXGA 3CFYA 3O8OA 4GZ3A 5T8KA 5CNKA 4HDRB 4QGBA 4QPCA 3EMKA 2RE8A 4YWJA 2HX1A 2RK4A 3AVQA 2C4VA 2QBYA 1JE0A 2QI9C 3K5PA 3G59A 1L9KA 3Q6BA 3OJCA 1OFIA 2LCFA 2RARA 4FGLA 3U4MA 3X0WA 2PLFA 3P0RA 4Q00A 3T7AA 1XVIA 2Y1OA 3VTZA 5AEKB 3ER6A 4YHBA 1C0KA 3L0CA 1PU2A 4OHXA 5H59A 2ZWVA 3JRXA 4ZT7A 2Y2UA 1OXXK 4Z9BA 2D07B 4MZXA 3WOHA 1O8CA 2VCHA 1HXHA 3DZDA 4KVGB 2LIVA 2C4WA 2C1ZA 4I99A 4KK4A 2J7QB 1CTQA 1JIKA 1CJSA 4EGSA 3UWMA 3RVJA 5DYGA 2IHVA 1BN6A 4JT8A 1ZI8A 5IM4A 2RHGB 3AGQA 1UWMA 5AZFA 1J33A 4R5HA 1NSYA 4IO1A 2VXOA 2JKYA 1DDKA 3HLKA 3HHPA 2XRFA 4Q7EA 3W6PA 2J09A 2JUOA 1WCXA 2VBIA 3TD6A 3ROTA 1H4VB 2PGDA 3K1AB 3I05A 1JR2A 2FB9A 2GAIA 5CG2A 4KR0A 5GIOE 4P53A 3W3AH 3PD7A 3OIWA 1VG1A 1Z4MA 1AKRA 1RXYA 1R0LA 2JD0A 1YO6A 4WSOA 2Q9BA 3VTAA 2WDPA 3SZRA 4DMRA 1YZKA 3EJ6A 3GQVA 3K2EA 1I2ZA 2IZZA 2X6RA 4WWMA 1Q19A 1X2EA 2W2OA 1C29B 1OU0A 5FLKA 1U6KA 2ZBRA 3KHKA 4UQLA 2JQRB 4V3BA 4CLRA 5G40A 2GBMA 4CLHA 1DFHA 1S9HA 1JLSA 2Q2VA 2XCSB 3ETRA 1A5SB 2BKFA 4KU4A 1B0ZA 5EPEA 3CEJA 3F71A 1C3JA 3A6JA 3ZE2B 1BWQA 2B8JA 3SHVA 4GX1A 1WH3A 3KQVA 4BY9E 2PZLA 4G4IA 3M6AA 1RC0A 2ZQZA 4LNUB 4PZDA 3QMVA 1EWYA 3QXGA 3NNNA 3NBKA 5TC4A 1KDZA 3TEMA 3ADRA 4KDRA 3F8SA 1T2FA 3T5AA 5LC1A 3WYAA 1FXWF 2PBRA 3AC0A 4NZMA 3HDQA 5DM0A 3DE4X 1M94A 3L7LA 2L0XA 2XJ4A 3QLTA 3TI9A 4P16A 4IGFA 5AKXA 3R20A 4PAGA 3C19A 2Q3LA 4BVKA 3IUJA 2CU3A 2NP6A 1MFPA 1Z6AA 4C04A 3AEXA 3NRCA 4A03A 4C4RA 3BN3A 721PA 4YMLA 4PGHA 5IAJA 1VL1A 1J56A 2CC2A 3M62B 1T0UA 3PHLA 5EE1A 1J2UA 2O1EA 2JVCA 2PZAA 3QFSA 4NULA 1NQUA 1P6XA 3SEZA 3TE7A 5B30A 4PX5A 3GA5A 2NSDA 1W88B 1NPTO 2VFAA 3BBLA 3K1AA 3NXKA 3WLKX 1LBQA 1XLWA 1Z6XA 5C7YA 521PA 4LZPA 4MSMB 3ABZA 6REQB 2QY9A 2SHKA 1TT7A 4TV9A 1ZU4A 4EJFA 5G53C 4BQQA 2QA5A 3A1VA 3WTCA 3RMKC 2VDLB 4B3BA 5ADUS 1XAGA 1L4KA 3PQCA 3TMAA 3PWSA 4MS1B 1P1KA 2GQ0A 3AF2A 1JILA 2VYND 4W5OA 2JATA 5EIAA 3VKWA 1TS4A 3V1KA 2WQ6A 2KM1A 1AGXA 3COZA 2QQEA 3ZCPA 3ADOA 1THTA 1EWCA 3JVDA 1N8KA 4S2UA 2NZWA 2VWGA 2HWXA 1VL0A 2WMDA 4BBJA 2XB9A 3OQ6A 2D0PB 1WXSA 2WVAA 3FMVA 3OURA 3JZMA 1RBMA 4CHLA 4IRMA 5DF1A 5JAIA 4RM3A 1QSGA 4HEA1 4J0QA 3MAGA 5B3RA 1IPHA 4LNUA 2J9XB 1W46A 1KU0A 5E7IA 4GB9A 3FR7A 5MN5A 4JCOA 1KOFA 3X43A 2DG2A 4B17A 1IB6A 4GI7A 1DDOA 4I4TF 1MEOA 3T7KA 3C85A 2XMGA 3RNGC 2KZRA 1T6XA 5SYMA 3MTBA 2CFCA 3DKKA 2MSKA 2ZYWX 4XIFA 5IC4A 1NLFA 3LT0A 4DCSA 3R9XA 1NIJA 1Q7EA 2VP2A 5J47A 1WZUA 3CURA 3CZAA 4RACA 4LJ6A 1VFNA 3IP8A 1KYXA 4ETWA 2AFHA 3GVXA 3WFZA 5L6LB 1YGPA 3UCXA 1Q16A 4A7PA 1RD4A 5EZ5A 4CHKA 5D1NA 5BMGA 4L8YA 1EWTA 2QORA 3D4PA 1G60A 4CLXA 4PGMA 5D51S 2ZLBA 2LVPA 4PZPA 3LCJA 1F52A 1EFVA 4UU0A 1BMQA 1R0ZA 1WVGA 4CMIA 1W88A 4I9UA 4MRAA 4MELA 4WASA 1SUDA 3KKLA 3KKPA 5JDIA 1I13A 5ARDA 5I7WA 3HYRA 5JY6A 4IKEA 1S3IA 2CXSA 1D6EC 6REQA 5KYXB 2NTTA 2ZR0A 4YUYA 1W85A 3EQ6A 5E6SA 3UV7A 2RHDA 1ORRA 3HRKA 2QENA 1W6UA 1G7TA 1SRQA 3O8QB 5EDSA 2EU8A 1HSOA 3QWFA 2C2ZA 4HN4B 1PZEA 4QRDA 1TFUA 2C9BA 3FPGA 1VCNA 3QELA 4B7XA 4OXQA 2OCYC 4AW9A 1SBZA 1LZKA 5D85A 1T4MA 1YR1A 5BVHB 1R5BA 3C6ZA 3OQIB 1XCQL 3L6NA 4KP7A 5J5VA 4J49A 3DLHA 1JDSA 1WVMA 3TIXB 1ZIYA 3N7TA 1U1EA 2QN8A 1KHHA 4U4AA 1XDZA 3TQTA 1C9FA 4PRYA 1WD5A 2AL7A 2XSZA 4G24A 4KSYA 4MWDA 4IX9A 5EIHA 2JGDB 4G84A 1L4LA 1SIWA 3ZO5B 4LX0A 1JKIA 4F6LA 4ASWC 16PKA 3GJZA 4M46A 3R24A 4BGEA 4RH3A 3O21A 3PFCA 3A9RA 4GN1A 3AWIA 2B82A 3MNFA 5KNDD 3B48A 2GTHA 1FB5A 3AEUB 3HN2A 1HL3A 1I7LA 1GPYA 3PIDA 5HSGA 3JSVB 4WCFA 4F06A 4DIFA 1RABA 3L7BA 3LUPA 4GXBA 1CY6A 4BKQA 4A8TA 4XI9A 1BQEA 1CUHA 1H69A 1U1FA 2HJ9A 5BRNA 2G5PA 1P4SA 4IH9A 3KAQA 3V2HA 4TZ6A 3PRPB 2B2NA 2DLCX 2R25B 2OO5A 3E7XA 1AQ6A 5G02A 4C1NA 4ND6A 2AF4C 4FCCA 1FIUA 2Q3CA 4G4JA 3FSGA 3ZZUA 5HTKA 1KIAA 2QE6A 1FPYA 1O57A 5KYXA 1NG9A 2PMEA 2GPWA 2IU3A 1GGJA 5M04A 4U2CA 5D3ZA 4RKFA 5DI9A 2QLMA 3DV0B 3EPHA 4UBKA 4EPYA 1T0RC 4UBQA 1DTEA 1KVUA 3KQLA 1FC0A 3LHKA 3ZLJA 4JC8A 4JH0A 1QH9A 2A14A 2IGHA 2XGGA 