3X30A

Crystal structure of metallo-beta-lactamase from thermotoga maritima
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
227
structure length
227
Chain Sequence
GMKVTFLGHAVVLIEGKKNIIIDPFISGNPVCPVKLEGLPKIDYILVTHGHGDHLGDAVEIAKKNDATVISNYEICHYLGKKGVKTHAMHIGGSYLFDFGRVKMTPAVHGSGILDGDSMIYGGNPSGFLITIEGKKIYHAGDTGLTREMELLAEENVDVAFLPIGGNFVMDVEDAVRAAVMIKPKKVVPMHYGTWELIFADVELFKKKVEEKGVECVILEPGESLEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UPF0173 metal-dependent hydrolase TM_1162
publication title Crystal structure of metallo-beta-lactamase from Thermotoga maritima
rcsb
source organism Thermotoga maritima msb8
molecule tags Hydrolase
total genus 60
structure length 227
sequence length 227
ec nomenclature
pdb deposition date 2015-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 3x30A00
5IQKA 3H3EA 2P1EA 3FCZA 4AX1B 4XWTA 2NYPA 3SW3A 4JO0A 5EWAA 2NZEA 1BVTA 2Q42A 3DH8A 4D1UA 3ZWFA 1A7TA 4F6HA 4D02A 4C1FA 2NZFA 4Z5ZA 3X2YA 5ACRA 1SMLA 4D1VA 4NQ6A 2ZO4A 3A4YA 3RKJA 5AEBA 3G1PA 2A7MA 2BIBA 2CBNA 2UYXA 5K4NA 1VMEA 4AWZA 5HH4A 1XM8A 4D1TA 2QDTA 3I14A 2WYLA 5ACWA 5EW0A 4FEKA 3WXCA 4Z60A 1KR3A 2Q0JA 2GFJA 2BFZB 3PG4A 3IE0A 3AF5A 3DHBA 3IE2A 4ZO2A 3RPCA 2FU7A 3VPEA 4UWOB 4EY2A 4ZEJA 4RAMA 5AXRA 3X2XA 4YSLA 2BTNA 3T3NA 1E5DA 4Z6XA 5EH9A 4P62A 3IE1A 5LS3A 5EV8A 5LE1A 1MQOA 5A87A 5HIQA 3DHAA 3BK2A 2BC2A 2Q0IA 4TYTA 4UAMA 1X8HA 4D1WA 3ADRA 3MD7A 1BMCA 2YNVA 4EYBA 2Q9UA 2BG8B 2GMNA 1ZKPA 1ZNBA 3IEMA 3SPUA 4HL2A 5LM6A 1DXKA 2Y8BA 4RM5A 1HLKA 4UWSB 1M2XA 3LVZA 5FQAA 4V0HA 4UWPB 2ZWRA 5DPXA 2FU9A 4J5HA 4BP0A 1YCHA 2YNTA 1KO3A 3I15A 4H0DA 4Z7RA 5EHTA 2BR6A 1ZTCA 1WUOA 4YSBA 4UA4A 5K0WA 4TZEA 3IDZA 4FSBA 5ACXA 4C09A 2YZ3A 5LSCA 2BG6A 4XUKA 2BFZA 2I7XA 4C1EA 2E7YA 4FR7A 3FAIA 4C1HA 2OHHA 1JT1A 4TZBA 2P97A 2WYMC 5ACPA 3S0ZA 1K07A 4RL2A 1XTOA 1VJNA 4O98A 4F6ZA 5K4MA 3SFPA 2BMIA 4C1GA 3ZQ4A 5LLDA 4HKYA 2OHIA 3IELA 5A0VA 2XF4A 5AXOA 2P18A 5B1UA 4TZ9A 2I7VA 3AJ3A 4AX0B 2FU8A 5B3RA 2FHXA 3IOGA 1JJEA 1BC2A 2WRSA 1WW1A 5EV6A 5K4KA 2QDSA 4GCWA 5EVKA 3ZR9A 1QH3A 5HIPA 2P4ZA 4XWWA 5LCHA 4GYUA 5LCFA 3T3OA 5LMCA 4TYFA 4C1DA 4CHLA 4RBSA 2FK6A 2AZ4A 5EVBA 4WD6A 5EVDA 2NXAA 3I11A 5LCAA 2WYMA 4UWRB 5FQBA 4AD9A 1YCGA 2OHJA 2GKLA 2XR1A 2BG2A 4NQ2A 