3T3OA

Molecular basis for the recognition and cleavage of rna (cugg) by the bifunctional 5'-3' exo/endoribonuclease rnase j
Total Genus 162
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
162
sequence length
553
structure length
553
Chain Sequence
SQGGPQDHVEIIPLGGMGEIGKNITVFRFRDEIFVLDGGLAFPEEGMPGVDLLIPRVDYLIEHRHKIKAWVLTHGAEDHIGGLPFLLPMIFGKESPVPIYGARLTLGLLRGKLEEFGLRPGAFNLKEISPDDRIQVGRYFTLDLFRMTHSIPDNSGVVIRTPIGTIVHTGDFKLDPTPIDGKVSHLAKVAQAGAEGVLLLIADATNAERPGYTPSEMEIAKELDRVIGRAPGRVFVTTFASHIHRIQSVIWAAEKYGRKVAMEGRSMLKFSRIALELGYLKVKDRLYTLEEVKDLPDHQVLILATGSQGQPMSVLHRLAFEGHAKMAIKPGDTVILSSSPIPGNEEAVNRVINRLYALGAYVLYPPTYKVHASGHASQEELKLILNLTTPRFFLPWHGEVRHQMNFKWLAESMSRPPEKTLIGENGAVYRLTRETFEKVGEVPHGVLYVDGLGVGDITEEILADRRHMAEEGLVVITALAGEDPVVEVVSRGFVKAGERLLGEVRRMALEALKNGVREKKPLERIRDDIYYPVKKFLKKATGRDPMILPVVIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular Basis for the Recognition and Cleavage of RNA by the Bifunctional 5'-3' Exo/Endoribonuclease RNase J.
pubmed doi rcsb
source organism Thermus thermophilus hb27
molecule tags Hydrolase/rna
molecule keywords Metal dependent hydrolase
total genus 162
structure length 553
sequence length 553
ec nomenclature ec 3.-.-.-:
pdb deposition date 2011-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07521 RMMBL Zn-dependent metallo-hydrolase RNA specificity domain
A PF12706 Lactamase_B_2 Beta-lactamase superfamily domain
A PF17770 RNase_J_C Ribonuclease J C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.580 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3t3oA03
3.40.50.10710 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Metallo-hydrolase/oxidoreductase 3t3oA02
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 3t3oA01
3I15A 3IEKA 4BP0A 3JXPA 3IOGA 3DHBA 3I13A 5AXRA 2BG6A 5HISA 5ACSA 2DOOA 5AHRA 2WYLA 5HIPA 2QDTA 5ACQA 3IEMA 2R2DA 2NYPA 4GYUA 3KL7A 5B3RA 5LM6A 2WYMA 3BC2A 4UWPB 2YNTB 5EW0A 5K4KA 5A5ZA 1YCGA 5FQCA 5FQAA 2BTNA 4EXYA 3BV6A 2ZWRA 4D1VA 4XWWA 2QINA 3I14A 4RL0A 2YNUA 3IE0A 5LE1A 5HH6A 2P18A 4B87A 4U4LA 1WUPA 2BIBA 4XWTA 1L9YA 3VPEA 4C1FA 5LCFA 2ZNBA 4TZFA 4EYLA 2NZEA 5A0TA 2YNVB 3SBLA 4C1CA 2OHHA 4GCWA 4FSBA 2P97A 3ZWFA 2A7MA 2GMNA 1BMCA 4C1HA 5HIOA 4LE6A 1ZTCA 2XR1A 1WUOA 4FEKA 4HKYA 4NQ4A 4UWSB 4WD6A 1X8HA 4TYFA 1ZKPA 3AJ3A 4RAWA 5AHOA 1DDKA 2BFLA 5EH9A 1SMLA 3QH8A 1E5DA 1BC2A 2GCUA 2BG8B 4YSBA 2I7XA 2Y87A 1KO2A 3S0ZA 5HH4A 5LS3A 2GKLA 2BR6A 3SW3A 4UA4A 2BFZA 3BK2A 2E7YA 1ZNBA 2P1EA 4KEQA 4Z60A 4HL2A 3ZR9A 5ACUA 4H0DA 2BFZB 4DIKA 3DHCA 4AX0B 2YNTA 3MD7A 5FQBA 1YCHA 4DILA 1BVTA 5AEBA 1DXKA 4UWOB 4J5FA 5KILA 2BMIA 2Q9UA 3VQZA 3PY6A 4EYBA 5AYAA 5A87A 4UBQA 2I7TA 2NZFA 3Q6VA 5ACTA 2QDSA 2ZZIA 1A8TA 3FCZA 3IOFA 4UAMA 5LCAA 3ZNBA 2FU6A 3H3EA 1VGNA 3R2UA 5HIQA 4RL2A 2WRSA 1M2XA 4NQ2A 4D1UA 3ESHA 1K07A 3AF6A 5B1UA 2YZ3A 1XM8A 2BC2A 3PG4A 1KO3A 3SPUA 3X30A 4AWYB 3TP9A 4EYFA 3WXCA 4RM5A 2FU8A 3LVZA 3T9MA 5ACWA 3T3NA 3PY5A 2AIOA 4AD9A 3FAIA 2QEDA 5DPXA 5LLDA 2FHXA 4ZEJA 4Z5YA 2M5CA 3F9OA 3SD9A 5EV8A 4XUKA 5EV6A 2BG2A 2GFKA 3ADRA 4YSLA 3IELA 2UYXA 1QH3A 4F6HA 5LCHA 2FU9A 3KNSA 2WYMC 2CBNA 4C1EA 4EXSA 5ACPA 4C1GA 5B15A 4O98A 5EVDA 2Y8BA 5ACRA 2HB9A 3T3OA 2FU7A 4EY2A 5IQKA 4C1DA 2FK6A 1JJEA 3BK1A 3RKKA 4J5HA 1A7TA 5K0WA 2OHJA 4GYQA 2Y8AA 4TZBA 3L6NA 1X8GA 2AZ4A 4D1WA 2BGAA 1YCFA 3DHAA 4PVOA 3X2XA 3SRXA 4TZEA 2P4ZA 2OHIA 2FHXB 2DKFA 4Z67A 4CHLA 3AF5A 2Q0JA 4Z7RA 3I11A 1X8IA 2I7VA 4EFZA 5KIKA 5ACXA 4JO0A 4KEPA 4F6ZA 5EHTA 4P62A 4AX1B 4RAMA 2NXAA 2BG7A 3SFPA 3IE2A 3I0VA 1VMEA 5AXOA 4C09A 3ZQ4A 5EWAA 4ZO3A 4UWRB 2WHGA 3P2UA 4Z6XA 2FM6A 3RKJA 4D1TA 3IE1A 4Z5ZA 2M5DA 4D02A 3G1PA 2YCBA 2YNWA 3KNRA 4ZO2A 2YNVA 2Q42A 4YSKA 1MQOA 3IDZA 4PVTA 1QH5A 4BZ3A 1JJTA 5K4MA 2VW8A 4ZNBA 3A4YA 3X2YA 3X2ZA 1WRAA 5HH5A 5EVKA 1XTOA 4V0HA 2ZO4A 3RPCA 5K4NA 2BFKA 4FR7A 5LSCA 5ACVA 1P9EA 1WW1A 4RBSA 4NQ5A 1KR3A 5A0VA 3DH8A 1JT1A 1Y44A 4AWZA 1DD6A 4TZ9A 2QJSA 2Q0IA 2H6AA 1VJNA 2XF4A 4NQ6A 4TYTA 4HL1A 1HLKA 2BG8A 5EVBA 2GFJA 5LMCA
chains in the Genus database with same CATH superfamily
2BGFA 4JCOA 2HHLA 1GG3A 1HNNA 3H8SA 3ZHOA 4MHSA 1NF9A 3AEQB 4P3NA 2GBKA 4HDCA 4MP8A 4OHPA 3NFYA 3A06A 2ZUSA 3N2GB 1B0AA 1N7IA 3HUTA 5ADUS 5JJLA 4N3BA 1J8FA 2PFKA 1A69A 1ECCA 4UM7A 2R7LA 1V3UA 3OIFA 2AR0A 4MVJA 5IMSA 3OX3A 4U7HA 5KU1A 1QRUA 4HB3A 1OJ7A 4MMZB 1M2VA 3U44A 1ZR4A 1K9SA 4LHZA 2B21A 1MC5A 4PC6A 1EHIA 3DR5A 2C20A 2V45A 4G1CA 2XWSA 5TGTA 1L5FA 3VUYA 1VI6A 2Q45A 3GCXA 2AFIE 3L79A 1ZD5A 2JCVA 3NBKA 4KQ1A 2VATA 3R7FA 4HRXA 3D7NA 3TKLA 2D4AA 2R2DA 1MPTA 1XLPA 2G28A 2H11A 4M8LA 4DV0B 1HTOA 3LC2O 4KYUA 3A4RA 1JHAA 4CETA 3LU1A 1PVDA 1ISSA 3EGRA 3PL1A 3UJHA 4ANXA 3FCXA 1QZXA 4GECA 3LH5A 1HMPA 4RFLA 2W2QA 1KSGA 4EEXA 4ZI3A 3KOXA 3UH1A 5IG2A 2IPKD 1F2VA 1FA9A 3HQ4O 4W9GA 3QXJA 3M4YA 4BPRA 1WRBA 3BVPA 4K3BA 4O63O 4U7TB 5C4IA 3Q7PA 3GBVA 1V8CA 3NVZA 4FXPA 1Q6YA 2V96A 1RC8A 2O0LA 4AICA 5KWVA 1T0YA 2MCNB 1ZGHA 4MP3A 3UHJA 1BEEA 1KJJA 1Y9DA 2A9QA 2AIRA 2HBQA 3EGDA 3QNMA 5KPJA 5LXTA 3B1VA 4INPA 1JEDA 1SQFA 3KZMA 4ALMA 3WGJA 1OCEA 2MDTA 4EKGA 4CI0B 1GAWA 3FYDA 4JYZA 2SCUA 3L0OA 5KNCH 3E81A 1AUVA 3MAJA 3EPRA 4IIEA 4RKYA 2QINA 5BN3B 2VYCA 3ZWAA 1EXVA 1LU9A 