3X30A

Crystal structure of metallo-beta-lactamase from thermotoga maritima
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
227
structure length
227
Chain Sequence
GMKVTFLGHAVVLIEGKKNIIIDPFISGNPVCPVKLEGLPKIDYILVTHGHGDHLGDAVEIAKKNDATVISNYEICHYLGKKGVKTHAMHIGGSYLFDFGRVKMTPAVHGSGILDGDSMIYGGNPSGFLITIEGKKIYHAGDTGLTREMELLAEENVDVAFLPIGGNFVMDVEDAVRAAVMIKPKKVVPMHYGTWELIFADVELFKKKVEEKGVECVILEPGESLEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords UPF0173 metal-dependent hydrolase TM_1162
publication title Crystal structure of metallo-beta-lactamase from Thermotoga maritima
rcsb
source organism Thermotoga maritima msb8
total genus 60
structure length 227
sequence length 227
ec nomenclature
pdb deposition date 2015-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 3x30A00
4HKYA 1K07A 2WYLA 4F6ZA 2R2DA 4UWOB 4EXYA 2YNVA 5ACUA 4FEKA 4ZEJA 1A7TA 5K0WA 1X8HA 5ACTA 2H6AA 3DHBA 4Z6XA 2BGAA 5ACSA 3IEMA 3KNRA 3SW3A 2CBNA 3S0ZA 1QH3A 1ZNBA 4UA4A 4UWSB 4HL1A 1L9YA 5LCHA 2BG8A 4XWWA 4YSBA 5HIPA 2P18A 3VPEA 3PY5A 5EVDA 4C09A 4Z67A 1Y44A 2P1EA 5AEBA 3ZQ4A 3ZNBA 1DXKA 4BP0A 4J5HA 2DOOA 5DPXA 2WRSA 4XUKA 5HIOA 2BG6A 3H3EA 3I14A 4RAWA 2FU8A 3VQZA 3BC2A 5EVBA 4EYFA 4TZBA 4AX0B 2NYPA 2UYXA 2M5CA 5LS3A 5AHRA 2A7MA 3KNSA 2GKLA 4KEPA 4LE6A 3AJ3A 5ACWA 3IE0A 1VMEA 4Z5ZA 2M5DA 3BK1A 3FAIA 2YNVB 4JO0A 2YNWA 5K4MA 3MD7A 2WYMC 2BFZA 5LLDA 4C1CA 3PY6A 2OHIA 2NXAA 2BR6A 4NQ6A 2YNUA 2XF4A 4P62A 3IE2A 2BFKA 5LE1A 3TP9A 4D1WA 2BG8B 4Z5YA 1VGNA 1XTOA 5FQCA 4V0HA 2XR1A 2OHHA 5HH5A 1JT1A 3T3OA 1DD6A 4EYBA 4TYFA 2FU7A 4RL0A 4D1VA 2BFLA 5ACVA 2GFKA 1A8TA 5EHTA 4H0DA 3IDZA 3T9MA 2P97A 4RBSA 5LSCA 3I15A 5EVKA 4HL2A 2FU6A 4NQ4A 2BC2A 3JXPA 1WW1A 5LCAA 2BFZB 4F6HA 2DKFA 4C1GA 3P2UA 1HLKA 2Y8BA 5LCFA 4Z7RA 3DHCA 5A0TA 3DHAA 2OHJA 2I7VA 5AXRA 4RM5A 4AWYB 5HISA 4TYTA 3BK2A 2FK6A 5ACQA 2GCUA 2GMNA 3RKKA 4YSKA 2QDSA 1KO3A 2AZ4A 4EFZA 3R2UA 5EV8A 1E5DA 2BMIA 4PVTA 3LVZA 1YCFA 3RPCA 3SFPA 2FM6A 2I7TA 3SRXA 1MQOA 4TZEA 3G1PA 2Q0IA 2BTNA 4C1FA 5EH9A 5HIQA 1JJEA 3X2YA 4GCWA 1JJTA 5HH4A 3X30A 2VW8A 4FSBA 3BV6A 2BIBA 2NZEA 1ZTCA 1WRAA 2ZO4A 2FU9A 4YSLA 4PVOA 3SD9A 5EW0A 1BMCA 4B87A 2Y8AA 4AX1B 1BVTA 2QEDA 2AIOA 3ZWFA 4AD9A 3AF6A 2P4ZA 4UWRB 2BG2A 4CHLA 5LMCA 