1JJEA

Imp-1 metallo beta-lactamase from pseudomonas aeruginosa in complex with a biaryl succinic acid inhibitor (11)
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
220
structure length
220
Chain Sequence
SLPDLKIEKLDEGVYVHTSFEEVNGWGVVPKHGLVVLVNAEAYLIDTPFTAKDTEKLVTWFVERGYKIKGSISSHFHSDSTGGIEWLNSRSIPTYASELTNELLKKDGKVQATNSFSGVNYWLVKNKIEVFYPGPGHTPDNVVVWLPERKILFGGCFIKPYGLGNLGDANIEAWPKSAKLLKSKYGKAKLVVPSHSEVGDASLLKLTLEQAVKGLNESKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords IMP-1 METALLO BETA-LACTAMASE
publication title Succinic acids as potent inhibitors of plasmid-borne IMP-1 metallo-beta-lactamase.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 69
structure length 220
sequence length 220
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2001-07-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 1jjeA00
2I7TA 2M5CA 3FAIA 2FU8A 3BV6A 1XM8A 4TZEA 5LMCA 2ZO4A 1X8IA 2GKLA 3ESHA 4XUKA 1VMEA 4RM5A 3RKKA 1ZKPA 3VPEA 1BC2A 1JT1A 4JO0A 2Q42A 1JJEA 4NQ4A 4EXYA 3SW3A 2GMNA 5HH4A 4EXSA 4LE6A 3R2UA 5EW0A 2WYMA 5LCAA 4C1GA 5EH9A 5HIOA 3L6NA 3IOGA 5ACQA 3JXPA 2OHJA 1K07A 5ACSA 5ACVA 1KR3A 4V0HA 4AD9A 3IEMA 4ZNBA 4HL2A 4FSBA 5EVKA 3I14A 2NZFA 5KIKA 2DOOA 2WYLA 4FEKA 2BFZA 1A8TA 3PY6A 4RL2A 4UAMA 1XTOA 5EVDA 1VGNA 3RKJA 4C1FA 2P18A 3IELA 5LCFA 1QH5A 2BFZB 4D1UA 2HB9A 5A5ZA 1KO2A 2FU9A 5HIQA 4J5HA 3SFPA 2Q9UA 4WD6A 1M2XA 2BFKA 2BG8A 2Y87A 3T9MA 4KEQA 4TZFA 4HKYA 2CBNA 4H0DA 4D1TA 4C1DA 2BG8B 5ACPA 2E7YA 1Y44A 2YNWA 2I7XA 3X2XA 2I7VA 3ZR9A 4XWTA 3IOFA 2M5DA 3QH8A 1WW1A 4GCWA 3WXCA 2BG7A 1ZNBA 4F6ZA 4EFZA 3AJ3A 2YNVB 2BG6A 2R2DA 1KO3A 1DD6A 3LVZA 4ZEJA 4AX1B 5EV8A 2GCUA 3VQZA 3IEKA 4U4LA 4YSLA 5LLDA 5AXRA 3G1PA 2GFKA 2P97A 4C1CA 4RBSA 4GYQA 2QINA 3MD7A 4YSKA 3FCZA 1BMCA 1DXKA 2DKFA 4BZ3A 3DHCA 2AIOA 4RAWA 5A0VA 3I11A 3IDZA 3RPCA 3T3NA 4ZO3A 3BC2A 5ACRA 2VW8A 4YSBA 3BK2A 4DILA 5ACTA 4UWOB 2FHXA 4CHLA 4AX0B 4EYBA 4PVOA 2QEDA 4RAMA 5AHOA 3SRXA 4NQ6A 5K0WA 4TYFA 1BVTA 5FQBA 1JJTA 5LCHA 3T3OA 2FHXB 1WRAA 2QJSA 5HH5A 3KNSA 4Z5YA 2BIBA 3IE1A 2OHHA 4TZBA 4TZ9A 4UBQA 2P4ZA 2BC2A 3TP9A 4UA4A 1YCGA 3A4YA 4UWPB 3DH8A 3KL7A 3BK1A 5B1UA 4F6HA 5ACUA 4UWSB 2YNTB 3SPUA 5K4NA 2NZEA 4GYUA 2YZ3A 2ZWRA 2WYMC 2FU6A 3H3EA 2YNVA 1MQOA 1YCHA 