3T3OA

Molecular basis for the recognition and cleavage of rna (cugg) by the bifunctional 5'-3' exo/endoribonuclease rnase j
Total Genus 162
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
162
sequence length
553
structure length
553
Chain Sequence
SQGGPQDHVEIIPLGGMGEIGKNITVFRFRDEIFVLDGGLAFPEEGMPGVDLLIPRVDYLIEHRHKIKAWVLTHGAEDHIGGLPFLLPMIFGKESPVPIYGARLTLGLLRGKLEEFGLRPGAFNLKEISPDDRIQVGRYFTLDLFRMTHSIPDNSGVVIRTPIGTIVHTGDFKLDPTPIDGKVSHLAKVAQAGAEGVLLLIADATNAERPGYTPSEMEIAKELDRVIGRAPGRVFVTTFASHIHRIQSVIWAAEKYGRKVAMEGRSMLKFSRIALELGYLKVKDRLYTLEEVKDLPDHQVLILATGSQGQPMSVLHRLAFEGHAKMAIKPGDTVILSSSPIPGNEEAVNRVINRLYALGAYVLYPPTYKVHASGHASQEELKLILNLTTPRFFLPWHGEVRHQMNFKWLAESMSRPPEKTLIGENGAVYRLTRETFEKVGEVPHGVLYVDGLGVGDITEEILADRRHMAEEGLVVITALAGEDPVVEVVSRGFVKAGERLLGEVRRMALEALKNGVREKKPLERIRDDIYYPVKKFLKKATGRDPMILPVVIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Metal dependent hydrolase
publication title Molecular Basis for the Recognition and Cleavage of RNA by the Bifunctional 5'-3' Exo/Endoribonuclease RNase J.
pubmed doi rcsb
source organism Thermus thermophilus hb27
molecule tags Hydrolase/rna
total genus 162
structure length 553
sequence length 553
ec nomenclature ec 3.-.-.-:
pdb deposition date 2011-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07521 RMMBL Zn-dependent metallo-hydrolase RNA specificity domain
A PF12706 Lactamase_B_2 Beta-lactamase superfamily domain
A PF17770 RNase_J_C Ribonuclease J C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.580 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3t3oA03
3.40.50.10710 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Metallo-hydrolase/oxidoreductase 3t3oA02
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 3t3oA01
1KO2A 4AWZA 3ZQ4A 1VJNA 5ACUA 2UYXA 3P2UA 4GCWA 2NZEA 4AX1B 4TYTA 2BG2A 4V0HA 5ACQA 3T9MA 4YSLA 1ZTCA 4UAMA 2BG8A 4Z60A 2WHGA 3SD9A 4TZEA 5ACPA 2NZFA 4NQ6A 3X2XA 4AD9A 1Y44A 4GYQA 4ZO2A 4Z5ZA 1QH5A 5AHOA 2E7YA 1DXKA 5EVDA 5A87A 5DPXA 3R2UA 3IEMA 3I14A 2BFZB 5K4KA 2FU8A 2AZ4A 2FU9A 5ACSA 4J5FA 4FSBA 5A5ZA 2WYLA 3KNSA 2R2DA 4DILA 5B15A 3BK1A 4D1UA 4ZO3A 3VQZA 3PY5A 2YCBA 3MD7A 3DHAA 3AF5A 3KL7A 3IE1A 2OHJA 5EWAA 4CHLA 4XWWA 2P97A 5AXOA 4GYUA 2YZ3A 4ZEJA 2ZO4A 5K4NA 2YNVA 3I0VA 2QINA 5EVKA 2FM6A 4EY2A 2ZWRA 5K0WA 3T3OA 5AXRA 4RAWA 1X8HA 1XTOA 5FQCA 4J5HA 2I7VA 4O98A 4LE6A 2ZNBA 5ACRA 2BIBA 5ACXA 3F9OA 4C1CA 5HIPA 2Q0JA 3T3NA 1ZKPA 2BG8B 4WD6A 5KILA 1X8IA 3AF6A 1JJTA 3PY6A 2XF4A 4ZNBA 2WRSA 5HH4A 4C1DA 3I13A 1YCHA 4Z7RA 2A7MA 4AWYB 5B3RA 2NXAA 1K07A 4F6HA 3G1PA 4EYLA 3TP9A 1DDKA 2YNUA 3SPUA 5LM6A 3RKJA 2BFLA 3DHBA 5ACTA 3ADRA 3S0ZA 5KIKA 2HB9A 4U4LA 2XR1A 3I15A 4RBSA 4XWTA 3ZR9A 4DIKA 2QDTA 2Q0IA 4EXSA 4PVTA 2Q42A 5ACVA 4TZ9A 4Z5YA 3I11A 2P4ZA 3DH8A 5LS3A 2BTNA 2QDSA 4YSKA 5EV6A 4TZBA 3IELA 1WUPA 2FU7A 3SRXA 1L9YA 2I7TA 4Z67A 3FAIA 4XUKA 2YNVB 2M5DA 2BC2A 4UWRB 1WRAA 5EHTA 5HH6A 1MQOA 2FK6A 1QH3A 2Y8AA 4KEQA 2VW8A 4RM5A 2GMNA 2DOOA 3VPEA 3FCZA 1M2XA 4C1EA 3PG4A 3RPCA 2AIOA 2GKLA 5AYAA 1BMCA 2I7XA 1KR3A 2BFKA 5B1UA 4EXYA 1BC2A 2QEDA 3LVZA 2WYMA 5EW0A 3IDZA 1WW1A 3IE2A 2YNTA 5LLDA 4NQ5A 5A0TA 1X8GA 2BMIA 2P1EA 5FQBA 4C1FA 4BP0A 2FHXB 4EYBA 2BGAA 5FQAA 4D1TA 3JXPA 4C09A 2Q9UA 4D1VA 3IOFA 2Y8BA 4FR7A 5EVBA 5HISA 4P62A 3BK2A 5IQKA 4EYFA 2ZZIA 2GCUA 3BC2A 3H3EA 4JO0A 5A0VA 2FHXA 2FU6A 3AJ3A 1HLKA 1KO3A 4RL0A 4F6ZA 4EFZA 3X30A 5HIQA 5LCFA 2Y87A 4UBQA 4HL2A 5ACWA 3SBLA 4RAMA 2GFJA 5EH9A 2WYMC 5AEBA 1DD6A 2OHIA 3ZNBA 5LE1A 2GFKA 4FEKA 4D02A 5LCHA 4UWPB 1YCFA 3SFPA 1VGNA 1A8TA 1A7TA 1P9EA 4TZFA 2DKFA 3IE0A 1WUOA 1VMEA 5HIOA 4YSBA 4AX0B 3X2YA 4TYFA 3QH8A 2BR6A 4D1WA 2BG6A 3SW3A 2QJSA 2CBNA 3WXCA 3BV6A 4HKYA 4UWSB 1E5DA 2YNTB 3ESHA 1SMLA 5AHRA 4H0DA 4NQ2A 5K4MA 4BZ3A 2YNWA 4KEPA 4B87A 1YCGA 1JJEA 1ZNBA 2BFZA 2M5CA 5HH5A 3Q6VA 3KNRA 1BVTA 3IOGA 4UA4A 3L6NA 1XM8A 4RL2A 2NYPA 5LMCA 4PVOA 4Z6XA 2OHHA 4NQ4A 1JT1A 2BG7A 3X2ZA 3DHCA 4UWOB 2H6AA 4C1HA 4C1GA 3ZWFA 5EV8A 2P18A 3A4YA 3IEKA 4HL1A 5LSCA 3RKKA 5LCAA
chains in the Genus database with same CATH superfamily
2VPZA 1KO2A 4ALKA 1NN1A 3E0XA 2RAUA 3C6YA 1N9GA 1BIFA 4H31A 3IMGA 1P7ZA 4DUPA 3I04M 1DNPA 4OMCA 2QI9F 3ZIUA 1I3MA 1MO4A 4QGGA 2XCTB 1ZCJA 3FPSA 3TEMA 2WY2D 1UINA 2FK8A 3NBMA 1G4AE 1JEDA 2ZAOA 3EHVA 2KKCA 3BD8A 3F8TA 2P9GA 2ATIA 3ZWMA 2JCSA 3DTYA 2FPIB 2JGNA 3ZWYA 2XY4A 3H9BA 5J2TB 3A4SC 4LF5B 2ADFA 2W6QA 1WXHA 4ZO9A 3SR3A 1FS6A 5EJ6A 4NBVA 3M6IA 2W43A 5KOYA 3G0GA 2BGMA 4BQOA 2C03A 2IO2B 4B3TB 3FSRA 2E21A 1LBEA 3PC7A 2QTZA 1F4LA 1P60A 1IOZA 4AVYA 5EWAA 4CF5A 1QAQA 1X1BA 1P6UA 1G8KA 2X86A 2XWSA 1U8TA 2WKQA 4K9MA 4EUTA 2WKPA 2GFQA 1EM8A 1NXWA 1NBIA 1XTTA 2CNWD 3F7TA 2X8JB 4WZAA 3HV0A 2AZTA 4HPJB 4W7HA 4O98A 1JECA 1Q0ZA 3E22B 1SG0A 3C3KA 2M19A 1E2UA 5B1DA 4QHTA 4AKIA 4J1NA 4N76A 2ZS9A 2ZE6A 1BXZA 1OTXA 1NJSA 3S81A 2L18A 1XNJA 4I9FA 4AZ3B 2C99A 4FGUA 1AS2A 1YI8A 5JZOA 3A6FA 4LZOA 1M2NA 4F2GA 2O8CB 3F6SA 1AZWA 3ZRCA 5T3YA 2QJOA 2FP4B 2C54A 1EMDA 1K9VF 3QHQA 5F2OA 2GZMA 2WA1A 3OOSA 4WOCA 5UKDA 4U5XA 1XEXA 1JQ5A 2GXSA 4G3XB 1XLPA 3K2BA 3TL6A 4TMVA 4RH0A 5AW5A 2QN7A 3U9SA 4H16A 1GR1A 2M1MA 3IOEA 4YWHA 4AULA 5L9AA 4HKZE 3WMGA 5L3ZA 2RC6A 1QF9A 3F3YA 1DCFA 