3X30A

Crystal structure of metallo-beta-lactamase from thermotoga maritima
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
227
structure length
227
Chain Sequence
GMKVTFLGHAVVLIEGKKNIIIDPFISGNPVCPVKLEGLPKIDYILVTHGHGDHLGDAVEIAKKNDATVISNYEICHYLGKKGVKTHAMHIGGSYLFDFGRVKMTPAVHGSGILDGDSMIYGGNPSGFLITIEGKKIYHAGDTGLTREMELLAEENVDVAFLPIGGNFVMDVEDAVRAAVMIKPKKVVPMHYGTWELIFADVELFKKKVEEKGVECVILEPGESLEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of metallo-beta-lactamase from Thermotoga maritima
rcsb
source organism Thermotoga maritima msb8
molecule tags Hydrolase
molecule keywords UPF0173 metal-dependent hydrolase TM_1162
total genus 60
structure length 227
sequence length 227
ec nomenclature
pdb deposition date 2015-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 3x30A00
2FU7A 3WXCA 5LCHA 4YSKA 2DOOA 5EH9A 2CBNA 5B3RA 4C1FA 3KNSA 1VMEA 5KIKA 3X2ZA 2P1EA 4NQ4A 4AWZA 2ZO4A 1QH5A 3Q6VA 5LLDA 3IOFA 1E5DA 3FCZA 1VGNA 4UWSB 5LE1A 4XUKA 5EW0A 3I14A 4J5FA 5LS3A 4GYQA 3VQZA 2Y8AA 4HKYA 4UWOB 5K4MA 4EXSA 1DXKA 3AF5A 1XM8A 2WYMC 3BK2A 4UAMA 4DILA 3ESHA 4RAMA 4RL0A 3I13A 3DHBA 2BR6A 2NYPA 5AXRA 3RPCA 4XWTA 4RBSA 5ACTA 5HH4A 3X2XA 4EYFA 2YNWA 2BGAA 2YNTB 4Z5ZA 4UBQA 2WHGA 3IE1A 3QH8A 5B1UA 1BVTA 5LCFA 2YNUA 2GCUA 3BV6A 1Y44A 4FR7A 3FAIA 3G1PA 5A5ZA 4EFZA 4D02A 3BK1A 2Y87A 3R2UA 3A4YA 4H0DA 1BC2A 5IQKA 5ACVA 4TZ9A 4PVTA 3IDZA 1L9YA 4TZEA 1DDKA 2I7TA 5KILA 4FSBA 5K0WA 2DKFA 1SMLA 2OHJA 1XTOA 1JJTA 2NZFA 2GFKA 5AHRA 4Z7RA 1KR3A 5LMCA 5AHOA 3SW3A 3IELA 4ZO2A 4J5HA 3TP9A 4AX0B 1MQOA 1WW1A 5A87A 4EYLA 3ADRA 3F9OA 5ACWA 5AEBA 3X2YA 2P4ZA 2Q42A 5HH6A 1YCFA 2QEDA 3VPEA 5FQBA 4D1TA 3SD9A 4C1CA 4D1VA 5FQAA 2VW8A 2Q0JA 2Q0IA 5AYAA 4GCWA 4F6HA 3KL7A 4C1GA 3I11A 1DD6A 4UWPB 4V0HA 4D1WA 3P2UA 1KO2A 2ZZIA 4KEQA 4YSLA 3PY5A 4DIKA 4AWYB 5EVDA 4KEPA 3ZNBA 3ZR9A 2BG8A 2P97A 2GFJA 4BZ3A 2M5CA 4Z60A 4NQ6A 3S0ZA 5A0TA 3DHAA 4JO0A 2BG6A 4RL2A 1K07A 5ACPA 4EYBA 4BP0A 5HIOA 2NXAA 2FM6A 2XR1A 4NQ2A 4XWWA 1P9EA 2FHXA 2BG7A 5HISA 3I15A 4P62A 2FU8A 5ACUA 1YCHA 3AF6A 5EWAA 4C1EA 1X8GA 2BG2A 2A7MA 4AX1B 2YCBA 2BG8B 4LE6A 5FQCA 2AIOA 4EY2A 2BFZA 2XF4A 3IEKA 2FU9A 2Q9UA 4UA4A 4ZNBA 2BC2A 2HB9A 2I7XA 4HL1A 3RKJA 2QDTA 1YCGA 2WYLA 2WYMA 2UYXA 4CHLA 2ZWRA 