1JJEA

Imp-1 metallo beta-lactamase from pseudomonas aeruginosa in complex with a biaryl succinic acid inhibitor (11)
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
220
structure length
220
Chain Sequence
b'SLPDLKIEKLDEGVYVHTSFEEVNGWGVVPKHGLVVLVNAEAYLIDTPFTAKDTEKLVTWFVERGYKIKGSISSHFHSDSTGGIEWLNSRSIPTYASELTNELLKKDGKVQATNSFSGVNYWLVKNKIEVFYPGPGHTPDNVVVWLPERKILFGGCFIKPYGLGNLGDANIEAWPKSAKLLKSKYGKAKLVVPSHSEVGDASLLKLTLEQAVKGLNESKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IMP-1 METALLO BETA-LACTAMASE
publication title Succinic acids as potent inhibitors of plasmid-borne IMP-1 metallo-beta-lactamase.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Hydrolase
total genus 69
structure length 220
sequence length 220
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2001-07-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 1jjeA00
2QINA 4XUKA 2DKFA 1KO2A 4D02A 4AWYB 2Q9UA 3IEKA 5ACUA 4RL2A 2YNWA 2QEDA 2NXAA 4ZO2A 2NZEA 5DPXA 5FQAA 4AX0B 4F6HA 1JJTA 4O98A 2BR6A 2Y8BA 4TZEA 5IQKA 2QDSA 4C1GA 4TZ9A 5EW0A 5K4MA 3S0ZA 3SPUA 3AF5A 5EV8A 2Q0JA 5EH9A 5HIQA 3IOGA 1X8HA 5AHRA 3FAIA 5ACWA 5AHOA 2GCUA 5ACRA 4KEQA 5LM6A 2M5DA 2ZZIA 2OHIA 1K07A 3IDZA 4HKYA 4PVTA 3IEMA 1VJNA 2A7MA 4HL1A 2YCBA 1XTOA 2P18A 5LLDA 5EVBA 1ZKPA 4EFZA 3IE1A 2WRSA 5AYAA 3DHAA 2BC2A 3A4YA 4D1WA 2XR1A 2BG6A 4NQ4A 5HIOA 1BMCA 3DHBA 3R2UA 3X2YA 5HH4A 2WYLA 1XM8A 2WHGA 2H6AA 1YCGA 4FSBA 3X2XA 2BG7A 3TP9A 3PY6A 2Y87A 2FU9A 2BMIA 2BG8B 4BP0A 4C1HA 4GYQA 2Y8AA 2FM6A 4XWWA 5EV6A 4Z7RA 2P1EA 2HB9A 3I13A 2BIBA 4AD9A 4UBQA 4UWRB 5K0WA 2OHJA 3VPEA 4Z6XA 4TZFA 1DXKA 4UA4A 2Q0IA 4JO0A 5AXRA 2FHXB 4CHLA 5EVDA 3KL7A 5A0VA 2DOOA 2OHHA 4U4LA 3L6NA 5A5ZA 3T3OA 4EYFA 3KNSA 3BV6A 3ESHA 1WUPA 2E7YA 1DDKA 1KO3A 3QH8A 5FQCA 5KIKA 5A87A 5LCAA 2BFZA 3F9OA 5K4KA 3WXCA 1KR3A 1A8TA 2FU8A 4P62A 4C1FA 2BG8A 5LE1A 2UYXA 3BK1A 3JXPA 2I7TA 2YNVB 3RKJA 4TYTA 1YCFA 4NQ2A 4D1VA 4RL0A 5ACTA 1BVTA 4EYLA 3X2ZA 2M5CA 4GCWA 5K4NA 5AEBA 3PY5A 3I15A 3IE2A 4ZNBA 1MQOA 4Z67A 4UAMA 4YSBA 2ZO4A 3SRXA 3PG4A 5LSCA 5HIPA 3DHCA 1WRAA 3ZWFA 5HISA 1Y44A 4TZBA 3ZR9A 4Z5ZA 3AJ3A 4HL2A 3MD7A 2QDTA 3SW3A 2WYMA 1WW1A 2ZWRA 4LE6A 2GFJA 4UWOB 5ACQA 2YNTB 3IOFA 4RAWA 5KILA 1X8GA 4PVOA 3X30A 2GKLA 1JT1A 4RBSA 