3T3OA

Molecular basis for the recognition and cleavage of rna (cugg) by the bifunctional 5'-3' exo/endoribonuclease rnase j
Total Genus 162
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
162
sequence length
553
structure length
553
Chain Sequence
SQGGPQDHVEIIPLGGMGEIGKNITVFRFRDEIFVLDGGLAFPEEGMPGVDLLIPRVDYLIEHRHKIKAWVLTHGAEDHIGGLPFLLPMIFGKESPVPIYGARLTLGLLRGKLEEFGLRPGAFNLKEISPDDRIQVGRYFTLDLFRMTHSIPDNSGVVIRTPIGTIVHTGDFKLDPTPIDGKVSHLAKVAQAGAEGVLLLIADATNAERPGYTPSEMEIAKELDRVIGRAPGRVFVTTFASHIHRIQSVIWAAEKYGRKVAMEGRSMLKFSRIALELGYLKVKDRLYTLEEVKDLPDHQVLILATGSQGQPMSVLHRLAFEGHAKMAIKPGDTVILSSSPIPGNEEAVNRVINRLYALGAYVLYPPTYKVHASGHASQEELKLILNLTTPRFFLPWHGEVRHQMNFKWLAESMSRPPEKTLIGENGAVYRLTRETFEKVGEVPHGVLYVDGLGVGDITEEILADRRHMAEEGLVVITALAGEDPVVEVVSRGFVKAGERLLGEVRRMALEALKNGVREKKPLERIRDDIYYPVKKFLKKATGRDPMILPVVIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular Basis for the Recognition and Cleavage of RNA by the Bifunctional 5'-3' Exo/Endoribonuclease RNase J.
pubmed doi rcsb
source organism Thermus thermophilus hb27
molecule tags Hydrolase/rna
molecule keywords Metal dependent hydrolase
total genus 162
structure length 553
sequence length 553
ec nomenclature ec 3.-.-.-:
pdb deposition date 2011-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07521 RMMBL Zn-dependent metallo-hydrolase RNA specificity domain
A PF12706 Lactamase_B_2 Beta-lactamase superfamily domain
A PF17770 RNase_J_C Ribonuclease J C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.580 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3t3oA03
3.40.50.10710 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Metallo-hydrolase/oxidoreductase 3t3oA02
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 3t3oA01
1MQOA 3T3NA 2CBNA 4CHLA 4Z5YA 3IE1A 4EFZA 3PY5A 2YNVB 5A87A 4C1DA 1P9EA 4DILA 4PVOA 2GKLA 2FK6A 5IQKA 4F6ZA 1K07A 1QH5A 5K0WA 2OHIA 4DIKA 3IEMA 2Q42A 3T9MA 2BFKA 2GMNA 4KEQA 5B15A 3H3EA 3X30A 2I7VA 2BG7A 5AXRA 5HIOA 1JJEA 2QDTA 4TZEA 4UWOB 3VQZA 3L6NA 2WHGA 2Y8BA 2FHXB 5LSCA 4C1EA 5HH6A 1M2XA 2WRSA 2DKFA 4NQ2A 4WD6A 2WYMC 3IOFA 4D1TA 5ACVA 3PY6A 1BVTA 4EXYA 3MD7A 1YCGA 3IE2A 2P1EA 4GCWA 5FQAA 3LVZA 5AYAA 2YZ3A 5AEBA 1WW1A 2ZNBA 2YCBA 2M5CA 2YNTA 4V0HA 2GFJA 1YCHA 1YCFA 2WYLA 4YSKA 2FU7A 3BV6A 3Q6VA 4TZFA 1QH3A 1ZTCA 4RAWA 3X2YA 4D1WA 5B3RA 5A0VA 3AF5A 4FR7A 4C1HA 1XM8A 2H6AA 3IEKA 4JO0A 3I0VA 2BFZB 2QDSA 4EYFA 4KEPA 4AWZA 2Y8AA 5EW0A 3RPCA 3KNSA 4RAMA 2FM6A 4J5HA 2BG6A 2HB9A 3ZQ4A 4Z67A 2FU9A 4BP0A 3F9OA 1E5DA 2QINA 1X8GA 5ACQA 4GYUA 4Z60A 1KR3A 2AZ4A 3X2ZA 2Q9UA 4HL2A 1JT1A 3A4YA 5ACUA 3IDZA 5K4KA 3DHCA 5AHRA 5ACSA 1X8HA 4FEKA 1BC2A 5B1UA 1DD6A 1X8IA 2FU6A 2DOOA 2BIBA 3JXPA 4UBQA 5KIKA 2GCUA 4UWPB 4LE6A 4RL2A 4UAMA 2QEDA 4F6HA 3I15A 2NZFA 1A8TA 3KL7A 1DXKA 2BFLA 1SMLA 4P62A 3PG4A 1VGNA 2BG2A 4Z5ZA 2P4ZA 4D02A 2BC2A 4NQ6A 2BTNA 2BG8B 2OHJA 5LE1A 3WXCA 5HH5A 2BMIA 2BFZA 1WUPA 3SW3A 5A5ZA 1WUOA 2WYMA 3ADRA 3AJ3A 4FSBA 3R2UA 2NXAA 4NQ5A 3G1PA 5K4MA 2P18A 4AX1B 5LCAA 1ZNBA 3BC2A 4UWRB 2Q0JA 3X2XA 2YNVA 5EV8A 3FCZA 2NYPA 2Y87A 5ACXA 4AWYB 2ZZIA 3IELA 4ZEJA 5LS3A 4RBSA 4GYQA 2YNUA 5A0TA 4Z7RA 5ACWA 5EVKA 1JJTA 4Z6XA 3BK2A 3FAIA 3DH8A 2M5DA 4U4LA 4AD9A 1L9YA 3ZR9A 2R2DA 3P2UA 3QH8A 2Q0IA 1KO3A 2FHXA 4TZ9A 2QJSA 3ZWFA 4AX0B 3RKKA 1VMEA 4ZNBA 2XF4A 4ZO3A 4EYBA 2YNWA 4RM5A 4PVTA 3IE0A 3SD9A 5ACTA 4H0DA 2XR1A 5DPXA 5FQCA 1DDKA 3SFPA 4BZ3A 1Y44A 3BK1A 4XUKA 4ZO2A 3ZNBA 4B87A 2ZO4A 4HL1A 4YSBA 5LLDA 2BG8A 5ACRA 2AIOA 3I13A 2A7MA 1HLKA 4J5FA 2GFKA 5HISA 5EWAA 3TP9A 1A7TA 2ZWRA 3VPEA 5ACPA 4XWTA 1WRAA 4EXSA 3SPUA 2BGAA 4EY2A 3DHBA 4RL0A 3SRXA 3RKJA 3ESHA 5HH4A 5LCHA 5LM6A 4YSLA 5EHTA 4C1GA 3IOGA 2FU8A 5LMCA 4HKYA 2YNTB 5EVBA 4D1VA 5LCFA 2BR6A 5EH9A 2I7TA 1XTOA 5FQBA 2P97A 4TYFA 4C1CA 1KO2A 4O98A 4TZBA 5HIQA 3S0ZA 1VJNA 5EVDA 3I11A 4TYTA 2VW8A 5EV6A 4UA4A 2NZEA 4D1UA 4EYLA 5K4NA 3DHAA 5AXOA 3SBLA 4NQ4A 3T3OA 2UYXA 3AF6A 4XWWA 4UWSB 3KNRA 5KILA 1BMCA 2I7XA 2OHHA 4C09A 5HIPA 2E7YA 1ZKPA 4C1FA 3I14A 5AHOA
chains in the Genus database with same CATH superfamily
1OXBB 3VAWA 1H5UA 1MEOA 1OLOA 3MWLA 4URWR 4JI1B 5BUZA 1IJEA 1PEDA 3W4IA 1M5UA 4DSAA 5K2MA 2J4DA 5J2TF 1GPKA 2O1XA 1U2EA 5E9AA 1FFGA 3AIKA 1J7KA 4NP6A 5DLQC 5DJ5A 5AZGA 3X1KA 1HV8A 1UBCA 2XZDA 2SKDA 3TFOA 3JQ8A 4YV2A 3HXQA 3PY5A 1BW9A 3WIEA 4OI1A 5DGXA 1V3TA 1I24A 4H4EA 1Q19A 3ZXYA 2H1FA 4AKSA 5CDGA 2V3CC 1KKMA 3GE8C 4Z4FA 2UUOA 3LUHA 4TTIA 3ZQUA 1TZ1A 2KFKB 2WXIA 2ODEA 5I6DA 4CL8A 1M1YE 1AURA 3HRHA 1XLTA 5ITVA 2OHIA 3I4LA 3D4PA 3QUTA 1QR2A 3B1ZA 3LT1A 3S4YA 3CPEA 1V97A 1GU1A 1QQTA 2WVHA 3DKKA 1WH3A 3KTAA 4M86A 4OYYA 5JO9A 1TS2A 3AE5B 2AV6A 4L6CA 4W99A 4WXMA 2FZ5A 3M4NA 2BFKA 1NYTA 3B3FA 3FCYA 3D2BA 4X71A 4OZAA 4JLSA 5B15A 1QH8B 1QK3A 4HPJB 2NO5A 1W5FA 1W5EA 2RHLA 3ECSA 3MD9A 4DLSA 2I7VA 1SN7A 1E4EA 4IZ6A 5BSFA 1GPWB 2JVKA 5AXRA 3BT7A 3LL4A 2K8BA 1G4HA 1RVV1 4Q34A 4WN9B 1WX7A 1FX0B 2VT2A 2R68A 4O2AA 3ESYA 1SC3A 5EL0A 2JFBA 2ZRLA 3FAIA 2Z9CA 4GSWA 1TK3A 5BO4B 1RKXA 3GN2A 4H4CA 4L9SA 2JJ1D 3EBLA 4OB6A 4A2QA 3DFUA 1PJCA 5DTQA 1PNOA 3GRZA 1X7WA 2I34A 2FHXB 2VP3A 2NTVA 2DH6A 2W2NA 2J6IA 2QYTA 1WZUA 4LXXA 5EHNA 1KDPA 2X5KO 3OCXA 1QCDA 3L8YA 1TQ8A 4TTPA 