2WPDD 1YRBA 2Z9DA 3L84A 3BUSA 1EF5A 2CB9A 2Z83A 3R7LA 2FOXA 4M0UA 2QMZA 1HDYA 1MA3A 4IMIB 2XRYA 1FDRA 1IHDA 5BVHA 3G85A 3OQIA 3MGCA 2I67A 2Q8NA 3GJQA 3TIXA 3AHDA 3CX7A 5MN6A 5F7JA 1TU3A 3E8XA 2Q3JA 2ZJ8A 4M1OA 1MHXA 5GGYA 2IOYA 1WU7A 2ZP1A 3W3AA 5EAIA 1UEJA 3OD1A 4ZT6A 4QTYA 4CR7A 1ECFA 5F76A 4KRXA 4JVNA 3MVEA 1NG1A 3Q3NC 1RYFA 4LTDA 1H5UA 4R7GA 4R01A 5DBIA 3PUHA 4JUFA 5A9SA 4BVUC 4NL4H 2QW0X 1NF8A 4BMOB 2IHYA 1B73A 3GLSA 3ONVA 2LWPA 5E3IA 4EJ0A 4ND8B 4YUWA 5TVGA 3WTBA 1TB4A 3CIFA 1GPH1 5H8YE 1JHPA 4CF3A 2O7SA 4NS4A 4JJ4A 3F8TA 3ELYA 5L7TA 3V4RA 1DEHA 4ZO7A 1G5HA 3FILA 2UZAA 4NMXB 4AURA 1SUPA 3A9JB 3PTFC 2WSYB 1NONA 1WM3A 2H7XA 4MTLA 4M1YA 4J29A 5I9TA 2AKEA 3BXOA 4N12A 1WIAA 2VK8A 3OU6A 4AJWA 1ESMA 5DEOA 5ALEA 2A94A 5HKKD 3QWAA 3A4VA 5FBVB 5ECGC 4ZGBA 4MUJA 2ERXA 4XD2A 1R4ZA 1U8UA 3J80A 2IZ7A 4JUDX 4E07A 1QO7A 3G2QA 1QGDA 3HZHA 1U0EA 4QQFA 2P8JA 2YLMA 4AMVA 4HL2A 4MJSB 2FETA 3HV0A 3CB4A 2NTSA 2GB4A 2VH1A 1G3MA 3ZQUA 4HKTA 3M4NA 2DMRA 1YD7A 1YDEA 3I2JA 4DLXA 4WY5A 3A6GA 3U2SC 2YZGA 3BREA 5EC8A 5L95C 2JIMA 1KJJA 1C3VA 3A6FA 4TTPA 3ND9A 4A6DA 4CQMD 3OMWA 2LASA 2JEZA 1XL1A 1L2TA 3KTAA 1C30B 3GX1A 3PDUA 2BDUA 1L5RA 2NQ8A 2ZRFA 4RL6A 1U2EA 4POAA 1YT5A 4KSCA 2BN4A 4ZVRA 4CN9A 3EK2A 5DX0A 1JFSA 3PBKA 1LDEA 3O90A 1BNCA 2WXPA 1T4DA 1Z06A 4LDAA 3EG5A 3X1DA 3TI7A 1D3ZA 4GYYA 1Y1KE 1UBRS 1ZHFA 3JVEA 1VIAA 3FHJA 3HWWA 4G6ZA 5EHXA 2X7XA 2BAGA 2Z95A 1CR6A 8MHTA 4WBNF 3JQ9C 4KBYA 3UWOA 2P2DA 4FKBA 4QX6A 1U1IA 3DDUA 3LOUA 1YR3A 4E08A 3NTQA 3W5DA 4DZZA 3KPWA 3P5SA 4KGDA 3B5IA 1K8QA 4B3CA 3LF1A 2FPIB 2ZSAA 4KIUA 3OH8A 1W7AA 3UF8A 4ZDJA 4ACBA 4B83A 5IT0A 2YXDA 2XB2A 5G4KB 1N1MA 5FUYA 1JFVA 1IZ0A 2W2XA 2G4LA 1JLKA 2FRDC 2NSHA 1ZJYA 2EKBA 1YDGA 4RNDB 5AUNB 5JZOA 4KQ6A 4WXYB 4MS4B 4G9BA 2HPHA 4R51A 2EBHX 1RRCA 3C5CA 4HRSA 4EZBA 2FWRA 3H1UA 3K9QO 4FINA 4IYJA 2HL6A 1JEAA 1P72A 5IDYA 3LP5A 2IV7A 2IYNA 5CA0A 1RWWA 1MIOB 1NW3A 3AE3B 2FQWA 3HBJA 3GJ3A 4MYHA 1TZJA 5K7SA 1U9IC 3PVZA 4U2EA 2YW9A 2GH1A 2QW8A 4WFIA 3OPYB 4I5FA 2R65A 1BO6A 3KLPX 3KQHA 2AEEA 2HNBA 5CXXA 1PJ4A 1L7QA 1MVNA 1PG0A 2XUPA 3PPYA 3RWMB 4NJCA 3UCEA 3ZYCA 5K0FA 1KFJB 3TLGA 3WIDA 4P7IA 2WYMC 2OEDA 1USUA 3PNOA 4TXNA 1IULA 1WPRA 3Q5EA 1HYEA 4DL9A 4QDZA 5IKXA 4C2UA 2WHQA 4MM3B 3MOSA 2O3JA 4O4LB 4TTRA 1RYYA 4AK9A 1ISNA 4X1YA 5BMVA 2Z1NA 5FBWB 3GXBA 2J6IA 4YV2A 3A6PC 4NQ2A 3IP3A 4ML3A 1XCBA 2A4ZA 2XIJA 5K8IA 1AN8A 3E2IA 4BFWA 3BFPA 4GNRA 5J2UF 1VSUA 4RKYA 1MO6A 4RGBA 3R6GA 3JQFC 4ZYUA 1JAHA 2IEGA 2C1XA 3G49A 3PDHA 3ZDAA 1Z7BA 2PX6A 4URFA 1WSPA 3KT8A 3G5MA 2Y3IA 3H3EA 2R5WA 1VB3A 1S4MA 2YJ4A 4A0HA 2YZKA 2YOHA 5G4KA 3F5SA 3RVMA 5KYWA 3AT1A 1SKBA 2JHCA 2BGLA 4YCLA 3W90A 5ACQA 2DHQA 4CIDA 1GSAA 1R5JA 3GMIA 1K97A 5JDCA 2HNAA 4YMUA 4G36A 5A6SB 1HC7A 1R9NA 1KOTA 3ZKWB 3FLAA 3TOZA 5HH4A 3ZXXA 3T1NA 1P5JA 1Q2UA 1U94A 2KOXA 2I29A 4XX0A 5BSFA 2UUOA 1E2FA 3DZBA 1RHUA 1MIOA 5AVRA 3I9OA 3BZUA 3DNFA 2Q5FA 4FGWA 4NBUA 5HGJA 2H1IA 3K0AA 4I1YA 3D32A 1R4NI 4KNYA 3OAAA 1XXLA 4QM6A 5KO2A 1NWCA 4ARSA 1EDDA 1CLUA 1BVYF 3CZMA 3T7EA 4EFLA 1ZG3A 2IITA 5AKGA 1WVIA 4G1VA 3RSZA 2DP4E 2LHDA 3BA6A 3NPAA 2FPMA 2XNHA 3G2JA 3SEAA 1XROA 2ZQYA 3MYRA 2AQ3B 1GT6A 1KPIA 2Y1DA 4MM3A 5ACXA 3D6AA 3PDIB 3IAUA 4QQNA 4CHGA 1T3LA 2G9UA 5ICCA 5KNCD 3EVDA 3FAKA 2Q5JA 5AVQA 2RGWA 1O6ZA 2WT9A 1NQWA 3L1VA 2X6QA 4IF6A 1HQRD 4CWAA 3BCUA 2V6MA 3OFSA 2GA9A 2JBAA 3GEGA 4M76B 4QXQA 4EYKA 2X7HA 3FPHA 3FNHA 4NE7A 5EQDA 1YK0A 4ZI3A 1C1HA 1P7PA 4GLJA 4XSGA 3GJTA 2R2QA 4DM7A 2CXXA 3KT6A 4HQ6A 4H1UA 2X8AA 2OYSA 1Y42X 1ZC4A 1H6CA 1GM5A 2N1WA 4ERNA 4IJMA 1GUZA 3VC3A 2K5UA 3LX5A 2HRRA 4S17A 2GSWA 2Z9BA 4OLJA 4WQOB 2O0HA 4ZXPA 1ESDA 2TRSB 1YVEI 4O5AA 1KETA 1HFKA 2VUHB 3ZNBA 2P2SA 4OHOA 3SFPA 1YTLA 3NG1A 4S0ZA 3N6VA 3GE8C 4Q19A 5A6SA 5FQNA 2HXYA 4CMGA 1WF6A 1ABFA 3NBZC 1JH8A 3EEOA 4DV1B 1LW7A 4LHVA 3S29A 3QSYA 1TCBA 3V55A 3QKRA 3RRZA 1OFUA 1A5AB 4B2IA 3GNLA 