3X30A

Crystal structure of metallo-beta-lactamase from thermotoga maritima
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
227
structure length
227
Chain Sequence
b'GMKVTFLGHAVVLIEGKKNIIIDPFISGNPVCPVKLEGLPKIDYILVTHGHGDHLGDAVEIAKKNDATVISNYEICHYLGKKGVKTHAMHIGGSYLFDFGRVKMTPAVHGSGILDGDSMIYGGNPSGFLITIEGKKIYHAGDTGLTREMELLAEENVDVAFLPIGGNFVMDVEDAVRAAVMIKPKKVVPMHYGTWELIFADVELFKKKVEEKGVECVILEPGESLEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UPF0173 metal-dependent hydrolase TM_1162
publication title Crystal structure of metallo-beta-lactamase from Thermotoga maritima
rcsb
source organism Thermotoga maritima msb8
molecule tags Hydrolase
total genus 60
structure length 227
sequence length 227
ec nomenclature
pdb deposition date 2015-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 3x30A00
1E5DA 3BK2A 3IEKA 1VJNA 3IE2A 3KNRA 1VMEA 3IOGA 4RL0A 3SRXA 5A87A 3DH8A 3L6NA 3RKJA 2YZ3A 2I7XA 5ACRA 2ZO4A 4TZEA 4ZO2A 4ZO3A 5HIOA 3DHAA 5LSCA 4F6ZA 3WXCA 2OHHA 5B1UA 4KEPA 3BK1A 2FU8A 5IQKA 2P18A 2M5DA 2P4ZA 4RBSA 3LVZA 3T3OA 5EVDA 4YSBA 4ZNBA 5LCAA 3BV6A 1YCFA 5K4NA 4RAMA 2FU7A 5K0WA 2BTNA 2FM6A 2OHJA 1YCHA 2UYXA 5AHRA 2Q9UA 4Z7RA 2Q0JA 3X2ZA 2YNUA 5ACWA 5B3RA 4DIKA 5FQBA 1X8IA 4C1GA 5KILA 4J5FA 2GFKA 5FQCA 2FK6A 5LM6A 1HLKA 3ZQ4A 2BG6A 1BC2A 4EYFA 2BG8A 2YNVA 5FQAA 2WRSA 4FEKA 2BFKA 1QH5A 4CHLA 3ADRA 1YCGA 5AXOA 2NZFA 4NQ5A 4AX0B 3AF6A 5EWAA 4D1TA 2ZNBA 2BFZA 5EH9A 4UA4A 4NQ6A 5K4MA 2I7VA 3I15A 4Z5ZA 4B87A 4BP0A 2QINA 3ESHA 4UWRB 5KIKA 3IELA 5EV8A 2XR1A 4ZEJA 5EHTA 4XUKA 2BG7A 2E7YA 1ZNBA 4TZ9A 3H3EA 2DKFA 2YNTA 5ACUA 1WW1A 3SW3A 1DD6A 2WYMC 4C1DA 2BGAA 4BZ3A 5ACSA 2P1EA 1K07A 4UWPB 5HH5A 4XWTA 3X30A 3I0VA 3RPCA 1KR3A 4UBQA 4GYQA 4AX1B 3FCZA 4TZFA 2R2DA 4D1UA 1KO2A 2ZZIA 3KNSA 4HL1A 4UWSB 3ZNBA 4C1HA 4GCWA 1ZKPA 5HH6A 2M5CA 3BC2A 2BC2A 4C09A 4PVOA 5HIPA 4RAWA 3A4YA 4NQ4A 3IE1A 1JT1A 3X2YA 3JXPA 2GFJA 3Q6VA 3SBLA 1P9EA 2BIBA 2FHXB 2FHXA 4TZBA 1WUPA 3SFPA 4C1FA 4WD6A 1WUOA 4Z67A 4EYBA 1A7TA 3X2XA 2BG8B 2YNVB 3I13A 4EXSA 3MD7A 2DOOA 5ACXA 4HKYA 2XF4A 4GYUA 4TYFA 5A0TA 4EY2A 2FU9A 3PG4A 4H0DA 5HIQA 3P2UA 3AJ3A 4EXYA 4YSLA 4UAMA 5ACVA 2Q42A 3ZWFA 4P62A 2BFZB 5AYAA 2WYLA 2Y8BA 4V0HA 2CBNA 5EW0A 4NQ2A 2YCBA 2NYPA 2ZWRA 1DXKA 