3BK2A

Crystal structure analysis of the rnase j/ump complex
Total Genus 168
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
168
sequence length
549
structure length
549
Chain Sequence
QDHVEIIPLGGMGEIGKNITVFRFRDEIFVLDGGLAFPEEGMPGVDLLIPRVDYLIEHRHKIKAWVLTHGHEDHIGGLPFLLPMIFGKESPVPIYGARLTLGLLRGKLEEFGLRPGAFNLKEISPDDRIQVGRYFTLDLFRMTHSIPDNSGVVIRTPIGTIVHTGDFKLDPTPIDGKVSHLAKVAQAGAEGVLLLIADATNAERPGYTPSEMEIAKELDRVIGRAPGRVFVTTFASHIHRIQSVIWAAEKYGRKVAMEGRSMLKFSRIALELGYLKVKDRLYTLEEVKDLPDHQVLILATGSQGQPMSVLHRLAFEGHAKMAIKPGDTVILSSSPIPGNEEAVNRVINRLYALGAYVLYPPTYKVHASGHASQEELKLILNLTTPRFFLPWHGEVRHQMNFKWLAESMSRPPEKTLIGENGAVYRLTRETFEKVGEVPHGVLYVDGLGVGDITEEILADRRHMAEEGLVVITALAGEDPVVEVVSRGFVKAGERLLGEVRRMALEALKNGVREKKPLERIRDDIYYPVKKFLKKATGRDPMILPVVIEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Metal dependent hydrolase
publication title Structural insights into the dual activity of RNase J
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Hydrolase
total genus 168
structure length 549
sequence length 549
ec nomenclature ec 3.-.-.-:
pdb deposition date 2007-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07521 RMMBL Zn-dependent metallo-hydrolase RNA specificity domain
A PF12706 Lactamase_B_2 Beta-lactamase superfamily domain
A PF17770 RNase_J_C Ribonuclease J C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.580 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3bk2A03
3.40.50.10710 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Metallo-hydrolase/oxidoreductase 3bk2A02
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 3bk2A01
4V0HA 5ACUA 3AF5A 3SBLA 2E7YA 2Y87A 2YNUA 4ZO2A 4D1UA 4EYFA 2OHIA 1P9EA 2OHJA 2YNVB 4NQ2A 3KL7A 1YCFA 4RL2A 5EH9A 1VGNA 3ADRA 4YSKA 4ZNBA 3IE2A 4D1VA 3FAIA 2M5CA 4FEKA 4J5FA 2I7VA 3JXPA 3Q6VA 4YSLA 5EVKA 4GCWA 5LSCA 5HH6A 4BZ3A 5EWAA 2WYMA 3VQZA 3X2ZA 2GMNA 3KNSA 2BMIA 4EYBA 1Y44A 2OHHA 1K07A 2YNTB 1KO2A 3IOFA 5K4NA 3X2XA 2ZWRA 2BG2A 4XUKA 4C09A 2NZEA 4ZO3A 4EYLA 3MD7A 4Z5YA 4PVTA 2I7TA 1XTOA 5AHOA 3ZWFA 2FU7A 2GCUA 4KEQA 3T3OA 4RBSA 3S0ZA 5ACSA 1L9YA 4TYFA 3ZNBA 4DILA 1YCGA 3IEMA 5HH5A 5LS3A 5A0VA 5EV8A 5AYAA 3PY6A 5LLDA 3I13A 5ACQA 1DDKA 3A4YA 3P2UA 2NXAA 1M2XA 2BFZA 4HL1A 3WXCA 4PVOA 4RL0A 5K4MA 5ACRA 4AX1B 3LVZA 3IEKA 3L6NA 2GKLA 3IE1A 1VMEA 2FK6A 2FHXB 1X8HA 1X8GA 2QJSA 4HKYA 4D1WA 2Y8BA 1QH3A 4UBQA 2P4ZA 2BGAA 4AWYB 3IDZA 5A0TA 4GYUA 3RPCA 3FCZA 2WYLA 4RM5A 2BFKA 1KO3A 4FR7A 2YCBA 1QH5A 4GYQA 1BMCA 5EV6A 3VPEA 3BK2A 2UYXA 2HB9A 5EVBA 3I15A 1A8TA 2WYMC 2BC2A 3I0VA 4ZEJA 5HIPA 2BR6A 2BG8B 2XR1A 4DIKA 2I7XA 3QH8A 1ZNBA 2FU6A 2VW8A 4UA4A 4AWZA 5K4KA 4HL2A 2FM6A 2YNVA 2BIBA 3T9MA 5ACPA 4EXYA 3DH8A 4AD9A 4UWOB 1YCHA 2Q0JA 4U4LA 4WD6A 5B1UA 4Z60A 4UWSB 5LE1A 1E5DA 1JT1A 1ZTCA 2Q0IA 5LM6A 1VJNA 3I14A 1KR3A 4FSBA 5HISA 4RAWA 2YNTA 1X8IA 3X30A 3G1PA 3DHAA 5FQCA 4UAMA 3IOGA 1MQOA 5AEBA 4UWPB 4XWWA 4C1FA 3F9OA 5HIOA 2CBNA 3R2UA 5LCAA 2BG6A 4BP0A 3BV6A 1ZKPA 3PY5A 5FQBA 4B87A 2M5DA 1WW1A 3SRXA 5A5ZA 2QDTA 3T3NA 4C1HA 4LE6A 4TZBA 4Z5ZA 2YZ3A 4TZEA 3TP9A 4D1TA 3RKKA 3IELA 1XM8A 5HIQA 2WRSA 5A87A 2YNWA 4NQ6A 4TZFA 3AF6A 1JJTA 4J5HA 5AXOA 3ZR9A 5LCFA 4F6ZA 1A7TA 2AIOA 5HH4A 3RKJA 2NYPA 5FQAA 2QINA 3SD9A 3SFPA 2FHXA 2Y8AA 1DD6A 4TYTA 5EW0A 1JJEA 5EHTA 4C1CA 5IQKA 1DXKA 3SW3A 2BG7A 1BC2A 5LMCA 5ACWA 2ZNBA 4XWTA 4AX0B 1WUPA 5ACXA 3BK1A 4NQ4A 2FU9A 2A7MA 4UWRB 5AXRA 4CHLA 4NQ5A 3H3EA 4JO0A 4Z6XA 5B15A 5LCHA 4Z67A 4F6HA 2P18A 4YSBA 5ACTA 2BG8A 3ESHA 2GFKA 2DOOA 2QDSA 1WRAA 2XF4A 4D02A 5K0WA 5B3RA 2WHGA 3DHBA 2BFZB 4C1DA 2BTNA 4C1GA 5EVDA 4H0DA 3KNRA 2ZO4A 3DHCA 5DPXA 4EFZA 1BVTA 2Q9UA 3SPUA 1HLKA 5KIKA 2GFJA 2R2DA 5ACVA 3X2YA 3IE0A 4EY2A 2NZFA 2ZZIA 4C1EA 4RAMA 3AJ3A 4P62A 2P1EA 3I11A 2QEDA 2H6AA 4KEPA 5KILA 3ZQ4A 2BFLA 3BC2A 2P97A 2AZ4A 5AHRA 3PG4A 1SMLA 4O98A 4Z7RA 1WUOA 4TZ9A 4EXSA 2FU8A 2Q42A 2DKFA
chains in the Genus database with same CATH superfamily
