3T3OA

Molecular basis for the recognition and cleavage of rna (cugg) by the bifunctional 5'-3' exo/endoribonuclease rnase j
Total Genus 162
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
162
sequence length
553
structure length
553
Chain Sequence
SQGGPQDHVEIIPLGGMGEIGKNITVFRFRDEIFVLDGGLAFPEEGMPGVDLLIPRVDYLIEHRHKIKAWVLTHGAEDHIGGLPFLLPMIFGKESPVPIYGARLTLGLLRGKLEEFGLRPGAFNLKEISPDDRIQVGRYFTLDLFRMTHSIPDNSGVVIRTPIGTIVHTGDFKLDPTPIDGKVSHLAKVAQAGAEGVLLLIADATNAERPGYTPSEMEIAKELDRVIGRAPGRVFVTTFASHIHRIQSVIWAAEKYGRKVAMEGRSMLKFSRIALELGYLKVKDRLYTLEEVKDLPDHQVLILATGSQGQPMSVLHRLAFEGHAKMAIKPGDTVILSSSPIPGNEEAVNRVINRLYALGAYVLYPPTYKVHASGHASQEELKLILNLTTPRFFLPWHGEVRHQMNFKWLAESMSRPPEKTLIGENGAVYRLTRETFEKVGEVPHGVLYVDGLGVGDITEEILADRRHMAEEGLVVITALAGEDPVVEVVSRGFVKAGERLLGEVRRMALEALKNGVREKKPLERIRDDIYYPVKKFLKKATGRDPMILPVVIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Metal dependent hydrolase
publication title Molecular Basis for the Recognition and Cleavage of RNA by the Bifunctional 5'-3' Exo/Endoribonuclease RNase J.
pubmed doi rcsb
source organism Thermus thermophilus hb27
molecule tags Hydrolase/rna
total genus 162
structure length 553
sequence length 553
ec nomenclature ec 3.-.-.-:
pdb deposition date 2011-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07521 RMMBL Zn-dependent metallo-hydrolase RNA specificity domain
A PF12706 Lactamase_B_2 Beta-lactamase superfamily domain
A PF17770 RNase_J_C Ribonuclease J C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.580 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3t3oA03
3.40.50.10710 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Metallo-hydrolase/oxidoreductase 3t3oA02
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 3t3oA01
5ACWA 4AD9A 4TYFA 4ZEJA 5HH5A 5HIQA 1MQOA 3DHCA 3A4YA 4FSBA 5ACRA 5KILA 4YSKA 5HIOA 3X30A 1JJEA 2GKLA 3ZNBA 2YNUA 2YNVB 2Y8AA 2WYMC 4EYLA 3T3NA 3RPCA 4TYTA 2BG8B 5ACQA 2AZ4A 2VW8A 4J5FA 4EY2A 4D1VA 3DHAA 4TZBA 5EWAA 3ZR9A 4GCWA 2NZEA 1VGNA 4D02A 2R2DA 5B15A 4UWPB 5LM6A 3PY5A 2HB9A 4XUKA 2NYPA 2BMIA 2Y87A 3PY6A 2YCBA 3RKKA 2UYXA 4C1DA 5A0VA 5EH9A 4Z5ZA 4XWWA 1DD6A 2WYLA 2YNTB 3SPUA 3Q6VA 3R2UA 2P4ZA 5ACVA 3H3EA 5K4NA 4ZO3A 1BVTA 3T3OA 3I11A 4O98A 4AX0B 1E5DA 3SW3A 5LCAA 4RAMA 4D1UA 3AF5A 5A0TA 4HL2A 4Z6XA 2FU9A 5K4KA 5HH4A 2ZNBA 2FHXA 4RBSA 1ZKPA 4Z7RA 1P9EA 1WUOA 1YCFA 1HLKA 1KR3A 4ZO2A 2BC2A 4NQ2A 5KIKA 3RKJA 2Q0IA 5FQBA 4C1FA 2FK6A 1XTOA 2YNWA 1K07A 2QEDA 3FAIA 5HIPA 5B3RA 2BFKA 3IEKA 2ZZIA 1DDKA 2I7VA 2QJSA 3BK1A 3IE2A 4GYUA 3WXCA 4NQ5A 4EYBA 3X2XA 1YCGA 1M2XA 5EVDA 3G1PA 3MD7A 2H6AA 4C09A 3KNSA 3VQZA 4EXYA 1DXKA 3BV6A 5FQAA 1A8TA 1SMLA 1QH5A 4V0HA 5EVKA 4BZ3A 2BFZA 2NXAA 3AJ3A 2BR6A 1Y44A 2QINA 3DHBA 3LVZA 5IQKA 3PG4A 2BG8A 2ZO4A 3X2YA 5LCFA 5HISA 4AX1B 2OHHA 5ACXA 5A87A 2P1EA 4LE6A 4RM5A 2QDTA 5B1UA 2FU8A 2Q42A 2BG6A 4NQ6A 2ZWRA 1WW1A 5AEBA 1JJTA 2YZ3A 4UWRB 2Q9UA 5LSCA 4HL1A 1ZTCA 2FU7A 1VMEA 2WRSA 3BK2A 1L9YA 4NQ4A 2I7TA 4D1WA 3VPEA 3IE1A 4FR7A 4TZ9A 1X8IA 5AXOA 2WHGA 5AHRA 3IDZA 1BC2A 4DIKA 2BG7A 3AF6A 4GYQA 4KEQA 3DH8A 4TZFA 4U4LA 4XWTA 5ACTA 2A7MA 3S0ZA 4ZNBA 5EV8A 3I0VA 4UWSB 3KL7A 2FHXB 2I7XA 4H0DA 2NZFA 2FU6A 4RAWA 4TZEA 4C1CA 2BTNA 4UWOB 4D1TA 1JT1A 5EVBA 4YSBA 5LMCA 5K0WA 2FM6A 4P62A 1X8GA 5DPXA 5EW0A 4UA4A 1WUPA 1KO2A 4J5HA 3BC2A 1KO3A 2AIOA 4WD6A 2DKFA 2CBNA 4F6HA 4KEPA 4F6ZA 1VJNA 2P18A 3IEMA 2YNVA 4UAMA 3I13A 5AHOA 3SD9A 2E7YA 5K4MA 2GFJA 2BFLA 3QH8A 2OHJA 2BFZB 2BG2A 4PVTA 2BGAA 2GMNA 3JXPA 2M5DA 1A7TA 2WYMA 3IOFA 4DILA 3KNRA 4FEKA 5LLDA 2OHIA 4AWZA 3IOGA 4C1HA 5LS3A 2DOOA 4YSLA 5ACSA 5LCHA 2BIBA 5HH6A 1X8HA 4Z5YA 2QDSA 3ZWFA 5AYAA 4JO0A 4EYFA 3SRXA 5FQCA 1ZNBA 3P2UA 2P97A 5EV6A 3TP9A 4HKYA 2YNTA 4RL0A 5A5ZA 2Q0JA 4EXSA 4C1GA 3F9OA 3FCZA 3IELA 1QH3A 2Y8BA 3ADRA 4RL2A 4CHLA 3ZQ4A 5LE1A 1YCHA 1BMCA 4UBQA 3ESHA 3T9MA 3X2ZA 3L6NA 3SBLA 2M5CA 2GFKA 5AXRA 4PVOA 1XM8A 4BP0A 1WRAA 5EHTA 5ACPA 4AWYB 3I14A 3SFPA 4C1EA 4Z60A 3IE0A 5ACUA 2XR1A 4EFZA 4B87A 3I15A 4Z67A 2GCUA 2XF4A
chains in the Genus database with same CATH superfamily
1CYDA 1DDOA 4BFYA 2QAIA 3QOYA 2L32A 3KVFB 3QPUA 5DMHA 1R6DA 1WB9A 3C8DA 3GGDA 4DCVA 3LDZE 3X30A 4QRDA 4OLAA 3JSVB 1F2RC 4KR2A 2IY1B 3NTOA 2NQTA 3WADA 3U52E 1KVSA 1CR0A 4KXUA 4F71A 3O21A 3HUDA 5A62A 5LU8A 4G86A 4C6SA 1E2QA 4RZSA 1JDUA 3U56A 2OLEA 4CM9A 4DG9A 2H2GA 4WESA 3EECA 3CNQS 1UWXA 3NTVA 1DTWB 3BVZA 1GJRA 3MVEA 3UJBA 1LBEA 1KVUA 4XWWA 1SJHD 1OFGA 2I2YA 3BH0A 4LDQA 2OGWA 1WD5A 1T0UA 2M17A 3ZRCA 4NECA 4EDHA 3LLVA 4AXXA 1FS5A 1AS2A 3AM4A 3T5DA 5CX4A 4EVRA 4ZALA 1NRJB 5GQSA 4JGIA 1C9YA 2G5GX 2X19A 1J70A 1Z0FA 2QTGA 3F4LA 5C4GB 2XQJA 3LSTA 2P2GA 3S5JA 3IR6A 2RE8A 1IULA 1ZIYA 4D4HA 1P60A 2RKOA 1HYQA 3IVRA 1CXZA 1PWXA 1Z63A 1HNZB 2NZ2A 3SJBA 2TMYA 2GZAA 5J23A 2SNIE 4ZT7A 4EI8A 3URYA 1RZVA 1C1HA 1MHTA 1JEEA 2RC6A 1O6GA 2JIZA 4IJUA 1TYGB 4NARA 1QCYA 3FZGA 4AROA 2NP7A 1PNTA 1WUTA 4Q9KA 2YHAA 3C3CA 3MM4A 4OLBA 3ELUA 4MW4A 2XCIA 4H18A 3ZDBA 2QUJA 2R11A 3OKPA 2WMNB 3C7DB 4IIJF 1NP3A 4YRIA 1BKDR 4WESB 3MUNA 2QMEA 1YB4A 3SFTA 3ZCPA 3RNEC 1SKMA 3ORYA 3EVFA 2CBZA 4KGTA 2C5HA 2HE7A 4UWRB 3B38A 1Z3CA 4EG1A 3U4AA 1EWCA 1C4CA 3IOBA 1ZW7A 1QIEA 1HY3A 3F1LA 1QORA 