4ZO3A 4F6ZA 1L9YA 4AWZA 4TYFA 5B15A 3BC2A 4UWSB 3LVZA 2GMNA 2QJSA 2YNVA 1P9EA 4GYUA 4J5HA 2I7XA 4RM5A 4YSKA 2BGAA 4C1CA 3I0VA 4DILA 2AIOA 5ACVA 5HH5A 4D1TA 2YZ3A 3IELA 2P4ZA 1E5DA 2YNUA 1X8IA 4EXSA 4RAMA 3Q6VA 5LCFA 1WUOA 3IE0A 4B87A 4H0DA 5ACSA 1QH3A 2FU7A 4D1UA 4NQ6A 2BFLA 3SFPA 5LMCA 5HH6A 1ZNBA 5LS3A 4EY2A 1VMEA 2NYPA 1BC2A 2CBNA 2YNTA 5EHTA 5AXOA 4UWPB 3SBLA 5EWAA 2R2DA 2WYMC 5EVKA 4C09A 3I11A 5B3RA 5ACPA 3ZQ4A 4KEPA 2VW8A 4V0HA 5A0TA 2FK6A 2BG2A 4YSLA 3SD9A 3ADRA 3RPCA 1JJEA 5ACXA 4J5FA 3BK2A 3VQZA 3DH8A 3FCZA 2FHXA 1SMLA 4NQ5A 4DIKA 3P2UA 3RKKA 1A7TA 2XF4A 3T3NA 4Z60A 4ZEJA 3AF6A 2NZFA 3H3EA 4BZ3A 3I14A 3KNRA 2FU6A 4FEKA 2AZ4A 2Q42A 2BFZB 2BFKA 4C1EA 1YCHA 4AX1B 4EYBA 3T9MA 1VGNA 4EXYA 5LCHA 2I7VA 5FQBA 4FR7A 1HLKA 2P97A 1ZTCA 2GFKA 2ZNBA 4C1DA 1M2XA 3ZNBA 3G1PA 2BTNA 4Z5YA 1DD6A 1QH5A 4XWTA 5B1UA 4WD6A
chains in the Genus database with same CATH superfamily
2QINA 4XUKA 2DKFA 1KO2A 4D02A 4AWYB 2Q9UA 3IEKA 5ACUA 4RL2A 2YNWA 2QEDA 2NXAA 4ZO2A 2NZEA 5DPXA 5FQAA 4AX0B 4F6HA 1JJTA 4O98A 2BR6A 2Y8BA 4TZEA 5IQKA 2QDSA 4C1GA 4TZ9A 5EW0A 5K4MA 3S0ZA 3SPUA 3AF5A 5EV8A 2Q0JA 5EH9A 5HIQA 3IOGA 1X8HA 5AHRA 3FAIA 5ACWA 5AHOA 2GCUA 5ACRA 4KEQA 5LM6A 2M5DA 2ZZIA 2OHIA 1K07A 2YHEA 3IDZA 4HKYA 4PVTA 3IEMA 1VJNA 2A7MA 4HL1A 2YCBA 1XTOA 2P18A 5LLDA 5EVBA 1ZKPA 4EFZA 3IE1A 2WRSA 5AYAA 3DHAA 2BC2A 3A4YA 4D1WA 2XR1A 2BG6A 4NQ4A 5HIOA 1BMCA 3DHBA 3R2UA 3X2YA 5HH4A 2WYLA 1XM8A 2WHGA 2H6AA 1YCGA 4FSBA 3X2XA 2BG7A 3TP9A 3PY6A 2Y87A 2FU9A 2BMIA 2BG8B 4BP0A 4C1HA 4GYQA 2Y8AA 2FM6A 4XWWA 5EV6A 4Z7RA 2P1EA 2HB9A 3I13A 2BIBA 4AD9A 4UBQA 4UWRB 5K0WA 2OHJA 3VPEA 4Z6XA 4TZFA 1DXKA 4UA4A 2Q0IA 4JO0A 5AXRA 2FHXB 4CHLA 5EVDA 5A23A 4AXHA 3KL7A 5A0VA 2DOOA 2OHHA 4U4LA 3L6NA 5A5ZA 3T3OA 2CFZA 4EYFA 3KNSA 3BV6A 3ESHA 1WUPA 2E7YA 1DDKA 1KO3A 3QH8A 5FQCA 5KIKA 5A87A 5LCAA 2BFZA 3F9OA 5K4KA 3WXCA 1KR3A 1A8TA 2FU8A 4P62A 4C1FA 2BG8A 5LE1A 2UYXA 3BK1A 3JXPA 2I7TA 2YNVB 3RKJA 4TYTA 1YCFA 4NQ2A 4D1VA 4RL0A 5ACTA 1BVTA 4EYLA 3X2ZA 2M5CA 4GCWA 5K4NA 5AEBA 3PY5A 3I15A 3IE2A 4ZNBA 1MQOA 4Z67A 4UAMA 4YSBA 2ZO4A 3SRXA 2CFUA 3PG4A 5LSCA 5HIPA 3DHCA 2CG2A 1WRAA 3ZWFA 5HISA 1Y44A 4TZBA 3ZR9A 4Z5ZA 3AJ3A 4NURA 4HL2A 3MD7A 2QDTA 3SW3A 2WYMA 1WW1A 2ZWRA 4LE6A 2GFJA 4UWOB 5ACQA 