5JS1A 1II8A 4DM3A 2FSSA 4XB2A 2Y3IA 1N1MA 3I1IA 1CP3A 4HPMB 1G1AA 4MIKA 5KSYA 3IKLA 5JAMA 3DLIA 1W36C 3SF0A 3VKGA 2KMCA 2HZBA 3GRRA 3IDQA 3PXAA 2WYUA 2OHOA 1P2DA 1G6OA 1GC7A 3N1YC 3PPXA 2R4QA 4IDOA 4GHWA 3DHWC 3TNLA 5CCBA 2PWYA 1M10A 2C77A 1E99A 1GNVA 4BBZA 4BCDA 1QLHA 2ZJ8A 3E7PA 4DV5B 4MCIA 2OZLA 3ZG6A 8AT1A 5LA6A 3FHCB 4TVKA 2PTGA 2Q9UA 3TBKA 2P6OA 5I9BA 2DFKB 2J30A 1P98A 3G8BA 1S6YA 5JUWA 3UXHA 4PG5A 1ADCA 3RBAA 1BWSA 2CMDA 3AFMA 2GARA 3KVVA 1P2UA 2VWGA 5ULLA 5LBTA 1J2UA 2JFNA 2I1KA 1NOJA 4TQUS 2B3AA 1QHHA 1BSVA 4EB3A 3DHEA 5AM2A 1Z4NA 3ZY5A 2W6JD 1XQVA 3LDUA 1HGXA 2FSVC 4GKVA 1QZ3A 4EYOA 2AJBA 4KUGA 2ZM5A 4L2IA 5DBIA 1WXEA 2E6UX 3KOYA 2IEGA 1XRQA 4DA9A 1VJGA 1NSTA 2ZYDA 4LN1A 2BG6A 4KX5A 3SFZA 3UH1A 2E3TA 1ZH6A 3GJTA 4ZO4A 4D5GA 3PLAE 3NRZA 1TEVA 4GUDA 3EJWA 5JZ9A 1VI5A 2EX0A 3ZWCA 4ASWC 2BFOA 3GRUA 2QN8A 3IUQA 1Q14A 2KO3A 4AUQC 4BWVA 3HK0A 3AGPA 2XECA 3T1NA 1L5LA 3BTOA 2OO3A 2Y1LA 4ESVA 1HZZA 2QX8A 3AG6A 4LFCB 3B89A 4WINA 1E7YA 3WLQA 5LCAA 3HO1A 5IASA 4MUYA 3TQTA 2OGTA 3VVBA 3H5NA 3VFKA 1TZOA 3NIGB 3S8YA 4GI2A 2QRUA 3FKQA 2CKDA 4N0QA 3ZBQA 2BGFA 2BIFA 4V0HA 3H9QA 4ZRIA 3PDCA 3EXHA 3GHHA 2D6FA 2FVXA 1Z62A 3H2ZA 3VZDA 4P31A 1AH2A 3S5JA 1QGDA 3HZHA 3VPHA 1P2VA 2YYZA 4C0JA 4TTSA 4MQEA 4B3DA 2GFHA 4KQWA 4LDJA 3D7KA 1NQTA 1MR3F 3OX4A 4JL9A 4Z53A 2FGJA 2OCKA 4DL9A 4Z8XA 3LDZE 3FOBA 2P65A 2F3PA 1TL7C 3BD6A 3RCZA 3EVFA 3O47A 5JNLA 4P32A 4QNMA 2QC8A 5M7EA 1ZDMA 1E9BA 1WM1A 1SBTA 2E9SA 1RWPA 2LGIA 4CR7A 3R3MA 2Y9PB 4HAUA 3M6VA 1ZIYA 2FRVA 3Q6IA 3E8SA 4R3NA 5C9ZA 1DAHA 1FDIA 2O8FB 2R2QA 1RPAA 1WF6A 4K46A 2M6RA 3RTDA 5EUMA 4U2KA 2ODPA 2WUGA 2Y2UA 3UN1A 1EK1A 4D4LA 3JD4A 1T1EA 3QF4B 1U1DA 4DY4A 1QGUA 3LLUA 3LSTA 1IBKB 2AB0A 1PDXA 4YBRA 5DO9A 2EJWA 5T7BA 1WMEA 2ZI9A 1DZIA 1WMDA 1PV2A 1UC5B 4Q19A 3MOSA 1WEHA 4PZEA 2N9XA 5DM2A 4IIJF 2Y93A 4HDMB 2JI9A 1NPTO 3A1FA 1QC5B 3ASYA 3AVYA 4MGYE 2HQBA 4KG7A 4FWIB 1VIMA 1O95D 1RXWA 4CQMD 2VDKB 1XHLA 3Q4GA 2JG3A 1CNFA 1O89A 5J4YA 4IDFA 4COKA 4JXZA 4JJEA 3KEOA 5H80A 3FMIA 2WJHA 4BC1A 2XPCA 3MJTA 5JD5A 4Q9JA 4UFPA 3HIZA 3O8LA 4EFNA 3WQSB 3FOFC 1O5OA 4Y67A 4YT8A 1Y5NA 4C78A 3AFNA 3QOYA 3RG2A 4AQDA 1H2EA 4LA4A 5AR1A 4TKLA 4R2HA 5CX1A 3G5LA 4YMUA 4HSGA 3OIVA 4C1NA 3GO4A 1KR2A 2PLAA 3BORA 3VR4D 1UMDA 4NOLA 3ZDEA 3UATA 7MDHA 2JVJA 1AO3A 1FBNA 4MEMA 3O0DA 2A3RA 4QG3A 3OCUA 4IOIE 2OTCA 4F8CB 2DC1A 2P2LA 3CBQA 2FW0A 2C57A 1BE8A 2OLJA 4CKCA 4MJ7A 1N3YA 5A2QA 5IZ4A 2X8XX 3H8SA 2LIPA 2PY6A 2EZ9A 2QRZA 2KWIA 1J97A 3ENKA 2W6OA 4OHKA 1YZGA 4RLSA 4OVUA 4P5EA 1NTOA 5HXAA 2WYMC 1P3DA 5CXSA 4GP9A 3UA4A 2B6HA 3JQGA 3PC3A 3F1LA 5DPRA 3ESBA 2F43B 2ZZMA 4N12A 5DYTA 3DFUA 3VDNB 4W99A 2QLFA 3H04A 1JEQA 2WU5B 1RYHA 1LDNA 3ZHOA 4G4SO 1J7AA 1AF4A 3H4TA 4N0PA 5CLQA 3VZCA 2IYUA 2AL7A 4WD3A 3Q10A 2J45A 3EXFA 4GLFA 4ZYXA 2LGDA 4N5MA 3RSHA 1SRQA 1HDGO 3CNBA 3TQSA 4YRSA 2W55A 1T2FA 2PBZA 2W2MA 1AD2A 4D8WA 1WMSA 3SVTA 1U9IA 2AFVA 1Y8CA 1VZ2A 3GAZA 1Z7GA 3AXTA 5FBKA 5AXAA 4ISCA 4XX5A 4QDTA 2B61A 3AHJA 5GADl 2VK8A 5FOWA 1PFGA 1A4IA 1N78A 3T5TA 4HZGA 2O1SA 4PYIA 1XR3A 1Z4PX 2W6ZA 4L95C 3HXMA 4CLDA 1S3SA 3CF4G 1YK0A 2BGJA 1GNLA 5HUJA 2ZUDA 1PUXA 2ONJA 1GAJA 1U28A 1SJ9A 1ZIDA 3G7NA 4PRYA 4EG6A 4WPGA 4LTDA 1R7SA 3JRNA 4X63A 3PX3A 1EBUA 3QLEA 2DUWA 4H3HB 3VOBA 5HJ5A 4E0BA 2W2XA 2JGDB 2BEKA 2AOUB 5AJTA 3I0MA 1ZZGA 1VJTA 1S89A 2OCBA 3PJEA 2O6VB 1YZVA 1V39A 4R9NA 5ESDA 1RRKA 2RHLA 3TB4A 3VYWA 5C81A 2PTHA 5TS2A 2Q49A 2C92A 4TXMA 5ESRA 5FPHA 5AUKA 3R6DA 2Q6VA 2PW9A 3O1HB 1VHLA 1JDBB 4OJMX 3AYXB 3KG2A 3R9KA 1XEWX 4NAHA 3MWLA 2V0GA 2CDCA 2OO5C 1M7BA 3LTEA 2VHTA 4K26A 5LP6C 4IDQA 2ZRKA 3AV0B 1FFWA 1ODSA 3D6MA 4RTQA 5CUQA 1ZJ6A 2YV3A 3RUDA 2HHJA 1XZBA 2RE8A 3HV2A 5DNWA 3CLHA 1W5SA 4KJZA 3C7AA 4K6FA 2DPYA 1Y8RC 2N7DA 4H0CA 4R2LA 5CFZA 2BGTA 3UMRA 2VJNA 1D0SA 1RZVA 1QSGA 1R9JA 5JJBA 4Z4GA 1DAMA 2WVJA 1MNQA 4KDLB 5FBQB 2A7MA 2WJ3A 1QIDA 4NEQA 3NP9A 1WBJB 2QRVA 4Y6QA 3EGDA 1CIPA 5BN5A 4MLDA 1MIOB 4X92A 5JH7F 3L7CA 1XD2A 4DB4A 3M6WA 1ZONA 5CG2A 1A97A 4ZARA 3WG9A 1A8SA 1U7XA 1XTUA 1TF2A 9ABPA 3V60A 1AQYA 1WB4A 4HI0E 3ILXA 3GPBA 4GGOA 4UAUA 4EVIA 3P0EA 4B76A 1YN3A 2H4YA 2XJ4A 4UUBA 1LC3A 1N5WA 1OBCA 1GHTA 4HB3A 2XTNA 1BCRB 4N5LA 4Q12A 3ICPA 3H5LA 1Z56C 3DDUA 3P9RA 3JQAD 2B8JA 1J0AA 2VBIA 3JYLA 3RYFA 1KJWA 1QO7A 2Y92A 2L8JA 2XBBC 4C1EA 4CM8A 1CUVA 1XCMA 3G1UA 1SUDA 5LYJF 2ECQA 4JHLA 3Q5EA 4BWFB 3NWJA 2XEWA 2INPE 2YQZA 4BB0A 1DO8A 3KB8A 5H16A 3DH0A 3N2KA 1KBOA 3ZWAA 3DBLI 4LNFA 4G07A 1R4MB 2WJPA 3O65B 3GJ5A 2OO7A 1X8GA 2DLDA 3ABOB 1UFVA 3IR5A 4LRTB 3FWPA 5H92C 3R7AA 3B1KA 4RZSA 2XVMA 1GUAB 1ZM7A 3TLMA 3ZE0B 1SQ5A 2H63A 4PBTA 4HGZA 1FPYA 3DNMA 1GARA 4EE2A 1C3EA 5CRIA 1LM8B 3ML1A 3PFNA 1NX9A 5JRZA 4H7FA 3ER8A 1ZGGA 3QX3A 4GSYA 1J99A 4MCAA 2BQQA 1M3SA 4HLCA 2JUOA 1UBJS 3BSYA 4GR4A 3MGBA 4BEJA 1LNZA 4LBVA 2CWWA 3U4AA 1D6NA 1A69A 4JWKA 2MMCA 4LDTD 4KAAA 3WNZA 2G08A 3SW3A 2ANBA 2C4WA 4WY2A 3ZBPA 2JRCA 4DCGA 1IRIA 4E31A 3B13B 4OXXA 2JI8A 3E5MA 1KY3A 1HSOA 5C53B 3HM3A 4ID9A 4NIMA 1PYOA 3QZUA 3LZDA 2F1JA 2PUBA 3QY9A 1S2DA 4G5OA 2FEMA 4JBHA 5DN6D 4B3XA 3AGQA 4OSEA 1H2FA 2PZFA 5ADVA 2ZJ2A 3JWPA 2BJWA 3HB9A 1WI0A 5JYDA 1Z39A 3S7TA 1QYIA 3HFRA 5JEEA 1MO5A 4MJXA 5G1PA 3PS6A 3C2QA 2HTHA 3B9QA 4KLZA 4FQ5A 