4FOPA 4FSDA 1OFFA 2XUFA 5LA6A 1M3SA 1K7XB 3J7AC 3VX4A 4OBWA 3DMFA 3HK2A 3UMVA 4GG1A 2CYCA 3TCKA 1G5QA 2H92A 3L7BA 1D09A 2VSOA 2I3AA 2FZLA 1O5IA 2HJWA 4QGFA 3BFVA 4UPVA 5EZYB 4QKQA 2F2TA 5CDYA 5D6NA 4U7DA 3MINA 1ZUNA 4AXBA 3MC8A 3OJ0A 3AB5A 2CJWA 4L8GA 4MRNA 4X8LA 2JJMA 1GQSA 4MINA 2F1JA 5B1SA 1U3DA 2H07A 4ARCA 3R6LA 2HIMA 4WA8A 1W5FA 2SNIE 2G4SA 1KLUD 2BEJA 2QGNA 4P4GA 1LRJA 1PT8A 3G9XA 4LKOA 4FA6A 1E2FA 1P1IA 2XUJA 3ABSB 3LOQA 3NBXX 2HTME 2UZIR 4MGKR 5EQDA 3ROTA 3TD9A 1ECJA 3FLAA 5DGTA 3F6YA 1Q7CA 2HA4A 3CKKA 2FH5B 3ETCA 1QHHA 2TMYA 2ZCBA 1Q91A 4YJ3A 2Q6VA 2JT4B 1VXRA 5GINE 4ND8B 2A7MA 4WZBA 2PGNA 4Z3OA 4KIUA 2G63A 3HV2A 2D3CA 1CY4A 3A1TA 3SE0A 4YUXA 2J6IA 3AETB 3A0RB 2YWHA 4HXFB 2M6RA 1YB6A 3E9NA 3GW8A 3OTQA 4LX8A 1SXHA 3SQWA 2B78A 2WSYB 2YFQA 3NT4A 3Q85A 4KE9A 3KJEA 3Q5EA 3TI9A 1E2NA 3VR3D 3ZU5A 1CUEA 2QPOA 3OCUA 4I3GA 1FFDA 2CG2A 1PNVA 2AD5A 2VIIA 1L4ZB 1QGZA 3OZBA 5KYTA 1JSLA 4HJGE 3EEQA 1JA0A 2WSSA 4P98A 4S35A 1NENB 2IXEA 2G1AA 1QZZA 2MJ3A 2W6ZA 5HCIA 1OWOA 4A5OA 4AWXA 3O3NB 2GBJA 1Y5LA 3FTNA 1T5DX 3GOQA 4NU8X 1AKVA 4ANWA 1JWAD 4GOXA 2I4TA 4TQAA 1FNBA 2E4WA 3U4IA 2VSXA 1UT8A 2X23A 5L45A 1FBNA 2AZXA 2GERA 3BILA 3GLIE 3OFSA 2W83A 3AB3A 5J4LA 5FWYA 5IJ9B 4CIDA 1LBIA 4IMPA 1T3SA 4KPGA 4L1BA 1LJ8A 2ZJ5A 3FNIA 1GNPA 4P7BA 1DMRA 1X15A 3LVBA 4TWJA 4Z4HA 2BG8B 1OI4A 1TFUA 2NVBA 4WXMA 5JEEA 1MQ9A 3IP1A 4UUBA 1WXGA 1E0DA 4KI7A 2EJTA 2ODAA 3A31A 3EXIB 3Q41A 4JN6B 4P5DA 1NE7A 3TUJC 5J2RA 2HPHA 2IZ7A 2WA1A 3ALBA 1I7NA 1IY1A 4C7YA 5MPOA 1Y7PA 3EAGA 4LDNA 4MV6A 5DBEX 5I7EA 1Z07A 1CD5A 1S4MA 4Q4DA 4AFNA 4UA4A 2IYUA 2VDOB 4YDSA 2X4GA 4J49A 1GCOA 1RQPA 3MCAA 2QTNA 4IBOA 2JZZA 2NQ2C 4YTEA 3NIDB 5K3AA 2IVFA 1Z0IA 3HA5A 1W76A 3Q9NA 3B2NA 1NBIA 4GSKA 5IZ4A 1G20E 3VOSA 4BOYA 3LXMA 2QRKA 3DE6X 1KF6B 4FWBA 3C43A 1KK3A 1PGQA 2Z1DA 1E6CA 2ZWVA 3PC2A 2MSLA 1B0ZA 4NCXA 4Q39A 2ST1A 1QCDA 4WN9A 3OQIB 1ZMTA 3TB4A 2JJ2D 3P19A 4WCDA 5KOJB 3DWIA 5G0WA 1KO8A 5FK9C 5LKRA 3V4RA 2ZB2A 2QMHA 3O03A 4FFVA 4NOLA 3R6GA 2PUVA 1F2RC 2AD1A 4FBGA 3UAZA 3H6GA 2J9XB 2CFTA 1V6CA 4GOLD 1ZNYA 4ZVMA 2Q29A 1WV1A 2E1RA 1QFJA 4KH0A 1SOAA 2GEBA 4K9KA 2JLXA 4JY7A 5CR9A 2B61A 3OPXA 4BUZA 3ZCRA 4OOEA 4ERNA 1V5OA 4Q1DA 5ARBA 3NW9A 3RTCA 3ABIA 1VDMA 2W8BB 2RB5A 3AUTA 3SHTA 4INAA 1KI1A 2QRVA 3TGWA 4OHJA 2FG6C 2NZVG 4B44A 4ALIA 3LXRA 1IONA 1C9KA 3NY5A 4BX3A 1XTJA 3OLVA 4OB8A 4RF5A 1P4HA 8ATCA 2YHIA 4FFRA 4OV6B 3OE7D 1RCTE 2GBPA 1NA5A 4GL2A 4UBQA 3RBZA 1GOZA 2QIPA 3G7SA 3UV6A 2P4ZA 4ZYWA 2XTNA 4IW3B 1KYIA 3E1GA 4R2MA 5BYKA 1I1HA 1YTLA 2CNOA 1GKLA 4FXCA 2HLDA 4G4GA 3WK9A 3FMIA 2HWWA 1CJTC 3VR8B 3FWPA 4FZ3A 4KXFB 1US8A 2W55A 1RZRA 4K9NA 2GETA 2WYVA 3DO5A 5KREA 3VRHA 1ONOA 3DMTC 3H0EA 2O14A 2YC2C 4RS4A 1W7AA 4L4YA 2R4UA 2WGSA 3G7NA 4Y6GB 2ZIAA 5ALJA 3W77A 2IBSA 3VR4H 1RJ9A 3AETA 1ESDA 3V00A 5BWCA 4BYGA 4FNMA 5GADl 1YBVA 3DDSA 1IBLB 2XOXA 4OP3A 3S8MA 2FPMA 2V6BA 3GDFA 3ER6A 1QF6A 4YSZB 3X44A 2WM3A 5JANA 4YL8A 1P29A 1JEJA 2OBLA 1WQ4A 2XAAA 2YZ3A 1EHCA 4PAQA 2DTEA 3EAFA 3PG4A 1HNZB 5HXAA 2WZQA 1E62A 3WIDA 4IIJB 5HJ2A 1FDVA 3E4DA 4PC3A 1NBHA 4XPIB 2RHDA 3N5KA 3HJBA 1TKRA 2FW0A 4RIEA 4TQUS 4BKUA 4LJOB 1ENFA 1SEBD 2WU2B 1WSBA 1BMQA 4W9MC 1JWLA 4XWKA 4K1XA 3OOEA 4Z1OA 4BBNC 1EWVA 4JL5A 3B6JA 1KVSA 2CCJA 3OP4A 3UUGA 4EYEA 2G1UA 2VJAA 3FOBA 3GY0A 4HYQA 3TSCA 3T9MA 1ZISA 3EZFA 4P4SA 5DWDA 3I8XA 5REQA 4RIIA 5ACWA 3NAGA 1CUZA 1I8TA 4L02A 4NXNB 3MINB 4RGBA 3TIVA 2I8CA 2WXKA 1GRVA 3H4TA 3FLMA 4Y1RB 5CDFE 3EUB2 3H97A 2EKEC 3QW4B 2DAPA 4P22A 4EPWA 5IJZA 3VSEA 2R0QC 3AR8A 1A9PA 4HGYA 1XQXA 3NDIA 4H7EA 4BX0A 2WIBA 3O4FA 4KFSA 5JEDA 2IYTA 2ACEA 1RRPA 2QX9A 3E9CA 3KALA 3O38A 1SC4A 1OFGA 1WY5A 2V9PA 1E1NA 1GKYA 1NUUA 1DYQA 2E0IA 1LFAA 2EEZA 2ZREA 4JOQA 5FBQB 4ARBA 1O5OA 4DREA 3E3LA 3OLWA 3VHXA 3BGOS 4H7KA 4HWPA 3ZIUA 3ZVKA 1EM6A 1N2IA 3U7RA 3BBPA 4EJSB 1AHNA 4LCBA 2MBEA 3D31A 4P4TA 4AJKA 1C0LA 3FB4A 2NP7A 5CLFA 2VQDA 1N92A 3DNMA 8AT1A 1QVRA 2J6HA 2ZSIA 3C8UA 3WR5A 3LIIA 1Y33E 3H5LA 1DGQA 3DMPA 3IHTA 1CULC 2H57A 4MGZR 3TSOA 1WI0A 2G45B 1H2BA 3BWBA 2HH9A 3RU7A 3RS7A 3FA2A 1UZXB 3UENA 2OUIA 2FWIA 4FDVA 4F8YA 5T7BA 1FNWA 1L3IA 2ZRGA 4F60A 1KA9H 2GN8A 4IZOA 3FHTA 1ZOSA 2DENB 4JC5A 4PR0A 1Y1QA 4GQBA 4XOUA 1RYJA 4BNLA 3I53A 2W6JA 4UAVA 1PVVA 3I92A 4PZYA 1TVKB 1ZDMA 4EO4A 1E3LA 4MI6A 3B52X 4F56A 1HEZE 4GH5A 3CEPB 1Y89A 1EH5A 3IJPA 3M4XA 4YQFA 5LP6F 5LD2C 3K6RA 1RBYA 1XRLA 5D5HA 5AOAA 3N8HA 4XGAB 1VFNA 2IPOA 1C4WA 1XQ1A 3ENEA 3A9TA 2GJKA 4GT1A 5A6SA 2ZRKA 5IHPA 2LHEA 2FW6A 2Q21A 3GJSA 3L13A 1NNUA 1A4RA 2WVGA 3BMOB 3QPUA 4ZVQA 3TNLA 3HJRA 2ACZB 1SULA 2FVYA 4OX9Y 1IOZA 5DTRA 1GARA 5AKEA 3ZRCA 2X6TA 3Q88A 5CPFA 3STWA 4Y2XA 3VTZA 1T43A 2Q1SA 3B8HA 1HE2A 1JHXA 3W2IA 3WLRA 1JJEA 5KDDA 4PDXA 5E7JA 2WPDA 4O4LF 2NZUG 2QX6A 1Z5ZA 4EA8A 2FUG6 1NYTA 2KJHB 1NMXA 4KJZA 2WKPA 2BUAA 4BBAA 1AA6A 3S1SA 3TL6A 5F3DA 4GYYA 3ORSA 4GPZA 1SD5A 3D4LA 2G4VA 4TZEA 1C3LA 2YVQA 4HH1A 4YUZA 3MB5A 1MI0A 2GZHA 2JWUA 2W71A 5EIOA 3ZXSA 4NBRA 2QGFA 3MVEA 1PFDA 4YQEA 4ZXFA 3N7TA 2NO7A 3AIKA 5JFTA 2X0EA 4FGLA 5GIOE 3ONSA 2QEJC 1M8KA 1YDGA 1OX4B 1XXHB 3AESA 3KR9A 1GNQA 1KKMA 1MG8A 4HLCA 4M8SA 4NF2A 4ALKA 5L7TA 1JDJA 4MO2A 4Q3NA 1MW8X 4L15A 2W43A 3SICE 1PUIA 2G3QB 1HDOA 1EJ6A 1UPFA 2VYVD 2QYHA 