1X8HA 2GFJA 4NQ2A 1SMLA 5EV6A 3DHAA 4AWYB 1WUPA 4D02A 1A7TA 4Z67A 4P62A 3I13A 5B15A 3X30A 2BFLA 2NXAA 2ZNBA 1E5DA 4C1EA 3S0ZA 5B3RA 3Q6VA 5DPXA 5KILA 4Z6XA 5AYAA 2H6AA 3SBLA 4B87A 5EWAA 4FR7A 1L9YA 4D1WA 3P2UA 2WHGA 3PY5A 4Z7RA 1X8GA 5AHRA 1DDKA 5FQAA 5EVBA 3DHBA 2QDTA 2ZZIA 3KNRA 4D1VA 4TYTA 4C1HA 1HLKA 1YCFA 4HL1A 5AXOA 3ZQ4A 5IQKA 3I0VA 1P9EA 2Q0JA 5A0TA 2UYXA 4NQ5A 5K4MA 5ACXA 4EYLA 2Y8BA 4Z60A 4XWWA 5LS3A 5HH6A 3AF6A 3PG4A 4AWZA 4ZO2A 4J5FA 4PVTA 3SD9A 5HISA 2QDSA 4EYFA 2Y8AA 3F9OA 2WRSA 1VJNA 2BR6A 3AF5A 4UWRB 2YNTA 2Q0IA 2AZ4A 3I15A 2FM6A 5EHTA 5LE1A 2NYPA 2FK6A 2OHIA 3IE2A 2P1EA 3IE0A 5K4KA 1ZTCA 3ADRA 3ZWFA 2XF4A 2BG2A 1QH3A 3X2ZA 2BGAA 4KEPA 2BMIA 2YCBA 2BTNA 3ZNBA 2A7MA 2YNUA 4DIKA 4RL0A 5HIPA 3X2YA 5ACWA 5LM6A 5AEBA 4C09A 4O98A 5LSCA 2XR1A 1WUOA 5A87A 5FQCA 4BP0A 4Z5ZA 4EY2A 2FU7A
chains in the Genus database with same CATH superfamily
2I7TA 2M5CA 3FAIA 2FU8A 3BV6A 1XM8A 4TZEA 5LMCA 2ZO4A 1X8IA 2GKLA 3ESHA 4XUKA 1VMEA 4RM5A 3RKKA 1ZKPA 3VPEA 1BC2A 1JT1A 4JO0A 2Q42A 1JJEA 4NQ4A 4EXYA 3SW3A 2GMNA 5HH4A 4EXSA 4LE6A 3R2UA 5EW0A 2WYMA 5LCAA 4C1GA 5EH9A 5HIOA 2CG3A 3L6NA 3IOGA 5ACQA 3JXPA 2OHJA 1K07A 5ACSA 5ACVA 1KR3A 4V0HA 4AD9A 3IEMA 4ZNBA 4HL2A 4FSBA 5EVKA 3I14A 2NZFA 5KIKA 2DOOA 2WYLA 4FEKA 2BFZA 4AV7A 1A8TA 3PY6A 4RL2A 4UAMA 1XTOA 5EVDA 1VGNA 3RKJA 4C1FA 2P18A 3IELA 5LCFA 1QH5A 2BFZB 4D1UA 2HB9A 5A5ZA 1KO2A 2FU9A 5HIQA 4J5HA 3SFPA 2Q9UA 4WD6A 4PDXA 1M2XA 2BFKA 2BG8A 2Y87A 3T9MA 4KEQA 4TZFA 4HKYA 2CBNA 4H0DA 4D1TA 4C1DA 2BG8B 5ACPA 2E7YA 1Y44A 2YNWA 2I7XA 3X2XA 2I7VA 3ZR9A 4XWTA 3IOFA 2M5DA 3QH8A 1WW1A 4GCWA 3WXCA 2BG7A 1ZNBA 4F6ZA 4EFZA 3AJ3A 2YNVB 2BG6A 2R2DA 1KO3A 1DD6A 3LVZA 4ZEJA 4AX1B 5EV8A 2GCUA 3VQZA 3IEKA 4U4LA 4YSLA 5LLDA 5AXRA 4AXHA 3G1PA 2GFKA 2P97A 4C1CA 4RBSA 4GYQA 2QINA 3MD7A 4YSKA 3FCZA 1BMCA 1DXKA 2DKFA 4BZ3A 3DHCA 2AIOA 4RAWA 5A0VA 3I11A 3IDZA 3RPCA 3T3NA 4ZO3A 3BC2A 5ACRA 2VW8A 4YSBA 3BK2A 4DILA 5ACTA 4UWOB 2FHXA 4CHLA 4AX0B 4EYBA 4PVOA 2QEDA 4RAMA 5AHOA 3SRXA 4NQ6A 5K0WA 4TYFA 1BVTA 5FQBA 1JJTA 5LCHA 3T3OA 2FHXB 1WRAA 2QJSA 5HH5A 3KNSA 4Z5YA 2BIBA 3IE1A 2OHHA 4TZBA 4TZ9A 4UBQA 5A23A 2P4ZA 2BC2A 3TP9A 4UA4A 1YCGA 3A4YA 4UWPB 3DH8A 3KL7A 3BK1A 5B1UA 4F6HA 5ACUA 4UWSB 2YNTB 2CFUA 3SPUA 5K4NA 