3SPUA 4J5FA 2I7XA 4EY2A 3QH8A 2QINA 4D1UA 5EWAA 3KL7A 5AXOA 5KILA 3X2XA 5AHOA 2NZFA 4Z60A 2Q9UA 2FHXA 5ACRA 1KR3A 4RL2A 5ACXA 3IOGA 2QDTA 1VJNA 5AYAA 3A4YA 2YNTA 3ZR9A 5K4KA 5K4NA 4EYLA 1WUOA 1YCGA 2HB9A 4RAMA 3DH8A 3FCZA 3WXCA 2BG7A 1M2XA 3PG4A 1XM8A 4DILA 5LM6A 2GFJA 3ADRA 5KIKA 3I11A 3I13A 4WD6A 4KEQA 4TZ9A 1BC2A 1WUPA 4NQ2A 3ESHA 2ZNBA 4UAMA 2Q0JA 4BZ3A 4TZFA 3RKJA 3AF5A 3Q6VA 4XWTA 3SBLA 4D02A 4C1EA 4GYQA 1QH5A 4C1DA 4UWPB 1ZKPA 2FHXB 3IOFA 4UBQA 1P9EA 1SMLA 5ACPA 2WYMA 2YCBA 5FQAA 3T3NA 2Y87A 2YZ3A 2YNTB 4O98A 2QJSA 2ZWRA 4C1HA 5A5ZA 4U4LA 5B3RA 3IE1A 5IQKA 4ZNBA 2Q42A 4EXSA 4ZO3A 5FQBA 5B15A 3IEKA 5EV6A 4FR7A 3X2ZA 4DIKA 4D1TA 1KO2A 5A87A 1X8IA 4NQ5A 4ZO2A 4GYUA 1YCHA 3F9OA 3I0VA 3L6NA 2WHGA 2ZZIA 2E7YA 1X8GA 3IELA 5A0VA 4AWZA 5B1UA 1DDKA 5HH6A
chains in the Genus database with same CATH superfamily
4HKYA 1K07A 2WYLA 4F6ZA 2R2DA 4UWOB 4EXYA 2YNVA 5ACUA 2CG2A 4FEKA 4ZEJA 1A7TA 2CG3A 5K0WA 1X8HA 5ACTA 2H6AA 3DHBA 4Z6XA 2BGAA 5ACSA 3IEMA 3KNRA 3SW3A 2CFUA 2CBNA 3S0ZA 1QH3A 1ZNBA 4UA4A 4UWSB 4HL1A 1L9YA 5LCHA 2BG8A 4XWWA 4YSBA 5HIPA 2P18A 3VPEA 3PY5A 5EVDA 4C09A 4Z67A 1Y44A 2P1EA 5AEBA 3ZQ4A 3ZNBA 1DXKA 4BP0A 4J5HA 2DOOA 5DPXA 2WRSA 4NURA 4XUKA 5HIOA 2BG6A 3H3EA 3I14A 4RAWA 2FU8A 3VQZA 3BC2A 5EVBA 4EYFA 4TZBA 4AX0B 2NYPA 2UYXA 2M5CA 5LS3A 5AHRA 2A7MA 3KNSA 2GKLA 4KEPA 4LE6A 3AJ3A 5ACWA 3IE0A 1VMEA 4Z5ZA 2M5DA 3BK1A 3FAIA 2YNVB 4JO0A 2YNWA 5K4MA 3MD7A 2WYMC 2BFZA 5LLDA 4C1CA 3PY6A 2OHIA 5A23A 2NXAA 2BR6A 4NQ6A 2YNUA 2XF4A 4P62A 3IE2A 2BFKA 5LE1A 4AXHA 3TP9A 4D1WA 2BG8B 4Z5YA 1VGNA 1XTOA 5FQCA 4V0HA 2XR1A 2CFZA 2OHHA 5HH5A 1JT1A 3T3OA 1DD6A 4EYBA 4TYFA 2FU7A 4RL0A 4D1VA 2BFLA 5ACVA 2GFKA 1A8TA 5EHTA 4H0DA 3IDZA 3T9MA 2P97A 4RBSA 5LSCA 3I15A 4PDXA 5EVKA 4HL2A 2FU6A 4NQ4A 2BC2A 3JXPA 1WW1A 5LCAA 2BFZB 4F6HA 2DKFA 4C1GA 3P2UA 1HLKA 2Y8BA 5LCFA 4Z7RA 3DHCA 5A0TA 3DHAA 2OHJA 2I7VA 5AXRA 4RM5A 4AWYB 5HISA 4TYTA 3BK2A 2FK6A 5ACQA 2GCUA 2GMNA 3RKKA 4YSKA 2QDSA 1KO3A 2AZ4A 4EFZA 3R2UA 5EV8A 1E5DA 2BMIA 4PVTA 3LVZA 1YCFA 3RPCA 3SFPA 2FM6A 2I7TA 3SRXA 1MQOA 4TZEA 3G1PA 2Q0IA 2BTNA 4C1FA 5EH9A 5HIQA 1JJEA 3X2YA 4GCWA 1JJTA 5HH4A 3X30A 2VW8A 4FSBA 3BV6A 2BIBA 2NZEA 1ZTCA 1WRAA 2ZO4A 2FU9A 4YSLA 4PVOA 3SD9A 5EW0A 1BMCA 4B87A 2Y8AA 