2FM6A 2YCBA 5HH6A 3ZNBA 4KEQA 4EYFA 5ACUA 5HIOA 4J5FA 3X30A 2M5DA 5AHRA 4EXSA 3SD9A 3IOFA 4RL0A 5A0TA 2H6AA 4B87A 2YNVB 2BGAA 2DKFA 1KO2A 3R2UA 1YCFA 3I13A 5ACSA 4EXYA 5KILA 1A8TA 4KEPA 1DDKA 4HL1A 2R2DA 5AHOA 2DOOA 5ACQA 1Y44A 3IEKA 3BV6A 3PY5A 3L6NA 4AWYB 4PVOA 4PVTA 3P2UA 3ESHA 2YNTB 3RKKA 5A5ZA 2GCUA 2Y8AA 1DD6A 3DHCA 4ZO3A 4EYLA 4NQ4A 3Q6VA 4BZ3A 3SBLA 5ACTA 3TP9A 2I7TA 3KL7A 4C1CA 4DIKA 4Z5YA 3PY6A 4EFZA 4U4LA 3VQZA 4YSKA 3T9MA 2YNWA 1L9YA 2VW8A 4ZNBA 3F9OA 3KNRA 2BG7A 2BG8A 4TZFA 5HH5A 2FU6A 1VGNA 1WRAA 1JJTA 2BFKA 5HISA 2BFLA 4Z67A 3SRXA 5ACVA 2HB9A 2QINA 3BC2A 2QJSA 2WHGA 1WUPA 4RAWA 5AYAA 4GYQA 5KIKA 2YNUA 2FHXB 2M5CA 1QH5A 2QEDA 1X8GA 2ZNBA 3BK1A 3KNSA 5B15A 2GFKA 3JXPA 4NQ5A 3QH8A 1P9EA 3X2ZA 3I0VA 2ZZIA 4UBQA 1X8IA 2AIOA 3AF6A 4LE6A 4DILA 2Y87A 5FQCA
chains in the Genus database with same CATH superfamily
5IQKA 3H3EA 2P1EA 3FCZA 4AX1B 4XWTA 2NYPA 3SW3A 4JO0A 5EWAA 2NZEA 1BVTA 4PDXA 2Q42A 3DH8A 4D1UA 3ZWFA 1A7TA 4F6HA 4D02A 4C1FA 2NZFA 4Z5ZA 3X2YA 5ACRA 1SMLA 4D1VA 4NQ6A 2ZO4A 3A4YA 3RKJA 5AEBA 3G1PA 2A7MA 2BIBA 2CBNA 2UYXA 5K4NA 1VMEA 4AWZA 2CG3A 5HH4A 1XM8A 4D1TA 2QDTA 3I14A 2WYLA 5ACWA 5EW0A 4FEKA 3WXCA 4Z60A 1KR3A 2Q0JA 2GFJA 2BFZB 3PG4A 3IE0A 3AF5A 3DHBA 3IE2A 4ZO2A 3RPCA 2FU7A 3VPEA 4UWOB 4EY2A 2CFUA 4ZEJA 4RAMA 5AXRA 3X2XA 4YSLA 2BTNA 3T3NA 1E5DA 4Z6XA 5EH9A 4P62A 3IE1A 5LS3A 5EV8A 5LE1A 1MQOA 5A87A 5HIQA 3DHAA 3BK2A 2BC2A 2CG2A 2Q0IA 4TYTA 4UAMA 1X8HA 4D1WA 3ADRA 3MD7A 1BMCA 2YNVA 4EYBA 2Q9UA 4AXHA 2BG8B 2GMNA 1ZKPA 1ZNBA 3IEMA 3SPUA 4HL2A 5LM6A 1DXKA 2Y8BA 4RM5A 1HLKA 4UWSB 1M2XA 3LVZA 5FQAA 4V0HA 4UWPB 2ZWRA 5DPXA 2FU9A 4J5HA 4BP0A 2YHEA 1YCHA 2YNTA 1KO3A 3I15A 4H0DA 4Z7RA 5EHTA 2BR6A 1ZTCA 1WUOA 4YSBA 4UA4A 5K0WA 4TZEA 3IDZA 4FSBA 5ACXA 4C09A 2YZ3A 5LSCA 2BG6A 4XUKA 2BFZA 2I7XA 4C1EA 2E7YA 4FR7A 3FAIA 4C1HA 2OHHA 1JT1A 4TZBA 2P97A 2WYMC 5ACPA 3S0ZA 1K07A 4RL2A 1XTOA 1VJNA 4O98A 4F6ZA 5K4MA 3SFPA 2BMIA 4NURA 4C1GA 3ZQ4A 5LLDA 4HKYA 2OHIA 3IELA 5A0VA 2XF4A 5AXOA 2P18A 5B1UA 4TZ9A 2I7VA 3AJ3A 4AX0B 2FU8A 5B3RA 2FHXA 3IOGA 1JJEA 1BC2A 2WRSA 1WW1A 5EV6A 5K4KA 2QDSA 4GCWA 5EVKA 3ZR9A 1QH3A 5HIPA 2P4ZA 4XWWA 5LCHA 4GYUA 5LCFA 3T3OA 5LMCA 4TYFA 4C1DA 4CHLA 4RBSA 2FK6A 2AZ4A 5EVBA 4WD6A 5EVDA 2NXAA 