2NZEA 4GYUA 4NURA 2YZ3A 2ZWRA 2WYMC 2FU6A 3H3EA 2YNVA 1MQOA 1YCHA 1X8HA 2GFJA 4NQ2A 1SMLA 5EV6A 3DHAA 4AWYB 1WUPA 1A7TA 4Z67A 4D02A 4P62A 3I13A 5B15A 3X30A 2BFLA 2NXAA 2ZNBA 1E5DA 4C1EA 3S0ZA 5B3RA 3Q6VA 5DPXA 5KILA 4Z6XA 5AYAA 2H6AA 3SBLA 4B87A 5EWAA 4FR7A 1L9YA 4D1WA 3P2UA 2WHGA 3PY5A 4Z7RA 1X8GA 5AHRA 1DDKA 5FQAA 5EVBA 3DHBA 2QDTA 2ZZIA 3KNRA 4D1VA 4TYTA 5AIJA 4C1HA 1HLKA 1YCFA 4HL1A 5AXOA 3ZQ4A 5IQKA 3I0VA 1P9EA 2Q0JA 5A0TA 2UYXA 4NQ5A 5K4MA 5ACXA 4EYLA 2Y8BA 4Z60A 4XWWA 5LS3A 5HH6A 3AF6A 3PG4A 2CFZA 4AWZA 4ZO2A 4J5FA 4PVTA 3SD9A 5HISA 2QDSA 4EYFA 2Y8AA 3F9OA 2WRSA 1VJNA 2BR6A 3AF5A 4UWRB 2YNTA 2Q0IA 2AZ4A 3I15A 2FM6A 5EHTA 5LE1A 2NYPA 2FK6A 2OHIA 3IE2A 2P1EA 3IE0A 5K4KA 1ZTCA 3ADRA 3ZWFA 2XF4A 2BG2A 1QH3A 3X2ZA 2BGAA 2CG2A 4KEPA 2BMIA 2YHEA 2YCBA 2BTNA 3ZNBA 2A7MA 2YNUA 4DIKA 4RL0A 5HIPA 3X2YA 5ACWA 5AJLA 5LM6A 5AEBA 4C09A 4O98A 5LSCA 2XR1A 1WUOA 5A87A 5FQCA 4BP0A 4Z5ZA 4EY2A 2FU7A
chains in the Genus database with same CATH topology
2I7TA 2M5CA 3FAIA 2FU8A 3BV6A 1XM8A 4TZEA 5LMCA 2ZO4A 1X8IA 2GKLA 3ESHA 4XUKA 1VMEA 4RM5A 3RKKA 1ZKPA 3VPEA 1BC2A 1JT1A 4JO0A 2Q42A 1JJEA 4NQ4A 4EXYA 3SW3A 2GMNA 5HH4A 4EXSA 4LE6A 3R2UA 5EW0A 2WYMA 5LCAA 4C1GA 5EH9A 5HIOA 3L6NA 3IOGA 5ACQA 3JXPA 2OHJA 1K07A 5ACSA 5ACVA 1KR3A 4V0HA 4AD9A 3IEMA 4ZNBA 4HL2A 4FSBA 5EVKA 3I14A 2NZFA 5KIKA 2DOOA 2WYLA 4FEKA 2BFZA 1A8TA 3PY6A 4RL2A 4UAMA 1XTOA 5EVDA 1VGNA 3RKJA 4C1FA 2P18A 3IELA 5LCFA 1QH5A 2BFZB 4D1UA 2HB9A 5A5ZA 1KO2A 2FU9A 5HIQA 4J5HA 3SFPA 2Q9UA 4WD6A 1M2XA 2BFKA 2BG8A 2Y87A 3T9MA 4KEQA 4TZFA 4HKYA 2CBNA 4H0DA 4D1TA 4C1DA 2BG8B 5ACPA 2E7YA 1Y44A 2YNWA 2I7XA 3X2XA 2I7VA 3ZR9A 4XWTA 3IOFA 2M5DA 3QH8A 1WW1A 4GCWA 3WXCA 2BG7A 1ZNBA 4F6ZA 4EFZA 3AJ3A 2YNVB 2BG6A 2R2DA 1KO3A 1DD6A 3LVZA 4ZEJA 4AX1B 5EV8A 2GCUA 3VQZA 3IEKA 4U4LA 4YSLA 5LLDA 5AXRA 3G1PA 2GFKA 2P97A 4C1CA 4RBSA 4GYQA 2QINA 3MD7A 4YSKA 3FCZA 1BMCA 1DXKA 2DKFA 4BZ3A 3DHCA 2AIOA 4RAWA 5A0VA 3I11A 3IDZA 3RPCA 3T3NA 4ZO3A 3BC2A 5ACRA 2VW8A 4YSBA 3BK2A 4DILA 5ACTA 4UWOB 2FHXA 4CHLA 4AX0B 4EYBA 4PVOA 2QEDA 4RAMA 5AHOA 3SRXA 4NQ6A 5K0WA 4TYFA 1BVTA 5FQBA 1JJTA 5LCHA 3T3OA 2FHXB 1WRAA 2QJSA 5HH5A 3KNSA 4Z5YA 2BIBA 3IE1A 2OHHA 4TZBA 4TZ9A 4UBQA 2P4ZA 2BC2A 3TP9A 4UA4A 1YCGA 3A4YA 4UWPB 3DH8A 