2O2YA 2WQYB 1I4WA 1V2GA 2GBCA 2VHWA 1SG0A 4GL4A 1GFWA 4NICA 4RD4A 5C51B 2EHJA 3V4LA 3WKCA 1A82A 2MSEB 4WLVA 2X19A 4BAXA 3FOFC 1JQ3A 3E1SA 2IGBA 1IVYA 2IXGA 3QC8B 2H1IA 1WXSA 3MOGA 5EIFA 3EEQA 3GFSA 2LMCA 1EGHA 4DXFA 1ZZGA 3U7GA 2OILA 1R74A 1SCKA 4EKUA 2HLPA 4FXOA 4J0GA 3TSCA 3EZFA 4NJMA 4H7HA 3E2MA 3W5VB 2H2DA 5HHTA 3GFVA 3IT3A 2FQYA 1YKGA 1OFFA 2ETXA 3LX5A 4X3PA 5FKJA 3T34A 1PD0A 1VL6A 4EGQA 1JH9A 1SUEA 4MW9A 1KO8A 3TSYA 4RTQA 4HDRA 1FA9A 4HYEA 5DLDA 4UCQA 4UMFA 4YQEA 4BE9A 4C4PA 1XYVA 2O7NA 3GIWA 1VSQA 3VFKA 4RKWA 4F5DA 1C0PA 1PX0A 1YZGA 2VUUA 4TTQA 4R0MA 3T1HB 2FWNA 4D4KA 2OGSA 3D6AA 1ZW1A 1HE8B 3KT3A 3L1HA 1YZFA 2LVBA 4LC0A 4N0QA 2H31A 4HDAA 2X3YA 1IIBA 4AMYA 2GFJA 4C0SA 2BEUA 2V7BA 4YJDA 1H85A 1T29A 3HO6A 1YN4A 2I5PO 1BT0A 1ZHOA 3A6ZA 5CHWA 1KU6A 2JSVX 2AMFA 1W5BA 3OSZA 4EHJA 4TUYA 4DREA 1MQSA 1MGPA 2WIDA 1B7GO 1R4NB 4MR7B 1XTKA 1UZNA 4ARAA 3A4LA 4L6AA 2X1VA 2IP1A 3LUGA 3A9RA 3DQVA 1R3UA 3QITA 3DBIA 4HLEA 4TS9A 2NTJA 2BFZB 3JARB 3QFTA 3AQIA 4TMYA 2XNCA 2FEKA 5DPSA 4R2LA 1G8JA 4G50A 2INNE 2HOQA 3I52A 4DVJA 4IAOA 1AN9A 1UXHA 2Y4OA 3NEPX 3GJXC 3F98A 1ISHA 3LUBA 4XOUA 3N2NA 1V8PA 3MT8A 4LYDA 3WBJA 4B43A 5EW0A 3C6KA 2ID9A 2JFHA 1OGWA 2IHTA 3H9BA 4U2EA 5E8JA 2CCKA 2G63A 3VH2A 2QENA 4JBXA 1OSNA 1R4NA 4MRVA 3B2FA 3KYDA 3O38A 1B0AA 3KVRA 1KJWA 1I01A 1NVDA 3V2GA 2XMZA 1UL1X 1MIHA 1XEWY 4BP0A 4DYDA 2KDIA 1G8YA 4JBGA 1O3YA 2AIRA 2F67A 1YCDA 2O2XA 1WBJB 1BE8A 1E5DA 1D3ZA 3KM0A 3LE8A 3DOEA 3ESCA 1CJKC 2Q6TA 4YPFA 1FTYA 2JKZA 4KZPA 4QOIA 1HDXA 3EZXA 3H0KA 4FGZA 4JA2A 3FETA 4R2JA 2K1FA 1LF5A 1IGDA 3P4SB 2INPE 2F1HA 2TMGA 2B3DA 4JBIA 4EY3A 1E63A 4GL2A 2GOYA 2AN5A 2XYVA 1WZ0A 3EXG1 3ZE6A 4AO8A 2QZSA 1TFRA 4R7GA 3SC2B 4Y9RA 3N74A 4YCLA 5IT9A 5I9TA 3FKJA 3LL7A 1EDDA 1YSCA 2Q9UA 2H5JA 4N9WA 2ZYUX 4ZU3A 1L4KA 1E77A 4K81B 3KLOA 4FZ3A 3PPAA 4P7JA 4KWCA 5I7SA 1M1YB 4YV0A 3QE0A 4I4TA 2YDYA 1P4SA 4B85A 5HQTA 1QANA 3RVBA 3TZEA 1N6HA 2C2WA 3L9XA 4F4CA 3F90A 3OA2A 1AIPA 3L7YA 1LKZA 4LX0A 5CVVA 4ZO6A 2Q5FA 5FD8A 4UDNA 2N1MA 3ADCA 4ZHPA 2ZJDA 3MJ4A 3AT1A 3B7PA 3MRXA 2JJ2A 2VJMA 4UZSA 3TLJA 4GZ3A 2WDVB 2OV2A 2ES4A 4TL9A 2I6GA 1ECJA 4KC0A 4B3MB 1DJQA 4E12A 3E1GA 3GQBB 3UW3A 4EY8A 4K81A 1MAAA 2M2IA 1JH8A 4CQMA 5M5BA 3GJRA 3GLQA 1K2VN 2KKCA 1NHWA 1NBOA 2A5JA 2VPPA 3DOIA 1IQUA 3AU8A 3DOJA 3R0VA 4I55F 4OHCA 5AJTA 5ALIA 5KBYA 4RGMA 1FNNA 4RVSA 5CDHA 1R00A 4HRSA 4UUOA 4W5NA 1THTA 4IVNA 1ISJA 4P32A 4A8PA 3ZHTA 3MGKA 4BC0A 3ECIA 4G5XA 1YACA 1YRLA 3DXFA 3A1TA 2BCEA 5D6JB 2UAGA 1GFIA 3OG5A 1XEXA 2E18A 3BFVA 1E5QA 4QBGB 5FP0A 3VR5A 3M82A 1OAKA 3G0DA 1DCMA 1L7XA 2C1XA 1RRBA 2M6KA 3ECCA 4CM9D 1W48A 5BMIA 2B7LA 1L2NA 2FSHA 2SBTA 3HWRA 1PQYA 1E3WA 4MITA 3DWGC 4P1ZA 2HJ1A 5AICA 1VGVA 1XJQA 4HAZA 4CM9A 3SIRA 3VNQA 3WL8A 4DRZA 5JEDA 4R83A 4MJSB 2B6HA 5LQMA 3EUB2 4M8MA 1FU8A 2H48A 4IIJA 3RS2A 3FOZA 4D79A 4WXPA 4QYWA 2BVCA 1E6LA 3B1XA 4HLCA 5H83A 3U62A 5AW1A 4KQJA 4Q1DA 1BRMA 2BKLA 3P94A 3GLGA 2H06A 3H11B 2JFGA 5F2EA 1ZVQA 4AFNA 4W5WA 3WDMA 2JYTA 2FZ4A 4HDQA 4EA7A 2Q9BA 1GLVA 2CVZA 2CS4A 5EP3A 3RSOA 3FUVA 1G8MA 2XIQA 2FVXA 2Z2IA 1V11A 4Y2JA 5CHYA 1OHHD 2AR9A 2GKGA 3HABA 4K0RA 4WBXC 1NVTA 5HZKA 3PI6A 3QYAA 5B12A 3OJ0A 3OE5A 3MELA 2WSYB 4LSGA 4MPRA 4MXDA 1AB5A 2PTLA 1BQ3A 1R0ZA 1H2ZA 1T1JA 3F4BA 3C19A 2V3WA 3K2QA 3LV8A 3QY0A 3Q9SA 4BMZA 1PWEA 1XJWA 1T2CA 4A2WA 3EDQA 4IIYA 1C5KA 4BDTA 1FYFA 4DIOA 3CH7A 3I4FA 3KYDB 4Q24A 3HP7A 1Y6JA 4JCOA 2QD3A 3T9LA 1ML3A 1I4OA 2PZJA 2GJAA 2JEYA 3DBOB 5AQ1A 2ZB4A 4P3YA 3BFKA 1V6EA 4TMZA 1C9EA 2BM1A 3IAM6 1B23P 1CUXA 2B1IA 3K5IA 3PQ7A 5EVCA 5CLQA 1ZH6A 1Z2OX 5A4IS 2FCNA 3L17A 3X0WA 1DG9A 1M72A 1SCJA 2I4RA 2P5SA 2P9FA 2Z83A 3F2VA 4MS3B 4RIEA 3AH7A 2P9YA 1YHYA 2J0UA 3HM6X 2QTCA 3C8UA 4BO8A 5BR1A 1IBXA 4O3FA 2WABA 3TKLA 2CFUA 3KWVA 3PT5A 1T13A 1XLUA 2CZCA 2I2WA 3P0FA 1DLJA 1PX2A 1Z26A 2GVZC 2I4OA 4DWVA 2QN7A 4L8LA 5F51A 3L40A 4DR2B 3FGPA 2X7JA 3A32A 3CR3C 3UJPA 2C3OA 5EA2A 2AR0A 3DWIA 4B73A 3BY4B 4CHGA 5HSGA 2Q3DA 1GNQA 2V4LA 2O7VA 3K96A 3LH5A 1XLTC 3K2IA 3R0XA 5KCZA 2YHSA 3LOUA 2OWEA 3T7KA 2JLAA 3ILSA 1I9CA 3NM5A 3JWEA 4NJEA 4GDKA 4P35A 1UBHS 4WZBA 4CV2A 3UIPB 1NXXA 3EW7A 5LMUB 2FMTA 2MH7A 2F8SA 1RHRA 1PP4A 3E8MA 4D9IA 1DAIA 1J7BA 1P3JA 3BJIC 3FVWA 5AJUA 4LJ6A 1L9XA 1M2VA 4TVBA 4DHEA 3AM9A 2EZTA 3Q6MA 5G3ZA 3C3PA 4F7DA 3QH8A 1E8DA 4UVDA 2GM4A 3I2KA 1KY5A 4HBZA 2C95A 2WYUA 4CQMB 3SN6A 3Q4GA 2PPVA 3VVWB 3OKCA 4J0CA 5K6AC 4G0NA 3IIJA 4GOCA 3WK4A 3VZPA 1JIQA 1VMEA 2P5UA 3DT9A 3H2ZA 1V8ZA 4PQGA 3Q3IA 4UBIA 3VH4A 2BRUC 1YL6A 1TGVA 2UZ3A 3E3OA 1BWSA 4MUBA 4PY2A 3OBBA 4I4NA 2XQKA 4AMBA 3IE0A 4PVTA 3M63B 3UMVA 1N2ZA 2YFQA 3NLLA 2P9QA 3TCXB 1TM2A 2FPSA 2O1EA 4RFSB 4XGIA 4YREA 4B2IA 4ZWNA 4DUPA 2NUTA 4F5YA 5JBNA 3VC7A 5IP4D 2QA5A 2QMYA 1B8PA 2XI4A 1EU3A 2ZITA 3ROMA 4AN4A 5CAEA 3SFPA 1Y44A 2LXCA 4LX8A 5K8VA 2N46A 1G291 2WJYA 3BK1A 3HH8A 4X65B 1PGNA 1ZDVA 1O9BA 2AKAB 1X92A 3F4KA 1PNRA 3ENVA 4KMMA 3HBLA 5FK9C 3ZNBA 4PYKA 3H4IA 3E5MA 1CF2O 2Q1YA 3CF0A 1F3OA 4IHJA 3VPFA 1VDMA 1JI0A 1U9IA 3F71A 4GOXA 3E05A 1SHUX 4GI2A 4NOKA 3ZQJA 2D6FA 4NNJA 1TF7A 1DG3A 2IHZA 2Q2QA 2P6NA 4HDMB 1H94A 5LWQA 1AUOA 1DCFA 3HDJA 1XU4A 4OLFA 2E48A 3TAXA 3TCAA 2WTNA 3BMXA 4RA9A 1YQQA 3KR0A 1DWUA 2Y92A 1HG1A 2Q8QA 3OLZA 5IA7A 