2HB9A 2QDSA 2GMNA 5AHOA 4HL2A 5EVKA 4D1WA 2NXAA 3S0ZA 4AD9A 2I7TA 1WRAA 2P97A 2QDTA 2YNTB 4PVTA 4C1EA 5AEBA 4Z6XA 2QJSA 4C1CA 1A8TA 5EV6A 2H6AA 2Q0IA 2AIOA 2BMIA 4RL2A 4RM5A 4O98A 5LS3A 4J5HA 5LCHA 2GKLA 4Z60A 3IDZA 5ACQA 4AWYB 5K4KA 4D02A 2AZ4A 1SMLA 3TP9A 5EVBA 3IOFA 1X8HA 2A7MA 4KEQA 4Z5YA 3ZR9A 3F9OA 2QEDA 3RKKA 1XTOA 2Y8AA 5DPXA 2NZEA 3FAIA 5ACPA 4XWWA 4TYTA 1JJTA 3DHBA 4YSKA 3SD9A 4EYLA 5LMCA 5LLDA 3PY5A 3I14A 4AWZA 5HISA 2WHGA 2BR6A 2OHIA 4F6HA 5B15A 3IE0A 4FR7A 3DHCA 1X8GA 3IEMA 2VW8A 1DDKA 3QH8A 3I11A 4DILA 1KO3A 4LE6A 5AXRA 3PY6A 3AF5A 3KL7A 4D1VA 1MQOA 2BFLA 5LE1A 1VGNA 3G1PA 3VPEA 4UWOB 1BMCA 5HH4A 2Y87A 3T9MA 1Y44A 4FSBA 3SPUA 2WYMA 3VQZA 3R2UA 4U4LA 5ACTA 3T3NA 5A5ZA 1M2XA 1XM8A 1JJEA 1ZTCA 5A0VA 5LCFA 2YNWA 1QH3A 4JO0A 1BVTA 2GCUA 2BG2A 1L9YA 4EFZA 2FU6A
chains in the Genus database with same CATH superfamily
1E5DA 3BK2A 3IEKA 1VJNA 3IE2A 3KNRA 1VMEA 3IOGA 4RL0A 3SRXA 5A87A 3DH8A 3L6NA 3RKJA 2YZ3A 2I7XA 5ACRA 2ZO4A 4TZEA 4ZO2A 4ZO3A 5HIOA 3DHAA 5LSCA 4F6ZA 3WXCA 4AV7A 2OHHA 5B1UA 4KEPA 3BK1A 2FU8A 5IQKA 2P18A 2M5DA 2P4ZA 4RBSA 3LVZA 3T3OA 5EVDA 4YSBA 4ZNBA 5LCAA 3BV6A 1YCFA 5K4NA 4RAMA 2FU7A 5K0WA 2BTNA 2FM6A 2OHJA 1YCHA 2UYXA 5AHRA 2Q9UA 4Z7RA 2Q0JA 3X2ZA 2YNUA 5ACWA 5B3RA 4DIKA 5FQBA 1X8IA 4C1GA 5KILA 4J5FA 2GFKA 5FQCA 2FK6A 5LM6A 1HLKA 3ZQ4A 2BG6A 1BC2A 4EYFA 2BG8A 2YNVA 5FQAA 2WRSA 5A23A 4FEKA 2BFKA 1QH5A 4CHLA 3ADRA 1YCGA 5AXOA 2NZFA 4NQ5A 4AX0B 3AF6A 5EWAA 4D1TA 2ZNBA 2BFZA 5EH9A 4UA4A 4NQ6A 5K4MA 2I7VA 3I15A 4Z5ZA 4B87A 4BP0A 2QINA 3ESHA 2CG3A 4UWRB 5KIKA 3IELA 5EV8A 2XR1A 4ZEJA 5EHTA 4XUKA 2BG7A 2E7YA 1ZNBA 4TZ9A 3H3EA 2DKFA 2YNTA 5ACUA 1WW1A 3SW3A 1DD6A 2WYMC 4C1DA 2BGAA 4BZ3A 5ACSA 2P1EA 1K07A 4UWPB 5HH5A 4XWTA 3X30A 3I0VA 3RPCA 1KR3A 4UBQA 4GYQA 4AX1B 3FCZA 4TZFA 2R2DA 4D1UA 1KO2A 2ZZIA 3KNSA 4HL1A 4UWSB 3ZNBA 4C1HA 4GCWA 1ZKPA 5HH6A 2M5CA 3BC2A 2BC2A 4C09A 2CG2A 4PVOA 5HIPA 4RAWA 3A4YA 4NQ4A 3IE1A 1JT1A 3X2YA 3JXPA 2GFJA 4AXHA 3Q6VA 3SBLA 1P9EA 2BIBA 2FHXB 2FHXA 4TZBA 1WUPA 3SFPA 4C1FA 4WD6A 1WUOA 4Z67A 4EYBA 1A7TA 3X2XA 2BG8B 2YNVB 3I13A 4EXSA 3MD7A 2DOOA 5ACXA 4HKYA 2XF4A 4GYUA 4TYFA 5A0TA 4EY2A 5AIJA 2FU9A 3PG4A 4H0DA 5HIQA 3P2UA 3AJ3A 4PDXA 4EXYA 4YSLA 4UAMA 5ACVA 2Q42A 3ZWFA 2CFUA 4P62A 