3I11A 5LCAA 2WYMA 4UWRB 5FQBA 4AD9A 1YCGA 2OHJA 2GKLA 2XR1A 2BG2A 4NQ2A 2FM6A 2YCBA 5HH6A 3ZNBA 4KEQA 4EYFA 5ACUA 5HIOA 4J5FA 3X30A 2M5DA 5AHRA 4EXSA 3SD9A 3IOFA 4RL0A 5A0TA 2H6AA 4B87A 2YNVB 2BGAA 2DKFA 1KO2A 3R2UA 1YCFA 3I13A 5ACSA 4EXYA 5KILA 1A8TA 4KEPA 1DDKA 4HL1A 2R2DA 5AHOA 2DOOA 5ACQA 1Y44A 3IEKA 3BV6A 3PY5A 3L6NA 4AWYB 4PVOA 5AIJA 4PVTA 3P2UA 3ESHA 2YNTB 3RKKA 5AJLA 5A5ZA 2GCUA 2Y8AA 1DD6A 3DHCA 4ZO3A 4EYLA 4NQ4A 3Q6VA 4BZ3A 3SBLA 5ACTA 3TP9A 2I7TA 3KL7A 4C1CA 4DIKA 4Z5YA 3PY6A 4EFZA 4U4LA 3VQZA 4YSKA 3T9MA 2YNWA 1L9YA 2VW8A 4ZNBA 3F9OA 3KNRA 2BG7A 2BG8A 4TZFA 5HH5A 2FU6A 1VGNA 1WRAA 1JJTA 2BFKA 5HISA 2BFLA 4Z67A 3SRXA 5ACVA 2HB9A 2QINA 3BC2A 2QJSA 2WHGA 1WUPA 4RAWA 5AYAA 4GYQA 5KIKA 2YNUA 2FHXB 2M5CA 1QH5A 2QEDA 1X8GA 2ZNBA 3BK1A 3KNSA 5B15A 2GFKA 3JXPA 4NQ5A 3QH8A 1P9EA 3X2ZA 3I0VA 2ZZIA 4UBQA 1X8IA 2AIOA 5A23A 3AF6A 4LE6A 4DILA 2CFZA 2Y87A 4AV7A 5FQCA
chains in the Genus database with same CATH topology
5IQKA 3H3EA 2P1EA 3FCZA 4AX1B 4XWTA 2NYPA 3SW3A 4JO0A 5EWAA 2NZEA 1BVTA 2Q42A 3DH8A 4D1UA 3ZWFA 1A7TA 4F6HA 4D02A 4C1FA 2NZFA 4Z5ZA 3X2YA 5ACRA 1SMLA 4D1VA 4NQ6A 2ZO4A 3A4YA 3RKJA 5AEBA 3G1PA 2A7MA 2BIBA 2CBNA 2UYXA 5K4NA 1VMEA 4AWZA 5HH4A 1XM8A 4D1TA 2QDTA 3I14A 2WYLA 5ACWA 5EW0A 4FEKA 3WXCA 4Z60A 1KR3A 2Q0JA 2GFJA 2BFZB 3PG4A 3IE0A 3AF5A 3DHBA 3IE2A 4ZO2A 3RPCA 2FU7A 3VPEA 4UWOB 4EY2A 4ZEJA 4RAMA 5AXRA 3X2XA 4YSLA 2BTNA 3T3NA 1E5DA 4Z6XA 5EH9A 4P62A 3IE1A 5LS3A 5EV8A 5LE1A 1MQOA 5A87A 5HIQA 3DHAA 3BK2A 2BC2A 2Q0IA 4TYTA 4UAMA 1X8HA 4D1WA 3ADRA 3MD7A 1BMCA 2YNVA 4EYBA 2Q9UA 2BG8B 2GMNA 1ZKPA 1ZNBA 3IEMA 3SPUA 4HL2A 5LM6A 1DXKA 2Y8BA 4RM5A 1HLKA 4UWSB 1M2XA 3LVZA 5FQAA 4V0HA 4UWPB 2ZWRA 5DPXA 2FU9A 4J5HA 4BP0A 1YCHA 2YNTA 1KO3A 3I15A 4H0DA 4Z7RA 5EHTA 2BR6A 1ZTCA 1WUOA 4YSBA 4UA4A 5K0WA 4TZEA 3IDZA 4FSBA 5ACXA 4C09A 2YZ3A 5LSCA 2BG6A 4XUKA 2BFZA 2I7XA 4C1EA 2E7YA 4FR7A 3FAIA 4C1HA 2OHHA 1JT1A 4TZBA 2P97A 2WYMC 5ACPA 3S0ZA 1K07A 4RL2A 1XTOA 1VJNA 4O98A 4F6ZA 5K4MA 3SFPA 2BMIA 4C1GA 3ZQ4A 5LLDA 4HKYA 2OHIA 3IELA 5A0VA 2XF4A 5AXOA 2P18A 5B1UA 4TZ9A 2I7VA 3AJ3A 4AX0B 2FU8A 5B3RA 2FHXA 3IOGA 1JJEA 1BC2A 2WRSA 1WW1A 5EV6A 5K4KA 2QDSA 4GCWA 5EVKA 3ZR9A 1QH3A 5HIPA 2P4ZA 4XWWA 5LCHA 4GYUA 5LCFA 3T3OA 5LMCA 4TYFA 4C1DA 