3KL7A 3BK1A 5B1UA 4F6HA 5ACUA 4UWSB 2YNTB 3SPUA 5K4NA 2NZEA 4GYUA 2YZ3A 2ZWRA 2WYMC 2FU6A 3H3EA 2YNVA 1MQOA 1YCHA 1X8HA 2GFJA 4NQ2A 1SMLA 5EV6A 3DHAA 4AWYB 1WUPA 4D02A 1A7TA 4Z67A 4P62A 3I13A 5B15A 3X30A 2BFLA 2NXAA 2ZNBA 1E5DA 4C1EA 3S0ZA 5B3RA 3Q6VA 5DPXA 5KILA 4Z6XA 5AYAA 2H6AA 3SBLA 4B87A 5EWAA 4FR7A 1L9YA 4D1WA 3P2UA 2WHGA 3PY5A 4Z7RA 1X8GA 5AHRA 1DDKA 5FQAA 5EVBA 3DHBA 2QDTA 2ZZIA 3KNRA 4D1VA 4TYTA 4C1HA 1HLKA 1YCFA 4HL1A 5AXOA 3ZQ4A 5IQKA 3I0VA 1P9EA 2Q0JA 5A0TA 2UYXA 4NQ5A 5K4MA 5ACXA 4EYLA 2Y8BA 4Z60A 4XWWA 5LS3A 5HH6A 3AF6A 3PG4A 4AWZA 4ZO2A 4J5FA 4PVTA 3SD9A 5HISA 2QDSA 4EYFA 2Y8AA 3F9OA 2WRSA 1VJNA 2BR6A 3AF5A 4UWRB 2YNTA 2Q0IA 2AZ4A 3I15A 2FM6A 5EHTA 5LE1A 2NYPA 2FK6A 2OHIA 3IE2A 2P1EA 3IE0A 5K4KA 1ZTCA 3ADRA 3ZWFA 2XF4A 2BG2A 1QH3A 3X2ZA 2BGAA 4KEPA 2BMIA 2YCBA 2BTNA 3ZNBA 2A7MA 2YNUA 4DIKA 4RL0A 5HIPA 3X2YA 5ACWA 5LM6A 5AEBA 4C09A 4O98A 5LSCA 2XR1A 1WUOA 5A87A 5FQCA 4BP0A 4Z5ZA 4EY2A 2FU7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I7T A;  2M5C A;  3FAI A;  2FU8 A;  3BV6 A;  1XM8 A;  4TZE A;  5LMC A;  2ZO4 A;  1X8I A;  2GKL A;  3ESH A;  4XUK A;  1VME A;  4RM5 A;  3RKK A;  1ZKP A;  3VPE A;  1BC2 A;  1JT1 A;  4JO0 A;  2Q42 A;  1JJE A;  4NQ4 A;  4EXY A;  3SW3 A;  2GMN A;  5HH4 A;  4EXS A;  4LE6 A;  3R2U A;  5EW0 A;  2WYM A;  5LCA A;  4C1G A;  5EH9 A;  5HIO A;  3L6N A;  3IOG A;  5ACQ A;  3JXP A;  2OHJ A;  1K07 A;  5ACS A;  5ACV A;  1KR3 A;  4V0H A;  4AD9 A;  3IEM A;  4ZNB A;  4HL2 A;  4FSB A;  5EVK A;  3I14 A;  2NZF A;  5KIK A;  2DOO A;  2WYL A;  4FEK A;  2BFZ A;  1A8T A;  3PY6 A;  4RL2 A;  4UAM A;  1XTO A;  5EVD A;  1VGN A;  3RKJ A;  4C1F A;  2P18 A;  3IEL A;  5LCF A;  1QH5 A;  2BFZ B;  4D1U A;  2HB9 A;  5A5Z A;  1KO2 A;  2FU9 A;  5HIQ A;  4J5H A;  3SFP A;  2Q9U A;  4WD6 A;  1M2X A;  2BFK A;  2BG8 A;  2Y87 A;  3T9M A;  4KEQ A;  4TZF A;  4HKY A;  2CBN A;  4H0D A;  4D1T A;  4C1D A;  2BG8 B;  5ACP A;  2E7Y A;  1Y44 A;  2YNW A;  2I7X A;  3X2X A;  2I7V A;  3ZR9 A;  4XWT A;  3IOF A;  2M5D A;  3QH8 A;  1WW1 A;  4GCW A;  3WXC A;  2BG7 A;  1ZNB A;  4F6Z A;  4EFZ A;  3AJ3 A;  2YNV B;  2BG6 A;  2R2D A;  1KO3 A;  1DD6 A;  3LVZ A;  4ZEJ A;  4AX1 B;  5EV8 A;  2GCU A;  3VQZ A;  3IEK A;  4U4L A;  4YSL A;  5LLD A;  5AXR