1OI2A 3NYWA 1C1HA 2WWZA 1TUEA 1PT5A 3W1WA 3OX4A 3B1FA 3PS9A 4I50F 2OCGA 1GJZA 421PA 2LRHA 3FDZB 5EH9A 3AFMA 2QTAA 1SPXA 1B23P 2VH2A 3FPEA 1ID1A 3MJ4A 1LFAA 4HAXA 1LCIA 1NDHA 5EWAA 3D02A 4R7TA 3CZPA 5KCZA 3FVTA 4LYAA 2LMCA 4NXNB 3G2MA 3CEHA 2JFNA 3RC3A 1MOPA 3RASA 4YMTA 1JFVA 4ZVPA 4BNDA 5JNUA 1WRBA 1KK0A 2K4MA 2QP4A 2WYQA 4N9QA 4NZLB 4LXYA 2XN9C 4Z9FA 1LRKA 4NV3A 4C00A 1QCCA 1N2OA 4LAFA 2TS1A 3D7LA 2FFJA 5LS3A 4XGQA 3L7MA 2AN3A 2ZUBA 2FCNA 2I6UA 3A1SA 1VCNA 1ZG3A 1PI3A 4HY3A 3WK4A 4DWOA 4KQ9A 1XZMA 4EZEA 1H23A 2PGAA 4WAUA 2GD1O 4WWNA 4A23A 5G3ZA 3EFOA 4H1TA 1FVXA 2GZSA 3EISA 2X76A 1P91A 2KHWB 4ZHQA 1BMFD 1NZJA 1C3LA 5F4ZA 3CA8A 2QQ5A 5LQAA 3BJZA 1UKCA 5KNBA 5KZMB 2YYZA 3WV5A 2VTEA 4N58A 3C4QA 1OIWA 1QWSA 1YJ8A 1G64A 4FYPA 1G41A 5KQRA 4HQNA 2V6MA 1ADFA 1K86A 1BG6A 3N76A 3P4YA 4PG7A 1YI0A 3TLCA 3K5IA 4C06A 5ACPA 1H4QA 1M1UA 3E61A 1DAIA 4X24A 2ZUWA 3AEEB 4HWGA 3P52A 2I2YA 2IBIB 1CDZA 3BWCA 5TPWB 5LE1A 3W5CA 1P0CA 1YL6A 4ZO7A 3HDJA 1QZUA 2BHNA 3P4SB 2IP2A 4B8ZA 1OV6A 5F1OA 5I9BA 1Y9EA 4WEOA 1H5UA 2KJQA 2RI0A 3FILB 1W85A 3NOOA 4YP6A 2J85A 1XF5L 3K92A 5BPFA 3BIJA 2VCEA 1D04A 1R18A 4XZ4A 3MHSD 4MV7A 2PKQO 1CVRA 1GFWA 2GNAA 1SXJA 4LRQA 2IPOA 2FG5A 1HDZA 2IK8A 1EA5A 1P4SA 2H1SA 3UGTA 4CMBA 4DLSA 1CZLA 3DWFA 4XB6B 4ARVA 1SCQA 5JCXA 3HACA 4J1QA 4CUJA 2R84A 3B9PA 4L5JA 5C8YB 5AVUA 3M4JA 3IVFA 4ZHSA 2QX4A 3O82A 1X8XA 2AIOA 1VFPA 4P53A 1QPZA 1O94D 3SFEB 5AESA 3GP7A 5ALRA 3I34X 1ISGA 2QRMA 5F76A 3REGA 2IYSA 5LIRA 1X1MA 3AIIA 3OMWA 5IYZF 4CLDA 2V0NA 2VK8A 3OMXA 4YCSA 1A4IA 4J2HA 4JO0A 4E11A 3MYRA 3LOQA 1SE9A 2JJQA 3AE7B 5EUQB 3WCQA 3OO1A 5F78A 4N0MA 5IX8A 2BAGA 1Q17A 3RSLA 1ADJA 3U2QA 2B4KA 3OQIB 4BV9A 1NLZA 1UDXA 3BIID 3D6HA 1W52X 1UDAA 1BE6A 4MICA 4AX4A 4AK9A 2FKAA 1Z6QA 4P1ZA 1KVRA 3S55A 4EB0A 3K5PA 3OWEB 3LQ4A 4EW3A 2VT3A 5IOIA 1PX0A 2KDIA 1QGED 2W9NA 3D0OA 5AOCA 1U5BB 2OESA 1N36B 5KYXB 2NUPA 2B9VA 3QEKA 3KZ1E 3AU5A 3RD2A 2ZRCA 2A0KA 2QEDA 4KDFA 3JQAA 3A36A 1GPKA 4GMVA 3A6FA 2NUAB 3F7MA 4D9IA 4GLSC 2VDOB 3WALA 1M2EA 2X7HA 3BRWA 1BYUA 2IUSA 2VSQA 1XAGA 1UK7A 3P9XA 3KD3A 2C5EA 2ODTX 2OV4A 2J7PD 2RGNC 3FMGA 1PWHA 4G4SO 1Y7TA 1GAWA 5IVIA 4TWJA 1NVTA 3A1VA 4O0MA 1VD2A 2PX0A 1K89A 3NR2A 2PMFA 4GCWA 3C0KA 3RSQA 1NTOA 4F86A 3FUWA 3SR3A 4URHA 2OBNA 3O26A 3BMOB 2ZUVA 3FAKA 4D0SA 1CQWA 2Y4NA 4Y0NA 2H3EA 4H59A 4QM6A 3KJXA 5CMLA 3KHKA 4C30A 3F6SA 3RN9C 3TYXA 8GPBA 3L10B 4LK2A 2JGIA 5A05A 4UTNA 4F46A 4U7JA 4ZDJA 2J0SA 4OTZA 1NFQA 4YJFB 1OLSA 4YI5A 3HA7A 1RJGA 5F2OA 4RSGA 5MGNA 2I65A 3ROFA 1T6BX 4PZ9A 3QVXA 4LA4A 2GA8A 5E8JA 4UUPA 1X92A 1QLJA 3W0LB 5E6UA 3DAPA 3X23A 4LYJA 4UATA 2DUUA 4DB4A 5ACRA 5HZGA 1DQRA 2CFCA 3WNBA 3PQ7A 3H18A 4UBLA 4YK7A 2DQYA 3VH3A 1JLSA 3CNNA 1WZUA 4ZOAA 4FR7A 3OZWA 2JIZA 5F1YA 3L17A 2NTEA 2FUG1 4P7KA 2F3UA 3TL5A 4KFTA 2Y66A 2PAAA 1V48A 2BFWA 3UT5B 3SHOA 3D64A 3ONEA 1XZHA 4CM8A 4QUEA 4C87A 4PWYA 1T5HX 2BH9A 2R4QA 4PYZA 1KSFX 3NOVA 1D4AA 3VGPA 5KDDA 4JLVA 1FJXA 1WDWB 1YFJA 1RWNA 3JQ8A 4KE8A 4FDVA 5CYPA 3AEFB 1PZHA 3QOWA 2Y9PB 3PA8A 3HDYA 3AFNA 5COQA 5CM8B 1Z5VA 4K8OA 3HCEA 2CXQA 4XWAA 1T4MA 5MFPA 3EXHA 4B34A 3H6KA 1SKUA 1BXGA 1PR2A 2V7XA 3F97A 1JKMA 2FUCA 5A4MS 1UP7A 1PCXA 3E70C 2LKCA 4ARIA 2BYTA 1IE3A 2K25A 4RVSA 3LHFA 1NOJA 1U0OC 3D6VA 2EHDA 1C29B 3OOWA 1Q1GA 2ILTA 2X8XX 4OGFA 3JYHA 4PQYA 3WIVA 1YZ3A 3GEEA 2PR7A 1P7ZA 4HQ6A 2IZ7A 4Q4LA 4EMTA 4C5AA 3CJTA 4W9HA 1PNVA 2GD6A 2QZ4A 2XK5B 2GMWA 3FB1A 5ABPA 3DVLA 1NLFA 3EZNA 1XHFA 1CERA 2CE7A 5HH4A 2O8FA 3BE8A 3CBQA 3IOMA 3NGMA 2H89B 4ERXA 1VRWA 3K8OE 3VUEA 4BQRA 3G2LA 1FEHA 1KQPA 3MJFA 1DAFA 1R4MA 3F67A 4QO8A 4PAGA 4R1PA 4CTOA 4AL4A 2VPPA 2CVQA 4JJAA 4DIDA 2XSZA 4NBRA 3LY9A 4I5IA 2F9FA 3C8YA 1XPRA 3B38A 1P72A 2JARA 1NW7A 1WZCA 1ZUIA 3K9WA 3T5GA 2EBWA 1EWTA 1DKMA 3N0TA 3MT9A 3MGKA 3OJFA 4M22A 1VGVA 4MRRA 4FN2A 2EDAA 1U8YA 1ULUA 1FNVA 3PT2B 4IW3B 2JZZA 2LD9A 3BX1A 2XRFA 1I42A 1FSSA 4KMSA 4FHKA 2YUIA 4C1DA 2ASEA 1OFGA 4Y6QA 2BTNA 4UDNA 1DIBA 5ECDA 4AVYA 2HMAA 3DA8A 1SOWA 2CYAA 2DUMA 2ZTVA 5C3MA 1IQPA 4D46A 3G5TA 5DLYA 2FPIA 1G98A 2DSTA 3ICVA 1ZEMA 3FVWA 4NYIQ 3MMZA 1JA0A 3TQTA 4D9HA 1UC8A 1K5HA 3LHSA 5HHTA 1ZKHA 3RTBA 2WC1A 1DRWA 1EJ2A 1EUCA 2BF4A 3ONFA 4KLZA 1N2CE 3V6LA 