1AUQA 1I5RA 4TMXA 4LDTB 2BKXA 2GEKA 2ZVDA 2YBEA 3E9MA 3ECCA 2ZSHA 3T1OA 2EZ8A 3VSAA 1UMBA 1XZCA 2KN4A 4U6SA 3RKUA 2GJ8A 1GC6A 1RFAA 2VT2A 1ESEA 2XB4A 4OVKA 3IEVA 4RPHA 1OXVA 4DLPA 2WZDA 2EJWA 3K5IA 1G6JA 2XYHA 2PJHA 3UOGA 1JWUD 3NTVA 3PDIA 2I33A 2RKWA 1OXBB 3M8KA 4WDQA 1MHPA 5CH5A 2RSUA 2FPLA 2IS1A 2FK8A 3PQ8A 4ZAGA 5BR1A 5CFLA 4OB6A 1ZN7A 3FKSA 3TUIC 3C3JA 4F84A 3IP9A 4DREA 1P7ZA 4XZ3A 1X8KA 4MO9A 4P33A 1G4HA 2IFTA 3C16C 3E22A 3HKBB 4LRTB 3DZJA 1R5NA 3GFRA 1UBEA 3JYOA 4HHEA 3SXUB 1QQ5A 4RKRA 4UD6A 4C6SA 3NMUF 1UK8A 1ABEA 3PR1A 1M66A 3GCWA 4TRRA 2Q4BA 1LSUA 3A1TA 4NQ6A 1NLZA 3LUCA 4N7JA 5IARA 1E1LA 1C7RA 1P8AA 5IKCM 3ZI4A 4MS3A 2QN3A 2XGMA 1K5DA 4N8DA 4QYIB 4OBXA 1QPZA 2NUTB 4N7RA 5H92C 1C3TA 2QP3A 4RFSB 2QLNA 2G83A 2JFZA 4IV5A 4Z7NB 2BM0A 1E2JA 1DINA 5ERXA 2O2VB 2HBYA 2IYDB 2O59A 3NOXA 3I9FA 3CWCA 4Y30A 3FDZB 2PMDA 3JQGA 3S1LA 3TQSA 4M8KA 4BNXA 1I9GA 2V7TA 4I3HA 5AJWA 4JJ7A 4MA4A 5AJUA 1AM4D 5HF9A 2C7GA 4ZTZB 4BC1A 3C6QA 2QI9F 5F33A 5K6TA 3RT9A 3IPLA 1RMYA 2N1BA 3ZV7A 4HATA 2O6VB 2XVAA 4FOSA 4A73A 1GL6A 1R8JA 4HNAA 2IUSA 5EMLA 4C1CA 3ZHUA 4W9MC 4IIGA 4CF5A 2RGYA 3C1AA 3QKUA 3OZ7A 1BFUA 4US8A 1NIPA 1CQIB 2HMUA 5AXOA 4YCAA 2JBHA 3RYTA 2QZ4A 4L95C 1FFHA 1TFRA 2EYUA 1V5TA 3V9AA 4YRZA 2F3TA 1JAXA 2OORC 1M72A 1GPUA 1YDWA 4LBVA 4V03A 1CS4C 2ADOA 4HVLA 2DKFA 5BSGA 4HLUC 4MXDA 3UIPB 4OXNA 2A0XA 4ESHA 3THOA 3H8WA 3JWHA 4YUXA 2NXCA 1OFFA 5JAOA 5KB3A 4BKSD 3N0VA 2WHPA 5H80A 1M1UA 2VAXA 3SZGA 3NM4A 3HCDA 2PJUA 1IRIA 1L5OA 4HSGA 3PK0A 4HDNB 4DT1A 4R0NA 3NR2A 1X14A 3ZD9A 3RRFA 4MUHA 3AKDA 4R1SA 1L7RA 1U3WA 2LJ5A 4L0MA 1E6KA 3NO4A 1FS6A 4BJ5A 1QJ4A 2PV0A 1WY7A 1QP0A 4IIJB 2HTFA 1Z6YA 3KNRA 4LTMA 3D6UA 1L5PA 5FTJA 3QWBA 2MH7A 4M38A 1N60A 2JCBA 2ZUEA 3IC5A 9LDTA 3UJAA 2VP0A 3ISVA 3DL0A 3VR6H 4TKLA 4PGGA 4RTMA 5HKLA 2PE9A 2YWFA 1T3QA 2H6AA 4S1WA 1ACLA 3OZDA 4MKFA 2YNTB 4CZ2A 2IXTA 5LWQA 1R0XA 1NMSA 2IZ1A 1X87A 5DCLA 3TRFA 2EMSA 3H2IA 3DCJA 2Q4OA 2BIBA 1X70A 1TLTA 3TSWA 2G1KA 1KJTA 3NEAA 4DCCA 1N9GA 2GWHA 4KFCA 1Y8RA 5AI8A 3HBNA 2G80A 4IVQA 2RH5A 4P82A 4Z67A 2ESRA 5GVSA 3DHAA 1GYRA 5FBRB 1JW9D 4CM9A 1MC1A 2DBQA 3V7FA 2LKDA 1U2PA 3KKMA 3VR3A 5EQJB 5EVJA 1C0IA 3RZWC 5AK0A 3SQLA 3U49A 3QARA 3C6XA 3ZUNA 1AGNA 4FIZA 3CRVA 2ZUVA 5EPUA 3OFJA 3L8ZA 2IYUA 1RXUA 2OV8A 3GARA 4ME6A 4FMBB 2IEBA 4V02A 2YZNA 1TM7E 1G6OA 3COPA 4Z86A 4YVFA 3VDQA 5JQGF 1HF3A 2EARA 3VR1A 2A7MA 2GEBA 1XTQA 2C4TA 1JYEA 3G1WA 1ZVMA 1FYEA 2D1TA 4Q3CA 3U4AA 5AXRA 3QVMA 1ZN8A 3IMEA 2BGRA 2YHSA 2FR1A 4C0JA 2O3RA 1U28C 3WGYA 2IPMA 1NVMB 2BFCA 1A8QA 2G7ZA 3C3WA 1YRHA 1NI5A 1U90A 1E5TA 4AO7A 5KILA 3I2IA 4B6FA 1UOQA 4AWBA 1EHCA 3M6IA 3TO5A 2OECA 1O08A 2PU5A 2KC2A 5HK9A 5KOJB 2AKYA 2YNTA 4XIYA 5JG7A 3NHYA 4XVHA 3LAWA 3A4YA 1KKMA 3P20A 3QI2A 1RE0A 4MVJG 1EINA 2AQHA 1NMXA 3TIIA 3GIWA 3EXG2 5THQA 4MGHA 4MWSA 2F1IA 2H0AA 3TPZA 3FX2A 1V25A 3KTOA 4MT5A 4AAYA 3R75A 3W8NA 2ZOSA 4KLRA 4ZVKA 3GS2A 5IC6A 4ND4A 3EQ9A 3KE9A 2F6RA 3NP7A 1A9PA 3EAQA 5FR3A 3UY4A 4CL2A 3TN7A 4MGYR 4EATA 4D81A 4RNCA 4W8GA 1A5TA 2KTFA 4RLHA 4NP6A 5ALYA 2P9FA 5G2OA 5LNK1 1RZVA 3QY9A 2QY6A 3EUAA 4OUKX 1C8BA 4RQBA 4OQMA 4UXJA 2XQIA 2IHZA 4WXPA 2WVGA 3FUTA 4E71A 1RHJA 1E59A 1ZXIA 3EWSA 4D43A 1AKYA 4B3RB 1TPYA 3W6UA 2M8SA 4OQDA 4BVHA 4F6ZA 4LK0M 4GBJA 1XCJA 2OV2A 2CLHB 1JMVA 3LA8A 3U39A 3QEMA 1UCFA 3BL5A 5LSAA 3G0HA 2QX9A 2Q0QA 3H84A 2VQ6A 1AVTA 1VG0B 1DTWB 3I63C 4FI3F 3K6RA 2W6PA 4NARA 1EIWA 5CDHA 3A32A 4RTQA 5CLGA 5FLEX 4NC9A 5AXCA 2M1ZA 4FD3A 4EH1A 1Q7CA 1ZD2P 4LNNA 2FZCA 3VUYA 5CYOA 2HAEA 4YJHB 4GOLD 5E6PA 4TS4A 3ZY6A 4OJKA 3B9QA 3GLFB 4CU2A 3F67A 3OE5A 4J94A 1GTRA 1USWA 3AF3A 1J2JA 3K9FC 3AU8A 3NBAA 5DPWA 4GC5A 3R7QA 5JCXA 1CNEA 1HLFA 3W2EA 1B9RA 3ZLVA 1BVTA 4ZVVA 5B3LA 1SVSA 1XTVA 1Q57A 2R6AA 2ZIFA 3BXHA 1I3OA 3AUAA 2BTOA 5J43A 1E2LA 3OFND 3QVSA 5DCUA 3Q69A 3O13A 3R09A 5A02A 2VNIA 4A8JC 3LNCA 4P4TA 1QCYA 1NN1A 3A1NA 1P2VA 2J32A 