5IVPA 3EXEA 1JZSA 4NFSA 2GD1O 1HE4A 1AKQA 2LGXA 4ZHSA 1C9DB 2F3QA 2ZB2A 1VGVA 3GBPA 3ZWOA 1R37A 3KHKA 4FNGA 2X8WA 4KBYA 4E32A 4OP2A 5DHRA 2Q4EA 4KQHA 2EC5A 2BBWA 4J0CA 4XDHA 2Z58A 1Z6YA 4UFPA 3I3SR 3PNBA 3GPIA 3L49A 1LD3A 4CR7A 5A2QA 3LDGA 3KWMA 3U80A 5DIZA 3F98A 4JUIA 2VQDA 2XTMA 3G2KA 3U7IA 1I9CA 1N2EA 4ZCRA 5BR8B 1GL3A 3CSFA 3W1YA 1MV5A 4F6HA 3NHYA 1G8FA 2Q5EA 1VPVA 4QGBA 1T0HB 2QV7A 1TZJA 4CLEA 3FF1A 2BGNA 4QBFA 2ECFA 3ZYYX 1PFGA 4Y1GA 3CZMA 3KZOA 1G64A 1S89A 2N1VA 2BGAA 2ST1A 4DPKA 4UTPA 1T5XD 2INNE 1NVFA 2QE6A 3OPYI 3OHPA 1M0EA 2ZBEA 3N2YA 2I55A 1G3UA 1XJQA 1WCXA 5HUJA 2Z1DA 2IT1A 4M7PA 2VYND 1I0ZA 2QQEA 1N34B 3HU3A 3TP9A 3WIDA 1UPUA 1JWBD 4W8HA 3LPLA 3EXEB 3U9TA 1W36C 2Q0JA 3KJHA 4YXDB 1DJNA 2Z0EB 1BHSA 2K7FA 2I22A 4HTFA 3ZH9B 1XQ9A 3FMVA 1K08A 1MH9A 3UO8B 5A1JA 1NVVR 4UBQA 1HE5A 4TZ6A 3DMPA 5F35A 3U5TA 2QDFA 1HDIA 1GR1A 2CNOA 2NM0A 1A88A 4JQCA 3KSMA 2DUNA 1XAIA 4TMZA 2KSQA 1OUMA 1C7FA 3ELBA 3FLBA 5FH9A 3PHLA 3V97A 3B6JA 3E9ZA 5G40A 4MVJG 3WIEA 5CFRA 1QNFA 3D4OA 5JU6A 4LZPA 4NZPA 2POCA 4W9RA 3FUUA 2VL7A 3KYIB 4PLPA 1ZESA 4RNAA 1N0UA 4JNCA 2X8JB 2DAPA 3P4XA 1YKGA 3SBXA 2VHXA 1GLVA 1E2DA 4H3HB 2VZ8A 3LDFA 1B1AA 3E35A 2W6QA 3OY2A 3SGLA 2FIDA 4MW7A 3WAJA 1XZNA 5C7IO 1YR7A 1UBUS 1WMAA 1QQTA 4BNVA 1RJGA 1O5OA 1P4GA 1U1DA 5ALEA 2WG0A 1ZNQO 2GXAA 3HCDA 2IOQA 2C2MA 3IG3A 3O7MA 1UMBB 5IAAA 5EHXA 1AN8A 2QHOA 2N4FA 4HTFB 3CTPA 4Z4QA 3C8MA 4GZ6A 2NBVB 4LYAA 2BW2A 1PNOA 2KDBA 2HMAA 2BKXA 2BMJA 4HAUA 4J4HA 2IY7A 5A6VA 1S3IA 1QILA 5T4EA 1VZ2A 1O9HA 2AMJA 1Q1BA 1MVLA 1QIDA 3HI4A 1WNFA 1X8KA 2IGTA 3ZCTA 5L83A 3VNUA 3WSVA 1HDRA 2QP3A 4DWFA 2RFLA 1EVIA 2ADMA 2JHPA 1B0AA 4Y9RA 2XUFA 3KNSA 3KOYA 2UZ0A 3A9RA 4M8NE 3IQXA 3LB8C 2GOYA 5JYDA 3GFFA 4KV2A 3UMMA 1MO5A 4FWBA 5FOTA 1Y56A 4PVDA 3TL3A 3OFND 1TAGA 3FNRA 1KZ6A 3WLPA 1HEYA 3ZN2A 2MHJA 2WU8A 1L5FA 1EF1A 1YI0A 2GEVA 2CXXA 2FWNA 3FVWA 3BDIA 2X9QA 4OF4A 4KE7A 1ICIA 4LN1A 4ASWC 1OGYA 2JVJA 4C1NA 3HP7A 4GEGA 2DULA 1VHJA 3X1WA 4NNJA 2IA5A 2I4TA 1VOTA 5KQGA 4F6RA 1NJSA 4MJXA 1N3BA 1S2GA 5COAA 4XX0B 2Q8PA 2WIFA 4RTNA 2ZDGA 3A2LA 3Q6NA 2WKRA 3DQVA 2KVZA 2MCNB 1VGQA 1S2MA 2W6NA 4DJFC 3DE7X 2DG2A 2C8JA 1COWD 1DQSA 2ZR7A 4U8GA 2HDNB 1HV8A 1EUQA 2Q3FA 1BW9A 4ZVNA 1TVCA 4KJXA 4BGEA 4N47A 1EB9A 1WUHS 3HCCA 1G8GA 3O95A 2ZCCA 2Q3EA 4DMMA 2UKDA 1XKTA 3NHBA 2PM8A 4UAMA 4OJTA 2L19A 3L0OA 1FS4A 3N2EA 4K81B 2D0IA 3OF2A 3GE8C 1RVDA 1L5OA 3S2SA 3L1IA 4G1UC 5HGXA 4XUCA 2XZTA 1NQUA 3HHEA 1GOZA 3G2NA 3PQFA 4K9QA 4HLEA 1R64A 1ZAKA 4H6PA 5IEJA 1ZNBA 1LFAA 4EB0A 3QYAA 4DNPA 2YY5A 3H9UA 3D6VA 4MI6A 4Z2AA 3NBYC 1AHNA 3QSYA 1F6WA 2QM8A 3GJRA 4F6RB 3PUWA 3RLIA 5LDGA 1KI8A 1YL7A 1GAJA 2J31A 3F5FA 3X3HA 2GFKA 1FFAA 1RI4A 4HAWA 1FMLA 3TCKA 5TR9A 2A5FA 4Q05A 3C14C 1KYWA 2Q3JA 3K8OE 1BW9B 4PWZA 2Z4SA 3MHPA 4Z1MA 4P3YA 2OKCA 3IUYA 4TVKA 2BMVA 4MH8A 3APDA 4KDIC 2HMTA 2ONCA 4L51A 1SE9A 2Q46A 1AVTA 2N7EA 4MIOA 1VDVA 4OW0A 1L5LA 4OSEA 1GPAA 3CVYA 1DQZA 3QPDA 4ZHQF 5HZKA 1UZXB 1BCSB 3HL4A 5K3CA 3MNFA 1V3TA 2BG8B 5EXPA 1FNBA 3V2GA 4BNYA 4F6LA 5A6SB 4Y2TA 2FWRA 4RDHA 1FSGA 3GJZA 4O25A 4U0KA 4JY7A 4DJAA 5FA8A 3WLRA 4FXPA 3VC7A 3AN1A 4I1PA 2WWTA 1V8FA 3AOEC 3IAS6 1RNLA 4JQSA 3FJYA 4D57A 4M4SA 5AESA 4ITVA 3A33B 2O3UA 1UJ4A 1WQ1R 5G0WA 1ZUHA 5G0TA 5K4KA 4KKVA 4ND6A 2MSCB 2N9XA 4G0XA 3QHQA 5EMJA 2ZRNA 3C5EA 3BGIA 3HUUA 4G8DA 1JG1A 4F97A 4US0R 3E81A 5HCIA 3QE4A 1T6YA 1M6EX 2J7QB 4BTEA 4UREA 2FMKA 5KNCA 2NUBA 1V9CA 2DMRA 4X66B 4MAAA 4HLDA 4HXFB 3NHPA 5E1DA 3RFCA 4BKMA 4JI2B 2ERXA 3INRA 3PWZA 3I2IA 4RABA 5ECDA 3HNRA 3G2LA 4PX2A 1WIAA 4ETIA 5IQKA 5K3OA 3EIFA 1E5LA 3BXEA 4NQLB 5LZ2A 5BNWA 3TQQA 4XD7D 1I4PA 1AMNA 2CKHB 5DHUA 4EITA 2OC9A 3UH1A 1PJ8A 1SWWA 3HCEA 3OT5A 4J0GA 3KB8A 3L5OA 5C23A 3P2JA 4OL9A 1JDBC 3WJ7A 4YT5A 3AIKA 1E3TA 2KMMA 3LCRA 1J5EB 3M1YA 2FU7A 2PJUA 3I9FA 3K1ZA 3MIZA 2EP5A 1GRQA 2XOKA 2OY0A 5GGYA 1HDYA 2J3JA 2P11A 3M63B 3IEVA 2CG3A 2EGUA 1OH8A 3RSSA 2OBMA 3TBLD 2BWFA 3NHZA 2WTAA 2YEPF 3H84A 5AD1A 3RVNA 1PUIA 1NR5A 3UPTA 4KKJA 4IRMA 3IO5A 1PFQA 3ISTA 2JKVA 5EVCA 1IBRA 3A14A 2QYHA 3KSUA 2I8AA 4AUEA 2WT4A 3A9UA 3RC3A 5IKOA 2ZUEA 1KDZA 1KFEB 1XYYA 3DS8A 5EKXA 1M34A 1GG8A 4ENQA 1P0CA 1XU4A 3PEWA 1IUNA 1JEJA 1J8QA 3E9EA 5C7YA 4K6HA 3NYWA 1XA4A 3RZWC 4B4OA 2QPLA 3W3AD 2WJZB 1ZN7A 4ZO4A 2E4UA 4V0ME 5J5VA 3P9XA 3Q8XB 3RKUA 3UTCA 3Q88A 3IOFA 1QVAA 2HR1A 4WEOA 1U4SA 4LAFA 2BCGY 3BFXA 3DDOA 1US8B 2H18A 2BMWA 2M2IA 3PUKA 4JB2A 1SOWA 4ZAXA 1HBJA 1EESA 3ONFA 3WA7A 2MMGA 3QCAA 3AJ9A 2R8OA 3D6NB 1XZEA 3WIVA 2ON6A 4G5GA 1FSPA 1GUZA 3NOOA 2IHJA 5J4HA 4LYJA 2ZBPA 1DXHA 2VG8A 2IYYA 1I1NA 2ZWVA 3VDNB 4AY5A 5K7SA 1KLVA 4MUNA 3CUKA 4LX0A 3KBBA 1BKYA 3L6NA 5AR1A 4II2A 1GHTA 2V58A 2CLSA 4BNJA 1Y5LA 3U5ZB 2PRYA 2LUEA 1YR3A 2XD4A 2O3SA 1Y4ZA 4ZIRA 5FOUA 3I9OA 2H07A 5EJGA 4LNOA 1VI6A 3BFPA 5C52B 2C4HA 2HA3A 1KK0A 2GAAA 1NY6A 1KA9H 1M34B 4ZZ1A 2Q5QA 3C6ZA 3V1UA 1HT2E 4Z3KA 3VZDA 4CIWA 1V47A 4RE6A 1SD2A 3NPMA 1Z18A 3LBHA 4HWTA 2MOKA 3GFVA 2BS3B 4KPUA 3ZDFA 1DFGA 8ATCA 1QRAA 2NV2B 2VWPA 3AG5A 4Y0AA 3CE6A 3E8SA 3ENWA 2HCBA 1XAJA 2BDTA 1U3TA 1SCJA 1LF5A 1V6SA 3PSAA 2FQYA 2BUAA 2PW9A 3ZY4A 3AJAA 4CN9A 2WSLA 4D0GA 2J3KA 1RYFA 1RZ3A 4KFSA 1RQNA 1AA6A 4DLZA 1TKRA 4EI9A 2XB8A 3VFKA 2YCBA 1NJ5A 4N41A 