1LZKA 2ZJ5A 2J3EA 4KXFB 3WQSB 5JNWA 3TR0A 3VJKA 1IOZA 5DLYA 3K9CA 2R1VB 2UYCA 2FUCA 2CNDA 4MMXB 3NY5A 2G9HD 1K7SN 3NBUA 4RMNA 2R6R1 2UKDA 1E0DA 2R97A 2E87A 4KP7A 3HA3A 1U4AA 3VUXA 4RIHA 3RRNA 1MCZA 3PTLA 1YZHA 2NZ8A 3AVOA 3LBAA 4B6GA 1Z4KA 3TEWA 1NBHA 2IHYA 2X4DA 4DHZE 3FWHA 4N59A 4PSVA 2WXPA 5C8YB 4UNPA 1B14A 1ZRSA 3FPEA 4BCBA 1G8FA 5DBEX 5AUPB 4C2TA 3RIYA 5JAMA 1LPSA 1WABA 4OH1A 4V3BA 2Q5OA 2A5DA 4O2BB 5J4KA 4MV5A 1PJSA 2CYCA 1K52A 3KEGA 2Y1WA 4PLYA 4ZZ0A 2BR4A 2XITA 3EGXB 1DI0A 2I55A 3QQPA 4IF6A 1Q7RA 1IBCA 3E9SA 3H9DA 1JQ5A 2D2XA 2WFZA 2Y2UA 2ZTVA 4JX9A 3VR6A 4HVCA 2AZTA 1JWLA 3RKJA 4GYJA 1QK4A 1XRMA 4Q1BA 4MUXA 3WGNA 3BVZA 1II9A 1LTQA 2VPTA 3GGOA 2BFWA 3PFHA 3GVHA 1V8FA 1YI8A 2X14A 2W2PA 3CE9A 3H13A 1DRUA 1XQ6A 3MJHA 4N0DA 9LDBA 1SR8A 2KN4A 2HSGA 3OJCA 3KT0A 1QCZA 4BLPA 4IZHA 3HN2A 4FFNA 1IN7A 1NQXA 4Y18A 3GT0A 4OYHA 3WDSA 4RFBA 1J5EB 3PEYA 1YBAA 3A05A 4ZRJA 1E8NA 1NW3A 4JLPA 3UVEA 5IWCA 4CV1A 4RSRA 2QU8A 1UXOA 3Q2IA 3OH8A 1EFVB 2C92A 1B43A 2B82A 3DGEC 1COZA 4RD3A 4D1VA 3E8XA 3VDQA 1XWIA 3A26A 3LG2A 4KIUA 1XTZA 2EOAA 1I2AA 3P9QA 3SM9A 3RFZB 3WV4A 4ZYTA 4TZKA 3PXXA 1KP3A 1T1GA 1E0AA 1KMMA 1U2DA 3DT6A 3QG1A 3TOCA 5L6LB 3FFTA 1RQXA 2EYUA 4I1SA 3FW1A 3T9BA 1KYZA 2HWYA 4W6QA 3J81k 3CVUA 2X3FA 4WSOA 3PC4A 1I5OA 3WWEA 3ABVB 2ZUSA 5EVDA 4UNQA 5E7JA 4BNKA 3H9QA 1BQEA 1K5DA 5KNDA 1T36A 3LAWA 3STVA 4UA4A 4X0EA 2O4CA 2AYYA 1Z4OA 1VPDA 1PR2A 2RC6A 3KQPA 4DMLA 4ENSA 4Z9XA 4B3XA 1OZHA 4MGIE 2OGWA 4MVJF 4O3MA 5EP2A 2GXQA 2I1QA 3MJ5A 4LJRA 5G1OA 4UM9D 1ECBA 5IASA 3WA7A 1MO4A 4CZ2A 1D6JA 2VJPA 4DNOA 5BV7A 3AMVA 4DABA 2GN6A 1AM4D 4Q9NA 4OHXA 2UYXA 3T6KA 4Q6WA 1VSUA 1MX9A 5IT0A 3WDLA 2E55A 3ELBA 2JVJA 1EXMA 4BO9A 2WDPA 1B8UA 3P2IA 4MHOA 2B21A 1E2LA 1I2DA 2ZQYA 3DZGA 3GYGA 1U3DA 3P4XA 4JOSA 1CR1A 1Z3IX 2ODPA 3R6GA 5JJ5A 1DOHA 1TVKB 2Z8YA 4MX8A 1JYSA 3K1JA 5LP6F 2RMMA 4WKCA 5AHKA 2RG1A 4DNXA 3CKMA 4L0QA 2WNHA 4IDHA 3RGGA 2E7YA 2D11A 2FWMX 2RHTA 2PD4A 1U3VA 3BXEA 1QPGA 4WZAB 3VPCA 3PBKA 2PQMA 3UOGA 5KHOC 4KPUA 4DMCA 2RE8A 1E32A 4OV6B 3HWSA 4AP9A 1THGA 3ENNA 3VXWA 1VSVA 2JGDB 5TGDA 4PU0A 2CMKA 5C8YF 3GLGE 2BEJA 2CBNA 4JUIA 5HJEA 1WX9A 2PWYA 4AVYA 2VSYA 4JX8A 1R0RE 3KZ1E 3PGEA 3L5OA 1WX8A 1C9NA 1FCCC 2A4ZA 1G5IA 1NMEA 1SG6A 3K0CC 4BAUA 5ERGB 2QGFA 1DARA 1M74A 1V1JA 1L8XA 3I1YA 3B38A 3AR4A 1QTRA 5B1DA 4LZZA 2EATA 4EI8A 5JDIC 1N3BA 1G18A 1UFQA 2V1YA 3ZLZA 2EFDB 3BRWA 3EWNA 4I5GA 5A87A 4U9UA 4EBFA 1KSHA 4MW6A 3IQZA 4IQGA 3C8DA 1GDDA 1WU8A 1SVIA 5CNMA 2O6LA 2X2OA 1K07A 4DNQA 4QUKA 1KTIA 3GAFA 3CTMA 2J0SA 3ZIAA 4EPWA 4YRSA 4C1EA 5JADA 1C4WA 4R40A 4BLSA 2NYAA 2DJIA 3QPDA 3O3MB 2HLDD 1TLFA 4P38A 3AB7A 2C9YA 5I4CA 2BFDA 3N2GB 1GTRA 1DAHA 3VU1A 3WWPA 1O03A 3S8MA 4OBEA 4Q05A 5EYPA 2LKDA 4C06A 3EPPA 5EPOA 4ENVA 2H7XA 2V7VA 4K05A 4DVGA 3PJGA 3ZWPA 1I1QB 4PFKA 1ENPA 2WLTA 1GCIA 3B1VA 3PUZA 1GYRA 2JH9A 1SKMA 1J0EA 3QG5A 2PMEA 5HIOA 3HM3A 4NU8X 4GZ5A 4R3DA 4DV3B 4A3SA 2HH9A 3I53A 3OT4A 3VU9A 2EKZA 3ESQA 3RK1A 1O6FA 4JLOA 3AFNA 1CP3A 1XHEA 2Z0DB 2BH9A 3MRTA 2PNJA 4DM4A 1Q57A 4G23A 4QQNA 3AUUA 2O3JA 4AJNA 4WBSA 5LYJB 4FJYA 1CLUA 2AOTA 2I3DA 2XE6A 3IMCA 1KETA 1FDVA 2J42A 4MO9A 4ZOBA 3DHYA 2BKXA 2PUFA 4JP1A 4HRVA 3GGGA 5BN3A 1E2GA 2XNHA 4EAQA 1XROA 3APCA 4Z5XA 3PXAA 1V4NA 2HADA 2HLDA 3B8EA 4C7VA 2XJ4A 2KXJA 3E03A 1XCPA 1UWXA 3MT0A 1BMQA 2I7DA 1CJTC 4XSGA 3VHRA 1ZONA 1XUOA 4C0XA 3VH3B 1L4DB 4DHJB 1IIRA 1E2KA 2ILVA 2PZKA 3A9WA 1GDHA 3DMTA 4CEHB 4LY6A 1HEUA 1QB7A 4DXHA 1X1DA 2WHXA 5CM8B 1L4NA 1XNGA 1VD2A 1A70A 4FBGA 4CGZA 1DV2A 5H7XA 4EDFA 4H1WA 3I01M 4HY3A 1Y5NA 3R2JA 4UUQA 3HN6A 5AHWA 3AEXA 4WLFA 1PV2A 2JBWA 5AKHA 3X1XA 4C0QC 2C5BA 4PXAA 1GB1A 4R51A 3IQWA 1D6MA 2G0AA 4S04A 5J2UF 4Q4JB 5A3SA 2GN0A 2HIMA 2P77A 4X7RA 3UT0A 1K86A 4FPXA 3M9XA 4YUAA 4ZK2A 3N5CA 3VNBA 5A06A 2HGSA 2C4KA 2CXTA 4CKCB 1PD1A 4B5LA 1CHDA 1Z73A 1L3CA 3KJFA 4GMHA 4Q16A 2EV9A 2OZEA 4JLBA 1RW4A 4E70A 4HNUA 2DCUA 1ZTCA 4UD2A 4FMCF 1XD3B 2KVRA 2FOLA 3DDOA 4QGFA 3B1WA 3SFEB 4CMAA 3M4JA 2B1RA 1JHDA 3O75A 3KVFB 2FX3A 3FTNA 4A73A 2KPOA 3ZO5B 1HTTA 4JJ8A 4FR7A 1QILA 4L9AA 3A31A 4C1HA 1ZCAA 4NYJR 3EGEA 4NMXB 5A4JA 2IW1A 3OESA 2MSNA 4A91A 1F48A 4BU0A 3KJNA 3DE3X 3A4NA 2F59A 3MB8A 3GVPA 3IUJA 3ZX5A 5JWRA 4XTCS 5GGXA 4YJGB 4N6EB 4PYRA 4Y2VA 2LUOA 2D74A 1Z2MA 3X43A 2KWVB 2C04A 2PMBA 1J9GA 3L0PA 4TUYB 3K0BA 1BD4A 2E7ZA 2GRIA 1QGOA 1MD9A 1PSZA 1Z8NA 2GD1O 1J33A 2CFTA 1TJ3A 4MPDA 4N5NA 4EL5A 1NVVQ 2WFLB 1P2SA 5C3JB 1W5TA 2JJMA 3UGBB 1E2UA 3O4VA 2BW2A 1MAUA 1WM3A 1YAJA 5G4LA 4I36A 2OOSA 3WYGA 4OVVA 5KU7A 4PYUA 2DYMA 4RK1A 1M2OB 1DFHA 4N7RA 1N6PA 3AILA 3M6WA 4QNMA 3RAGA 1ZSVA 3V7UA 5CFPA 2Y77A 5LOVB 4BL5A 1XVIA 4B31A 1IN6A 3EZGA 3IJPA 2QL9A 1H4VB 1Z6XA 4PLZA 1WG8A 3AUXA 2AI2A 4BO5A 1RQGA 1KR3A 4MLZA 1KBZA 1UBSB 2D1TA 1GNSA 4NF2A 1GY8A 2QMTA 2JXXA 1LS1A 5H3LA 4DV0B 2VTVA 5DTJA 5LZ2A 1DV1A 3U3OA 4JQOA 1KR2A 4FDVA 2ARKA 4KIFA 1D2HA 4LNUA 3DDZX 5HQJA 1GT91 3RUCA 3SQMA 2OCLA 5L51A 1CF9A 4FN5A 3ML9A 4DDMA 4HJXA 3VO8A 2L1AA 2II6A 2V03A 4MDFA 1EJ2A 3C6YA 4OSOA 1O4WA 5AHRA 2IYNA 5LR6A 3CNQS 1K2WA 4KWTA 2EARA 3VTUA 3UXMA 3FKQA 2DEUA 5CLFA 3JASB 3L6EA 2HQRA 2DENB 3SQWA 1USGA 4JLCA 1R4ZA 2HRZA 2JEZA 3OOJA 4ESEA 5M2QA 5B1UA 2PAFA 3P0IA 4E6PA 2ZKLA 2FFBA 1X8IA 3I45A 