2VRRB 5AW6A 1JB9A 3NGMA 2XB4A 2RHDA 2ZCVA 4M1KA 2H29A 4MR8A 2FAZA 4GLOA 3D0OA 3TLCA 2GCGA 3TKYA 2GPJA 4YSLA 1NZJA 4QQNA 4IICA 1DTEA 1YA4A 4JL5A 4CQJA 2LGSA 2R84A 3BE5A 4KPUA 4M21A 1KI9A 1SCUA 4HXDA 2RI6A 1PDVA 2BR4A 3RB8A 1TUGA 2A0KA 4PGHA 3WVNA 2P0AA 1PV1A 5EWJB 3ZWBA 3EXG1 3P9XA 3NGXA 3AJRA 3T5GA 2JCXA 1Z33A 4J7AA 4DADA 4R3DA 5B64A 1AT1A 5IT5A 3H11A 2NMQA 2FX5A 4HWSA 4DCVA 3SR0A 4JC0A 3OT5A 4UZSA 2P1RA 3D3NA 2AEMA 1P5HA 2VO1A 3HGMA 4KWCA 1E1CA 2FG7C 3B12A 1Y1QA 1X77A 1GWNA 4QOEA 1ZDVA 2HRCA 2K4MA 2VPXA 4K9SA 2YJTD 3ZLJA 2KHWB 4FLEA 1KO1A 3AL3A 1QCYA 3WMWA 4BAUA 3ODPA 2RGNA 1DOAA 2VP0A 3AT1A 2CN1A 5AK5A 3WLSA 2WXRA 4D2IA 3L8GA 1YVDA 4NBKA 4EA8A 3HKCB 1YZHA 3L7DA 3I8SA 1XDDA 3GWZA 3O9VA 1Z3CA 1PSZA 2BKLA 2FCSA 3L6BA 3AU5A 4D9BA 1VIVA 4F2PA 3LECA 5KTYA 2X4IA 3U2QA 3ZNHB 1VBKA 1A4RA 2E1RA 4AF7A 1TUBB 2ACZB 1OTRB 3I05A 1NJGA 3GNTA 1GPBA 1M1YA 1SUIA 2Q3BA 3CE9A 1T5TA 4ZYUA 5L8VA 3QELA 4R1OA 4LF7B 4FA6A 1G8HA 1XA0A 3MUFA 5EIOA 1T9DA 2ECOA 5GV8A 16PKA 5ERYA 1DEHA 2DHRA 1T6NA 1XZEA 4YB8A 3KJZA 1FXUA 2F17A 2HYIC 4LBZA 1Q6ZA 4TUYB 2O8DB 5TQ2B 1A5AB 2D5IA 2P9EA 2REQA 4OVZA 3CPSA 4U7TB 4AYWA 5JQGF 5KOIA 1SBZA 4RY9A 4WBNF 3E9YA 4MACA 4NU5A 1R15A 5JH7B 5BNIA 4ERNA 1OYVA 3O4GA 3NKVA 4EPYA 2PH5A 4F1KA 4PN7A 3DBIA 5BP7A 1OWMA 2QIEB 3BK7A 3FNHA 1IM2A 2ZUUA 4UATA 1KYWA 2GBPA 4UOQA 1EHYA 3AF3A 2JQRB 2C2HA 2JWZA 4LK2A 1E96A 1WR1A 2PGNA 2X0KA 4PGAA 2JPHA 4JWTA 2C8KA 3E9EA 1V7CA 3DF9A 4DANA 5CVUA 2V45A 2L83A 1YL5A 1MOSA 1TEXA 3BRCA 2XGOA 3VXWA 5IS2A 1DCMA 4Y9DA 2VPIA 5LYJB 4A0SA 5TE9A 1X1TA 4PYNA 5ECDA 1A8IA 4R1TA 5EXPA 2GZAA 2BFWA 3GFTA 3ICWA 4OGLA 5JCZA 1Y9ZA 5KYWB 3NPAA 4YJ2F 2Y27A 621PA 1LLQA 1ZMXA 4W9CA 9GPBA 1R0ZA 5CH8A 4IS3A 3JWJA 1E3IA 2VSOA 2ZBUA 2MMGA 2PR7A 1F8YA 3EVAA 2O8NA 2J09A 3STYA 1XN1A 1P1CA 2B94A 2YIVX 5D3ZA 1NVXQ 2ZBQA 4EGSA 5FP0A 2WNIA 2VRCD 3GVIA 4DLAA 3VXKA 1DINA 3FMVA 2EKDA 1Y7LA 5JPCA 1QMGA 4HRAA 2KLGA 5B4VA 4DG9A 3I58A 4TYFA 4QPZA 4P86A 2GVDC 4AZ0B 4QDUA 2V6FA 4DM7A 2C9BA 4YLYA 3L8CA 4UWSB 1HFKA 4TZ6A 2JGEA 4HN9A 1T1RA 3D1JA 2WUVA 3EQ7A 1BOFA 1CZKA 4LJ9A 1KFKB 2PIAA 3AI5A 1FTQA 4A8PA 4YBZA 4C7XA 3HJAA 1ICEA 5TEVA 2RJOA 2YWEA 2D4AA 2HWYA 2RARA 4XJSA 1HC7A 1DBWA 3WB2A 1SBYA 1XA3A 1EFPB 2GK6A 4FD2A 3M81A 3PNQA 1T0YA 4IEFB 5AMXA 3O8NA 4PX3A 5HRCA 4QYTA 4QAJA 2GESA 4EAAA 4ZAGA 1P9DU 1I5EA 2P4HX 2IHKA 1EHCA 3D8RA 3N28A 2P8JA 3RG8A 3C7TA 2A5DA 1KP3A 1J1UA 3CV3A 1PHPA 4YREA 2L2QA 3KU1A 5KSOA 2XTAA 3X1JA 4OHRA 1XAIA 2ZWOA 3C1UA 2WVGA 4FDMA 2X3YA 2OXCA 1E9EA 2NSLA 1LNQA 2WIKA 2JLYA 1GQ2A 4XGKA 2YIJA 3KZKA 3E1SA 2PUVA 4BQIA 5TX7A 4WK4B 5IAKA 3T41A 4F9GA 1ZXHA 1DL5A 1AQIA 3ZY6A 1LPPA 3HDHA 3GLUA 2JZZA 4H6XA 1M2KA 2RCNA 1GUDA 2GXUA 5F4BA 5KYYA 1NI5A 2LXNA 2WUEA 3CA8A 1CVLA 4BYGA 3NFYA 5DCNA 3OD5A 4PR3A 5EG5A 5BSKA 1FSFA 1GTZA 1PS8A 1HNZB 4U63A 5DKFA 4PLWA 4AUKA 3U7IA 3JAKB 2FF5A 3IP8A 4MHOA 1Y6JA 1GTRA 3QMPA 4JDPA 4KFRA 3M1YA 4BEBA 1KEEA 5D6JB 4QHSA 3FY4A 4Q7MB 2MINB 3HA3A 4ZI3A 2C7QA 3NANA 4MR9A 3I53A 3DTVD 3GH1A 4HH1A 1GL7A 3P2KA 4DRXA 3NU1A 1F8FA 4D9EA 2XF4A 4KPEC 1K6IA 5LM3A 2IKSA 3T3MB 5AI6A 3U7RA 2Z95A 1YJ8A 3PHCA 1R0XA 1H5QA 5COBA 3P9YA 5KTOA 4F1WA 5E4TA 5BO5A 1YE3A 1CG6A 1SOAA 3R5SA 1C77A 4YQFA 1YVPA 1SWWA 3G2JA 1SQ0A 3ZWPA 1PV4A 4KX3A 2ZT8A 3WBFA 1VMIA 1T9GR 1Y9JA 3PWZA 1SXJD 4PG4A 2GTPA 1UL1X 2BONA 1XXLA 2ZBEA 3AIIA 4LXGA 3E1GA 4M8KA 4BFCA 1P5FA 1GA1A 3ITKA 3IELA 1PO7A 3HY4A 1TU4A 3EDYA 1R8QA 3SRXA 5TPZA 1JU4A 3X1KA 4BQFA 2GN0A 4D44A 1FRRA 4AZSA 1O9HA 2FGKA 1ODTC 3CRW1 4URKA 2J3IA 4KR0A 5JQGB 2EFCB 1L5NA 3GN1A 4WBNB 2VZ9A 4PXYA 4QDJA 3EIWA 4NJOA 2FIDA 2AHRA 1Y6RA 2O2IA 5C3JB 2O1WA 1EQUA 1MAAA 4PAOA 4WBXC 2NPFA 2V74B 2FWJA 3I3SR 1UJ4A 1JWAD 2W2TA 4JGHB 2I1VB 1N6PA 4BEWA 2C4TA 2J9YB 1D09A 5HMLA 3KLBA 2IEZA 2BZ1A 3IBSA 4MVCA 4MRNA 1VPTA 2QXTA 2ZJDA 3NOBA 3PL5A 5B7QA 1EIWA 5THQA 1SVOA 4RVSA 1YS1X 3FDIA 3FPCA 3F74A 4JO0A 2I54A 4CNBA 3WISA 3O75A 1TM1E 5A3VA 3RSFA 2IY8A 1T1JA 3HO8A 5DPMA 2OHVA 4YCBA 4GQBA 2Z4SA 3EGOA 5DCYA 3RK1A 3ABRB 2E48A 4YALA 4ZHQA 5KQRA 3SSNA 3AY7A 4CM3A 1IP9A 1PX2A 2WFAA 4JCOA 1RLFA 1OGWA 4AKSA 3CGGA 1OXUA 1Z25A 4FSXA 2VBGA 3IG3A 2EOAA 4X95A 4B1FA 3T3HA 4P58A 1ZUNB 3DHGC 1C1XA 4DQOC 3TAXA 2KWVB 4YYZA 2O3QA 1RLIA 5DMHA 5AEKB 2M4NA 3V4VB 5LN1A 4QU0A 3KS9A 2DPHA 5JQWA 4DHZE 1RZRD 4F4IA 421PA 4L72A 5LBIA 5HZMA 1JFLA 1Z0ZA 3W90A 5HIKA 2N75A 2QDXA 2NCNA 3FTQA 4B80A 2CU3A 1LI5A 2WNSA 3QNMA 1W49A 3ORSA 4CF4A 3OJEA 2X7HA 1UJNA 3KBOA 3SICE 3ZWFA 1ZW1A 1P8AA 4YV7A 4EX6A 2RIPA 4MS1A 3RKKA 6LDHA 3ZNPA 1XXHA 1CQJA 5BQ3A 1RFLA 2BFBB 1C3TA 1V6CA 3OQBA 3UPTA 1CDEA 2VNIA 3HYTA 2P3SA 2EVWX 1ZR4A 4X0EA 3V8PA 4Z9FA 1G21A 4YMHA 3UCFA 5AK3A 2G5CA 1I3OA 4MDKE 4YDHB 2O57A 4WZBA 3WL6A 2XUHA 1G5IA 3LT5A 1I4LD 3EIOA 5EQDA 2CNOA 5F1YA 3Q7PA 1SXGA 3GEPA 3KPWA 2R1VB 5TMDA 4E1AA 2Q0XA 1QJ4A 1H2BA 4CRWB 4F6LA 5F35A 3CN7A 3RABA 3MLAA 3FPGA 3KDSE 1J49A 2NR2A 4H2DA 4O08A 3NVDA 2P5SA 1G42A 5C8ZA 1R5JA 5IOIA 4D8YA 2FWRA 2P9QA 3KKMA 4RIIA 1HDOA 1U1EA 3D8SA 4KXFB 3IVAA 3HKDA 1B3BA 1WXIA 3EZXA 2WUWE 2VP3A 4I8DA 3K72B 4F11A 2ZIXA 4PLCA 5EPEA 4Z1MD 3DULA 4HGOA 5CFRA 3MINB 1U5BB 2Q1TA 4FDAA 4DA4A 2A57A 3KCNA 3WX0A 2ONCA 4O8ZA 1KI4A 1IBXA 2WYIA 1ZIPA 1J2RA 1X39A 2JGLA 4A03A 4DCMA 4JA2A 5CVTA 