4AX1B 1BVTA 2QEDA 2AIOA 3ZWFA 4AD9A 3AF6A 2P4ZA 4UWRB 2BG2A 4CHLA 5LMCA 3SPUA 4J5FA 2I7XA 4EY2A 3QH8A 2QINA 2YHEA 4D1UA 5EWAA 3KL7A 5AXOA 5KILA 3X2XA 5AHOA 2NZFA 4Z60A 2Q9UA 2FHXA 5ACRA 1KR3A 4RL2A 5ACXA 3IOGA 2QDTA 1VJNA 5AYAA 3A4YA 2YNTA 3ZR9A 5K4KA 5K4NA 4EYLA 1WUOA 1YCGA 2HB9A 4RAMA 3DH8A 3FCZA 3WXCA 2BG7A 1M2XA 3PG4A 1XM8A 4DILA 5LM6A 2GFJA 3ADRA 5KIKA 3I11A 3I13A 4WD6A 4KEQA 4TZ9A 1BC2A 1WUPA 4NQ2A 3ESHA 2ZNBA 4UAMA 2Q0JA 4BZ3A 4TZFA 3RKJA 3AF5A 3Q6VA 4XWTA 3SBLA 4D02A 4AV7A 4C1EA 4GYQA 1QH5A 4C1DA 4UWPB 1ZKPA 2FHXB 3IOFA 4UBQA 1P9EA 1SMLA 5ACPA 2WYMA 2YCBA 5AIJA 5FQAA 3T3NA 2Y87A 2YZ3A 2YNTB 4O98A 2QJSA 2ZWRA 4C1HA 5A5ZA 4U4LA 5B3RA 3IE1A 5IQKA 4ZNBA 5AJLA 2Q42A 4EXSA 4ZO3A 5FQBA 5B15A 3IEKA 5EV6A 4FR7A 3X2ZA 4DIKA 4D1TA 1KO2A 5A87A 1X8IA 4NQ5A 4ZO2A 4GYUA 1YCHA 3F9OA 3I0VA 3L6NA 2WHGA 2ZZIA 2E7YA 1X8GA 3IELA 5A0VA 4AWZA 5B1UA 1DDKA 5HH6A
chains in the Genus database with same CATH topology
4HKYA 1K07A 2WYLA 4F6ZA 2R2DA 4UWOB 4EXYA 2YNVA 5ACUA 4FEKA 4ZEJA 1A7TA 5K0WA 1X8HA 5ACTA 2H6AA 3DHBA 4Z6XA 2BGAA 5ACSA 3IEMA 3KNRA 3SW3A 2CBNA 3S0ZA 1QH3A 1ZNBA 4UA4A 4UWSB 4HL1A 1L9YA 5LCHA 2BG8A 4XWWA 4YSBA 5HIPA 2P18A 3VPEA 3PY5A 5EVDA 4C09A 4Z67A 1Y44A 2P1EA 5AEBA 3ZQ4A 3ZNBA 1DXKA 4BP0A 4J5HA 2DOOA 5DPXA 2WRSA 4XUKA 5HIOA 2BG6A 3H3EA 3I14A 4RAWA 2FU8A 3VQZA 3BC2A 5EVBA 4EYFA 4TZBA 4AX0B 2NYPA 2UYXA 2M5CA 5LS3A 5AHRA 2A7MA 3KNSA 2GKLA 4KEPA 4LE6A 3AJ3A 5ACWA 3IE0A 1VMEA 4Z5ZA 2M5DA 3BK1A 3FAIA 2YNVB 4JO0A 2YNWA 5K4MA 3MD7A 2WYMC 2BFZA 5LLDA 4C1CA 3PY6A 2OHIA 2NXAA 2BR6A 4NQ6A 2YNUA 2XF4A 4P62A 3IE2A 2BFKA 5LE1A 3TP9A 4D1WA 2BG8B 4Z5YA 1VGNA 1XTOA 5FQCA 4V0HA 2XR1A 2OHHA 5HH5A 1JT1A 3T3OA 1DD6A 4EYBA 4TYFA 2FU7A 4RL0A 4D1VA 2BFLA 5ACVA 2GFKA 1A8TA 5EHTA 4H0DA 3IDZA 3T9MA 2P97A 4RBSA 5LSCA 3I15A 5EVKA 4HL2A 2FU6A 4NQ4A 2BC2A 3JXPA 1WW1A 5LCAA 2BFZB 4F6HA 2DKFA 4C1GA 3P2UA 1HLKA 2Y8BA 5LCFA 4Z7RA 3DHCA 5A0TA 3DHAA 2OHJA 2I7VA 5AXRA 4RM5A 4AWYB 5HISA 4TYTA 3BK2A 2FK6A 5ACQA 2GCUA 2GMNA 3RKKA 4YSKA 2QDSA 1KO3A 2AZ4A 4EFZA 3R2UA 5EV8A 1E5DA 2BMIA 4PVTA 3LVZA 1YCFA 3RPCA 3SFPA 2FM6A 2I7TA 3SRXA 1MQOA 4TZEA 3G1PA 2Q0IA 2BTNA 4C1FA 5EH9A 5HIQA 1JJEA 3X2YA 4GCWA 1JJTA 5HH4A 3X30A 2VW8A 4FSBA 3BV6A 2BIBA 2NZEA 1ZTCA 1WRAA 2ZO4A 