A;  3G1P A;  2GFK A;  2P97 A;  4C1C A;  4RBS A;  4GYQ A;  2QIN A;  3MD7 A;  4YSK A;  3FCZ A;  1BMC A;  1DXK A;  2DKF A;  4BZ3 A;  3DHC A;  2AIO A;  4RAW A;  5A0V A;  3I11 A;  3IDZ A;  3RPC A;  3T3N A;  4ZO3 A;  3BC2 A;  5ACR A;  2VW8 A;  4YSB A;  3BK2 A;  4DIL A;  5ACT A;  4UWO B;  2FHX A;  4CHL A;  4AX0 B;  4EYB A;  4PVO A;  2QED A;  4RAM A;  5AHO A;  3SRX A;  4NQ6 A;  5K0W A;  4TYF A;  1BVT A;  5FQB A;  1JJT A;  5LCH A;  3T3O A;  2FHX B;  1WRA A;  2QJS A;  5HH5 A;  3KNS A;  4Z5Y A;  2BIB A;  3IE1 A;  2OHH A;  4TZB A;  4TZ9 A;  4UBQ A;  2P4Z A;  2BC2 A;  3TP9 A;  4UA4 A;  1YCG A;  3A4Y A;  4UWP B;  3DH8 A;  3KL7 A;  3BK1 A;  5B1U A;  4F6H A;  5ACU A;  4UWS B;  2YNT B;  3SPU A;  5K4N A;  2NZE A;  4GYU A;  2YZ3 A;  2ZWR A;  2WYM C;  2FU6 A;  3H3E A;  2YNV A;  1MQO A;  1YCH A;  1X8H A;  2GFJ A;  4NQ2 A;  1SML A;  5EV6 A;  3DHA A;  4AWY B;  1WUP A;  4D02 A;  1A7T A;  4Z67 A;  4P62 A;  3I13 A;  5B15 A;  3X30 A;  2BFL A;  2NXA A;  2ZNB A;  1E5D A;  4C1E A;  3S0Z A;  5B3R A;  3Q6V A;  5DPX A;  5KIL A;  4Z6X A;  5AYA A;  2H6A A;  3SBL A;  4B87 A;  5EWA A;  4FR7 A;  1L9Y A;  4D1W A;  3P2U A;  2WHG A;  3PY5 A;  4Z7R A;  1X8G A;  5AHR A;  1DDK A;  5FQA A;  5EVB A;  3DHB A;  2QDT A;  2ZZI A;  3KNR A;  4D1V A;  4TYT A;  4C1H A;  1HLK A;  1YCF A;  4HL1 A;  5AXO A;  3ZQ4 A;  5IQK A;  3I0V A;  1P9E A;  2Q0J A;  5A0T A;  2UYX A;  4NQ5 A;  5K4M A;  5ACX A;  4EYL A;  2Y8B A;  4Z60 A;  4XWW A;  5LS3 A;  5HH6 A;  3AF6 A;  3PG4 A;  4AWZ A;  4ZO2 A;  4J5F A;  4PVT A;  3SD9 A;  5HIS A;  2QDS A;  4EYF A;  2Y8A A;  3F9O A;  2WRS A;  1VJN A;  2BR6 A;  3AF5 A;  4UWR B;  2YNT A;  2Q0I A;  2AZ4 A;  3I15 A;  2FM6 A;  5EHT A;  5LE1 A;  2NYP A;  2FK6 A;  2OHI A;  3IE2 A;  2P1E A;  3IE0 A;  5K4K A;  1ZTC A;  3ADR A;  3ZWF A;  2XF4 A;  2BG2 A;  1QH3 A;  3X2Z A;  2BGA A;  4KEP A;  2BMI A;  2YCB A;  2BTN A;  3ZNB A;  2A7M A;  2YNU A;  4DIK A;  4RL0 A;  5HIP A;  3X2Y A;  5ACW A;  5LM6 A;  5AEB A;  4C09 A;  4O98 A;  5LSC A;  2XR1 A;  1WUO A;  5A87 A;  5FQC A;  4BP0 A;  4Z5Z A;  4EY2 A;  2FU7 A; 
#chains in the Genus database with same CATH topology