4CHLA 4RBSA 2FK6A 2AZ4A 5EVBA 4WD6A 5EVDA 2NXAA 3I11A 5LCAA 2WYMA 4UWRB 5FQBA 4AD9A 1YCGA 2OHJA 2GKLA 2XR1A 2BG2A 4NQ2A 2FM6A 2YCBA 5HH6A 3ZNBA 4KEQA 4EYFA 5ACUA 5HIOA 4J5FA 3X30A 2M5DA 5AHRA 4EXSA 3SD9A 3IOFA 4RL0A 5A0TA 2H6AA 4B87A 2YNVB 2BGAA 2DKFA 1KO2A 3R2UA 1YCFA 3I13A 5ACSA 4EXYA 5KILA 1A8TA 4KEPA 1DDKA 4HL1A 2R2DA 5AHOA 2DOOA 5ACQA 1Y44A 3IEKA 3BV6A 3PY5A 3L6NA 4AWYB 4PVOA 4PVTA 3P2UA 3ESHA 2YNTB 3RKKA 5A5ZA 2GCUA 2Y8AA 1DD6A 3DHCA 4ZO3A 4EYLA 4NQ4A 3Q6VA 4BZ3A 3SBLA 5ACTA 3TP9A 2I7TA 3KL7A 4C1CA 4DIKA 4Z5YA 3PY6A 4EFZA 4U4LA 3VQZA 4YSKA 3T9MA 2YNWA 1L9YA 2VW8A 4ZNBA 3F9OA 3KNRA 2BG7A 2BG8A 4TZFA 5HH5A 2FU6A 1VGNA 1WRAA 1JJTA 2BFKA 5HISA 2BFLA 4Z67A 3SRXA 5ACVA 2HB9A 2QINA 3BC2A 2QJSA 2WHGA 1WUPA 4RAWA 5AYAA 4GYQA 5KIKA 2YNUA 2FHXB 2M5CA 1QH5A 2QEDA 1X8GA 2ZNBA 3BK1A 3KNSA 5B15A 2GFKA 3JXPA 4NQ5A 3QH8A 1P9EA 3X2ZA 3I0VA 2ZZIA 4UBQA 1X8IA 2AIOA 3AF6A 4LE6A 4DILA 2Y87A 5FQCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IQK A;  3H3E A;  2P1E A;  3FCZ A;  4AX1 B;  4XWT A;  2NYP A;  3SW3 A;  4JO0 A;  5EWA A;  2NZE A;  1BVT A;  2Q42 A;  3DH8 A;  4D1U A;  3ZWF A;  1A7T A;  4F6H A;  4D02 A;  4C1F A;  2NZF A;  4Z5Z A;  3X2Y A;  5ACR A;  1SML A;  4D1V A;  4NQ6 A;  2ZO4 A;  3A4Y A;  3RKJ A;  5AEB A;  3G1P A;  2A7M A;  2BIB A;  2CBN A;  2UYX A;  5K4N A;  1VME A;  4AWZ A;  5HH4 A;  1XM8 A;  4D1T A;  2QDT A;  3I14 A;  2WYL A;  5ACW A;  5EW0 A;  4FEK A;  3WXC A;  4Z60 A;  1KR3 A;  2Q0J A;  2GFJ A;  2BFZ B;  3PG4 A;  3IE0 A;  3AF5 A;  3DHB A;  3IE2 A;  4ZO2 A;  3RPC A;  2FU7 A;  3VPE A;  4UWO B;  4EY2 A;  4ZEJ A;  4RAM A;  5AXR A;  3X2X A;  4YSL A;  2BTN A;  3T3N A;  1E5D A;  4Z6X A;  5EH9 A;  4P62 A;  3IE1 A;  5LS3 A;  5EV8 A;  5LE1 A;  1MQO A;  5A87 A;  5HIQ A;  3DHA A;  3BK2 A;  2BC2 A;  2Q0I A;  4TYT A;  4UAM A;  1X8H A;  4D1W A;  3ADR A;  3MD7 A;  1BMC A;  2YNV A;  4EYB A;  2Q9U A;  2BG8 B;  2GMN A;  1ZKP A;  1ZNB A;  3IEM A;  3SPU A;  4HL2 A;  5LM6 A;  1DXK A;  2Y8B A;  4RM5 A;  1HLK A;  4UWS B;  1M2X A;  3LVZ A;  5FQA A;  4V0H A;  4UWP B;  2ZWR A;  5DPX A;  2FU9 A;  4J5H A;  4BP0 A;  1YCH A;  2YNT A;  1KO3 A;  3I15 A;  4H0D A;  4Z7R A;  5EHT A;  2BR6 A;  1ZTC A;  1WUO A;  4YSB A;  4UA4 A;  5K0W A;  4TZE A;  