1BFUA 4XM2A 3V60A 1YS1X 5DGIA 3VHQA 4A10A 2QAGC 2RAFA 1X7XA 4HGQA 2BVNA 4NMLA 4C1BA 3DBHI 3HZRA 4ZGGA 4BNIA 4PGHA 4IILA 4JP5A 4DQXA 1XD2A 2JZ3B 2ZYHA 1CQPA 2HDWA 4IOJA 1Y0BA 3VTKA 3WK4A 1RAXA 3A3YA 1THZA 3M95A 3GUZA 3H9EO 1HL7A 4WXPA 2DR3A 1U0SY 2MSNA 4ZAXA 5KDLA 4CCAA 3BZWA 3E53A 4MVYA 4ZU1X 3KWLA 1NV9A 3PCTA 4PAWA 1JJBA 2ZB8A 2V7PA 5HJ5A 4XWGA 4W9EA 3GMTA 4DG5A 5GM2A 4A23A 4HPXB 2C9MA 3ZDTA 2P65A 3TUZC 1RABA 2Z3VA 4PPNA 4TTIA 4P8RA 2XXAB 3ESZA 2W4MA 3UFXA 1AGXA 4YJDA 4ZO3A 3B36A 2CHZA 2YS6A 5C52B 4F3KA 1KMIY 5BNWA 4XC2A 2B34A 3IUYA 2D07B 4DPKA 5CH8A 1VI5A 2QLNA 3H2SA 4UU0A 4EF4A 2OOKA 1E1MA 3OOSA 2GILA 8GPBA 3AY7A 2G4LA 3AEEB 1BDBA 2H2IA 2HMAA 4PIPA 3UC9A 1ZGAA 2J3HA 3OOYA 5FXMA 3WGOA 4U6NA 4B7CA 3VR5D 2M5DA 2FEAA 1UT5A 2BC9A 2PLNA 3GLFA 2VDKB 2H65A 4O02B 2YUIA 4JODA 4DSTA 1UAAA 2X5XA 1MOQA 1PTJA 4P1BC 1PL8A 4EFMA 4ZO2A 1KRHA 4G36A 4FT4A 2JXTA 5HK9A 1LQUA 1XP8A 3TJRA 1TS5A 1P7PA 2GK7A 5A9SA 3DVGX 1JDTA 1PLLA 1P98A 1PLKA 2RMKA 1G8KA 5EZSA 4EM6A 1P6XA 4LE2A 4N5MA 5CH5A 4C7ZA 3UMSA 3NM5A 2X8XX 1BWRA 1R5JA 4BFTA 1P1CA 2FNJB 4U9IS 3U1TA 5F2EA 3SF8B 1V0JA 4IDOA 3G9TA 3GP7A 1C4CA 8LDHA 3NV7A 2L52A 3S2EA 4OB7A 3ZYZA 1S3IA 5EVKA 5M04A 1OFTA 4CT0A 4QX6A 2OBXA 2X58A 2AXPA 3PQ2A 4HH4A 4BEBA 3E7WA 3I9NA 5T64A 2PXHA 2XH8A 3EG5A 5AIAA 3WLMA 4DZTA 3VDXA 4PS3A 5LSCA 4D0NA 5D3MA 3QVLA 4AOFA 5EE1A 2LGIA 1O0SA 1W1WA 2ZUWA 1OU4A 3DCYA 4G25A 4LDQA 2ZNVC 1D2RA 4N8DA 1E6EB 4N76A 2HC9A 4MM3B 5DBOA 2LE0A 1YIDA 5FFFA 4E22A 5IFLA 1DIOB 2JGEA 1O8BA 2R44A 2BGMA 4N01A 1Z74A 2ZSAA 4C22A 1KWKA 3I64A 4F4UA 2J30A 1OSNA 2FPLA 4W7SA 1U7PA 1K68A 1NJ2A 1RZUA 3H87A 1FDRA 1U8EA 1VHWA 2HT6A 2Z0DB 2HLPA 4G0PA 5A7HA 4XUDA 4DLLA 1G2PA 2J46A 4UNRA 1QFZA 2P2ZA 2UYOA 4I36A 4KZCA 3W3ZB 4OJQA 1N8TA 2FK8A 1P0CA 3M89A 3OVMA 5FYDA 4JSYA 2YNMA 1LUAA 3DHBA 1JROA 4NJ6A 1L0BA 3G8AA 4UNNA 3SFZA 5BUSA 3NC0C 4M89A 5K8UA 5AXRA 1RRCA 5NLLA 2YV3A 4F5EA 4OSEA 4TMXA 3REQB 3AE2B 4GQAA 5DCWA 3A05A 4CTKA 5ER6A 2PHZA 2R1TA 3BJIC 3B9BA 2IHJA 2V4ZA 3A3OA 1T1RA 5BYSA 3SEZA 5LP1A 1GZDA 2CDRA 3QVXA 4L9RA 3N5CA 4QFMA 1E2HA 4MDHA 4TKUB 3UPDA 3UBMA 2KVZA 3QHTA 2QY9A 1QX4A 1U90A 3OEYA 2FIFA 1D4ZA 3RPFC 1PEDA 1CJKC 1T3LA 4URWR 1C9MA 1JE0A 2GDJA 4HGRA 4CG0A 2VJNA 4L23A 1YBMA 3I1FA 3ZDBA 3JASB 4CKXA 2DEUA 3K8QA 4KVFA 4MA4A 2GEUA 1Q1EA 2OK7A 1RC1A 5ILGA 3CV3A 3INRA 5FO1A 5P21A 3OEHD 3WRXA 4ZD6A 1ZZGA 3C3XA 2A5FA 4L27A 2B8JA 2AEEA 3BFXA 4KKXB 3WZLA 1BD3A 1MB0A 4N39A 3ODGA 5H1YA 4IUBS 5KOJA 1I3MA 1AUOA 3R3VA 2UAGA 3R3UA 3HRHA 3OJCA 4FHCA 4I55F 3V8NA 5GZ1A 1MIOA 3JYQA 3IOEA 3TIXA 4FYHA 4ZTZB 2HIAA 3LDFA 3D3KA 4MULA 3G0DA 3T5BA 1J99A 3UWOA 5K03A 2FMFA 4KX6B 4LGCA 5F5XA 3URKA 3AYXB 4QAJA 3BEDA 3BZDB 1K0UA 1VE6A 1Z7WA 1CF9A 2WTEA 3D5QA 3HYNA 4N6EB 2ZCCA 1J00A 4P4LA 1P3Y1 2WB2A 5GOZA 5IABA 3B3AA 2GBLA 1P0RA 3IOBA 3H9DA 2AOUB 2IEDA 4X1KA 2QCZA 3R4CA 4CDNA 5L40A 5HH6A 4MACA 4L08A 3NOXA 3P4RB 2V5VA 4RF3A 3BBLA 2RGWA 3P8ZA 3EIQA 4UBOA 3HFSA 3HCBA 5EWJA 1UXJA 1AW7A 1WHSA 1DV1A 1ICIA 5KX5F 1AQLA 3HMKA 2VHXA 1XEWX 1XZFA 2C4UA 3AIIA 2O0KA 4WY8A 2V3VA 5BR8B 3OQOA 2IDMA 4CQLA 2FN8A 3P2KA 4AN1A 3CMMB 3VPXA 3VPEA 4EHNA 1KNXA 4PW0A 4TZFA 4BQRA 5FPQA 1WG8A 1I6KA 1TQ6A 3GVXA 1EVEA 2JNWA 2YN2A 4OUKX 3EGWA 1SU4A 4KVGA 2ZEJA 4OQQA 2AK2A 4ZPJA 3U3KA 4LDJA 2E4YA 1SBQA 1U3CA 4U2GA 3CGWA 4FSBA 2CXQA 3HVHA 3LUHA 5BSHA 4EMUA 1WCV1 2B36A 4U4AA 5E4JA 4RCOA 4BMXA 4O4HA 4YCCA 5ALLA 2QDFA 2XA1A 5FFNA 4A2WA 3ZWYA 1CR4A 1UBLS 4W5JA 3RNAC 4ETWA 3PFCA 2RE8A 1R4NA 1G17A 2M6SA 4LRYA 4YVFA 4I8IA 3I6ZA 4DBGA 3FIUA 2Q6LA 4TM7A 1EX1A 1G8GA 1U1CA 3MRXA 1RXCA 1JHRA 4TMWA 2ZU6A 1CRWG 5J2UB 1V39A 2X1LA 5GQSA 2IJ0A 4IHJF 4LZJA 5D6OA 4BVBA 4EG6A 4DCTA 3EWAA 1JB9A 4D42A 4IGAA 2R97A 2YWBA 4C01A 4D8TA 1GPBA 4EGQA 4GMGA 3CNOA 1FCLA 3V8BA 1BQ3A 1P44A 1RLIA 1CNMA 3UOAB 3O0DA 4C2AA 2IV2X 5L3RA 3DHYA 5ERGB 3T41A 2ZBFA 4N5NA 4FMPA 1NATA 1X7WA 5EMNA 3UMYA 4F92B 1Z0UA 3M9LA 4MKRA 3WCQA 4B6WA 1YGPA 3U0BA 2NUTA 1OTHA 1Z5GA 1T5LA 4LSWA 3T4EA 1K8RA 2EDCA 3BD9A 3O4RA 3ZZNA 2AUNA 2PS1A 4DT1A 4MAAA 3I76A 5EHXA 1DPFA 5C31A 3QELB 4PFQA 5AK0A 1SQSA 5TMPA 1BOOA 2J07A 3H0KA 2AWNA 3AM4A 3K1YA 5J5VA 3T9BA 2QBYA 1D2EA 1W5EA 4BRWA 1RHKA 1J7AA 2NVUB 4M54A 2AN9A 1E9CA 1IH8A 5A4DA 1RYYA 3DL4A 3JSVB 2YZMA 1IG0A 1B93A 1RLJA 1T6XA 3LBNA 3SFTA 3U09A 4PVOA 4RGOS 4TXHA 4Z4IA 1I4DD 1ORDA 2DFVA 1JLLA 1OJLA 3GGCA 2QJRA 3IOCA 3PICA 4IYJA 4LBWA 3HSKA 1P45A 1FFGA 2F67A 2EQBA 4IJ5A 4O8ZA 1AMNA 1BVHA 2IYNA 1FLDA 3CX3A 4AKGA 3UXEA 3VPFA 3U7GA 4S2EA 5D85A 4QDZA 2N1MA 1NP7A 3CNLA 5K45A 1CW2B 1RPJA 1XZJA 1GDHA 3A9KA 3KXIA 1MT0A 3PPVA 4LCJA 3K0FB 3Q3FA 5SY6A 1CJBA 4H0DA 1FJGB 4LXGA 2JGAA 1GB1A 5D94A 1DRJA 1LI4A 1ZKMA 4RWZA 2PRYA 4QYWA 3RASA 2W2LA 1TKCA 2BGWA 2WYUA 1MZVA 1U7UA 2FX2A 3UWPA 4B5LA 1Z5NA 1H6AA 1ZL2A 2FW9A 2VPWA 3LK7A 1TCAA 4HNVA 2QUAA 3DUFB 3GFQA 3KYIB 3MEQA 1IAQA 2F1HA 3A1CA 3N58A 4ND4A 2HO5A 2XGMA 3BWYA 3BMCA 1LPPA 3CHYA 1JG2A 2JGNA 3M2TA 3NHLA 4JT8A 5LFAA 3FDIA 3KYCA 4MKGA 4LHVA 1YR7A 4FKBA 4NZMA 1GNLA 3QW2A 1UC5B 1FW6A 2CSXA 1HQDA 2C8LA 5H68A 5IC5A 1JNYA 1ECPA 1GNRA 3DKKA 3QLJA 5HZKA 1IN5A 5JAPA 1IGCA 2JC3A 2X4IA 3R3WA 3Q8AA 1A9OA 3IEUA 5DCNA 4V0MA 3TW8B 2IIBA 4LVNA 3H7PB 2HIHA 2Q5JA 4AYXA 4UPEA 2A0YA 1DXQA 2FZEA 1QTIA 2FU5C 