1A8TA 3DH8A 3ZQ4A 4U4LA 4F6ZA 2YNVB 3PG4A 4NQ5A 5ACXA 4ZO3A 1JT1A 4UWRB 5LSCA 2BFLA 3JXPA 5LCAA 2FHXB 3IOGA 5HH5A 2YZ3A 1X8IA 2FU6A 2GKLA 5AXOA 4C09A 3L6NA 5EVKA 4D1UA 4RM5A 4TZBA 5A0VA 2FK6A 2BMIA 4HL2A 4TZFA 1WUPA 1HLKA 2P18A 4RAWA 2BFKA 4O98A 2AZ4A 5EV8A 4YSBA 3PY6A 4EXYA 1WUOA 5B15A 4AD9A 2QJSA 1KO3A 4Z67A 3IEMA 2QDSA 2BFZB 1ZNBA 4TYFA 5EHTA 5HIPA 3T3NA 5EVBA 5ACQA 3T3OA 4ZEJA 4C1DA 2ZNBA 2Y8BA 5EV6A 1QH3A 3ZWFA 2NZEA 5HIQA 2BIBA 3DHCA 1VJNA 2GMNA 4C1HA 2YNVA 2M5DA 2QINA 4WD6A 3SPUA 1M2XA 5DPXA 5K4KA 3RKKA 2OHIA 3LVZA 1WRAA 4Z5YA 3BC2A 3H3EA 1BMCA 3SRXA 3X30A 4GYUA 5LM6A 3I0VA 2I7VA 1ZTCA 2YNTA 3AJ3A 3IE0A 3IE2A 4TYTA 4FEKA 3SBLA 2OHHA 3MD7A 4PVOA 1A7TA 2E7YA 5K4NA 3SFPA 5ACRA 3T9MA 4Z6XA 5ACSA 2WRSA 2H6AA 2R2DA 2BTNA 3KNRA 1JJEA 4B87A 1ZKPA 1X8HA
chains in the Genus database with same CATH superfamily
2FU7A 3WXCA 5LCHA 4YSKA 2DOOA 5EH9A 2CBNA 5B3RA 4C1FA 3KNSA 1VMEA 5KIKA 3X2ZA 2P1EA 4NQ4A 4AWZA 2ZO4A 1QH5A 3Q6VA 5LLDA 3IOFA 1E5DA 3FCZA 1VGNA 4UWSB 5LE1A 4XUKA 5EW0A 3I14A 4J5FA 5LS3A 4GYQA 2CFUA 4AXHA 3VQZA 2Y8AA 4HKYA 4UWOB 5K4MA 4EXSA 1DXKA 3AF5A 1XM8A 2WYMC 3BK2A 4UAMA 4DILA 2CFZA 3ESHA 4RAMA 4RL0A 3I13A 3DHBA 2BR6A 2NYPA 5AXRA 3RPCA 4XWTA 4RBSA 5ACTA 5HH4A 3X2XA 4EYFA 2YNWA 2BGAA 2YNTB 4Z5ZA 4UBQA 2WHGA 3IE1A 3QH8A 5B1UA 1BVTA 5LCFA 2YNUA 2GCUA 3BV6A 1Y44A 5A23A 4FR7A 3FAIA 3G1PA 5A5ZA 5AIJA 4EFZA 4D02A 3BK1A 2Y87A 3R2UA 3A4YA 4H0DA 1BC2A 5IQKA 5ACVA 4TZ9A 4PVTA 3IDZA 1L9YA 4TZEA 1DDKA 2I7TA 5KILA 5AJLA 4FSBA 5K0WA 2DKFA 1SMLA 2OHJA 1XTOA 1JJTA 2NZFA 2GFKA 5AHRA 4Z7RA 1KR3A 5LMCA 5AHOA 3SW3A 3IELA 4ZO2A 4J5HA 3TP9A 4AX0B 1MQOA 1WW1A 5A87A 4EYLA 3ADRA 3F9OA 5ACWA 5AEBA 3X2YA 2P4ZA 2Q42A 5HH6A 1YCFA 2QEDA 2CG3A 3VPEA 5FQBA 4D1TA 3SD9A 4C1CA 4D1VA 5FQAA 2VW8A 2Q0JA 2Q0IA 5AYAA 4GCWA 4F6HA 3KL7A 4C1GA 3I11A 1DD6A 4UWPB 4V0HA 4D1WA 3P2UA 1KO2A 2ZZIA 4KEQA 4YSLA 3PY5A 4DIKA 4AWYB 5EVDA 4KEPA 3ZNBA 3ZR9A 2BG8A 2P97A 2GFJA 4BZ3A 2M5CA 4Z60A 4NQ6A 3S0ZA 2CG2A 5A0TA 3DHAA 4JO0A 2BG6A 4RL2A 1K07A 5ACPA 4EYBA 4BP0A 5HIOA 2NXAA 2FM6A 2XR1A 4NQ2A 4XWWA 1P9EA 2FHXA 2BG7A 5HISA 3I15A 4P62A 2FU8A 5ACUA 1YCHA 3AF6A 5EWAA 4C1EA 1X8GA 2BG2A 2A7MA 4AX1B 2YCBA 2BG8B 4LE6A 5FQCA 2AIOA 4EY2A 2BFZA 2XF4A 3IEKA 2FU9A 2Q9UA 4UA4A 4ZNBA 