2WM3A 1G6HA 1QBGA 4MEBA 4GC5A 4L22A 4TM8A 1I42A 1V5FA 4ER0A 2CLEB 2Y1EA 4ARUA 3AETA 1JBKA 5KAPA 5D86A 5EXSA 2JAWA 4D0RA 3Q7SA 2IHUA 4HNAA 3W5UA 2W8BA 4AYTA 3T5GA 2PX3A 2FMUA 1E4VA 5J4YA 4II2B 2VRBA 3RVOA 2ARKA 1WUOA 3TTXA 1K7SN 3TNLA 1YO6A 2NPOA 4ZKEA 4G1MB 3QU5A 4CM7A 1EJ0A 2GFIA 1VLVA 3CPSA 2QUBA 2Q3LA 2H4YA 2V6JA 2R6DA 4U5QA 4BYGA 4GX1A 1QYRA 2XRYA 1VLZA 3JQBC 1VKOA 3EVZA 4RJ2A 4HDQB 4ZV4A 2CUNA 1QP4A 1MO4A 4DLLA 4KPUB 2J85A 2KJRA 2IH4A 1T36A 1Z5OA 2NVOA 4YP5A 1NJ2A 2OYCA 2GOWA 4A82A 2OQVA 4CV2A 2N3ZA 4Y9TA 4DV0B 1RM0A 2NN3C 4B83A 1FF9A 5FI1B 3V9PA 2CJFA 2FHSA 3OUZA 1PK7A 3LBAA 5KQPA 1Z74A 3CH4B 2DZMA 1UPFA 2BM1A 4NE7A 3ONDA 4CODB 2WXKA 4C89A 3RSLA 4MVYA 3FNEA 3AV0B 3AETB 3D1VA 2Z2XA 5JAQA 4RPJA 1NIPA 1IN4A 3C4JA 3W5UB 1OGWA 3MC1A 2W8BB 1P91A 1VXRA 4G0QA 3C5VA 1THTA 5KDLA 1C1XA 1WRIA 3DT6A 3G2QA 1ZLYA 4LJPB 5EP1A 4GMHA 1GGKA 5P21A 4K6GA 4QYTA 3OM1A 2WM8A 1QLBB 5BYSA 4JMLA 5H3CA 4IL5A 2WM9B 1X9HA 1AGYA 1CCWA 4J6FA 1PJAA 1BDHA 5KYXA 3WYEA 3RULA 2CYBA 1WIWA 1V49A 1P2SA 4BP1A 5AK5A 4GB9A 4GPTA 2J08A 1VJNA 4WERA 1RXCA 4R5MA 4LCJA 1P9OA 5AHOA 3TRHA 1JIXA 2GFJA 1JIQA 3E15A 5JECA 1HTTA 1OXSC 4O6VA 3HU5A 2HLHA 1JYSA 5LBIA 1T36B 1Z2EA 3Q7RA 1CR1A 1S7GA 2FUNB 3CR8A 4EY8A 4K03A 1Q83A 1NL3A 4IDIA 3WK8A 5LS3A 2KWCA 4F84A 2DOOA 2XA9A 4NLLA 2BSQA 1DEOA 1R8QA 2VIIA 2VYNA 1MV8A 1DX6A 3OIVA 5DJ5A 1JG3A 3VSEA 3LJ3A 2GYVA 3WYFA 4B4UA 1FQKA 2DFPA 1Z0JA 4RH1A 3LCCA 1RLOA 2C04A 2ZT5A 1ZL0A 6ABPA 3LO8A 2Q2QA 3AO0B 3GLUA 4MJ3A 1FMJA 4RGQA 5CDGA 1JSXA 3WSWA 1GTMA 2DAFA 2IP4A 2AMVA 2G09A 3FYCA 3OLQA 1DV2A 2LVOA 1MRNA 2QZSA 1TXGA 3G0HA 1Q0RA 2WOJA 3QSGA 2OV6A 1C1XB 3RK1A 5EJIA 4D80A 3E3AA 3QFHA 3ZHUA 3HMKA 5ALQA 4BY9E 4IX9A 3PWSA 4PN3A 2RR9A 3IDFA 4IYJA 5MFZA 4ENRA 2ORED 3EIWA 4AJJA 1D07A 1QDEA 4Q3EA 3KWFA 5FULA 4BU1A 2QN7A 3QE0A 5FRDA 3M1IA 4UU0A 3EPRA 1K51A 2MINA 3CQ9A 1DKOA 4P4TA 4B81A 5CDFE 1JU3A 3L43A 4ABYA 3M33A 4D1VA 2PKRA 1AXGA 3I1YA 2RPVA 3UMRA 1BAPA 4PONA 16PKA 3FE2A 2VHCA 1W94A 3AV3A 3KO8A 1DADA 3H9QA 4CCAA 4HXDA 2Z5VA 1OMOA 1BN7A 3FLMA 3VJMA 3E2IA 3W1SC 1SOMA 3PI7A 1FXSA 5D3DA 1GFIA 5F7ZA 4QHTA 3ESBA 3BQNB 4RZUA 4O4JA 2BHSA 2XMQA 4I50F 4MLCA 2ZETA 2PSFA 3IXLA 4MHOA 1EX6A 1SZCA 4W9EA 1R12A 5CMLA 3KZKA 4Z4CA 1D4ZA 4GXRA 1PL7A 4I6JA 4GXBA 2M1XA 4RAMA 4LGCA 7MHTA 2E49A 5K8LA 2ACWA 1O5TA 1OLOA 3JQ9C 3T1OA 4MP8A 1XMIA 3P4RB 2DRIA 1KOFA 2BC2A 3ET4A 2W3SA 2QTZA 4MICA 3KYDD 3U3OA 1F8FA 1MKYA 3ZEAA 4MYRA 1WGDA 1ZAYA 2QRGA 4B6PA 1JFFB 1BA2A 3H04A 5ADVA 2WMYA 2JC3A 2QRJA 1SSNA 3G1PA 4EGSA 4V0KA 3INGA 5M7EA 3OFNA 2G67A 1LDNA 4M9UA 2MINB 2VQSA 4B3XA 4YQFA 1AGPA 5BO5A 2PY6A 1G3IA 3WLFA 1WZ2A 1R18A 1SQ5A 2YXLA 2UZ1A 3CINA 1D4AA 4AX1B 5GONF 4YCLA 1YI8A 2WAOA 4GYYA 4ZGBA 1EFKA 4UVDA 1F8XA 1T3GA 4Q19A 4E07A 4RM5A 2YHEA 2HI0A 1CEXA 4IG7B 4DCGA 1NLMA 1ORTA 4D4KA 1XPRA 4FFVA 2HXSA 3E5HA 1TJ4A 4UHDA 4LNUB 3VYTB 1GQFA 1L7DA 4Z4HA 4O4JB 1MTZA 2QUIA 3SOPA 1M74A 3IDZA 2I99A 3EWIA 3TB4A 3W2EA 4JIGA 1OFUA 1PTJA 3B20A 2H5IA 3Q5GA 2OGSA 1H0HA 1SXTA 2RGRA 4AKGA 4AN0A 4A20A 3PZ7A 2HJSA 4A3OA 4PTZA 2QUKA 3RNAC 2XAAA 1COWA 1I7NA 5FR6A 1XMQB 1YNTE 3PR1A 4LJKA 4CL2A 4QQKA 2XGGA 4TS3A 5DYNA 4NZLB 1C4XA 2QSUA 2J32A 4EHFA 2R96A 3ZX4A 3DKKA 3A1WA 3NBQA 4AKIA 3ZDXB 1X8JA 1KMCA 1UC4B 4PGAA 3MOGA 1R8JA 2WYWA 1TK3A 2Z4TA 4Y98A 2ZIXA 1VFPA 1JA0A 3OD5A 2VRNA 1L0XB 4QGSA 3VR5D 4JLBA 1CY7A 3N0VA 4OPMA 4WFKA 5F9FA 1VRAB 4ODIA 4BL5A 4UAUA 1YBAA 1WX9A 2F67A 4G24A 5K45A 3AINA 5ALYA 1D2EA 2Z98A 2UZ1B 2QMYA 3MERA 4EJSC 4E4YA 4BO7A 1K5PA 3DBSA 2D5BA 2XAUA 1MJHA 2BDEA 3HCOA 4C4VA 1V5IA 1IVYA 3BWXA 3RODA 2DQYA 2GEDA 4GPD1 2MH7A 4AX8A 1E96A 4CL0A 3TRFA 1OD6A 3P4QB 3RSOA 4BHTA 1S01A 1EWRA 1CJCA 3VYWA 3B0AA 3ZS8A 4Y2YA 4IDFA 1WMBA 1WWTA 3SF0A 5K6RA 2VQ3A 4O5AA 6NULA 1ACLA 5MDHA 2I4MA 3QW2A 3KUZA 4NYJR 2REQB 2I2WA 5JD3A 2N46A 4RVCA 4Q15A 1QFJA 3TOXA 2O23A 3O4HA 3W90A 1URPA 4LY6A 2OFFA 3OG5A 1IY8A 3K09C 1GGVA 4OK6A 4Z6KA 1CZOA 3PHBE 4RCZA 4HAIA 3BL8A 3A4LA 3H19A 1H22A 3L4BA 1HMPA 2ZIXB 2MSWA 3RD2A 3IAHA 3VPSA 2ZRAA 1P81A 2W43A 1HTQA 4UEWA 2IYWA 3FTFA 1EP2B 3WL4A 2GKLA 2PU5A 4K05A 1KH0A 1PHRA 2JCYA 4RS4A 3MWKA 1D9ZA 2C94A 1QF6A 4RPCA 1QR2A 1TJEA 4RH0A 3QJZA 3FVQA 4P7GA 1XMVA 4KG7A 3D9QX 4U7HA 2EZ8A 3K9FC 4RAQA 2OHOA 3AVPA 3ZQKA 1LBSA 5E2IA 3UMYA 2BR5A 3R76A 1USVA 4L8WB 3AVTA 2NQ2C 2YWDA 2X3UA 4KX6B 3Q7TA 8LDHA 2C5LC 2HB6A 4C4VB 2DZJA 1HL7A 1PT7A 5FHQA 4DQKA 5KWVA 4INJA 2EHJA 2GO1A 3MTQA 1IBLB 1GNQA 2DLDA 2IIBA 1BG6A 2RHLA 1BUIC 3VPFA 3HUTA 2VK8A 1RQGA 1MAAA 4KNWA 3AR4A 4IXDA 3LP8A 3EUAA 2OGTA 2ECPA 2ABWA 1BH6A 4GRAA 1H2YA 1IDN1 2GBMA 3A0RB 1QANA 3EZ7A 1E3MA 1RLMA 1EZ4A 3N2ZB 1FDOA 1NTOA 1L5HA 2FWPA 1RJ9A 1AQIA 2QRUA 3KPYA 5KHQA 4ZOLA 4AECA 5EVDA 3P9CA 3M9LA 4RGTA 2H0QA 5BW4A 5FQAA 1KE2A 1KHTA 1Z6TA 4HB4A 4XD7A 1JHOA 3JQ8A 1CUEA 2PKOA 4JUFA 3U2SC 1J06A 2Q49A 4HPXB 3LO5A 4YTMB 2FSVA 1NF3A 4YIKA 2BFFA 3P0FA 2Z9DA 2A4MA 2WZCA 4R2KA 1G9SA 1LW7A 3FYSA 2K1FA 1P9NA 5EZYF 4A16A 4O0LA 1UK8A 5BN5A 4YCJA 1I4XA 4MCJA 3KSAC 1WW1A 4DZRA 4AIRA 1ECPA 3AERB 2YZ3A 1U9ZA 2HK9A 4DCJA 1GPNA 1W1WA 5B7GA 3HNOA 3P7MA 5ITZA 4Z3DA 4JE3B 1TLFA 3BULA 5IKEA 2H1OA 1JIUA 5JNWA 3ND5A 3LTEA 3MT0A 5G3YA 1Y8RC 4YLGA 4RIIA 1OZGA 2QU8A 2IYQA 4ZO7A 1AURA 4PS0A 1U2QA 1L4HA 3LQ2A 