4H60A 1TA9A 4TL7A 3IE0A 1FBTA 2EZ4A 4WOCA 4UUMA 3Q15C 1EM6A 4DXGA 4FYWA 3B3FA 1OX4A 4OJMX 4FMDF 2ISCA 3DB2A 4DLBA 2XNAC 2I6FA 5DK6A 2XE7A 3EHEA 1EWRA 3RSLA 1U65A 3CIOA 2JA1A 4ZO6A 4PRZA 3ZWQA 5CB4F 1NLMA 4EW1A 2INPE 1PO7A 3V6CB 2XT0A 2PJRA 3RFXA 3PQ2A 4L9SA 3BZDB 5I48A 4ZRIA 5AOAA 2BG2A 2PUWA 3GLFE 4X84A 1W49A 3RUDA 5TEWA 5BSVA 3FBTA 4YLYA 1YB2A 4XPZA 3JAMA 4M9XA 2ZVPX 2DXIA 2WIFA 3P0FA 3HVHA 3Q2IA 1IVSA 4IEEA 1S96A 4C0AC 4Q48A 1JJ7A 4BFXA 1JF8A 3U5TA 4H7HA 1GLNA 4TV8A 5DHAA 2ODTX 2GF9A 2V96A 3QVXA 3DMTC 1YVRA 1NQAO 4K46A 2EKIA 3PNKA 1HRDA 2XH8A 3K70B 2IXGA 5H4GA 10MHA 4XWTA 1GV1A 2G9RA 2NQ2C 4CF4A 4TL6A 3ICWA 5K6AA 3BF8A 2E6KA 5K2OA 3B82A 2CJPA 3SR6A 5ALKA 1HUQA 4EPVA 3F7NA 4DDWA 1W93A 3RAPR 4IDIA 3WK9A 1J0EA 1NAHA 4QXAA 4Q15A 5H70A 2AI3A 4ZV7A 2WHIA 3LUHA 2EBFX 1TGYA 1GLVA 4LJOB 3OE4A 3S55A 5CVVA 5AW0A 5AK4A 1I4PA 2HTHA 3MZ0A 3HB0A 1KVTA 2G0AA 3PIIA 3LUGA 1T8SA 5IEBA 2AN3A 2WHXA 5JECA 3R3WA 1ZICA 3LRXA 4AC9A 4XJXA 1KTKA 4WJPA 5HA5A 3IT1A 4D2IA 3DZIA 3VR6A 4CG2A 1PR2A 2G17A 2G4DB 2WA1A 1OXMA 4TQ1A 3N2GB 3WGTA 1X6VA 1MX1A 2I4OA 2QRLA 1ZIXA 3AEEB 4QQKA 2QIEB 4RZ3A 4MDYA 1BS9A 3KAKA 3MJHA 5AW2A 2R7NA 4PLYA 2W22A 1NLYA 1T5BA 3MAAC 3QIAA 5DV9A 4UWPB 2CKDA 2R7LA 3VUFA 3CEMA 4MQ6A 1DRJA 1FRVA 3MWFA 2PKQP 4GXQA 1XXHB 3AJ8A 1N62A 3T4PA 3ZDMC 1FS5A 3D5EA 1WJ6A 3O8NA 1QG0A 3AOEC 3FUUA 1YZUA 3OZBA 4ODIA 5BSRA 4GLFA 2RHJA 4GMGA 3T54A 3DVLA 1IPFA 1CKEA 3IYLW 6AT1A 3UJ3X 4DRYA 4G3XB 4FBMA 4JOCA 3WLRA 2G1AA 1II0A 1KLUD 3BB3A 3W1SC 1GPLA 3F6CA 2VUTA 1IK4A 1DKPA 1WLYA 4OVZA 3LS2A 4MW6A 3QKSB 1S8FA 1XZIA 5JD3A 1QWOA 1AV6A 5HF5A 3KJQA 2R86A 1ZLXA 4YP9A 1SB3C 1TJEA 2HHAA 2KLGA 3NC0C 3HM9A 2FMIA 4HO1X 2I1QA 1UK6A 3RGWS 3VR9B 3W2GA 4HXDA 5TQ0B 2ENWA 4YRKA 1MXHA 1ZP0B 1HDRA 4IW3B 3P2YA 1PG5A 4HD8A 4BBNC 2BLLA 4LOIA 4ICIA 3LQKA 3AUXA 4H17A 2J9FA 1ULSA 1NURA 1WLSA 1W2GA 3I0VA 1XXHE 3R5SA 1ZW7A 5DNAA 4IWXA 2BFPA 2ZE8A 3KEMA 1WX1A 4YRCA 4Q1AA 4XGQA 5FPQA 4A6XA 5C2TB 3NYIA 3CT4A 1MJHA 5KU7A 4GG1A 2QC8A 4P7BA 1MABB 2PKRA 3E5NA 5DP1A 2REBA 5LKAA 4ZFNA 3L2OB 1PI3A 2L76A 5CEFA 2H92A 3O73A 2YZ2A 3CMCO 2FLKA 2IHBA 3PE3A 3WKBA 3CZPA 1ZVJA 4QBIA 3AKYA 2XIQA 4DYHA 3DYVA 2D5CA 2EFCB 4O2BF 1ZOSA 3SS8A 2H07A 3AOGA 4NECA 4M1SA 1VKNA 3KP1A 3LBIA 3GNQA 4A8HA 4MWZA 4HVTA 3FJOA 2G09A 3KQSA 5LQJA 4LV5B 3PHIA 1G3RA 4G3XA 3GL9A 2E4AA 1RQGA 5JQWA 4P3XA 4I6PA 2QUJA 2QR2A 4WLOA 2F8MA 4M1EA 3TPCA 2WP8J 3STTA 3Q3JA 2SKEA 3KLNA 1RAHA 2BG7A 2ONQA 5PGMA 3ZTTA 2WU2B 2FPWA 1U3CA 3OQOA 5I8ZA 1B0PA 2CJXA 4BX9A 3NFRA 3W1VA 3FZEA 3UGTA 3ZX4A 1UP6A 5IFLA 1ZUHA 3UB4A 4JC0A 3ZDYB 1FD6A 3VPGA 4RELA 2ZDHA 2CCJA 3SXPA 2VP5A 2VRCA 1Z5PA 4WVFA 1GCAA 3NVAA 1BDBA 1FSZA 3ENZA 4JSRA 4W82A 3AEDB 5DXAA 1P3QU 2LUEA 3KAJA 3CKKA 1AYFA 4XD7A 2KX3A 2AN1A 5I3ZA 3L43A 2RMMA 3OMXA 3SX2A 2VSYA 1DG1G 3KUCA 2HLPA 3LYUA 3QPCA 1EYZA 1PEAA 4JYZA 2PH3A 3TSCA 4MLDA 2IZOA 3R3JA 3PQEA 1N8SA 3L02A 3EEIA 1QMPA 3TSOA 3RBVA 3WRXC 1OC4A 1PT9A 1MABA 2G07A 2WFAA 3X0DA 4KWIA 4AU1A 2YFYA 2B1IA 1C4CA 4Z51A 1BCSB 2D3GA 2A35A 5H8WA 1E3MA 3BIOA 3FW1A 3D6FA 4HDRA 3CPHA 1E2BA 3KOXA 3MTGA 2HSDA 2ODWA 3THSA 3W06A 2JFQA 4KZ0A 1SVIA 2VA9A 5A23A 4X7PA 5GZ3A 1IZ8A 1BVRA 1JQAA 4D92A 3TD2A 3PVCA 5B7PA 3IAM1 4C7YA 3SM3A 3UXEA 1GKIA 1MOQA 1NNSA 2E18A 2HWUA 3O31A 1R2QA 3C6KA 1SUFA 2I3ZA 5B4VA 4EF6A 4ZKEA 1EMDA 3IQHX 1PV4A 3BDAA 1UWLA 2FFRA 2DVMA 1UBFA 2MBHA 1E10A 5IANA 4YRDA 4UHCA 4BLRA 4RDIA 2A30A 2O48X 2YTZA 3DOOA 1N3YA 2H8KA 4KVGA 1R0BA 4AY2A 2AJTA 1E90A 1JG7A 1JPVA 3F90A 2IY9A 1CUAA 3P42A 2C88A 1U4NA 1H1LB 4QUKA 1PQYA 1J09A 3BHJA 5JNVA 3B2GA 3FKQA 1YOVB 4P38A 1FRZA 4G5RA 1JEOA 3GMSA 2PSEA 4YJKA 2XCUA 4DIUA 3DJYA 4CQJA 2A4MA 1JR3D 1QAMA 1ZP6A 3NEJA 1T0BA 4IJ6A 3NBQA 1X7DA 4Y6LA 4EHJA 3U7EB 4UAMA 3AU4A 2ZXUA 3MPOA 2J0JA 4Q4LA 2WXFA 3SSMA 4MP3A 2WNIA 1N2XA 5FKJA 4KR7A 1T5SA 1I33A 4ZYNA 2OGTA 5K0ZA 4EB3A 3VPAA 3OZSA 2FUCA 2Z4SA 2K6QA 2QE7A 