4BQSA 3C24A 3AE6B 5DNEA 1OLUB 3TLBA 3B6JA 3FIJA 3AF6A 3HCBA 4ENPA 2YLMA 1BN7A 1GTSA 3Q41A 1G8GA 3FETA 1Z2DA 2D2XA 3VSEA 7MHTA 2LGJA 4M4SA 4WACA 2ASQA 4OAPA 1D2HA 5CFMA 3HP4A 1IHDA 1WYWB 6GPBA 3KEFA 2XMRA 1HDRA 1PZGA 4RX1A 4IP0A 4P98A 4Q6BA 3EBLA 3ZYCA 3V5NA 4ZAXA 3Q3JA 4UNNA 3EGEA 4IM3A 2CYAA 4M60A 1SQ6A 5JO9A 4P2BA 3GF4A 3ZY2A 4HR7A 5HQJA 3CKKA 4FB4A 4YXWA 3ZTTA 3IDFA 2QG6A 4CFYA 2HJVA 1L7BA 1SN7A 4D6PA 3FE2A 4FR0A 3MGKA 4J43A 2WABA 3ECAA 4DVGA 1P72A 3AN1A 4DWWA 3NIDB 3TZLA 1CZUA 3K71B 1MB2A 1XZ8A 2R8YA 2V6MA 2Y66A 2BFFA 1EWQA 1Q17A 4BFWA 3V6EB 2RK4A 2CS4A 5DHAA 1QXSA 1L5SA 2G63A 2SHKA 1NPYA 2GZ2A 5JNVA 4MYCA 1T5DX 3HPQA 3SLGA 4PO8A 3EQ8A 2Y1OA 2P2YA 2H07A 2HLHA 2GCOA 3DMYA 1OH5A 2G9ZA 3GEIA 4L2YA 3RS9A 1HURA 1O6CA 1C9YA 2FXVA 1OPXA 2K25A 3BGVA 2A5FA 1RDFA 4O02B 1BFUA 3BB4A 3TQCA 3I6IA 5AUNB 4G36A 3L7AA 2FN7A 3IS3A 4A4DA 2D1TA 4HUQB 1EU3A 3R0JA 3RODA 1CY6A 3FC4A 3Q8LA 4CKEB 4QGHA 1U8EA 1YV9A 1ZMOA 3IHWA 4JPSA 3GDWA 1WL8A 1K7CA 3MTNB 2KAJA 2IPXA 1YJCA 4PM4A 2X0FA 1ZSYA 3VNAA 1OU0A 3HNPA 1BHSA 1VHTA 4QT0A 1B16A 4Y18A 1Q44A 2OR3A 4ZYSA 4DEVA 4QYWA 3UMGA 2R66A 1QQTA 3V1NA 1G7RA 5EUBA 2HWKA 3V6LA 3GHYA 4LJ6A 1KC3A 3KW5B 2HCFA 1PL0A 1VOTA 4PHGA 3D59A 4EPXA 2LKCA 1GNPA 4BKSD 1YBHA 3H42B 3P9CA 2ODQA 1D4OA 1W0JD 4EW1A 3QEOA 3A1QA 2V6JA 5H1YA 1H9BA 4MQFA 1SZPA 1SHTX 4INJA 1SOMA 5BNZA 3NASA 1QU3A 4GOKA 1F60A 5NLLA 1UQRA 2BCJQ 4CG3A 2DUJA 1PVDA 2XT0A 4BZWA 2PV7A 2DHCA 5A5GA 2EWWA 3U49A 1UQUA 4M9XA 3IJPA 4F5DA 2YYYA 3ORQA 2QVLA 2NAPA 1WRIA 5C8YF 4PZUA 3QTTA 2ODEA 1QK5A 2XUIA 1EVYA 1KXZA 3DD5A 3NZ3A 5C1DA 3UXMA 2LNDA 2WYHA 1QG6A 1RWMA 2YMLA 4URUR 1TLFA 5CHVC 4ZJZA 3ZKWA 1JEOA 2RI0A 2PE5A 3ROTA 1P7YA 3GJ7A 4YUZA 1Q0RA 1VGVA 3MCTA 4WOKA 3JQ9C 1E1MA 4DREA 3TTWA 4ZEOA 3WWZA 1ONBA 3RVLA 1I7SB 3KTAA 4BL5A 1KS9A 4QRDA 3DHVA 3IT1A 2H85A 2WE7A 3IAAA 1JH8A 3UJPA 1BAPA 4UBNA 5CP8A 3TTSA 1ZA2A 1CJCA 1OFUX 2W6IA 2W6JA 3OQ1A 4P53A 5ENVA 4AY4A 2AUNA 3A28A 4X60A 3B85A 1C3JA 4DUZB 4PC3A 5CVJA 4AROA 4F9EA 5JSYA 4E09A 3RNFC 4XWKA 2BWES 1UZNA 2IZ5A 4KMMA 3HU5A 1DLJA 3WKEA 3LPCA 1I13A 3P94A 3RQSA 4V1CA 1NXQA 1NJFA 1JE1A 1GSIA 4JJIA 3LF1A 4U7WA 2QR5A 2ZT6A 4ZDKA 2HM7A 2KNBA 3BX1A 3K5IA 5B2EA 4NABA 3W3ZB 1PYGA 4IVRA 2DBYA 3IAEA 2XLBA 4Z99A 4F1JA 3F96A 1E94E 1P18A 4IW3B 4BB6A 1BG6A 5EI5A 4DQ0A 5L6LB 5H3CA 4G09A 5A3SA 4XUGB 2BOVA 2B4YA 5TDHA 4HEJA 2Q0IA 1EPUA 4LDZA 2J3LA 3CZAA 2R11A 2R1TA 5FKAC 4G63A 2V3CC 2BTNA 5EJ2A 2DFVA 4KAJA 4PGMA 4HVAA 1K53A 1L9YA 3SQNA 5D5HA 3DFMA 4AJNA 1RI1A 2X2EA 3HMKA 3PFFA 3NKLA 3KVOA 2R86A 4EHFA 1J24A 4DLSA 2QTMA 1A50B 4XWAA 2GJKA 2KHZA 2ZKLA 1ENOA 3I34X 1M2VA 3L0WB 4LJPB 1B7GO 4HKQA 2IOYA 2IUYA 4ZD6A 1QBKC 1KI6B 4EA9A 4FULA 2F9MA 2BGKA 3ZLTA 2R8PA 3UK1A 1Q7GA 4QATA 4BNKA 3ZGXA 4Q4LA 5EIAA 4IJMA 2GLTA 1O6ZA 3HJUA 4RD0A 1XZJA 3ROQA 3BKWA 1QO0A 4DCSA 3P2YA 1KO3A 5E6JA 5BURA 2K39A 4ZAYA 4HP8A 1CY0A 1UOQA 4A0GA 2IIVA 4XD2A 4D02A 3LF2A 2EAUA 2A0WA 4GOJA 3OC0A 3NZSA 3VHLB 3QY0A 3L0IB 4GG1A 2AEJA 4YO7A 1X7WA 5I7UA 1ITZA 3VR2A 4ZU6X 5FR2A 1J8FA 3MC8A 1VYVA 3NHKA 2II6A 1J0CA 4B84A 1WF9A 5JAZA 2FU5C 4IZIA 3RZFA 4KWHA 4FFLA 1AXRA 1MQSA 2ZYGA 4DN6A 1A98A 4PQEA 1KBZA 4NQ2A 4OHPA 4YJ3F 1X7XA 4C0XA 3AW8A 3OX3A 1QV9A 4EQ6A 3ZD7A 3NZUA 1TZJA 4NKRA 2J0MA 1O95A 2Z1DA 3M82A 3GJXC 4FBLA 2NTVA 2ZSBA 1EK0A 3FUCA 4QNNA 5F7ZA 1HE8A 3SDSA 3DZDA 5ALDA 4HCJA 2NU9B 1L8OA 2OCPA 3UG6A 5JDCA 1OTYA 4UNRA 1AE1A 1DKPA 5EIFA 1GKLA 2HD5B 1YRWA 3E18A 1UJ6A 3ZX5A 4NU6A 5J4VA 2OK8A 4QLBA 2QBYB 4X8MA 2JIZA 4GYYA 1IHXA 5KJ6A 3CEHA 3I5MA 1IN5A 1CZOA 4RZIA 1VPWA 2RMKA 1YNSA 2ZTLA 3E03A 4F6RB 3VR4A 5K7SA 3HEBA 5C8YB 4DDUA 1P19A 3PEEA 1C9JA 2C1EA 3EGXB 4G4SP 3IH5A 3KUCA 3V61A 3QPVA 2O19A 1A2KC 1UBIA 1JQKA 3GY0A 2HRZA 2RJ3A 3CWCA 4C7OB 1AKYA 2OFPA 3NO4A 4ENSA 2HEGA 2FDRA 4MGIE 2VDVE 5J17A 4Q4HA 3ADPA 5DPSA 3EG5A 2AK3A 4TS9A 4F5YA 3QXXA 4X1IA 4C4VB 1IH8A 1I8TA 2BEWB 3HDTA 5KX5A 4RFSA 5BQPA 1J0EA 1YL6A 5B55A 2C9CA 4E5YA 3R09A 1X7ZB 4OK6A 4RO0A 2F90A 3ND7A 3ADKA 4HBZA 4PFSA 3HY3A 1V43A 3RROA 1YR9A 2V9PA 3L79A 3DBHI 3GCDA 2WS3B 1H0RA 2ZDQA 4C30A 3JQPA 3CUVA 1ONOA 3MMXA 2LVBA 3O31A 1R8YA 3L7IA 1DWUA 5E2AA 2CFOA 1YCDA 1WXWA 4QEKA 3HEMA 5BUZA 2QVCA 4RVFA 2AG1A 4NL4H 3RBZA 3OLWA 4P4GA 1XEFA 2FYTA 1MABB 4YSKA 4QTYA 4CKBB 2NUPA 2BYTA 5EE5B 2JLBA 5JYEA 3NPMA 4IJKA 2FK6A 2HK7A 5FI5A 3UQBA 3PNKA 4CJXA 3T5BA 1VHJA 3RNBC 2ESRA 3HHMA 2OLKA 4NV3A 1BXGA 4QOSA 2O7VA 3OZUA 3B3AA 2H4XA 3G82C 4DLNA 4D9FA 2FJ0A 3WNBA 4J29A 1P1KA 4V39A 4MVJA 5FTMA 2WHPA 2NV2B 4G37A 4MCJA 4QFMA 2C00A 5BN4A 1Y3DE 5EE9A 2I6FA 3DP9A 2Y6VA 3DL4A 1MG0A 5EUCA 3HA7A 3GT3A 4AZWA 3QX9A 1L1QA 1VLJA 2MSEB 3O3OB 2AYOB 1C4PA 1W25A 3NR2A 1Z0FA 1SHUX 4XX0B 3X30A 5JZSA 2BUCA 2J0UB 1BH2A 1E2NA 1H1DA 5HF8A 5AKZA 1W6UA 4BLOA 1U80A 1Q19A 1Q2UA 3QFSA 1ISFA 4PIMA 1AHIA 3G7UA 4JEHA 3IE0A 1FRNA 3MBIA 4KR2A 2AC4A 3A04A 3O5AA 4MEBA 1KJNA 3R5FA 3THYB 3KD3A 4GD3Q 1V5EA 1P6XA 3KEQA 3AZPA 3ZJYA 2GZDA 3VOSA 3UJ8A 5GV7A 3X1WA 4P7IA 4NPAA 4TMWA 1M5RA 3IP6A 3W7AA 4OXYA 4B5LA 5EMKA 1OLXB 3I2YX 4DLVA 3ROKA 3PTAA 2O5CA 3SDLC 3BDAA 4E07A 4W1QA 1XWFA 2B8NA 5C52B 3AH8A 4LGVA 1Z9BA 1N77A 2VDNB 2EDCA 5EMLA 4NMLA 1P9OA 1QF7A 4DUYB 3X1MA 4H60A 4ETMA 4ZVTA 4YJ3B 4DDGD 1E9RA 1F12A 5B12A 1H65A 1XEEA 4RHXA 