3VPBA 1C41A 2C96A 1LUAA 3H5RA 2JJYA 3B6IA 4FOSA 1YOBA 4M54A 4IS2A 4URUR 3A1EA 1T1JA 4XZ3A 1ZU5A 3ZU3A 3I23A 3H9BA 1CFZA 3QELA 1CJUC 1VDMA 1C7IA 1ZYUA 1L5HB 4HJRA 4DLAA 1WUPA 4KXXA 1Y7IA 2GUGA 4DLWA 1YTUA 1M6WA 3Q0EA 3W3AA 2GBCA 1FLVA 2V4ZA 3H97A 5FI0B 1WXXA 1DOIA 4AT1A 4Y30A 1E7VA 4B1FA 1YZUA 3QFTA 5JI2E 2PUGA 2RB5A 1VGRA 3V4LA 5EQDA 2NXWA 5LZ4A 4YRAA 4CEJA 3GJYA 2P6NA 1I8TA 5C37A 3ZBUA 4E31A 4LJYA 3OESA 4Q9JA 5E6NA 2BFFB 1XX6A 4JX1C 4CXMA 5HH6A 4FCCA 3SZUA 3S81A 3KPUA 5BN5B 1W1IA 3SC6A 4C3UA 2G4DB 1ELOA 4PZLA 1NBHA 2PIDA 3LQRA 1PU2A 2ZRJA 1X1BA 1R0YA 4L3WA 5ITZB 1PD1A 2BY4A 2XIQA 3QHAA 3RZFA 4N6EB 3ETDA 3FI9A 1YE3A 2ZAMA 4BQIA 4CHLA 4PQYA 3QW4B 5CLIA 4JDPA 4JXJA 1Z8HA 3GQBA 3GT3A 3QVJA 3Q9UA 3QELB 4JC5A 2PQ0A 4JVNA 1X7YA 2XOEA 1E0JA 4KQ6A 1A04A 5K0FA 5LYYA 4RFLA 4CKCA 4LDAA 4R3DA 1YBVA 1V96A 5KWSA 2WICA 3G5MA 4ZRNA 1FJXA 1UEJA 4HUTA 1OQRA 4ZP1A 1EWKA 1ZPDA 2AEFA 5HE8A 2GS9A 3RREA 5L3SA 1SU4A 2Z56A 4F4FA 5HJ5A 4CEJB 4DV7B 4CL3A 1IYZA 4F45A 2I6UA 2A2ZA 1X92A 1FE8A 3X1DA 2WQ7A 3N2IA 4J3OD 1JLSA 3HDGA 2DFNA 2B4AA 2C82A 2V3NA 3GZNA 3HCNA 3P4PB 1LPOA 5BO4B 1UAAA 3IYLW 3BSWA 4NX2A 2P9HA 3C41J 5TMDA 2NAPA 3E9NA 2XEDA 1P2DA 1LQ2A 2ZRQA 4FWTA 3JYLA 4KR3A 1PR5A 3V9AA 1YFKA 1TQ2A 1Z7GA 5KJ6A 1FNDA 1VLLA 2A5UA 4QQFA 3QVGA 1XGKA 1XJWA 3PUIA 2YWHA 1YN3A 1CUJA 4MCAA 3HI6A 1ZCAA 3NTLA 3SEQA 3STUA 1WXWA 2J30A 4JITA 2HWYA 3GQBB 5FCDA 3H9CA 4I5GA 4OVZA 5H8WA 3UI3A 1KPHA 2BF4A 2GQ0A 3I45A 2ECOA 4UD6A 4BJ1A 1X7YB 1JBEA 2ZJ1A 3VNSA 2O52A 1E0AA 3LWBA 3IUQA 4CKCB 1DL5A 1SBZA 3IEKA 1M2JA 4DBGA 3MJTA 3IFSA 1N3IA 1IJBA 3HB4X 1E6CA 2PXXA 2F8TA 1JEAA 3TOCA 4V2UA 1C4PA 1ZM7A 4EW6A 1SMLA 5L3SB 3MMSA 2KWUB 4J2OA 4ENPA 1EQUA 3B3AA 3UG7A 2PCJA 1EE2A 2PZGA 1P7FA 3QARA 5I6DA 5H92C 3QLTA 4JJFA 2PLAA 4WAAA 3RG8A 521PA 3BIID 3TNYA 2H2AA 3ZE1B 1X15A 3GZNB 4NQ6A 2DYBA 4YP1A 2WAYA 3KSZO 2O05A 2HT1A 1PJRA 1K66A 3QENA 4CBVA 1E2JA 4TL8A 4YRDA 3IBFA 2W2PA 4DYHA 5DASA 1O9GA 4ZQIA 2VK4A 5FTWA 3ZDDA 1P1IA 5HKLA 3BKXA 1U0EA 5IVKA 2GPBA 2GBNA 1TUGA 1FOEB 2GJ8A 1ZH2A 2HRCA 4IUBS 3HCAA 2CJNA 2PZEA 3SC3A 1IM5A 3T12A 3T99A 2PPHA 2FM6A 1SC1A 4JGHB 1P73A 3ZHRA 5AVXA 4XUDA 4KRXA 5K9ZA 3IKMB 3KVVA 3UAOA 1KO2A 2O7NA 5CAEA 3M3DA 1V25A 1ODSA 4HEA1 1EK2A 1ORDA 1M8PA 4X92A 1UC5B 3PQ8A 2VDQB 2EP8A 4E09A 2GAIA 4HL6A 2C4UA 1DQRA 3M34A 4CMIA 2UXDB 4PQGA 1ZSYA 1SXQA 4TSRA 2D5CA 5GOTA 4OU4A 1XXGA 3DBLI 2RKBA 4QTXA 1CF4A 2EQBA 4ZOCA 2N1WA 4I55F 1V9SA 7MDHA 1U7WA 3TEFA 3PQEA 1P44A 2H1VA 3O8OA 2D3TA 3EPLA 5CLJA 2MJLA 4C2BA 4YPFA 2V8BA 3PE6A 4AO7A 2Y71A 4BAXA 5FR2A 4HKQA 1YXMA 3AEZA 5HZGA 3MD0A 4G8CA 4IIEA 4OI2A 4QNRA 3OKCA 3L54A 3I1IA 1T1RA 1DMSA 1UXOA 3OQOA 3ME5A 1JHMA 3TIIA 3UHJA 1F1BA 4KQXA 3ZLUA 1TIPA 2NOAA 2YN0A 4FLEA 1J19A 1QG2A 3DMTA 3WLOA 4KO2S 3R8FA 4RENA 4MQEA 4GZ5A 2PS0A 2KWIA 2D5AA 4XGQA 4E21A 4LLGM 4D81A 4MWGA 4BMSA 4ICUA 3CKLA 2G63A 5CAEB 2A7QA 4ND1A 2ZJDA 4FX2A 5ALJA 3SEZA 4R7GA 1SQ6A 2FEMA 2B82A 1RHJA 3RFTA 4CMIB 1KY2A 5GVSA 3H5WA 4ANVA 3ADKA 1GZHB 1A5AB 3KPVA 4BP3A 5C8XA 5DCLA 2VYVD 2PLPA 4N48A 3D3QA 4ISCA 5JPCA 4TLDA 4ZCPA 1NN3A 2R7LA 3ICPA 3MTJA 1M5RA 2YH2A 4F5DA 2O8NA 4N5NA 3CT4A 2QN1A 1QK4A 3O8OB 2IZZA 1PUJA 3CZRA 2AG0A 3ZXUB 1BX0A 4ETMA 5CVJA 3NNNA 3ISJA 4HYTA 3ASZA 5EEGA 2JLWA 4LRQA 3AE5B 1OA0A 3OZRA 3AE7B 1YVUA 4QIHA 4OKSA 3I11A 1WOYA 4UFNA 4F8CB 2B7CA 2B1GA 4NAUA 4B85A 3QTLA 2HWWA 2I2CA 2IGHA 3U7ZA 4B3DA 2WY2D 3KYDA 3OC6A 1NBFC 1UH6A 1R8YA 1N2CE 3Q3CA 4MQEB 4YNBA 4AYWA 1U0BB 4FC6A 1UCFA 1N7IA 1L8XA 3K8QA 2QN8A 2KB0A 1IG0A 3CVUA 3TVTA 5KU7A 4TRJA 3FOAA 3BYYB 4PR0A 1RACA 5A5GA 4GVPA 1CRPA 3GROA 2ODNA 2WUFA 3F78A 4US1R 4C87A 4GLSC 4KWIA 4TV8F 4CLOA 3TZKA 2X8JA 3USES 3G0OA 2GKSA 5AHXA 3N1UA 1M1XB 4YP0A 4OH1A 1AYFA 4YRJA 2J0QA 1HEUA 2XZOA 2CXUA 3QVKA 2O2ZA 1DC4A 5JATA 4LDPA 1AK9A 1YDHA 3GG9A 3W8RA 4L23A 2ZZNA 4YT4A 4XE0A 4ZICA 4EA7A 1T8SA 3MSXA 4AS3A 2BEUA 3W4IA 4LTUA 4E74A 2HUPA 2PFGA 3N75A 3M3PA 1QFYA 2ASEA 3T7SA 3FRJA 1O57A 3NVWA 4KZCA 1NVDA 3H17A 2EELA 4MW9A 1UMBA 1YQQA 2XK5B 2Y67A 1QQ5A 1L5YA 5DI9A 4OJYA 3VGJA 3TR5A 4OO3A 1G6OA 5FPHA 2CNBA 3KYDB 4OSOA 1PQ4A 3TZQA 4ANUA 3TH5A 4U9UA 3R6DA 4EA8A 2HHJA 2XCTB 4BFTA 3VR5A 1GA1A 2PRIA 1ZK0A 2D1FA 4OGWA 7AT1A 3EEYA 2FETA 3JU3A 3QOWA 1CJVC 4ZXPA 1ZD4A 4L9AA 2FFAA 4UVEA 4F6ZA 2C0QA 4IWQA 3CZ5A 1E20A 2P68A 3FTNA 3I13A 2HTME 5L53A 2PMFA 4CLOB 5JEEA 3KQWA 1XQYA 4G0OA 3N9IA 2PVGC 4IIHA 2RHJA 2SKCA 3T3EA 3WB2A 3C1UA 3NEJA 2WSMA 3RFXA 1SEBD 1MPXA 3QBJA 2GKGA 5I01A 3N0XA 3PHIA 4H0FA 1Q3KA 1J20A 5K03A 3DTYA 3CLUC 3JAKA 4JO0A 2BEUB 3IEUA 5K4GA 3LHKA 4TTPA 1DZ3A 1W9MA 4ALNA 4I1UA 1WVGA 5L6LB 3OICA 1S3GA 4DY4A 1BNCA 2C7BA 3ECIA 3H2KA 4UXIA 3HFRA 2GN0A 2J52A 2OT3B 4NYIQ 2EIXA 4I4TA 4KL8S 5IM4A 2R2AA 3CJQA 4M1QA 3GT0A 3UICA 4XX0A 3UJ6A 2FPUA 2ILTA 3AF1A 3CWZA 5CEFA 1Q92A 1MX5A 4JBLA 2WLBA 1KHHA 1PEKE 1VFNA 5F3DA 1EDEA 3DWIA 3UKDA 2CW5A 4UTOA 1MO6A 2MT9A 2JRLA 7ADHA 3RNLA 1EFTA 1FYFA 4DJDC 1E1KA 2ZRFA 4OG2A 1E92A 3NR2A 4EFKA 4ZTZB 4L07A 5H59A 1DPGA 3V8VA 3BILA 2ZB8A 2B0JA 4D45A 3H9EO 1J97A 2O8VA 2YZNA 3FH0A 3FW1A 4AKSA 1IOWA 4DSZA 2J6IA 4MA4A 2K22A 3BN3A 3CIFA 4NCXA 2WKQA 4CT4B 2BUBA 4JJ7A 4K81A 4M8NA 5AUKA 3TJMA 2K2WA 4M0MA 3NCHA 1YN5A 3FPCA 3ZPXA 4YACA 5AVSA 4YDQA 2WWGA 3SJCA 4MUHA 