4G07A 5JG7A 5KSYA 1EVLA 4II2B 4UXIA 2O48X 2AXQA 3E5NA 4UPDA 1UDWA 2JBWA 3G0HA 2X8LA 1EBUA 4D3YA 2JYEA 2A5JA 2P6NA 4ZDKA 2WUDA 1JQLB 3D64A 4OY3A 2C2OA 3P0JA 2FU6A 2E3JA 2VKTA 3IBFA 3DKPA 4AT1A 2CL6X 3GEMA 2JX5A 2X3YA 4HZIA 2O2VA 2QM7A 1N0IA 3BMQB 1PDVA 2P2DA 4W9IA 2A9FA 2X4DA 3DBLB 4D1UA 2CFZA 3RI7C 2YVAA 4JITA 3TSSA 1G8PA 3JR7A 1ZUIA 5BNFA 1EX7A 2XNSA 5JZVA 4YTPB 1VM6A 3FCZA 1YVDA 4Y18A 2J9RA 3U62A 4F9FA 1W9HA 2OZEA 1LNQA 5CX3A 1JG4A 3C7AA 3QM1A 4KI0A 4MW1A 1XQQA 5H02A 5I9LA 2D1FA 2NUPA 4GLSC 3KXKA 1LBSA 3H1FA 1ZXHA 1H3FA 1MB2A 4NAHA 4R9VA 3GNQA 2GESA 4FU0A 5AT1A 1XT6A 4PSKA 2PSSA 2ZGVA 3KAJA 3ESQA 4G3XA 2Z0EB 1VJGA 2F3TA 1CK1A 2X3FA 2I71A 3NM4A 2PRJA 3NXSA 2EZ9A 4PCUA 2O8DA 1WHTA 2JH9A 1M6HA 1V5EA 3IMCA 4AJLA 1Y5IA 4TXMA 3GJRA 4KOAA 1JSRA 1AQIA 4WH4A 2FPXA 3MWJA 4BGVA 1A70A 2LZ6A 2NO0A 1RHMA 2ZBPA 2A1IA 4XYBA 4UJ3A 1K88A 1WUKS 2WJ3A 2ZJAA 4U2EA 2N1WA 2QZ4A 5CLLA 2AIOA 2RHGB 2YOHA 1X0XA 2XCRB 1T2DA 1YHZA 3G23A 3GL9A 1RWXA 4R8LA 4E7OA 2R8RA 1DJQA 1IUKA 1V1MA 4CR6A 2I4RA 1QIJA 3RSQA 4AUNA 2OY0A 4RZHA 4MVJM 3S29A 2KX7A 2JF0A 4P5PA 5TEVA 4ENSA 1RTKA 3QTTA 3G6KA 4TN5A 5FKAC 5F64A 1P2DA 1EO6A 2WT4A 4YFVA 4BKSD 5EV8A 4XEUA 1RQXA 1EYZA 1KERA 3BIOA 3HCOA 3FI9A 3NBUA 2RK4A 3KHSA 2ZYUX 2AG1A 1SMKA 4L57A 4DMUB 3NEJA 5C51B 4OYHA 2Y4NA 5AXDA 3TVYA 5JJIA 1RLOA 1AHHA 4S1WA 5A1JA 4B2IA 4ZHQB 3KUDB 1CIVA 2VJMB 5AM4A 3H3FA 1D03A 3RUDA 3LUAA 1VB3A 4JU9A 5CXSA 2W48A 3QHQA 5JSZA 2KZRA 3EAQA 5K6TA 4EQ6B 1LBHA 4IO1A 5KQMA 3WGMA 4JOCA 2WNMA 3SU8A 4BNXA 5BV7A 5LUAA 4GOKA 1HDXA 1LZKA 1Y3CE 4KSCA 1PV1A 4WZAE 2WSLA 3DONA 2C00A 2OB1A 3A9WA 3PEUA 4BCDA 5ACPA 4JLOA 3NALA 5L6MB 3PKIA 4M0UA 4PIMA 3A1SA 1UZLA 5FOWA 2FU7A 2Y8BA 1WXEA 2Q8QA 3EYAA 1P5RA 4ZJYA 3DW1X 1Q7RA 2C4HA 1QT9A 3PQ7A 4GQIA 5HKKA 1EMDA 4CIXA 3AUJB 3SEFA 4CDGA 3AEZA 2CLSA 3GAZA 4GI3A 5SYNA 3IERA 2CMGA 3FWYA 3HU3A 3BK1A 2HMSA 4YRGA 3MGBA 5A4IS 1X0VA 5CTJA 2OXIA 1K4KA 4V02A 2IEAA 4BVLA 3P5SA 4EUEA 4GYKA 4DJ5X 1PK9A 1P9WA 4BAGA 2IGBA 2RGDA 3N2LA 4RCZA 3JZAA 1HBJA 1CX9B 3TOVA 1LVGA 2Y6UA 1W36D 1E3IA 1F5SA 2IDJA 2OILA 4N6NA 4BMNA 1ES9A 4J0IA 1LSJA 4H1WA 3FOFC 3Q1KA 1N5KA 2UUOA 2RH8A 4G2TA 3CEJA 5CK4A 5JNVA 4DR1B 4RTMA 4I1RA 5JC8A 3KQLA 4IKOA 4QUGA 1SCUB 4ZT4A 3IEMA 4Z67A 5E2AA 1Z4NA 3BC2A 3C16C 3JYOA 3V2GA 3KKPA 4LYJA 3T3MB 2CMKA 2PKOA 2CB0A 4ZGWA 3PRYA 4EY7A 1U80A 4BNNA 2XNHA 4G1EB 4L3WA 1VYHA 1AHPA 3L4JA 1HZZA 1QYWA 1WB5A 3L0IB 2P6PA 5EPUA 1LCIA 4NNJB 3D3EA 4G65A 5F7JA 5JXVA 3RBXA 2CHGA 4BMOB 1J7KA 2GPNA 3QWBA 1CR1A 2X5OA 3PGKA 4TS4A 4WW0A 3FZEA 3WDSA 2JEYA 1F0KA 1UKYA 3AUFA 3G0BA 4Q7JB 3U7HB 5JNSA 3RBVA 2WG1A 4JLWA 2D1YA 1M4VA 1LDNA 2QVYX 3L0CA 4IJKA 5TR9A 5LSAA 1WBJB 2BG7A 3VDNB 1LI7A 2W6JD 1F8UA 4KLZA 2HRQA 3F8TA 1OFVA 5ALKA 1LKZA 2QL5A 5FH9A 3QIVA 5DHRA 5TSDA 1A96A 1M75A 3THOA 1D9XA 1M6EX 2RDBC 1XPJA 3R7WB 3ZQ4A 3L7CA 3CIFA 3OT4A 1OYYA 1JRUA 5BVGA 2ZXUA 3UKOA 1ILEA 4G4SO 2Y9PB 3DBIA 5SYMA 1E1RD 2MU1A 5LC1A 1XCTL 1G4AE 4RKFA 4DMLA 2E4XA 3GEBA 3HJHA 5B36A 2KN4A 4UWRB 1RQ2A 1XC7A 1N5DA 2N1BA 2ZI5A 5GONA 4XGIA 4D8YA 4E51A 5C1BA 5LYJF 2FM6A 4AECA 3QVMA 1WA5A 5DRTA 2QGZA 1M1NB 3F9IA 3FUCA 1Z2MA 4RELA 2I3GA 1RWOA 5LDHA 2VL7A 4Z0TA 1R4MB 3G1PA 4PFKA 4MHTA 1X2EA 2BFDB 3E3AA 3ECCA 4LHWA 1FO4A 3OJXA 4NOJA 1XXLA 4JUBA 4BMSA 3RYIB 4EBFA 2IHUA 1JTFA 5C81A 3NHFA 2C60A 4KR9A 4A8PA 2DWOA 2J5RA 2ZBRA 4PPGA 4RPKA 1U5CA 4UEOA 4BBJA 4G1BA 1UFQA 2BVCA 3QA8A 3NNNA 1B1CA 3PHLA 3B3JA 2C7HA 1UMBB 3UOWA 1GEGA 2A9VA 4X41A 1L2TA 1V7QA 4PGGA 5HEKA 4EOGA 4KR6A 1ZOOA 2XY4A 3EA5A 3JQ7B 3FNEA 3RRMA 1V5FA 4CDRA 5BNTA 1EWCA 5JZEB 1P5ZB 3H4VA 3IPXA 4LJLA 2W42A 4JLMA 3BGWA 1V9SA 1EVKA 4Z51A 4UMVA 3FPEA 2B4RO 4LDRA 1WGDA 1J2EA 1LTHR 2QU8A 3TYXA 1MX1A 2H54A 4AMGA 4ZK6A 2A84A 9MHTA 2Y27A 4QPCA 1V8DA 2BFKA 1CJEA 4TKZA 3OLQA 5JSKA 4AL4A 3BHIA 3BF7A 4TS9A 4OBEA 1FDWA 4RORA 3TX6A 4FD3A 4GP9A 1KU0A 2MSEB 3BFPA 1FS5A 1GYRA 1E3SA 2RHLA 3F6SA 4FR5A 3UNXA 3VI3B 5ARCA 4PNZA 3ZDYB 2UZ1B 3O4IA 3SQNA 2FFHA 1KLVA 3PQDA 1DEOA 1X77A 2G07A 3MWLA 4TRMA 5BWMA 2VYFA 3KFXA 3QPDA 3PE4A 5IAKA 2VP4A 3T54A 3ZD9A 3A2KA 1Q0LA 2HCRA 4D44A 1ZD3A 4FJYA 3A6KA 3GEGA 4N58A 1EFUA 5H83A 4R1PA 1AE1A 1TZKA 2HCTA 2DCMA 1DKNA 2PX0A 2R6CA 4LJ5A 5JFOA 1HX7A 2BKVA 3QZUA 5TDHA 2K2QB 4AJ1A 2PZEA 4YLEA 1HXYD 3KR0A 3KOYA 3ZRFA 4URKA 1YZQA 4U00A 1CQIB 1DKUA 3GGOA 1LPAB 3VNAA 4F6RA 5EJFA 4E12A 2LVQA 1QE0A 2KDMA 1I3CA 1UJNA 2EJVA 2AXNA 2CLKB 2V7EA 2VXOA 1QH0A 3AF1A 4HXYA 4MAMA 4DLKA 2P77A 4DRYA 2GCNA 5BP7A 1WR8A 3KQQA 5IOIA 4Z4EA 3ZLZA 1GNTA 1HDIA 4R31A 2BBSA 2Y1OA 4WZ6A 2FPGB 3MF4A 1WKVA 2ILTA 4CZ2A 1ENPA 3WL8A 4IOIE 4F93B 2ZJ6A 2OCIA 2P1ZA 2Z1MA 3I3SR 5T6BA 2CVOA 4KNYA 1PLJA 4K7SA 4UATA 5A03A 2H7XA 1BWQA 2ICIA 5DIFA 5CIWA 4E2YA 2QKYA 5AK3A 3NBZC 1NVMB 4A6EA 1GL6A 1DU4A 2AXEA 2GCOB 1SU7A 4EG3A 4I08A 2J4XA 1E3JA 3WYEA 3DTTA 1E69A 1PL0A 2COUA 4QDOA 4I1OA 5A4AA 1QMGA 3C0RB 5GZ3A 3QMWA 4H3KB 4KFTA 3RK4A 4K86A 3RS3A 5FTLA 1UFRA 1E4YA 2P62A 1FZQA 5IBCA 1ZU5A 4JBYA 1BIFA 3ANXA 4ZVUA 2BGKA 3SR6A 2JGLA 2Q4EA 4UHDA 1JHVA 2R47A 2VNSA 3D6TB 2WXRA 3H1AA 3RVNA 3TLCA 7REQB 3DR3A 1KYTA 1XELA 3PG5A 3TPZA 4CQMB 2ZWRA 4IX9A 2ZR8A 1YJJA 4RCYA 4PRZA 3S2ZA 3UQYS 4OM7A 1IBRA 2O1WA 3EXG1 4MR7A 4AJHA 1Z22A 5I6DA 2JLUA 2JG3A 2N9PC 4KXYA 