5FQNA 1IZ8A 3BWVA 4HDKA 5BVHA 3F9CA 1PP4A 4B44A 3KKQA 4L74A 4QSHA 3KLOA 5BN3B 1RTTA 2JCVA 4B09A 3LWDA 2AZDA 4G24A 4GX0A 4JB3A 2V4ZA 2VF2A 4M7OA 3OPXA 3K1TA 4JOQA 1ENYA 3FYDA 3HZZA 1E32A 2IDYA 4TSRA 3IAXA 3WWOA 3BF7A 5CXXA 2ODBA 2PA0A 1Z6PA 4WCFB 2P7IA 3S2SA 3R2UA 1N0WA 1PTJA 2KWUB 3BMQB 2N9KA 1TPZA 4OHWA 1SUCA 1LGRA 3TLAA 1GSAA 1WGHA 3PQCA 1IPGA 2W9NA 3QCAA 4OB8A 4R54A 4DABA 5AXDA 2Z5LA 1KTIA 2AMVA 3QK7A 3VC1A 1C76A 2G1AA 5JXHA 3MS4A 3NOQA 5IKOA 5FLYA 4EY3A 4DDKA 2H2FA 4JOSA 2XYQA 3FPHA 1I35A 2MSCB 5IU6A 3DEFA 3KOWA 4IEEA 1YR7A 3IBGA 3RIEA 3I2HA 3T3OA 1DRWA 2UUAB 1QFXA 4S1PA 2DE0X 4ZYTA 4ZQEA 1JCKB 1Y3BE 2J41A 4WZAE 2GT1A 3KXKA 4ER0A 2ONKA 1L5FA 3TZHA 5EP1A 3IXSA 4IHAA 4MRSA 3SVLA 4IMRA 1J42A 3O90A 1TTTA 1Q10A 2KK8A 5DLEA 4IGKA 4PTZA 1QRRA 3GQBB 5HS6A 4DA0A 3DDCB 2H1CA 4PSDA 1OKKD 2JFXA 3NKFA 3E9MA 5KIKA 2N0SB 4Q39A 2XUQA 1C4CA 2HV9A 3KQSA 3QEAZ 3PLUA 4B0PA 2CLHB 1IATA 4WY5A 2N47A 2IKQA 5DX0A 5FUQA 2YEPF 3TEFA 4A2PA 1GO2A 1U0NA 3GL9A 1U3GA 2VJQA 1IAQA 4TRRA 3C3XA 4LHVA 3CCBA 3DV0B 3DEJA 2V4LA 2C7BA 4X41A 1N6KA 4DXHA 1G19A 4D4KA 3CNOA 2ZZKA 1L7YA 5C31A 2HGZA 2BP7A 1N5JA 1CRLA 1K08A 2DBZA 1XZFA 3CM0A 1DWPA 3BIID 1UKVY 2Y1KA 1QONA 1LPSA 1YBAA 4L08A 3NM5A 1F1JA 3K0EA 1EJ6A 1AGXA 3SU8A 3OZIA 3TCNA 1SVLA 5I3CA 1ZY2A 1UPAA 4EYKA 4LRSB 1FP4B 2VCHA 4AUEA 3PD0A 3PNLA 4BAXA 4MYTA 1CR6A 3B48A 1SM4A 4OJKA 2HMSA 5G3YA 1GPMA 1Z4KA 2ZYVX 1ORIA 4H7KA 4ECEA 4OD0A 3KK0A 2ZVOA 2XUPA 4K1LA 1PE0A 4UAJA 4WFIA 1JEAA 1RVDA 2BT4A 3H6NA 1VMKA 1WSPA 1TNDA 4P4LA 3HN7A 2J9FA 2ALJA 1Q5PA 3JAMA 1V9JA 4D42A 1REQA 4ZVQA 1MB9A 1G6KA 2XUDA 3ZIMA 3NHUA 2EQBA 3ETNA 4C2AA 2RSUA 2ROQA 5FD8A 3N2GB 1MVKA 2PBRA 1XLVA 3W5DA 1WZ2A 3ANSA 1U8ZA 1ZEJA 1JAYA 3U52E 3TI9A 1EK5A 3AQIA 1BWQA 1GG5A 2CLSA 3DLBA 3DAOA 2QRQA 3U4CA 1Z68A 1VCOA 5J5AA 3FDZB 2KBFA 2RHRA 4HEQA 4J0KA 2ATXA 1JR3E 3M5PA 2PH7A 4KAXA 3GRFA 4PYZA 4UM8B 1NBAA 4YACA 3AWIA 4C3ZA 3DD1A 4EAQA 3QEMA 4EGQA 2X5KO 3V4ZA 4ER6A 2KTFA 2H59A 3OKFA 2KS6A 4OSPA 5B6IA 4LNIA 5L40A 1QTNA 4B7CA 4YCMA 4B6EA 1EFVB 3WIDA 1PQUA 3Q3IA 4Q1EA 1PG5A 1UELA 4LW8A 1E0AA 2FZVA 1OXXK 2RGEA 1H94A 2QT1A 3KAPA 2MBBB 4IYJA 4QBIA 4FMCB 4CMJA 4AJKA 5HSGA 3R0ZA 2GN8A 3GLQA 1J7KA 3DS8A 4TUYF 2GA9A 3GRYA 5TT1A 1ZM3A 3UWPA 4ZT2A 2X5JO 1TI7A 2ZITA 3O83A 1JUDA 2QRNA 5E1BA 3UFBA 2WHGA 3DMTA 3OT1B 4NMWA 4P82A 4R8VA 3ZR4B 2NQ8A 3EMDA 3BVZA 4LFAB 5LUBA 4JC4A 1C3XA 2XXJA 1N5RA 2CJPA 3JD2A 1FU4A 2E4UA 1KQ3A 3HCCA 2LHEA 1WRDB 2IPNA 4EZJA 3SS7X 2BFZB 3L4SO 2GD6A 4Z9XA 3PVZA 3FNIA 1L5WA 5J43A 3WADA 4GKBA 2M1ZA 1LRKA 1EVEA 4ZO3A 2ZT7A 4LY6A 3UMFA 4AV7A 5GMVA 2W2OA 2HA5A 5ALRA 3IQGX 2XE6A 2WSYB 2QIPA 3VO2A 4LXYA 4PG8A 2P0EA 4K3UA 3GUUA 4BX8A 4XYGA 9MHTA 2Q0HA 3CX4A 3O8QB 1P4GA 4ARSA 3D7SA 2AJTA 4GGPA 1SURA 1JQEA 4WEOA 1BO6A 5ELXA 2PS3A 4HB4A 1XMVA 3EVBA 5KILA 1QG2A 1T9KA 1CY4A 3W04A 3K9PB 5KQPA 4E5KA 4NJEA 4WMLA 3WAOA 4Z9BA 1NBOA 4KQIA 1Q7RA 1ULBA 3I39X 3BFKA 2H6EA 3AE7B 1I7QB 5T4EA 1KY2A 2XUFA 3QUTA 5FT9A 1YDEA 4RYDA 3ICEA 2CXUA 1GPYA 1ZVMA 1QZTA 4KDFA 3JQFA 1UXHA 1OLSA 3M6UA 3ET4A 2H1VA 4UD2A 2E4ZA 2WG1A 3RWMB 5MDHA 4RGTA 4TLEA 3M62B 4B4VA 5CDHA 3AR5A 1T4CA 2QLTA 2PUDA 4KGDA 5BPHA 3FDFA 4Z67A 3USCS 4DB2A 2INDC 2Q2OA 1XZHA 2YNVB 5DIZA 3LCRA 1KA9H 3C8HA 3CLTD 1BQ4A 4KVZA 2AG0A 4HS4A 2QX9A 3R3YA 2KVZA 1ZM9A 5JAQA 3UEOA 5K4AA 5I7FA 4UQPA 2C8JA 2Q6LA 1R66A 3F2IA 4R1SA 3V8EA 2YEPB 1M2JA 1QRSA 1C2YA 1L4KA 5F9HA 3CKYA 2WHXA 3FLBA 1MUUA 5TV2A 4R2WA 1XMSA 1W0KD 3X23A 1S4QA 4LAFA 3V2IA 2GOWA 2O0JA 4V2IA 1TO1E 2ODAA 5H9VA 4BASA 3VRBB 1Z7BA 4FFBA 5CXQA 1CETA 1E7UA 5FWYB 1OUMA 2ZRGA 4D3SA 4MKXA 4TZTA 1PR2A 1WXFA 2AXNA 3LJ3A 2D1QA 5BVGB 1I0IA 3ILYA 3QVUA 1R6VA 3VQTA 4HAVA 4F4CA 4B32A 5LKRA 4CLRA 2EIHA 1WOMA 4B33A 1KKLA 3PGVA 3ZWXA 1O03A 2ZTVA 2CXXA 1KDPA 2FZCA 3AVVA 4G4IA 4W9LA 2R751 4KSCA 3AEEB 2QL5A 3HBMA 2PQ0A 3ZGVA 4DY6A 1E9AA 1KFCB 4K7SA 4XH9B 5LXTA 2E4VA 2O7SA 3TIVA 2CGEA 3FF1A 2YOGA 3KJGA 3UT5A 4ER3A 4EDFA 2B4RO 3R9WA 4NYJR 1KP9A 4KBGA 3VTAA 4XYMA 3SMQA 3C6KA 3RFZB 3SJBA 2DPGA 4PZZA 2BMVA 4Q02A 2QILA 3LUCA 4C80A 4Q7EA 3B78A 4LJAA 2WZDA 1JIIA 4YUYA 2ZRCA 4HJXA 3CU5A 3OQ6A 3PF8A 4HLEA 3DKKA 1J19A 4EJ6A 1Y81A 2PZAA 1SG9A 4KKIA 4UDXX 4AM8A 3HCWA 5HIAA 3HB7A 3U31A 3V9PA 2CG2A 5D1HA 1FM0D 2UVQA 3AOEA 4ESEA 3EHDA 4OHFA 4L8VA 2CNBA 1BH6A 5EINA 3KUDA 1H1LA 3ZLUA 1G5PA 1V11A 2F8SA 3EGCA 3BGDA 1NNEA 2PSJA 3PY5A 3C6BA 4II2B 3GK3A 1FO4A 4D98A 3K70C 3FCCA 4MUEA 3IT2A 1F7VA 1PUTA 3E9SA 2H88B 4B8YA 3PVSA 5IN4A 3ANXA 3KWVA 3A9JB 5KWVA 5IVHA 1IN1A 5G5HA 2A0UA 3T35A 1PQ4A 2WBLC 2ERCA 4M1EA 3WGVA 1CQIA 3BFPA 4D26A 2EERA 3B2GA 4FEYA 2K8CA 3TLGB 1K88A 7ABPA 1E1QD 1SGHA 4H27A 1ZD4A 1ULUA 2NPTA 3INGA 5AJYA 2QI9C 1Y34E 4J0GA 5HFJA 1T3LA 1L9XA 2QN6A 4GM1A 2APJA 4B3IA 3JVDA 4LMRA 2GN6A 1E60A 3SG0A 2REOA 4EKEA 4LYHA 1M34B 4ZPJA 3OIFA 3F3KA 4LYGA 4NENB 4TKVB 1NUQA 1TQDA 4O29A 721PA 1ESNA 1NNLA 2H1OA 3ELUA 3KVNA 5ALGA 4WH4A 5TC4A 3WNCA 2WXGA 2XSZD 1WMHB 2CVPA 2AOWA 2CF5A 1E2GA 1GVHA 4DV3B 3NHWA 4YUXA 2FU7A 1K8XB 3EUWA 1EUCA 1YZQA 1QHXA 1GSHA 2CV0A 1L5ZA 1T34A 1NP6A 1SXIA 4GXBA 5GJVC 2OD2A 2FW9A 1Y5IA 2Q3HA 1H4SA 5M29A 1Y8QA 3V32A 3V48A 3DOFA 4TLLB 4KQ6A 3Q88A 1QT9A 3L41A 4N3BA 4KVAA 1DIHA 1VRAB 3UAVA 1YIDA 2IO3B 1Q3HA 2AYZA 5J63A 3LNTA 