4B48A 3JAKB 1QHYA 3RBZA 1NR7A 4GKBA 2EFYA 2Q6KA 1E94E 2AOTA 1WAMA 3OBIA 3GVXA 1E3WA 1CY8A 4QOSA 2N9EB 1EGHA 2R6JA 4JZYA 4I4TB 4KWHA 3SIRA 2DC1A 1I5OA 1DTSA 2DQ4A 4E3ZA 5EL0A 2YHIA 4Q3AA 1PTKA 2J87A 3DLIA 6ADHA 2IOFK 2P0EA 1NDDA 4DXAA 1WJGA 4RD6A 3ZIAD 1W59A 4C1FA 4C0JA 2WWYA 3F96A 3JYOA 4YROA 3UOGA 3HYCA 1KRWA 4HS9A 3RAFC 1Q15A 4O4LF 3P2YA 3QLVC 2DTEA 5IDQA 2VAVA 2EDCA 2Z0DB 4X8MA 4Y6QA 3LBFA 2RHRA 2ZJOA 4WLVA 1J39A 2CE2X 3CF2A 5JS2A 4YALA 5A9RA 4FKBA 5C51B 3SQLA 1BCSA 1NJ8A 2D0DA 3V3KA 2EVWX 5J2TA 1M8FA 2BG8A 1TCUA 3X2YA 1VPLA 3UY4A 4S0XA 5A6SA 2B37A 3ESRA 2M1ZA 2WKPA 1G6JA 3HM3A 2GMWA 3D5QA 3BMNA 3F3MA 1KFCB 4B5LA 2I2AA 2QMTA 5FEUA 5FOVA 2Q4OA 1BOOA 5EIAA 1AZWA 4N5HX 5A5FA 3JWEA 3Q72A 4LWOA 3IS3A 3G8AA 5LXTF 821PA 1P7ZA 1VBKA 5AJWA 2EBFX 3A0UA 3WMRA 4NQ4A 1XD9A 3TTTA 2D2IA 3VPEA 2AOTB 1QPBA 5ALHA 4AMBA 1A69A 5FUBA 1E3WB 2XUIA 4WN9A 1QB7A 3HRIA 1C7RA 3WHPA 3M6UA 2IYSA 5J4KA 2IPKD 1L3IA 3PEVA 3K5IA 4JKOA 1T0BA 4CHTA 2KC2A 2YHIB 2FMHA 3UXYA 1K6JA 2Y3IA 1NG1A 2OVFA 3L3BA 2IV3A 3BWYA 3OOWA 3I30X 3UAZA 4KAJA 4DXAB 2LZ0A 3AFMA 5IANA 4JI8B 5ADUS 3VRAB 4PDXA 4XOIA 3TCXB 3I3TB 1ZRNA 3FAKA 2VC2B 2IZ7A 5WRFA 1SVOA 1Q7EA 1VYVA 4A0GA 3TLEA 4JR2A 5CNMA 2IZ1A 4YJ2F 4EJFA 2RGDA 5DLPA 1IN5A 1RZUA 4RF4A 1ZVKA 2B76B 5EZQA 2C1EA 1L1RA 5J2TB 3SJUA 4MO2A 4KB5A 1V8BA 4ZK2A 3WALA 3LAWA 5DPWA 4EGQA 5KYGA 1E69A 2AQ1B 2E3TA 2G70A 3BMNB 1IXYA 4Q16A 3DMDA 3EODA 3QBVA 4KLCA 4AQ7A 1GA6A 1TFRA 1WGKA 5A5VA 3FWKA 2LCQA 5JMWA 3ST7A 1GSOA 1RBZA 1M66A 3U3KA 2H7CA 2CG2A 1SIOA 1T2EA 4HQOA 2GK3A 4X45A 3DVNU 4NBTA 4WN9B 1XLNA 2V7WA 1S4MA 2QG9A 5CIWA 4POOA 2OWEA 3TLGA 4PLYA 1UXHA 4PAWA 2KTRA 4OBEA 1AQ6A 4LF7B 3QEOA 4QD3A 4DYDA 3LUCA 5JZMA 4KSLC 3B1YA 3SOZA 1NW4A 5L7TA 1NE2A 2JD2A 2Y0EA 3HYLA 1A9TA 3OIGA 4O33A 4Q93A 3CVVA 1XDSA 4ZVOA 3DB1A 3IP8A 1KWGA 3W34A 2W2NA 4EVQA 2ZUSA 2C4WA 2I29A 2FN8A 5ALWA 5FUMA 1QYDA 2XZPA 3GYBA 1SIWA 2CFTA 1SZJG 4P82A 4YAOA 3NEYA 3EDOA 1DUIA 1XZBA 4E7PA 1RPZA 4GIBA 1HDXA 1YR9A 3HO1A 3KPWA 1LPNA 1JFLA 1XZFA 2W83A 2JI9A 3WQHA 1QYXA 4BNLA 2TECE 3ZR9A 4GI1A 4R8LA 1EMDA 2VUTA 4NV1A 4DMCA 5SZIA 2FCQA 1J9ZA 2XY4A 1US8A 4H16A 3ZH2A 1U9JA 3E9YA 2H4JA 5CBPA 4NXMB 1E8ZA 3K72B 2QW8A 3HR7A 3T5MA 3KLPX 5I7SA 4IX1A 1ZD8A 4RGYA 4Y2SA 3BXZA 3JARA 2R2QA 4RGMA 1QRTA 1ZJ5A 1ZCJA 1E5DA 4RWZA 2OCKA 3B36A 5A2GA 4C01A 3WGJA 4PG7A 2I54A 4WLNA 3TLGB 3GA5A 4O1MA 2KTRB 3UENA 3ZDEA 2FBWB 4DXHA 4A7PA 3WMFA 3CU5A 1YTLA 4JQWC 4D3ZA 2GK6A 4DMRA 4R1TA 2OXFA 4A23A 3LCVB 2Z2YA 2F1RA 4HH1A 4E12A 2PWYA 2QBYA 1Z15A 1QOGA 2Y76A 3NTQA 5DBFA 2K3UA 5C0OE 1I2AA 3BCHA 4B6FA 4FOOA 4QOEA 1Y4UA 2QK4A 3T54A 5AW2A 3U2QA 5EXXA 1GZ3A 4JBIA 4NJEA 1E6KA 3IBEA 3DDZX 2CXTA 2DP4E 1SBHA 3MS4A 1I7HA 4KODA 3JR7A 1WCIA 2PUCA 1NQVA 3C7KA 3PIRA 2W2LD 4F2GA 4A2WA 4N8DA 1M5TA 2QN3A 4LRUA 1OHHD 4ZYTA 3WSTA 3OX2A 1OA1A 1XDUA 5J58A 1L4NA 4EH1A 4V0MA 1OLXA 5C3JB 3C24A 3MQ4A 4DF3A 1XJ0A 4O2BF 1HH4A 5CBPB 3EQ6A 4IPTA 4RVFA 2NSHA 1JKMA 4ONEA 1IRXA 4DC0A 2VH1A 5BV7A 3C15C 4FR7A 4GMFA 4U9IS 2J6HA 1E64A 3JARB 3D8NA 3GFBA 4AB1A 2YWRA 5NLLA 3FWHA 2BG7A 1SOUA 1PS8A 5ALIA 1SF0A 4PLWA 1B26A 4MDEA 1HDCA 4N6GA 1C0KA 3EIEA 2YVQA 2D4AA 4PQRA 3N32A 4DR5B 4FZ3A 2DWUA 4ZNBA 5EE3A 3IP7A 4UE6A 3DMRA 5B1IA 4A5OA 1VG8A 3AVVA 2WSBA 4WJZA 4M1ZA 4TZEA 1CNFA 3ICEA 1DGQA 1H4SA 4GXQA 4C88A 2QBYB 1AWDA 2IEYA 3NBKA 2WJIA 2FOLA 1X0VA 3U48A 3EMKA 2EKLA 3NFRA 3MWEB 2WMDA 2ZIZA 4INPA 2CS4A 1YZFA 2MR5A 4K9PA 1AKVA 4JC0A 4ESOA 4XLTA 1SVKA 3ZDMC 3I6BA 4NJEB 1WW2A 1OJ7A 3CNOA 3UH0A 3LK6A 4HDQA 4TZKA 5KOHA 1WCIB 1ULAA 3WIOA 4IRXA 1R10A 4GSWA 4K7UA 3HEBA 1IEXA 1U2EA 3JQGA 3L0ZA 2C5BA 1E6WA 3N5KA 1ECJA 2XE6A 2IUTA 4K8RB 4HDNA 5IKPA 1JVNA 4UD2A 1OLXB 1FRFS 1SUAA 2JA1A 2AKEA 2AGVA 4I7EA 4NTZA 5KQLA 3U26A 3MUEA 5BT8A 1X9IA 2OBFA 2YNTA 1X8LA 4KLZA 4PC2A 5IFLA 4EL5A 1KEVA 1ZCFA 2VPTA 2NYRA 1BX3A 5AI4A 2UV8A 1WXIA 1ZM2A 1VKJA 1ZM4A 2PWBA 3RGWS 4EF5A 3VRBB 5KYVA 3GP5A 5JDCC 1U65A 2C77A 2PR7A 4YAUA 3HY4A 1JMYA 1AO0A 1R8XA 2A9PA 1QFZA 1KU6A 2XSZD 1IEQA 1WMHA 3OMWA 5BSVA 4IAOA 1PFWA 3AU5A 3U4EG 2JBAA 3K0BA 4P2BA 4TLCA 2AJLI 1IJKA 4DANA 4M87A 3GF4A 1AHPA 4I1VA 3NDPA 3CW9A 4BB5A 3BE6A 1RRCA 1UOQA 1Z47A 1F2TA 1KKUA 1TYDE 1Z0KA 3W78A 4Z4FA 2EMTA 2V3CC 4I3FA 2VYVA 2XA2A 2IEBA 4UBMA 1T9BA 2WABA 2GCNA 3TMYA 2C0CA 1PBTA 2ZRHA 1V6AA 4BFSA 5KOHB 5IXJA 2JHGA 4WWPA 4UHFA 1YVEI 1Z68A 1UFKA 2X9LA 3GD7A 2CSUA 2R0QC 3QXGA 3JQGB 1DEXA 3EISA 5HRAA 1VSUA 4U00A 5TS3A 3VJKA 3T06B 1G7RA 1DIGA 4HDNB 4P3PA 1Y1QA 5ARBA 5B2ZA 4XUKA 3VC2A 1AG9A 3KH0A 2OCLA 2BKUA 2ZYHA 5BRAA 5AIBA 1SC6A 2YNTB 3GU3A 2PXHA 2VRRB 4U7WA 3PPWA 3ZNNA 1ZM9A 3GH3A 1F17A 4M53A 3D2AA 4EZIA 3FTCA 1I2MA 2ZJYA 1HQDA 4ESHA 4HNUA 4X44A 4EMTA 3WGIA 2G9HD 4G67A 1R0RE 2EJUA 2GPWA 3W5AA 3MFYA 4PXSA 1MFPA 4J6EA 1JF8A 1WMHB 3ABVB 1CT9A 2B2NA 2EYUA 1XHLA 3SZMA 2JBAB 2OTCA 3M9XA 2PK3A 1Z62A 5C5IA 5T8IA 4JL5A 4IW3B 3LX4A 2XUZA 4BNXA 2QTWB 3L79A 5AM4A 3UC9A 4F8EA 4W9LA 3I6YA 4BUCA 1F2TB 5CTRC 5AKXA 3FZNA 5EJ2A 1ZBQA 5LM3A 2YMPA 3EHDA 5TQ0A 2MCFA 2Q0XA 3OJEA 4FGSA 3UFXA 4RM8A 3S2FA 5JSUA 3WB0A 3C19A 1RWXA 3SPXA 2Y9PB 2OV2A 1AB6A 4KSKC 4HO1X 1N3YA 2EBWA 4I4IA 3CSDA 1C0LA 3AWIA 2N1BA 2VBFA 1RYNA 2Y92A 4XM2A 1Z83A 2YHUA 1RC8A 3EMDA 2JQRB 3U4MA 1QO7A 4BYMA 1I35A 2QMHA 