2YNTB 3IOFA 4RAWA 5KILA 1X8GA 4PVOA 3X30A 2GKLA 1JT1A 4RBSA 4ZO3A 4F6ZA 1L9YA 4AWZA 4TYFA 5B15A 3BC2A 4UWSB 3LVZA 2CG3A 2GMNA 2QJSA 4AV7A 2YNVA 1P9EA 4GYUA 4J5HA 4PDXA 2I7XA 4RM5A 4YSKA 2BGAA 4C1CA 3I0VA 4DILA 2AIOA 5ACVA 5HH5A 4D1TA 2YZ3A 3IELA 2P4ZA 1E5DA 2YNUA 1X8IA 4EXSA 4RAMA 3Q6VA 5LCFA 1WUOA 3IE0A 4B87A 4H0DA 5ACSA 1QH3A 2FU7A 4D1UA 4NQ6A 5AJLA 2BFLA 3SFPA 5AIJA 5LMCA 5HH6A 1ZNBA 5LS3A 4EY2A 1VMEA 2NYPA 1BC2A 2CBNA 2YNTA 5EHTA 5AXOA 4UWPB 3SBLA 5EWAA 2R2DA 2WYMC 5EVKA 4C09A 3I11A 5B3RA 5ACPA 3ZQ4A 4KEPA 2VW8A 4V0HA 5A0TA 2FK6A 2BG2A 4YSLA 3SD9A 3ADRA 3RPCA 1JJEA 5ACXA 4J5FA 3BK2A 3VQZA 3DH8A 3FCZA 2FHXA 1SMLA 4NQ5A 4DIKA 3P2UA 3RKKA 1A7TA 2XF4A 3T3NA 4Z60A 4ZEJA 3AF6A 2NZFA 3H3EA 4BZ3A 3I14A 3KNRA 2FU6A 4FEKA 2AZ4A 2Q42A 2BFZB 2BFKA 4C1EA 1YCHA 4AX1B 4EYBA 3T9MA 1VGNA 4EXYA 5LCHA 2I7VA 5FQBA 4FR7A 1HLKA 2P97A 1ZTCA 2GFKA 2ZNBA 4C1DA 1M2XA 3ZNBA 3G1PA 2BTNA 4Z5YA 1DD6A 1QH5A 4XWTA 5B1UA 4WD6A
chains in the Genus database with same CATH topology
2QINA 4XUKA 2DKFA 1KO2A 4D02A 4AWYB 2Q9UA 3IEKA 5ACUA 4RL2A 2YNWA 2QEDA 2NXAA 4ZO2A 2NZEA 5DPXA 5FQAA 4AX0B 4F6HA 1JJTA 4O98A 2BR6A 2Y8BA 4TZEA 5IQKA 2QDSA 4C1GA 4TZ9A 5EW0A 5K4MA 3S0ZA 3SPUA 3AF5A 5EV8A 2Q0JA 5EH9A 5HIQA 3IOGA 1X8HA 5AHRA 3FAIA 5ACWA 5AHOA 2GCUA 5ACRA 4KEQA 5LM6A 2M5DA 2ZZIA 2OHIA 1K07A 3IDZA 4HKYA 4PVTA 3IEMA 1VJNA 2A7MA 4HL1A 2YCBA 1XTOA 2P18A 5LLDA 5EVBA 1ZKPA 4EFZA 3IE1A 2WRSA 5AYAA 3DHAA 2BC2A 3A4YA 4D1WA 2XR1A 2BG6A 4NQ4A 5HIOA 1BMCA 3DHBA 3R2UA 3X2YA 5HH4A 2WYLA 1XM8A 2WHGA 2H6AA 1YCGA 4FSBA 3X2XA 2BG7A 3TP9A 3PY6A 2Y87A 2FU9A 2BMIA 2BG8B 4BP0A 4C1HA 4GYQA 2Y8AA 2FM6A 4XWWA 5EV6A 4Z7RA 2P1EA 2HB9A 3I13A 2BIBA 4AD9A 4UBQA 4UWRB 5K0WA 2OHJA 3VPEA 4Z6XA 4TZFA 1DXKA 4UA4A 2Q0IA 4JO0A 5AXRA 2FHXB 4CHLA 5EVDA 3KL7A 5A0VA 2DOOA 2OHHA 4U4LA 3L6NA 5A5ZA 3T3OA 4EYFA 3KNSA 3BV6A 3ESHA 1WUPA 2E7YA 1DDKA 1KO3A 3QH8A 5FQCA 5KIKA 5A87A 5LCAA 2BFZA 3F9OA 5K4KA 3WXCA 1KR3A 1A8TA 2FU8A 4P62A 4C1FA 2BG8A 5LE1A 2UYXA 3BK1A 3JXPA 2I7TA 2YNVB 3RKJA 4TYTA 1YCFA 4NQ2A 4D1VA 4RL0A 5ACTA 1BVTA 4EYLA 3X2ZA 2M5CA 4GCWA 5K4NA 5AEBA 3PY5A 3I15A 3IE2A 4ZNBA 1MQOA 4Z67A 4UAMA 4YSBA 2ZO4A 3SRXA 3PG4A 5LSCA 5HIPA 3DHCA 1WRAA 3ZWFA 5HISA 1Y44A 4TZBA 3ZR9A 4Z5ZA 3AJ3A 4HL2A 3MD7A 2QDTA 