1DMRA 1LSJA 3CZ9A 4Z4FA 5F77A 2QY9A 4G81A 5FQAA 3P9QA 3Q0IA 4TXLA 2MR6A 2W83A 1HEUA 3F3SA 3D0QA 3WAMA 3R7FA 1RHMA 3HRHA 2ZREA 1C7IA 4Z1MA 5TLSA 3CT6A 2IYNA 3H3EA 1T25A 3Q15C 3MTGA 2FG6C 1H0HA 4LVCA 3AJ3A 1GPDG 1YNOA 4KQKA 5D3MB 4GN1A 3EA4A 2DBVO 5JIBA 3OKAA 3D3KA 5FHRA 2DVMA 1TZ1A 1ZQ9A 4X54A 3U13A 1EWYA 2N1BA 1N5KA 2K6QA 3VVWB 2ZSJA 3SXPA 4YRCA 1I1QB 4B46A 2W90A 2I33A 2W00A 1U0BB 3MHPA 2GJSA 2C8LA 3RYTA 4PHHA 1C0LA 1C8LA 4QGSA 4E94A 2VI5A 4BLSA 2A5LA 3REGA 2XCRB 2H11A 1Q7TA 5JHAA 1F4PA 3EEBA 3RBVA 4I1SA 3ZZMA 1BMFA 4HQ6A 2DLCX 2D54A 3P45A 5EFZA 4X24A 2ZJ4A 5J47A 2RGCA 2IV3A 3UO8B 3PP8A 3E0QA 4ZYNA 1Z6ZA 3FIUA 1S3SG 4HO1X 3ZWKA 1JG3A 1UBHS 1UP7A 2HA6A 4C1HA 3KSRA 5CX4A 1UXGA 1SXTA 4IZHA 2VP5A 4MMXB 1K97A 3GUZA 4NCNA 3FCAA 1K5GA 1RKVA 1JEEA 1TAHA 4Q3EA 3LFUA 2ISCA 5KYXA 2O59A 2DAJA 1RJGA 2TMDA 4X71A 4DA6A 3AI2A 1QH0A 3RKSA 2UZAA 3AU9A 3LU1A 1S3GA 4D0RA 4JP3A 2JF5A 3T9MA 2E5FA 1UK9A 2NUAB 3OCXA 5FI0B 1QIIA 4BKRA 1C8VB 2AN9A 2VJCA 3UHPA 4C88A 4ZDIA 3OIGA 2ORYA 1SIOA 5EJ5A 2YCLA 4KSLC 4A0HA 1W85B 3VUYA 1M6NA 1V0JA 1AMUA 3SQLA 4RYLA 5H9WA 2KOXA 2YS7A 2JL1A 1EWRA 3KQKA 3JQRA 4O4LB 3T5PA 5ALJA 4HAWA 3W6UA 1LTHR 2JFPA 2B76B 5JS7A 3U7QB 5KJ1A 3DEKA 3HCPA 3NBUA 3KKLA 4TUUA 3CZCA 1V1PB 1K50A 5IAAC 1VLBA 4ZVNA 5JCJD 2XN9C 4AX4A 2G1PA 1M72A 3LV8A 4XGRA 4M0MA 5JVDF 2R5NA 2ZWMA 3L6RA 5AVWA 2AQ8A 3K2EA 4UU1A 3RWBA 3G0CA 2O05A 2AYXA 1RQ2A 3BL8A 2A14A 5BR8B 3DE4X 5AW1A 1I4HA 2WJGA 2IGGA 2Q0QA 1SR8A 1IBSA 1YBVA 3I5AA 1GGJA 4NE7A 1XPUA 1WSAA 3QU9A 3KYDB 2OY0A 4IXMA 1WTCA 4FSDA 5CDFE 3R3VA 2XUOA 4COOA 2V9ZA 3H2SA 4X91A 1UPTA 1LUAA 4MYSA 1F1HA 4QICA 4JYBA 4Z4HA 3B36A 3NEAA 1PR9A 1ZN2A 2NW6A 4BP9A 1JT9A 3DZKA 1Y6ZA 2Z30A 5AJLA 4YCNA 3GMTA 2QUBA 3GROA 2IE0A 1MLDA 4Y8VA 1QIEA 2CBZA 2XNSA 1LBHA 4KOEC 4RKRA 3FLAA 2FZ5A 1GAQB 3RI3A 3L93A 1FYWA 3ADOA 2EKEC 1BC5A 3FNFA 4R1LA 3A4RA 4HNVA 2RGDA 5A3RA 3LC1O 2Q9BA 1N62A 3WHKA 1SOVA 4I6JA 3W5VB 3CUKA 4EKGA 1USKA 2YY6A 1FVHA 1D5XC 1CZHA 5BOSB 1T8TA 3EN0A 3MWDA 5C23A 2XYVA 1LDGA 2Z0DB 3NJRA 4IWOA 4L73A 3WAGA 3EFEA 4FOLA 4E1VA 1L4UA 4GL2A 2Q1WA 4JIMA 3FOAA 4QM7A 4NBWA 1EVIA 2JI4A 4U9IS 3QYFA 4JP5A 3AHIA 2ENWA 4N3CA 1J8MF 2WM3A 4RIFA 3GOEA 3QKSB 3TL5A 2VBFA 3EBOA 1VZ8A 2OV8A 5KHQA 2HMVA 4R0MA 2RJNA 1E2DA 3DCJA 2O06A 4YSZB 1CUEA 1W46A 1LLUA 3L82B 3GEHA 2DYOA 2OECA 1AUXA 2JARA 3PPAA 1OAOC 1C3OB 1N3IA 4IDHA 2ID8A 4DMHA 3RRJA 2ZVPX 3MJCA 4MWSA 2ORED 4LHEA 2ZQZA 2WDTB 5JI2E 4LJRA 4FIDA 4NYJQ 2G40A 4OK3A 4BLPA 4HDCA 3RC3A 2Q50A 2W6PA 3WGMA 4GICA 1LRJA 3G23A 5JI3E 1F2UB 4DMUB 2FLKA 1VRVA 4WA7A 2GAIA 4XUCA 1YOVA 1T3TA 3L4JA 3JD0A 3A3YA 4G01B 5JLJA 5SICE 2P2GA 3QKWA 1E6WA 2G17A 1UDAA 2JW5A 2ZE7A 3TSOA 4EMSA 4ENWA 2KJHB 1S9DA 4EHNA 2WIJA 1XLTC 3OQIA 1LY1A 4DGQA 3HFSA 3IFSA 2H4WA 3CH5A 2UYHA 3QE0A 3O8OA 4KKJA 1DI0A 3TIXB 4JU8A 1U2GC 2DJ5A 2WB4A 2X13A 1YJBA 3IDSA 3NRBA 4RF4A 1C5KA 3HO6A 3NH9A 3L4KA 1Z4JA 1IOVA 2ZJYA 1L5PA 3ILSA 3E7FA 1Q7BA 1JV2B 1C1YB 2QQ5A 1Z7WA 3WE7A 3CJQA 2K6GA 4ZHOA 1G20E 2PS9A 1XKLA 1Y5LA 2ST1A 2RH5A 4O2BA 3NTLA 1IBRA 1S2MA 1IK6A 1SBQA 2GK7A 4JEIA 4RHFA 3TPZA 4OP3A 4LGMA 3RWOA 5F76A 3U7FB 1XTZA 1OX4B 3KQHA 2VP9A 4C4OA 2I80A 4MWOA 1S5PA 1QPZA 1L4DB 4B3BA 4N9F4 4PGFA 2QR2A 2LWPA 5AVXA 1SZCA 4F8EA 1ZWLA 4ANFA 4MWTA 4TV8F 2BLNA 4OA5A 4C7BA 1ULSA 1KZ9A 4JI7B 1FEZA 3OE1A 3AVUA 3L0BA 2HSJA 2B8EA 4O5OA 5EIWA 5KZMB 4BO0A 4F86A 3G59A 4D9NA 3DDWA 4XVQA 3Q8MA 4YPVA 3I9FA 3ZDRA 3C87A 3DXFA 2PZLA 4UHCA 3KYBA 5M2QA 2CHXA 4FYJA 4KBYA 3MJRA 4ARZB 4M00A 2C3PA 5CB6A 4FCTA 1U2DC 3PC8A 2QTGA 5JNSA 5J9FA 5LKAA 4X20A 4HH4A 4QQFA 5JVDB 4EY4A 4YRJA 3HJFA 3IDAA 4NZPA 3I04A 4E2XA 4L3VA 4LZWA 3IBCA 1OYOA 2HDNB 4M98A 1RRCA 1P44A 3DHHC 2R48A 2B7LA 1OI4A 4MV9A 1LSOA 3J9CA 1O96B 4BVBA 2N9EB 1QP4A 2HXYA 4KUHA 4EJFA 2Q7OE 1WLYA 3I2FA 1CCWA 3P9KA 4OYRA 4I3GA 2H52A 2XR1A 1NRWA 3N0WA 4D80A 2Q45A 2Y1GA 2CNWA 1T2DA 4CLOA 5GZ1A 2R00A 1D0VA 4C22A 2AWOA 3DVGY 4JR2A 4NTZA 2GS9A 2DWCA 1PZNA 3NP7A 4TN5A 3HQ4O 5EWLB 4B3GA 3HJTA 1ZG3A 4P7GA 4RKFA 4HZUA 3K0CC 1UC4B 3X2EA 13PKA 1LX6A 3M3DA 1T5OA 4R8MA 3ZHZA 1TRKA 3O7WA 2E85A 2ZRIA 2OC4A 2ZE5A 3D8BA 4E70A 4G84A 2VP4A 4R8KA 4OX9B 4EXYA 1GCAA 3FYTA 1BDHA 1K3FA 1X7YB 4J4HA 3WIVA 4UW9A 4MARA 4MAFA 4IHKA 3KUXA 2Q5EA 4MW5A 4BOZB 3T9AA 2A9QA 3NT5A 2I3GA 1CJTC 1SC3A 4TVOA 2Z8YM 3QA3E 1AF7A 3EYWA 1N8TA 4C0KA 1ZRHA 4JLSA 4TSKA 4HLUA 1N6RA 2R8EA 1PJ2A 1IBCA 2Y1CA 3TR0A 2Q5HA 5HP4A 1C9DB 2MYTA 4Z51A 2IXEA 1KM7A 3THSA 1D2NA 4YRFA 3N74A 3OO0A 3FKSD 3P4SB 5HZHA 2C58A 3RNLA 2JJYA 1ISGA 2CEKA 1AO0A 2YKGA 5IXJA 1RWSA 4KCGA 1XELA 1GTG1 3TRFA 4P7BA 4OHUA 1TJ4A 4LQLA 3VZRA 1XVLA 2YV1A 1B2LA 3HL0A 3WYNA 4YAOA 1SD5A 4EZLA 2DKFA 2VT6A 1KZ6A 3RJZA 2CNNA 1YS9A 4JGGA 1IWPB 3IUYA 4OYHA 2DSTA 4ZAWA 3RC2A 3E3AA 4IWQA 2G5TA 3H05A 3H99A 2UXCB 3Q0TA 1EJ0A 1SK9A 4GMKA 3QW4B 3EEFA 2O0HA 2E82A 4DPKA 2Q5CA 4RIEA 4I3FA 4KNWA 1C79A 3IJ5A 1U0GA 3WLOA 3MRTA 1C0EA 2M5CA 5FOVA 4IXWA 3CUTA 4YRAA 4X8OA 3TW8B 2IE8A 2WZCA 1XLQA 4WZ6A 5C37A 3X0WA 5IN5A 3T61A 4KAFA 1Q92A 4NMMA 4RHUA 2NS5A 1PL6A 3RFTA 1TAGA 1MZPA 1Z34A 5K0NA 4OI0A 1E1NA 2BRUC 1XXHE 4C7VA 2R7NA 5DHTA 4G4JA 2ZW0A 5DBEX 2BGNA 4D3DA 3NUHB 3WRVA 4R8RA 3F98A 4QVIA 4NOJA 4AIIA 3WYCA 3FSEA 1K9SA 1OFFA 2WLSA 5AOBA 2QCZA 4M0LA 