5HG0A 1L5WA 4OB7A 2HH9A 3DULA 1H5UA 2WRSA 4F3RA 3AR9A 3OWHA 3UGBB 1HLPA 4C80A 3RNOA 5DWQA 4KEQA 3NRCA 1N1GA 3EIUA 3N28A 1LJUA 4N7MA 2FW7A 5IU6A 1R5JA 3HCWA 1UP4A 1J2TA 4N7RA 1U7XA 4GSKA 1UKZA 4AOFA 1JSLA 4W9HA 1ZSVA 1NZFA 3MILA 4EKIA 1F77A 3E82A 3K35A 2ZCUA 1GG9A 4NU0A 1WSBA 4JUBA 1YR2A 5TXGA 4KJZA 1YIOA 5LOVF 1QPZA 4ESVA 1JFFA 3V4SA 3DO6A 3HKBA 5H4GA 4FVTA 5IT5A 5TQ0B 2YNVA 1ZE3D 3VSAA 3LYAA 1XUOA 4ZRPA 3UFXB 4WJOA 1R15A 2PQ6A 1O6BA 1NGSA 4GECA 3AT1A 3EGDA 1CIVA 3JQEA 5EUQB 1OV6A 2IYPA 3GP7A 4XEHA 1IDOA 4C1HA 3MCVA 4ZOHC 3KEQA 4DEYA 4AJHA 4DFDA 4LI3X 3NASA 2GLXA 3T94A 5CDFA 2WF8A 3IUNA 2WXMA 1XU7A 5KHOA 1H4RA 5ED0A 2HHCA 5ECWA 4PM4A 3ZZMA 3VZBA 3K0SA 4YH1A 2RK6A 3LK7A 3VVCA 4A0FA 1Z7EA 4LNUA 3PQCA 4M83A 4D74A 2ON8A 1P4SA 3DHNA 1OAOA 1BGWA 1H2ZA 5D85A 4RL2A 1QHIA 4X7BA 1NX9A 1IE3A 4RGVA 4JWUC 3ESHA 3WGMA 1WKVA 4HH4A 1AKUA 3IDOA 3VQIA 3HFGA 3GDOA 5JSFA 3ABRB 4U7PB 4YAEA 5BMVF 3Q8FA 3PDWA 4RE5A 4XIGS 1VP9A 1D5ZC 4GM1A 5TF4A 2C5GA 4FEEA 4PLCA 1X39A 4KPFC 4HAYA 1QF9A 4HBZA 1NJ1A 3GJSA 5EMLA 5KS2A 1Z73A 3HNPA 1ZD3A 1E2MA 3BIXA 4ZT5A 4GQBA 4ECEA 1PQWA 3HKBB 2E37A 5D2CA 3V3XA 1TECE 4EWLA 2VT3A 3TTSA 2YNVB 4ZZ2A 1ONPA 2WT8A 4TYTA 1MQAA 2HKIA 3HKDA 4B7UA 5ERGB 1NYTA 2PZLA 4KVAA 2VBGA 3PFHA 1B16A 4QUDA 4NFHA 2LNDA 4I6EA 3EGDB 3LFUA 1QOBA 2NX2A 3UOWA 4P5DA 3WNZA 2KZRA 3TFOA 1O0BA 5FWXA 4DIBA 1RKXA 2XLBA 3KOUA 3CMMA 1BEEA 4K9MA 4Y6GB 4HB0A 4OM8A 2JRIB 4YAGA 3F2VA 1ESNA 3DMNA 3K96A 4GVLA 1RQPA 4M7OA 3FROA 4ZYSA 4LJAA 2AL7A 3SPUA 5GMOA 3KG2A 2XUAA 1TS3A 3A3YA 1F4LA 1NUQA 4MA5A 2Z04A 3ITEA 3H87A 1VCBA 2N47A 4A0RA 2QQ0A 1V1MB 3ZWPA 4Z6XA 2V03A 2REQA 2FPOA 5FXMA 3Q2IA 4J1SA 2ZBUA 3ZIAA 2WWWA 1Y6QA 3FDIA 5JOQA 2I3AA 3MFQA 4TRRA 3V2HA 1IXSB 3RNBC 2CXPA 1MGOA 2M32A 1UINA 3RTAA 2Z6QA 4QELA 3JWJA 4QNMA 3TYXA 3FCXA 3PP8A 3F97A 3AFHA 2FJ0A 2I7VA 2A9FA 1LBIA 2OEPA 1UBRS 2Q1SA 1TEXA 1NXWA 1ADYA 5E8RA 3WB9A 2BONA 2VP4A 4G5SA 3GGGA 4ER5A 4DCTA 2PBZA 2KMLA 3KAPA 1OT3A 5C80A 1W7AA 1UDWA 3HKDB 2HZBA 2V7TA 4RY9A 1Y9JA 4OKNA 3V60A 3IAFA 3DZCA 2P9QA 2V6IA 4ER6A 5FWXB 4M37A 4GOMD 2PUWA 4Q3OA 3CMMB 2PMBA 4E1AA 4W5RA 4JI7B 3AI5A 4YRNA 2IXAA 1Q77A 1V5WA 2F4VB 1F6BA 1E9CA 3L6BA 5IAAC 3X1KA 1ZINA 2I1VB 2JCXA 3NOBA 4HX9A 2RGAA 4HHEA 4N12A 1NSTA 4OXKA 3G8BA 1YQGA 1GB4A 1H2XA 5B1SA 1BC2A 3RS2A 5JYEA 3IMFA 4JI6B 1GFZA 4UM8B 5E6PA 1XWWA 4E5YA 3UPDA 4TTVA 3TBFA 4EFDA 4US2R 2F59A 3GUHA 1YZLA 2IXFA 2UZ3A 3GEIA 1NMXA 5F4BA 1MA3A 4YRSA 2MHCA 4RJJA 1WB6A 1G8HA 1W73A 4Q9HA 4JBYA 5ERXA 2JFBA 2A5JA 3IPAA 4G1FA 4KUGA 4RORA 3JRNA 3WK4A 4X3CA 5JAZA 4R1OA 2XGJA 3N2LA 4UCWA 3PQ7A 3HYTA 2Q41A 2O0HA 1D7AA 4NE2A 2FPLA 4CHKA 3O03A 4IQFA 5IUJC 1KF0A 5K05A 3M1AA 3EVDA 1GL6A 3F6PA 5IAOA 4LE2A 2EW2A 5B36A 3ZCRA 1AS3A 2KS6A 2Z2JA 3IOGA 1LXDA 4GRIA 4RF0A 3VXKA 4WGFA 2O2YA 5EE1A 4ZEXA 5A4MS 3BFJA 3AERA 4DG5A 1XNJA 1JTEA 3HVRA 2R5FA 4Q3NA 1YB5A 1UQTA 5LB2A 1VPDA 3AHJA 1Y6JA 2Z09A 4P1BC 4HY3A 2CXNA 5EJ8A 4KI7A 4BNTA 5GXGB 4EG5A 5C1OA 2Z95A 4EPXA 1C3XA 1ZIPA 4QLAA 5HOEA 4MEMA 2BFEB 4AO8A 5REQA 1NNSA 3KZXA 4R69A 1PX0A 3A6LA 2JEYA 3P4UA 1C9MA 1LLFA 3A6GA 3CFYA 4XGAB 4G5HA 2XKKA 5CW1A 3AHFA 3IULA 1ZD1A 2Q0QA 4XDDA 4LBVA 3KX2A 2XQGA 1XEWX 2QYOA 4EY6A 1WGYA 1XKXA 3TNJA 1IN7A 1VHQA 1L4ZB 2RGNA 4L72A 4LE0A 2E6KA 3ACDA 4GPAA 1AF4A 1W25A 2XLCA 1ISFA 1JPJA 1LSOA 3OM9A 4LF6B 5KU1A 1KLUD 4MACA 4W5NA 2C8KA 2H5EA 2DH5A 2RH8A 2HCTA 5CIQA 3A9CA 1UPBA 3LPNA 2IYXA 5A4DA 3RKKA 2C7PA 2CJYA 2BR3A 2VWQA 3TZHA 4TYNA 2JKZA 1LX7A 4ZZ3A 1G63A 5D3MA 4BQEA 3AEKA 3WCQA 2CDCA 5CCDA 3ZNHB 4PAOA 3VU9B 4HBGA 3K70D 2GN4A 1CUBA 2NUAA 1DJMA 3AF5A 4UCFA 2P9CA 4L5CA 2ZTUA 4MGYE 3SI7A 3U81A 4YHHB 3W9BA 2OV1A 4URYR 3EQ7A 3BD8A 5KNBD 1T6BX 4MI9A 3LY9A 2A8YA 5REQB 1HT0A 5LA6F 3SEAA 1R3DA 2PVSA 4IV5A 3SZGA 1R8SA 1KBOA 2WE7A 1O08A 2GZRA 1WCYA 4WBNA 2EX1A 5A3RA 4BNKA 5DCNA 4AG5A 1XVUA 4ZDVA 4RXTA 3KVYA 4ZJPA 2RGXA 4W8GA 4QA9A 3K9HA 4H1VA 2WXNA 2W2LA 3V6LA 2WP9B 3FZEA 1OHHA 2V0GA 3PCRB 1CDZA 3UWKA 1VL8A 1H3EA 4FZ5A 1XRLA 1FVFA 3WIMA 2AK2A 5CX1B 5JXWA 3E5RA 4OMUA 5AZHA 2WU1A 2WKWA 3I5JC 2WDPA 2W70A 4KQIA 3PHJA 5FJJA 2J3EA 2LGDA 3KJEA 2BBTA 4BEVA 3F71A 1VJTA 4E03A 3THOA 1KGDA 3RRBA 4MQUA 5I3ZA 3PR2B 4KAAA 4ZARA 2HSWA 3KEFA 1XU9A 4UBOA 1NJ6A 4B5KA 5A06A 5KVCA 1X8IA 4IDDA 5B7PA 4V1CA 1B1ZA 5D3MB 3LBIA 1VZ8A 2I2FA 3EEBA 3AEKB 5CNJA 5F73A 3RIXA 5F78A 4CNQA 3ZNID 1M2WA 1P3QU 2OYSA 1SBCA 1KERA 2NUAB 5H9WA 2QIOA 3S0ZA 3PNMA 4J4TA 4YMUA 3N2KA 4CFYA 2BTEA 3T5TA 4NJ6A 1WUIS 4C7ZA 1YCDA 2IP1A 5LZ8A 3VNBA 2VRWA 4BFCA 5BYRA 4LDTD 3HB9A 3KCQA 4DSUA 5DGDA 3RTBA 3OZXA 4JSRA 2WRZA 3EZ2A 4UZSA 1KSJA 4GMXA 4MIEA 2D2QA 3D32A 2POQX 4WBNB 3PIDA 4D9KA 4H3VA 2V3SA 4FJ2A 2WLTA 1DIBA 1V1JA 4IMPA 4IWXA 3ZDAA 2AOWA 2OCBA 5AVZA 1OYVA 3R4CA 4F21A 1H0KA 2IPXA 3JQFA 1KK1A 2HCRA 2IYLD 4LPKA 1JP7A 2HLPA 3EJ6A 3T5BA 3B51X 3PZDA 4QG7A 5LLDA 1GZUA 3I5XA 3R2IA 2XEWA 2UZAA 1UGMA 2AYZA 2DF8A 1QV7A 1N5OX 1G8KA 4K6CA 2B92A 2IVZA 1T4GA 3SRXA 3DHGC 1JMKC 5EV6A 3IKVA 4US8A 2EWMA 2F64A 4OMDA 3V6EB 2OZVA 3NQ41 4CM5A 4V1CB 2RHMA 4TM7A 5KSPA 1SGWA 4KH1A 2XSZA 5DNDA 2IPOA 4UAVA 1YE5A 3N2KB 2EJVA 2J9FB 2XYRA 4UZEA 3AE2B 1FFSA 3G1WA 5BV1A 5TPWA 2QRQA 3R0QA 2CF5A 4AC9A 5EGSA 1FNUA 4Z4IA 1DCTA 3HY6A 2IYUA 2IH2A 2CNWD 3DONA 1UD7A 