2BFZB 5AYAA 2WYLA 2Y8BA 4V0HA 2CBNA 5EW0A 4NQ2A 4NURA 2YCBA 2NYPA 2ZWRA 1DXKA 2HB9A 2QDSA 2GMNA 5AHOA 4HL2A 5EVKA 4D1WA 2NXAA 3S0ZA 4AD9A 2I7TA 1WRAA 2P97A 2QDTA 2YNTB 4PVTA 4C1EA 5AEBA 4Z6XA 2QJSA 4C1CA 1A8TA 5EV6A 2H6AA 2Q0IA 2AIOA 2BMIA 4RL2A 4RM5A 4O98A 5LS3A 4J5HA 5LCHA 2GKLA 4Z60A 3IDZA 5ACQA 4AWYB 5K4KA 4D02A 2AZ4A 1SMLA 3TP9A 5EVBA 3IOFA 1X8HA 2A7MA 4KEQA 4Z5YA 3ZR9A 3F9OA 2QEDA 3RKKA 1XTOA 2Y8AA 5DPXA 2NZEA 3FAIA 5ACPA 2CFZA 4XWWA 4TYTA 1JJTA 3DHBA 4YSKA 3SD9A 4EYLA 5LMCA 5LLDA 3PY5A 3I14A 4AWZA 5HISA 2WHGA 2BR6A 2OHIA 4F6HA 5B15A 3IE0A 4FR7A 3DHCA 1X8GA 3IEMA 2VW8A 1DDKA 3QH8A 3I11A 4DILA 1KO3A 4LE6A 5AXRA 3PY6A 3AF5A 3KL7A 5AJLA 4D1VA 1MQOA 2BFLA 5LE1A 1VGNA 3G1PA 3VPEA 4UWOB 1BMCA 5HH4A 2YHEA 2Y87A 3T9MA 1Y44A 4FSBA 3SPUA 2WYMA 3VQZA 3R2UA 4U4LA 5ACTA 3T3NA 5A5ZA 1M2XA 1XM8A 1JJEA 1ZTCA 5A0VA 5LCFA 2YNWA 1QH3A 4JO0A 1BVTA 2GCUA 2BG2A 1L9YA 4EFZA 2FU6A
chains in the Genus database with same CATH topology
1E5DA 3BK2A 3IEKA 1VJNA 3IE2A 3KNRA 1VMEA 3IOGA 4RL0A 3SRXA 5A87A 3DH8A 3L6NA 3RKJA 2YZ3A 2I7XA 5ACRA 2ZO4A 4TZEA 4ZO2A 4ZO3A 5HIOA 3DHAA 5LSCA 4F6ZA 3WXCA 2OHHA 5B1UA 4KEPA 3BK1A 2FU8A 5IQKA 2P18A 2M5DA 2P4ZA 4RBSA 3LVZA 3T3OA 5EVDA 4YSBA 4ZNBA 5LCAA 3BV6A 1YCFA 5K4NA 4RAMA 2FU7A 5K0WA 2BTNA 2FM6A 2OHJA 1YCHA 2UYXA 5AHRA 2Q9UA 4Z7RA 2Q0JA 3X2ZA 2YNUA 5ACWA 5B3RA 4DIKA 5FQBA 1X8IA 4C1GA 5KILA 4J5FA 2GFKA 5FQCA 2FK6A 5LM6A 1HLKA 3ZQ4A 2BG6A 1BC2A 4EYFA 2BG8A 2YNVA 5FQAA 2WRSA 4FEKA 2BFKA 1QH5A 4CHLA 3ADRA 1YCGA 5AXOA 2NZFA 4NQ5A 4AX0B 3AF6A 5EWAA 4D1TA 2ZNBA 2BFZA 5EH9A 4UA4A 4NQ6A 5K4MA 2I7VA 3I15A 4Z5ZA 4B87A 4BP0A 2QINA 3ESHA 4UWRB 5KIKA 3IELA 5EV8A 2XR1A 4ZEJA 5EHTA 4XUKA 2BG7A 2E7YA 1ZNBA 4TZ9A 3H3EA 2DKFA 2YNTA 5ACUA 1WW1A 3SW3A 1DD6A 2WYMC 4C1DA 2BGAA 4BZ3A 5ACSA 2P1EA 1K07A 4UWPB 5HH5A 4XWTA 3X30A 3I0VA 3RPCA 1KR3A 4UBQA 4GYQA 4AX1B 3FCZA 4TZFA 2R2DA 4D1UA 1KO2A 2ZZIA 3KNSA 4HL1A 4UWSB 3ZNBA 4C1HA 4GCWA 1ZKPA 5HH6A 2M5CA 3BC2A 2BC2A 4C09A 4PVOA 5HIPA 4RAWA 3A4YA 4NQ4A 3IE1A 1JT1A 3X2YA 3JXPA 2GFJA 3Q6VA 3SBLA 1P9EA 2BIBA 2FHXB 2FHXA 4TZBA 1WUPA 3SFPA 4C1FA 4WD6A 1WUOA 4Z67A 4EYBA 1A7TA 3X2XA 2BG8B 2YNVB 3I13A 4EXSA 3MD7A 2DOOA 5ACXA 4HKYA 2XF4A 4GYUA 4TYFA 5A0TA 4EY2A 2FU9A 3PG4A 4H0DA 5HIQA 3P2UA 