The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
162
|
sequence length |
553
|
structure length |
553
|
Chain Sequence |
SQGGPQDHVEIIPLGGMGEIGKNITVFRFRDEIFVLDGGLAFPEEGMPGVDLLIPRVDYLIEHRHKIKAWVLTHGAEDHIGGLPFLLPMIFGKESPVPIYGARLTLGLLRGKLEEFGLRPGAFNLKEISPDDRIQVGRYFTLDLFRMTHSIPDNSGVVIRTPIGTIVHTGDFKLDPTPIDGKVSHLAKVAQAGAEGVLLLIADATNAERPGYTPSEMEIAKELDRVIGRAPGRVFVTTFASHIHRIQSVIWAAEKYGRKVAMEGRSMLKFSRIALELGYLKVKDRLYTLEEVKDLPDHQVLILATGSQGQPMSVLHRLAFEGHAKMAIKPGDTVILSSSPIPGNEEAVNRVINRLYALGAYVLYPPTYKVHASGHASQEELKLILNLTTPRFFLPWHGEVRHQMNFKWLAESMSRPPEKTLIGENGAVYRLTRETFEKVGEVPHGVLYVDGLGVGDITEEILADRRHMAEEGLVVITALAGEDPVVEVVSRGFVKAGERLLGEVRRMALEALKNGVREKKPLERIRDDIYYPVKKFLKKATGRDPMILPVVIE
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule keywords |
Metal dependent hydrolase
|
publication title |
Molecular Basis for the Recognition and Cleavage of RNA by the Bifunctional 5'-3' Exo/Endoribonuclease RNase J.
pubmed doi rcsb |
source organism |
Thermus thermophilus hb27
|
molecule tags |
Hydrolase/rna
|
total genus |
162
|
structure length |
553
|
sequence length |
553
|
ec nomenclature |
ec
3.-.-.-: |
pdb deposition date | 2011-07-25 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF07521 | RMMBL | Zn-dependent metallo-hydrolase RNA specificity domain |
A | PF12706 | Lactamase_B_2 | Beta-lactamase superfamily domain |
A | PF17770 | RNase_J_C | Ribonuclease J C-terminal domain |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | Roll | Ubiquitin-like (UB roll) | Ubiquitin-like (UB roll) | ||
Alpha Beta | 3-Layer(aba) Sandwich | Rossmann fold | Metallo-hydrolase/oxidoreductase | ||
Alpha Beta | 4-Layer Sandwich | Metallo-beta-lactamase; Chain A | Ribonuclease Z/Hydroxyacylglutathione hydrolase-like |