1M0WA 1DHTA 4WTOA 4GKKB 4UZFA 1J0AA 3NIDB 1EP3B 3BUSA 3LXXA 3C14C 3W5JA 4DIMA 5B3LA 4Q5IA 4WV3A 4G37A 5TQ2B 3G8YA 5TPZD 1SF0A 1Z38A 2FEOA 2GA9A 3NWJA 3OO1A 4M7RA 3S29A 2CYAA 2WAXA 3AUKA 3QVUA 2HWWA 3SHQA 3TBLD 3TUZC 4LE2A 3IHKA 3GFBA 3RH0A 3TEXA 2R96A 1F6WA 2QZJA 1JFLA 1L7MA 1E9VA 1SHLA 1XO1A 1U7XA 2BMEA 2GWHA 2HY7A 4I1RA 3NPMA 1JILA 1PLJA 2BL4A 1NC3A 3LLMA 1UC5B 4D42A 3PEWA 5HF9A 4Z6XA 1OAOC 2QAGC 3T3GA 2ZVOA 2PSJA 1Z6AA 2WMOB 2AJ8A 1BXRA 3F5SA 3L6DA 4LNIA 5CNKA 4F86A 2FPWA 1U7PA 3NM4A 4X9XA 2BFLA 2FF7A 1A9YA 2C9WB 2HEGA 3JQGA 5JVDF 3M81A 4OO3A 5P8WA 3BHNA 3FAKA 3CEAA 3HZOA 3MWDA 4PNHA 3RKRA 3TD6A 2R61A 3BCHA 4K88A 4N40A 2IFTA 5BXQC 3RODA 4TKNA 1ZK1A 2JGMA 1I32A 1WNFA 4QQFA 1GCUA 3WLRA 2HMUA 1HDIA 5KYXA 4BBJA 1JHPA 1GLGA 3E9NA 4PGGA 3UB2A 3MJTA 4EYEA 3OQHA 3D7RA 2DY0A 2NG1A 4OHOA 3DBRB 5LB2A 3FB4A 3STXA 1VB5A 3QVGA 2GCOA 3WXCA 1HFWA 1DUVG 2GAIA 3P9KA 2GMWA 4IIFA 4AF8A 1WUPA 1CUSA 1DELA 4IIEA 2M8SA 3BULA 4RORA 1VJRA 1ODSA 2AX5A 1E18A 4RF3A 2PJZA 1W46A 3U48A 2WF6A 4MJSA 1RCTE 2OBBA 3AUTA 1N8KA 2FZKA 4CMGA 5LSAA 4WY8A 2XMRA 3E2PA 4C4RA 3R6WA 4Z7NB 1OU0A 4MZDA 3N76A 3I28A 1KYXA 4H7IA 2J0QA 5ITZA 2GYYA 2QTHA 4KB5A 4L3VA 3IBSA 4RD2A 4XFDA 4CFZA 5HRCA 4H2AA 2B69A 1HA5A 3GCWA 2NXAA 1CUHA 1V5TA 1XNJA 3GLFA 1ZH0A 5IJ0B 5THQA 2FHPA 5HTOA 1C7ZA 2BOVA 4UOZA 3T9AA 4J3JA 1PEKE 3HBNA 3HUTA 1NP6A 1C1XB 3ODPA 2B20A 2IOFA 4HDNB 1Z5OA 3L0BA 3EHDA 3LQKA 1W0JA 1W47A 3OQBA 4GXQA 1T4CB 1T6NA 1NATA 1RE1A 3PSAA 3DFZA 4LJOB 4QXOA 5CHFA 4CU5A 3ZU4A 1T91A 1KPIA 2WU4A 3MLBA 4K8RB 2Q0JA 3AEKA 4UEQA 1TJNA 4NYMR 4Z54A 5I7AA 1K3UB 5LXTA 1VA4A 1GRCA 1RYYA 1CK1A 1JU4A 5G55A 1HE4A 1KBOA 2YUIA 3BXOA 3JZIA 1IXZA 2FWAA 1OIXA 2G8NA 2V7XA 1XZQA 2PEZA 3FMGA 1FDWA 4MCIA 1PU2A 4GOJA 3FNRA 2ETVA 4ZRNA 3JPYA 4RJTA 2DY1A 4M36A 4EB0A 1BJRE 5I51A 2DOOA 1VLBA 2VF8A 2ZZIA 1VZ8A 1DGJA 2KDBA 1M2GA 1PT6A 3N6XA 3NZEA 4PX2A 4DQKA 1G59A 4Z7RA 4C43A 2AD1A 2IA5A 3GHYA 1P1CA 4IIUA 4Y67A 3X1MA 1LPBB 3O7MA 3B2QA 3ETCA 5JHAA 4RK5A 2DWUA 2PRSA 2WZCA 2OQVA 1TYDE 2PM8A 4M8KA 4ZMRA 1YZ3A 1W0KD 4MWBA 4HSEA 1HRKA 5HVNA 2R6FA 4KWHA 3TGPA 4IDAA 3ZNZB 1DJLA 1ISGA 2ICAA 2RDGA 3DO8A 1L9YA 1U0OC 3W0LB 2IVZA 1NFRA 4LJ9A 5BYJA 3JSVB 5EJ6A 3ZXUB 3F6CA 4KN8A 4XC2A 2XEWA 1XXHE 4KDEA 2ZKIA 4DLXA 2JWUA 5C23A 1R0LA 3CEHA 6ADHA 1E79D 4FGJA 2Q0IA 2FZWA 4TZ9A 3IKVA 3QKIA 4E5PA 1MAVA 4YAUA 1VE1A 2G0NA 3SDSA 4DV7B 3MC8A 2P11A 2QX8A 3CZ9A 3HRIA 3V1UA 3WNBA 4D56A 3DCGA 3BHMA 5IO9A 3G1WA 4M0LA 4ZMBA 1FP2A 2NVBA 2X0RA 4F85A 4NYIQ 3VNVA 5DCYA 1YDMA 2W6NA 2ZJ0A 4LCEA 1PTJA 2X77A 2ZI7A 1J09A 3AW8A 4P2GA 5CCDA 3FA2A 1X1EA 3ZUPA 4E5SA 4Z7QB 4YT8A 2J9FA 3IPLA 1CJBA 3FPKA 5FBWB 1UK9A 3IILA 2CHQA 3DDWA 3L43A 2RHMA 5TVKA 2HTEA 4LYHA 1I35A 3D02A 5D84A 4RY8A 2DPMA 4J49A 2QTLA 4UCWA 4TQ0A 5KYVA 1BS9A 1GNRA 1TU0A 3O95A 4JMLA 4YRAA 2H07A 5HS6A 5DWDA 4MDKE 2K7ZA 2WV7A 4YP9A 4BX8A 1ISIA 4F92B 5L6MB 1W1IA 1Z7WA 2MR6A 1E3TA 1U5BA 3CMMA 4B4OA 3C5EA 1KQFA 4L2IB 2O3RA 4A55A 2CVOA 4GNKA 4F3KA 4RTMA 3EIQA 1SE2A 4IGAA 1UPBA 2CVFA 4BQFA 4RBNA 3IR7A 3OZIA 3CLTD 2RK4A 2R66A 3THOA 5ACRA 4JOCA 5EMMA 2ZYDA 2GMIC 3NDPA 3R7NA 2ZTSA 1GKLA 1O6BA 2KC1A 5DRTA 2PE6B 2QRLA 4IIJB 3SBDA 2GI4A 3P4UA 3PD7A 3DMNA 3GUYA 2C61A 4LOAA 2QTTA 4IY1A 4NESA 5AVQA 3RS7A 1PG2A 2ROQA 2ZJZA 4NK5A 3H2YA 4KQGA 5LXIB 1T25A 1PN3A 4A36A 1F4LA 1BJTA 2EJBA 1P75A 2FPGA 2PY6A 1TY0A 1YDGA 3CUWA 4KJZA 2VPYA 4AXBA 2OYRA 1ESCA 3RUDA 3ZU3A 1CY0A 4PS8A 3OY2A 1H3FA 3G88A 4Z8XA 1JEYB 2JLRA 2QRZA 3BN3A 5BY2A 3S7ZA 1FRDA 3BWMA 1DZIA 4XGNA 3IXLA 1A7TA 3GUCA 3GGJA 3L8GA 1MX1A 3PNYA 2IYEA 1TAGA 4G5RA 4IHQA 4HLUC 5FB3A 1E6KA 3PITA 5CB0A 1BTOA 2BGUA 2BYVE 1R0KA 1IQRA 1T9BA 1F12A 1Y48E 3QU5A 4RGYA 1OZGA 4L4XA 4TWRA 3LWBA 4KQEA 4F45A 5HWSA 1UMDB 4Z4EA 1T4CA 3IA2A 4WFQA 3J81A 5TJ9A 4FYXA 2BP7A 3LPAA 4Q3NA 5J3JA 2B2XA 2Z08A 3AEKB 4TV9A 4HYYA 1UOEA 1RLJA 1B3RA 4PLPA 3FYDA 4M01A 2WTEA 2A5GA 1Z34A 3F46A 3GNLA 4RHFA 3EJ6A 1GUYA 3CX3A 1XP8A 3LOQA 1O95D 3MHPA 2D2IA 1SA0A 2PO5A 4OGLA 2PZMA 4RSGA 3WBKA 3ZQKA 3T54A 4DZTA 4DR4B 1SO8A 3C41J 1WB4A 4DCPA 1NVAA 5EWLB 2R4QA 1UZLA 2ZVQX 5D2CA 2MCNB 3UANA 3ZR4B 4DR7B 5JO0A 1QQBA 2W9XA 4MIOA 2LI5A 2Z6UA 1DKLA 2M1MA 4N03A 4PYZA 5FOTA 4D9EA 1N33B 2EBFX 2JATA 4ZCSA 3KW5B 2NZUG 1XMPA 1UCFA 3VHXA 2VYVD 3RB8A 2HV8A 3HUFA 4OK6A 2RH5A 5F5NA 3SHVA 1TJ5A 3AF3A 5T5QA 2BFFB 2JZNA 1RU3A 2MSLA 3FROA 1FMJA 2KDFB 1RAAA 4JL9A 3W1SA 2C5LA 3GEDA 4TKLA 5TLSA 2NVUA 1FXUA 3H75A 5I01A 1XTOA 4QT4A 1R6UA 1GGKA 4JBLA 4RCZA 3RNCC 1JB9A 1Q91A 4N0EA 4MVYA 4PX5A 5F21A 2P97A 3IP7A 3A9JA 4GE3A 3W1WA 1USWA 3KS9A 4N5MA 1Q1ZA 1MTOA 3O2QB 3PX3A 5D6NA 1E7RA 1Y56A 4GR9A 1QQ5A 5HQ3B 1OFUX 3UF0A 4AECA 4B4UA 3HM2A 2XSZA 3HUEA 1APBA 2GDJA 3PWTA 4TYTA 2VW8A 5E6NA 5GMVA 4A23A 5DHRA 5BNWA 1JG1A 3IO3A 1E2EA 4LRWA 1N9ZA 1JSLA 1NXWA 4EUNA 1AYFA 4HEA1 3MFGA 1U0TA 2QKYA 4HL6A 4U9HS 3U7FB 3W2DA 1NRXA 4HDSB 1DIBA 4OP1A 4BP3A 4ZDIA 3TUOA 1RE0A 3R0QA 4ETWA 3LDZE 3NG1A 4FDMA 4URYR 5DASA 1ZMBA 3AF2A 2BT6A 5TARA 1ZUD2 2IH5A 4RH1A 2BCGY 1EZZA 1L7DA 4CTMA 4NQ4A 4YDRA 1Y1LA 1RRPA 1RXWA 3DEKA 3EEBA 3F74A 4EA8A 1H2WA 1P98A 1JJVA 3COVA 2JCGA 4XRGA 1UWLA 1GNPA 4Q12A 4DEYA 2P41A 2WWWA 2XUPA 3DBRI 3AU5A 4QFCA 3D32A 2A5FA 5FULA 1Z0UA 2NS5A 5AMXA 2BUCA 2I6UA 3DMYA 