5AW7A 5FA5A 4Q4CA 4F4CA 3WY9A 1PL6A 1AQ6A 4IIFA 1JJVA 2GD2A 1AZTA 4FULA 5MGBA 3P97A 3MIZA 4AU1A 2FOXA 1JT2A 2RGRA 4ZNBA 3DBRA 4FQ7A 1V9JA 4YJ2A 3IQFA 4WESA 3QJGA 4F1SA 4QZVA 1USUA 4H9GA 1YZUA 4L8GA 2P6PA 3OO0A 1YV9A 2WKQA 2H5EA 4S2EA 3JZMA 2EZTA 2QUZA 1ZM2A 2DT5A 4HRSA 4IILA 5M5BA 4AJ4A 5ALUA 4G67A 1W8IA 4N76A 4WBNA 3SSOA 2IPAB 3L5OA 3CW2A 3HRIA 1U0JA 1L5QA 5KVSA 3N3AC 2PR2A 3CIOA 1USIA 1T8YA 2IF0A 3K6SA 3LYYA 1CS0A 4JLCA 3H0KA 1N32B 1BX1A 2GPSA 5BN1A 1H4VB 3Q2OA 4KXVA 1TO6A 4EUEA 5ACQA 4YHBA 1CUVA 3SLRA 2W3SA 1E2IA 5CG1A 1J20A 2PMCA 4R8SA 1LRJA 4KQIA 1EFTA 3I1JA 2K9XA 5K3CA 2RHHA 5SZHB 1CUSA 1DKRA 5GONA 2IC5A 1V11B 2A58A 2DSNA 3SNKA 3TDMA 1IJBA 1I4XA 3T34A 1MB4A 5JT1A 3RUAA 1FFVA 1IGDA 1MTOA 3A2MA 4POAA 1SCAA 2IGDA 1SM4A 3DQPA 4AMUA 1HQKA 2B3AA 1GZHB 3QQ5A 2XT9A 3OFVA 4PTLA 5TJHA 2QAGB 3DWGA 3AM3A 3FVRA 2P67A 5DDIP 2I67A 1M73E 1NBMA 2V96A 5DULA 5JS7A 4JLAA 3K53A 2Q5EA 1QOQB 1UK6A 5EE0A 3D7NA 1XWIA 1DBRA 2H17A 1W5EA 2KJRA 3EDMA 1CZHA 4IFIA 3ANSA 1KTKA 1BEZA 2UYHA 2BZ1A 1VLMA 4HQLA 5E6SA 3W6PA 4M0DA 1IBXA 3WLTA 4C0BA 2FQ1A 3PJEA 4Z8XA 3WSWA 3ZJ5A 5TF4A 3NDRA 1EIWA 3JAKB 3R0QA 3WKDA 4JB8A 4JZYA 1M1YE 4HLQB 2M2IA 4QJIA 3VVMA 5FWXB 2Z5GA 3CLKA 2Z8LA 4GNKA 4YRGA 1GUAA 5AK5A 1SGWA 3O47A 4M98A 3SS8A 3INRA 2ISCA 5A5ZA 4JR0A 3WWCA 5A9TA 1DBQA 2BJHA 4HRYA 5G55A 2QTRA 2OFWA 3CX6A 4I9UA 1QO7A 1G8AA 2JGNA 2EARA 4KN9S 3W7AA 1OKKA 2F8SA 2C7HA 3M3HA 3T4UA 1IXZA 2JBAB 3PUWA 1RYBA 2TMYA 3EXFB 4BO5A 4EI8A 4BE7B 1QOFA 4HRVA 3N8HA 3V1NA 2DENB 3OCJA 2HXSA 5LVAA 1X7HA 1BS1A 1P33A 1KZ6A 1KZ1A 3AUJB 5DNAA 4L8VA 4XI9A 4QRDA 4DIUA 4HX9A 4CZ2A 3FR8A 4A6DA 1N1EA 2CLFB 1OLXB 1K8RA 5HBGA 2B0CA 1XZQA 2H7CA 2RPQA 2AZTA 2QWXA 3OMLA 4ZEXA 1D3ZA 2H7XA 5A7FA 3VR6D 3C70A 3DMNA 2DF8A 3WB9A 2VDVE 1I3CA 2QEQA 2WU2B 2JAHA 2AK2A 4FSHA 1UGMA 1HY3A 3K96A 2EFDB 2BFLA 3SFDB 3F1KA 3A32A 1RYZA 4NCXA 3RIHA 1I2ZA 3DTTA 4HWRA 1BVUA 3VHXA 2J07A 3BF8A 4U2GA 1G2OA 3I05A 1IMOA 2ZCCA 4QGGA 5AW4A 3NFRA 3DMHA 5IKOA 5YASA 3IUJA 3BA6A 4CKWA 3PR3A 5TQ0A 2SCUA 3JALB 3QELB 2GBFA 5FUMA 1K66A 4PLTA 1Z68A 2CFSA 3LNCA 3IT2A 2R7KA 1N5IA 2V4ZA 1Y42X 2E4AA 1TYGB 1J7BA 4OHYA 4Q3BA 1GG9A 3LLUA 3DF7A 4C3OB 4EF5A 2O4CA 4KZ0A 1K07A 1VYHA 3DPUA 2BKVA 5GVRA 1ESEA 2I22A 1C7IA 2BI8A 3WLRA 2EMTA 1LQTA 3AHCA 3K3PA 1MR3F 1H42A 2ZQZA 4E03A 3V8PA 1U2QA 4OB6A 1F8UA 4P82A 3OQ6A 1FUKA 2OJWA 1WSAA 1WKCA 2Q3LA 3K1AA 2ZRMA 3M6XA 3KZKA 4GD3Q 5IHPA 3DL7A 1XCBA 1ZOPA 4XDYA 4DGSA 1RRVA 4K1XA 3ZH9B 1OE0A 2W2NA 4ARSA 2IYUA 5M29A 4E70A 4EPRA 3SIRA 4XRGA 4HB4A 3RU3A 2CJOA 3R9XB 4FB4A 3DH0A 3CUEF 3OIYA 1NJ1A 3PJFA 4BMNA 3LA6A 1LJLA 3QEMA 4E5KA 5G0VA 2OT3B 2DH6A 2DUNA 4D57A 4TWBA 5A0TA 4WNYA 4G37A 4A3PA 3NOBA 1FNBA 3ZDXB 3WHKA 4RAQA 3SX2A 3WWDA 2QC8A 3FF4A 2JKVA 3GEPA 3D0RA 5BSHA 4MDYA 3AVOA 3TCKA 3A4NA 3F0TA 1Q1AA 5BWOA 1T25A 3KAKA 2I6GA 1RBZA 4OVVA 2WAAA 1AQJA 1OB5A 4CGZA 3W5DA 2BIBA 5CH8A 5J5CA 5CX4A 2WU8A 3HZHA 2ZSHA 5CR9A 3KAPA 3N05A 4AFNA 1EJ0A 1Z5GA 1X13A 4AZ3B 4NDNE 1BDBA 1UZMA 3NWPA 1U2TA 1XHLA 2WP0A 4KXLA 2W55A 2Y8EA 4IFTA 3GUVA 3Q8FA 4ISBA 1SKYE 4PZPA 5JQGF 3CSFA 4EGSA 1HNWB 4DTIA 3ZDMC 4W5NA 6PFKA 3PFNA 2BJWA 1AUQA 4GLFA 4XSGA 1C3JA 1B15A 2I8LA 3KUZA 2A3NA 3MTQA 3KEMA 1KJWA 4HXYA 2R5NA 2QRPA 4LOAA 3AE9B 2D1SA 3SC4A 1ORDA 5LXTF 3OETA 1RCFA 3IHLA 1CUFA 1LW6E 1RRGA 5ADUS 2Z6VA 2J0JA 5EHXA 2O8DA 2FBWB 8ATCA 4HXGA 1UBIA 4MMXB 3QLUA 2MBHA 4NC9A 1VDMA 4UTVA 5B7PA 1V1PA 3AFOA 2YJ4A 3UWPA 4M9SA 1Z25A 2CMKA 5ERXA 4Y6LA 4ARAA 4FYIA 5IJ0B 4ZAVA 2B8WA 1ZIDA 3QA8A 1GRVA 4R69A 1DO2A 1PDVA 2K0PA 4PYRA 3OOSA 1V86A 3GPLA 4HH3C 1CJUC 1IIRA 3BORA 4CCYA 5AXRA 1SCIA 3DBLI 3CCFA 2O6LA 2QUAA 4NJ6A 1SO8A 4ZARA 3WWEA 4YRSA 2Z09A 2I7DA 4EYGA 4GFDA 1CU1A 4J07A 2C54A 1BDJA 2G83A 2YH2A 1VCOA 2REOA 4ZK2A 1V1RB 2V6GA 2OR3A 1A70A 1PWXA 3JR7A 5EVDA 4YRDA 1PEDA 4A5SA 5LP6B 2YZMA 1Y1QA 2BWFA 9ATCA 5F3WB 2CD7A 3SEZA 5D3DA 3HNOA 3IVCA 2PNJA 2HMTA 4L02A 1ZXIA 5BO5A 1GDTA 4D9NA 2VJQA 4TRNA 1UBUS 3MUNA 1H6DA 4KYUA 3AY6A 4J75A 2VAVA 3R3HA 1X1CA 2D3WA 4OLAA 4YMSA 1KZ4A 4OQNA 3VDRA 2BMAA 4Q3EA 2IJ0A 3G5AA 1U6KA 3TLMA 2KDMA 