2FU9A 4YSLA 4PVOA 3SD9A 5EW0A 1BMCA 4B87A 2Y8AA 4AX1B 1BVTA 2QEDA 2AIOA 3ZWFA 4AD9A 3AF6A 2P4ZA 4UWRB 2BG2A 4CHLA 5LMCA 3SPUA 4J5FA 2I7XA 4EY2A 3QH8A 2QINA 4D1UA 5EWAA 3KL7A 5AXOA 5KILA 3X2XA 5AHOA 2NZFA 4Z60A 2Q9UA 2FHXA 5ACRA 1KR3A 4RL2A 5ACXA 3IOGA 2QDTA 1VJNA 5AYAA 3A4YA 2YNTA 3ZR9A 5K4KA 5K4NA 4EYLA 1WUOA 1YCGA 2HB9A 4RAMA 3DH8A 3FCZA 3WXCA 2BG7A 1M2XA 3PG4A 1XM8A 4DILA 5LM6A 2GFJA 3ADRA 5KIKA 3I11A 3I13A 4WD6A 4KEQA 4TZ9A 1BC2A 1WUPA 4NQ2A 3ESHA 2ZNBA 4UAMA 2Q0JA 4BZ3A 4TZFA 3RKJA 3AF5A 3Q6VA 4XWTA 3SBLA 4D02A 4C1EA 4GYQA 1QH5A 4C1DA 4UWPB 1ZKPA 2FHXB 3IOFA 4UBQA 1P9EA 1SMLA 5ACPA 2WYMA 2YCBA 5FQAA 3T3NA 2Y87A 2YZ3A 2YNTB 4O98A 2QJSA 2ZWRA 4C1HA 5A5ZA 4U4LA 5B3RA 3IE1A 5IQKA 4ZNBA 2Q42A 4EXSA 4ZO3A 5FQBA 5B15A 3IEKA 5EV6A 4FR7A 3X2ZA 4DIKA 4D1TA 1KO2A 5A87A 1X8IA 4NQ5A 4ZO2A 4GYUA 1YCHA 3F9OA 3I0VA 3L6NA 2WHGA 2ZZIA 2E7YA 1X8GA 3IELA 5A0VA 4AWZA 5B1UA 1DDKA 5HH6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HKY A;  1K07 A;  2WYL A;  4F6Z A;  2R2D A;  4UWO B;  4EXY A;  2YNV A;  5ACU A;  4FEK A;  4ZEJ A;  1A7T A;  5K0W A;  1X8H A;  5ACT A;  2H6A A;  3DHB A;  4Z6X A;  2BGA A;  5ACS A;  3IEM A;  3KNR A;  3SW3 A;  2CBN A;  3S0Z A;  1QH3 A;  1ZNB A;  4UA4 A;  4UWS B;  4HL1 A;  1L9Y A;  5LCH A;  2BG8 A;  4XWW A;  4YSB A;  5HIP A;  2P18 A;  3VPE A;  3PY5 A;  5EVD A;  4C09 A;  4Z67 A;  1Y44 A;  2P1E A;  5AEB A;  3ZQ4 A;  3ZNB A;  1DXK A;  4BP0 A;  4J5H A;  2DOO A;  5DPX A;  2WRS A;  4XUK A;  5HIO A;  2BG6 A;  3H3E A;  3I14 A;  4RAW A;  2FU8 A;  3VQZ A;  3BC2 A;  5EVB A;  4EYF A;  4TZB A;  4AX0 B;  2NYP A;  2UYX A;  2M5C A;  5LS3 A;  5AHR A;  2A7M A;  3KNS A;  2GKL A;  4KEP A;  4LE6 A;  3AJ3 A;  5ACW A;  3IE0 A;  1VME A;  4Z5Z A;  2M5D A;  3BK1 A;  3FAI A;  2YNV B;  4JO0 A;  2YNW A;  5K4M A;  3MD7 A;  2WYM C;  2BFZ A;  5LLD A;  4C1C A;  3PY6 A;  2OHI A;  2NXA A;  2BR6 A;  4NQ6 A;  2YNU A;  2XF4 A;  4P62 A;  3IE2 A;  2BFK A;  5LE1 A;  3TP9 A;  4D1W A;  2BG8 B;  4Z5Y A;  1VGN A;  1XTO A;  5FQC A;  4V0H A;  2XR1 A;  2OHH A;  5HH5 A;  1JT1 A;  3T3O A;  1DD6 A;  4EYB A;  4TYF A;  2FU7 A;  4RL0 A;  4D1V A;  2BFL A;  5ACV A;  2GFK A;  1A8T A;  5EHT A;  4H0D A;  3IDZ A;  3T9M A;  2P97 A;  4RBS A;  5LSC A;  3I15 A;  5EVK