3AJ3A 4EXYA 4YSLA 4UAMA 5ACVA 2Q42A 3ZWFA 4P62A 2BFZB 5AYAA 2WYLA 2Y8BA 4V0HA 2CBNA 5EW0A 4NQ2A 2YCBA 2NYPA 2ZWRA 1DXKA 2HB9A 2QDSA 2GMNA 5AHOA 4HL2A 5EVKA 4D1WA 2NXAA 3S0ZA 4AD9A 2I7TA 1WRAA 2P97A 2QDTA 2YNTB 4PVTA 4C1EA 5AEBA 4Z6XA 2QJSA 4C1CA 1A8TA 5EV6A 2H6AA 2Q0IA 2AIOA 2BMIA 4RL2A 4RM5A 4O98A 5LS3A 4J5HA 5LCHA 2GKLA 4Z60A 3IDZA 5ACQA 4AWYB 5K4KA 4D02A 2AZ4A 1SMLA 3TP9A 5EVBA 3IOFA 1X8HA 2A7MA 4KEQA 4Z5YA 3ZR9A 3F9OA 2QEDA 3RKKA 1XTOA 2Y8AA 5DPXA 2NZEA 3FAIA 5ACPA 4XWWA 4TYTA 1JJTA 3DHBA 4YSKA 3SD9A 4EYLA 5LMCA 5LLDA 3PY5A 3I14A 4AWZA 5HISA 2WHGA 2BR6A 2OHIA 4F6HA 5B15A 3IE0A 4FR7A 3DHCA 1X8GA 3IEMA 2VW8A 1DDKA 3QH8A 3I11A 4DILA 1KO3A 4LE6A 5AXRA 3PY6A 3AF5A 3KL7A 4D1VA 1MQOA 2BFLA 5LE1A 1VGNA 3G1PA 3VPEA 4UWOB 1BMCA 5HH4A 2Y87A 3T9MA 1Y44A 4FSBA 3SPUA 2WYMA 3VQZA 3R2UA 4U4LA 5ACTA 3T3NA 5A5ZA 1M2XA 1XM8A 1JJEA 1ZTCA 5A0VA 5LCFA 2YNWA 1QH3A 4JO0A 1BVTA 2GCUA 2BG2A 1L9YA 4EFZA 2FU6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E5D A;  3BK2 A;  3IEK A;  1VJN A;  3IE2 A;  3KNR A;  1VME A;  3IOG A;  4RL0 A;  3SRX A;  5A87 A;  3DH8 A;  3L6N A;  3RKJ A;  2YZ3 A;  2I7X A;  5ACR A;  2ZO4 A;  4TZE A;  4ZO2 A;  4ZO3 A;  5HIO A;  3DHA A;  5LSC A;  4F6Z A;  3WXC A;  2OHH A;  5B1U A;  4KEP A;  3BK1 A;  2FU8 A;  5IQK A;  2P18 A;  2M5D A;  2P4Z A;  4RBS A;  3LVZ A;  3T3O A;  5EVD A;  4YSB A;  4ZNB A;  5LCA A;  3BV6 A;  1YCF A;  5K4N A;  4RAM A;  2FU7 A;  5K0W A;  2BTN A;  2FM6 A;  2OHJ A;  1YCH A;  2UYX A;  5AHR A;  2Q9U A;  4Z7R A;  2Q0J A;  3X2Z A;  2YNU A;  5ACW A;  5B3R A;  4DIK A;  5FQB A;  1X8I A;  4C1G A;  5KIL A;  4J5F A;  2GFK A;  5FQC A;  2FK6 A;  5LM6 A;  1HLK A;  3ZQ4 A;  2BG6 A;  1BC2 A;  4EYF A;  2BG8 A;  2YNV A;  5FQA A;  2WRS A;  4FEK A;  2BFK A;  1QH5 A;  4CHL A;  3ADR A;  1YCG A;  5AXO A;  2NZF A;  4NQ5 A;  4AX0 B;  3AF6 A;  5EWA A;  4D1T A;  2ZNB A;  2BFZ A;  5EH9 A;  4UA4 A;  4NQ6 A;  5K4M A;  2I7V A;  3I15 A;  4Z5Z A;  4B87 A;  4BP0 A;  2QIN A;  3ESH A;  4UWR B;  5KIK A;  3IEL A;  5EV8 A;  2XR1 A;  4ZEJ A;  5EHT A;  4XUK A;  2BG7 A;  2E7Y A;  1ZNB A;  4TZ9 A;  3H3E A;  2DKF A;  2YNT A;  5ACU A;  1WW1 A;  3SW3 A;  1DD6 A;  2WYM C;  4C1D A;  2BGA A;  4BZ3 A;  5ACS A;  2P1E A;  1K07 A;  4UWP B;  5HH5 A;  