3SW3A 2WYMA 1WW1A 2ZWRA 4LE6A 2GFJA 4UWOB 5ACQA 2YNTB 3IOFA 4RAWA 5KILA 1X8GA 4PVOA 3X30A 2GKLA 1JT1A 4RBSA 4ZO3A 4F6ZA 1L9YA 4AWZA 4TYFA 5B15A 3BC2A 4UWSB 3LVZA 2GMNA 2QJSA 2YNVA 1P9EA 4GYUA 4J5HA 2I7XA 4RM5A 4YSKA 2BGAA 4C1CA 3I0VA 4DILA 2AIOA 5ACVA 5HH5A 4D1TA 2YZ3A 3IELA 2P4ZA 1E5DA 2YNUA 1X8IA 4EXSA 4RAMA 3Q6VA 5LCFA 1WUOA 3IE0A 4B87A 4H0DA 5ACSA 1QH3A 2FU7A 4D1UA 4NQ6A 2BFLA 3SFPA 5LMCA 5HH6A 1ZNBA 5LS3A 4EY2A 1VMEA 2NYPA 1BC2A 2CBNA 2YNTA 5EHTA 5AXOA 4UWPB 3SBLA 5EWAA 2R2DA 2WYMC 5EVKA 4C09A 3I11A 5B3RA 5ACPA 3ZQ4A 4KEPA 2VW8A 4V0HA 5A0TA 2FK6A 2BG2A 4YSLA 3SD9A 3ADRA 3RPCA 1JJEA 5ACXA 4J5FA 3BK2A 3VQZA 3DH8A 3FCZA 2FHXA 1SMLA 4NQ5A 4DIKA 3P2UA 3RKKA 1A7TA 2XF4A 3T3NA 4Z60A 4ZEJA 3AF6A 2NZFA 3H3EA 4BZ3A 3I14A 3KNRA 2FU6A 4FEKA 2AZ4A 2Q42A 2BFZB 2BFKA 4C1EA 1YCHA 4AX1B 4EYBA 3T9MA 1VGNA 4EXYA 5LCHA 2I7VA 5FQBA 4FR7A 1HLKA 2P97A 1ZTCA 2GFKA 2ZNBA 4C1DA 1M2XA 3ZNBA 3G1PA 2BTNA 4Z5YA 1DD6A 1QH5A 4XWTA 5B1UA 4WD6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QIN A;  4XUK A;  2DKF A;  1KO2 A;  4D02 A;  4AWY B;  2Q9U A;  3IEK A;  5ACU A;  4RL2 A;  2YNW A;  2QED A;  2NXA A;  4ZO2 A;  2NZE A;  5DPX A;  5FQA A;  4AX0 B;  4F6H A;  1JJT A;  4O98 A;  2BR6 A;  2Y8B A;  4TZE A;  5IQK A;  2QDS A;  4C1G A;  4TZ9 A;  5EW0 A;  5K4M A;  3S0Z A;  3SPU A;  3AF5 A;  5EV8 A;  2Q0J A;  5EH9 A;  5HIQ A;  3IOG A;  1X8H A;  5AHR A;  3FAI A;  5ACW A;  5AHO A;  2GCU A;  5ACR A;  4KEQ A;  5LM6 A;  2M5D A;  2ZZI A;  2OHI A;  1K07 A;  3IDZ A;  4HKY A;  4PVT A;  3IEM A;  1VJN A;  2A7M A;  4HL1 A;  2YCB A;  1XTO A;  2P18 A;  5LLD A;  5EVB A;  1ZKP A;  4EFZ A;  3IE1 A;  2WRS A;  5AYA A;  3DHA A;  2BC2 A;  3A4Y A;  4D1W A;  2XR1 A;  2BG6 A;  4NQ4 A;  5HIO A;  1BMC A;  3DHB A;  3R2U A;  3X2Y A;  5HH4 A;  2WYL A;  1XM8 A;  2WHG A;  2H6A A;  1YCG A;  4FSB A;  3X2X A;  2BG7 A;  3TP9 A;  3PY6 A;  2Y87 A;  2FU9 A;  2BMI A;  2BG8 B;  4BP0 A;  4C1H A;  4GYQ A;  2Y8A A;  2FM6 A;  4XWW A;  5EV6 A;  4Z7R A;  2P1E A;  2HB9 A;  3I13 A;  2BIB A;  4AD9 A;  4UBQ A;  4UWR B;  5K0W A;  2OHJ A;  3VPE A;  4Z6X A;  4TZF A;  1DXK A;  4UA4 A;  2Q0I A;  4JO0 A;  5AXR A;  2FHX B;  4CHL A;  5EVD A;  3KL7 A;  5A0V A;  2DOO A;  2OHH A;  4U4L A;  3L6N A;  5A5Z A;  3T3O A;  4EYF