 2I7T A;  2M5C A;  3FAI A;  2FU8 A;  3BV6 A;  1XM8 A;  4TZE A;  5LMC A;  2ZO4 A;  1X8I A;  2GKL A;  3ESH A;  4XUK A;  1VME A;  4RM5 A;  3RKK A;  1ZKP A;  3VPE A;  1BC2 A;  1JT1 A;  4JO0 A;  2Q42 A;  1JJE A;  4NQ4 A;  4EXY A;  3SW3 A;  2GMN A;  5HH4 A;  4EXS A;  4LE6 A;  3R2U A;  5EW0 A;  2WYM A;  5LCA A;  4C1G A;  5EH9 A;  5HIO A;  2CG3 A;  3L6N A;  3IOG A;  5ACQ A;  3JXP A;  2OHJ A;  1K07 A;  5ACS A;  5ACV A;  1KR3 A;  4V0H A;  4AD9 A;  3IEM A;  4ZNB A;  4HL2 A;  4FSB A;  5EVK A;  3I14 A;  2NZF A;  5KIK A;  2DOO A;  2WYL A;  4FEK A;  2BFZ A;  4AV7 A;  1A8T A;  3PY6 A;  4RL2 A;  4UAM A;  1XTO A;  5EVD A;  1VGN A;  3RKJ A;  4C1F A;  2P18 A;  3IEL A;  5LCF A;  1QH5 A;  2BFZ B;  4D1U A;  2HB9 A;  5A5Z A;  1KO2 A;  2FU9 A;  5HIQ A;  4J5H A;  3SFP A;  2Q9U A;  4WD6 A;  4PDX A;  1M2X A;  2BFK A;  2BG8 A;  2Y87 A;  3T9M A;  4KEQ A;  4TZF A;  4HKY A;  2CBN A;  4H0D A;  4D1T A;  4C1D A;  2BG8 B;  5ACP A;  2E7Y A;  1Y44 A;  2YNW A;  2I7X A;  3X2X A;  2I7V A;  3ZR9 A;  4XWT A;  3IOF A;  2M5D A;  3QH8 A;  1WW1 A;  4GCW A;  3WXC A;  2BG7 A;  1ZNB A;  4F6Z A;  4EFZ A;  3AJ3 A;  2YNV B;  2BG6 A;  2R2D A;  1KO3 A;  1DD6 A;  3LVZ A;  4ZEJ A;  4AX1 B;  5EV8 A;  2GCU A;  3VQZ A;  3IEK A;  4U4L A;  4YSL A;  5LLD A;  5AXR A;  4AXH A;  3G1P A;  2GFK A;  2P97 A;  4C1C A;  4RBS A;  4GYQ A;  2QIN A;  3MD7 A;  4YSK A;  3FCZ A;  1BMC A;  1DXK A;  2DKF A;  4BZ3 A;  3DHC A;  2AIO A;  4RAW A;  5A0V A;  3I11 A;  3IDZ A;  3RPC A;  3T3N A;  4ZO3 A;  3BC2 A;  5ACR A;  2VW8 A;  4YSB A;  3BK2 A;  4DIL A;  5ACT A;  4UWO B;  2FHX A;  4CHL A;  4AX0 B;  4EYB A;  4PVO A;  2QED A;  4RAM A;  5AHO A;  3SRX A;  4NQ6 A;  5K0W A;  4TYF A;  1BVT A;  5FQB A;  1JJT A;  5LCH A;  3T3O A;  2FHX B;  1WRA A;  2QJS A;  5HH5 A;  3KNS A;  4Z5Y A;  2BIB A;  3IE1 A;  2OHH A;  4TZB A;  4TZ9 A;  4UBQ A;  5A23 A;  2P4Z A;  2BC2 A;  3TP9 A;  4UA4 A;  1YCG A;  3A4Y A;  4UWP B;  3DH8 A;  3KL7 A;  3BK1 A;  5B1U A;  4F6H A;  5ACU A;  4UWS B;  2YNT B;  2CFU A;  3SPU A;  5K4N A;  2NZE A;  4GYU A;  4NUR A;  2YZ3 A;  2ZWR A;  2WYM C;  2FU6 A;  3H3E A;  2YNV A;  1MQO A;  1YCH A;  1X8H A;  2GFJ A;  4NQ2 A;  1SML A;  5EV6 A;  3DHA A;  4AWY B;  1WUP A;  1A7T A;  4Z67 A;  4D02 A;  4P62 A;  3I13 A;  5B15 A;  3X30 A;  2BFL A;  2NXA A;  2ZNB A;  1E5D A;  4C1E A;  3S0Z A;  5B3R A;  3Q6V A;  5DPX A;  5KIL A;  