1DQZA 5DSXA 3T6KA 3LHKA 3MTIA 4AECA 2AJLI 1U7UA 1CUWA 3SZGA 5CAEB 6REQA 5CNJA 1T0JB 1NQXA 1WUIS 3GP3A 4BIIA 4FSBA 2AJDA 3EWSA 1FFHA 1R0LA 1FB5A 1U81A 4MSUA 1RKBA 1RQLA 3UA3A 5CBKA 5AVQA 4DYDA 2PGJA 1DUVG 2PLFA 3ADCA 4O1HA 3LQ2A 4TV8B 3I4LA 1NTRA 2J4CA 3DXXA 3JQQA 1T5IA 2EHJA 2RGBA 1QO9A 1NNI1 1FJHA 1LFAA 3NT4A 2PT7A 1OT3A 1HM5A 4LXUA 2UYCA 3IQZA 4H4DA 2Y68A 4GI1A 3N2YA 1W4LA 1UBCA 2CCGA 3KQVA 3H5VA 1SG6A 3FHTA 3OJCA 5FV7A 5JJLA 4FGLA 4BN0A 4WESA 4G1FA 2FDCA 4XFDA 4IDAA 4GPD1 4XPIB 2IIQA 2XVXA 5DI9A 1TVCA 2GAJA 3T94A 4EB0A 5IWCA 4CYEA 3QH4A 5D3QA 1NASA 3BXEA 1P2TA 1G8YA 4OJYA 4FZVA 1EFDN 2FRDA 4PT5A 2GZ1A 3ZXRA 3STVA 3DCNA 4UAVA 4DV2B 4QFCA 3KJIA 4UDNA 1R10A 4KXYA 1XQQA 2BKFA 3H2GA 2B30A 1UWCA 1E2IA 2BAGA 5C1OA 2L05A 2R1ZA 1HZ5A 4F7DA 2BKEA 2WF5A 3FUXA 4CTMA 3RK4A 2F4VB 1RXEA 2LBPA 3H7PB 3ZV5A 2JS7A 4JU9A 2QE7D 3CF0A 2HSWA 1VBMA 1YB4A 2HNBA 4CLEA 2XRYA 1ML3A 4BAZA 3V3TA 3TBFA 5HKLA 4B8WA 1EG2A 3OFJA 1VDZA 2R47A 1K6EA 2I2XB 2DFNA 4Z2YA 2AR9A 4CQMA 2BSAA 4WK2B 1V1OA 4DCUA 3PYLA 3FAKA 1YVEI 4M01A 4XDCA 4LRYA 1V37A 3V8VA 2NU6A 4GGQA 3KWMA 1L8QA 2OEPA 1KZYC 2ZYIA 3PK0A 3AR7A 3U19A 1V25A 4FEGA 3TQIA 1GN8A 2VQDA 3RU2A 5AQEA 4U6NA 2FU6A 3CXRA 2VT3A 3L5KA 4P4SA 3E2PA 1XF5L 4IM2A 1JLHA 2ERYA 4QODA 4V0NA 1DV1A 3IHLA 5PGMA 4NWIA 1S8FA 1FDTA 5CEJA 5JO0A 4FBGA 3T0FA 5JSHA 1TYDE 1ENZA 4GU5A 3I5YA 1UQTA 3OPYI 1V26A 4NZOA 5ALEA 1VJCA 1KH2A 3W8DA 3X2SA 3ME5A 4ZQFA 1OKKA 5T8KA 4YPOA 2NM0A 4JSYA 2QUKA 4PZAA 3QOFA 4E15A 4JXJA 1OJ7A 3M5WA 2Y1FA 5JNTA 2QYSA 1BA3A 2F62A 2WG0A 1YRYE 4OUKX 1WSBA 3BXZA 1PL8A 2B9VA 4PVOA 3R3WA 3LX6A 3DZIA 1R64A 5G4KB 2VT2A 1DKMA 1ADBA 1P7CA 1N2BA 4IVNA 3A6HA 1YGYA 3PEWA 1FPMA 5DK4A 3WGGA 3UF0A 1KI2A 5BSGA 3TFOA 3RMKC 1TS3A 5JWOA 1R88A 1PJLA 3HWWA 3ICVA 3IXQA 5K3CA 1JHMA 4RDHA 5LMZA 4I81A 2B5OA 2X2PA 2WI8A 4M36A 4E12A 3C3JA 4TM8A 3WDMA 2O2VB 2KTRB 4J16C 3W6ZA 4DBZA 2BUAA 2J3EA 3KLMX 1MOPA 4BJ6A 3SF8B 3ZE6A 3BCSA 3DBVO 1M0WA 3H8JA 3VHQA 2YJGA 3KHUA 4DE5A 3ERCA 1OI7A 1ODCA 1Z37A 2BH2A 3KQYA 3MJDA 1PK9A 4G23A 3P4RB 3QGMA 5KYNA 2AK2A 2ZRBA 3MAJA 1UT6A 1BJKA 1XTVA 3PDIA 5KSWB 3G88A 4RA6A 4PDXA 3AEKA 4QPCA 3SBDA 5JASA 3OO1A 1KKUA 5FL7D 4RVUA 2C9MA 4QTTB 4I9HA 3PRHA 2GF0A 4L5BA 1ZVJA 4L5CA 4CN9A 1WYGA 3LA8A 1PJQA 2FA9A 5CMLA 3GLVA 1XLNA 1NX6A 4J5HA 4HXYA 1WE2A 1FJXA 4LOIA 3ENNA 1XZKA 2JHGA 2QROA 1Z4QA 2QVGA 2ZU6A 3D3EA 4MYRA 5ERGB 3W2IA 1X8IA 1PUJA 2VDUE 1HNXB 4DCPA 2I65A 4EA7A 2P2ZA 4MINA 2B37A 3GRPA 2FHPA 2G9RA 2R6FA 4BIMA 4I1UA 4JOBA 4ZAVA 5EQJB 1P62B 3IUMA 5IARA 1U5AA 2A86A 1MDFA 3OHPA 3QE2A 4BVEA 5KPJA 3IP1A 4GKAA 1BRTA 4RBSA 2Q1YA 3AERB 4JP8A 1HA5A 2A0XA 3V1YA 1Y89A 2GDZA 4NNPA 5IT0A 1N7IA 3PJGA 4O4JF 5DHRA 5IDQA 3K9OB 4JGIA 3BDVA 4WT7A 2CK3D 1ID1A 1Q22A 1I6MA 2NYUA 4I4LA 4AJHA 1EVZA 3I2KA 5AJUA 4OGWA 2MOKA 2E4XA 1YB6A 5K20A 4QU8A 2HNAA 2OCIA 3PI7A 3ZE1B 3AB7A 4WCDA 4XVHA 2QMOA 4EKNB 2VWPA 4MV7A 2P8SA 4CWAA 2QTCA 5AK6A 4EYQA 1T9AA 3FGZA 4N47A 2X9NA 3RRYA 2BFDA 4KYVA 2Z9BA 1GTL1 5J18A 4DA7A 3JZIA 4HGNA 4UNIA 3GLFE 1IUKA 2WT8A 3L1JA 3AUSA 2KANA 4EUNA 2AYYA 1WW1A 1AN8A 1ADGA 2O8BA 3RE1A 4A3OA 4HWIB 1DTWA 4FMCF 1VB3A 1YZFA 1YS6A 4AP5A 5FWAA 2Y4NA 3ZHXA 5LQMA 3QEKA 3USES 3UWKA 5DYYA 3TLXA 1PDWA 3HKBA 4BVGA 1FVOA 1D2GA 3WRXA 3JQAA 3O8BA 1W1WA 3BZDB 3CX6A 4IH1A 3L8ZA 2OBNA 4P7FA 3HABA 3LUGA 1JBEA 1T8YA 1Y1PA 1RWOA 3DE1X 2ATVA 4HRYA 3CSDA 4YMIA 4WVLA 4WWOA 4LJOB 1PD0A 3ZU2A 2UKDA 1QV6A 3AHFA 3KZOA 3WWPA 1E1KA 1NBFC 4E71A 4CU2A 2P4EA 4MXDA 3MN1A 4MR7A 4RAQA 1NMZA 3BCUA 2FCMA 4CEIA 5HIOA 2I3AA 2VS1A 2VWQA 4A16A 4EZIA 3BGWA 1AJEA 2QJWA 5CIWA 3ZOKA 1P39A 4LJLA 1ODFA 5DU2A 4WGGA 2Q9AA 3C98A 3DBHB 1TAUA 1IJEA 1Y63A 4FHCA 1TY2A 3COPA 1XLOA 2NZVG 3RFFA 1H4QA 4JT2A 1VGQA 4F97A 4LOHA 2WPDD 1E3MA 4QO7A 3A9SA 2ZP1A 3T8YA 1H6DA 2LVPA 2DYMA 5IG2A 4INOA 1H6BA 4QECA 1NW9B 2ZNVB 3OZAA 1F5NA 3SSAA 4EBBA 3NT2A 2ODWA 1WPXA 3ZH9B 1TZCA 2I4OA 4IMPA 4U8HA 1Z26A 2UZ4A 2Z58A 2HA2A 3DEZA 5KB3A 3R8CA 4F6CA 5HFNA 1NW5A 4DLRA 2BHNA 4YV2A 5CJ2A 2W0SA 3S3TA 4IJWA 3THWB 1KTKA 1R4NI 5U4QA 2ZPNA 4QL3A 3V00A 2AR0A 1C29B 2WWWA 4DXAA 4LKOA 1E5LA 3MYYA 2QORA 5DN6A 5ACPA 2JZ3B 3DWMA 1LDYA 4I4TF 3X44A 3NNNA 3SD5A 1GSOA 1CMXB 2H4FA 1KMHB 2DETA 3WWDA 4LYJA 4FZJA 4GDMA 1A7UA 4C9BA 3ZTCA 2MCFA 3RTAA 3QKIA 1JP7A 4Y2YA 3W1SC 3P0RA 1RZUA 1R0BA 4HAOA 3AKCA 2BYVE 2A30A 1XP8A 2P4QA 3CRRA 1MDBA 2IY9A 1D4AA 3U3MA 4DDID 3IE1A 5AW4A 4QVKA 4FUQA 3DM9B 4H1VA 4XWWA 3A9VA 2PH3A 4CR8A 4PNPA 3DE6X 3MC0B 4MZXA 3SKXA 4UXIA 4EGAA 2IEAA 3EASA 5BO4B 5AOCA 3Q8EA 3N8DA 4DLXA 2OQVA 2YWCA 2P5UA 1OXSC 4HYTA 4JJ6A 4IXNA 2WAMA 2MCNB 2GI4A 1Y82A 2IEYA 4CMAA 4BFVA 1Z2NX 5KYUB 5LFAA 3MYRA 4C14A 5LWQA 3BMCB 4PYOA 2J4FA 1NI4A 3MJVA 3KB2A 3ORRA 3KLSX 2KWDA 3WK6A 1ZPDA 3ZXXA 4Y2JA 2IEIA 1FFVA 4ZZ0A 5ITZA 2HW8A 4D46A 2WRZA 3JYQA 5EP3A 2D1RA 2Z8XA 4IKGA 1E2LA 2X4DA 3KZCA 2DNFA 1IYFA 3PHBE 4GECA 1V45E 1WUPA 3IQIX 1GQOA 4E2ZA 5BYKA 1L8AA 2ZB7A 3VKWA 4FYPA 3HCAA 5E7QA 3RKRA 4Y2GA 4O4JB 1KQNA 1KEZA 2WMYA 2COKA 2NBVB 2EW2A 1URPA 2I0FA 2WHIA 3KE8A 1E64A 1OXBB 5AVVA 1WM2A 4ZANA 2BBOA 1IIRA 2HLNA 4IINA 4YUVA 2ETVA 4XJVA 4ECAA 1UANA 3PD1A 4OJQA 3ZE9A 3OF2A 3BZUA 3KX2A 3U3KA 5JH5C 3H0CA 2I99A 3LBAA 2MLBA 3AILA 5MPOA 1A77A 4EJ2A 3ID6C 5FB3A 5I01A 2QTAA 4L0QA 