4XWT A;  3X30 A;  3I0V A;  3RPC A;  1KR3 A;  4UBQ A;  4GYQ A;  4AX1 B;  3FCZ A;  4TZF A;  2R2D A;  4D1U A;  1KO2 A;  2ZZI A;  3KNS A;  4HL1 A;  4UWS B;  3ZNB A;  4C1H A;  4GCW A;  1ZKP A;  5HH6 A;  2M5C A;  3BC2 A;  2BC2 A;  4C09 A;  4PVO A;  5HIP A;  4RAW A;  3A4Y A;  4NQ4 A;  3IE1 A;  1JT1 A;  3X2Y A;  3JXP A;  2GFJ A;  3Q6V A;  3SBL A;  1P9E A;  2BIB A;  2FHX B;  2FHX A;  4TZB A;  1WUP A;  3SFP A;  4C1F A;  4WD6 A;  1WUO A;  4Z67 A;  4EYB A;  1A7T A;  3X2X A;  2BG8 B;  2YNV B;  3I13 A;  4EXS A;  3MD7 A;  2DOO A;  5ACX A;  4HKY A;  2XF4 A;  4GYU A;  4TYF A;  5A0T A;  4EY2 A;  2FU9 A;  3PG4 A;  4H0D A;  5HIQ A;  3P2U A;  3AJ3 A;  4EXY A;  4YSL A;  4UAM A;  5ACV A;  2Q42 A;  3ZWF A;  4P62 A;  2BFZ B;  5AYA A;  2WYL A;  2Y8B A;  4V0H A;  2CBN A;  5EW0 A;  4NQ2 A;  2YCB A;  2NYP A;  2ZWR A;  1DXK A;  2HB9 A;  2QDS A;  2GMN A;  5AHO A;  4HL2 A;  5EVK A;  4D1W A;  2NXA A;  3S0Z A;  4AD9 A;  2I7T A;  1WRA A;  2P97 A;  2QDT A;  2YNT B;  4PVT A;  4C1E A;  5AEB A;  4Z6X A;  2QJS A;  4C1C A;  1A8T A;  5EV6 A;  2H6A A;  2Q0I A;  2AIO A;  2BMI A;  4RL2 A;  4RM5 A;  4O98 A;  5LS3 A;  4J5H A;  5LCH A;  2GKL A;  4Z60 A;  3IDZ A;  5ACQ A;  4AWY B;  5K4K A;  4D02 A;  2AZ4 A;  1SML A;  3TP9 A;  5EVB A;  3IOF A;  1X8H A;  2A7M A;  4KEQ A;  4Z5Y A;  3ZR9 A;  3F9O A;  2QED A;  3RKK A;  1XTO A;  2Y8A A;  5DPX A;  2NZE A;  3FAI A;  5ACP A;  4XWW A;  4TYT A;  1JJT A;  3DHB A;  4YSK A;  3SD9 A;  4EYL A;  5LMC A;  5LLD A;  3PY5 A;  3I14 A;  4AWZ A;  5HIS A;  2WHG A;  2BR6 A;  2OHI A;  4F6H A;  5B15 A;  3IE0 A;  4FR7 A;  3DHC A;  1X8G A;  3IEM A;  2VW8 A;  1DDK A;  3QH8 A;  3I11 A;  4DIL A;  1KO3 A;  4LE6 A;  5AXR A;  3PY6 A;  3AF5 A;  3KL7 A;  4D1V A;  1MQO A;  2BFL A;  5LE1 A;  1VGN A;  3G1P A;  3VPE A;  4UWO B;  1BMC A;  5HH4 A;  2Y87 A;  3T9M A;  1Y44 A;  4FSB A;  3SPU A;  2WYM A;  3VQZ A;  3R2U A;  4U4L A;  5ACT A;  3T3N A;  5A5Z A;  1M2X A;  1XM8 A;  1JJE A;  1ZTC A;  5A0V A;  5LCF A;  2YNW A;  1QH3 A;  4JO0 A;  1BVT A;  2GCU A;  2BG2 A;  1L9Y A;  4EFZ A;  2FU6 A; 
#chains in the Genus database with same CATH topology