A;  4HL2 A;  2FU6 A;  4NQ4 A;  2BC2 A;  3JXP A;  1WW1 A;  5LCA A;  2BFZ B;  4F6H A;  2DKF A;  4C1G A;  3P2U A;  1HLK A;  2Y8B A;  5LCF A;  4Z7R A;  3DHC A;  5A0T A;  3DHA A;  2OHJ A;  2I7V A;  5AXR A;  4RM5 A;  4AWY B;  5HIS A;  4TYT A;  3BK2 A;  2FK6 A;  5ACQ A;  2GCU A;  2GMN A;  3RKK A;  4YSK A;  2QDS A;  1KO3 A;  2AZ4 A;  4EFZ A;  3R2U A;  5EV8 A;  1E5D A;  2BMI A;  4PVT A;  3LVZ A;  1YCF A;  3RPC A;  3SFP A;  2FM6 A;  2I7T A;  3SRX A;  1MQO A;  4TZE A;  3G1P A;  2Q0I A;  2BTN A;  4C1F A;  5EH9 A;  5HIQ A;  1JJE A;  3X2Y A;  4GCW A;  1JJT A;  5HH4 A;  3X30 A;  2VW8 A;  4FSB A;  3BV6 A;  2BIB A;  2NZE A;  1ZTC A;  1WRA A;  2ZO4 A;  2FU9 A;  4YSL A;  4PVO A;  3SD9 A;  5EW0 A;  1BMC A;  4B87 A;  2Y8A A;  4AX1 B;  1BVT A;  2QED A;  2AIO A;  3ZWF A;  4AD9 A;  3AF6 A;  2P4Z A;  4UWR B;  2BG2 A;  4CHL A;  5LMC A;  3SPU A;  4J5F A;  2I7X A;  4EY2 A;  3QH8 A;  2QIN A;  4D1U A;  5EWA A;  3KL7 A;  5AXO A;  5KIL A;  3X2X A;  5AHO A;  2NZF A;  4Z60 A;  2Q9U A;  2FHX A;  5ACR A;  1KR3 A;  4RL2 A;  5ACX A;  3IOG A;  2QDT A;  1VJN A;  5AYA A;  3A4Y A;  2YNT A;  3ZR9 A;  5K4K A;  5K4N A;  4EYL A;  1WUO A;  1YCG A;  2HB9 A;  4RAM A;  3DH8 A;  3FCZ A;  3WXC A;  2BG7 A;  1M2X A;  3PG4 A;  1XM8 A;  4DIL A;  5LM6 A;  2GFJ A;  3ADR A;  5KIK A;  3I11 A;  3I13 A;  4WD6 A;  4KEQ A;  4TZ9 A;  1BC2 A;  1WUP A;  4NQ2 A;  3ESH A;  2ZNB A;  4UAM A;  2Q0J A;  4BZ3 A;  4TZF A;  3RKJ A;  3AF5 A;  3Q6V A;  4XWT A;  3SBL A;  4D02 A;  4C1E A;  4GYQ A;  1QH5 A;  4C1D A;  4UWP B;  1ZKP A;  2FHX B;  3IOF A;  4UBQ A;  1P9E A;  1SML A;  5ACP A;  2WYM A;  2YCB A;  5FQA A;  3T3N A;  2Y87 A;  2YZ3 A;  2YNT B;  4O98 A;  2QJS A;  2ZWR A;  4C1H A;  5A5Z A;  4U4L A;  5B3R A;  3IE1 A;  5IQK A;  4ZNB A;  2Q42 A;  4EXS A;  4ZO3 A;  5FQB A;  5B15 A;  3IEK A;  5EV6 A;  4FR7 A;  3X2Z A;  4DIK A;  4D1T A;  1KO2 A;  5A87 A;  1X8I A;  4NQ5 A;  4ZO2 A;  4GYU A;  1YCH A;  3F9O A;  3I0V A;  3L6N A;  2WHG A;  2ZZI A;  2E7Y A;  1X8G A;  3IEL A;  5A0V A;  4AWZ A;  5B1U A;  1DDK A;  5HH6 A; 
#chains in the Genus database with same CATH topology