1M6VA 4HDQB 4B3SB 1VECA 4D8VA 1YC5A 3CH6A 3HH8A 2JJ2D 4YWGG 4DHJD 3PXDA 2FRXA 2UDPA 4LF9B 3BN3A 1IZYA 3RYIA 2G06A 3PR3A 2OWDA 1NU8A 4YP6A 4E7OA 3LHFA 1I80A 5FK9C 4J2TA 2HADA 4JLUA 2IDMA 1U0JA 2OE2A 1E1QA 1IB0A 3QVJA 4KH0A 1AGPA 3KPVA 2FETA 2V8BA 2FPOA 4BUCA 3M89A 2V8OA 3PIDA 5JJKA 5EJ8A 1YH3A 2WSMA 2D2IA 2PNFA 3ETEA 4LXQA 3H1PA 2WSIA 5K9ZA 2IYAA 3VNBA 2C2WA 3QVGA 4FJ0A 3T34A 4GPZA 5B30A 3TR6A 5HH5A 4AJ9A 1ORRA 4J03A 3TQQA 2I8CA 2LZ6A 5FUMA 2DCUA 4CKYA 4BFSA 4AS2A 3DB1A 1ADFA 4CCYB 4RL6A 2Y76A 3PCRB 4QD3A 3RNEC 1ORVA 3Q72A 1ZS9A 3JYPA 4IIFA 3FTPA 1GPKA 1X7DA 2VRCA 1JTEA 3ZWWA 3KSDO 4UDOA 1KIAA 4RH6A 3O4RA 3J80A 4RV9A 2BFCA 3ZNNA 3LGAA 4XX1A 3DWGA 5EZSA 3HDJA 1TCUA 2XT6A 4J2OA 4GXNA 2V6BA 2NO1A 4OYYA 1H8CA 2YMMA 1VRWA 1JF8A 3A3OA 3NTOA 2XE8A 3GBSA 5HOQA 5IFLA 2OGUA 4Q9NA 4MOWA 2IZVB 1NURA 1TS2A 3UM9A 2GCNA 1UBQA 1FNNA 2FCNA 3UKOA 1E69A 1F48A 2BTEA 2QK4A 1HE3A 3NHYA 3NHZA 4GAEA 3RI7C 1PI3A 1ZC4A 4JC8A 1I3NA 3H1FA 3L01A 4I4TB 5AICA 1G3QA 2BELA 1A71A 3EQZA 1NXTA 2JFOA 3VTWA 1S02A 1XQXA 3HHEA 5JG7A 3ESZA 3DAGA 4BNNA 1WVMA 4NY0A 3CURA 3NB0A 4MDEA 5F5XA 1UWLA 1XEWY 5J23A 5GZ3A 1EDEA 1K3TA 4CNQA 1XT9B 2GTHA 1LFDB 4NXMB 2F6RA 4JMPA 1ONSA 3DE5X 1ZGBA 5LZ9A 1HTBA 1V48A 1EFUA 2P5TB 3G13A 1AQ6A 1QHGA 1KOLA 2JBAA 2PZBA 4IMJB 3K0KA 1DRJA 2GBLC 1QHFA 2DTEA 5J3JA 4BVKA 2ECKA 2R7KA 2XCQA 4CEHB 5DBGA 2N46A 1DBIA 4NSNA 3KLNA 1XTIA 3SC2B 4Y2RA 4UOZA 1T9ZA 5B3RA 1RAEA 1H93A 1BFKA 1XKXA 3DO8A 3BXPA 2G9VA 3RKJA 5C7IO 1KVUA 3IAS6 4PS1A 3X0DA 3CY6A 5JDIA 4UQLA 4YRDA 3D2LA 4HTAA 5K0JA 2COUA 3MJ4A 5F2NA 4DPMA 1JG7A 4AWAA 4GRIA 3QX7A 3DW3X 1HF3A 4GBMA 1EH5A 3DTVA 2Y1WA 1XDGA 4FX5A 1YDGA 4QYIA 5JHGB 4ZVUA 3DE2X 2QVYX 3CF2A 4CG2A 4O2AB 2WAXA 1T91A 1Y9DA 1DRKA 1DT5A 1MQOA 2NNWB 1JPUA 2I2CA 2KWCA 2VHUA 1WV1A 2DWUA 5FEUA 1AKMA 4RHYA 4Y7CA 3VPXA 4PZCA 4O33A 5EJMA 4EOYA 1RBQA 4MAAA 3JQBC 3RUAA 3JS5A 1SXJA 1LW7A 3O0TA 1GIAA 3N39C 2JGFA 4ZHSA 1KFYB 1Y6FA 4JQCA 4PY2A 4A8XC 4I6NB 2KACA 1SSNA 2RGAA 1VL0A 5BSMA 3VR4H 3L0SA 2GXQA 3AMVA 3U4GA 1YULA 2WTBA 4IZOA 1JLLA 2G7ZA 3IV7A 4F85A 3P2MA 2XCUA 4NZMA 5AJWA 2QTBA 3W34A 4OJTA 4MUBA 1SQFA 3BA1A 5JMWA 2Q4RA 3E9DA 2Y67A 3IIJA 2HREA 1GKUB 1GG8A 3H1TA 2IYZA 1MO2A 3DQZA 5B7GA 2PVCA 1CW2B 3OJWA 4KN5A 1YMVA 4O4LF 1TT5A 5ALYA 4XYBA 4JL8A 4Z49A 1U9ZA 4FINA 3HCRA 3AZOA 4WIAA 4H1UA 3K4HA 4LYFA 1E1YA 5BXYA 5HJ7A 2GVNA 4JXKA 1FP2A 2WXNA 4OL9A 3DBLB 1UAAA 1NVMB 5AHKA 3RJ5A 1SXPA 2W2QA 1Y1RA 3JASB 1X13A 1HLGA 1ANKA 1QE0A 4PLZA 3R40A 3IT0A 4QA9A 1V3TA 2WV7A 3PYXA 3U4IA 1GNQA 3ZVKA 4YLGA 3GLKA 2YNTB 1Z4LA 2I4MA 4MX8A 2JHAA 4N82A 3U60B 2AW5A 3D32A 5K6AA 4AY6A 2M6SA 1L7QA 4LRUA 3B1YA 1FS5A 4BU1A 2I38A 2J9GA 1W36D 1T8PA 3TFQA 2C42A 5DF1A 5JBIA 4WNIA 2PFSA 1VDVA 1L1FA 4S0RA 4LNHA 3EARA 5HGXA 5AP9A 2G7MC 2YIMA 4DV7B 4M2LA 5G2NA 4IWYA 5IF3A 5GJCA 5FUYA 1JHUA 2PRJA 5ACUA 2VN8A 2B99A 2GM5A 4BTLA 1JR2A 2C2XA 4FILA 3SBEA 4U7HA 2MJLA 1JZSA 5KIAA 1YOBA 4H9GA 1XRMA 4FTWA 1RZRA 4MPPA 2QUJA 1N9KA 4AK9A 1PBNA 3TSYA 2MW5A 4B4WA 3VHXA 4X7BA 3A6JA 4G1UC 3FRHA 4YJHA 4PGGA 1RPTA 2I6XA 4IFTA 4ZU1X 1K8ZB 2M56B 4JASB 4ANWA 3QXSA 4RC9A 1IOWA 4MICA 4AMGA 2CNLA 1XWWA 2VA8A 2O0LA 4JI5B 2NT4A 3P4YA 3U4EG 4MVJH 1A7KA 2FSHA 1JKIA 4Z4IA 3GW8A 3HNOA 1DTSA 2W2NA 1PEDA 1QX4A 3C16C 3HJHA 4AJOA 1XQWA 1UDBA 1ET6A 4MRAA 2RMMA 4CHLA 3IBTA 3TTYA 3W8FA 4ODIA 1P2FA 3ZY3A 2OB1A 3QFHA 3AU4A 1GGVA 2ZIZA 2PDAA 1QCZA 5DISB 5JBQA 1KWGA 1PR1A 3SS8A 2ZWVA 1TADA 4J90A 3OZDA 2OJRA 4OPMA 4OUDB 1PEAA 3I5XA 2HJ1A 2A1UA 4CM4B 3R4VA 1VIDA 1F52A 3GP8A 1BE6A 3S8MA 4UUPA 1C7FA 2D1SA 3ZE8A 2F1KA 3VTFA 3M70A 4DK5A 4C21A 3MJWA 4UPVA 3FMOB 3ZRFA 2FSUA 2GBMA 4BGEA 3AV8A 1L7MA 4OBWA 4E32A 3W9UA 1IJBA 2DJIA 4CU5A 2OD9A 5EZYA 3K1JA 1BDMA 4MI1A 3WV4A 3ZYYX 5F12A 1QLWA 2ACEA 1YIWA 4L6AA 1L5KA 2V55B 4DWJA 2R60A 2IW3A 3IO5A 1FYFA 2O20A 4YN3A 4ASUD 1JALA 3ZWQA 2DWQA 4LNUA 5LOVF 5CA0F 3ELDA 2D5BA 4O63O 5EKUA 3WIMA 1N2ZA 1EUYA 1XNQB 2DB3A 2IP2A 3HG7A 4NAUA 5E3JA 4MA0A 3ED1A 2NQTA 4PS7A 3FLMA 2VHXA 1K3UB 1GP2A 2JZNA 4RPCA 1KLVA 5DXJA 3TQHA 1VG8A 2DUMA 1VBNA 4EJ0A 3VC7A 4BNDB 2NXJA 3LVZA 5DIFA 4OK5A 1I4WA 4DWVA 3PGJA 2BB5A 1XQ6A 1WV0A 2VSFA 1QIHA 2BWFA 2E37A 1DKUA 3CTPA 2LJ5A 1X19A 4F5ZA 1R8JA 2RB4A 4OMDA 1ZGJA 3NDIA 3L4EA 1TKBA 1Z4OA 2ZJ5A 5IX8A 2VPTA 5A0VA 3BD9A 3MCVA 3U56A 1P17A 3P9ZA 1I4DD 5F51A 3QEJA 3W9SA 2W71A 4TYNA 3N2LA 5AI9A 2XGJA 4ABYA 5AKLA 2YWXA 1M6EX 5HM8A 1YCFA 3JRWA 1H8ED 2I6TA 2GD0A 3EZGA 3D3WB 3OFVA 1KPIA 5E6PA 3VU9A 1NVVQ 3CJRA 3LYUA 5CDSA 2L0TA 3FILB 4D43A 1OWOA 3URYA 2D3AA 3RYHB 3GFQA 1V16A 1Y3HA 5AFSA 2HA4A 1NWCA 3AESA 3LA6A 1RQGA 4HL6A 1T0HB 2HFKA 1XYYA 2H1LA 3F6CA 1LV8A 1QVAA 2Z2XA 3G0BA 5FFMA 2EBWA 2O23A 4GO1A 3FUWA 1LA2A 1YQWA 1C1HA 4FLMA 3AEFB 5L45A 3RVSA 1VZ6A 5C1ZA 1CS0B 4GYJA 4EGJA 3E3NA 3PE3A 2FLWA 4KH1A 3L7MA 4PLPA 1TCAA 1M8PA 4AP9A 4A3PA 4AQ7A 5JSKA 1X1EA 3C0KA 3QLJA 2GO7A 3PQ3A 5HK9A 5H4GA 2H1RA 4TYTA 3SKYA 1IQPA 1E10A 4NFLA 1UMCA 1QS0B 1BEZA 3G1TA 3DXYA 1ECPA 5I51A 4G5GA 4WK6A 1JG2A 1C4XA 2G77B 4NXNB 2Q3CA 4L9SA 4Q3LA 4GQAA 4MH0E 1M1YE 4BKSA 3T3GA 1JDBC 1W0JA 3NV7A 4TS1A 2FWMX 2YZMA 4DCTA 4WOJA 4M89A 4B3FX 2RDGA 1R0RE 2JFVA 2CE7A 3TZKA 5E6RA 4B0OA 1M2EA 1TPYA 2BUBA 1V5WA 5CD1A 4YR7A 2GYWA 1BMLC 3B5JA 4R1QA 2WWHA 1Q5WB