 1E5D A;  3BK2 A;  3IEK A;  1VJN A;  3IE2 A;  3KNR A;  1VME A;  3IOG A;  4RL0 A;  3SRX A;  5A87 A;  3DH8 A;  3L6N A;  3RKJ A;  2YZ3 A;  2I7X A;  5ACR A;  2ZO4 A;  4TZE A;  4ZO2 A;  4ZO3 A;  5HIO A;  3DHA A;  5LSC A;  4F6Z A;  3WXC A;  4AV7 A;  2OHH A;  5B1U A;  4KEP A;  3BK1 A;  2FU8 A;  5IQK A;  2P18 A;  2M5D A;  2P4Z A;  4RBS A;  3LVZ A;  3T3O A;  5EVD A;  4YSB A;  4ZNB A;  5LCA A;  3BV6 A;  1YCF A;  5K4N A;  4RAM A;  2FU7 A;  5K0W A;  2BTN A;  2FM6 A;  2OHJ A;  1YCH A;  2UYX A;  5AHR A;  2Q9U A;  4Z7R A;  2Q0J A;  3X2Z A;  2YNU A;  5ACW A;  5B3R A;  4DIK A;  5FQB A;  1X8I A;  4C1G A;  5KIL A;  4J5F A;  2GFK A;  5FQC A;  2FK6 A;  5LM6 A;  1HLK A;  3ZQ4 A;  2BG6 A;  1BC2 A;  4EYF A;  2BG8 A;  2YNV A;  5FQA A;  2WRS A;  5A23 A;  4FEK A;  2BFK A;  1QH5 A;  4CHL A;  3ADR A;  1YCG A;  5AXO A;  2NZF A;  4NQ5 A;  4AX0 B;  3AF6 A;  5EWA A;  4D1T A;  2ZNB A;  2BFZ A;  5EH9 A;  4UA4 A;  4NQ6 A;  5K4M A;  2I7V A;  3I15 A;  4Z5Z A;  4B87 A;  4BP0 A;  2QIN A;  3ESH A;  2CG3 A;  4UWR B;  5KIK A;  3IEL A;  5EV8 A;  2XR1 A;  4ZEJ A;  5EHT A;  4XUK A;  2BG7 A;  2E7Y A;  1ZNB A;  4TZ9 A;  3H3E A;  2DKF A;  2YNT A;  5ACU A;  1WW1 A;  3SW3 A;  1DD6 A;  2WYM C;  4C1D A;  2BGA A;  4BZ3 A;  5ACS A;  2P1E A;  1K07 A;  4UWP B;  5HH5 A;  4XWT A;  3X30 A;  3I0V A;  3RPC A;  1KR3 A;  4UBQ A;  4GYQ A;  4AX1 B;  3FCZ A;  4TZF A;  2R2D A;  4D1U A;  1KO2 A;  2ZZI A;  3KNS A;  4HL1 A;  4UWS B;  3ZNB A;  4C1H A;  4GCW A;  1ZKP A;  5HH6 A;  2M5C A;  3BC2 A;  2BC2 A;  4C09 A;  2CG2 A;  4PVO A;  5HIP A;  4RAW A;  3A4Y A;  4NQ4 A;  3IE1 A;  1JT1 A;  3X2Y A;  3JXP A;  2GFJ A;  4AXH A;  3Q6V A;  3SBL A;  1P9E A;  2BIB A;  2FHX B;  2FHX A;  4TZB A;  1WUP A;  3SFP A;  4C1F A;  4WD6 A;  1WUO A;  4Z67 A;  4EYB A;  1A7T A;  3X2X A;  2BG8 B;  2YNV B;  3I13 A;  4EXS A;  3MD7 A;  2DOO A;  5ACX A;  4HKY A;  2XF4 A;  4GYU A;  4TYF A;  5A0T A;  4EY2 A;  5AIJ A;  2FU9 A;  3PG4 A;  4H0D A;  5HIQ A;  3P2U A;  3AJ3 A;  4PDX A;  4EXY A;  4YSL A;  4UAM A;  5ACV A;  2Q42 A;  3ZWF A;  2CFU A;  4P62 A;  2BFZ B;  5AYA A;  2WYL A;  2Y8B A;  4V0H A;  2CBN A;  5EW0 A;  4NQ2 A;  4NUR A;  2YCB A;  2NYP A;  2ZWR A;  1DXK A;  2HB9 A;  2QDS A;  2GMN A;  5AHO A;  4HL2 A;  5EVK A;  4D1W A;  2NXA A;  3S0Z A;  4AD9 A;  2I7T A;  1WRA A;  2P97 A;  2QDT A;  2YNT B;  4PVT A;  4C1E A;  5AEB A;  4Z6X A;  2QJS A;  