2BC2A 2HB9A 2I7XA 4HL1A 3RKJA 2QDTA 1YCGA 2WYLA 2WYMA 2UYXA 4CHLA 2ZWRA 1A8TA 3DH8A 3ZQ4A 4U4LA 4F6ZA 2YNVB 3PG4A 4NQ5A 5ACXA 4ZO3A 1JT1A 4UWRB 5LSCA 2BFLA 3JXPA 5LCAA 2FHXB 3IOGA 5HH5A 2YZ3A 1X8IA 2FU6A 2GKLA 4NURA 5AXOA 4C09A 3L6NA 5EVKA 2YHEA 4D1UA 4RM5A 4TZBA 5A0VA 2FK6A 2BMIA 4HL2A 4TZFA 1WUPA 1HLKA 2P18A 4RAWA 2BFKA 4O98A 2AZ4A 5EV8A 4YSBA 3PY6A 4EXYA 1WUOA 5B15A 4AD9A 4PDXA 2QJSA 1KO3A 4Z67A 3IEMA 2QDSA 2BFZB 1ZNBA 4TYFA 5EHTA 5HIPA 3T3NA 5EVBA 5ACQA 3T3OA 4ZEJA 4C1DA 2ZNBA 2Y8BA 4AV7A 5EV6A 1QH3A 3ZWFA 2NZEA 5HIQA 2BIBA 3DHCA 1VJNA 2GMNA 4C1HA 2YNVA 2M5DA 2QINA 4WD6A 3SPUA 1M2XA 5DPXA 5K4KA 3RKKA 2OHIA 3LVZA 1WRAA 4Z5YA 3BC2A 3H3EA 1BMCA 3SRXA 3X30A 4GYUA 5LM6A 3I0VA 2I7VA 1ZTCA 2YNTA 3AJ3A 3IE0A 3IE2A 4TYTA 4FEKA 3SBLA 2OHHA 3MD7A 4PVOA 1A7TA 2E7YA 5K4NA 3SFPA 5ACRA 3T9MA 4Z6XA 5ACSA 2WRSA 2H6AA 2R2DA 2BTNA 3KNRA 1JJEA 4B87A 1ZKPA 1X8HA
chains in the Genus database with same CATH topology
2FU7A 3WXCA 5LCHA 4YSKA 2DOOA 5EH9A 2CBNA 5B3RA 4C1FA 3KNSA 1VMEA 5KIKA 3X2ZA 2P1EA 4NQ4A 4AWZA 2ZO4A 1QH5A 3Q6VA 5LLDA 3IOFA 1E5DA 3FCZA 1VGNA 4UWSB 5LE1A 4XUKA 5EW0A 3I14A 4J5FA 5LS3A 4GYQA 3VQZA 2Y8AA 4HKYA 4UWOB 5K4MA 4EXSA 1DXKA 3AF5A 1XM8A 2WYMC 3BK2A 4UAMA 4DILA 3ESHA 4RAMA 4RL0A 3I13A 3DHBA 2BR6A 2NYPA 5AXRA 3RPCA 4XWTA 4RBSA 5ACTA 5HH4A 3X2XA 4EYFA 2YNWA 2BGAA 2YNTB 4Z5ZA 4UBQA 2WHGA 3IE1A 3QH8A 5B1UA 1BVTA 5LCFA 2YNUA 2GCUA 3BV6A 1Y44A 4FR7A 3FAIA 3G1PA 5A5ZA 4EFZA 4D02A 3BK1A 2Y87A 3R2UA 3A4YA 4H0DA 1BC2A 5IQKA 5ACVA 4TZ9A 4PVTA 3IDZA 1L9YA 4TZEA 1DDKA 2I7TA 5KILA 4FSBA 5K0WA 2DKFA 1SMLA 2OHJA 1XTOA 1JJTA 2NZFA 2GFKA 5AHRA 4Z7RA 1KR3A 5LMCA 5AHOA 3SW3A 3IELA 4ZO2A 4J5HA 3TP9A 4AX0B 1MQOA 1WW1A 5A87A 4EYLA 3ADRA 3F9OA 5ACWA 5AEBA 3X2YA 2P4ZA 2Q42A 5HH6A 1YCFA 2QEDA 3VPEA 5FQBA 4D1TA 3SD9A 4C1CA 4D1VA 5FQAA 2VW8A 2Q0JA 2Q0IA 5AYAA 4GCWA 4F6HA 3KL7A 4C1GA 3I11A 1DD6A 4UWPB 4V0HA 4D1WA 3P2UA 1KO2A 2ZZIA 4KEQA 4YSLA 3PY5A 4DIKA 4AWYB 5EVDA 4KEPA 3ZNBA 3ZR9A 2BG8A 2P97A 2GFJA 4BZ3A 2M5CA 4Z60A 4NQ6A 3S0ZA 5A0TA 3DHAA 4JO0A 2BG6A 4RL2A 1K07A 5ACPA 4EYBA 4BP0A 5HIOA 2NXAA 2FM6A 2XR1A 4NQ2A 4XWWA 1P9EA 2FHXA 2BG7A 5HISA 3I15A 4P62A 2FU8A 5ACUA 1YCHA 3AF6A 5EWAA 4C1EA 1X8GA 2BG2A 2A7MA 4AX1B 2YCBA 2BG8B 4LE6A 5FQCA 2AIOA 