 4HKY A;  1K07 A;  2WYL A;  4F6Z A;  2R2D A;  4UWO B;  4EXY A;  2YNV A;  5ACU A;  2CG2 A;  4FEK A;  4ZEJ A;  1A7T A;  2CG3 A;  5K0W A;  1X8H A;  5ACT A;  2H6A A;  3DHB A;  4Z6X A;  2BGA A;  5ACS A;  3IEM A;  3KNR A;  3SW3 A;  2CFU A;  2CBN A;  3S0Z A;  1QH3 A;  1ZNB A;  4UA4 A;  4UWS B;  4HL1 A;  1L9Y A;  5LCH A;  2BG8 A;  4XWW A;  4YSB A;  5HIP A;  2P18 A;  3VPE A;  3PY5 A;  5EVD A;  4C09 A;  4Z67 A;  1Y44 A;  2P1E A;  5AEB A;  3ZQ4 A;  3ZNB A;  1DXK A;  4BP0 A;  4J5H A;  2DOO A;  5DPX A;  2WRS A;  4NUR A;  4XUK A;  5HIO A;  2BG6 A;  3H3E A;  3I14 A;  4RAW A;  2FU8 A;  3VQZ A;  3BC2 A;  5EVB A;  4EYF A;  4TZB A;  4AX0 B;  2NYP A;  2UYX A;  2M5C A;  5LS3 A;  5AHR A;  2A7M A;  3KNS A;  2GKL A;  4KEP A;  4LE6 A;  3AJ3 A;  5ACW A;  3IE0 A;  1VME A;  4Z5Z A;  2M5D A;  3BK1 A;  3FAI A;  2YNV B;  4JO0 A;  2YNW A;  5K4M A;  3MD7 A;  2WYM C;  2BFZ A;  5LLD A;  4C1C A;  3PY6 A;  2OHI A;  5A23 A;  2NXA A;  2BR6 A;  4NQ6 A;  2YNU A;  2XF4 A;  4P62 A;  3IE2 A;  2BFK A;  5LE1 A;  4AXH A;  3TP9 A;  4D1W A;  2BG8 B;  4Z5Y A;  1VGN A;  1XTO A;  5FQC A;  4V0H A;  2XR1 A;  2CFZ A;  2OHH A;  5HH5 A;  1JT1 A;  3T3O A;  1DD6 A;  4EYB A;  4TYF A;  2FU7 A;  4RL0 A;  4D1V A;  2BFL A;  5ACV A;  2GFK A;  1A8T A;  5EHT A;  4H0D A;  3IDZ A;  3T9M A;  2P97 A;  4RBS A;  5LSC A;  3I15 A;  4PDX A;  5EVK A;  4HL2 A;  2FU6 A;  4NQ4 A;  2BC2 A;  3JXP A;  1WW1 A;  5LCA A;  2BFZ B;  4F6H A;  2DKF A;  4C1G A;  3P2U A;  1HLK A;  2Y8B A;  5LCF A;  4Z7R A;  3DHC A;  5A0T A;  3DHA A;  2OHJ A;  2I7V A;  5AXR A;  4RM5 A;  4AWY B;  5HIS A;  4TYT A;  3BK2 A;  2FK6 A;  5ACQ A;  2GCU A;  2GMN A;  3RKK A;  4YSK A;  2QDS A;  1KO3 A;  2AZ4 A;  4EFZ A;  3R2U A;  5EV8 A;  1E5D A;  2BMI A;  4PVT A;  3LVZ A;  1YCF A;  3RPC A;  3SFP A;  2FM6 A;  2I7T A;  3SRX A;  1MQO A;  4TZE A;  3G1P A;  2Q0I A;  2BTN A;  4C1F A;  5EH9 A;  5HIQ A;  1JJE A;  3X2Y A;  4GCW A;  1JJT A;  5HH4 A;  3X30 A;  2VW8 A;  4FSB A;  3BV6 A;  2BIB A;  2NZE A;  1ZTC A;  1WRA A;  2ZO4 A;  2FU9 A;  4YSL A;  4PVO A;  3SD9 A;  5EW0 A;  1BMC A;  4B87 A;  2Y8A A;  4AX1 B;  1BVT A;  2QED A;  2AIO A;  3ZWF A;  4AD9 A;  3AF6 A;  2P4Z A;  4UWR B;  2BG2 A;  4CHL A;  5LMC A;  3SPU A;  4J5F A;  2I7X A;  4EY2 A;  3QH8 A;  2QIN A;  2YHE A;  4D1U A;  5EWA A;  3KL7 A;  5AXO A;  5KIL A;  3X2X A;  5AHO A;  2NZF A;  4Z60 A;  2Q9U A;  2FHX A;  5ACR