2QXYA 4Z1MD 3LBAA 4EHBA 1ZP6A 2YQ4A 3MMSA 1VCBA 2DH5A 1WGDA 1F17A 1L7OA 1P1HA 5JOQA 1LNSA 2OHJA 3B2EA 1A9XA 4M8LA 4U8HA 1JQEA 1EAMA 4UW9A 1QX3A 4NF2A 3SFTA 4OUDA 2IV2X 2PT7A 5SYMA 2G06A 4B3SB 2A8YA 3OHPA 3EUWA 3E4DA 3B7PA 5ERYA 1KI7A 2KBFA 4DCOA 3PGA1 5JSUA 3VOBA 2NZUG 3DDNA 4X9XA 5ALGA 3FCEA 3WGVA 1WO8A 2O2GA 4IUDS 3CU5A 3TPFA 2RH8A 1X8KA 3NNDA 1KAEA 3UZUA 4PANA 5ACSA 5JSFA 1QCYA 2RGEA 1W4CA 4BN0A 1V4BA 3TAUA 2BGNA 1CULC 4GP9A 2WGSA 1N63A 3I04M 4JLUA 5L95A 4RD3A 5FI0B 4KN6A 4OXNA 3BWUD 3JYPA 2WHPA 1SKAA 4RJTA 2PU5A 1K08A 5CDSA 2XEXA 1YC2A 4IIEA 3SEBA 7MHTA 1YB7A 1Z3CA 5IA7A 5HFYA 3GIDA 3M6UA 3MYYA 1YU9A 2FEPA 3A70A 1T6YA 4ZODA 3QF4A 4F7ZA 3GEHA 3KE9A 5D94A 1Y5LA 4LV6A 4JQWC 3VPEA 4E5YA 4DV6B 4MUGA 2OZPA 1A9PA 1P80A 3L6UA 2G3QB 3KVOA 4PLYA 2CEAA 4GDLA 1WXVA 1TRKA 1KRWA 4GDMA 1E1LA 4HUTA 4KR0A 2XB4A 3RE1A 1J7KA 5GMVA 1KI9A 3KUCA 4DSAA 4RZIA 8MHTA 4US0R 3AYZB 2IHNA 4XUEA 1L4MA 3D7RA 3H0CA 4BZZA 4N01A 3WQBA 2G8LA 1LQ2A 4JJKA 4PS0A 2MLBA 3ZZNA 1G6Q1 4JA2A 1CRZA 3HQ4O 3WYEA 2IEAA 2QRNA 1PK9A 3IAXA 2PPLA 4RDIA 3WGHA 3FTQA 4IWYA 5U4XA 5F7OA 1CE8A 4DQLA 2M0XA 2ZWPA 5DM60 4EKGA 5DTRA 3RADC 1MQOA 4C4YA 3BS4A 1TKCA 2RIPA 4GSKA 4Y2GA 1F7VA 4H6WA 3A06A 5CA0B 4QPJC 1Z5NA 1KYTA 1SD5A 4NNPA 3FHOA 3RU2A 1P1FA 5B30A 3WMGA 3TR5A 4MVJP 1K8YB 3IXLA 2NUTB 4JELA 3R3XA 3MIIA 3SYMA 2WUWE 3A6JA 2I3DA 3L7IA 4FE7A 4DPMA 4AJPA 4YRFA 1CK4A 4KAFA 4EYEA 2VPTA 2B7CA 1N2IA 5F64A 5GY7A 1SHTX 3IR7A 3OLVA 1TM4E 4KPEC 2Y8AA 4EPWA 3T12A 1T8TA 2BG7A 4YAIA 3OTOB 4C0JA 3R3YA 3A3NA 1U99A 1AHNA 5LKAA 1K98A 1H2FA 5BSGA 2JFOA 2QYSA 2OCYC 2JJ8A 1I6MA 4JV5B 3DMTA 3G2NA 3V8RA 2RHTA 5DLQC 2CC2A 3VJRA 1E66A 3UUWA 1Z4LA 3CX8A 4WLEA 1VI6A 1RFLA 3WDMA 2QDXA 2DFNA 5CB6A 2EKIA 3RNFC 2EAUA 2CZCA 2VYND 4U1RA 3NYQA 2ZSBA 4J4BA 3G23A 2J45A 1NQ5A 1OW3B 3PFBA 1NSFA 4FMPA 2OFPA 3DFZA 4URUR 1YQWA 3SIWA 1XRRA 3BMCA 3FMOB 5DYYA 5JALA 4QUIA 3GJ4A 3IOYA 4JKOA 1PEAA 2POCA 2WIDA 2FGKA 3HGQA 1EH5A 1JG2A 2BDTA 3PL1A 4O4LF 3VVWB 2JYTA 4O98A 4X1KB 1NVVR 1G7CA 1M3SA 2NXCA 4YL8A 2CHQA 4BKRA 3JYOA 2R79A 5AVQA 3SR6A 4N1AA 1LLFA 3NLLA 2L32A 3FPLA 1U3TA 4BTEA 3L18A 4MGIE 2P3OA 1G5HA 3KFLA 5T5QA 1I9CA 2YJZA 3ZDEA 3S1AB 5H70A 1Z2NX 2WVJA 2AN4A 4XTRA 1TUGA 3RIXA 2CVOA 2QAIA 4EG0A 1QZZA 3AVWA 1J0DA 3UMYA 1F14A 3GJ5A 1I2DA 4RFSB 1IB6A 1URPA 2YZGA 4RZXA 2W8BB 2BT6A 3GRUA 1THTA 2GAOA 3FD8A 4LI0A 4CN9A 2XTZA 3DE6X 3I9KA 2PD3A 3CZRA 4FNGA 4TX1A 3OT5A 2O9JA 2N7JA 2HPAA 3RVPA 4Y2PA 1YCGA 3IHKA 4JY7A 3ROPA 1NBIA 1U8CB 4D42A 2YHIA 3MQ2A 4HCNB 1L1RA 2K39A 2WUVA 3OOEA 1L5HA 3BB4A 2HR1A 1DEXA 4M21A 2ALJA 1L0VB 2V1UA 4GOJA 1E92A 1LPBB 2HQ1A 5JSKA 4I6EA 4OLHA 1WX8A 3GYGA 4JBLA 4X1OA 3D54D 1DIOB 3K4PA 3TCAA 4D6PA 4C56C 2YIJA 2PZGA 3N2EA 3MRXA 2CGEA 1W4LA 3SVTA 1WSWA 2Y77A 3LC1O 4B40A 4IH1A 2QTMA 1SIWA 2NP6A 4NEGA 4AG5A 2PZKA 1E6EA 2AMLA 2V3SA 1NWHA 1SWWA 1YVEI 3I8SA 1G6JA 1FDTA 5D3MB 3GZNI 1H6BA 2RGXA 2GILA 1UZUA 2BR6A 2GXUA 3FAHA 4TQ0A 3JW0X 5FPKA 3U3OA 2CNNA 1K27A 5J58A 1I7DA 2NXEA 4DA4A 3UIOB 1T6ZA 4R3NA 1SXQA 2VF5X 3PDIB 2ZAYA 1RC1A 3APCA 4OIMA 5AT1A 4FSBA 4RAWA 5C81A 1WSDA 1H8CA 5LQUA 3WDKA 1F7UA 2JKYA 2JGFA 2IYAA 3HFSA 3GYBA 2EEPA 3EVFA 3NP9A 1OGJA 5ALWA 3EAGA 2OXTA 5EDSA 3PR2B 1ZO8A 3GD7A 4ALMA 4UM9B 1JYFA 2GZMA 5JY1A 3EPHA 4YECA 1EX7A 3QWHA 2O8CA 1TMGE 4O02B 2HLDA 2GJAA 2P1ZA 2M1XA 2FWIA 3KOUA 2BDUA 4ANVA 2QJWA 1TT5B 5FP0A 2ATIA 2PKQP 4MDFA 1TTNA 2W58A 1XXHE 2VSFA 4EECA 1FXWF 2O8EB 1V2GA 5CNMA 2K5UA 2V7QA 3KQSA 5AJHA 2JEOA 4QASA 1ABFA 4A82A 1X0VA 2PLNA 1A5RA 1ETUA 1B8NA 3ESDA 4U9HS 3K0AB 2HYIC 4ZT3A 4UDOA 1EK2A 3LUJA 1BCSA 1MC5A 1MIOA 1RR6A 3IH5A 4JGHB 5FKAC 4EKEA 1W8DA 2UZ4A 5G5HA 4DDVA 1FCCC 1R4NI 1QH8B 5CCEA 4Z6XA 2CFIA 4M1KA 1PJZA 1TAHA 1T2CA 5LYJA 1OJLA 3UA3A 3QFHA 4K2HA 1XL1A 3EOZA 1P3Y1 4JLDA 4ZAFA 4ZIRA 3VNQA 5DEIA 1PIWA 5JY6A 3HM3A 3KVYA 3TQOA 4PN7A 2WXMA 4XX0A 1E5XA 1KJTA 1VPWA 4CEHB 2Q2VA 4U2BA 3SEFA 1GQOA 8LDHA 3TSYA 2QTWB 2A94A 5BR8B 4KQFA 4F21A 2V7BA 4NENA 2PSFA 2P1DA 2NT4A 1CCWA 4Q7KA 4W9MC 4CFSA 4PPYA 4RH0A 4NJEB 3L0IB 3WOVA 1D7AA 1Q7BA 3EGVA 3MUFA 1F12A 5KSZA 1Q3KA 