1C7EA 3L7AA 3Q3VA 1M4VA 1V39A 1W1UA 4HGPA 3S40A 5KNDH 3HK2A 4I3HA 3WA6A 1CQVA 2HA3A 1VTKA 2VZ9A 2C5LC 4M37A 2XUHA 2YOFA 1WZCA 3ETDA 3E9RA 5EJMA 1KIFA 3DTVB 1FDSA 5K0LA 1JSRA 4QPPA 1UUPA 4UZEA 2JD1A 2XNKA 3EBPA 3WO0A 5E3HA 5HZHA 2FUNB 3C3YA 2LNDA 3P2BA 1MO3A 1PSDA 2MMCA 2VPIA 4LZAA 5AVJA 7ADHA 4FD3A 1ID8A 1MQOA 3AEGB 3SOZA 1HDGO 4B6WA 2DPXA 4BVJA 2IXAA 2R1VA 3H65A 3R6LA 4TSSA 4BQIA 2G70A 2DR0A 2WHIA 1U8EA 4EF6A 4EHNA 1F20A 3F9IA 2AWTA 2O2VB 1B1AA 1XTQA 1ZIXA 2PGNA 5DLEA 1U02A 4ZXPA 3PEVA 4YQZA 3FUWA 1UBOS 1L5QA 2Z43A 4ESVA 3T94A 1PUXA 3V1NA 4PO8A 2ZPUA 1J2RA 2VSXA 5JVDA 3GLHA 1J2EA 3OZTA 4PICA 1SXGA 2COEA 3BE5A 3H11A 4V0QA 4YGXB 4DLAA 3GW8A 1EUVB 1QGAA 4PG7A 3AYXB 4RW0A 3AI3A 4OHMA 3VSAA 3FCSB 1PJ3A 4PPYA 5E6OA 3KCNA 4EZJA 5LD2C 2KDMA 3BREA 4K2HA 1FS4A 3ZXRA 4OHVA 3ZCVA 5TMPA 4PZZA 2NQ2C 1VKJA 3REGA 2X9VA 2A2ZA 4L07A 1I3LA 2F8MA 4TMXA 4EYSA 1JEEA 3KFVA 3PVSA 4IIHA 4TTRA 5IARA 5DN9A 5EZSA 1UBNA 1ZS9A 1WPRA 2VN8A 4EB6A 3QPBA 3TBFA 5H9VA 3GOEA 5M7EA 3X30A 5H8YE 1Y82A 4Y1FA 4UBJA 2DULA 5AIAA 5H1YA 5LXTF 2HMTA 2BG7A 3M3PA 4EHKA 1XXGA 2YJ4A 2V3NA 4ZVLA 1S6YA 1K63A 2A0FA 4KVGA 3RABA 1GIAA 2XE7A 2DFTA 3LX6A 4IQ0A 5ELMA 3SQNA 1UBIA 2C03A 2QW8A 4TWZA 3ZW8A 3NHKA 1U2ZA 3IAS1 3BZUA 4QOEA 4ZQGA 5AW5A 3VQZA 3ZE1B 5LU8A 5BQ3A 2HNAA 1ONNA 5D3MA 2QRKA 1SIOA 2JD2A 2R0QC 3HFRA 1J19A 1X77A 4KE6A 3COSA 3I8XA 3DLBA 2P9GA 3ET5A 5J2UB 4LJAA 1FYXA 5KB3A 2H4HA 3EPRA 3KPWA 4P7FA 4J1QA 4MYHA 1D6NA 4HG2A 5GONF 3TLKA 1P0CA 4JC4A 2ZRAA 4EKGA 4TSFA 3DBSA 4CM5A 5EGNA 1GPJA 1RBQA 4NJ7A 1JLLB 1MVKA 4X57B 3SEBA 5FI5A 5C1BA 5BVGB 1O58A 1AB6A 1C30A 1XN4A 1XV5A 5DNEA 4EX6A 3UZUA 4L5CA 3GRCA 3LRPA 4W5JA 4H27A 4X7MA 3WGGA 1I4HA 2A1UA 1EK6A 5C3UA 3IFSA 3RANA 1PTJC 4L4ZA 4KCGA 3AF1A 4WXEA 3OU7A 1F8GA 1DC5A 1DWQA 4J6EA 4CLOB 2IXBA 1E1CB 2PBRA 4NOMA 5CX4A 3RHFA 1GXSA 4LYGA 4E09A 1DTEA 5JCZA 2CVHA 3UATA 1JWUD 3GE3C 1FSSA 1JXMA 4JGGA 3FXAA 1R12A 5MFPA 1M9NA 4RL4A 3QVVA 1YS2X 2NUBA 1ODTC 1GV0A 3QMWA 1M94A 1P2FA 3R77A 1XRPA 2FU7A 1NDQA 1FUUA 1G0OA 1JYEA 3QKSA 4PS3A 1JIXA 3VO2A 4DSNA 2WAMA 4RZHA 1HZZA 5KTYA 5IU6A 3PEUA 3DTVA 1RYNA 5SZJA 2PLRA 1BH2A 1IXRC 1ZWLA 4OVZA 3AWDA 3EIOA 4ERNA 3GT7A 1G2PA 1HR0B 1QHFA 5JYEA 4N8SA 1RXIA 3WWCA 2JGIA 2QN9A 4U0KA 1Q17A 4D5GA 4YMHA 5B3RA 3II6X 3PNQA 3AF5A 1MOSA 1SQ0A 2ZZPB 4JY7A 2A9JA 4PLCA 3GU3A 5L7YA 1WGHA 1NV8A 2EKDA 1RM6C 1H8CA 1D2GA 1XTPA 1K4YA 1P80A 3K9HA 3N6VA 3PYLA 4Y2QA 3HG7A 3PT2B 4DF3A 3QSYA 4GZ6A 1XPRA 5A04A 2WX0A 4IMPA 4PC1A 1XRJA 4MWCA 4PHCA 3CCBA 3GNQA 5GJVC 5L3SA 1O6GA 1XZMA 1WIWA 1EWTA 1HMYA 4MVJG 5BWMA 2W00A 1HMPA 4EHFA 2KAJA 5TR5A 1U63A 1JEAA 4QUAA 1TTNA 1IWOA 4ROSA 2KTRB 1LB1B 3RPCA 2CLSA 1SBYA 1U28A 1YZLA 3HEAA 2O8CB 2JWZA 4ENWA 4O4IA 2AUNA 2EGGA 5GVRA 3TSSA 2B92A 4FHFA 1DINA 1AGXA 3LDHA 4E71A 2FEWB 2ZR7A 1LV7A 4PZUA 2NM0A 1JN0A 4ZI3A 1YQWA 2HNKA 1EDEA 3ZEAA 4WOPA 4WURA 3S1AB 4BO1A 1P7YA 4YJGA 4PNEA 3ZXIA 1KWKA 1WW8A 5IJ9A 3SDZA 3U5ZB 3FOBA 1JU3A 4QYMA 1AZTA 1QUEA 4S12A 5AI8A 3T06B 3PGA1 3QOYA 4HRXA 2E4VA 1E1KA 4X90A 2P0AA 2AB0A 3AGQA 4GP9A 1PYGA 1MHHE 4IH4A 2B3TA 1L5YA 5JATA 2YOHA 4HMPA 3K09A 1JG4A 3HYCA 3X2ZA 2ORYA 2ZSJA 3WKAA 4OKIA 3ORQA 5IVHA 4ZICA 1FDTA 1JT1A 1QF9A 1UC9A 2V3VA 1H5NA 2LIPA 1WCWA 3GI1A 4PTYA 5ALFA 3V4PB 1DPFA 4XQ9A 3PNLA 3H5OA 4I50B 4C05A 1NOJA 2I8CA 4CKYA 4XB2A 2MINA 4IIVA 2IZ0A 1IHYA 1NF3A 4FFVA 5GY7A 5BWLA 1K7FB 3FUCA 1T8SA 2GM5A 3FCEA 4GWGA 3PLAE 2HX1A 1IVSA 2IS1A 1MVLA 1N9GB 1V0JA 2Q99A 4RXMA 3M2PA 4QBIA 2H65A 6YASA 1J0DA 4GR5A 1G5FA 3K32A 4ZI7F 4DLRA 5ITSA 5LYJA 4NJCA 3HCEA 5DNWA 2ZYRA 2FUEA 4HS4A 5LQUA 4QFBA 4C4AA 2NQ8A 1FB5A 3OF5A 2WNIA 1ES9A 4K8OA 4OHPA 3N3AC 3ZQ6A 4RS4A 5K8TA 2CUKA 1J2YA 3KB2A 4BAZA 3D2AA 1D8TA 1MJDA 3P5SA 5GONA 4J3NA 4I0WB 3BWXA 4BLQA 3UB4A 3PI7A 5FNVF 4YHHB 4RL2A 1I7NA 2WBLC 5CT4A 1W59A 1ABBA 1EEXB 4G41A 1HE2A 4AJKA 1K6EA 2Z1MA 4ASUA 4ZEXA 3I8OA 4PQFA 2JKYA 2WIBA 5FA5A 4CVNA 4ED9A 2VTEA 4GPEA 3I15A 2PYZA 3E70C 2X8BA 2QMUA 2AJDA 4BNMA 3PJRA 1LX6A 4DE5A 1NKSA 5GJWC 4YRGA 2ORWA 2M6SA 2CK3D 3GZJA 4A6QA 1M66A 3D3QA 2F90A 1OVMA 2PUEA 2OGUA 1E2HA 4OUKX 5EJ5A 5K9ZA 2WU5B 4QT0A 2Z95A 2H85A 2ORVA 4S17A 4B3BA 4WKOA 2IELA 2LCIA 1VG8A 5CM2Z 1QIJA 3NHUA 3OF2A 3ZHVA 2GXAA 1HT2E 2WM8A 1UMCB 4WE3A 4M00A 3NIFB 2UVQA 4J0JA 1TECE 1XTSA 4IDPA 3LO5A 5JQGA 4M0MA 1D2MA 2C3YA 1VLQA 1SZPA 1M2NA 3HFGA 3VKVA 4ZVTA 3SQLA 5A5DA 1PZHA 1IG3A 2IO3B 5C5DA 5TB5A 4QDJA 4U3JA 5KYXB 1NLFA 2AQIA 4LRSB 3ZDRA 4RF1A 4E30A 3L7JA 1NNI1 2I4MA 5FTNA 4PC7A 2IOQA 3UAYA 5J2TA 4V0LA 5E95A 3U3DA 2UU9B 2JGNA 4G9EA 3ILYA 1ORWA 5HR5A 3GD5A 4Q4JA 5GM1A 1RABA 1NE7A 1YC2A 3G1PA 1FP7A 4CM3A 3KPYA 3KUUA 1MR3F 2V96A 5A7FA 4RWZA 3F9RA 4M9SA 2Y71A 2GO1A 3UH1A 4QLBA 4M1YA 4W7SA 5FO0A 2B94A 4I9NA 2GVNA 5LCAA 4K6OA 1GUZA 4DT1B 4NV0A 2MBOA 1GLNA 4RGVA 3V8RA 2J9RA 4FS8A 1EP9A 3FNGA 3TLMA 3VVMA 4WAFA 3HVIA 3B9PA 1A50B 4D82A 5MN4A 2I87A 4LWOA 4P33A 4IS2A 1KI7A 1JIKA 2NWQA 4EUHA 2YY6A 3IEIA 4LBZA 2GN2A 4MVJP 2KWUB 1QNFA 4FBJB 1IYZA 2FSVA 2XOEA 4UJ3A 5JPIA 2NYPA 3CNBA 1CYDA 3HDTA 2C4VA 1XJ5A 3WANA 1YQ9A 4DR1B 1BMDA 1NSTA 1OJ7A 3ZWOA 2QMQA 2HXSA 2MWMA 4KOEC 1JXOA 1QPZA 4D0LB 1X94A 4U7WA 3IDFA 2RHOA 4TWBA 2EZ8A 3OQIB 2H16A 2B5VA 2X7HA 3FDXA 4NEGA 4AQDA 4BWVA 3SDLC 1N9GA 3D3NA 4UM9B 