4Z6X A;  5AYA A;  2H6A A;  3SBL A;  4B87 A;  5EWA A;  4FR7 A;  1L9Y A;  4D1W A;  3P2U A;  2WHG A;  3PY5 A;  4Z7R A;  1X8G A;  5AHR A;  1DDK A;  5FQA A;  5EVB A;  3DHB A;  2QDT A;  2ZZI A;  3KNR A;  4D1V A;  4TYT A;  5AIJ A;  4C1H A;  1HLK A;  1YCF A;  4HL1 A;  5AXO A;  3ZQ4 A;  5IQK A;  3I0V A;  1P9E A;  2Q0J A;  5A0T A;  2UYX A;  4NQ5 A;  5K4M A;  5ACX A;  4EYL A;  2Y8B A;  4Z60 A;  4XWW A;  5LS3 A;  5HH6 A;  3AF6 A;  3PG4 A;  2CFZ A;  4AWZ A;  4ZO2 A;  4J5F A;  4PVT A;  3SD9 A;  5HIS A;  2QDS A;  4EYF A;  2Y8A A;  3F9O A;  2WRS A;  1VJN A;  2BR6 A;  3AF5 A;  4UWR B;  2YNT A;  2Q0I A;  2AZ4 A;  3I15 A;  2FM6 A;  5EHT A;  5LE1 A;  2NYP A;  2FK6 A;  2OHI A;  3IE2 A;  2P1E A;  3IE0 A;  5K4K A;  1ZTC A;  3ADR A;  3ZWF A;  2XF4 A;  2BG2 A;  1QH3 A;  3X2Z A;  2BGA A;  2CG2 A;  4KEP A;  2BMI A;  2YHE A;  2YCB A;  2BTN A;  3ZNB A;  2A7M A;  2YNU A;  4DIK A;  4RL0 A;  5HIP A;  3X2Y A;  5ACW A;  5AJL A;  5LM6 A;  5AEB A;  4C09 A;  4O98 A;  5LSC A;  2XR1 A;  1WUO A;  5A87 A;  5FQC A;  4BP0 A;  4Z5Z A;  4EY2 A;  2FU7 A; 
#chains in the Genus database with same CATH homology
 2I7T A;  2M5C A;  3FAI A;  2FU8 A;  3BV6 A;  1XM8 A;  4TZE A;  5LMC A;  2ZO4 A;  1X8I A;  2GKL A;  3ESH A;  4XUK A;  1VME A;  4RM5 A;  3RKK A;  1ZKP A;  3VPE A;  1BC2 A;  1JT1 A;  4JO0 A;  2Q42 A;  1JJE A;  4NQ4 A;  4EXY A;  3SW3 A;  2GMN A;  5HH4 A;  4EXS A;  4LE6 A;  3R2U A;  5EW0 A;  2WYM A;  5LCA A;  4C1G A;  5EH9 A;  5HIO A;  3L6N A;  3IOG A;  5ACQ A;  3JXP A;  2OHJ A;  1K07 A;  5ACS A;  5ACV A;  1KR3 A;  4V0H A;  4AD9 A;  3IEM A;  4ZNB A;  4HL2 A;  4FSB A;  5EVK A;  3I14 A;  2NZF A;  5KIK A;  2DOO A;  2WYL A;  4FEK A;  2BFZ A;  1A8T A;  3PY6 A;  4RL2 A;  4UAM A;  1XTO A;  5EVD A;  1VGN A;  3RKJ A;  4C1F A;  2P18 A;  3IEL A;  5LCF A;  1QH5 A;  2BFZ B;  4D1U A;  2HB9 A;  5A5Z A;  1KO2 A;  2FU9 A;  5HIQ A;  4J5H A;  3SFP A;  2Q9U A;  4WD6 A;  1M2X A;  2BFK A;  2BG8 A;  2Y87 A;  3T9M A;  4KEQ A;  4TZF A;  4HKY A;  2CBN A;  4H0D A;  4D1T A;  4C1D A;  2BG8 B;  5ACP A;  2E7Y A;  1Y44 A;  2YNW A;  2I7X A;  3X2X A;  2I7V A;  3ZR9 A;  4XWT A;  3IOF A;  2M5D A;  3QH8 A;  1WW1 A;  4GCW A;  3WXC A;  2BG7 A;  1ZNB A;  4F6Z A;  4EFZ A;  3AJ3 A;  2YNV B;  2BG6 A;  2R2D A;  