4EY2A 2BFZA 2XF4A 3IEKA 2FU9A 2Q9UA 4UA4A 4ZNBA 2BC2A 2HB9A 2I7XA 4HL1A 3RKJA 2QDTA 1YCGA 2WYLA 2WYMA 2UYXA 4CHLA 2ZWRA 1A8TA 3DH8A 3ZQ4A 4U4LA 4F6ZA 2YNVB 3PG4A 4NQ5A 5ACXA 4ZO3A 1JT1A 4UWRB 5LSCA 2BFLA 3JXPA 5LCAA 2FHXB 3IOGA 5HH5A 2YZ3A 1X8IA 2FU6A 2GKLA 5AXOA 4C09A 3L6NA 5EVKA 4D1UA 4RM5A 4TZBA 5A0VA 2FK6A 2BMIA 4HL2A 4TZFA 1WUPA 1HLKA 2P18A 4RAWA 2BFKA 4O98A 2AZ4A 5EV8A 4YSBA 3PY6A 4EXYA 1WUOA 5B15A 4AD9A 2QJSA 1KO3A 4Z67A 3IEMA 2QDSA 2BFZB 1ZNBA 4TYFA 5EHTA 5HIPA 3T3NA 5EVBA 5ACQA 3T3OA 4ZEJA 4C1DA 2ZNBA 2Y8BA 5EV6A 1QH3A 3ZWFA 2NZEA 5HIQA 2BIBA 3DHCA 1VJNA 2GMNA 4C1HA 2YNVA 2M5DA 2QINA 4WD6A 3SPUA 1M2XA 5DPXA 5K4KA 3RKKA 2OHIA 3LVZA 1WRAA 4Z5YA 3BC2A 3H3EA 1BMCA 3SRXA 3X30A 4GYUA 5LM6A 3I0VA 2I7VA 1ZTCA 2YNTA 3AJ3A 3IE0A 3IE2A 4TYTA 4FEKA 3SBLA 2OHHA 3MD7A 4PVOA 1A7TA 2E7YA 5K4NA 3SFPA 5ACRA 3T9MA 4Z6XA 5ACSA 2WRSA 2H6AA 2R2DA 2BTNA 3KNRA 1JJEA 4B87A 1ZKPA 1X8HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FU7 A;  3WXC A;  5LCH A;  4YSK A;  2DOO A;  5EH9 A;  2CBN A;  5B3R A;  4C1F A;  3KNS A;  1VME A;  5KIK A;  3X2Z A;  2P1E A;  4NQ4 A;  4AWZ A;  2ZO4 A;  1QH5 A;  3Q6V A;  5LLD A;  3IOF A;  1E5D A;  3FCZ A;  1VGN A;  4UWS B;  5LE1 A;  4XUK A;  5EW0 A;  3I14 A;  4J5F A;  5LS3 A;  4GYQ A;  3VQZ A;  2Y8A A;  4HKY A;  4UWO B;  5K4M A;  4EXS A;  1DXK A;  3AF5 A;  1XM8 A;  2WYM C;  3BK2 A;  4UAM A;  4DIL A;  3ESH A;  4RAM A;  4RL0 A;  3I13 A;  3DHB A;  2BR6 A;  2NYP A;  5AXR A;  3RPC A;  4XWT A;  4RBS A;  5ACT A;  5HH4 A;  3X2X A;  4EYF A;  2YNW A;  2BGA A;  2YNT B;  4Z5Z A;  4UBQ A;  2WHG A;  3IE1 A;  3QH8 A;  5B1U A;  1BVT A;  5LCF A;  2YNU A;  2GCU A;  3BV6 A;  1Y44 A;  4FR7 A;  3FAI A;  3G1P A;  5A5Z A;  4EFZ A;  4D02 A;  3BK1 A;  2Y87 A;  3R2U A;  3A4Y A;  4H0D A;  1BC2 A;  5IQK A;  5ACV A;  4TZ9 A;  4PVT A;  3IDZ A;  1L9Y A;  4TZE A;  1DDK A;  2I7T A;  5KIL A;  4FSB A;  5K0W A;  2DKF A;  1SML A;  2OHJ A;  1XTO A;  1JJT A;  2NZF A;  2GFK A;  5AHR A;  4Z7R A;  1KR3 A;  5LMC A;  5AHO A;  3SW3 A;  3IEL A;  4ZO2 A;  4J5H A;  3TP9 A;  4AX0 B;  1MQO A;  1WW1 A;  5A87 A;  4EYL A;  3ADR A;  3F9O A;  5ACW A;  5AEB A;  3X2Y A;  2P4Z A;  2Q42 A;  5HH6 A;  1YCF A;  2QED A;  3VPE A;  5FQB A;  4D1T A;  3SD9 A;  