5AJUA 3JW0X 5F3WB 2ODWA 4QQ8A 4UCWA 3X1WA 1IWBB 1DUIA 2I2AA 3ZGOA 1H1DA 3ME5A 1ODJA 1T9GR 3WK5A 2J5XA 2NS5A 1FP4B 3RYCA 1TAUA 4FLEA 4L7QA 2QT9A 2C3MA 3KELA 1T4DA 2X5JO 1GIAA 4I5GA 2P8SA 4OA5A 1MX9A 3HVJA 4FMDB 4BNVA 5DK6A 2CLIB 3IVFA 1G9SA 1KL7A 2BTOA 1COWD 3AE6B 1ESMA 1K8XB 3CPEA 4DHWA 3ZV3A 4D41A 4V38A 1JXAA 1H6BA 4MH0E 5B2FA 1LWNA 2XGOA 2QD2A 4QQKA 4WXYB 4POAA 2EQ5A 4ARAA 4MYSA 4W82A 2F62A 5BW6B 1GQYA 3R0VA 2IYZA 4TYQA 2YCLA 4WLOA 3VPCA 3HXQA 3C3DA 3ZTYA 4RTKA 1LX6A 2YYAA 4V0ME 3OWXA 4BP9A 3MJ5A 4MWGA 1I2CA 5CXXA 4D9KA 4JLNA 4FEGA 4CQMA 4AY5A 1GADO 4K26A 4WFQA 3SPXA 2PUDA 3MSXA 4G84A 4LVUA 4BV2A 1QP8A 2AQ8A 3DP9A 3O95A 3V32A 2OHHA 2ZYGA 1GG9A 2LGYA 1V7ZA 3PNKA 2ZRDA 1QS0A 5GMVA 1V3VA 3E3OA 4PQYA 2UVDA 3T0GA 2P0EA 2FCRA 1UR5A 4BAZA 4CKCA 5DX8A 1FXSA 1HRDA 2R1UA 1E8ZA 1QP7A 1H1LB 3OO1A 4FGUA 2IEYA 2UZ3A 1VBMA 3DF7A 1NUQA 3WMXA 4CODB 5CITA 1VHQA 1TIPA 3ZI7A 1TOAA 3ICEA 4F4CA 3RABA 2J3QA 3E5MA 4LE6A 3ANMA 3LNCA 3EGIA 3JSAA 1RWQA 2M6LA 4HAVA 5HUQA 1WMHB 4CV0A 3WNCA 5DYIA 5HKAA 4NQ4A 4DTIA 3WLSA 5LDDC 4LNFA 5IKMA 3DS8A 3HBLA 3WLHA 5LJLA 4TYNA 2L82A 1QZTA 2JGRA 3AJ3A 4DIMA 5H9WA 1MD9A 3PFBA 1KI3A 3IT1A 3TCXB 5BUCA 1LK7A 4RL4A 3KSBC 2FCMA 1L5KA 3BIJA 2B7LA 3NATA 5KNDD 4CCYB 2VT7A 4LOAA 3LHKA 3U9SA 4FM9A 1EF5A 4ZI7F 4NZNA 3CF6E 1CVRA 4G8JA 2C82A 4HDQB 3TQIA 5AIBA 9ABPA 2QTGA 5KYXB 4A82A 4DDID 1JVSA 2L3ZA 3UPUA 2R61A 2FLKA 2RC5A 3IT0A 4D8XA 3OCZA 3IAS1 3P9XA 4LGMA 5BYQA 4AG6A 4F4HA 2GCUA 3OSUA 1DQPA 3TL5A 1KXZA 1NAHA 1WJ4A 1XRQA 4I9FA 1U1GA 5CH3A 3ZU4A 4UAUA 3PQ5A 3ZHBA 5EZYF 1MF7A 4U5QA 5LXTF 2DUWA 4RTNA 3IHLA 1QIDA 5J1TB 1WX8A 3JU3A 1QUEA 3LBAA 4FJ0A 1CZRA 4D74A 1JKFA 2EX1A 3PI6A 3HKCA 3GQVA 2L0FA 2QF7A 2OD7A 1KP9A 1ORIA 5EXDA 3R76A 4L73A 5DYYA 1HG1A 4H6XA 4JL9A 4YDHB 5JXWA 5LOVF 4PG5A 5ICCA 3DZBA 4AIIA 3RSCA 3E9QA 3I01M 3QEJA 2ZJFA 2ONJA 3MUOA 1PFQA 1HKHA 4L8YA 4MR8B 4HSGA 4MUXA 1KR5A 1S8FA 3YASA 3D02A 4AD8A 5BMVA 1W4RA 4L76A 5F73A 4B95A 4YWJA 4YRLA 3P71T 1TMYA 3DMDA 4OVKA 3I5AA 3I1IA 1K8QA 4HCPB 2OWEA 3HVKA 3IODA 5FBLB 5FA5A 4YMHA 4AY6A 3DTNA 2BF8B 5DGCA 3U49A 1N1MA 1CVLA 4XIFA 2O8BA 4M7WA 1WHTB 1U0GA 1PL6A 1CWUA 2OEPA 1WIAA 4FGWA 4NAUA 3QWAA 4HN9A 5CURA 1CIPA 3AVYA 5AEBA 3I6IA 4TLLB 3CX6A 1I4GA 1RLMA 5KHOC 1ZD8A 4RETA 1I6WA 2BKAA 4F4FA 3CVYA 3OIDA 1K89A 2ZRCA 2NT3A 4BFWA 2KWVB 1A3CA 5LBUA 2CHUA 2MLBA 2BFPA 3GR6A 1CR2A 3W8DA 3ZTTA 4KL8S 3HI4A 2ZG6A 2PZLA 1ZVMA 2VFAA 2DULA 2BWES 3E9EA 4LPSA 4RZUA 1U9JA 3IAS6 3CVJA 3MCVA 5I9IA 1L4LA 3I9OA 4UBLA 3NNSA 4UUOA 2QAJA 3GJ8A 4A3OA 1TYCA 2I7TA 1EK0A 3TKYA 1GITA 4UZEA 5JCXA 5JVDA 1V5TA 1SD2A 2BHLA 1M2FA 3DLBA 4AWAA 1UOQA 4G11A 1JKXA 1YRWA 2QLBA 3Q40A 3C45A 3CLKA 2CZGA 2QJOA 4WGFA 5E6RA 4U0JA 5TQ2A 3HKBB 3R5KA 4WBNF 1J9GA 3F4BA 1IZ8A 2ZI9A 4YSYB 5BRAA 1A1VA 2ZJDA 2I1WA 3V4ZA 2EDAA 1PWYE 4K6HA 3U2SC 1O6CA 4R16A 4NWIA 5C34B 4Y2UA 4D0RA 2CNKA 4ZJPA 2O8NA 2G06A 4ZRKA 1EU1A 2D3BA 1IDN1 2A67A 1KZ4A 1IK6A 1A9XA 3AR6A 3BFJA 3PQ4A 4K9QA 3ZQKA 4BV9A 3OJ4B 4ZHPA 2G70A 1CRPA 5AOBA 1XR3A 5K3FB 2QLFA 1EU3A 1UMDB 2ET6A 3HZOA 4H7IA 4NCIA 1C4XA 3G17A 3N7AA 4G50A 1W2HA 4YGYA 1U4OA 5CX1B 4WFJA 1Y6FA 1NRWA 1YSCA 3AR7A 1T8YA 4MV3A 2I2YA 1SA0A 3PD0A 4O2LA 1BDIA 4QTZA 2PMVA 3U7JA 3CRVA 6REQB 3TMAA 3VC3A 1ITZA 1I4TD 4MA5A 1PWEA 2VOEA 3IUEA 3KEGA 3HJTA 3KT8A 4JKYA 1ZWLA 2ZT5A 2VPPA 2ZSDA 5NULA 3JD4A 4BNKA 3B5IA 4LXTA 1V86A 5J2TF 3QAQA 1QBKC 2O2EA 1H9BA 4NBLA 4LF7B 2H88B 4MQBA 1RKBA 3FAIA 4E32A 1SE2A 2DH5A 3GEEA 1Z8DA 2XRMA 1MVKA 1YHYA 4YRJA 2K3UA 1G8SA 3I6BA 4MPTA 4XVQA 4RVOA 3HA2A 4LTMA 3IBGA 5FHQA 4LISA 3WO0A 5T67A 4OQZA 1QZUA 5GVSA 1ZGUB 2LIPA 2K8CA 2NZ2A 1U11A 3GYBA 4YXFA 2LVBA 5G1PA 2M5CA 3JRXA 1XF1A 2OORA 2QWXA 5D1NA 1Z5OA 4HWRA 3WADA 4W5TA 1E8MA 2GS9A 5CX4A 5B1IA 1U0BB 3AC0A 5A9TA 4WLVA 1TLFA 2TS1A 1SXPA 3VR5H 3T7DA 1HRKA 3RULA 4N0DA 1W36C 3GB1A 1HEIA 3ZY5A 4QLAA 1PQUA 2CBXA 3N2KA 1XLNA 1N78A 1POWA 2I03A 4OREX 4P36A 2JKVA 5CK5A 1QHEA 1V41E 3FDZB 1E8WA 3S2YA 1R66A 3MP9A 1E9AA 2FXIA 3KEFA 3IT3A 4D6PA 1QVAA 3AVQA 2NSYA 1UDRA 5L3SA 4YSLA 2YV1A 1XPRA 3DXFA 4F2WA 4W9FA 1JV2B 4N1AA 2R2QA 1T1SA 1DRUA 1FNDA 4B7UA 2NUTB 1M34A 4RH6A 5AD1A 3TJPA 1D3AA 4LQ4A 2VJBA 3OZGA 3QBEA 4OKNA 4WBSA 1C7IA 3V9AA 4RIHA 1F6BA 4DR4B 1KEVA 4ARIA 2C5FA 2IXBA 5E9AA 5LWQA 3EJWA 4X20B 2QTAA 1R18A 3HB5X 5LQUA 1EFDN 3BTVA 5AI4A 4GNRA 1QU3A 1KZ1A 2EW1A 5AOCA 2WJVA 3M2PA 3R0IA 5FP0A 5JDCA 2UVPB 3WICA 3QH8A 1I42A 1U2SA 4CKWA 2JFVA 2WMNB 3OG9A 5TS2A 1XEEA 1JW9B 2WUGA 3IILA 3TE7A 4ZYVA 2Q3CA 2BP7B 4U7FA 3ZCXA 2Q5LA 1JVBA 2GBMA 4UW9A 4OVUA 1Z15A 4HQRA 4V0NA 3UXHA 3QWFA 4CG2A 3R0JA 4DF3A 4ZVLA 2VNIA 2KD0A 2FE1A 1W0CA 3PRKE 2AKAB 4BWFB 4KBGA 2JU6X 1NDDA 5CU7A 3I2YX 3RWOA 4OXXA 2AQHA 3T0IA 2I6XA 2DZDA 1RQGA 1YDWA 2Y8AA 4NAWB 1RKQA 1RQRA 2OCBA 3C7KA 4FJ1A 5F4ZA 4BIMA 3WJ2A 2JLAA 3NVKI 9ATCA 1ZH6A 1LBTA 2OAGA 1OLXA 2P40A 3DAOA 2FY8A 2ZYDA 1ZK0A 3C3KA 4UE6A 3C5EA 2GA9A 4C08A 2L0TA 1L1RA 5GJCA 3B2GA 4BFVA 3RREA 1ACLA 2IKSA 3O2SB 1Y6GA 4MUKA 2RAUA 3D2CA 4QHTA 4BOZB 3PFGA 4KJXA 2QI9F 4KDCA 1RLFA 1I13A 3RTEA 1C3EA 5JMPA 5IPFA 1EUDB 4A92A 3AUSA 1RD4A 1PSWA 5H8YE 3FCEA 1XDZA 1WHSB 4XCXA 2QTZA 1DT5A 3UJDA 2IZ6A 1TI7A 3O4JA 4IF6A 4P6VF 4L5BA 4WMLA 2AW3A 5IAEA 3WLFA 3JD3A 1JG1A 4G1VA 1PTJC 1EK5A 1Q6ZA 