6CHYA 1QVRA 5IN5A 4LVUA 2EW2A 3LSYA 2JBAB 2VJNA 2CJYA 2ZBQA 2ZT5A 3CF6R 1J2TA 1PGQA 3F47A 2Z6VA 4KFUA 4X97A 4ZV4A 3CLTC 1VBKA 2OBLA 3K9WA 3RU9A 5T41A 2XUDA 4QQKA 3H2SA 1J0BA 3CKLA 4HNHA 3L7CA 3UKOA 1IBXB 1XLOA 1NIJA 2FU5C 4HQRA 5AJLA 4BO4A 3ZWFA 1BMTA 1N6KA 4JVLA 2O59A 4GOLD 4OGKA 7REQB 2F48A 3WY9A 1GU0A 2C77A 3KETA 4OQLA 2VRCD 2JLVA 1HYBA 1OASA 4M9ZA 5TMDA 1N1GA 4GG1A 2OG1A 3HJFA 3ZD8A 1NN3A 4F9EA 3NGLA 4P4LA 4C1NA 5BUSA 1S0UA 2ZT7A 4BVAA 3EASA 3OO0A 4X85A 4ZVMA 5IC6A 3BIOA 4ZOCA 2ZUTA 2JZCA 1TVEA 2WWFA 4OSPA 4BNIA 1UJ6A 2WKRA 4WJQA 3GP3A 1F3LA 3JQPA 3RRJA 4C04A 4EPRA 4EZKA 5CCBA 3ACDA 1GL9B 3C24A 4F0JA 2B0CA 3R75A 2OOBB 2R8EA 1PQPA 3BB4A 5C52B 2CDNA 5KSPA 2FPIB 3FPHA 1T34A 3G9TA 4TWAA 1ULTA 1W5SA 4XCQA 2NT3A 1E7VA 2C0CA 2Q6VA 1RHUA 1VJ0A 1WF3A 5COQA 4P7IA 2QJFA 3L1IA 1FCJA 3ZDXB 3BJRA 3IL2A 2P30A 4NLLA 4CR6A 3KV1A 5HJ7A 1U1GA 2D07B 3LK6A 5K99A 1GN9A 3V8EA 1VQ1A 4C4SA 1PQSA 2HNBA 3DZCA 1ILWA 1HLKA 5ALTA 4XI9A 4TUYF 5L45A 2VKQA 4D2KA 2GKSA 2HRQA 2X1MA 2O8DB 1AXRA 1K6JA 2ZBPA 4DIDA 4EJSC 2ZEQA 1X42A 3H5TA 1XZHA 1Y8AA 3UJ9A 1U4OA 1WI0A 1AD2A 1CUAA 1NJ1A 2LDXA 3IAXA 3ONNA 4QQRA 4ZV9A 3V46A 4RK7A 1V71A 1SD1A 2DFKB 1F1BA 3RTEA 1FVFA 4WAUA 2DFPA 3TP9A 4GI3A 1Z2CA 2PNFA 1F8XA 1OWMA 4ALLA 1T3LA 4RMAA 2P68A 3TL5A 3IUYA 4EF5A 2AWOA 3DQPA 3R3XA 4JSTA 3EC2A 3W2GA 1OY1A 1NU8A 4GC9A 1TEHA 3KKMA 5K2OA 5EXTA 2H2AA 1P77A 1EDOA 3FYTA 1UF9A 2QTMA 1C76A 5I7HA 1H1TA 2CLEB 2QJOA 3Q3FA 2I2YA 3M6IA 4WWMA 1EWRA 1LK7A 1F51E 1ECCA 3M34A 3PQ4A 4JR0A 3SLGA 1ZD4A 3ZWVA 1ADBA 3TVDA 1XC7A 3ZJTA 3UMFA 4EFKA 2QBYA 4I3FA 2ZB3A 5P21A 3T5MA 3DOOA 4JYBA 1DEKA 2V58A 5I8WA 3R3UA 4D3XA 5EHZA 2EJVA 2KYWA 4Z4CA 1O95A 3IAS6 2QDKA 2D54A 3CWZA 5EUQB 5CXXA 3AVXA 1OJLA 4AJOA 1UIMA 4RKEA 2L32A 2LRWA 2OKGA 2R86A 3EYAA 4MV4A 2LUMA 1AGNA 1YMUA 1Q1OA 2PD3A 2PS9A 2YEPB 3OAAD 3KE8A 4IILA 4JYCA 1T0UA 5JSKA 2RFLA 3MBOA 4NHOA 1O95C 3SJUA 1GUBA 2PUBA 1Q15A 4UM8B 1O08A 1W52X 3CRZA 4P58A 1JR2A 3D1JA 1V4BA 2VCYA 3JZAA 4PG6A 4YAFA 3QENA 3QI2A 3R7FA 1Z0ZA 1WM1A 4FUTA 1GR0A 5DNUA 2GBJA 2EFCB 3HP1A 2ZOSA 4G0QA 4HXEB 4BN5A 4E7PA 2ZRCA 4P3PA 3G0HA 5K8UA 1JIIA 5EMNA 1ULHA 1YFZA 3W9UA 4YTMB 1DBSA 2CDBA 3WHPA 4KG7A 1EB8A 4UDYX 5CVUA 1GZ3A 5DXJA 2O2SA 3OP1A 4L8GA 4NMLA 4P22A 1KXJA 4W1RA 1DCKA 2G77B 4AO6A 4CUJA 2CU3A 2ZZKA 1F2TB 5IYZF 2C5HA 2GJ4A 3KQUA 1THZA 2IOHA 2BGMA 1FNDA 5EV6A 3GN1A 4KL8S 4DXAB 4W1SA 2KLHA 3RUPA 2I9KA 2WQ7A 4OZBA 4FKMA 4J9VA 4M0FA 4V38A 4KZ0A 3DEHA 1KZ4A 3JALA 4EYLA 4EG0A 5FI1B 1SJHD 1V9JA 2XHEA 2WJHA 3GRRA 1QKJA 2XN9C 1J99A 1GAJA 1Y7HA 2ZAYA 3WGJA 4DCNA 4MB6A 3R9WA 2KBFA 4UUBA 3RAEC 3GUUA 3K0AA 3PT9A 1C4PA 2MBHA 4FJ2A 4KGDA 5FPHA 2HTME 1FP6A 5A4AA 3NYIA 3DJFA 5K5EA 5T3UA 3U9SA 1V7CA 3Q3MC 2ZNVB 1SELA 3GPDG 5IM5A 1YQ4B 2Z5FA 3WB2A 3U60B 1EFHA 3INTA 5CUQA 1ZIOA 3LKDA 4CLHA 2ZUEA 3CF4G 1N7HA 2HK9A 4NDAA 5BMOA 4KYTA 2JPDA 1SURA 3PEEA 3M62B 5I3CA 3U3XA 4C80A 1A5TA 1T1RA 3EXEA 4OA5A 5AT1A 1P60A 3E22A 3IYLW 4E2ZA 4WHMA 5REQA 4RAQA 3OZRA 4MUHA 3GEMA 4QRDA 1U9ZA 4CF7A 5E4JA 3HN7A 5JH7B 2DH5A 3BKXA 1HTOA 1B4DA 1U2GA 1U0SY 2HBRA 2P3OA 2A9FA 2QLTA 2I1LA 2XB8A 3PUKA 3DS8A 3TZCA 5BMHA 1NSYA 1PVOA 3ND5A 3ESRA 1ZY2A 1DX6A 4N6NA 1EQUA 1MX5A 4IUMB 1GPYA 1WDLA 4MSUA 4QO7A 4YJFA 3DB1A 1ORDA 3EZ2A 3LTNC 3CVYA 4DV1B 2UUBB 1J8VA 3AEZA 2BYEA 8ATCA 4W9HA 4PHHA 4LRYA 1CY8A 1NLZA 2QX4A 3A10A 2IHBA 1Q77A 3L9WA 4IFBA 4IV5A 4JI3B 4BHTA 2N1BA 2KJHB 1G1MA 1D4OA 1TAHA 3E7PA 6NULA 1F2RC 3PHXB 3MEQA 4WJLA 1MQ9A 2UYGA 3KOMA 3ZI4A 1YK1A 3ZDMC 1JDJA 1QOZA 3UMJA 2OCIA 5FWAA 2GZDA 4DT1A 2GKOA 3KT8A 2OM2A 4CM4A 2MJLA 3M83A 1BSVA 1DDOA 1NI4A 1QFZA 1WOMA 2J09A 3KYCB 4X6XA 2GM9A 5CAEB 3BYTB 3UMSA 1QHSA 2AW5A 2X0JA 2G06A 3DUFA 1G5RA 3M3DA 1PGJA 2XOKD 1Y98A 2NX2A 3H1AA 4JENA 1QLJA 3W1VA 4YQFA 2Y1XA 4MRNA 5I7UA 1IM5A 4KZCA 1YDWA 4IS3A 3SYTA 2NZYA 3G8BA 3ICWA 2EU8A 1KZHA 2ZI3A 3TI7A 3ZJ5A 3IKTA 3ZY6A 5JSQA 3R44A 1KIMA 1M6VB 1T2EA 4ZDJA 2K2QB 2AK3A 4EO4A 5HM6A 3FTEA 3I0MA 1MBZA 2YNMC 1KZ7B 1XLNA 5JXWA 1T3SA 3LXUX 3NT4A 4IM3A 5L40A 3ID6C 1CY6A 3GXOA 3R9IA 3G0CA 3FWYA 3L7LA 1GL6A 3SXUB 1IHXA 2WJ3A 3PD1A 2ECKA 4KPFC 2HAEA 3VHXB 2XRMA 2HF8A 4WNYA 4AYXA 4CKZA 1JKJA 1AN8A 1SU8A 1B0PA 2XAAA 5IUKC 3U4HA 2CXOA 1ULBA 2JKVA 2R2GA 2X15A 4RO0A 3WAJA 5HH6A 1CUVA 1AQNA 2AXQA 2C8LA 3H9GA 2VUTA 2VSOA 2BBOA 1DEXA 3W8NA 2RJNA 1I80A 1DLIA 3NG0A 1C77A 2C31A 4RJKA 3AJEA 4YYEA 4RVOA 4RTKA 2WU0A 5HP4A 4CT5A 2FETA 4F2HA 4DXAA 2KMAA 3PR3A 4URFA 5EIBD 1TTTA 1XQ9A 5I47A 1BVTA 2GARA 5DKFA 4ZJYA 3QF7A 4JL8A 4LYAA 1UIRA 2JFVA 4YQYA 4AMZA 1TUGA 3MD7A 2PGJA 4OFXA 1DBQA 4FFRA 1YBFA 3MMXA 4MQ5A 1AHNA 1YZUA 2HXGA 1GVHA 1L8AA 3AEYA 3E9DA 5ALNA 4RDXA 4ISBA 1UJ2A 3I0NA 2R4TA 4M54A 1P74A 1X1CA 3MUFA 4XLZA 4BVUC 2GZ3A 4Q9KA 3SC3A 4ZPXA 1K0UA 4HZIA 2QD2A 2ZBGA 2DHQA 4K6FA 2N1WA 1R8SA 2JIOA 3D64A 5J59A 3T4UA 1WKVA 1EP2B 2FFAA 4HZGA 4M9QA 5AEBA 1ODJA 1DAOA 1HWYA 2D0OB 2JRLA 4QRHA 1UP7A 1E5WA 1T5DX 4Q9HA 4D81A 5F7XA 3ROKA 5JIBA 3EPJA 1YNSA 4J07A 4KPYA 2VDVE 1C30B 1K75A 2ZJFA 4NZYA 3OEYA 1TCAA 1U9YA 2GZSA 2HLHA 2NVWA 2IE8A 3FNHA 1A96A 1YJIA 3BIWA 3MPUA 4ZCQA 3R74A 2WWIA 4BMDA 4EGJA 5C7YA 4M0WA 3UNXA 3BGSA 3BICA 3O2SB 1G5HA 2H7YA 2HN9A 4R6XA 5MHTA 4GF5A 4RLHA 4ENUA 2YFHA 4YY3B 1H1LB 1I4TD 4HAUA 5JH7A 3PNPA 