1PYGA 1K68A 5GZ6A 4JJZA 1IONA 1SBIA 3ZDBA 2VHXA 3S99A 2OCPA 5DSZA 2EIXA 1BDHA 4WFQA 1T2DA 1Q74A 5G3YA 3ZY5A 2C3OA 4LG1A 3O1IC 3KJFA 4P4UA 1APBA 1V35A 2HIHA 2HV9A 2D0DA 4E6PA 4KI7A 3CKKA 1TPYA 1YCFA 1JB1A 4CDNA 5E0OA 4EELA 3AG6A 1V37A 5ARDA 3AEUB 3HBJA 1IAQA 3L7LA 3ONWA 5DGCA 5CD9A 3IQIX 2LJIA 3EH2A 3EEOA 4J0CA 5J59A 1T0JB 4G4SP 2QTVA 2Y68A 5E3IA 2FJUA 2WMNB 2WXLA 2E37A 2R86A 4EYLA 1LLUA 3QBJA 4XOUA 2YVKA 1E2KA 1KU0A 5FT9A 5THQA 2IH5A 1XZJA 3G0CA 4F45A 2E85A 4BQPA 2O2IA 3GFRA 4Z2YA 2BSAA 1SY7A 4QO7A 3OP4A 4FS8A 5NLLA 1VHJA 3AFHA 3PI7A 3IP5A 1Y5MA 3BTVA 4NIMA 1DC7A 3RRZA 3GUZA 4LXXA 4UU0A 3PPVA 1PZFA 4QRIA 2FP3A 2N0SA 3IBTA 2OUKA 2WD9A 3T5AA 2M4NA 5LOVB 1EXVA 2PL5A 3ASYA 1BNCA 2RHDA 5BURA 1HMYA 4MDKE 5ALJA 1SPBS 3KSZO 4DANA 2M1MA 3PV0A 1Z12A 3N07A 3OSZA 4JLWA 1EVJA 3RO7A 2O6HA 5FV7A 1QR6A 2WJ4A 2YRXA 3K1ZA 1R0WA 4MJXA 1YZQA 4E6EA 1QOPB 4MUAA 2NADA 1RQ7A 2YWFA 3I76A 1YC5A 3A04A 3EE6A 2RGBA 5C8YF 3U4AA 1W4AA 2G67A 2XTNA 4L4YA 4IQ0A 5IKCM 3PIRA 2MTBA 3EA5A 2JDIA 2VS1A 5HWSA 3JTMA 3T9MA 2MYUA 1NN1A 4D80A 5AOBA 4U5XA 5C52B 5BVGB 4ZVRA 4CEJA 3FKSA 3TRFA 1ZVVA 3PXXA 1S3SG 3V4PB 4K5QA 3S2GA 1KI4A 3VDMA 4IR7A 4MZDA 1AC5A 3D9QX 2NTTA 4Q4JB 1JJAA 1V3VA 1NRXA 1W1UA 3KKKA 1WW8A 5DLEA 3WYFA 4UAMA 3ZW7A 4B45A 2J6CA 5IKXA 1HK7A 3L8CA 1A71A 4HG2A 2ZRNA 5I7EA 1UKYA 3EIEA 5B2EA 3W2GA 4GE3A 4EBBA 2C29D 3HP1A 4FDAA 2V5VA 5EINA 2LCFA 4UULA 3A6LA 2FDXA 2WW8A 4JXKA 2B4YA 2HM7A 3IEIA 4HPXB 3ESRA 4OI0A 3I6ZA 4MW2A 4NQ6A 5E4FA 4XE5A 3BB1A 1RZVA 4ND8B 3IVAA 4AJKA 1V9CA 5FDFA 4BZAA 4TV9B 1C79A 2ZJOA 4P7JA 3T7SA 2DFVA 4C01A 5GINE 1THMA 3EFHA 1KYWA 1LSUA 3B9RA 4E32A 4H3SA 3WNZA 5TEVA 3LXXA 3FPJA 1YN4A 3OHSX 2E49A 5FTJA 4N3NA 3C6ZA 5GTDA 4EKYA 1EM6A 1ZH8A 2EL9A 4M36A 3AUXA 4LHYA 1ROEA 4RE5A 1T5TA 1BHQ1 3WJ1A 1V8ZA 2QVBA 5ACTA 4KJXA 3KQQA 5KNCH 4A0RA 1B00A 1GY8A 1OFTA 5BVHB 2ACKA 4R7GA 2BCJQ 1KI2A 4ZRDA 4IJWA 4FMDB 3WZ2A 5BQPA 2CJWB 2N1MA 1K6MA 4JBNA 3G0OA 1G8FA 4EPTA 5AHXA 5DM2A 1N4DA 3ON5A 2CDRA 5EJMA 2NVBA 2XIJA 1U11A 2JCXA 3QCAA 3VV3A 1ML4A 3WIDA 1GLGA 2ZI4A 4WJOA 2PYIA 4C0XA 1CZPA 2QQEA 3KQKA 2EZUA 3SYNA 2QAJA 4IIJB 1A77A 1ZNQO 4JEMA 1T1SA 3IP1A 5E1BA 1YQDA 1FDVA 4LECA 2FPPB 2YN0A 3VYSB 1VL6A 4RTOA 1D1PA 4YQFA 4NJMB 4MITA 2P9CA 2B8EA 4LJLA 6Q21A 4DV2B 1KJYA 4BYGA 1WZNA 2I3ZA 4H3KB 3SDBA 1Z2AA 3GJYA 4EKUA 1A5SB 4PIVA 4YGYA 4L57A 3ADRA 3C48A 3GWZA 4EUTA 4X63A 3DFFA 4FS3A 4RKWA 1L5MA 1GGMA 1T0PA 4JLPA 1JHXA 5FPPA 3UAVA 1MRSA 2P2YA 5A6SB 3KXKA 1PV4A 2HQBA 1UCFA 1D4OA 1U0HC 2LKDA 2F7SA 2PVGC 1Z6GA 4NZYA 3GBPA 5LP1A 2Q5OA 4YRBA 3DLHA 2OFXA 1QYVA 2RG7A 2WJAA 3TNYA 4M9ZA 3RI7C 4Q24A 1F38A 2B1RA 5FV4A 2PUJA 2X6QA 3BINA 4RORA 2CJYA 3RBZA 1JILA 1KC1A 4IGIA 2XAUA 5FX2A 4RS4A 3FYSA 3V4VB 3CT6A 1VKJA 1R1DA 1RPTA 1XZCA 3PY6A 4G0PA 4H0CA 5DCUA 4O2LA 2FI1A 1UMDA 4A4DA 4F5DA 1W73A 4ZZIA 1CQPA 5K6RA 4C7KA 2NZ8A 1AQNA 2QX8A 3DW3X 3LO5A 4O8CA 2XUOA 5CA1A 1KMCA 1E3SA 1XNRB 5DB4A 3PIIA 2PXXA 1WZEA 4M0LA 2BE7A 3PFCA 1OBFO 1IRIA 3GIWA 2PIAA 1QFMA 5K8TA 2EJUA 3DP9A 2UYYA 4EH1A 2Y8BA 3ROXA 3W9BA 1ECJA 2RAPA 2BVNA 3LZDA 4DR4B 1GG3A 4UXJA 5H1YA 1HFWA 1SVLA 2HDHA 5DN6A 5FWYB 2AFHA 3QVWA 4M9RA 2Q3FA 4FJ2A 4KQXA 1C0IA 3Q7QA 1QTNA 4M7WA 2DR3A 1KH2A 2MP2A 4L4UA 1CD5A 3RKUA 2IP1A 1U4SA 1D6EC 4TRJA 4B76A 5B6PA 1GYQA 4G5SA 1O4WA 4G0NB 5P21A 3RJTA 4P0PB 1BHO1 1HL7A 3MN1A 5IJZA 2EQAA 4DOMA 1KBOA 4WKCA 1XJ5A 3ZCTA 2O50A 2JCYA 1H0HA 1IATA 4IHKA 1B4DA 2QRLA 4FCCA 2OGUA 5KOIA 4Z5XA 2V9HA 3RG8A 1VIMA 1PR1A 1T2FA 4NZPA 2P5YA 4R68A 3I42A 3Q3MC 2LBPA 5I9TA 3KQVA 3IOGA 5ADWA 1B8VA 5TGDA 4DY4A 2K6GA 4OHKA 2V98A 4AJIA 5TY0A 3ELWA 4U6QA 3KJHA 2AQKA 2C5AA 2H4JA 4X1IA 4K9NA 1Z45A 4AQYB 1GNTA 5DCLA 3DBHI 1GAJA 5DFAA 2H4ZA 3SZMA 1BROA 2OCXA 4A1FA 1U2RA 4GRAA 1J1UA 2E3TA 3UIPB 3GLKA 4HDOA 4DDWA 3S28A 3QUQA 1AGXA 1KQ3A 3GCGA 3B6KA 4HYEA 5DF1A 4DV1B 4LBZA 4F97A 1DOAA 1E8XA 1AQLA 1Y4SA 2P78A 2PM8A 3SD9A 1RABA 4CMEA 3W5IA 4OF4A 1HR0B 4XARA 1JVSA 5B12A 4K1LA 5AJYA 1H93A 3HC7A 1KFCB 2R44A 4ZT7A 4O6VA 1PVVA 1RAAA 3AVPA 2FHSA 3OBBA 1NJ8A 2Q0XA 4E5VA 1WI0A 2HCBA 2HF7A 4HMPA 4L4XA 3UMSA 