A;  3KNS A;  3BV6 A;  3ESH A;  1WUP A;  2E7Y A;  1DDK A;  1KO3 A;  3QH8 A;  5FQC A;  5KIK A;  5A87 A;  5LCA A;  2BFZ A;  3F9O A;  5K4K A;  3WXC A;  1KR3 A;  1A8T A;  2FU8 A;  4P62 A;  4C1F A;  2BG8 A;  5LE1 A;  2UYX A;  3BK1 A;  3JXP A;  2I7T A;  2YNV B;  3RKJ A;  4TYT A;  1YCF A;  4NQ2 A;  4D1V A;  4RL0 A;  5ACT A;  1BVT A;  4EYL A;  3X2Z A;  2M5C A;  4GCW A;  5K4N A;  5AEB A;  3PY5 A;  3I15 A;  3IE2 A;  4ZNB A;  1MQO A;  4Z67 A;  4UAM A;  4YSB A;  2ZO4 A;  3SRX A;  3PG4 A;  5LSC A;  5HIP A;  3DHC A;  1WRA A;  3ZWF A;  5HIS A;  1Y44 A;  4TZB A;  3ZR9 A;  4Z5Z A;  3AJ3 A;  4HL2 A;  3MD7 A;  2QDT A;  3SW3 A;  2WYM A;  1WW1 A;  2ZWR A;  4LE6 A;  2GFJ A;  4UWO B;  5ACQ A;  2YNT B;  3IOF A;  4RAW A;  5KIL A;  1X8G A;  4PVO A;  3X30 A;  2GKL A;  1JT1 A;  4RBS A;  4ZO3 A;  4F6Z A;  1L9Y A;  4AWZ A;  4TYF A;  5B15 A;  3BC2 A;  4UWS B;  3LVZ A;  2GMN A;  2QJS A;  2YNV A;  1P9E A;  4GYU A;  4J5H A;  2I7X A;  4RM5 A;  4YSK A;  2BGA A;  4C1C A;  3I0V A;  4DIL A;  2AIO A;  5ACV A;  5HH5 A;  4D1T A;  2YZ3 A;  3IEL A;  2P4Z A;  1E5D A;  2YNU A;  1X8I A;  4EXS A;  4RAM A;  3Q6V A;  5LCF A;  1WUO A;  3IE0 A;  4B87 A;  4H0D A;  5ACS A;  1QH3 A;  2FU7 A;  4D1U A;  4NQ6 A;  2BFL A;  3SFP A;  5LMC A;  5HH6 A;  1ZNB A;  5LS3 A;  4EY2 A;  1VME A;  2NYP A;  1BC2 A;  2CBN A;  2YNT A;  5EHT A;  5AXO A;  4UWP B;  3SBL A;  5EWA A;  2R2D A;  2WYM C;  5EVK A;  4C09 A;  3I11 A;  5B3R A;  5ACP A;  3ZQ4 A;  4KEP A;  2VW8 A;  4V0H A;  5A0T A;  2FK6 A;  2BG2 A;  4YSL A;  3SD9 A;  3ADR A;  3RPC A;  1JJE A;  5ACX A;  4J5F A;  3BK2 A;  3VQZ A;  3DH8 A;  3FCZ A;  2FHX A;  1SML A;  4NQ5 A;  4DIK A;  3P2U A;  3RKK A;  1A7T A;  2XF4 A;  3T3N A;  4Z60 A;  4ZEJ A;  3AF6 A;  2NZF A;  3H3E A;  4BZ3 A;  3I14 A;  3KNR A;  2FU6 A;  4FEK A;  2AZ4 A;  2Q42 A;  2BFZ B;  2BFK A;  4C1E A;  1YCH A;  4AX1 B;  4EYB A;  3T9M A;  1VGN A;  4EXY A;  5LCH A;  2I7V A;  5FQB A;  4FR7 A;  1HLK A;  2P97 A;  1ZTC A;  2GFK A;  2ZNB A;  4C1D A;  1M2X A;  3ZNB A;  3G1P A;  2BTN A;  4Z5Y A;  1DD6 A;  1QH5 A;  4XWT A;  5B1U A;  4WD6 A; 
#chains in the Genus database with same CATH topology