1W5AA 4OGLA 1MXHA 3DYVA 4MR8A 4TMWA 1FTSA 2XUDA 3ETHA 4FOPA 1LVGA 4RULA 4XX5A 3NZSA 1GTVA 5JJIA 2V55B 1PLKA 1VMAA 3RPCA 1B14A 2R6R1 2BFOA 4JASB 5F5LA 1QWOA 4UBJA 3DEYX 3VTUA 4EHHA 3Q3EA 2RGEA 1I4LD 4RVDA 1E9VA 3R9KA 3N0RA 1CK1A 5FPQA 2ZBGA 1X6VA 3U3MA 1ZD9A 3NH9A 3DBVO 1LNSA 2Y6VA 2DYOA 4YI3A 4HVCA 1KYVA 5TDHA 4QAYA 5GP1A 4M89A 2L83A 2FLKA 5GOZA 2G08A 3UMCA 5BW8A 1QOPB 4CN8A 3BHJA 3PQ4A 3GCZA 5AM5A 3DAPA 3AY6A 1UDBA 1WOMA 2QTCA 3N86A 3WRYC 1HWYA 5T5QA 4CQMD 5EYPB 1JDPA 3JW0X 4K46A 4CMEA 3KT3A 5IT0A 3ZQJA 2Z9BA 3O4RA 5TPWB 4OREX 5KEIA 1L9KA 4K1RB 4NQ2A 3U7FB 3SYLA 2WXOA 3KNZA 4PSAA 3C3EA 1E90A 3CUEF 3U37A 1XZHA 5BSGA 2Y0BA 1X1QA 4MR8B 3GJ7A 1D2NA 2X5OA 1W4ZA 1U1IA 5JISA 1F0ZA 4B43A 2AA3A 4QGHA 4OMCA 3ZE2B 4RTQA 3OZDA 4Q9NA 4QJ5A 3F5SA 3RR2A 2HBQA 2GBGA 3DXXA 2X15A 1SG6A 4EOYA 5K0CA 3FGOA 5JQGA 1SQ0A 1KKMA 1HE3A 1N7HA 3GIDA 2LASA 2SBTA 2YYZA 2C7VA 2G45B 3F3SA 1MDBA 3JQPA 3HJTA 3GJQA 5SZKB 3LCMA 5DT2A 4ZV9A 3P9NA 2UYOA 2H1LA 5JJBA 1QFSA 5H68A 1LTQA 4D8YA 2WDZA 2R66A 3Q14C 4B8ZA 4Q03A 4M9ZA 2PH1A 1W52X 2Y5CA 2K5UA 4KN6A 3ZJ5A 3HPQA 2IW1A 3TLYA 1DQYA 5KB3A 3CGGA 4TZFA 4PYMA 4WAFA 2C2WA 3ADDA 3F5MA 4GF5A 5IJAA 3E7PA 3L8EA 2IDMA 3BF7A 5K8UA 4ZEVA 4NMXB 2X1VA 1PAUA 1UEIA 5CT9A 1PLJA 2P41A 2VUHB 1HXHA 2J42A 2JWUA 2NG1A 4BX8A 1DBQA 1ZH6A 4NCIA 1QGZA 4CT0A 2ZI6A 4G5OA 2RDBC 2WXJA 1QGED 3AEXA 3PPVA 2BKRB 5DX1A 2RJNA 3O4VA 1RXUA 4JYPA 3GUVA 2V9CA 1XLUA 4B47A 4HVAA 4ENSA 1NFQA 2PD3A 3QOFA 5DB4A 3D7SA 4ROTA 1E0ZA 1DKQA 1N0VC 2W5UA 2PBLA 2MBQA 5LQUA 5JQGB 4B6SA 3VHTC 3GR6A 5G0SA 2PO5A 4TTTS 3GEEA 4QAQA 3IKTA 3JZIA 1N7GA 4LWQA 3KQTA 2WTNA 1Z7BA 3LT0A 3T4EA 4MV0A 3M5WA 1KVRA 3TQHA 2OAEA 3H2GA 1R50A 5F64A 3C6XA 4WK2B 3GS2A 3GX1A 4C3OB 4DIEA 1HMYA 3K94A 2O8CB 3U4QA 1HKHA 3I8SA 4M49A 1CYEA 3WNCA 4HWSA 2XK5A 1FYVA 2X77A 2GI4A 4H7HA 4JI4B 2DR0A 3IQFA 2HNAA 2DCMA 2CXRA 5INTA 1HYGA 3OZIA 4AM8A 1FLDA 1UPCA 2I2BA 5ACUA 2IOHA 5DM60 2P9YA 1Q6YA 5T57A 3ZU6A 1RYYA 3VISA 1U3FA 3QVVA 1T9CA 1N2CA 3CRZA 4AW9A 2GEFA 2QYTA 4YT2A 4XASA 3OZBA 2EFCB 3G9XA 3EB9A 1IN6A 4F46A 2AX3A 5ALNA 3MC8A 1NRWA 4RVGA 2IWRA 3J9CA 2ZRPA 3M5CA 1JPNA 1ZUWA 1H1TA 5ESDA 4NFLA 3L4SO 2V9ZA 1YMVA 4JVSB 1L7RA 4D82A 2HB9A 4A1FA 4BX9A 4WZAE 1U7HA 4BV2A 1U7OA 4O4IF 3TUZC 2NYVA 3PF9A 1Z56C 3BL6A 1LVUA 2CMDA 3U4QB 5DM2A 3R3JA 2CHWA 5BSEA 1KK2A 2M19A 1E8MA 4D1UA 3LLUA 3UT5B 3LL7A 5CYFA 3WAMA 1WJUA 1WM3A 4R3UC 4WLEA 3UPUA 1W4CA 1PJSA 1P0FA 2P5UA 5DTQA 5JZ9A 1RRFA 4Y2UA 1Q0WB 1N2HA 1LWOA 4R9SA 1RRGA 1ZN9A 5JW6A 2MU1A 2D1RA 4OQMA 1A5TA 3EFBA 2V4MA 2FUKA 2FPMA 5KVSA 1N2CB 4ZCTA 4OQDA 4NIMA 1CQXA 2A57A 2OXTA 4EG4A 2Z5LA 4R2JA 3VPHA 2VS1A 1U81A 4PAGA 2VDVE 5C1IA 2KX3A 1OFHA 5ETJA 5B37A 1NX6A 3W6UA 1MG8A 3F7OA 1HNXB 1EAYA 4DUYB 4BFLA 3BG5A 4MYCA 1E4YA 2QN9A 3D54D 5UKDA 1QE0A 1N7JA 3ONVA 3KXDA 3GE3C 1KXZA 4LCDE 1XPJA 3KZNA 4HGPA 2X6RA 4DWOA 3OCYA 4ARZA 3E7XA 2K0PA 5FFMA 3AILA 3OOJA 4C0SA 5EVJA 3VJLA 1FXAA 4PG4A 1P9RA 5AVUA 3O2NA 3QVOA 1Z5NA 1A72A 2F9LA 3NUGA 2ZIWB 2C4NA 2ESRA 3UF8A 1W85A 2D3AA 4NF2A 4JL8A 3CY6A 3QU4A 3R6GA 4L50A 1KXJA 3ZRFA 4HWIB 5GWXA 4B4WA 1WM2A 1V9JA 3BXFA 1FC0A 5LXHA 1WXFA 1IZYA 1XF5L 1IN8A 2EZ4A 3EGVA 3TRKA 1OXVA 8ADHA 5BURA 3S27A 4XQCA 3VO9A 3IDQA 5ICFA 4HEQA 2WNSA 1Z0AA 1KR5A 3UZUA 1G8SA 2E4ZA 3P2IA 4E5NA 2JD0A 2JVKA 2WAMA 4AJ2A 2FA9A 2P3OA 4P22A 5AJUA 3BIFA 5EHNA 4FP9A 1E6MA 2IV2X 2Y0PA 2PJDA 3O1JC 5CP8A 4PZ9A 2K8HA 3VKWA 4G0YA 3FN4A 1STEA 1I2ZA 5HJEA 4R6WA 1CB0A 3FKYA 3P94A 1E7MA 3RVKA 3Q9LA 3GRYA 3O75A 1TUBB 2WJ4A 3H1AA 4NI5A 3HJGA 3R0IA 4U63A 2I91A 2ZYSA 5E7MA 1UIMA 4X57B 3F6CA 4ARZB 4JS0A 3IP1A 1BMQA 3UN1A 1EX1A 4E1BA 2QDSA 3NS7A 3TI9A 4BWYA 1DS6A 4L5BA 4XIJA 1PTJC 3SQDA 3DTNA 3CISA 1Z7YA 1FRDA 1XAGA 3X1JA 1PZHA 3DO8A 4OI1A 3B7GA 4FD3A 5HFJA 3HVZA 3MW8A 5IS2A 221PA 1W85B 2P79A 1FYEA 1C8KA 4AWJA 2MIIA 1ZGHA 1YQWA 5KWEA 4KV7A 5E9QA 5LE1A 2QP9X 2QRPA 3IIJA 4NCJA 2ZUTA 5CVTA 4KH0A 4AQYB 1P6XA 1SVIA 2O7RA 1GVHA 2DCUA 2I4RA 3FGNA 3FTDA 2QYSA 4I6LB 2PVCA 5GZ6A 2D10A 5K09A 3W6NA 4BX2A 4ZOAA 2PE6B 1L5MA 3WAKA 1SIFA 4F11A 5CB4F 4OFZA 5CA0F 4TYFA 5KPDA 5F51A 2YRFA 1WW8A 4E5VA 2XT0A 4MP3A 2K8BA 4XYLA 4WJLA 3O91A 4F9FA 5ACRA 1BA3A 5L3RA 1D2HA 3NZUA 5EIOA 2AOXA 3ZNBA 4L0QA 1SXHA 2OAP1 4TV3A 1Y1TA 2EFHB 2QMUA 3NLLA 3SC2A 1M0WA 3FWYA 1U0GA 1K0FA 2IGGA 3HA2A 4ERNA 5KHLB 1S9DA 2PSSA 1WZUA 2VAPA 1CV2A 2BLNA 5TMBA 1SXJE 2KDMA 3EWNA 3K6RA 5I7HA 1SMKA 2GK7A 4LSGA 3MUOA 3HJAA 3T4XA 1YA4A 3IPYA 3KDSE 1LGYA 2QN2A 2CHXA 3CHYA 2IHBA 3AEAB 1C81A 4MB0A 5BW5A 5JS1A 1MUUA 4B71A 3B48A 4L6CA 1XWIA 5KNBA 1PT8A 2R60A 2ZNBA 2L69A 1FCCC 1KH3A 3E18A 4GFDA 3L4BC 1TCCA 1HOXA 5AW9A 4Z5XA 1KO4A 1R4AA 1NQAO 2ZGVA 3N6XA 1IUOA 5FFFA 1H69A 3IRVA 3DXFA 4XYGA 5DPMA 2R1ZA 1Y3AA 3CWCA 4HOYA 1A8QA 4P08A 2ZPNA 3WXCA 3KDPA 1AXEA 4QT0A 1W5FA 1DIRA 4XR4A 1NXPA 5LMZA 3QX8A 3SC2B 1Q22A 4DCUA 2UUPA 4CWAA 4KO8A 5B58C 3NT2A 3GGCA 1QM5A 5EY5B 3LZCA 3NDBB 1KY4A 5B1UA 5AEBA 2DPGA 3R8CA 5K2MA 3SN6A 3OTQA 1D4OA 5AM3A 4ANWA 3WA6A 2QM3A 3KTOA 3QFFA 2R86A 4LWZA 2H1WA 2HYIC 3SYNA 3K70B 4OGFA 1GN9A 2G6BA 4G5FA 3T3MB 4F3CA 1SOAA 3F6BX 4EFMA 3I37X 3LUAA 4RJTA 1XLPA 4QGGA 3GRKA 2PH7A 3LQ1A 4EGCB 5C1ZA 1KVTA 5CU7A 1YN4A 1XTVA 4UWOB 1SC3A 2E4XA 3NYRA 2Q29A 3N70A 2BMAA 2G80A 2ODTX 3RTGA 