4YFVA 1SU8A 1KVQA 3AERA 4TL7A 2QLTA 1PNTA 3DQZA 5EXTA 1VKNA 3T99A 4Y1EA 4PU0A 3ED5A 3SIPA 3KNRA 1J19A 4CODB 2ZRGA 3GQVA 5EI5A 1ZMTA 1BMLC 2VFAA 3GT4A 3HCNA 4MVJF 3DC2A 1YRWA 3IO5A 4FWTA 4HNVA 3R7SA 2R6HA 4DR7B 4AZWA 3FDFA 2M8SA 3T1VA 3CNBA 5IT9A 4GVLA 4BN5A 3CF6R 1UQUA 1IB0A 4IJMA 1P7PA 3T3EA 5JAMA 3F5QA 3WE7A 4KNYA 3V1YA 4RF3A 4IKPA 1UD7A 3S3TA 3CSUA 4LJPB 1JW9D 1QHEA 1WPGA 4LNUB 5BNWA 4EYFA 2HSDA 1TYDE 3TQHA 2A4MA 4MKXA 5HIIA 1QIMA 3TMAA 1C1YB 4JUBA 4ID9A 4TL8A 4ND1A 2OORC 3AHHA 1XNGA 4BO4A 3CONA 2BRUC 2COKA 1GSAA 3HABA 4WJPA 3MOGA 1LDEA 3GT3A 2R96A 2DFTA 2GXAA 1CFJA 1XAHA 1JZSA 3M4YA 3ZLJA 2W2KA 1EZ4A 3ST7A 1E4YA 2Z95A 1EEXB 4KVAA 3HKEB 5K45A 4EPVA 5BQFA 1KFBB 5C5DA 3AVYA 4BB0A 3DMFA 2Z3ZA 2AYOB 2VSXA 3G6KA 4W1PA 4MUMA 1F8GA 2XITA 2EWVA 4ZQGA 3CUSA 1L9YA 2QM8A 4JLSA 2PMKA 1ILEA 1P77A 1ISRA 4L8WB 2YWXA 2WMYA 4RF4A 1QLHA 3NANA 4D25A 2XZDA 4J0EA 3KEOA 2XOEA 3IDSA 3BULA 5HKLA 4K9OA 1GCAA 1TUIA 4H7FA 2XUIA 4D4JA 3Q1KA 1Q0ZA 2DWPA 3JTEA 4HZUA 5JXJA 4E7PA 3HE3A 4D3SA 1CXZA 1RWOA 4XWKA 5C7LO 3TL6A 3IO3A 2QT0A 2GF0A 1YE8A 5KHOA 4FM9A 2JJ2A 2XZOA 2GBCA 2CNOA 5JTUA 2Q6TA 2UYXA 1GITA 1VL8A 4YAWA 2CYCA 4GX2A 2D7CA 4MR7A 2V7PA 4WKNA 2Z5LA 1A98A 2PMEA 5BQOA 1WBJB 1KAOA 3H7PA 1Q19A 2F3QA 4DIMA 3W3AA 2RK4A 4UPVA 4G5OA 4HHEA 3NIGB 4AMYA 4K0RA 2MJDA 4K2AA 3UV6A 3QF7A 2LGIA 3ZNZB 1CUXA 4A90A 1UNSA 4JNKA 1SA0B 4M3NA 3JD3A 3HDVA 2XYGA 4TLBA 2JAWA 3H5LA 3VR5A 1RLTA 3LW8A 2XVAA 5HF8A 1Y8ZA 1T0RC 2XIQA 3BWDD 4O1NA 5G53C 2KB0A 2YFHA 4LX0A 2BN4A 1ESDA 2MBQA 3DPIA 1PV1A 1C1DB 3TZKA 4FWBA 1Q7RA 5FO0A 3MT8A 3G9UA 3J80A 2AIRA 2DB3A 4N41A 2QMHA 3AJRA 2BBCA 2E5FA 5EUMA 2E5LB 3BICA 3ECAA 4UU8A 3ZDQA 2CG3A 2A3RA 3IBFA 5DW3A 3IX7A 4BS9A 4ZI7A 5TQVA 2G76A 2ZJ4A 2DGDA 3TIXA 3B5IA 4AS2A 4Z9AA 1P73A 1H8HA 4YDSA 1CHDA 1H2AS 5KNLA 2HQRA 1E4EB 2LWIA 2FZ5A 2WIGA 2NGRA 2CLIB 1YOVB 2LRUA 2GI9A 4GL4A 3CRMA 1Z5PA 2Q9CA 3RUPA 3JWHA 2C2BA 4MRVA 4C0KA 2HWUA 3OA0A 4OFBA 4LTDA 4KRXA 2E82A 2ZVJA 4A6PA 1PW7A 1Z3IX 2HAEA 1U65A 1X1DA 1YOBA 1E9RA 2Z3WA 1EVEA 5HVNA 2BW0A 4UU7A 5AUQA 1U98A 3K70D 4UCXA 3GUYA 4W9NA 1BAPA 3SC2A 2DERA 5CB4B 1E2MA 4HGPA 2WQ7A 4GM0A 1OWPA 4L50A 3UM9A 2AWTA 4BEVA 4IUBS 2X0RA 4YN3A 2QY6A 2NPFA 3V1MA 3A25A 4LJ4A 2JAXA 4FNOA 3U7JA 2L8JA 1GG5A 3L8HA 2P97A 5IVKA 1EUZA 1BHJA 3VKFA 1E7WA 1WY7A 4NCIA 2BP7A 1GU0A 1EK0A 3TUOA 3ZWQA 4OYRA 3OE4A 1P8JA 1R0ZA 5CM9C 1S9HA 4AN0A 1I7HA 4FWIB 1RI3A 5JCOC 2OHIA 3T8MA 1LO5D 4OZBA 2L69A 4Y6PA 1JEAA 1GSOA 4CI9A 5KYUB 5A7HA 3FRIA 2WD7A 3RAGA 1MZPA 2JFVA 3TEYA 4FR5A 4OGKA 1AKWA 2WM8A 3PDJA 3VZRA 4G86A 2HW8A 3BH7A 3UK7A 2B3DA 5LL6P 4CHGA 3K2QA 1MH1A 2XE7A 2C77A 3ZXIA 3B48A 3J81A 3TOVA 1G5QA 2PL1A 1K6JA 1H4RA 5SICE 1WZ2A 4D3FA 5KWSA 4U8GA 4ZRJA 5JROA 3UATA 2G5PA 4QAQA 5FOUA 4UTXA 1ODIA 1H85A 3PJGA 1AS3A 1PKEA 1GTJ1 3BWEA 1EK1A 1RI5A 3W1SA 1SVSA 3FWYA 3GB1A 5G4LA 1EUDB 3PC3A 2C78A 4J90A 3B6ZA 3HKCA 2VJOA 3OM9A 3WX0A 4KDEA 1NW9B 2H59A 2MA9B 3ACBA 3L92A 2VTDA 4W9KA 4PZYA 2JHFA 2AJBA 4XDHA 4EQ6B 3IT0A 5DH9A 2WU0A 1CR0A 4XYLA 1QM5A 4B2LA 2V7TA 4N82A 7GPBA 1CQJA 5HUJA 5DCWA 4XLTA 1L4FA 1MGPA 1V6CA 2ORVA 1Z4OA 3DZ8A 4EY8A 1F2TA 2VYVD 1W1WA 4M1SA 2KMMA 2XRZA 3SYLA 3CINA 2ZSEA 1T6XA 1WWKA 1PZXA 2CJNA 4MQ4A 4KYIB 4ALKA 4XW2A 3UFXA 3Q6NA 5FFFA 4PLCA 3NBAA 5T64A 4EA9A 2WYWA 2A1TR 3NHMA 5BOSA 2VJLA 5L53A 2HADA 2J48A 4ZMRA 4P98A 4TT8A 3DD1A 1JLKA 5AVXA 3ZHUA 5JTTA 4M0PA 1KJIA 4OBWA 4MACA 4F5ZA 2G80A 1EJ6A 3RODA 2BTEA 5CYGA 2PZBA 5B2ZA 5EMHA 4FGKA 1WF3A 4YDQA 3RS9A 1CVIA 1C7FA 1BCRB 4O5AA 2PWBA 1IULA 3TVTA 4GU2A 2J0QA 1MG8A 4XIJA 2POQX 3RYFB 5A9SA 1FS5A 5C4IA 1MJHA 5ALNA 2XCIA 2P3LA 3T1HB 2JW5A 5BSFA 2XWJI 4RD0A 5LP6F 2IW1A 4MKGA 1ZIYA 4RD2A 4I1PA 3LKZA 3TTVA 1GV0A 1G2PA 2QNIA 3AVTA 3O2SB 3SICE 2BJVA 3A0RB 4J16A 3G9XA 4CG1A 4DG9A 4TZFA 1H2YA 5BW4A 4JBGA 4WX2B 1JI3A 2BFFB 2P1RA 3T5CA 2QQFA 3DNFA 4EEXA 2K2QB 3AVXA 1V2HE 2NU9B 5EHTA 1DXKA 1Z9BA 1K1EA 3PQ8A 4LDPA 1S7GA 1HE3A 1P2BA 2KQ4X 3AV3A 3CVVA 4TMAB 5EE5B 1AGYA 1RS0A 3KQMA 3SF8B 5BY2A 4D9JA 4IXDA 4AZ0A 3JQ9C 3ICQB 4ZICA 2X8LA 2ZIEA 1OV4A 3C8UA 4WD3A 2WD8A 3ESHA 