 2QIN A;  4XUK A;  2DKF A;  1KO2 A;  4D02 A;  4AWY B;  2Q9U A;  3IEK A;  5ACU A;  4RL2 A;  2YNW A;  2QED A;  2NXA A;  4ZO2 A;  2NZE A;  5DPX A;  5FQA A;  4AX0 B;  4F6H A;  1JJT A;  4O98 A;  2BR6 A;  2Y8B A;  4TZE A;  5IQK A;  2QDS A;  4C1G A;  4TZ9 A;  5EW0 A;  5K4M A;  3S0Z A;  3SPU A;  3AF5 A;  5EV8 A;  2Q0J A;  5EH9 A;  5HIQ A;  3IOG A;  1X8H A;  5AHR A;  3FAI A;  5ACW A;  5AHO A;  2GCU A;  5ACR A;  4KEQ A;  5LM6 A;  2M5D A;  2ZZI A;  2OHI A;  1K07 A;  2YHE A;  3IDZ A;  4HKY A;  4PVT A;  3IEM A;  1VJN A;  2A7M A;  4HL1 A;  2YCB A;  1XTO A;  2P18 A;  5LLD A;  5EVB A;  1ZKP A;  4EFZ A;  3IE1 A;  2WRS A;  5AYA A;  3DHA A;  2BC2 A;  3A4Y A;  4D1W A;  2XR1 A;  2BG6 A;  4NQ4 A;  5HIO A;  1BMC A;  3DHB A;  3R2U A;  3X2Y A;  5HH4 A;  2WYL A;  1XM8 A;  2WHG A;  2H6A A;  1YCG A;  4FSB A;  3X2X A;  2BG7 A;  3TP9 A;  3PY6 A;  2Y87 A;  2FU9 A;  2BMI A;  2BG8 B;  4BP0 A;  4C1H A;  4GYQ A;  2Y8A A;  2FM6 A;  4XWW A;  5EV6 A;  4Z7R A;  2P1E A;  2HB9 A;  3I13 A;  2BIB A;  4AD9 A;  4UBQ A;  4UWR B;  5K0W A;  2OHJ A;  3VPE A;  4Z6X A;  4TZF A;  1DXK A;  4UA4 A;  2Q0I A;  4JO0 A;  5AXR A;  2FHX B;  4CHL A;  5EVD A;  5A23 A;  4AXH A;  3KL7 A;  5A0V A;  2DOO A;  2OHH A;  4U4L A;  3L6N A;  5A5Z A;  3T3O A;  2CFZ A;  4EYF A;  3KNS A;  3BV6 A;  3ESH A;  1WUP A;  2E7Y A;  1DDK A;  1KO3 A;  3QH8 A;  5FQC A;  5KIK A;  5A87 A;  5LCA A;  2BFZ A;  3F9O A;  5K4K A;  3WXC A;  1KR3 A;  1A8T A;  2FU8 A;  4P62 A;  4C1F A;  2BG8 A;  5LE1 A;  2UYX A;  3BK1 A;  3JXP A;  2I7T A;  2YNV B;  3RKJ A;  4TYT A;  1YCF A;  4NQ2 A;  4D1V A;  4RL0 A;  5ACT A;  1BVT A;  4EYL A;  3X2Z A;  2M5C A;  4GCW A;  5K4N A;  5AEB A;  3PY5 A;  3I15 A;  3IE2 A;  4ZNB A;  1MQO A;  4Z67 A;  4UAM A;  4YSB A;  2ZO4 A;  3SRX A;  2CFU A;  3PG4 A;  5LSC A;  5HIP A;  3DHC A;  2CG2 A;  1WRA A;  3ZWF A;  5HIS A;  1Y44 A;  4TZB A;  3ZR9 A;  4Z5Z A;  3AJ3 A;  4NUR A;  4HL2 A;  3MD7 A;  2QDT A;  3SW3 A;  2WYM A;  1WW1 A;  2ZWR A;  4LE6 A;  2GFJ A;  4UWO B;  5ACQ A;  2YNT B;  3IOF A;  4RAW A;  5KIL A;  1X8G A;  4PVO A;  3X30 A;  2GKL A;  1JT1 A;  4RBS A;  4ZO3 A;  4F6Z A;  1L9Y A;  4AWZ A;  4TYF A;  5B15 A;  3BC2 A;  4UWS B;  3LVZ A;  2CG3 A;  2GMN A;  2QJS A;  4AV7 A;  2YNV A;  1P9E A;  4GYU A;  4J5H A;  4PDX A;  2I7X A;  4RM5 A;  4YSK A;  2BGA A;  4C1C A;  3I0V A;  4DIL A;  2AIO A;  5ACV A;  5HH5 