4C1C A;  4D1V A;  5FQA A;  2VW8 A;  2Q0J A;  2Q0I A;  5AYA A;  4GCW A;  4F6H A;  3KL7 A;  4C1G A;  3I11 A;  1DD6 A;  4UWP B;  4V0H A;  4D1W A;  3P2U A;  1KO2 A;  2ZZI A;  4KEQ A;  4YSL A;  3PY5 A;  4DIK A;  4AWY B;  5EVD A;  4KEP A;  3ZNB A;  3ZR9 A;  2BG8 A;  2P97 A;  2GFJ A;  4BZ3 A;  2M5C A;  4Z60 A;  4NQ6 A;  3S0Z A;  5A0T A;  3DHA A;  4JO0 A;  2BG6 A;  4RL2 A;  1K07 A;  5ACP A;  4EYB A;  4BP0 A;  5HIO A;  2NXA A;  2FM6 A;  2XR1 A;  4NQ2 A;  4XWW A;  1P9E A;  2FHX A;  2BG7 A;  5HIS A;  3I15 A;  4P62 A;  2FU8 A;  5ACU A;  1YCH A;  3AF6 A;  5EWA A;  4C1E A;  1X8G A;  2BG2 A;  2A7M A;  4AX1 B;  2YCB A;  2BG8 B;  4LE6 A;  5FQC A;  2AIO A;  4EY2 A;  2BFZ A;  2XF4 A;  3IEK A;  2FU9 A;  2Q9U A;  4UA4 A;  4ZNB A;  2BC2 A;  2HB9 A;  2I7X A;  4HL1 A;  3RKJ A;  2QDT A;  1YCG A;  2WYL A;  2WYM A;  2UYX A;  4CHL A;  2ZWR A;  1A8T A;  3DH8 A;  3ZQ4 A;  4U4L A;  4F6Z A;  2YNV B;  3PG4 A;  4NQ5 A;  5ACX A;  4ZO3 A;  1JT1 A;  4UWR B;  5LSC A;  2BFL A;  3JXP A;  5LCA A;  2FHX B;  3IOG A;  5HH5 A;  2YZ3 A;  1X8I A;  2FU6 A;  2GKL A;  5AXO A;  4C09 A;  3L6N A;  5EVK A;  4D1U A;  4RM5 A;  4TZB A;  5A0V A;  2FK6 A;  2BMI A;  4HL2 A;  4TZF A;  1WUP A;  1HLK A;  2P18 A;  4RAW A;  2BFK A;  4O98 A;  2AZ4 A;  5EV8 A;  4YSB A;  3PY6 A;  4EXY A;  1WUO A;  5B15 A;  4AD9 A;  2QJS A;  1KO3 A;  4Z67 A;  3IEM A;  2QDS A;  2BFZ B;  1ZNB A;  4TYF A;  5EHT A;  5HIP A;  3T3N A;  5EVB A;  5ACQ A;  3T3O A;  4ZEJ A;  4C1D A;  2ZNB A;  2Y8B A;  5EV6 A;  1QH3 A;  3ZWF A;  2NZE A;  5HIQ A;  2BIB A;  3DHC A;  1VJN A;  2GMN A;  4C1H A;  2YNV A;  2M5D A;  2QIN A;  4WD6 A;  3SPU A;  1M2X A;  5DPX A;  5K4K A;  3RKK A;  2OHI A;  3LVZ A;  1WRA A;  4Z5Y A;  3BC2 A;  3H3E A;  1BMC A;  3SRX A;  3X30 A;  4GYU A;  5LM6 A;  3I0V A;  2I7V A;  1ZTC A;  2YNT A;  3AJ3 A;  3IE0 A;  3IE2 A;  4TYT A;  4FEK A;  3SBL A;  2OHH A;  3MD7 A;  4PVO A;  1A7T A;  2E7Y A;  5K4N A;  3SFP A;  5ACR A;  3T9M A;  4Z6X A;  5ACS A;  2WRS A;  2H6A A;  2R2D A;  2BTN A;  3KNR A;  1JJE A;  4B87 A;  1ZKP A;  1X8H A; 
#chains in the Genus database with same CATH topology