A;  1KR3 A;  4RL2 A;  5ACX A;  3IOG A;  2QDT A;  1VJN A;  5AYA A;  3A4Y A;  2YNT A;  3ZR9 A;  5K4K A;  5K4N A;  4EYL A;  1WUO A;  1YCG A;  2HB9 A;  4RAM A;  3DH8 A;  3FCZ A;  3WXC A;  2BG7 A;  1M2X A;  3PG4 A;  1XM8 A;  4DIL A;  5LM6 A;  2GFJ A;  3ADR A;  5KIK A;  3I11 A;  3I13 A;  4WD6 A;  4KEQ A;  4TZ9 A;  1BC2 A;  1WUP A;  4NQ2 A;  3ESH A;  2ZNB A;  4UAM A;  2Q0J A;  4BZ3 A;  4TZF A;  3RKJ A;  3AF5 A;  3Q6V A;  4XWT A;  3SBL A;  4D02 A;  4AV7 A;  4C1E A;  4GYQ A;  1QH5 A;  4C1D A;  4UWP B;  1ZKP A;  2FHX B;  3IOF A;  4UBQ A;  1P9E A;  1SML A;  5ACP A;  2WYM A;  2YCB A;  5AIJ A;  5FQA A;  3T3N A;  2Y87 A;  2YZ3 A;  2YNT B;  4O98 A;  2QJS A;  2ZWR A;  4C1H A;  5A5Z A;  4U4L A;  5B3R A;  3IE1 A;  5IQK A;  4ZNB A;  5AJL A;  2Q42 A;  4EXS A;  4ZO3 A;  5FQB A;  5B15 A;  3IEK A;  5EV6 A;  4FR7 A;  3X2Z A;  4DIK A;  4D1T A;  1KO2 A;  5A87 A;  1X8I A;  4NQ5 A;  4ZO2 A;  4GYU A;  1YCH A;  3F9O A;  3I0V A;  3L6N A;  2WHG A;  2ZZI A;  2E7Y A;  1X8G A;  3IEL A;  5A0V A;  4AWZ A;  5B1U A;  1DDK A;  5HH6 A; 
#chains in the Genus database with same CATH homology
 4HKY A;  1K07 A;  2WYL A;  4F6Z A;  2R2D A;  4UWO B;  4EXY A;  2YNV A;  5ACU A;  4FEK A;  4ZEJ A;  1A7T A;  5K0W A;  1X8H A;  5ACT A;  2H6A A;  3DHB A;  4Z6X A;  2BGA A;  5ACS A;  3IEM A;  3KNR A;  3SW3 A;  2CBN A;  3S0Z A;  1QH3 A;  1ZNB A;  4UA4 A;  4UWS B;  4HL1 A;  1L9Y A;  5LCH A;  2BG8 A;  4XWW A;  4YSB A;  5HIP A;  2P18 A;  3VPE A;  3PY5 A;  5EVD A;  4C09 A;  4Z67 A;  1Y44 A;  2P1E A;  5AEB A;  3ZQ4 A;  3ZNB A;  1DXK A;  4BP0 A;  4J5H A;  2DOO A;  5DPX A;  2WRS A;  4XUK A;  5HIO A;  2BG6 A;  3H3E A;  3I14 A;  4RAW A;  2FU8 A;  3VQZ A;  3BC2 A;  5EVB A;  4EYF A;  4TZB A;  4AX0 B;  2NYP A;  2UYX A;  2M5C A;  5LS3 A;  5AHR A;  2A7M A;  3KNS A;  2GKL A;  4KEP A;  4LE6 A;  3AJ3 A;  5ACW A;  3IE0 A;  1VME A;  4Z5Z A;  2M5D A;  3BK1 A;  3FAI A;  2YNV B;  4JO0 A;  2YNW A;  5K4M A;  3MD7 A;  2WYM C;  2BFZ A;  5LLD A;  4C1C A;  3PY6 A;  2OHI A;  2NXA A;  2BR6 A;  4NQ6 A;  2YNU A;  2XF4 A;  4P62 A;  3IE2 A;  2BFK A;  5LE1 A;  3TP9 A;  4D1W A;  2BG8 B;  4Z5Y A;  1VGN A;  1XTO A;  5FQC A;  4V0H A;  2XR1 A;  2OHH A;  5HH5 A;  1JT1 A;  3T3O A;  1DD6 A;  4EYB A;  4TYF A;  2FU7 