A;  4D1T A;  2YZ3 A;  3IEL A;  2P4Z A;  1E5D A;  2YNU A;  1X8I A;  4EXS A;  4RAM A;  3Q6V A;  5LCF A;  1WUO A;  3IE0 A;  4B87 A;  4H0D A;  5ACS A;  1QH3 A;  2FU7 A;  4D1U A;  4NQ6 A;  5AJL A;  2BFL A;  3SFP A;  5AIJ A;  5LMC A;  5HH6 A;  1ZNB A;  5LS3 A;  4EY2 A;  1VME A;  2NYP A;  1BC2 A;  2CBN A;  2YNT A;  5EHT A;  5AXO A;  4UWP B;  3SBL A;  5EWA A;  2R2D A;  2WYM C;  5EVK A;  4C09 A;  3I11 A;  5B3R A;  5ACP A;  3ZQ4 A;  4KEP A;  2VW8 A;  4V0H A;  5A0T A;  2FK6 A;  2BG2 A;  4YSL A;  3SD9 A;  3ADR A;  3RPC A;  1JJE A;  5ACX A;  4J5F A;  3BK2 A;  3VQZ A;  3DH8 A;  3FCZ A;  2FHX A;  1SML A;  4NQ5 A;  4DIK A;  3P2U A;  3RKK A;  1A7T A;  2XF4 A;  3T3N A;  4Z60 A;  4ZEJ A;  3AF6 A;  2NZF A;  3H3E A;  4BZ3 A;  3I14 A;  3KNR A;  2FU6 A;  4FEK A;  2AZ4 A;  2Q42 A;  2BFZ B;  2BFK A;  4C1E A;  1YCH A;  4AX1 B;  4EYB A;  3T9M A;  1VGN A;  4EXY A;  5LCH A;  2I7V A;  5FQB A;  4FR7 A;  1HLK A;  2P97 A;  1ZTC A;  2GFK A;  2ZNB A;  4C1D A;  1M2X A;  3ZNB A;  3G1P A;  2BTN A;  4Z5Y A;  1DD6 A;  1QH5 A;  4XWT A;  5B1U A;  4WD6 A; 
#chains in the Genus database with same CATH homology
 2QIN A;  4XUK A;  2DKF A;  1KO2 A;  4D02 A;  4AWY B;  2Q9U A;  3IEK A;  5ACU A;  4RL2 A;  2YNW A;  2QED A;  2NXA A;  4ZO2 A;  2NZE A;  5DPX A;  5FQA A;  4AX0 B;  4F6H A;  1JJT A;  4O98 A;  2BR6 A;  2Y8B A;  4TZE A;  5IQK A;  2QDS A;  4C1G A;  4TZ9 A;  5EW0 A;  5K4M A;  3S0Z A;  3SPU A;  3AF5 A;  5EV8 A;  2Q0J A;  5EH9 A;  5HIQ A;  3IOG A;  1X8H A;  5AHR A;  3FAI A;  5ACW A;  5AHO A;  2GCU A;  5ACR A;  4KEQ A;  5LM6 A;  2M5D A;  2ZZI A;  2OHI A;  1K07 A;  3IDZ A;  4HKY A;  4PVT A;  3IEM A;  1VJN A;  2A7M A;  4HL1 A;  2YCB A;  1XTO A;  2P18 A;  5LLD A;  5EVB A;  1ZKP A;  4EFZ A;  3IE1 A;  2WRS A;  5AYA A;  3DHA A;  2BC2 A;  3A4Y A;  4D1W A;  2XR1 A;  2BG6 A;  4NQ4 A;  5HIO A;  1BMC A;  3DHB A;  3R2U A;  3X2Y A;  5HH4 A;  2WYL A;  1XM8 A;  2WHG A;  2H6A A;  1YCG A;  4FSB A;  3X2X A;  2BG7 A;  3TP9 A;  3PY6 A;  2Y87 A;  2FU9 A;  2BMI A;  2BG8 B;  4BP0 A;  4C1H A;  4GYQ A;  2Y8A A;  2FM6 A;  4XWW A;  5EV6 A;  4Z7R A;  2P1E A;  2HB9 A;  3I13 A;  2BIB A;  4AD9 A;  4UBQ A;  4UWR B;  5K0W A;  2OHJ A;  3VPE A;  4Z6X A;  4TZF A;  1DXK A;  4UA4 A;  2Q0I A;  4JO0 A;  5AXR