3IDZ A;  4FSB A;  5ACX A;  4C09 A;  2YZ3 A;  5LSC A;  2BG6 A;  4XUK A;  2BFZ A;  2I7X A;  4C1E A;  2E7Y A;  4FR7 A;  3FAI A;  4C1H A;  2OHH A;  1JT1 A;  4TZB A;  2P97 A;  2WYM C;  5ACP A;  3S0Z A;  1K07 A;  4RL2 A;  1XTO A;  1VJN A;  4O98 A;  4F6Z A;  5K4M A;  3SFP A;  2BMI A;  4C1G A;  3ZQ4 A;  5LLD A;  4HKY A;  2OHI A;  3IEL A;  5A0V A;  2XF4 A;  5AXO A;  2P18 A;  5B1U A;  4TZ9 A;  2I7V A;  3AJ3 A;  4AX0 B;  2FU8 A;  5B3R A;  2FHX A;  3IOG A;  1JJE A;  1BC2 A;  2WRS A;  1WW1 A;  5EV6 A;  5K4K A;  2QDS A;  4GCW A;  5EVK A;  3ZR9 A;  1QH3 A;  5HIP A;  2P4Z A;  4XWW A;  5LCH A;  4GYU A;  5LCF A;  3T3O A;  5LMC A;  4TYF A;  4C1D A;  4CHL A;  4RBS A;  2FK6 A;  2AZ4 A;  5EVB A;  4WD6 A;  5EVD A;  2NXA A;  3I11 A;  5LCA A;  2WYM A;  4UWR B;  5FQB A;  4AD9 A;  1YCG A;  2OHJ A;  2GKL A;  2XR1 A;  2BG2 A;  4NQ2 A;  2FM6 A;  2YCB A;  5HH6 A;  3ZNB A;  4KEQ A;  4EYF A;  5ACU A;  5HIO A;  4J5F A;  3X30 A;  2M5D A;  5AHR A;  4EXS A;  3SD9 A;  3IOF A;  4RL0 A;  5A0T A;  2H6A A;  4B87 A;  2YNV B;  2BGA A;  2DKF A;  1KO2 A;  3R2U A;  1YCF A;  3I13 A;  5ACS A;  4EXY A;  5KIL A;  1A8T A;  4KEP A;  1DDK A;  4HL1 A;  2R2D A;  5AHO A;  2DOO A;  5ACQ A;  1Y44 A;  3IEK A;  3BV6 A;  3PY5 A;  3L6N A;  4AWY B;  4PVO A;  4PVT A;  3P2U A;  3ESH A;  2YNT B;  3RKK A;  5A5Z A;  2GCU A;  2Y8A A;  1DD6 A;  3DHC A;  4ZO3 A;  4EYL A;  4NQ4 A;  3Q6V A;  4BZ3 A;  3SBL A;  5ACT A;  3TP9 A;  2I7T A;  3KL7 A;  4C1C A;  4DIK A;  4Z5Y A;  3PY6 A;  4EFZ A;  4U4L A;  3VQZ A;  4YSK A;  3T9M A;  2YNW A;  1L9Y A;  2VW8 A;  4ZNB A;  3F9O A;  3KNR A;  2BG7 A;  2BG8 A;  4TZF A;  5HH5 A;  2FU6 A;  1VGN A;  1WRA A;  1JJT A;  2BFK A;  5HIS A;  2BFL A;  4Z67 A;  3SRX A;  5ACV A;  2HB9 A;  2QIN A;  3BC2 A;  2QJS A;  2WHG A;  1WUP A;  4RAW A;  5AYA A;  4GYQ A;  5KIK A;  2YNU A;  2FHX B;  2M5C A;  1QH5 A;  2QED A;  1X8G A;  2ZNB A;  3BK1 A;  3KNS A;  5B15 A;  2GFK A;  3JXP A;  4NQ5 A;  3QH8 A;  1P9E A;  3X2Z A;  3I0V A;  2ZZI A;  4UBQ A;  1X8I A;  2AIO A;  3AF6 A;  4LE6 A;  4DIL A;  2Y87 A;  5FQC A; 
#chains in the Genus database with same CATH topology