 2FU7 A;  3WXC A;  5LCH A;  4YSK A;  2DOO A;  5EH9 A;  2CBN A;  5B3R A;  4C1F A;  3KNS A;  1VME A;  5KIK A;  3X2Z A;  2P1E A;  4NQ4 A;  4AWZ A;  2ZO4 A;  1QH5 A;  3Q6V A;  5LLD A;  3IOF A;  1E5D A;  3FCZ A;  1VGN A;  4UWS B;  5LE1 A;  4XUK A;  5EW0 A;  3I14 A;  4J5F A;  5LS3 A;  4GYQ A;  2CFU A;  4AXH A;  3VQZ A;  2Y8A A;  4HKY A;  4UWO B;  5K4M A;  4EXS A;  1DXK A;  3AF5 A;  1XM8 A;  2WYM C;  3BK2 A;  4UAM A;  4DIL A;  2CFZ A;  3ESH A;  4RAM A;  4RL0 A;  3I13 A;  3DHB A;  2BR6 A;  2NYP A;  5AXR A;  3RPC A;  4XWT A;  4RBS A;  5ACT A;  5HH4 A;  3X2X A;  4EYF A;  2YNW A;  2BGA A;  2YNT B;  4Z5Z A;  4UBQ A;  2WHG A;  3IE1 A;  3QH8 A;  5B1U A;  1BVT A;  5LCF A;  2YNU A;  2GCU A;  3BV6 A;  1Y44 A;  5A23 A;  4FR7 A;  3FAI A;  3G1P A;  5A5Z A;  5AIJ A;  4EFZ A;  4D02 A;  3BK1 A;  2Y87 A;  3R2U A;  3A4Y A;  4H0D A;  1BC2 A;  5IQK A;  5ACV A;  4TZ9 A;  4PVT A;  3IDZ A;  1L9Y A;  4TZE A;  1DDK A;  2I7T A;  5KIL A;  5AJL A;  4FSB A;  5K0W A;  2DKF A;  1SML A;  2OHJ A;  1XTO A;  1JJT A;  2NZF A;  2GFK A;  5AHR A;  4Z7R A;  1KR3 A;  5LMC A;  5AHO A;  3SW3 A;  3IEL A;  4ZO2 A;  4J5H A;  3TP9 A;  4AX0 B;  1MQO A;  1WW1 A;  5A87 A;  4EYL A;  3ADR A;  3F9O A;  5ACW A;  5AEB A;  3X2Y A;  2P4Z A;  2Q42 A;  5HH6 A;  1YCF A;  2QED A;  2CG3 A;  3VPE A;  5FQB A;  4D1T A;  3SD9 A;  4C1C A;  4D1V A;  5FQA A;  2VW8 A;  2Q0J A;  2Q0I A;  5AYA A;  4GCW A;  4F6H A;  3KL7 A;  4C1G A;  3I11 A;  1DD6 A;  4UWP B;  4V0H A;  4D1W A;  3P2U A;  1KO2 A;  2ZZI A;  4KEQ A;  4YSL A;  3PY5 A;  4DIK A;  4AWY B;  5EVD A;  4KEP A;  3ZNB A;  3ZR9 A;  2BG8 A;  2P97 A;  2GFJ A;  4BZ3 A;  2M5C A;  4Z60 A;  4NQ6 A;  3S0Z A;  2CG2 A;  5A0T A;  3DHA A;  4JO0 A;  2BG6 A;  4RL2 A;  1K07 A;  5ACP A;  4EYB A;  4BP0 A;  5HIO A;  2NXA A;  2FM6 A;  2XR1 A;  4NQ2 A;  4XWW A;  1P9E A;  2FHX A;  2BG7 A;  5HIS A;  3I15 A;  4P62 A;  2FU8 A;  5ACU A;  1YCH A;  3AF6 A;  5EWA A;  4C1E A;  1X8G A;  2BG2 A;  2A7M A;  4AX1 B;  2YCB A;  2BG8 B;  4LE6 A;  5FQC A;  2AIO A;  4EY2 A;  2BFZ A;  2XF4 A;  3IEK A;  2FU9 A;  2Q9U A;  4UA4 A;  4ZNB A;  2BC2 A;  2HB9 A;  2I7X A;  4HL1 A;  3RKJ A;  2QDT A;  1YCG A;  2WYL A;  2WYM A;  2UYX A;  4CHL A;  2ZWR A;  1A8T A;  3DH8 A;  3ZQ4 A;  4U4L A;  4F6Z A;  2YNV B;  3PG4 A;  4NQ5 A;  5ACX A;  4ZO3 A;  1JT1 A;  4UWR B;  5LSC A;  2BFL A;  3JXP A;  5LCA A;  2FHX B;  3IOG A;  5HH5 