4C1C A;  1A8T A;  5EV6 A;  2H6A A;  2Q0I A;  2AIO A;  2BMI A;  4RL2 A;  4RM5 A;  4O98 A;  5LS3 A;  4J5H A;  5LCH A;  2GKL A;  4Z60 A;  3IDZ A;  5ACQ A;  4AWY B;  5K4K A;  4D02 A;  2AZ4 A;  1SML A;  3TP9 A;  5EVB A;  3IOF A;  1X8H A;  2A7M A;  4KEQ A;  4Z5Y A;  3ZR9 A;  3F9O A;  2QED A;  3RKK A;  1XTO A;  2Y8A A;  5DPX A;  2NZE A;  3FAI A;  5ACP A;  2CFZ A;  4XWW A;  4TYT A;  1JJT A;  3DHB A;  4YSK A;  3SD9 A;  4EYL A;  5LMC A;  5LLD A;  3PY5 A;  3I14 A;  4AWZ A;  5HIS A;  2WHG A;  2BR6 A;  2OHI A;  4F6H A;  5B15 A;  3IE0 A;  4FR7 A;  3DHC A;  1X8G A;  3IEM A;  2VW8 A;  1DDK A;  3QH8 A;  3I11 A;  4DIL A;  1KO3 A;  4LE6 A;  5AXR A;  3PY6 A;  3AF5 A;  3KL7 A;  5AJL A;  4D1V A;  1MQO A;  2BFL A;  5LE1 A;  1VGN A;  3G1P A;  3VPE A;  4UWO B;  1BMC A;  5HH4 A;  2YHE A;  2Y87 A;  3T9M A;  1Y44 A;  4FSB A;  3SPU A;  2WYM A;  3VQZ A;  3R2U A;  4U4L A;  5ACT A;  3T3N A;  5A5Z A;  1M2X A;  1XM8 A;  1JJE A;  1ZTC A;  5A0V A;  5LCF A;  2YNW A;  1QH3 A;  4JO0 A;  1BVT A;  2GCU A;  2BG2 A;  1L9Y A;  4EFZ A;  2FU6 A; 
#chains in the Genus database with same CATH homology
 1E5D A;  3BK2 A;  3IEK A;  1VJN A;  3IE2 A;  3KNR A;  1VME A;  3IOG A;  4RL0 A;  3SRX A;  5A87 A;  3DH8 A;  3L6N A;  3RKJ A;  2YZ3 A;  2I7X A;  5ACR A;  2ZO4 A;  4TZE A;  4ZO2 A;  4ZO3 A;  5HIO A;  3DHA A;  5LSC A;  4F6Z A;  3WXC A;  2OHH A;  5B1U A;  4KEP A;  3BK1 A;  2FU8 A;  5IQK A;  2P18 A;  2M5D A;  2P4Z A;  4RBS A;  3LVZ A;  3T3O A;  5EVD A;  4YSB A;  4ZNB A;  5LCA A;  3BV6 A;  1YCF A;  5K4N A;  4RAM A;  2FU7 A;  5K0W A;  2BTN A;  2FM6 A;  2OHJ A;  1YCH A;  2UYX A;  5AHR A;  2Q9U A;  4Z7R A;  2Q0J A;  3X2Z A;  2YNU A;  5ACW A;  5B3R A;  4DIK A;  5FQB A;  1X8I A;  4C1G A;  5KIL A;  4J5F A;  2GFK A;  5FQC A;  2FK6 A;  5LM6 A;  1HLK A;  3ZQ4 A;  2BG6 A;  1BC2 A;  4EYF A;  2BG8 A;  2YNV A;  5FQA A;  2WRS A;  4FEK A;  2BFK A;  1QH5 A;  4CHL A;  3ADR A;  1YCG A;  5AXO A;  2NZF A;  4NQ5 A;  4AX0 B;  3AF6 A;  5EWA A;  4D1T A;  2ZNB A;  2BFZ A;  5EH9 A;  4UA4 A;  4NQ6 A;  5K4M A;  2I7V A;  3I15 A;  4Z5Z A;  4B87 A;  4BP0 A;  2QIN A;  3ESH A;  4UWR B;  5KIK A;  3IEL A;  5EV8 A;  2XR1 A;  4ZEJ A;  5EHT A;  4XUK A;  2BG7 A;  2E7Y A;  1ZNB A;  4TZ9 A;  3H3E A;  2DKF A;  