 5IQK A;  3H3E A;  2P1E A;  3FCZ A;  4AX1 B;  4XWT A;  2NYP A;  3SW3 A;  4JO0 A;  5EWA A;  2NZE A;  1BVT A;  4PDX A;  2Q42 A;  3DH8 A;  4D1U A;  3ZWF A;  1A7T A;  4F6H A;  4D02 A;  4C1F A;  2NZF A;  4Z5Z A;  3X2Y A;  5ACR A;  1SML A;  4D1V A;  4NQ6 A;  2ZO4 A;  3A4Y A;  3RKJ A;  5AEB A;  3G1P A;  2A7M A;  2BIB A;  2CBN A;  2UYX A;  5K4N A;  1VME A;  4AWZ A;  2CG3 A;  5HH4 A;  1XM8 A;  4D1T A;  2QDT A;  3I14 A;  2WYL A;  5ACW A;  5EW0 A;  4FEK A;  3WXC A;  4Z60 A;  1KR3 A;  2Q0J A;  2GFJ A;  2BFZ B;  3PG4 A;  3IE0 A;  3AF5 A;  3DHB A;  3IE2 A;  4ZO2 A;  3RPC A;  2FU7 A;  3VPE A;  4UWO B;  4EY2 A;  2CFU A;  4ZEJ A;  4RAM A;  5AXR A;  3X2X A;  4YSL A;  2BTN A;  3T3N A;  1E5D A;  4Z6X A;  5EH9 A;  4P62 A;  3IE1 A;  5LS3 A;  5EV8 A;  5LE1 A;  1MQO A;  5A87 A;  5HIQ A;  3DHA A;  3BK2 A;  2BC2 A;  2CG2 A;  2Q0I A;  4TYT A;  4UAM A;  1X8H A;  4D1W A;  3ADR A;  3MD7 A;  1BMC A;  2YNV A;  4EYB A;  2Q9U A;  4AXH A;  2BG8 B;  2GMN A;  1ZKP A;  1ZNB A;  3IEM A;  3SPU A;  4HL2 A;  5LM6 A;  1DXK A;  2Y8B A;  4RM5 A;  1HLK A;  4UWS B;  1M2X A;  3LVZ A;  5FQA A;  4V0H A;  4UWP B;  2ZWR A;  5DPX A;  2FU9 A;  4J5H A;  4BP0 A;  2YHE A;  1YCH A;  2YNT A;  1KO3 A;  3I15 A;  4H0D A;  4Z7R A;  5EHT A;  2BR6 A;  1ZTC A;  1WUO A;  4YSB A;  4UA4 A;  5K0W A;  4TZE A;  3IDZ A;  4FSB A;  5ACX A;  4C09 A;  2YZ3 A;  5LSC A;  2BG6 A;  4XUK A;  2BFZ A;  2I7X A;  4C1E A;  2E7Y A;  4FR7 A;  3FAI A;  4C1H A;  2OHH A;  1JT1 A;  4TZB A;  2P97 A;  2WYM C;  5ACP A;  3S0Z A;  1K07 A;  4RL2 A;  1XTO A;  1VJN A;  4O98 A;  4F6Z A;  5K4M A;  3SFP A;  2BMI A;  4NUR A;  4C1G A;  3ZQ4 A;  5LLD A;  4HKY A;  2OHI A;  3IEL A;  5A0V A;  2XF4 A;  5AXO A;  2P18 A;  5B1U A;  4TZ9 A;  2I7V A;  3AJ3 A;  4AX0 B;  2FU8 A;  5B3R A;  2FHX A;  3IOG A;  1JJE A;  1BC2 A;  2WRS A;  1WW1 A;  5EV6 A;  5K4K A;  2QDS A;  4GCW A;  5EVK A;  3ZR9 A;  1QH3 A;  5HIP A;  2P4Z A;  4XWW A;  5LCH A;  4GYU A;  5LCF A;  3T3O A;  5LMC A;  4TYF A;  4C1D A;  4CHL A;  4RBS A;  2FK6 A;  2AZ4 A;  5EVB A;  4WD6 A;  5EVD A;  2NXA A;  3I11 A;  5LCA A;  2WYM A;  4UWR B;  5FQB A;  4AD9 A;  1YCG A;  2OHJ A;  2GKL A;  2XR1 A;  2BG2 A;  4NQ2 A;  2FM6 A;  2YCB A;  5HH6 A;  3ZNB A;  4KEQ A;  4EYF A;  5ACU A;  5HIO A;  4J5F A;  3X30 A;  2M5D A;  5AHR A;  4EXS A;  3SD9 A;  3IOF A;  4RL0 A;  5A0T A;  2H6A A;  4B87 A;  2YNV B;  2BGA A;  