1KO3 A;  1DD6 A;  3LVZ A;  4ZEJ A;  4AX1 B;  5EV8 A;  2GCU A;  3VQZ A;  3IEK A;  4U4L A;  4YSL A;  5LLD A;  5AXR A;  3G1P A;  2GFK A;  2P97 A;  4C1C A;  4RBS A;  4GYQ A;  2QIN A;  3MD7 A;  4YSK A;  3FCZ A;  1BMC A;  1DXK A;  2DKF A;  4BZ3 A;  3DHC A;  2AIO A;  4RAW A;  5A0V A;  3I11 A;  3IDZ A;  3RPC A;  3T3N A;  4ZO3 A;  3BC2 A;  5ACR A;  2VW8 A;  4YSB A;  3BK2 A;  4DIL A;  5ACT A;  4UWO B;  2FHX A;  4CHL A;  4AX0 B;  4EYB A;  4PVO A;  2QED A;  4RAM A;  5AHO A;  3SRX A;  4NQ6 A;  5K0W A;  4TYF A;  1BVT A;  5FQB A;  1JJT A;  5LCH A;  3T3O A;  2FHX B;  1WRA A;  2QJS A;  5HH5 A;  3KNS A;  4Z5Y A;  2BIB A;  3IE1 A;  2OHH A;  4TZB A;  4TZ9 A;  4UBQ A;  2P4Z A;  2BC2 A;  3TP9 A;  4UA4 A;  1YCG A;  3A4Y A;  4UWP B;  3DH8 A;  3KL7 A;  3BK1 A;  5B1U A;  4F6H A;  5ACU A;  4UWS B;  2YNT B;  3SPU A;  5K4N A;  2NZE A;  4GYU A;  2YZ3 A;  2ZWR A;  2WYM C;  2FU6 A;  3H3E A;  2YNV A;  1MQO A;  1YCH A;  1X8H A;  2GFJ A;  4NQ2 A;  1SML A;  5EV6 A;  3DHA A;  4AWY B;  1WUP A;  4D02 A;  1A7T A;  4Z67 A;  4P62 A;  3I13 A;  5B15 A;  3X30 A;  2BFL A;  2NXA A;  2ZNB A;  1E5D A;  4C1E A;  3S0Z A;  5B3R A;  3Q6V A;  5DPX A;  5KIL A;  4Z6X A;  5AYA A;  2H6A A;  3SBL A;  4B87 A;  5EWA A;  4FR7 A;  1L9Y A;  4D1W A;  3P2U A;  2WHG A;  3PY5 A;  4Z7R A;  1X8G A;  5AHR A;  1DDK A;  5FQA A;  5EVB A;  3DHB A;  2QDT A;  2ZZI A;  3KNR A;  4D1V A;  4TYT A;  4C1H A;  1HLK A;  1YCF A;  4HL1 A;  5AXO A;  3ZQ4 A;  5IQK A;  3I0V A;  1P9E A;  2Q0J A;  5A0T A;  2UYX A;  4NQ5 A;  5K4M A;  5ACX A;  4EYL A;  2Y8B A;  4Z60 A;  4XWW A;  5LS3 A;  5HH6 A;  3AF6 A;  3PG4 A;  4AWZ A;  4ZO2 A;  4J5F A;  4PVT A;  3SD9 A;  5HIS A;  2QDS A;  4EYF A;  2Y8A A;  3F9O A;  2WRS A;  1VJN A;  2BR6 A;  3AF5 A;  4UWR B;  2YNT A;  2Q0I A;  2AZ4 A;  3I15 A;  2FM6 A;  5EHT A;  5LE1 A;  2NYP A;  2FK6 A;  2OHI A;  3IE2 A;  2P1E A;  3IE0 A;  5K4K A;  1ZTC A;  3ADR A;  3ZWF A;  2XF4 A;  2BG2 A;  1QH3 A;  3X2Z A;  2BGA A;  4KEP A;  2BMI A;  2YCB A;  2BTN A;  3ZNB A;  2A7M A;  2YNU A;  4DIK A;  4RL0 A;  5HIP A;  3X2Y A;  5ACW A;  5LM6 A;  5AEB A;  4C09 A;  4O98 A;  5LSC A;  2XR1 A;  1WUO A;  5A87 A;  5FQC A;  4BP0 A;  4Z5Z A;  4EY2 A;  2FU7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...