5A2GA 1RAGA 4ND6A 4OK3A 3S6JA 3O8RA 1HYGA 4ALKA 3DOWA 2E4ZA 3EY9A 2XQFA 4CFYA 3G17A 4WKGA 5C1ZA 1PVVA 3HDYA 3ZXVA 2WUFA 4EZBA 4WACA 1DQSA 3HU1A 2JAOA 4YRTA 3V33A 2Q7OE 1QE0A 4MCJA 4ZZ3A 3AL2A 4V0MA 2NXWA 1JXAA 1UFKA 2R79A 3G0IA 3GVXA 3LHFA 4KFRA 4TTVA 1AF7A 4U7GA 3UUGA 1Z4MA 1ESNA 2OAEA 2EAUA 2KTFA 3ANLA 3HS3A 3IBGA 3VX4A 4JO0A 3V97A 3B12A 1V7QA 2AW3A 1BKSB 3ED5A 3WK8A 1Q5WB 1A5RA 3CY6A 3PQ8A 4AG3A 3RSHA 3UT5A 3WGMA 5LM3A 4H3HB 3ETHA 3HWWA 3WGTA 2KLBA 3QVOA 1N2JA 1NXVA 3I6YA 4BNZA 4MW0A 4X92A 1QMPA 3RN9C 1V2HE 4PCUA 3IVXA 3SIXA 5ALUA 2R6GA 4ER3A 3NHWA 3RFTA 5HUQA 3DKIA 1E2IA 1JTEA 3O8QA 3ZJ4A 2VRWA 2P9CA 2ZJ2A 1PZGA 1ET6A 4J5HA 3LXMA 4QLAA 4B48A 1CY2A 4Z67A 4N5LA 2IIQA 2YYSA 3SAJA 4D3SA 2NUTB 4AKIA 1UKCA 1DEOA 1L5LA 3A4VA 3T9EA 3BB3A 1OYOA 1OBVA 1C3JA 3G2JA 1YD8U 1LJLA 1E94E 3OJEA 2D1RA 4PX9A 4S1TA 5HE8A 1DT5A 4WJKB 5AKYA 3QZUA 4CR7A 3WSWA 4ZHQB 3RNEC 3DBHB 2A8YA 2XVMA 3PGVA 4JVMA 1RLUA 4MQMA 2H2HA 3TLYA 4BGVA 4FE4A 2AHRA 3MYRA 3LX8A 1A9TA 1SCDA 2CFRA 4AUNA 1IE3A 3F96A 3WB0A 3D59A 3T99A 3FWNA 1K1EA 5A5VA 1YDHA 3GIDA 4BKSA 4US0R 1JPNA 5EIBC 3DMPA 2OMEA 5HFNA 1YJQA 5AVRA 5IG2A 4X91A 1GKUB 1KC3A 2G4CA 2GSDA 4D43A 1RKQA 4MZXA 4RJJA 1IEWA 3QYPA 3Q7SA 3TEMA 4CDMA 4HLNA 1RC0A 3WV5A 3B60A 5T4EA 2CHEA 2NTYC 3WWDA 3U6KA 1XDSA 4GMFA 2JS7A 4NARA 4MRSA 5KIAA 1YA4A 3VR6H 1XMIA 1B0UA 2ZIXB 3GJ5A 4N8DA 4CMHA 1AGPA 4GEKA 3OHPA 4LKRA 2F55A 4INZA 1ISRA 5ACSA 2RGWA 5AWFC 3PVCA 2KACA 1HLFA 1H0KA 1ODIA 3OAAA 3WGQA 4LYFA 3D0OA 4G85A 4WVFA 2F43A 1KZ6A 1F60A 1G5TA 3ZI0A 4R8SA 3OFND 1S1QB 4HBGA 4UHKA 1ZCFA 5EAIA 3TB4A 4CTKA 4KHPB 4RTOA 1JBKA 1U28C 2ACVA 1B8VA 4YALA 3MGCA 3F0TA 3JYQA 1UJNA 5EP4A 1U1EA 2P6RA 2K3UA 1ZKMA 3CRMA 1UC4B 2IYVA 1WD5A 2XA2A 4PO9A 3EXHB 5ESWA 5KSWB 1FFYA 3F67A 821PA 1G3IA 3LFTA 1LLFA 3FMPB 1E6EB 2NSLA 4HB4A 4L5BA 4DMHA 1NW9B 2OV3A 5JRDS 1JDSA 1YR8A 2QVBA 5JZBA 2ATEA 2FZGA 3SJZA 2L19A 1KHTA 1VHTA 4F84A 3IC5A 3WG9A 1UDBA 2BFPA 3ZV5A 2A1UB 1UDXA 2GF9A 2OGTA 2CD9A 1J8MF 2Q5HA 4OMFG 3CT4A 3K9BA 1L8QA 1Z5PA 4AG6A 4PIVA 4B45A 1T36B 4BFXA 3I5MA 1JRLA 4A8JC 2HLNA 2QUHA 3UWMA 3A70A 1NX9A 1RRGA 1JHAA 3CONA 5JJBA 4Q39A 1OTHA 1Z4LA 2P4EA 2RHCA 3QLVA 3UFBA 2QN3A 4X20A 5CJPA 4G65A 5I5GA 2O2IA 2Q4RA 2VFAA 5EE9A 3BINA 1BGWA 1H6CA 2OHVA 2YYAA 2G45B 2VSQA 3B85A 4W9EA 2X8JA 3T9MA 5G5HA 1X1RA 4XDZA 3DPIA 5BSHA 2BTNA 2Z09A 4JWTA 3M2TA 1XLVA 4A6PA 3W5BA 3KLMX 4R1QA 2BT4A 3CIRB 3ZD7A 1CZPA 2W11A 1X7GA 3FGNA 3RJMA 4POOA 4JJ4A 5D1NA 1UWVA 2DETA 3IV7A 1NBFC 3PDCA 2EW8A 5F3DA 3PPVA 2CE2X 2ZIGA 4NMMA 4TLBA 4FB4A 5CIQA 5JBIA 3W4KA 4KRFA 1EK1A 4CR8A 1DNPA 2HDHA 5KTSA 4OUDA 3U2SC 2IP2A 4NHEA 1QF6A 2HEIA 1Q20A 1YNTE 2A35A 1HBJA 1I5EA 1WKBA 2C58A 2GNOA 3AJ3A 4DQXA 3BGIA 2AGVA 3OUUA 4UREA 5EIAA 4HQ6A 4EMBA 4W5RA 1GZDA 1KR5A 3HI6A 3GDFA 2Q45A 4TLAA 3Q69A 2ZJ6A 3VOAA 3D6NB 3NVZA 4XGQA 4YVFA 1FC0A 4AJLA 1E3IA 1HE8A 4L4RA 2R8OA 1L5MA 4A8JB 5KOHA 4HDMA 5B7PA 4LHSA 5JZSA 4ANVA 4WXYB 2M0XA 3K9FC 4DEXA 2BM0A 4JJFA 4XQ0A 3UXYA 1K9VF 3ND8A 1D7AA 4U2KA 1G4UR 3L0WB 3IKLA 621PA 4BBAA 1DXYA 2GPYA 4TQ1A 1Q6ZA 2IDZA 2QEJC 3PKIA 4MS4A 1KI9A 2O2VA 3JAKB 4DMFA 4OU5A 3V8BA 5K8LA 4GBGA 4WNAA 4AWYB 1XRSB 2R8XA 4NMWA 3L4SO 1XNQB 4PBRA 4R1UA 4JS0A 4ZHOA 3WCQA 1O8BA 3IELA 4KBFA 4Q7JB 1NZDA 5A9RA 3FCUB 1MG4A 3T9FA 4UFNA 2YY5A 4D9KA 1LVUA 1SFRA 1H9CA 5EZ5A 2XDQB 3T7TA 4DN6A 2P5TB 3CZRA 1KQOA 5AI0A 3IQIX 1E2BA 1O94A 1YMVA 1LLDA 2PTGA 3FGZA 3BRWD 5I5EA 3FBWA 4N3AA 3D3EA 3ZR9A 4ZRPA 2Z56A 3OZUA 2J85A 5C3MA 5DNAA 1KF6B 2WINI 4BMPB 4EVIA 1JFFA 4UNRA 1HDYA 3BGVA 3GNTA 1R5JA 3LT2A 4RF4A 3Q8MA 2PUVA 2ZI4A 3HCAA 2O2HA 3PX2A 4GU5A 4ZRMA 4A0SA 4DGSA 3RC8A 5KNBA 1QP0A 1OI3A 1UEIA 1DRWA 1E8ZA 1Y4AE 3BEDA 3BYYB 1WW3A 3D9QX 5GTDA 2HA4A 2NZJA 4H35A 5HUJA 2JBAA 3ZHZA 2OO5A 2ZB2A 2VPXA 2OCDA 4NQRA 4C87A 2LRHA 5DGHA 2AFHB 2XMDA 5KTMA 3TJMA 2F00A 4BNGA 4DJDC 2DWQA 5EMKA 2OFPA 2FCAA 3TG8A 1M2FA 3IP1A 3ONFA 1QFMA 4DA9A 4GPBA 4A2CA 3R3YA 3LVQE 3NYWA 2OSBA 2YHAA 3LWNA 2LJIA 4FOSA 3MK31 1M1NA 2CGEA 1TYGB 2HT6A 4R71A 3CJRA 3LZDA 2MINB 3MERA 2IY1B 1ATZA 1MMFB 2OP1A 4Q82A 2FJ0A 4RLFA 1L5HA 4E21A 1T0JB 4K2AA 1V5IA 4PRKA 1IL0A 3PDHA 4M0UA 4U6SA 3D0QA 3B53X 1FMFA 2BFCA 3K9LA 2BMAA 4G1UC 3RS8A 1BC5A 3C48A 2MBEA 1M0SA 4ZO9A 5E6UA 2AZXA 3IEMA 1I9GA 4FFWA 4K9NA 5KNCD 4KX3A 1H0RA 1WSWA 2V6FA 4JQCA 4L7QA 4LV6A 3VPDA 1AUQA 2XK5A 2R1TA 2H54A 3O4HA 2G7ZA 1XQQA 4GLOA 4MDEA 5B1IA 3B1KA 2ZWAA 2BR5A 4C4ZA 5DF1A 1X7YB 1YOVB 3AF4A 2X0DA 1BXZA 1ZNYA 1L4HA 1K6XA 2WTAA 1KYWA 2IIPA 3O74A 1N2SA 4HWSA 3ZWWA 2JFUA 2XWJI 3PJFA 3SD7A 3UK6A 4C1BA 5E6PA 4XYBA 2WSSA 1COWD 3FMFA 4UTNA 1KO1A 1YQEA 2YZNA 3E4DA 5DHUA 4CT0A 1Q1AA 2VH2A 3CA8A 3MQFA 4LEIA 5TR9A 1USVA 4BTEA 4EY7A 3FLBA 2PS1A 5IYZB 1I4GA 4Y2TA 1GUFA 3HZZA 4DZZA 3AFHA 3UK0A 4G0UA 3DHBA 1QQ6A 1WF9A 3PR1A 1BWQA 2Q46A 1N0HA 3ZDDA 3NM6B 4K9LA 1FLAA 4KRYA 4P0QB 1FBNA 5C7IO 3ENWA 3NB0A 4UDXX 5FCDA 4I5DA 5FFMA 1Y33E 1ACLA 1MXHA 2CNBA 4F9GA 3KSRA 5AM1A 3QOFA 1EWQA 4PXSA 2ZRDA 1EJ6A 4KSLC 2QTZA 2W48A 2Z1NA 4F2GA 2QVXX 3BAZA 1GGEA 2GA8A 2NTSA 1YB4A 4QD3A 2NADA 4GYKA 4EEZA 2OECA 2YHIA 4MHSA 3OJXA 2FPGB 4ARSA 5ALQA 3K70B 4X6YA 2CVPA 3DFIA 4KIJA 1QR6A 4XCVA 1O7JA 1WUYA 4J7XA 4J16C 3EA4A 2H6EA 4NE9A 1VRWA 1AK9A 1WXGA 3NATA 1QIMA 5LMCA 