1KVRA 2VP9A 4IIGA 5AKZA 1GPDG 4IDBA 4QG7A 3DAGA 4NJOA 5FNZA 4ZVNA 2Y1DA 4E30A 5CA1A 1M76A 3RYIA 1L4YA 4NYJR 3OMLA 2D62A 4TXJA 5EHTA 2FFBA 3ZLTA 3FRIA 3EA4A 1OILA 1RWPA 4OZBA 1LLUA 2FWAA 5EIAA 3R9KA 1DWOA 5AM0A 3QP9A 3F3SA 4B3DA 1LM8B 2W3SA 3TL3A 4WNYA 2VTKA 4JUAA 2OLEA 4AIRA 3IALA 4YUAA 1KQPA 3HUDA 5KTRA 1WWTA 2KXJA 4Y6SA 3QYPA 4AZ3A 1MRNA 5AVJA 3UK1A 2NBWB 5C1PA 4RV4A 2QM3A 2HRZA 2R84A 4E7PA 1BE1A 2PVGC 2QUBA 5KJEA 3AHIA 3C19A 1WETA 1I7DA 5C8YF 3EVAA 3H05A 3WLAA 2RG7A 1UEXC 3ELYA 2Q6OA 2F90A 1KZHA 3GRUA 4MUMA 1N5WA 4WLFA 3NYRA 4UU1A 4FMCF 1I2ZA 4OVVA 2O57A 2YVKA 3RIGA 2ZZNA 2H7VA 3CUSA 3KLOA 1P3DA 5JXGA 1GQQA 4R1UA 4G37A 4Z8XA 3RI3A 2AN5A 2QE6A 3LTEA 3Q2KA 3HM6X 2XQKA 3I2JA 3KIPA 4YT0B 2YCBA 2Z3WA 2PX5A 3QYJA 1E32A 2Q0SA 2QRHA 3KB6A 2LCFA 4QYIB 4XIYA 2XMCA 3KVRA 4CU2A 3SX0A 3GI1A 3WVNA 5B2EA 1ODIA 3DPSA 2FG5A 2ZJBA 2PA0A 1W9MA 3AIMA 4Z9BA 3VV3A 2ADMA 2WB4A 3NHMA 4ECAA 2BM9A 4XYLA 3T4UA 3HUEA 1LLQA 3KPYA 1ZJ4A 3ET5A 3TF5A 2VHJA 1VYUA 4B0EA 1OAAA 1CUIA 1MA0A 2HQ1A 1N5XA 1R8JA 3I83A 5GPBA 1ZN9A 3VKWA 4ZNBA 5ES4B 2CNLA 2CSUA 3L7MA 2PCLA 4KN5A 4WIAA 6Q21A 3QPWA 2I3DA 2I62A 5JH5C 3CW2A 3NG1A 4DMHA 4OEHA 3K35A 1QDLB 4J0JA 4TROA 4JQYA 5CYOA 1F7VA 2DR0A 3O47A 4BLTA 2Z2KA 4HYEA 3ZNZB 3P9IA 3JALB 4NQRA 2I80A 4ZRDA 1AMOA 2FGKA 4GDLA 2YZ7A 3R44A 1DO8A 2JFUA 4EARA 4CN9A 1JRPA 4BFXA 5IVDA 4MM3A 2ZT8A 4RPLA 3EY9A 2YJNA 4MTLA 1CJUC 1NQWA 3O94A 5FRDA 1OBOA 1NXWA 3P0RA 2ZSBA 1E7WA 3FWZA 2QT0A 1OREA 1MC4A 2JLSA 2ZAIA 3CF4A 3I23A 1WXXA 3PXUA 3B1LX 3OU2A 4XARA 2G6BA 1LS6A 4TZ9A 3PQ3A 1GU0A 3FYCA 2ZANA 2P1RA 3QXSA 5I48A 1U3UA 2WJHA 1RVDA 3KTFA 2XEDA 4MWDA 4N5DA 2H6AA 4KP7A 1GPMA 3EDOA 4UUPA 3PV1A 3ZV5A 2RGBA 3LWBA 4J16C 4AULA 5KX5A 4TYTA 3G2OA 1ZJJA 4KBFA 4B40A 4NDNE 3R1IA 3WSTA 3JQBA 3SSNA 3V2IA 2GXUA 4AMYA 1RM4A 4INZA 4OQNA 1U99A 1N7HA 2QY6A 3DNFA 4AY2A 1XL1A 3HRDD 3T7EA 1KYZA 2IJGX 3NVDA 3R3XA 4BNMA 4NMMA 4RM9A 2CHFA 2RHRA 2VJKA 2IDYA 4BB6A 5CTAA 5CB4A 2A1UB 1UWLA 1UFOA 4FD2A 1G3IA 4O0LA 1VJ1A 1SEPA 4EHJA 6ABPA 2INPE 4OQFA 1D5MC 2ID4A 4YTMB 3I9JA 4QYSA 2NZEA 3PUXA 5K6AA 3TEYA 4JL8A 4WOKA 2F59A 5E1OA 1R5BA 2QG6A 4XSGA 2QRLA 1L4DB 1E3QA 2H9IA 2XMDA 3B48A 1WP9A 3RYFB 1AB6A 4UNQA 4ZHQA 2C9WB 4A73A 4Z0HO 2KI5A 3IMKA 4MW6A 3IQIX 4ZJZA 4TV3A 1NVAA 4Y30A 3GFSA 1GL9B 4W7HA 5AKYA 2ONQA 2FUKA 3QWIA 1MJNA 4HS9A 4JI1B 1YZYA 3R3SA 1GPH1 4IM7A 4JASB 4CM3A 4DCGA 5CDTA 5L4SA 2XZLA 4BFRA 1YCGA 1G7SA 3V4OA 3QEMB 5KS2A 3SLGA 1UK7A 2WVHA 2DQYA 3CA8A 1DRKA 4B75A 5KSOA 1F1BA 2BL4A 1ZKHA 1EGHA 1QYXA 1FS4A 2F1IA 2JHPA 3GGDA 1N7GA 2CFSA 2JWZA 1WMBA 2P2YA 4JLAA 4R5MA 4XSVA 5CYPA 2OAQ1 5KOYA 4E5MA 2X6QA 2C92A 2D2VA 4ZPXA 3MTDA 1JL3A 1HC7A 1HQCA 3BTOA 2FHPA 3CYFA 3Q1LA 5LKAA 1UK9A 1AXEA 1V6SA 1P81A 3PD7A 4NYIQ 3S0JA 1VZ3A 2E21A 2L42A 5C3MA 1G3RA 2YHBA 3AONB 3PFNA 2ID9A 2QM8A 2E37A 3KR2A 4MIEA 2F43B 5K8JB 2W98A 3HLTA 5IEBA 2DBVO 5ETJA 5HRAA 1A8PA 3VNRA 1KAMA 1D4OA 3L77A 4RK4A 4CO7A 1RFKA 1F60A 1BE6A 1RYMA 2BCGY 3OZVA 4I0WB 4ENUA 3QEBZ 3H75A 5H7XA 5B6JA 1V16B 3BB1A 1BDMA 2PEAA 1DEKA 2X5NA 4ZT3A 2XYVA 2QL6A 4GU5A 3ZW7A 3QU7A 2PQ0A 1X94A 2KVRA 3O3OB 4IFIA 3W78A 4EMBA 3U39A 2P75A 2WBLC 3H8WA 1FXIA 4OJTA 1FCCC 1P39A 2CUKA 2ZI3A 3DT6A 3G5TA 3GJ0A 3PITA 4X00A 4CLXA 4YLYA 3OZIA 3DEFA 3TVDA 4AROA 2PEZA 3UK2A 4IM3A 5C1ZA 2AS0A 2DFLA 4N9F4 2PX8A 3QXHA 4MVWA 4QQNA 3RKUA 2AJDA 1M6YA 2NG1A 4EJMA 3SBEA 3PO0A 3WA0A 4CEJB 4HDNA 3T38A 3LO8A 3U3OA 3SQMA 1C2TA 1MVOA 2WOOA 2E5LB 1YULA 4NYJQ 4W7IA 4ZHSA 4MHOA 4R0VA 2Q5CA 3GF4A 1I7QB 3QX3A 4Z53A 1JT9A 1JX6A 3M4ZA 3PXAA 4DLZA 4CTNA 1XKQA 4N7BA 4OHXA 4P33A 1W5SA 4KUEA 4WIPA 3N76A 1XLWA 2P5YA 2Z2IA 1NN3A 3K9NA 1O94A 3W7VA 1HZ6A 3D1VA 4YXDB 3KZXA 4FX5A 4LC0A 4ZZ1A 4X1IA 3WYBA 1NMEA 1GKUB 1X1TA 5CCXA 4GICA 1F06A 4Z4FA 2NYAA 3MCUA 1LV7A 5IT9A 2ZSJA 1W19A 3DEZA 1GUAB 1UBNA 2I0FA 2OESA 1AS3A 4HPLB 1RADA 3LE8A 1GLNA 4C7XA 4WN3A 2DR2A 4XTRA 4PSAA 4UWSB 3G5AA 4IZIA 4CLOB 1DI0A 2WI8A 1XK6A 2WSMA 3R3ZA 1QRTA 1Z2CA 1RAFA 4M1ZA 1JMLA 1GKKA 2VUHB 2KBFA 1UD7A 2W70A 4BO9A 4D4JA 4GSWA 1A8SA 2Q9BA 2WU0A 1HGXA 1XRNA 1IK4A 1B74A 3BMCB 2DX7A 4IXNA 5EQFA 2P9QA 4MWZA 4Q1VA 1M1YB 3I63C 1TW3A 4M0WB 3D8BA 2O3QA 1FSZA 4IW0A 1WEKA 1GGNA 1JA9A 2WJ6A 4EHLA 4EW1A 1Q7TA 3F90A 5C80A 2DX5B 4Q9DA 1GR1A 4HEQA 4NZLB 4IV0A 2O59A 2HE7A 3DV0A 1B6GA 2JK0A 4WBNB 2C07A 1FTSA 3SS7X 2HF2A 5FEUA 3NZ3A 5HH4A 4RY8A 1OLUA 2PVPA 2HA2A 5KIAA 4W5NA 3GFGA 2YFYA 2P5TB 1SKUA 3EARA 2AOTB 3AHCA 5JSUA 5AHWA 5KU7A 5CX1A 3STHA 1JEQA 1G21E 4TTQA 3TQFA 3RW9A 3Q8FA 5IZCC 3MGGA 1TK9A 1N2ZA 3DDUA 2DM6A 5E2IA 1V71A 1ISIA 2XZPA 2BFOA 3L18A 1AARA 3QFCA 1BDHA 2O8EA 5K4GA 2IO2B 3BXFA 4WK6A 4ITVA 4PQGA 5A7FA 4W9DA 2P1EA 2QZPA 3LCVB 1PX2A 3SCZA 1N0VC 5AVWA 1CZPA 3RC7A 4M88A 2PGAA 1W87A 3COJA 3EE6A 1CQJA 1UXOA 2VBIA 2C61A 2JDID 3OF5A 3T1NA 1DLJA 3F47A 1ZJWA 4YMSA 1T0RC 4M6WB 2VDJA 4JENA 1H2EA 1IY9A 5ALEA 3DAYA 4X85A 4G63A 3VR6A 1IVNA 1HT1E 2Z8LA 3TJMA 3OLMD 5LLTA 1ISJA 1TMGE 3MSCA 1XFDA 4MWEA 1VJKA 2LGSA 1URPA 3OOJA 4GLBA 4F71A 1FF9A 4C4SA 4BFLA 1LC0A 4M8NA 1BWPA 1JKIA 1T3TA 3LF2A 5G55A 2QUZA 5DTQA 3HP7A 1M66A 5FTWA 4EHAA 1I10A 1MHXA 5F23A 1L3BA 4XPIA 3WJ7A 1U94A 4KPUB 2IS6A 1ROEA 2I78A 4ZRJA 2ZRLA 3CR3C 3Q8KA 1YQWA 1CQVA 3KW5B 1EFLA 1XZAA 2NXJA 3PYXA 4XVUA 