4K2AA 1NONA 4ABTA 1VI5A 4BC0A 3IOYA 1N6KA 1DKNA 4UUNA 4YJGA 3LRXA 2PUVA 1QRSA 1SBBB 1MRSA 3N74A 2A92A 1QXSA 4HN2A 5AKZA 4PPNA 2FZLA 3CSSA 5LIRA 4GLJA 5FA5A 2C2YA 2QLMA 3IA7A 5LUBA 5CLFA 3K9LA 3GPLA 1YJ1A 1GNPA 2FW1A 4HRSA 3Q3MC 3KCNA 4ZQHA 2ERYA 4G0PA 3BMQB 2BZGA 3U0VA 3D7KA 1POXA 1ZDXA 1KQOA 3AI3A 1HI9A 3MJFA 1Z33A 2PRSA 4PLVA 3ZE7A 4BRUA 3ZHCA 1CW2B 4PSVA 1GR0A 3V42A 1RABA 2HNBA 1J0EA 1X86B 3RIEA 3SF8A 1OWLA 3WQBA 3UUFA 2I0FA 1GPBA 1BXKA 5J5CA 4RD4A 4FYHA 1QBKC 4X97A 5HOQA 3FX2A 1GV1A 1CTQA 4W5JA 4HRYA 1PT5A 2ACVA 1D6JA 4I9FA 4Q5IA 3SBLA 1DO0A 1BKSB 4LDTB 2CNWA 4YDHB 1PG0A 1M1NB 2OHGA 1A9OA 3KTAA 3FYDA 1P0PA 3URMA 1MAUA 5LQSA 3VVBA 4PHFA 3H5TA 4G4IA 3O4IA 3DFMA 4AJ1A 5EINA 1CJSA 4Z2YA 4AD9A 3WNDA 3RF7A 3GEBA 3FNGA 2GF0A 4CV3A 4YJGB 4JT4A 1T26A 3MWEA 4ND3A 5K0ZA 3LUHA 4PRZA 4F5EA 2MYNA 1G291 2JIDA 4BO8A 2Y93A 3TDMA 3U7JA 3ABQB 2WG1A 4JBGA 3PTLA 3EPHA 4IY1A 1J8MF 3ETNA 4AJ4A 1KYZA 5A05A 4OYRA 2WAXA 3FYHA 5EJ4A 5KNLA 4A6QA 4CDNA 2CK3D 2HA7A 5DNUA 2BR4A 1PRYA 2AWNA 1VRVA 3W7AA 1R0SA 2BMIA 2J67A 3PS9A 3TLXA 4BWGA 2VPQA 1WPQA 4UHJA 1E8YA 4B31A 3RHTA 3SF8B 4JP8A 3AEBB 2O48X 3QLUA 1UP7A 1T3ZA 4IM2A 5LB4A 1JI3A 2JFQA 3TLCA 3GT7A 2V0NA 1T3SA 1DWQA 4CQMA 5LCAA 1G17A 5ALTA 1QQBA 4C7BA 2QORA 4X95A 4RBSA 1EXWA 2HHAA 5ALRA 4TTIA 3OWXA 4U1RA 2GZDA 3UJ9A 4RQBA 1YCFA 2ES4A 2CLMB 2BB5A 4HQKA 3J7AC 1ZGAA 3B3GA 3PTZA 3G68A 1GC7A 3KTAB 1FEHA 1NNUA 5ALSA 1LI7A 4QGFA 1RC0A 2XJ9A 4E7OA 3ROTA 3NHLA 1J0AA 3FHOA 2XW6A 4OV6B 1SXIA 1GQQA 4RANA 1IZ7A 3EOZA 2GN9A 4Q9IA 3P0IA 1VIMA 1CLUA 3L7BA 4PU0A 1ISPA 2FZ5A 1WWKA 3SLKA 2EKPA 2JBWA 1YUMA 5JAUA 1YZNA 5I9LA 2N9PC 2X7HA 4W5HA 1WUJS 3GARA 3HJNA 1R0LA 3TPFA 4QYSA 3FG9A 3W5HA 2Q7XA 1NW8A 3FNBA 1N2XA 3LLSA 2CFIA 1KQGA 4LYYA 2FU8A 1SCBA 2JK0A 4XSVA 4REZA 3ZCVA 5BUQA 2MMCA 1T2DA 4A15A 3VGPA 3X0WA 2O7SA 2E82A 2I7TA 3BBLA 4CFSA 1MEEA 5HA5A 5AHRA 2ZYUX 5KSZA 4XUEA 3PC8A 3H1PA 2QV0A 2PYIA 3B53X 5ICSA 2QDKA 1X9GA 1DWUA 4B33A 5HTKA 4CQMB 3AL0C 3AHEA 1THGA 2Z3ZA 3H8JA 3CLKA 3UKOA 3WYGA 3D5TA 4BMYA 2YVKA 3KAQA 2NZYA 2QX8A 3FCUB 2G7ZA 1ZJZA 1QNLA 3AEUB 2BIFA 1QLWA 3PBKA 1TADA 5AW6A 2DXIA 4JH0A 1U0FA 2VHQA 3MMNA 1DJOA 1O6FA 1E0SA 1U6JA 3MGAA 4ZHOA 3CBGA 4GD3Q 1LZKA 4X62B 1ZH8A 1FUIA 5JR3A 3RRZA 4C20A 1G2QA 1YDWA 2X9NA 1IZ9A 2YVLA 1JNYA 3GCXA 4C5CA 3JXPA 3QE3A 1Z5UA 1N32B 5C81A 3G2MA 3LH5A 2V1YA 5YASA 1TJNA 5I4DA 1P19A 3PLUA 1OWMA 1L6UA 1P2BA 4L78A 1TI7A 4H7PA 2W98A 1KJZA 1VHWA 4RSGA 1GKLA 1XQXA 3H4VA 1KO7A 5CXUA 1FS6A 1CSEE 3MWDA 4OHUA 5KOYA 2DX7A 3PRJA 3KT6A 3LOQA 1VB3A 4KW7A 3G1TA 4NOMA 2PD6A 1JT9A 4X1YA 3TJZA 2XNDD 1OCEA 2GXUA 3I2JA 3SEFA 2JRCA 2F2TA 2FWBA 1JLKA 3UGTA 3M8KA 4DRXA 3P45A 4Q0MA 4FE4A 1P80A 1TM2A 3IERA 4FPXA 1U31A 1HDEA 1YJQA 4TT8A 5A7FA 5IP4D 1O94C 1OYYA 3VTFA 5AJXA 4KCGA 3RC8A 3ONNA 5KYNA 3G8CA 3L6OO 1BWSA 3AUYA 3WDKA 3I28A 3BJIC 4GEKA 3KOOA 2FW0A 4AG3A 3QF7A 3R5XA 2CV1A 2QL6A 2PKEA 1SO8A 3A4YA 1YZ3A 3BXGA 2YMQA 3WDLA 3F7NA 1SKQA 4GNRA 3NAQA 3OE5A 1NHGA 1NPYA 1KNXA 2CV2A 2AR9A 4LTDA 4Y18A 4FULA 4MZDA 1CP3A 1LTHR 3QJYA 4M1MA 4CUZA 5E6RB 3J7TA 1DEKA 2SKDA 1XTPA 1SH7A 3SP1A 3RE1A 2ZSDA 1F2DA 5C5EA 5CT8A 2NTVA 2LXNA 3AQ4A 3EEIA 4N3CA 1E3LA 1XPUA 3A4TA 1Z2CA 4LMPA 3OFSA 2ZYWX 5B7NA 1GGNA 2G6TA 3MWDB 4AWXA 1N78A 2CN1A 2CJPA 4BV8A 1EM8A 2VPXA 4X1YB 5H4HA 4IJKA 3P8ZA 1IL0A 4CM3A 3DMTC 3PC3A 4GM0A 4UNSA 4DRXB 2D2VA 2ZTSA 3A11A 3IIIA 3URKA 2BFCA 1QVWA 3SBEA 2BMFA 1ITZA 1WABA 5T8KA 3OJFA 4Q01A 3IOEA 3SY8A 3IR7A 4MGKE 3IHWA 4HQNA 4E51A 1K07A 3WNQA 2BGFA 5KNDH 3GEDA 4C4XA 1KJJA 3QWFA 4LSMA 5A3QA 3UTDA 3HV2A 2VF4X 4BO9A 4TSFD 3JVVA 4ALLA 4WOKA 1NIJA 5FKAC 4KOEC 4D8XA 3VQZA 5AK4A 1L9XA 4FMDB 4BJ3A 5I9BA 5DX0A 2D6FA 4Y6OA 2QINA 1XQ6A 2GFQA 2O3QA 5HG2A 1P4JA 1YRWA 2GCGA 3UATA 2EFDB 4YBZA 4CTOA 1WU7A 4R54A 3SYKA 2BJWA 3OCUA 3USCS 4BTLA 1EVKA 3CT6A 2MYPA 4X93A 4B8YA 1A9XA 3IBYA 2WIKA 1N9GA 4F3YA 4ZCLA 3KYJB 1LPPA 3L06A 4YQZA 3QJ5A 2IQ5A 2GYWA 3DZDA 3LY5A 4BZAA 4F56A 5G3ZA 1GIAA 1EM8B 1KQPA 3AJRA 1TM5E 3BS4A 1TY0A 4P7BA 4DTCA 3CGWA 3H11A 1T6XA 3B60A 5BR7A 2D2FA 5AVWA 2QRVA 9ATCA 4TVOA 1V1MA 3KQHA 3TJRA 1JWMD 3AULA 1EF5A 2ZU6A 1E4EA 2BFCB 2ZJ7A 5I9IA 3OZSA 5TEWA 1D04A 3HZHA 5JIBA 2HJWA 2FKAA 2O0LA 2Y1OA 4MI3A 3I04A 2NTEA 1BVUA 4LJ9A 4AKEA 1M10A 1Y82A 2O2XA 1FP4A 4QBHA 2XDWA 1KZYC 4MUYA 4C30A 5IF9A 4CQNA 3MCUA 2ZRMA 4E2YA 4C06A 3LY7A 1YHZA 5TB5A 2ERCA 1BQ4A 3H9DA 2OP1A 1WE7A 4HAOA 1QRRA 5DKFA 4Z0TA 4LRWA 4QYMA 3VO2A 2LVPA 5I47A 4DIOA 1N6ZA 4K0KB 3H3FA 5A4AA 3HCFA 4JP3A 2WZQA 1C9EA 1Q0HA 1ADFA 3CRQA 1TO2E 1NFFA 3QAQA 1A9XB 5JCOA 1N9GB 3V8QA 9ABPA 4WZBE 1HT3A 1JB9A 3CBQA 3M3JA 4CDGA 2FUHB 2JCGA 4FT2A 3IIEA 2VKQA 3VAYA 2VN8A 1A2KC 2H1IA 4BECA 5F23A 3H11B 2QRVB 3DCGA 2Q50A 1ICEA 3DV2A 4RWEA 2KJQA 1AN9A 1E4EB 4DW8A 2VJNA 4Q3LA 4NFYA 4A73A 1WULS 3AG6A 2CLKB 2RHHA 5DW0A 5TF0A 5EWLB 3R2JA 2WUVA 2H4FA 1DWPA 3QXHA 3L4JA 1FP4B 8MHTA 1UBJS 3B6ZA 4FA6A 2RG1A 3DW3X 1SG0A 2DBRA 4P32A 1IM8A 4YMHA 2VP3A 2PMVA 4RDIA 2EXXA 4EUTA 4MUBA 4DUGD 5HFNA 2WV9A 2CEAA 2PH5A 2P7HA 2A5LA 3ENKA 4BNMA 1TCAA 2MSNA 3HS3A 5KYYA 2YDYA 1ZXIA 2R2OA 4LJSA 3ZKAA 1NVID 3I0ZA 4DHJB 4EJ0A 1REQA 2PNFA 4HMQA 1AN0A 5EIEA 4UATA 2VP5A 4RMIA 3CPEA 4R98A 3N3BC 1R6TA 5FLKA 4RF2A 4KXMA 1J7AA 2KN5A 3VR6H 2Y87A 3P2MA