A;  2YZ3 A;  1X8I A;  2FU6 A;  2GKL A;  4NUR A;  5AXO A;  4C09 A;  3L6N A;  5EVK A;  2YHE A;  4D1U A;  4RM5 A;  4TZB A;  5A0V A;  2FK6 A;  2BMI A;  4HL2 A;  4TZF A;  1WUP A;  1HLK A;  2P18 A;  4RAW A;  2BFK A;  4O98 A;  2AZ4 A;  5EV8 A;  4YSB A;  3PY6 A;  4EXY A;  1WUO A;  5B15 A;  4AD9 A;  4PDX A;  2QJS A;  1KO3 A;  4Z67 A;  3IEM A;  2QDS A;  2BFZ B;  1ZNB A;  4TYF A;  5EHT A;  5HIP A;  3T3N A;  5EVB A;  5ACQ A;  3T3O A;  4ZEJ A;  4C1D A;  2ZNB A;  2Y8B A;  4AV7 A;  5EV6 A;  1QH3 A;  3ZWF A;  2NZE A;  5HIQ A;  2BIB A;  3DHC A;  1VJN A;  2GMN A;  4C1H A;  2YNV A;  2M5D A;  2QIN A;  4WD6 A;  3SPU A;  1M2X A;  5DPX A;  5K4K A;  3RKK A;  2OHI A;  3LVZ A;  1WRA A;  4Z5Y A;  3BC2 A;  3H3E A;  1BMC A;  3SRX A;  3X30 A;  4GYU A;  5LM6 A;  3I0V A;  2I7V A;  1ZTC A;  2YNT A;  3AJ3 A;  3IE0 A;  3IE2 A;  4TYT A;  4FEK A;  3SBL A;  2OHH A;  3MD7 A;  4PVO A;  1A7T A;  2E7Y A;  5K4N A;  3SFP A;  5ACR A;  3T9M A;  4Z6X A;  5ACS A;  2WRS A;  2H6A A;  2R2D A;  2BTN A;  3KNR A;  1JJE A;  4B87 A;  1ZKP A;  1X8H A; 
#chains in the Genus database with same CATH homology
 2FU7 A;  3WXC A;  5LCH A;  4YSK A;  2DOO A;  5EH9 A;  2CBN A;  5B3R A;  4C1F A;  3KNS A;  1VME A;  5KIK A;  3X2Z A;  2P1E A;  4NQ4 A;  4AWZ A;  2ZO4 A;  1QH5 A;  3Q6V A;  5LLD A;  3IOF A;  1E5D A;  3FCZ A;  1VGN A;  4UWS B;  5LE1 A;  4XUK A;  5EW0 A;  3I14 A;  4J5F A;  5LS3 A;  4GYQ A;  3VQZ A;  2Y8A A;  4HKY A;  4UWO B;  5K4M A;  4EXS A;  1DXK A;  3AF5 A;  1XM8 A;  2WYM C;  3BK2 A;  4UAM A;  4DIL A;  3ESH A;  4RAM A;  4RL0 A;  3I13 A;  3DHB A;  2BR6 A;  2NYP A;  5AXR A;  3RPC A;  4XWT A;  4RBS A;  5ACT A;  5HH4 A;  3X2X A;  4EYF A;  2YNW A;  2BGA A;  2YNT B;  4Z5Z A;  4UBQ A;  2WHG A;  3IE1 A;  3QH8 A;  5B1U A;  1BVT A;  5LCF A;  2YNU A;  2GCU A;  3BV6 A;  1Y44 A;  4FR7 A;  3FAI A;  3G1P A;  5A5Z A;  4EFZ A;  4D02 A;  3BK1 A;  2Y87 A;  3R2U A;  3A4Y A;  4H0D A;  1BC2 A;  5IQK A;  5ACV A;  4TZ9 A;  4PVT A;  3IDZ A;  1L9Y A;  4TZE A;  1DDK A;  2I7T A;  5KIL A;  4FSB A;  5K0W A;  2DKF A;  1SML A;  2OHJ A;  1XTO A;  1JJT A;  2NZF A;  2GFK A;  5AHR A;  4Z7R A;  1KR3 A;  5LMC A;  5AHO A;  3SW3 A;  3IEL A;  4ZO2 A;  4J5H A;  3TP9 A;  4AX0 B;  1MQO A;  1WW1 A;  5A87 A;  4EYL