2Y5BB 1LPNA 2JL1A 3D8SA 3MQ2A 3PXEA 4Y2HA 4FWTA 1Q95A 3G13A 4D9CA 5BOVA 5JU6A 3OX1A 4RSRA 5J2UA 2V1UA 1A9SA 4M9QA 1ENZA 2ZVOA 2VDWB 3ILHA 1MQAA 2QU7A 2NXCA 3VH3A 4R40A 1YQ4B 1UBOS 2PUCA 1YV9A 2BHNA 1NN1A 2OXCA 4QUAA 2KQ4X 4OQMA 2FZCA 4NJ7A 1BS1A 4NBVA 3B1KA 1ZWKA 2CXSA 4C3ZA 3H3EA 2A0FA 5DTIA 2KYRA 3QVSA 3RRFA 5EKTA 3O8CA 1EFRD 1US8B 3WKDA 1UDXA 1JB1A 2WFLB 1FUUA 4USAA 2XECA 4Q3CA 2BZSA 2M98A 3RNOA 4XZ3A 3ROZA 2PR2A 3WOHA 1L5VA 3D6UA 4ZCPA 4HDAA 4O0MA 4HQOA 3W2TA 2W2XA 4MI3A 1RRFA 2LEKA 1N2JA 4IPTA 3AF6A 1TPYA 1GZ7A 4H1VA 1R4MI 1EWRA 2E48A 2AKYA 1X86B 5EQJB 4RHFA 3WAOA 5ALFA 4OAPA 4N3AA 4ZOLF 1W47A 4M9RA 2PVOD 3CBGA 1UNSA 1VYTA 3CMMA 3KKOA 1DT3A 4ZU6X 2IU0A 1KO3A 1RBQA 1IL0A 2KSQA 1ZZEA 4ZAVA 4KR2A 1YZVA 2D00A 5HA5A 3BYTB 3LQYA 1P7EA 3UIOB 3VR1A 3ROFA 1X2BA 4N12A 3PK0A 3NP9A 2ASEA 2PGDA 2V5UA 4F1JA 4EYFA 4PZLA 2B8WA 2DU8A 1BD4A 3RARA 2DECA 4B71A 4Y67A 3C7TA 1JFSA 3H6HA 4M86A 1K1EA 3C6ZA 3AQIA 2RMMA 1C3OB 2NX2A 3SK0A 4G3XB 3LO5A 5HIKA 2R85A 1P1HA 5B53A 5CEFA 2PLAA 1S96A 2AF4C 5FBKA 3AL0C 1PW7A 1EVQA 3HTXA 1JQ4A 2PE6B 3T9FA 5DPSA 5AVXA 3EQ8A 2IHNA 3AUXA 3RFUA 3IXSA 2BMEA 4JX1C 1IPFA 1AU9A 1IATA 4DBZA 1W0KD 1E2DA 1YU6A 3KB2A 1DAOA 4GBMA 4BLSA 5KTSA 1N36B 2I4IA 5BMVF 4BLUA 4IWQA 3QKTA 3UMJA 2VLIA 2YX1A 3BWEA 3CW8X 3DLHA 1RAHA 3PLVA 3UF8A 2ZYWX 3QQPA 4GXNA 3VV2A 4B7XA 1RU3A 2IF2A 3OF3A 3PT5A 1QH1A 2Y0DA 3AE7B 1PR4A 3D5EA 1WXIA 5DLPA 1FVOA 4I50A 2OBFA 4O2AF 3RG2A 2H8KA 4PG7A 4JJ6A 5TQ0A 2B4YA 3V2HA 4OLJA 2R6ZA 3HVIA 2CJXA 1GNVA 5GJWC 1L0XB 2EKQA 4RJ2A 5HYVA 4WDRA 3AM5A 4EATA 1T15A 3MA0A 2V4LA 4YN3A 3JQAA 4ETMA 2PIDA 3D6NB 1EAMA 4HAZA 3OT5A 2QXUA 3VPSA 1S2DA 1HG0A 1XU7A 1EXNA 3IELA 3L1HA 4FOSA 4W9RA 1KYXA 1IN4A 3CF0A 2R1TB 4WLNA 4ED9A 4WAAA 2R7AA 3NFRA 1T9HA 4II2A 3RROA 4DR6B 1STOA 1Y4AE 1SIJA 1TU4A 4BP8A 3DO8A 1ISMA 3ETHA 4XQGA 3ZZTA 3PUYA 2FPIB 1RKUA 1Q1NA 4IYRA 5DP1A 4R01A 3X1KA 3PLAE 3QUTA 4F5DA 2W2OA 1SBYA 2GO1A 5HHDG 3DEHA 1ZMRA 1RHRA 5I5GA 2WYMC 5ELMA 2CG3A 2OMEA 2XNDA 1D2MA 3KL2A 5C23A 2DBZA 2G67A 3A6LA 3WB2A 1XWWA 4G23A 4AJOA 4R7TA 1R5NA 1JQ3A 1NJGA 1K7SN 3DH0A 4Q4HB 1N60A 1JZQA 2V8BA 3RVBA 3LLMA 3WQBA 3EGVA 1ZIOA 2WTXA 3EMDA 3NWOA 4JA0A 4RLSA 4UQOA 1WUPA 2YWRA 4UUMA 5EVDA 3IR7A 4M98A 1F8XA 5EMKA 1II8B 4HKQA 1O4VA 1QHSA 1Y9ZA 1EM7A 5DW0A 1SEVA 5F9MA 2BGUA 4JI4B 1JN0A 3P9NA 3BINA 1GV0A 3GLGB 2QQEA 3COYA 4EUFA 6LDHA 3VZSA 2NPTA 2MMGA 1VJDA 1JDPA 2FSGA 1DAMA 2DQ4A 3ZH9B 1MG4A 4OHCA 1R9JA 1P5FA 4E2ZA 1JECA 4QU5A 1G8JA 3SXUA 4M83A 1QC5B 1E6EA 4DNXA 1N6OA 3DYVA 2XNDD 1A71A 3LWDA 4Q4JA 2PWBA 4L6AA 2OOSA 1EE1A 4CIWA 1NOIA 1NVDA 1L9XA 1SVOA 4AZTA 3KS9A 4YJ3B 5FI5A 2AE2A 2H48A 5C1OA 5DPTA 3DE5X 4DCMA 1XMOB 4ZZ0A 1KH2A 4K3VA 1QVWA 4N54A 3O74A 1H5UA 3I0NA 4DGQA 3PTZA 2FWBA 1WWKA 1FDUA 4PLFA 3AK4A 2CU3A 5KNDA 3FCAA 4EKYA 1OB2A 2IPLA 4HNSA 5ES3A 4A55A 4JC0A 3JQAD 2FF7A 1PGOA 1PJBA 2Z04A 3QVWA 4ID9A 3DOIA 1X8XA 1E3WA 2ACVA 1IYZA 2AL7A 1N4DA 4IWOA 1GJRA 3EBOA 3GDHA 4NVRA 1UPUA 4Z54A 3BJMA 5CDHA 2BDEA 3WG9A 1IY2A 1T0JB 2RGXA 3WS7A 1L5MA 1KEZA 1P4JA 1ZUNB 1YQEA 2WIFA 4U7GA 5K4AA 2FV8A 4DDVA 2ON8A 2GOYA 4G0YA 3BC1A 4KXNA 3U2QA 1GFIA 2PXAA 1X1EA 1XEFA 4D9MA 2D11A 2VDPB 5FEMA 1KTKA 4YJ2A 3SMVA 4WJOA 4CR8A 2K4MA 4R2HA 4EEKA 5AW2A 4LI3X 4QSHA 5DXFA 4DLAA 1PGJA 2P4QA 1SUWA 3JQFA 7MDHA 1H9CA 2IVZA 1QTQA 1B6SA 1MOZA 4TXLA 1MJDA 1KPIA 3TUIC 3V80A 4RAMA 4BE9A 4TLBA 3SZ3A 4YV2A 2ATEA 5JS8A 4V0OA 1FQJA 5C35A 3LGAA 1N33B 2JFNA 3K53A 3UI3A 1NJ8A 4FUQA 2W5UA 5E6PA 3X1XA 1JAZA 5JBIA 3AI2A 3ZG6A 2Q5FA 4ML3A 1GGJA 2DFKB 2EAUA 3F9RA 1IVSA 5AXOA 1RCFA 2QJLA 4WA7A 1TK3A 1KOFA 1N2OA 1XZNA 1M54A 2C2ZA 1EK1A 1NQOA 2GBCA 3HU1A 3PIIA 5LQAA 1QG0A 5EWAA 3DCNA 3VO9A 3EISA 1ONNA 1K6EA 2PZ8A 3E03A 4DY4A 1IJKA 1F9EA 2HMWA 1KDPA 4Y2YA 5JAZA 3DV2A 2N0SB 1ZEJA 1U2DC 3ZJTA 1XN1A 2C54A 5ECWA 5AVZA 2LI5A 4J7XA 5GZ6A 3U13A 1W75A 4XUEA 3NHBA 4L4UA 1E5TA 2OZPA 1BO6A 2X77A 4X5OA 5EAIA 4AZWA 1T9CA 3LDZE 2GF9A 1T6YA 1OZFA 2K2WA 3RJ5A 3JAMA 1SOVA 4JJAA 3NHYA 5E9WA 4QTUB 1Y1SA 4GYWA 4WERA 4V0RA 4DV6B 2BTQB 1B3RA 1QB8A 4RPGA 1IRIA 1EGVB 2FMIA 5C0OE 5JQWA 1BYUA 2G4CA 4OQLA 3AF4A 2O19A 3IDZA 1KJQA 4RJKA 1Q11A 4GFDA 7YASA 3CVWA 2GKGA 2JLQA 1N6KA 4AUMA 4QM6A 5JS7A 4ZICA 3IJ5A 1GG8A 3TIGA 2CFIA 4ISBA 4A0RA 4KK3A 1SM4A 5IDVA 1UPCA 4RADA 2B92A 1G8FA 3ZV6A 4BUCA 3PWTA 4BNDB 3WKBA 3OU7A 1OV6A 2C1EA 2D3WA 4D2KA 1VCBA 2IU3A 2PM8A 2XF2A 2H2WA 3G1TA 3PDIA 1B41A 3A4YA 2XBMA 2HTHA 1CT9A 3BL8A 1SKYE 4TMFA 5LZ4A 3PQCA 4KO4S 4GGOA 1U9ZA 5L8VA 1R0KA 1YC2A 4QEKA 4F6CA 5E1MA 4X90A 1L7DA 4NNOA 1R0WA 2WS3B 5FOTA 2OCKA 2E6UX 1W48A 3AVUA 3DHWC 4TRNA 3TGLA 2HWUA 1QWSA 4ZREA 1NMSA 4I6GA 3V1YA 2IOYA 2QUJA 3HS3A 1OA1A 4H4EA 5EP3A 4KQEA 1BQEA 1DIGA 1RC0A 1KSJA 3OFKA 2NPIA 5E6SA 3S1AB 2NZYA 4GI7A 4A0HA 2AEHA 3G89A 1N5MA 4MLDA 4IH9A 4QD3A 1VR9A 2EBWA 5JO0A 2PW9A 1MGOA 3PS6A 1R9NA 1XIVA 4P58A 4OYYA 1YE3A 2R68A 3SI7A 2Y93A 1KI2A 3AE5B 1N2HA 3HCAA 4A91A 1DGJA 4IM0A 1FFSA 2QTCA 2G5PA 4L4XA 4ZT2A 1OQAA 2W6PA 5KAMA 2G82A 4W5RA 4Z2AA 1I32A 2C0QA 4I1UA 4TYPA 2II6A 6REQA 1NNLA 5I7RA 3KETA 2BW2A 4UHJA 1SCKA 3LPAA 1BH6A 4FN4A 2UVQA 2PUGA 4J5FA 1QKIA 4QPDA 2IF0A 1XTKA 1TTPB 2LZ0A 2FFJA 2ZBUA 1A7UA 3DBRB 1U6JA 4RD4A 1SWWA 5EA2A 3DBRI 3SC3A 3OQNA 4HLDA 3BWDD 2R48A 