3AVPA 2VBFA 1DBQA 4RY2A 2JLUA 4KRGA 5JHGB 4KNVA 3M63B 4QOSA 1QF9A 2HIMA 5BOVA 1Q0HA 2GI9A 1HDGO 1G0OA 1AKWA 4XJTA 3ZK9A 2NPIA 3CSFA 1BCSA 3HV2A 5IUNC 4OGGA 1NJ8A 4FC7A 1D5XC 4MVJM 1G59A 5D94A 1XQQA 2CSUA 4HB4A 2I1KA 3MIZA 4YT5A 2RAFA 1ESNA 4IS2A 4E14A 1FSFA 3OE1A 4LE0A 4Q4DA 2JLXA 4RU1A 1AB5A 4D99A 4L3VA 2CR5A 1TOAA 3KVVA 2BBSA 4YASA 5TT0A 3PVLA 3AL3A 4W9EA 1CS0B 1K51A 4UEOA 1T2AA 4K8OA 5I4BA 4HGNA 2IV2X 5TF4A 2X4GA 4QUEA 3GAAA 2Z6QA 2PRSA 4F1WA 3D7MA 3HI4A 3JD1A 3L0YA 2F00A 3DHHC 3KNSA 2NTYC 1PJSA 3OZIA 5PNTA 3ZJ5A 4OQZA 1HBJA 3SY8A 2WTNA 1JHMA 5CLHA 1JNYA 5BNTA 4FHCA 5H68A 2FCMA 3RVLA 1JT9A 2NACA 2GM5A 5KNLA 4PDXA 4MSQB 1H2EA 5IP4D 1KDRA 2MSEB 1UMKA 2YRXA 4L5YA 3S0JA 3LT4A 3H0CA 1E6CA 4PPGA 3DPIA 3ZHQA 3JZDA 3L0SA 1J7CA 1R27A 1IM8A 3ZN2A 1W34A 4JBYA 4DB4A 1G20B 3QIVA 3VUXA 4YAOA 1NVBA 5LDDC 2K2WA 4IC7B 1SCDA 3TLYA 5A9RA 2QRZA 4MS1A 1V5GA 3G5LA 3FNRA 2NOAA 1WMFA 3DBIA 3H5VA 4FI3C 2O20A 4YBRA 1TIPA 5EWMB 2FEOA 1VYTA 1CR4A 3AFMA 1OAOC 3FVQA 3NBXX 3ONSA 1HL7A 2B4QA 4YMGA 4BGVA 2P1RA 1OUMA 2CN1A 2M0XA 2F8LA 1L7YA 1SUIA 2YL2A 2J5XA 2J5RA 2QM8A 4PSVA 5DNWA 4M53A 4RUKA 1HZ5A 5JD6A 4GXNA 3F6EX 1GY8A 1LC3A 1P45A 4L6IA 4EOGA 1MCZA 4DLKA 3PPAA 8ADHA 3I4LA 5FD8A 4CNBA 2DEUA 3AF4A 2J87A 1XUOA 2GD2A 1CS0A 3UJ8A 3VHXB 1Q7TA 3FG9A 3K1JA 2DAJA 1AE1A 3GR6A 1JVSA 4BQFA 3AVYA 3PUVA 1SF0A 4H6XA 1D9ZA 2XUAA 1WZ2A 9MHTA 4B4OA 3KVRA 2OHIA 4NEGA 1YL7A 4XX1A 4CRWB 3NPMA 4G5OA 2X5OA 3WISA 1A9XB 2LVOA 1YQ4B 1LF5A 4AJKA 1JDZA 3BRWD 2Z2IA 1CP2A 3H2ZA 4MKHA 2FSPA 3Q5GA 4TT8A 5ICFA 4C0WA 4M22A 2C54A 2ZS7A 4FFPA 1FMCA 1G20E 2IYYA 5IG2A 3MT7A 1NBHA 3L7IA 1RI1A 3H9CA 1CQVA 1NRIA 2NGRA 3ZE6A 3N0XA 4PHGA 4YRSA 1TYGB 3FKYA 4J1QA 1KTIA 4KITB 1NUUA 2HA4A 5EWLB 2CFTA 3D9QX 5IA7A 2ZU0C 4RW0A 5IU6A 1I14A 1Y6ZA 4HGOA 3KSDO 3K9OB 4I0WB 1NHGA 1KE1A 1GRRA 3AKEA 1I0LA 2C7QA 5EE5B 2GD6A 5K0TA 1AX9A 2W0SA 4AQ7A 2ZWOA 2BKLA 1X3SA 4YAGA 3HBMA 4PSDA 1G20A 1NXQA 4IYRA 3D54D 2PGOA 4NFHA 4W1RA 2OFOA 2WNMA 2HSJA 3O8QA 1JIIA 4TSFA 4DMMA 2V1UA 3RR2A 4YY3B 1O1YA 2Q21A 1RBYA 2AR0A 2RC6A 4QU5A 2H4XA 4M3NA 1D7AA 4QUDA 3HL4A 3T3DA 3N8DA 1J5EB 3HGTA 2EX0A 2VHVA 2FWAA 5HCNA 4QTTB 2KPOA 3IQGX 4MLCA 2RHBA 2CHFA 5BV0A 3CF6R 1FBNA 5IBQA 1CY7A 2X5KO 4U8GA 3NS8A 1EXWA 3R7AA 3Q6IA 1FSSA 5HMLA 5IW8A 3RZFA 2PT9A 3B2QA 1NLUA 3B6ZA 4PYUA 2VHEA 3NXSA 3VHXA 4Z3OA 2JGDA 1IP9A 5J1TB 1NP3A 1W19A 2YY5A 1FLAA 1JU9A 3RI7C 1HEZE 2P9YA 2AH5A 1T6YA 3FCUB 2FSIA 4G50A 3QQ5A 1DRKA 1L5LA 3GDGA 1Z08A 1X1MA 5HDBB 4E12A 5LD2B 2JFNA 3AEUA 1XCMA 1NJ1A 1C3EA 4O5OA 1ESFA 1T26A 3JSVA 2ZNVB 3Q3HA 1A9SA 1JQ3A 3IAS1 5I7VA 3ZXVA 4LYDA 2MBQA 2V9CA 4M0LA 2ZE7A 2WSBA 2FKNA 4C00A 5EQFA 4TYNA 4MWGA 2B5WA 3MILA 5DM60 4KQGA 4MMZB 2AQKA 2R6GA 1EQAA 3BORA 4M1KA 5AJHA 4D5GA 4BQSA 2XI4A 4QXOA 5CCBA 1SKYE 4ZQEA 1YJ5A 4OD0A 2J48A 3NHPA 5B6IA 2DBRA 3P96A 4ETNA 2G8NA 1O6BA 1J0XO 4KKIA 1GYQA 1E9AA 1GTZA 3ITDA 1KORA 4F5YA 4W63A 2CK3D 4X8HA 3DV0A 2C7NB 5M34A 3QX9A 4KJXA 3VTWA 1GJZA 4J4HA 3KFLA 1WA5A 4X92A 1Z5SB 1YQEA 1MNQA 1ZJ4A 2ONJA 4NWIA 4NCBA 2AW5A 4F8JA 1SZPA 3FNIA 4OXYA 1V8PA 2COKA 1I6MA 4YREA 421PA 1B0UA 3TX6A 4A3SA 4PONA 1KERA 2V5AA 3OZXA 2OCPA 1MG8A 1JH9A 5CJJA 4BTVA 1TVMA 3KD2A 5IMBA 4BO5A 4KQMA 1GNRA 1FU8A 4RABA 2FW8A 3WK7A 4J0JA 1F0YA 2UUCB 3PFFA 3RHSA 1AZWA 3GFVA 4B45A 4DLVA 2XRMA 3LVBA 3JD2A 2YY6A 5JHBA 1EP1B 4L7QA 5CP8A 5F51A 2OHOA 4AWXA 3GBVA 5BYQA 1RZRA 4CKBB 4GD3Q 4J4BA 5B4TA 5KDOA 1DKQA 2AJLI 4EJSC 4ND8A 4CM3A 2P67A 3ZE0B 3EIUA 1RNLA 4RK7A 4FGJA 2ICIA 2ID8A 1AN0A 3RNCC 2RGBA 3D7KA 1R4NB 2IEZA 5AJXA 1WEHA 2MOKA 2BEVB 3AX6A 3ZXRA 2OXCA 1FXAA 4LGVA 4KKJA 3A9JA 4MUNA 4GSKA 5H9WA 1HQCA 2QAJA 4CBVA 3WE7A 1MGOA 2YUTA 3G2OA 1T9HA 2CLMB 3V5NA 4E5MA 4OCZA 2N9EB 3D2AA 2CFSA 2C2GA 5A2QA 1W59A 2XYRA 2CVFA 4RJKA 3UMYA 2XBBC 2AK3A 5SYAA 1OT3A 2JAXA 4TTIA 5A0TA 4PZEA 1UUPA 3TCNA 5KWEA 1LH0A 3V8PA 1IXKA 2O2ZA 1UGMA 4JC4A 1ZINA 4MJSA 5IS2A 3IOMA 