A;  4RL0 A;  4D1V A;  2BFL A;  5ACV A;  2GFK A;  1A8T A;  5EHT A;  4H0D A;  3IDZ A;  3T9M A;  2P97 A;  4RBS A;  5LSC A;  3I15 A;  5EVK A;  4HL2 A;  2FU6 A;  4NQ4 A;  2BC2 A;  3JXP A;  1WW1 A;  5LCA A;  2BFZ B;  4F6H A;  2DKF A;  4C1G A;  3P2U A;  1HLK A;  2Y8B A;  5LCF A;  4Z7R A;  3DHC A;  5A0T A;  3DHA A;  2OHJ A;  2I7V A;  5AXR A;  4RM5 A;  4AWY B;  5HIS A;  4TYT A;  3BK2 A;  2FK6 A;  5ACQ A;  2GCU A;  2GMN A;  3RKK A;  4YSK A;  2QDS A;  1KO3 A;  2AZ4 A;  4EFZ A;  3R2U A;  5EV8 A;  1E5D A;  2BMI A;  4PVT A;  3LVZ A;  1YCF A;  3RPC A;  3SFP A;  2FM6 A;  2I7T A;  3SRX A;  1MQO A;  4TZE A;  3G1P A;  2Q0I A;  2BTN A;  4C1F A;  5EH9 A;  5HIQ A;  1JJE A;  3X2Y A;  4GCW A;  1JJT A;  5HH4 A;  3X30 A;  2VW8 A;  4FSB A;  3BV6 A;  2BIB A;  2NZE A;  1ZTC A;  1WRA A;  2ZO4 A;  2FU9 A;  4YSL A;  4PVO A;  3SD9 A;  5EW0 A;  1BMC A;  4B87 A;  2Y8A A;  4AX1 B;  1BVT A;  2QED A;  2AIO A;  3ZWF A;  4AD9 A;  3AF6 A;  2P4Z A;  4UWR B;  2BG2 A;  4CHL A;  5LMC A;  3SPU A;  4J5F A;  2I7X A;  4EY2 A;  3QH8 A;  2QIN A;  4D1U A;  5EWA A;  3KL7 A;  5AXO A;  5KIL A;  3X2X A;  5AHO A;  2NZF A;  4Z60 A;  2Q9U A;  2FHX A;  5ACR A;  1KR3 A;  4RL2 A;  5ACX A;  3IOG A;  2QDT A;  1VJN A;  5AYA A;  3A4Y A;  2YNT A;  3ZR9 A;  5K4K A;  5K4N A;  4EYL A;  1WUO A;  1YCG A;  2HB9 A;  4RAM A;  3DH8 A;  3FCZ A;  3WXC A;  2BG7 A;  1M2X A;  3PG4 A;  1XM8 A;  4DIL A;  5LM6 A;  2GFJ A;  3ADR A;  5KIK A;  3I11 A;  3I13 A;  4WD6 A;  4KEQ A;  4TZ9 A;  1BC2 A;  1WUP A;  4NQ2 A;  3ESH A;  2ZNB A;  4UAM A;  2Q0J A;  4BZ3 A;  4TZF A;  3RKJ A;  3AF5 A;  3Q6V A;  4XWT A;  3SBL A;  4D02 A;  4C1E A;  4GYQ A;  1QH5 A;  4C1D A;  4UWP B;  1ZKP A;  2FHX B;  3IOF A;  4UBQ A;  1P9E A;  1SML A;  5ACP A;  2WYM A;  2YCB A;  5FQA A;  3T3N A;  2Y87 A;  2YZ3 A;  2YNT B;  4O98 A;  2QJS A;  2ZWR A;  4C1H A;  5A5Z A;  4U4L A;  5B3R A;  3IE1 A;  5IQK A;  4ZNB A;  2Q42 A;  4EXS A;  4ZO3 A;  5FQB A;  5B15 A;  3IEK A;  5EV6 A;  4FR7 A;  3X2Z A;  4DIK A;  4D1T A;  1KO2 A;  5A87 A;  1X8I A;  4NQ5 A;  4ZO2 A;  4GYU A;  1YCH A;  3F9O A;  3I0V A;  3L6N A;  2WHG A;  2ZZI A;  2E7Y A;  1X8G A;  3IEL A;  5A0V A;  4AWZ A;  5B1U A;  1DDK A;  5HH6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...