4PLHA 3M4YA 2REQB 1E1MA 4NDNE 5IUJC 4PFJA 2B61A 1M1XB 2MP2B 1AXGA 2FUKA 2LTAA 4HLQB 4B33A 3ER8A 2HMWA 2YNTB 2V9CA 2GCOB 3HKEA 4AYWA 1BXGA 3FUTA 4F04A 2IYXA 4HI0E 2GGSA 4D6XA 5EH9A 1A9QA 4EFNA 1YRYE 1SNYA 4F8JA 1E3SA 4Q18A 4ALJA 3CMCO 2QS9A 4R1OA 1V7ZA 2NO9A 4JT2A 4GP6A 2PXCA 3D4OA 5ALLA 3X1DA 2EGHA 3EY4A 3QTLA 5AI9A 2OEPA 2D5AA 4XWAA 4TZBA 2G9ZA 2BGWA 3NAMA 3D7NA 2ZATA 1WPXA 3E81A 4QYIA 1D4BA 1E90A 1BU5A 3JSXA 4V0ME 5A62A 3TJPA 1I1OA 1CRLA 1ZX1A 2QTNA 3PLRA 4HH3C 1HH4A 1ZJJA 1A8PA 1BHSA 1RWXA 2R2QA 1OV6A 2PX2A 4D4JA 3ONEA 3TF5A 4PS7A 2NZEA 4BV2A 4OG2A 3ANSA 3PTZA 5EOVA 2VNAA 3U09A 3R3ZA 2P1RA 1XEFA 3IBTA 3L5KA 1CP2A 3EGIA 1WUTA 1RXSA 2YBEA 4EG3A 3X0DA 1P7PA 2YICA 2C20A 4PN3A 2QIOA 4JA0A 2OMKA 4G1MB 1QKKA 2KWDA 1WB5A 1O5OA 4I9GA 4CMEC 5MPOA 3AF0A 2XTAA 4FKZA 1XK7A 4XZ4A 3KNRA 1QFYA 2GVDC 2VHUA 3C7CB 3K9GA 3A0RB 3NU1A 1UGMA 4DWFA 3PA6A 5JC1A 3L4KA 4N9QA 1BMCA 2AQKA 2R00A 2HSJA 2PZLA 4FWBA 3X23A 2YZ2A 1W34A 4BVEA 1REQB 3CVOA 2VHYA 4MCHA 3PC2A 4MTCA 4RTPA 4EFLA 4C09A 3GQBA 3L8MA 4PZEA 4ZZ1A 3MA0A 3RRZA 5DNDA 5AKEA 1Y8ZA 3RD2A 2PCJA 2KK8A 2VG8A 1NULA 2OV4A 3KZOA 4DYVA 4ARUA 5MF6A 3IHTA 4JLUA 4YO7A 5DYGA 2JLWA 4RLSA 2Q0HA 4E5DA 3ROZA 4EZLA 2WD8A 4IJWA 1Z07A 3ZIMA 1HDEA 3Q0EA 1VE5A 1XZPA 3M4XA 3PNKA 1BMLC 5LMZA 3DTVD 3M49A 3QU4A 2ZIZA 1FNUA 2HO4A 1FFHA 2BZSA 1G21E 3S2AA 1MC8A 1G63A 1K88A 2XWPA 2YHBA 4UHBA 3TTVA 2ZSKA 4FCVA 3WRXC 1JRUA 4RNDB 4RC9A 2WYOA 3CW9A 3QA3E 2JLYA 3PFCA 3I13A 2DQZA 2UYHA 2YNVB 1C0EA 4DDKA 1TYAE 4C1DA 1DG1G 3EVGA 1OIVA 4UXIA 1J22A 1T1EA 1QOAA 2GLXA 1BDMA 3L0ZA 4E46A 3I1JA 3F6RA 1ADCA 2XOKA 1T6XA 3PL5A 3EFOB 3SGLA 3QRWA 3VPHA 1NM5C 3BEOA 1W4LA 3C3WA 3CPSA 1HPLA 1T43A 4WK2B 1N4AA 9LDTA 3CGWA 3GT4A 1A7AA 1T2FA 3A9VA 2O8FB 4MUJA 2QLMA 1G4AE 3DZBA 4CCSA 2FSIA 1D1TA 1P0MA 4XUEA 4GEGA 3TW8A 4IWQA 2NR2A 2RK3A 1DJOA 3H0CA 3HYNA 5J63A 3NRZA 1QF7A 3QVLA 4ND3A 4DIUA 3KAJA 3L7IA 5HM8A 1R5OA 2W2VA 2IZVB 4HCJA 4I1VA 4YGYA 3RRBA 1EUZA 3HWX1 3W78A 4YAOA 1N60A 4EENA 3VKHA 3UG6A 1Y3CE 3PZDA 1FNBA 3N6RA 4UJ5A 5C8ZA 3ZRFA 5SV2A 4WDRA 5K1ZA 4B4WA 3AECB 1VIMA 3I1IA 3DW1X 1BX1A 3BL5A 3UAGA 2XVXA 2Q4DA 4WFJA 5CDUA 4YECA 2HU8A 1L4BA 1XA3A 1TZKA 2RGRA 1QRDA 3KX2A 4UHJA 3SLRA 1SVSA 2BFEA 3QV1A 5KSYA 3PDIB 3JARA 1Z2EA 2AMJA 3N3BC 1GU7A 3ZBTA 2BBSA 3OEEA 4RQUA 3QBTA 4TUUA 4YJHB 3B1FA 4CE6A 5HKLA 5DU2A 4YUVA 4NQ2A 4WD6A 2WYMC 4MGKR 1U3TA 1IONA 2O0MA 2OJWA 3RCZA 4G3XA 1KSGA 4A27A 3ZCPA 2Z3ZA 4OQMA 3W9YA 4NBWA 4EAAA 5JOQA 5J1SB 5ACVA 1FY2A 3QUQA 2ZR9A 4FLFA 5TY0A 4J8PA 3GXBA 4MVJM 3HK0A 4FSDA 4MWSA 2ZUUA 4TL8A 5T64A 3NR2A 1FIQA 3RRFA 4YRIA 5CBKA 4LTMA 2MYNA 2QZ9A 2HDWA 3CVWA 2GZHA 3IE2A 4R54A 2ZVNA 4AZ0B 2PZGA 1JBQA 2XWSA 4PTLA 1FFAA 4KIKB 1F9AA 3HFSA 3WKEA 3EDRA 1NLYA 3WXMA 1MHPA 3HCFA 1LW6E 3DP7A 2AYXA 5K0JA 4CM1A 4G5HA 4XWGA 3EA6A 3KWLA 1Q95A 1UDWA 5MN5A 4UVIA 2YZ3A 3ITNA 3AY7A 3E15A 1DKPA 2O2ZA 1Y9DA 2WT9A 2Q3BA 2NBVB 2XMCA 3ZXXA 1VCOA 1EFRD 3ONDA 5I7WA 2DLCX 3TZ6A 3ZWMA 1U80A 1UQRA 4MP8A 4Y7DA 3M6XA 2IOYA 4KAAA 3Q5EA 2FIFA 3AJDA 3VFDA 2QQ5A 4RF5A 3BC1A 1FMTA 1JMVA 3HRKA 4KYIB 2QUJA 1NBMA 3WHKA 3G23A 4KR2A 1U2RA 4PHFA 1DQYA 3SS7X 4YBRA 4HH0A 1OFGA 1ZMRA 1RQPA 1DMSA 1UODA 3H86A 3O84A 3ONVA 3OY7A 3NT2A 3LPNA 4XX0B 2C84A 2VNKA 4GO1A 5I9IA 2GPTA 3OZDA 1V45E 2CXHA 3IKMB 3RK4A 1TJEA 4O4LF 1FRVA 1UBFA 1FYDA 2J6HA 4YSXB 2C5AA 1JE0A 4EELA 5ICGA 4ZT2A 1WLYA 4D3FA 4ZHQF 3U3JA 1X80A 1E3JA 4ID9A 1RCUA 4TXNA 3N39C 2YKGA 3I09A 5J4LA 4INPA 3VH1A 2OPBA 3O83A 1XI2A 3NW9A 3VOSA 4OHRA 1VPEA 3EUAA 2IGTA 3MSCA 4QPZA 4NENA 3WWZA 2WIKA 2DTDA 4KWIA 5CFLA 4LNOA 3O1HB 2QDSA 5EQDA 2GOWA 1U7DA 2WU8A 2IIVA 4ITVA 3TGWA 1S89A 2FX5A 4MQEB 3VPSA 4DL9A 2CG3A 1WKCA 1G60A 1UADA 1E4OA 3RPFC 3G1UA 1R6TA 1NRIA 2FZLA 5AI5A 4X54A 4DA7A 4U7DA 3AEDB 1IXSB 1XTUA 1NG9A 2JLCA 4IDCA 5D7GA 4MGKE 3KYCD 1WJGA 4U7TB 1RYHA 4CWAA 4LJKA 1UBRS 1VL0A 1Z7YA 3VZBA 4MRAA 2FDCA 3UK2A 2W2XA 1HOTA 2SNIE 3EXEB 4D44A 4FWIB 1CR0A 2AE1A 1JR6A 2XAUA 1FNVA 3PFWO 4H7JA 3WSTA 4MS1B 1PR1A 4EEKA 4Q02A 1OILA 5IAEA 3TQFA 4AC9A 2IO0B 4LZLA 3LQQA 5C4MA 5CB8A 5K8CA 4FR0A 5ALRA 5EXDA 1HT3A 4Z60A 3G68A 4AS3A 3EG5A 4EVRA 3H6NA 4OOFA 5EMLA 3GAZA 1FXSA 2WTXA 3QW4B 3TZHA 3F8WA 2FCSA 1TB4A 2V1UA 2VVTA 5DRYA 3IDZA 4DBZA 1OXSC 1RYZA 2BBWA 3UHAA 3OU6A 4JIOU 2AFHE 3WGUA 3I04A 5DSXA 1RWMA 3JYHA 2Q1TA 4AJ1A 5CDYA 4FT4A 2RHDA 1BS1A 1PJRA 3FBTA 3KQQA 3I8SA 3TUJC 1EFTA 2POQX 4KE8A 4DQUA 1CZNA 1H6BA 3OCZA 4LRTB 4XYMA 4WLOA 4LNKA 4ZCIA 5IAOA 4KSKC 5TQJA 3HJCA 3PUHA 5PNTA 3UJHA 5DEIA 2CUTA 4RABA 3HLKA 5BW5A 4JDPA 3W8EA 4D96A 3Q12A 3AONB 2W82A 1ZXLA 3AI7A 1XXHB 1DB3A 1P1IA 2DF8A 2QC8A 4FW8A 3W5UA 4CDNA 5J17A 4ZANA 3VU3A 4ALIA 2CXUA 3QWIA 4XJXA 2XCQA 4UBQA 3A6HA 2XDAA 1PV1A 4MKXA 2TRSB 5CTRC 1LRKA 3PZ8A 3UUWA 2XB6A 1U1DA 1UPFA 1Y6ZA 3ZDBA 1G8GA 1US8B 3I6MA 3QHAA 5FBRB 2BI4A 2QZ4A 1QYWA 4AUEA 2OLEA 1CQJB 2WIAA 5JI2E 1G8PA 1SCAA 2V5AA 2Z2XA 4M9RA 4F6HA 3JRXA 1NUSA 3U7RA 3R23A 1T2UA 3LC0A 4UVEA 1Z56C 3B9BA 3TR5A 3S2SA 1N0UA 4PSDA 4YMSA 1MIOB 3WGIA 1J1UA 2EFYA 4D80A 5IJZA 1Q7EA 3DE0X 3B36A 2ERCA 5ILOA 1XMOB 3L4BC 1Y63A 5T6BA 5GWXA 4MK4A 4QJ5A 2WXQA 2WNSA 4XQGA 3I2JA 2DLBA 4RPKA 3W9BA 2QP9X 4QSHA 3VDXA 2OHFA 3K70D 2HTHA 3S68A 1QQRA 3RKUA 5HFYA 4N8EA 4IMIB 2QTVA 3L6OO 4PFQA 5KQRA