4E5VA 3CH4B 5EFOA 2XX3A 1BWRA 3VPXA 3BVPA 3V46A 3HO1A 5KYVA 1V5WA 2K6DB 1I0IA 1YF3A 4MCAA 1L7PA 1FTYA 1WOYA 4BRSA 1ZITA 4DS3A 5JADA 4DADA 4IRUB 3P52A 5JZEB 3BRCA 4EO4A 2XZTA 3AH8A 5FI1B 3QPAA 5T57A 1NNEA 2JSVX 3OCVA 1ZY2A 3VI3B 3U9LA 3TQFA 3ANTA 1VLBA 2UXCB 4BLQA 1C30A 2D00A 2RGNC 3IHKA 2FMFA 1K5PA 4FEGA 4W5TA 3RBZA 4TQ0A 2SNIE 2A0FA 3R3VA 5AW6A 2YFQA 3KL7A 1P9OA 5LQSA 5BMOA 4CKBA 3AR9A 1AKTA 4AUKA 2FW1A 3RK1A 1J1IA 3ZZTA 4G11A 4OFBA 4F86A 5C8YB 1U5CA 3OECA 1DKLA 1LGRA 4K5QA 4TMVA 4ZJZA 3P27A 1EUDB 1PS8A 3VYUB 3U61B 3Q9LA 1HTBA 2DTXA 3VNSA 2L82A 1F06A 1P1BA 4A2WA 4QECA 2BEVA 3HBLA 1Y4SA 3OCZA 1NDDA 3BILA 1CY8A 621PA 1A98A 3GLRA 1D1TA 2WJHA 2DZMA 1QIHA 2WYUA 5DSXA 1MTZA 2FPIA 1V2GA 2ZYDA 4C7MA 1GL7A 2IKQA 3Q3MC 5IVDA 4KGRA 4GZLA 4NXMB 1SPXA 5HISA 4JI1B 4RAMA 2NG1A 1NPYA 4EMSA 1UFKA 1T9BA 3BFKA 3AR3A 3HBFA 4MMXB 4MS4A 1P7YA 1Z7YA 4ALJA 3TFOA 1MRZA 1ZTCA 1OI7A 4PIMA 1BDHA 3HWRA 3PEFA 5IXSA 2JAUA 1UELA 3H3JA 4HUJA 1Z6GA 4LTUA 4E09A 3C7TA 2FXIA 2AD5A 3T7CA 2CLSA 4QULA 2BJWA 4H4EA 3OEHA 1DAOA 1MG5A 4XEHA 4S05A 3O84A 2QDFA 4RHEA 1PVVA 3IJRA 4JNKA 1Y9AA 1ZL2A 3PLNA 2A5YB 3RVPA 1EDOA 1SKUA 4FKMA 4ZJPA 3OPYA 1NOKA 3GJRA 2A0KA 3M3JA 3D6VA 2IU4A 5JMPA 1SUBA 3I04M 1KO4A 3MJ5A 1N2HA 3DDZX 4EW3A 2QM3A 1D2HA 3K8OE 4PG5A 2W3RA 1T5TA 5BN1A 1MQ8B 1WQ1R 2FR8A 5AIAA 3CGGA 3TCKA 3K32A 4CTJA 1E9EA 1O58A 2W55A 2JJMA 2VHCA 2XLCA 3BE6A 1UADA 3EHVA 2HSWA 2P9TA 4O4LA 2PNJA 3WKAA 1TYZA 4Y9DA 1NVAA 2VYCA 3GN1A 2XPCA 3S8EA 3WGHA 3CSUA 5CGQB 4JBIA 2BFKA 5KJEA 3VPDA 3OX3A 1EUDA 3BIXA 4I50B 3E27A 1M5TA 1Z2NX 4KV2A 4JKYA 2ZSKA 3FPKA 2P9HA 3V1MA 5EXSA 3GUCA 1I0ZA 4GVLA 1N5JA 4HAXA 4HTFB 4N6OA 2RI6A 1RLTA 4ZP1A 3C5HA 3ISJA 3QA8A 4X6YA 2V0CA 4N48A 3VFKA 1DFIA 1UWKA 1QOQB 2XN9C 3AP1A 4M21A 2PUVA 2EHDA 1KYWA 4PQRA 4JT4A 1Y4UA 3FCXA 1SXGA 1PQSA 3ZKWA 1H6BA 2JLWA 1YZ3A 2FUG1 1AA9A 3D1JA 4B95A 4NE2A 2HJ1A 1NI2A 4B74A 5JROA 1EE1A 1WXHA 3PNMA 2ZUFA 2II6A 4B7UA 4NOLA 5B57C 2IO0B 1ML4A 2FQYA 2I87A 1BEZA 2EJUA 2IXFA 1DJNA 4YIHA 2BHRA 3Q87B 4BV3A 1L7EA 3NT4A 1E3EA 4Q7MB 2CXRA 2IK8A 3SYTA 3R9WA 1GC7A 2GVDC 3CZ5A 3CEPB 1YZGA 1XRJA 3NTRA 3UAOA 2WWZA 3ESDA 3OBIA 2OVBA 3NANA 5I7HA 3WBJA 3GFTA 4DTIA 1ZM3A 3DNPA 2IHNA 2X8XX 3ZYZA 1F2RC 3R4VA 3VPSA 4XRGA 4IIDA 3H1BA 1GDTA 4XA8A 2YRWA 1QORA 4JHXA 1T2NA 4F56A 3UEOA 2VYQA 1HEIA 2VC2B 2YHIB 4FE7A 1UIRA 5IAKA 2GAAA 2GTPA 3HTXA 2FVXA 4ANXA 2FQ1A 3LGAA 1EK2A 5DBFA 4FP9A 3B5JA 1CJEA 3N1ZC 1V2HE 4RFBA 2XNDA 4MRMB 4X90A 3OJ3A 1THZA 1CRZA 3AM9A 1DV2A 5ESDA 2AEHA 3ICVA 2I6GA 1XEFA 3RRJA 1OJ7A 4KX3A 4HTFA 3DVQX 3WWCA 4GEGA 5JUWA 3G8CA 5K05A 2BS2B 3TBLD 4UHHA 3UGQA 2Z2ZA 4YPOA 3MQFA 3DDHA 1RLOA 3MIIA 3WYCA 1QO0D 5F7OA 5LCFA 3FMOB 1NKTA 4BBNF 1IJEA 2A9PA 1XL0A 3ZHXA 1FJHA 4RPIA 3K0SA 2PA0A 3ZX5A 4R2XA 1X7ZB 2K39A 2WOJA 2AKAB 3FPSA 4ILEA 1I5OA 2HCJB 4Y9UA 1PT7A 4FR0A 4JLOA 1IQ0A 2XQJA 4ZQFA 1Q14A 2G25A 4GPD1 1YMHE 2HU7A 1B1AA 2OZLB 3F9RA 2FW6A 1DYQA 2P6OA 3SPUA 3RTEA 4FXOA 2VDRB 1RWNA 4E30A 5GADl 4TS3A 4HLDA 2ZAYA 4TX1A 5FNVB 2A5LA 4I6EA 4ZCLA 3FDXA 3WIBA 2UWQA 1V7PC 3QAQA 1VJNA 3RUCA 4G8CA 2IEAA 2I4NA 2ODNA 3PHCA 2FE1A 3A58B 2RB5A 2CHUA 3AI5A 3H42B 3IVCA 4NR0A 3T0IA 1OAAA 4ZVUA 1XWIA 3GBPA 4B3SB 1YR2A 1VZ7A 1WCIB 4NYIR 3U2QA 3UOWA 1CUCA 1IMJA 5JO9A 3ZW3A 3RRNA 1VYVA 3TNYA 5CVUA 1OBCA 2J5QA 1I2AA 3TR0A 1V6EA 3IJ5A 3EBPA 3RFUA 2IIPA 4XGRA 3Q3GE 3JX9A 3CY6A 5BQOA 3JS5A 4G2TA 2ZW9A 1ZM4A 4YJGB 3ZH2A 3AVTA 3VGJA 5TPZA 2W2TA 2ATVA 4MRMA 4H0CA 1G2PA 1Q0WB 1ZM7A 2E1PA 1VYHA 4PZYA 1N7IA 2AG1A 3HKBA 4D98A 3AHEA 2AK2A 1DELA 3KKKA 4RJIA 2HSZA 4L5JA 2C92A 2QZZA 2RHCA 3GGDA 3SXUA 3VYTB 5HUHA 4PAQA 2VQDA 2PMWB 2LFIA 3T1QA 1XTTA 2V7GA 4N0DA 3FDFA 4GP7A 4KXYA 1JKXA 1BW9B 1PRYA 1A70A 3SE7A 1HZ6A 4QYIA 2NUTA 2TMGA 4FUTA 4RTRA 1LW6E 4RFSA 2X13A 1EJ2A 5IKPA 1L8OA 4LQ4A 4GOCA 1G7RA 1FDSA 2BVCA 3OIYA 4INJA 3QOFA 5A5EA 5CJ2A 1LJUA 4V0SA 2O2VA 3NM6B 5DHUA 1BFDA 4RORA 