2DKF A;  1KO2 A;  3R2U A;  1YCF A;  3I13 A;  5ACS A;  4EXY A;  5KIL A;  1A8T A;  4KEP A;  1DDK A;  4HL1 A;  2R2D A;  5AHO A;  2DOO A;  5ACQ A;  1Y44 A;  3IEK A;  3BV6 A;  3PY5 A;  3L6N A;  4AWY B;  4PVO A;  5AIJ A;  4PVT A;  3P2U A;  3ESH A;  2YNT B;  3RKK A;  5AJL A;  5A5Z A;  2GCU A;  2Y8A A;  1DD6 A;  3DHC A;  4ZO3 A;  4EYL A;  4NQ4 A;  3Q6V A;  4BZ3 A;  3SBL A;  5ACT A;  3TP9 A;  2I7T A;  3KL7 A;  4C1C A;  4DIK A;  4Z5Y A;  3PY6 A;  4EFZ A;  4U4L A;  3VQZ A;  4YSK A;  3T9M A;  2YNW A;  1L9Y A;  2VW8 A;  4ZNB A;  3F9O A;  3KNR A;  2BG7 A;  2BG8 A;  4TZF A;  5HH5 A;  2FU6 A;  1VGN A;  1WRA A;  1JJT A;  2BFK A;  5HIS A;  2BFL A;  4Z67 A;  3SRX A;  5ACV A;  2HB9 A;  2QIN A;  3BC2 A;  2QJS A;  2WHG A;  1WUP A;  4RAW A;  5AYA A;  4GYQ A;  5KIK A;  2YNU A;  2FHX B;  2M5C A;  1QH5 A;  2QED A;  1X8G A;  2ZNB A;  3BK1 A;  3KNS A;  5B15 A;  2GFK A;  3JXP A;  4NQ5 A;  3QH8 A;  1P9E A;  3X2Z A;  3I0V A;  2ZZI A;  4UBQ A;  1X8I A;  2AIO A;  5A23 A;  3AF6 A;  4LE6 A;  4DIL A;  2CFZ A;  2Y87 A;  4AV7 A;  5FQC A; 
#chains in the Genus database with same CATH homology
 5IQK A;  3H3E A;  2P1E A;  3FCZ A;  4AX1 B;  4XWT A;  2NYP A;  3SW3 A;  4JO0 A;  5EWA A;  2NZE A;  1BVT A;  2Q42 A;  3DH8 A;  4D1U A;  3ZWF A;  1A7T A;  4F6H A;  4D02 A;  4C1F A;  2NZF A;  4Z5Z A;  3X2Y A;  5ACR A;  1SML A;  4D1V A;  4NQ6 A;  2ZO4 A;  3A4Y A;  3RKJ A;  5AEB A;  3G1P A;  2A7M A;  2BIB A;  2CBN A;  2UYX A;  5K4N A;  1VME A;  4AWZ A;  5HH4 A;  1XM8 A;  4D1T A;  2QDT A;  3I14 A;  2WYL A;  5ACW A;  5EW0 A;  4FEK A;  3WXC A;  4Z60 A;  1KR3 A;  2Q0J A;  2GFJ A;  2BFZ B;  3PG4 A;  3IE0 A;  3AF5 A;  3DHB A;  3IE2 A;  4ZO2 A;  3RPC A;  2FU7 A;  3VPE A;  4UWO B;  4EY2 A;  4ZEJ A;  4RAM A;  5AXR A;  3X2X A;  4YSL A;  2BTN A;  3T3N A;  1E5D A;  4Z6X A;  5EH9 A;  4P62 A;  3IE1 A;  5LS3 A;  5EV8 A;  5LE1 A;  1MQO A;  5A87 A;  5HIQ A;  3DHA A;  3BK2 A;  2BC2 A;  2Q0I A;  4TYT A;  4UAM A;  1X8H A;  4D1W A;  3ADR A;  3MD7 A;  1BMC A;  2YNV A;  4EYB A;  2Q9U A;  2BG8 B;  2GMN A;  1ZKP A;  1ZNB A;  3IEM A;  3SPU A;  4HL2 A;  5LM6 A;  1DXK A;  2Y8B A;  4RM5 A;  1HLK A;  4UWS B;  1M2X A;  3LVZ A;  5FQA A;  4V0H A;  4UWP B;  2ZWR A;  5DPX A;  2FU9 A;  4J5H A;  4BP0 A;  