1GA1A 4QG7A 3ETEA 1N62A 4DWJA 1LF0A 1BE0A 3VC3A 4UAVA 3F8SA 3QOXA 4H77A 4DAEA 2ERCA 3D6JA 5JDIA 1XG5A 1YR8A 1R8XA 3R8FA 1FBNA 3MP9A 3P2JA 4R9RA 2ZJFA 4ZEOA 4KKIA 1VA4A 1JWAD 4NARA 1KOJA 1X7XB 4J8PA 3LY8A 3IEUA 2WPDA 3ZG6A 1F1JA 1CUIA 3NUQA 1ORHA 1HO3A 4DCCA 3ADBA 4XKJA 4QQ8A 1VHTA 3R75A 4EOGA 5JYDA 1G5IA 5M3BA 2ESRA 3AKDA 3G13A 2BH2A 4A3SA 4MM3A 1JQLB 1RTTA 1KIAA 4CV0A 1R3UA 2QLJA 2VDNB 1E7VA 1VGNA 3I3SR 5HSGA 4RTPA 2QL5A 3E3OA 2C9MA 1X9HA 4MSQB 5IKEA 2F00A 1ECBA 3RZFA 2ZR0A 3ZIAA 3SU8A 5AJUA 4J43A 5JNSA 4X7RA 4ND4A 2IYZA 2IHVA 4JYCA 1WJNA 1HTTA 5CGZA 2X9QA 4A9AA 1YS7A 3GNTA 2IPMA 1JGTA 3OT1B 1DWPA 4JYAB 2Q4EA 4KTVE 1ZESA 4JPSA 3GH3A 1C3VA 3D31A 2VP9A 3H9EO 2P9YA 3AH8A 2ICIA 2XB8A 3MRVA 5K01A 3KQTA 4TQUS 2VUTA 3HBFA 1VR9A 1XX6A 5CT4A 2GM4A 1XYVA 5TQJA 3TEXA 3OLQA 2PZFA 5KPDA 2XQGA 5F5XA 3PLVA 3N20C 4D1WA 1JMLA 1ICEA 2IZ0A 4I19A 3SZRA 1U3GA 5CA0F 2FK8A 4U7TB 4HPJB 3ZW3A 2WIBA 1FRRA 3VISA 2V65A 3LFTA 3PDHA 3URYA 4N5DA 3RC1A 3AN1A 3U7QB 4LOKA 1NF9A 1X87A 3VXKA 1VECA 2ZI3A 2RBKA 4B82A 1VXRA 1L4NA 2D62A 1GB4A 3CLTD 1TAUA 1K7CA 1A1VA 4F7WA 3I9LA 2W2LD 2H4HA 1QKJA 4WK0B 3DEIA 3ELBA 1HXYD 2ICAA 1DQYA 4G5HA 1L5NA 4I1YA 3LQ2A 3RUDA 2VDPB 2OAGA 2BONA 2HHLA 5JO9A 2HF9A 3DVQX 5ER9A 2QK4A 5ALLA 3OOHA 4OG2A 4QDOA 1TVKB 2YIDA 1QIDA 5JAHA 4OXQA 4WLUA 4LWQA 1WXXA 1JFTA 5CHVC 3CB4A 4IICA 3LUCA 4MHTA 4QUKA 3USCS 4TLCA 2DM6A 2GCGA 2YWJA 1T29A 5AI6A 2R00C 1PRYA 1TZOA 1LX6A 1MG4A 4PBSA 4WK4B 5F73A 2Z5FA 3HZRA 2GJKA 4TXNA 2FF7A 5GMOA 3WRYA 3TKYA 1WZ0A 1JDBC 3DLAA 4EAAA 3OZVA 1M34A 3A9JB 2A30A 3B60A 2DBRA 4H7PA 3TIVA 3KQWA 3PQDA 5IM4F 5K2MA 1OXUA 3H2BA 5KSPA 2CWDA 3DUFB 3RHFA 5JD3A 2FAXA 3PHGA 3FFXA 5GV8A 4EZKA 3I92A 1Z2MA 3E9SA 4AROA 5DHAA 3UYLA 4UTRA 5B36A 4NQ4A 3JW8A 1V80A 4J2TA 3U44A 1R0RE 1Y6ZA 4HAIA 1ZNXA 2MSED 4DA7A 2JLYA 1QZTA 3BIFA 1KYIA 2MSKA 2WABA 2GBMA 2IFTA 2I80A 4BMDA 2NCNA 2HJGA 2PWPA 4ACBA 4V1CI 1Z4JA 1KPGA 1ZL0A 1P0PA 1I3LA 2MHCA 3NVDA 1UINA 3LYUA 2MJ3A 4INAA 4QHSA 4RVNA 4RKYA 4LJ6A 5F2NA 1KYZA 2WXIA 1P1KA 2DKNA 3FDIA 4UCFA 5AMXA 1UOQA 4M9CA 1SVUA 2QW1A 5KQGA 2PY6A 5L3VA 3PRJA 5AVJA 5C80A 1Y3BE 3GB9A 3E2MA 4QDZA 5D3QA 1JAIA 4CF4A 1WUOA 2EF0A 3AUSA 3HY3A 3MD0A 2WYOA 4N3CA 4P80A 2GF9A 5TLSA 4BV8A 2ZI5A 2V5UA 4R2IA 4YAFA 1TZ2A 3D8TA 5K6AC 4D1UA 4ZMBA 4NFLA 1ES9A 1TZJA 5KYWA 2OPBA 3QX3A 2XLBA 3OE1A 1T0HB 2F43A 3I9JA 4D9FA 2GPYA 1RC0A 3N8IA 4GXNA 1UP4A 4PBRA 2BISA 4GOND 2ZM5A 1R64A 3FSRA 3P9ZA 5DM70 3ZXRA 1V7QA 4WINA 3N8KA 4FLHA 1TIKA 4FIDA 1DUSA 1DFHA 2HHHB 3U30A 2BBSA 1F0KA 3VKVA 3GLFB 1WF6A 2VWPA 1BHSA 3W77A 3P9RA 3PUKA 1TU0A 1KKLA 3T1TA 3LXRA 1CYEA 3AO0B 4KE7A 3U0BA 1N33B 4UUOA 2HQOA 3JARA 3C0RB 3W9CB 2J6HA 1EU4A 5EOVA 2FH5B 3VYWA 4UTZA 5CCDA 1L4EA 1MG5A 4TS9A 5L9AA 1PTJA 4QATA 5AVTA 1UMCA 2V3NA 2BGFA 4QXOA 4QD3A 2HU5A 1AOXA 2GEJA 4OHFA 5G41A 5HOEA 4J6EA 1NW5A 3OJ4B 4KRYA 4K6OA 2QD5A 2I91A 1GRQA 1CP2A 3RPEA 2XUJA 4IG7B 4NJOA 2SBTA 5CCBA 4DJDC 2A67A 3WLQA 1SJED 1UBLS 3LWBA 3R7NA 4U00A 3PTAA 1IJFA 4L16A 2P4ZA 4DV4B 1UEIA 5AKEA 4JWSC 4U2FA 4AXBA 4GW3A 2HL6A 5F21A 5EUCA 3IQZA 3B6MA 1QGYA 3RV4A 4P2BA 3OICA 1R2QA 1B2LA 1VP9A 4W9FA 1ZWLA 3U26A 2CR5A 4O2AB 4MP3A 3CE9A 4WMLA 3VJMA 5DPWA 2ERYA 3RYTA 1A8TA 3AXCA 4D9BA 1KR2A 3PR1A 2BOVA 1Z8FA 3BMNB 4GLOA 4IHJB 3ESXA 3B89A 2ZYVX 1K97A 2VDRB 1S2OA 3FWZA 1BDIA 1CR2A 1F8FA 3RQSA 2PBFA 3QYJA 4D7AA 1JS1X 2G4SA 2O1EA 4JGIA 1RXEA 4CQLB 4ZYNA 3R5XA 1XLQA 1M76A 4E7OA 4D3YA 3JATB 2AEHA 2J32A 1Y1SA 3FWPA 1D4ZA 1E2EA 5CUQA 3PXDA 2AJCA 5K3OA 4JBXA 1UMBA 4TUYB 1QVAA 3AKEA 4CQMD 2FPLA 3QAQA 4IEFB 1A5ZA 4PT5A 3VR9B 4NBKA 2PD4A 3B3QA 2FWPA 1TJEA 2WLSA 3NNNA 4FEAA 3T5DA 4BO0A 3C3XA 1GNVA 2Y1OA 4BQFA 4LNAA 1YZYA 4JJ7A 4G41A 2P5UA 3G9TA 3C8DA 2O7VA 4QX6A 4XYMA 4LQDA 5CAEA 2YMMA 4ZPXA 3ADPA 2VQ3A 1L7AA 2I4LA 5BN5B 4JC8A 2MR5A 3AI7A 1VKZA 4A15A 3P9QA 2C04A 1Y82A 1NHGA 3LDUA 5JJLA 1UH5A 1ZR2A 1PJQA 2NAFA 2RHBA 1VJ1A 5JJCA 2JVCA 2JCGA 1GTG1 4TYTA 1JJEA 4COOA 2G08A 2J9FB 1JXQA 2RKBA 4H0FA 2GK6A 5HHDG 4HQ0A 4BNUA 5C1BA 4RDCA 4L4SA 1F2RI 2B35A 3ZDTA 4TV8A 4NTZA 3HP4A 4YP7A 1BA2A 4U2CA 4X8HA 