A;  3ADR A;  3F9O A;  5ACW A;  5AEB A;  3X2Y A;  2P4Z A;  2Q42 A;  5HH6 A;  1YCF A;  2QED A;  3VPE A;  5FQB A;  4D1T A;  3SD9 A;  4C1C A;  4D1V A;  5FQA A;  2VW8 A;  2Q0J A;  2Q0I A;  5AYA A;  4GCW A;  4F6H A;  3KL7 A;  4C1G A;  3I11 A;  1DD6 A;  4UWP B;  4V0H A;  4D1W A;  3P2U A;  1KO2 A;  2ZZI A;  4KEQ A;  4YSL A;  3PY5 A;  4DIK A;  4AWY B;  5EVD A;  4KEP A;  3ZNB A;  3ZR9 A;  2BG8 A;  2P97 A;  2GFJ A;  4BZ3 A;  2M5C A;  4Z60 A;  4NQ6 A;  3S0Z A;  5A0T A;  3DHA A;  4JO0 A;  2BG6 A;  4RL2 A;  1K07 A;  5ACP A;  4EYB A;  4BP0 A;  5HIO A;  2NXA A;  2FM6 A;  2XR1 A;  4NQ2 A;  4XWW A;  1P9E A;  2FHX A;  2BG7 A;  5HIS A;  3I15 A;  4P62 A;  2FU8 A;  5ACU A;  1YCH A;  3AF6 A;  5EWA A;  4C1E A;  1X8G A;  2BG2 A;  2A7M A;  4AX1 B;  2YCB A;  2BG8 B;  4LE6 A;  5FQC A;  2AIO A;  4EY2 A;  2BFZ A;  2XF4 A;  3IEK A;  2FU9 A;  2Q9U A;  4UA4 A;  4ZNB A;  2BC2 A;  2HB9 A;  2I7X A;  4HL1 A;  3RKJ A;  2QDT A;  1YCG A;  2WYL A;  2WYM A;  2UYX A;  4CHL A;  2ZWR A;  1A8T A;  3DH8 A;  3ZQ4 A;  4U4L A;  4F6Z A;  2YNV B;  3PG4 A;  4NQ5 A;  5ACX A;  4ZO3 A;  1JT1 A;  4UWR B;  5LSC A;  2BFL A;  3JXP A;  5LCA A;  2FHX B;  3IOG A;  5HH5 A;  2YZ3 A;  1X8I A;  2FU6 A;  2GKL A;  5AXO A;  4C09 A;  3L6N A;  5EVK A;  4D1U A;  4RM5 A;  4TZB A;  5A0V A;  2FK6 A;  2BMI A;  4HL2 A;  4TZF A;  1WUP A;  1HLK A;  2P18 A;  4RAW A;  2BFK A;  4O98 A;  2AZ4 A;  5EV8 A;  4YSB A;  3PY6 A;  4EXY A;  1WUO A;  5B15 A;  4AD9 A;  2QJS A;  1KO3 A;  4Z67 A;  3IEM A;  2QDS A;  2BFZ B;  1ZNB A;  4TYF A;  5EHT A;  5HIP A;  3T3N A;  5EVB A;  5ACQ A;  3T3O A;  4ZEJ A;  4C1D A;  2ZNB A;  2Y8B A;  5EV6 A;  1QH3 A;  3ZWF A;  2NZE A;  5HIQ A;  2BIB A;  3DHC A;  1VJN A;  2GMN A;  4C1H A;  2YNV A;  2M5D A;  2QIN A;  4WD6 A;  3SPU A;  1M2X A;  5DPX A;  5K4K A;  3RKK A;  2OHI A;  3LVZ A;  1WRA A;  4Z5Y A;  3BC2 A;  3H3E A;  1BMC A;  3SRX A;  3X30 A;  4GYU A;  5LM6 A;  3I0V A;  2I7V A;  1ZTC A;  2YNT A;  3AJ3 A;  3IE0 A;  3IE2 A;  4TYT A;  4FEK A;  3SBL A;  2OHH A;  3MD7 A;  4PVO A;  1A7T A;  2E7Y A;  5K4N A;  3SFP A;  5ACR A;  3T9M A;  4Z6X A;  5ACS A;  2WRS A;  2H6A A;  2R2D A;  2BTN A;  3KNR A;  1JJE A;  4B87 A;  1ZKP A;  1X8H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...