1YCH A;  2YNT A;  1KO3 A;  3I15 A;  4H0D A;  4Z7R A;  5EHT A;  2BR6 A;  1ZTC A;  1WUO A;  4YSB A;  4UA4 A;  5K0W A;  4TZE A;  3IDZ A;  4FSB A;  5ACX A;  4C09 A;  2YZ3 A;  5LSC A;  2BG6 A;  4XUK A;  2BFZ A;  2I7X A;  4C1E A;  2E7Y A;  4FR7 A;  3FAI A;  4C1H A;  2OHH A;  1JT1 A;  4TZB A;  2P97 A;  2WYM C;  5ACP A;  3S0Z A;  1K07 A;  4RL2 A;  1XTO A;  1VJN A;  4O98 A;  4F6Z A;  5K4M A;  3SFP A;  2BMI A;  4C1G A;  3ZQ4 A;  5LLD A;  4HKY A;  2OHI A;  3IEL A;  5A0V A;  2XF4 A;  5AXO A;  2P18 A;  5B1U A;  4TZ9 A;  2I7V A;  3AJ3 A;  4AX0 B;  2FU8 A;  5B3R A;  2FHX A;  3IOG A;  1JJE A;  1BC2 A;  2WRS A;  1WW1 A;  5EV6 A;  5K4K A;  2QDS A;  4GCW A;  5EVK A;  3ZR9 A;  1QH3 A;  5HIP A;  2P4Z A;  4XWW A;  5LCH A;  4GYU A;  5LCF A;  3T3O A;  5LMC A;  4TYF A;  4C1D A;  4CHL A;  4RBS A;  2FK6 A;  2AZ4 A;  5EVB A;  4WD6 A;  5EVD A;  2NXA A;  3I11 A;  5LCA A;  2WYM A;  4UWR B;  5FQB A;  4AD9 A;  1YCG A;  2OHJ A;  2GKL A;  2XR1 A;  2BG2 A;  4NQ2 A;  2FM6 A;  2YCB A;  5HH6 A;  3ZNB A;  4KEQ A;  4EYF A;  5ACU A;  5HIO A;  4J5F A;  3X30 A;  2M5D A;  5AHR A;  4EXS A;  3SD9 A;  3IOF A;  4RL0 A;  5A0T A;  2H6A A;  4B87 A;  2YNV B;  2BGA A;  2DKF A;  1KO2 A;  3R2U A;  1YCF A;  3I13 A;  5ACS A;  4EXY A;  5KIL A;  1A8T A;  4KEP A;  1DDK A;  4HL1 A;  2R2D A;  5AHO A;  2DOO A;  5ACQ A;  1Y44 A;  3IEK A;  3BV6 A;  3PY5 A;  3L6N A;  4AWY B;  4PVO A;  4PVT A;  3P2U A;  3ESH A;  2YNT B;  3RKK A;  5A5Z A;  2GCU A;  2Y8A A;  1DD6 A;  3DHC A;  4ZO3 A;  4EYL A;  4NQ4 A;  3Q6V A;  4BZ3 A;  3SBL A;  5ACT A;  3TP9 A;  2I7T A;  3KL7 A;  4C1C A;  4DIK A;  4Z5Y A;  3PY6 A;  4EFZ A;  4U4L A;  3VQZ A;  4YSK A;  3T9M A;  2YNW A;  1L9Y A;  2VW8 A;  4ZNB A;  3F9O A;  3KNR A;  2BG7 A;  2BG8 A;  4TZF A;  5HH5 A;  2FU6 A;  1VGN A;  1WRA A;  1JJT A;  2BFK A;  5HIS A;  2BFL A;  4Z67 A;  3SRX A;  5ACV A;  2HB9 A;  2QIN A;  3BC2 A;  2QJS A;  2WHG A;  1WUP A;  4RAW A;  5AYA A;  4GYQ A;  5KIK A;  2YNU A;  2FHX B;  2M5C A;  1QH5 A;  2QED A;  1X8G A;  2ZNB A;  3BK1 A;  3KNS A;  5B15 A;  2GFK A;  3JXP A;  4NQ5 A;  3QH8 A;  1P9E A;  3X2Z A;  3I0V A;  2ZZI A;  4UBQ A;  1X8I A;  2AIO A;  3AF6 A;  4LE6 A;  4DIL A;  2Y87 A;  5FQC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...