3GDOA 5EJAA 4Z6KA 5DYTA 3B60A 3INTA 3JATB 3C15C 1WZCA 4BP0A 1TQ8A 5BRJA 4NE2A 3ED1A 3QUQA 1SUBA 2A33A 3VZCA 1B1AA 3AB7A 4BGEA 2PZMA 2IGGA 1V1RA 3BXZA 5BUZA 2PGJA 1TFRA 1TEXA 5DCYA 1AF4A 1JXOA 2VG8A 3HHEA 4PZ9A 2ZTVA 3TN7A 3Q3JB 1GSOA 3RNGC 2D2FA 2NADA 4K2AA 4KQCA 4RK6A 3T7JA 5IBPA 4DLUA 3VYRB 3WGUA 4J1QA 5FUWA 4E3WA 4DBLC 1JEYB 4FHGA 1PT6A 3KL7A 3WBBA 1DQYA 4J0KA 4X8OA 5B3RA 2HMYB 5DPWA 1ODLA 5DASA 2YY5A 5DOZA 3GLHB 4HGPA 1L9KA 1DTEA 3G5MA 3MAGA 1PHPA 3NWEA 2H5LA 3MTAA 3GPDG 1ZRSA 1AN8A 3JXEA 3QUCA 5EI5A 4E5KA 3FYHA 4EJSA 5A5ZA 3A9VA 3IAEA 4NG4A 4EMSA 2DCUA 1WX1A 5JNUA 4RXTA 2ZRMA 3HB7A 3D7RA 5L4NA 4MWBA 3QU9A 1QKKA 1ZRMA 1TJPB 2QVCA 4ONEA 1FFUA 1OQYA 1MAVA 1QHXA 1UJMA 3JVEA 3U3DA 3IT6B 1K50A 1DIAA 2REOA 4WQOB 3CONA 4NU0A 3RLFA 3LFHA 5KINB 2VDWA 2O2JA 4OI0A 3UQZA 2MOKA 3HNPA 3IAXA 4QT0A 4CM4A 4C07A 4CKBA 2PGIA 1H65A 3WRXC 1YDMA 3OICA 4WXEA 2AJLI 3G1UA 4KCGA 3FPHA 2BUBA 2TMKA 3IPLA 5HQJA 3VAZA 3ZGXA 3DCJA 3BZUA 3WQRA 5H92C 2W6MA 3N6RA 3R4VA 5E3IA 4GLLA 2YNUA 1MAWA 1NC3A 1VMIA 2Q62A 3H13A 4I4TA 4KPUA 3C41J 1P1FA 5B3AA 5C46F 3N07A 2ZITA 4J3JA 5GP1A 1NM5C 3FMPB 4BKRA 4UNPA 1WCIB 3EG9B 7MHTA 3CXUA 1JBEA 3KQOA 2JJ8A 5IF9A 5B1YA 1P4RA 2NSJA 2CJOA 1O94D 3PTLA 4WXRA 1AKWA 3WRYC 3M5CA 4JUFA 4CLEA 1BDJA 1C7EA 3WJ1A 1LZLA 2H9AA 4RGVA 2DBRA 3QWZB 3H0CA 4HBZA 2INDC 3WWOA 3W2DA 1WUTA 4ZV9A 3ZE9A 4YAUA 1QJ4A 5CW1A 4QUDA 1JQKA 2XCUA 4K05A 4HEHA 1XTQA 2JI8A 5A62A 1U81A 3CUVA 3ZNNA 4AP9A 2QHOA 2JCXA 2OBBA 2ZVPX 1T5TA 4QDUA 5A9SB 4CKBB 4CM4B 3G0OA 4ETNA 5EDSA 5D7BA 1PFVA 1A50B 1ZGJA 4G5SA 4X9XA 1HUQA 1VSBA 1MXFA 5E7MA 5H8WA 1CJMA 1G5HA 2FWJA 3O8QB 1CP2A 1CPYA 1USIA 2IL1A 3KUDA 4MZDA 4HNUA 5C18A 3ZWFA 4HB0A 2QD3A 3OZ7A 4TKMA 2HIGA 5I7AA 4ALJA 4WWPA 4BO7A 1K98A 3APDA 1NVVR 3CPSA 3UN1A 4JKIA 3M9WA 1YD8U 3OKCA 1WVGA 3QE4A 3ZDQA 4WZZA 3VISA 2X40A 1R8SA 1YB4A 3RSLA 4XTCS 3UXYA 3ESAA 5LQRA 4DMFA 5BW4A 5KO2A 3KRTA 2QPTA 2HQOA 1OQRA 4CWAA 1AN9A 3PUKA 4TSKA 1PSZA 2QP3A 4HWSA 4BFSA 1NP6A 5SYAA 1NHWA 4DLWA 3DULA 3NPMA 2PK3A 3IA7A 4TYFA 3FVQA 3HMQA 3PGJA 2H1WA 3BX1A 4NAVA 2XYGA 2ZTMA 1SWVA 4DZZA 4MDFA 3B1XA 1YDFA 2KK8A 1NNI1 3G2LA 1VRCA 3CCCA 1RM5A 2Z6VA 2JZCA 4H59A 5F12A 3GJ7A 4CNBA 4Q4CA 4LMPA 1O2DA 4ND7A 1M1YA 2WP9B 3HLYA 1WAMA 4LRSB 1I5RA 5FL7A 2XJ4A 4DSOA 2MWMA 2LWPA 4RM2A 2XV1A 4P84A 2DHEA 1X7ZB 2K87A 3WQHA 2ZAMA 3MYRA 4EL0A 3M62B 1LV8A 2GZDA 1U0LA 3NS8A 1SB3C 3NH9A 3U26A 4E2FA 5IDXA 1HV8A 4GOCA 3I9FA 4IJVA 3HHMA 2I7XA 5AJTA 1I14A 3EZGA 1EPUA 3QPVA 1D8TA 1GUAA 1VXOA 3AU9A 1DQZA 3B85A 3HN6A 1NF2A 2UZ4A 4X7BA 4ZP1A 4DSNA 3AKDA 4F2PA 1NKTA 2Y6VA 1Z6AA 5K8CA 1EUCA 1TDJA 5IBQA 4RUKA 3BE5A 1OFUX 4KWIA 3L17A 1PYDA 2R8EA 4DA9A 3THXA 1PJ4A 1QV9A 4PGFA 3DWGC 4IUYA 4KH1A 2GD1O 2YWJA 2WDPA 3ERCA 1PG5A 2C04A 1TY2A 5DM4A 5DYNA 3WAGA 3CQ9A 4UDYX 1Z4IA 2J9FA 1Z5SB 1DC3A 1L5YA 3F5FA 5DLDA 3CEMA 3LD9A 4PCVA 5IHXA 4QARA 1M83A 4DAOA 1W36B 1AKNA 4O59O 4CPDA 5KYKA 4IDPA 5CLGA 4PFSA 5FBWB 3IBTA 4HDMB 5HI1A 2Z1NA 2ENUA 1FC0A 2ZNVB 2J7PD 2IP2A 3LY5A 3AL2A 3THXB 2I6UA 5P8WA 4ESEA 1RJDA 2DVMA 2H9YA 2NVWA 3EWSA 1TEZA 5FQBA 1WZNA 1QLJA 3LHFA 4BNDA 4C5CA 1Q0QA 1YAHA 3P94A 4JSRA 4F6LA 5FWYB 1EQAA 4TXNA 4PX5A 4TMZA 1ESFA 1JIIA 2PG3A 4H1HA 5A06A 3HCFA 5JNRA 3MJWA 3NZSA 1G1AA 1KAEA 1ZJ6A 2B76B 2OC4A 1XGKA 3E48A 3KQPA 3TW8A 1UH6A 1YJAA 1NONA 3FIJA 5FTJA 5MN4A 5B5SA 5L95C 1WU7A 3JPYA 5H59A 1OH7A 3R6DA 3KJXA 1ABBA 3DKVA 4KMMA 5D7GA 5ITSA 3KYCB 1DZIA 4EBBA 1R7RA 3KQUA 3V3XA 2AJTA 3HB1A 2J42A 1QVZA 2VZ0A 1NEKB 2EV9A 1G9XA 3T9DA 2E3TA 5EJ4A 2NACA 2NQ8A 4QNNA 3L1JA 1Z6PA 2FPUA 4B3JA 3L6NA 1H05A 3P20A 1EFVA 4KC0A 1YZFA 4GM4A 1QU2A 4WNCA 3VM6A 3ECIA 2P2NA 2BBCA 5B37A 1C29B 3KSRA 3U3RA 4ZI7B 1Y4ZA 3TMKA 3ZCSA 4E4YA 3WLQA 1KRWA 2ZU0C 5LCAA 2K22A 3TBFA 3W5AA 4XD2A 2IHVA 3LUCA 2ZFUA 2YINC 3WGGA 3K0FA 4YPOA 2PE5A 2M56B 1EGMB 1F5NA 3B70A 4C6TB 4JBIA 4WECA 4AKEA 4DUGA 2FW8A 4PE5B 1A9YA 1Y1RA 4EJSC 4CMGA 2XQIA 3WYFA 5JDIA 1QHFA 3EGCA 1YKFA 5HILA 1SB9A 4BO4A 1CCWA 2ETXA 4JOSA 3TQQA 1W2WB 4URYR 1PZGA 3JSVA 4NPAA 2I2WA 4RNAA 2WFAA 3RAPR 5IXYA 3ODPA 3ZLJA 3WMFA 1H3NA 1MBZA 2WHIA 2B6HA 4F86A 3AKZA 1TEVA 3SPUA 4OG2A 3FNHA 3KV3O 4MKXA 5EWMA 3SD7A 4AWYB 2JK1A 2HJ8A 1L8OA 3JQDA 2WSBA 1RZ3A 4L85A 2RHHA 4IIHA 3U3JA 1BA2A 2IX9A 5E9JA 5CFPA 3CWQA 4MQFA 2F1OA 2JGKA 3VTWA 1GRNA 2NYUA 3HADA 1E9BA 3KUUA 4MUJA 4UCFA 3QX8A 4H08A 3K8YA 5CW2A 1E7VA 5REQB 2ZUTA 1H42A 1PR2A 1DX9A 2H1LA 3L6DA 1FS6A 5K0JA 5AXCA 1J4AA 3OQ6A 4MWCA 5KI6A 1NBME 4EP1A 5LIPA 1H2RS 1IJBA 1B23P 2JJ2A 4RVDA 4NY1A 3OCVA 3ONDA 4R05A 3X1DA 4J6FA 2M0AA 4C7OA 1QKZA 1UBFA 1KMHA 1OLOA 3FBGA 2D6FA 2NYRA 4AF6A 2WP8J 3IVRA 1AZWA 1F2UA 5DN9A 1YIOA 3K0BA 1ZICA 4EZIA 1R0BA 1VLHA 2WLTA 4D9GA 1XCBA 2CHQA 4YALA 5D3ZA 4LSZA 2I9KA 3Q9UA 4Q9KA 4Q4JB 5DTMA 1C76A 4FJ2A 5GJBA 2RD0A 2PCJA 1XCPA 4XOIA 5AJVB 3WE7A 4R8SA 3Q69A 2VDUE 1TEHA 1TUGA 3AUKA 3RJ9A 5MDHA 5AWFC 3QOYA 2NPTB 3FROA 1UBQA 3LX6A 4Y98A 4V1CA 1GNUA 2E6XA 3E7FA 3AE3B 1QUFA 4MYHA 2H51A 1VE3A 2OEDA 2GFKA 5J4KA 5IXSA 2BPOA 4WGGA 4LRUA 4YCLA 3CLHA 1XHFA 4LVOA 1E2UA 4QDTA 3W9UA 3B1JA 1MB9A 4RC9A 2VHUA 3ZU2A 5LYJB 4NOKA 2EXXA 4II7A 4GBGA 1NYQA 4OK5A 3DBVO 1MUUA 4KVGB 1BHO1 2V3NA 2B3DA 1NVFA 3AHJA 3TRHA 3VOAA 2F8TA 1Q0UA 1EI9A 4Y2JA 2XMPA 4X97A 3KTOA 5K2MA