2YNT A;  5ACU A;  1WW1 A;  3SW3 A;  1DD6 A;  2WYM C;  4C1D A;  2BGA A;  4BZ3 A;  5ACS A;  2P1E A;  1K07 A;  4UWP B;  5HH5 A;  4XWT A;  3X30 A;  3I0V A;  3RPC A;  1KR3 A;  4UBQ A;  4GYQ A;  4AX1 B;  3FCZ A;  4TZF A;  2R2D A;  4D1U A;  1KO2 A;  2ZZI A;  3KNS A;  4HL1 A;  4UWS B;  3ZNB A;  4C1H A;  4GCW A;  1ZKP A;  5HH6 A;  2M5C A;  3BC2 A;  2BC2 A;  4C09 A;  4PVO A;  5HIP A;  4RAW A;  3A4Y A;  4NQ4 A;  3IE1 A;  1JT1 A;  3X2Y A;  3JXP A;  2GFJ A;  3Q6V A;  3SBL A;  1P9E A;  2BIB A;  2FHX B;  2FHX A;  4TZB A;  1WUP A;  3SFP A;  4C1F A;  4WD6 A;  1WUO A;  4Z67 A;  4EYB A;  1A7T A;  3X2X A;  2BG8 B;  2YNV B;  3I13 A;  4EXS A;  3MD7 A;  2DOO A;  5ACX A;  4HKY A;  2XF4 A;  4GYU A;  4TYF A;  5A0T A;  4EY2 A;  2FU9 A;  3PG4 A;  4H0D A;  5HIQ A;  3P2U A;  3AJ3 A;  4EXY A;  4YSL A;  4UAM A;  5ACV A;  2Q42 A;  3ZWF A;  4P62 A;  2BFZ B;  5AYA A;  2WYL A;  2Y8B A;  4V0H A;  2CBN A;  5EW0 A;  4NQ2 A;  2YCB A;  2NYP A;  2ZWR A;  1DXK A;  2HB9 A;  2QDS A;  2GMN A;  5AHO A;  4HL2 A;  5EVK A;  4D1W A;  2NXA A;  3S0Z A;  4AD9 A;  2I7T A;  1WRA A;  2P97 A;  2QDT A;  2YNT B;  4PVT A;  4C1E A;  5AEB A;  4Z6X A;  2QJS A;  4C1C A;  1A8T A;  5EV6 A;  2H6A A;  2Q0I A;  2AIO A;  2BMI A;  4RL2 A;  4RM5 A;  4O98 A;  5LS3 A;  4J5H A;  5LCH A;  2GKL A;  4Z60 A;  3IDZ A;  5ACQ A;  4AWY B;  5K4K A;  4D02 A;  2AZ4 A;  1SML A;  3TP9 A;  5EVB A;  3IOF A;  1X8H A;  2A7M A;  4KEQ A;  4Z5Y A;  3ZR9 A;  3F9O A;  2QED A;  3RKK A;  1XTO A;  2Y8A A;  5DPX A;  2NZE A;  3FAI A;  5ACP A;  4XWW A;  4TYT A;  1JJT A;  3DHB A;  4YSK A;  3SD9 A;  4EYL A;  5LMC A;  5LLD A;  3PY5 A;  3I14 A;  4AWZ A;  5HIS A;  2WHG A;  2BR6 A;  2OHI A;  4F6H A;  5B15 A;  3IE0 A;  4FR7 A;  3DHC A;  1X8G A;  3IEM A;  2VW8 A;  1DDK A;  3QH8 A;  3I11 A;  4DIL A;  1KO3 A;  4LE6 A;  5AXR A;  3PY6 A;  3AF5 A;  3KL7 A;  4D1V A;  1MQO A;  2BFL A;  5LE1 A;  1VGN A;  3G1P A;  3VPE A;  4UWO B;  1BMC A;  5HH4 A;  2Y87 A;  3T9M A;  1Y44 A;  4FSB A;  3SPU A;  2WYM A;  3VQZ A;  3R2U A;  4U4L A;  5ACT A;  3T3N A;  5A5Z A;  1M2X A;  1XM8 A;  1JJE A;  1ZTC A;  5A0V A;  5LCF A;  2YNW A;  1QH3 A;  4JO0 A;  1BVT A;  2GCU A;  2BG2 A;  1L9Y A;  4EFZ A;  2FU6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...