A;  2FHX B;  4CHL A;  5EVD A;  3KL7 A;  5A0V A;  2DOO A;  2OHH A;  4U4L A;  3L6N A;  5A5Z A;  3T3O A;  4EYF A;  3KNS A;  3BV6 A;  3ESH A;  1WUP A;  2E7Y A;  1DDK A;  1KO3 A;  3QH8 A;  5FQC A;  5KIK A;  5A87 A;  5LCA A;  2BFZ A;  3F9O A;  5K4K A;  3WXC A;  1KR3 A;  1A8T A;  2FU8 A;  4P62 A;  4C1F A;  2BG8 A;  5LE1 A;  2UYX A;  3BK1 A;  3JXP A;  2I7T A;  2YNV B;  3RKJ A;  4TYT A;  1YCF A;  4NQ2 A;  4D1V A;  4RL0 A;  5ACT A;  1BVT A;  4EYL A;  3X2Z A;  2M5C A;  4GCW A;  5K4N A;  5AEB A;  3PY5 A;  3I15 A;  3IE2 A;  4ZNB A;  1MQO A;  4Z67 A;  4UAM A;  4YSB A;  2ZO4 A;  3SRX A;  3PG4 A;  5LSC A;  5HIP A;  3DHC A;  1WRA A;  3ZWF A;  5HIS A;  1Y44 A;  4TZB A;  3ZR9 A;  4Z5Z A;  3AJ3 A;  4HL2 A;  3MD7 A;  2QDT A;  3SW3 A;  2WYM A;  1WW1 A;  2ZWR A;  4LE6 A;  2GFJ A;  4UWO B;  5ACQ A;  2YNT B;  3IOF A;  4RAW A;  5KIL A;  1X8G A;  4PVO A;  3X30 A;  2GKL A;  1JT1 A;  4RBS A;  4ZO3 A;  4F6Z A;  1L9Y A;  4AWZ A;  4TYF A;  5B15 A;  3BC2 A;  4UWS B;  3LVZ A;  2GMN A;  2QJS A;  2YNV A;  1P9E A;  4GYU A;  4J5H A;  2I7X A;  4RM5 A;  4YSK A;  2BGA A;  4C1C A;  3I0V A;  4DIL A;  2AIO A;  5ACV A;  5HH5 A;  4D1T A;  2YZ3 A;  3IEL A;  2P4Z A;  1E5D A;  2YNU A;  1X8I A;  4EXS A;  4RAM A;  3Q6V A;  5LCF A;  1WUO A;  3IE0 A;  4B87 A;  4H0D A;  5ACS A;  1QH3 A;  2FU7 A;  4D1U A;  4NQ6 A;  2BFL A;  3SFP A;  5LMC A;  5HH6 A;  1ZNB A;  5LS3 A;  4EY2 A;  1VME A;  2NYP A;  1BC2 A;  2CBN A;  2YNT A;  5EHT A;  5AXO A;  4UWP B;  3SBL A;  5EWA A;  2R2D A;  2WYM C;  5EVK A;  4C09 A;  3I11 A;  5B3R A;  5ACP A;  3ZQ4 A;  4KEP A;  2VW8 A;  4V0H A;  5A0T A;  2FK6 A;  2BG2 A;  4YSL A;  3SD9 A;  3ADR A;  3RPC A;  1JJE A;  5ACX A;  4J5F A;  3BK2 A;  3VQZ A;  3DH8 A;  3FCZ A;  2FHX A;  1SML A;  4NQ5 A;  4DIK A;  3P2U A;  3RKK A;  1A7T A;  2XF4 A;  3T3N A;  4Z60 A;  4ZEJ A;  3AF6 A;  2NZF A;  3H3E A;  4BZ3 A;  3I14 A;  3KNR A;  2FU6 A;  4FEK A;  2AZ4 A;  2Q42 A;  2BFZ B;  2BFK A;  4C1E A;  1YCH A;  4AX1 B;  4EYB A;  3T9M A;  1VGN A;  4EXY A;  5LCH A;  2I7V A;  5FQB A;  4FR7 A;  1HLK A;  2P97 A;  1ZTC A;  2GFK A;  2ZNB A;  4C1D A;  1M2X A;  3ZNB A;  3G1P A;  2BTN A;  4Z5Y A;  1DD6 A;  1QH5 A;  4XWT A;  5B1U A;  4WD6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...