3ANYB 3FDZA 1Q1ZA 2FLVA 3QY0A 3V33A 3A33B 3BMOB 2E5WA 3MRSA 5JO0A 3SICE 1U6IA 3PO0A 1HORA 3KOUA 2H1HA 3D6MA 3LV8A 4KLCA 1C7JA 2R8EA 4KE9A 4MKRA 2XOKA 1SD1A 2ZUSA 3AE8B 1ZEMA 3ESHA 2QRUA 2O6VA 1EFUA 2C2MA 4MWOA 4TZBA 2QINA 1NX6A 1OEYJ 1T1JA 4U7HA 1CF2O 3MXTA 2W6JA 4D41A 3VYSB 3R8BA 2NYUA 3WG9A 3ZD8A 4X7BA 3TBFA 4PYLA 3BB4A 1CQIA 2B6HA 4E6PA 1OWPA 1A7AA 2F9LA 4NU0A 1QP7A 1Y82A 4ARAA 2VDVE 4CF7A 1L5HB 2BDEA 1SQGA 2JHFA 4YJGA 3O74A 3QUBA 1LD3A 3UJNA 2EGHA 2FNAA 4DUGA 1Y6FA 4MKIA 2NMVA 2PX3A 5ED4A 1QP4A 3MWGA 1DRUA 1LBEA 3FGZA 3GT0A 1C77A 4L8FA 1IHXA 1R74A 2DZJA 2JIPA 1NU8A 4PXYA 3DCNA 2QU8A 4E22A 4HDNA 3UN1A 2LHEA 5JAZA 2X2PA 5KJCA 3K53A 1BW9A 1JQDA 2O8FB 2C00A 3ZDFA 4QEZA 4NG4A 5HVNA 1V0JA 5AM4A 3RAGA 1W73A 3UG6A 2CV0A 3DBHI 2KT7A 2C96A 4HVBA 3FBWA 3H7SA 5LUAA 3Q2AC 5GJWC 3V4PB 2DM6A 1H66A 5I7UA 3P2BA 4IIJA 1C1DB 3GD5A 2PRYA 2GYYA 2HF9A 2O5RA 2IS6A 1NWHA 3RQSA 4TKNA 3BMOA 4BZWA 1QV9A 3EC7A 3TOXA 4KTTE 2HK6A 5BSWA 1O03A 4NDNE 1FXSA 3JTMA 1J90A 3NAMA 4BXOB 2CJOA 3QGMA 5C4GB 2EBUA 1W0KA 1R0YA 2KJRA 4BKRA 3NW9A 2D7DA 3KQQA 5SZJA 1FCJA 3TEJA 2IX9A 4EFDA 2QZSA 4PE5B 4AKTA 1KE2A 1X39A 3LDHA 4GR4A 4K6MA 3E5MA 2C5AA 3WGLA 2C2YA 2GLTA 3MPUA 4PYRA 2UKDA 1HK7A 2R85A 5JASA 3N3BC 1W4BA 4JQWC 3UK0A 2HFKA 3B6KA 3EGDB 4HWIB 4BNFA 3SZ3A 1AKVA 4Y1GA 4FHGA 5G1PA 1ZM9A 3SF8B 1I4LD 1W36C 1Z4OA 2R48A 2PD4A 3D5TA 4LYAA 1Q7BA 3QU7A 1QHFA 4GI5A 3V7WA 3RF7A 3CLSC 5BSUA 1RKQA 4ITVA 2BGIA 3JASB 4BQNA 2O57A 1RQLA 2UUBB 4EW2A 5GPBA 1IHYA 4BMYA 3G82C 1KGSA 3LT2A 5CXSA 1TZ1A 1RDFA 4IIBA 4KPYA 5GV7A 3OX4A 4J91A 2A1UB 3H19A 3T6KA 3GK3A 4MJ7A 4UA4A 3J81k 4ZO2A 4H7DA 1OR8A 1CIPA 4O4HB 2ZB8A 4ZHQB 2YNMA 4WN3A 3EZYA 2KDFB 5F1OA 4WBSA 4PX2A 3V2IA 1MJ5A 2GKLA 3RYCB 2WP0A 1BU5A 2ZBEA 2G9HD 1Q0UA 4MNTA 4OU4A 1NKVA 2ODPA 4TXLA 4OZCA 5LJLA 4K9PA 1BIFA 5LIPA 2RHMA 3WB1A 1GTJ1 3LSYA 4WA7A 5IF3A 3VXWA 2B35A 5I4CA 5B2EA 3NRZA 2Q4DA 1P3Y1 1MW9X 4W5QA 2WB4A 5FTNA 4EFZA 2VAWA 3STYA 4C5AA 5DLEA 5KOJA 1A04A 4DQVA 2BFFB 2WU0A 3RVNA 2Y0BA 1E8YA 5JD4A 3GT4A 2OA0A 1C9JA 2EXXA 3AKZA 1U2QA 4HNGA 2IIBA 3OOSA 3P26A 1PGJA 1IN5A 2B8NA 3G2NA 1WNFA 5ARBA 2F90A 4W9NC 2C99A 2G28A 4DCNA 2PQMA 2APJA 1KBQA 2Z9CA 4PC7A 1GGMA 4G0MA 3TLBA 1KS9A 3EGDA 4PO1A 3AONB 2ASQA 1TQ2A 1JLMA 2CHEA 4LNAA 3FWPA 3VZPA 3O8LA 3QF4B 1XTOA 2M5DA 4L8VA 2B78A 2H65A 2YIVX 4QTZA 3NHAA 5BRJA 3S40A 1N57A 3LZCA 3LUFA 1UQUA 5KMGB 3ENWA 3LUKA 2XWQA 4YDQA 2QQFA 3ZOKA 1D1QA 3ZY2A 1E3LA 3GJXC 4B9KA 2L32A 4MDFA 1M1YB 2ZZKA 1VR9A 5ALNA 3RV3A 3V7UA 3L46A 3SQDA 4GW3A 1SD2A 4RS3A 4EGCB 2ZRJA 4HI0E 5ETJA 2A1UA 1KP2A 1VJ5A 1GB1A 1YI8A 4EEKA 5EE3A 4GI1A 3VV3A 4L5AA 5ILGA 2IU0A 3DE1X 1U1GA 2BFWA 2H85A 2C4NA 1I7HA 3VPHA 3GPIA 5ICEA 4HQLA 3ESQA 1JG3A 1G8FA 5D7NA 1QIKA 1DTWA 2ZJ5A 1TY2A 4ZCQA 1BDMA 1KMIY 4PLTA 2VUUA 1ACMA 5D3IB 4YRIA 2AS0A 1ZJWA 4WL0A 1HX7A 1N2GA 2Z8YM 4I1OA 4OP2A 1UR5A 4RA9B 4Q7JB 1XB2A 1X80B 4YJHA 2BFFA 1FZQA 5I7RA 4L0CA 5JWRA 3B70A 3GLFA 2C58A 4WFQA 4RMNA 3RT7A 2QVYX 4TMAB 6LDHA 5A62A 1LEHA 2WIKA 1GTVA 5KSYA 2IYLD 2FPGB 3V3XA 1CQPA 1Q0TA 1YUBA 3TZKA 3VKHA 2GLSA 1V8BA 3EECA 2X0JA 3CO5A 1M3SA 1M1YE 2GFQA 1WS6A 3AU9A 1QKZA 1Z73A 1FSGA 3BS4A 2XCOA 2JI6A 1DBPA 5FPHA 3QYPA 4NAWB 1JDBB 3CJQA 5HRUA 4KFSA 1HOXA 2BYVE 2DERA 2O0MA 5DTJA 3QF4A 3OKFA 3VO8A 3AMZA 2R8RA 1PDWA 5IWAB 3X1YA 3C5VA 3T9DA 1SWVA 1D6JA 3DAPA 3WICA 3HCFA 2GXSA 4OXKA 1UJBA 4ZDKA 2NN3C 2G82A 2J41A 4F6HA 4O33A 3R66C 1N25A 3GIDA 2RHLA 4CMCA 4BUJA 1BHSA 4GE3A 3BEDA 1FFYA 5DBOA 3L54A 5IBPA 4JI8B 1L4NA 4Y18A 3S27A 4G4SO 3H17A 2QMTA 4RF4A 5DTEA 1ZUNB 2MCNB 3SI7A 5DI3B 1TS3A 3U7DA 3ZTWA 4NJMB 3I5UA 2NO5A 2VSXA 1M6NA 3TR5A 4AUNA 2X2EA 1MC4A 3FJYA 2OCAA 3O5AA 2IJGX 5H5JA 1IHPA 5E7JA 1V7ZA 2WICA 2O05A 3HLYA 4YP5A 3PFKA 1D8AA 1L4GA 5TJHA 4F1SA 3PGEA 3I32A 3U3JA 3LBHA 1ZOPA 2NBUA 1Y8CA 2ECOA 4IQ4A 5JJCA 5TXGA 2DPHA 1Z17A 4ANWA 1QH5A 1GFIA 1JR6A 1PR4A 5K2MA 1QGOA 3I62A 1UMCB 5CYPA 2ECPA 4DV5B 1GTG1 1SCNE 4JA2A 2C2WA 3EGEA 3OJLA 1I7SB 1EUQA 2P2CA 2P11A 3O3OB 5D2CA 1XDSA 2P9ZA 5LB2A 3KM0A 3COSA 3TP9A 4HCNB 3FSGD 1WX9A 4ILKA 1GITA 2WIJA 1HG1A 1F9AA 3D43A 3LZ6A 3IUQA 2KD0A 2VRRB 1N63A 3A7EA 3RF6A 1Z3IX 1ZWLA 2I76A 1LC0A 5B12A 2QR5A 4J1TC 1TIFA 2BFBB 5FWAA 4CE6A 3IRUA 3VVCA 1K68A 4X71A 3A3OA 4DQKA 3ZBTA 2PZEA 4UEQA 1W5BA 2HRQA 1Q91A 4J07A 3ZWWA 3SKYA 5H9VA 2FMKA 1P39A 2FSUA 3CC8A 3D4BA 1KAMA 2JCSA 5JHHB 2YJ3A 3QF7A 1R0WA 4OK5A 3P0JA 4JLJA 4BCCA 4K3BA 1E3IA 1C8LA 5I9MA 3EXG1 3N2GA 3AR8A 3R41A 3JQEA 2DLDA 3KJHA 3FOFC 3VKVA 2ZJFA 4DCVA 1RKBA 4FYPA 2M19A 3ZH9B 2NZVG 1OKKA 3EGRA 2Y2VA 5LZ7A 1NV8A 4R0VA 1N5RA 2VW8A 5EIOA 4LXUA 1K9VF 4PCUA 2VJMB 4QYTA 3W3AD 2QV0A 4CGZA 3GPCA 3CZ4A 2QUAA 3AZPA 1XXHA 4HKZE 4CO7A 5I01A 4BS9A 1ND5A 1PDOA 4B4VA 4P8RA 1XLTA 4YR7A 4P4NA 4JODA 3SFTA 1U0GA 2XLBA 2V4IB 2G45B 4AZTA 4LZWA 4D56A 3EDOA 2WG2A 2J3DA 5IF9A 4JEMA 1MORA 1OVGA 4LCJA 5ENDA 4YAKA 2YMLA 4C1EA 2NVBA 4BLWA 3DTVD 2XNJA 4DCUA 3QKSA 1V37A 3CS3A 3EMDA 2B4AA 2CZGA 1CR1A 2Q5IA 2KFJA 5DRTA 4QG3A 4X65B 4BMDA 3N7UA 4XOIA 1QH1B 1OH5A 2I7DA 4V2IA 5JCOA 5A7HA 5FQBA 4QPPA 4YC7A 3UQBA 3RBAA 2WF9A 1ISPA 1WW8A 2ZT5A 1WUIS 3DHGC 4BO8A 1MX5A 3BD7A 1FU4A 4PAOA 5TQ2B 5TQ0A 1RJWA 2O3UA 3HUTA 4DPKA 3P7MA 1VE5A 2PX2A 4HZGA 5EV8A 2WKWA 4LVOA 5FBQB 4NV1A 1YA6A 3G6WA 2MJLA 5IAAC 3HJBA 2ZCJA 1GRCA 4GDMA 3KUZA 3QU4A 5JXHA 1ZGUB 1ZKPA 1A2KC 2H18A 1XI2A 2ZZNA 2OHGA 4ZKDA 1WULS 3HYNA 3WLLA 2X42A 2Z2XA 5AXAA 2AI1A 4KMOA 4H1HA 3L6EA 4Q3KA 2P27A 2RIPA 2JJYA 1WCV1 2MT9A 1CMXB 3WWZA 4Q1VA 2FHPA 4OPMA 2KLCA 2ENUA 4LMPA 4FYYA 2VF8A 4YAUA 1ZK2A 2VJMA 5JS8A 2LIPA 1G2QA 3TXYA 4B84A 1Q17A 1DOXA 4NOKA 1ZQ1A 3HKCB 4UM8B 5L83A 5CIWA 3EXAA 3LHDA 4WOPA 4YYZA 2Q41A 1ECCA 4E03A 3HIZA 1Q7GA 5KKCA 3GGOA 1E9MA 1LCIA 3GDOA 1WGYA 1VB5A 1F2TB 2E4XA 3P2MA 4N5LA 3EFOB 1P17A 4UWRB 3F96A 2AG6A 2QD4A 4C0BA 1UOPA 2M4NA 1K92A 5B64A 2GSDA 4EUSA 5BP7A 2CMKA 5K8JB 1TTQB 2NR2A 1C7QA 2OEPA 5TNXA 5I3CA 2QXTA 2NZXA 4YUVA 5JXWA 1KP9A 1U7HA 3MHZA 4ZRMA 3E8SA 2GA8A 3QUSA 4H0DA 1BKSB 4JXZA 5CM9C 3LXMA 1Z15A 2XBLA 3C4QA 4N54A 1FTNA 3OF2A 5TQ2A 4K2HA 2Y5PA 5ALGA 3LGSA 1NUTA 4E7OA 2WMYA 2PUFA 4PU0A 4DJJA 2CVZA 3K4HA 1EEXB 5LWHA 2G8LA 4YIKA 1T2DA 1IBKB 4HJXA 4JE3B 1YRQA 4A2QA 3I1FA 5CM2Z 1RRVA 1R00A 2WS3B 2WQ7A 1UBOS 3TB4A 3V4FA 1U3VA 2C84A 4RTNA 2NAFA 3U31A 2YKGA 3H5OA 3X1WA 5AVXA 1BRTA 1Z2DA 3ABSB 5EXPA 3L8CA 4YJ2F 4W5NA 5LM6A 1F2RI 2MHJA 4YRPA 3EGIA 1TJYA 5TR5A 3DBRI 2MWSB 3COYA 4YSBA 3U0BA 2DQKA 2YJ5A 3HKCA 4MWBA 1E1QD 1R0RE 4OBBA 2FPRA 3QM1A 4LNHA 1SHTX 1K6XA 3MGGA 4WEQA 3QJZA 3WJ7A 5FR1A 3EA4A 2Z8LA 3MJDA 1W75A 4MPRA 5HJ7A 2LNDA 4C4ZA 4X45A 5K4AA 2XEXA 5EEGA 3N53A 4D4HA 1W1WA 4LYJA 5JXJA 1BXTA 4H6PA 1GGFA 5DCYA 3KEQA 5K8TA 3ICPA 4MYTA 3K9NA 4JXXA 4BNWA 5GZ1A 1RC1A 1Z22A 3ZW8A 4ES6A 5HCIA 3TF5A 3IRVA 1H1LA 3PYMA 1XPUA 1QRAA 1VJ0A 3NC4A 4ZAZA 2B1GA 4OB7A 1OB2A 5AM2A 4RF3A 1YOVA 4IDHA 1DBVO 1MDBA 1I7QB 2F64A 2J7KA 1N1DA 4DBGA 1QDUA 4MDHA 3PV1A 5D7GA 2VEDA 3GGSA 3OT1B 4D9HA 2VK2A 4YJ3B 3W6OA 3TE6A 5ALZA 4XOUA 1LVGA 1K9SA 1RRMA 2IZ0A 1ULZA 2MJ3A 1E6LA 5C1DA 4J76A 1XKQA 3J9CA 3ZWBA 5AK6A 4AYWA 1Y5MA 4ZPXA 1R8YA 1W4CA 3O8RA 5A5ZA 1X7YB 5KTRA 3ZR9A 2D13A 3LT1A 1QQAA 1AG9A 1IY9A 5AVYA 2GZRA 4ZJUA 2BMJA 4N9F4 5CNIA 4TVSA 1RZ3A 2WIGA 4IY1A 4ZARA 2P62A 2VTVA 4JLBA 4QOJA 5IN5A 3BL6A 1DJLA 1E60A 3R7WB 5MFZA 2FU7A 1TD1A 4LJKA 1K98A 4OQEA 3KJIA 2IYXA 3NHWA 5D1HA 3ZVNA 1SOVA 1L4EA 1F2VA 1HOTA 1NR1A 3DKPA 1E92A 4HDCA 4XVCA 4OJNA 4BKMA 5IUKC 5IP5A 4MH8A 3CRZA 2CDRA 1BN7A 1U0SY 4HDSB 4XQGA 2HY7A 5K51A 3VH3B 4ANVA 2FF5A 2O4UX 1H4RA 3PJGA 3DPDA 3FF4A 3O1IC 1KEEB 4MICA 2NUBA 5B1SA 3UUWA 5HKBA 3C6YA 2FUHB 2A78A 2H1SA 4S24A 1B1CA 3EVZA 3K0EA 1G9TA 3WQHA 2ZYUX 3EC8A 5L4NA 4IDOA 4FIDA 3DHEA 2FPOA 1OE0A 4TQAA 1FJXA 4BZPA 1L7BA 2QDKA 4N0PA 3K0KA 3ONDA 2GB1A 3G23A 5FI5A 3OAWA 3NH9A 3R5JA 3OQHA 4DHZB 5TGTA 5KQMA 4W1PA