1MB2A 4KWHA 5CFOA 3F5SA 3TNJA 1RZRA 1XZBA 4L8LA 3PQEA 3FBWA 5DTQA 2XYVA 1RLJA 9LDBA 1V5FA 2H1OA 1W2GA 5LUBA 1GTRA 1JDVA 4MB2A 4X84A 2DNFA 5AKIA 2J3EA 1GFZA 2ZUUA 4D9MA 3FY4A 3IE0A 4ENWA 3HN6A 1VL5A 3QX1A 4GYJA 2VUIB 4KBFA 3VQTA 2YHSA 1GT6A 821PA 1OA0A 4AZTA 5B55A 5I4KA 1IY8A 3BCHA 3FCSB 1UK9A 4PSAA 3C3KA 3L43A 3PUIA 3UHFA 1NDUA 2OBYA 3VNBA 4D6XA 2JUOA 2ZKLA 5KTKA 3FCXA 1QHIA 4YWHA 4IC7B 2J33A 4U7FA 2YBDA 3E5MA 5LOVF 1IOLA 3IVMA 1MENA 3L93A 1P5HA 1KWKA 3S70A 1HFKA 1V47A 2CY0A 2XDYA 5ETJA 5BYAA 4UMDA 3Q6VA 4HO1X 3M2PA 4BQEA 1KHTA 4I55B 4U7DA 2J3IA 4KR2A 2FN9A 4LHEA 2I1VB 3U56A 4TKUA 1XMIA 3IOBA 3D8BA 3STVA 3L1UA 3MAGA 4CW7A 3OJLA 3QPCA 1Y8QA 1XQYA 1E9MA 3C3WA 3TCNA 4XB2A 3INTA 3VAZA 2WDVB 2HBQA 4BO8A 3BVGA 4Q4DA 4ASUD 1UWKA 1T9GR 3OZIA 4QHYA 1ZE3D 3EFOB 1T5XD 5BT8A 4P3XA 1RBQA 5EYPA 1A97A 2GA9A 4XDDA 4ZFNA 2V59A 4B7XA 1JEQA 1UPTA 2NU7B 2BGLA 4JUFA 1TQHA 3N7AA 4NCKA 3VSBA 4RIEA 1U6JA 1DXQA 2EVWX 1GAXA 3FNRA 2WTAA 4F4DA 1UZXB 4EFDA 3LCRA 1KFYB 2GN9A 1SOMA 4DLXA 4MS3B 3LDFA 3PJRA 1ITZA 2JT4B 5H59A 5BSWA 3PFKA 2ZI9A 3S1SA 3KG2A 3WAJA 5FTLA 1DMSA 1I2BA 2Z1DA 3TXAA 3KZMA 3TUIC 2B34A 4BMVA 2V9PA 3ZWMA 2GCOA 4I6JA 2FPWA 3TD2A 4PHHA 3UPDA 4X3CA 1ENZA 3H11B 4Q3CA 2GXSA 1DC4A 5DTMA 1MFPA 2GYUA 3QA9A 3NOXA 2O2XA 4WNCA 4BJ6A 4TV9F 4NNJA 1W5AA 3WK8A 1Q7GA 2PJRA 1CJCA 1NVVQ 2DWOA 1V45E 5EE9A 5CTRC 2CLDX 3A7DA 4Q16A 3E9YA 3DBIA 3KPWA 2YJTD 2W6JD 3GU3A 1YN5A 5LZ4A 2C59A 3HPQA 3EGDA 1V5TA 3NBQA 3HO8A 1JU3A 3CNOA 4RX1A 1QU3A 4AKHA 3AE2B 4MVWA 4KPUA 1Q21A 2OM6A 1D8TA 1A7KA 1J90A 3A9SA 3OEHD 2FR0A 1ZIXA 3OQHA 2VHYA 5MFZA 1E3QA 4TKLA 4US2R 1GPLA 1FFXB 3VBEA 4NQZA 3LJKA 3FB4A 3B3FA 5GZ1A 1WD5A 4FMDF 3OUZA 3NG0A 2FZEA 3HY4A 3B3AA 3EGEA 4FQ5A 521PA 1OLUA 1PS8A 1ZLXA 1Y37A 2CFUA 4NBUA 3FNGA 1N5LA 3RBXA 4Z5ZA 1O95D 3RS5A 5JW6A 3WV4A 1VKHA 1Y80A 2AXNA 4IYRA 1PJTA 1SUEA 2HMSA 2YNWA 3MVEA 2Q5JA 3L0BA 1I5OA 4IIJF 4EG3A 2GBLA 3ELYA 4JUAA 3VX4A 1DKOA 3A3KA 3N2KA 4M60A 3F96A 2XUPA 2VHZA 4O3FA 4PF1A 3C7CB 3RS7A 1MORA 2QD3A 2HPVA 3KFVA 1KYXA 2CHZA 5IAGA 5F2KA 1NC1A 1GB1A 2INNE 1ZW6A 2GO7A 1QK5A 3BK1A 3U1TA 2KYWA 2PWYA 2GB4A 3LCMA 1EFAA 2E87A 2V54A 4GM4A 2LW7A 4JHLA 2JI7A 2REQB 3MINB 3RS8A 4EGQA 5HYVA 2H1VA 1ISIA 2NUPB 4QLOA 4EABA 3DBSA 1Z5UA 3IB6A 1GTZA 4JP5A 2C0CA 3OHMA 1JKJB 4BUJA 3QWBA 4DSZA 1WUYA 1BJKA 3CRQA 4CMIA 2H29A 2Z98A 4DA0A 1R00A 4G01B 4YT0B 3W5VB 3RJZA 1DAOA 2WU1A 4DM4A 2H0AA 4OH7A 2NZFA 4R9UC 1NQVA 2YS6A 1GRRA 1QS0A 4HFJA 2JWUA 4TLDA 4MJSA 3LDZE 4JITA 4D4MA 3F98A 4B17A 3ORQA 3AP2A 3QMWA 5K0CA 2E4VA 3VVCA 3NBFA 1SBYA 1GOTA 3IVGA 1FU7A 3DO8A 1TC2A 2F48A 1GILA 4M8MA 3PSHA 5E2AA 1RVV1 1RHQA 3F47A 4Z4IA 1KL7A 2AQHA 1ECPA 2P9HA 3RLIA 3F4LA 1XCQL 5FFNA 4QBKA 2GPAA 4J3JA 4G09A 2FOLA 4MRAA 4W9GA 4MWSA 3RTGA 4KR7A 5CVJA 2P2DA 2XNDD 1LSSA 3ZTCA 2HDOA 4HEA6 4AQ7A 2NIPA 1XPOA 5BWCA 3MJDA 4IX1A 3IOFA 2M19A 4OVUA 1GZ5A 2R8EA 2BG2A 4EQZA 3GAAA 5BV8A 2C20A 5E4TA 1YR3A 2Q3BA 1K0FA 2WXGA 3GQBB 5JU6A 3UPTA 1TU3A 4OCZA 1EFUA 3OIUA 4R2MA 1UJ4A 1OC2A 4QXPA 1RU3A 1GD1O 3CXUA 1JG1A 4Z6KA 3PT9A 2HDNB 1IUEA 1GAQA 3M9LA 4X7BA 3PGVA 2IZ1A 2EU8A 2VT7A 1CPYA 1ZX1A 4X60A 5HRUA 3GGJA 1CZNA 3B8HA 4LV8B 2Q2QA 3VH3B 2X0JA 1C7JA 4KC0A 3RFVA 2ZYTX 5LIPA 3KL4A 4PPNA 2QX6A 5E3JA 3KDPA 1S6YA 3LWDA 3AEQB 2B61A 2X8JA 4P4TA 2O6VD 2JD0A 3G2JA 2Q4TA 1XDGA 3JQEA 5ITVA 1C30B 4YAGA 2HF2A 2JGRA 3WKBA 4HDMA 3H1TA 5HFJA 3PXBA 1Q6YA 3O1LA 3QRWA 3U7EB 4R8RA 1SF0A 3HN7A 3PHHA 4EY6A 3V4ZA 2BY4A 3SC6A 1YRAA 3FG9A 4OHCA 1NMQA 4CM9D 2UXBB 2GM3A 3PRMB 1MJGM 3BMXA 4Q4HA 3HMKA 2A7QA 1NN0A 2TMDA 4Z0NA 4MAAA 3BFJA 4FBLA 3AEDB 2ID7A 1XEWY 1XSEA 3ZJUA 3C97A 4GO1A 2JLUA 1SVMA 2XUGA 1WEKA 1K7YA 2WB4A 4BECA 5FUVA 4ZHPA 3MWDA 4MCIA 3TW8B 2BLNA 3BMQB 1MEOA 1GKKA 1FNSA 5DXAA 1CDDA 3G7NA 1PX2A 3E2PA 4JSRA 2BKAA 1OFFA 3AB3A 3DGFC 2A14A 1QFZA 4Y1RA 4QBGB 2L0TA 4YGXB 5F52A 1UT8A 4CKEB 4CMKA 5BO4B 4F93B 1FDSA 3F78A 4DMMA 4O1IA 5HRCA 3WQHA 3H19A 4UQPA 1XPUA 2LJ5A 1LDBA 3NORA 1ISHA 2ZRFA 5HPYB 3VX3A 3RF7A 2OV2A 1SCUA 1OPRA 5DHFA 1E8DA 5CB0A 2R8YA 3CUKA 2AI1A 3I28A 4HGRA 2M17A 3EGOA 2JFGA 3TRDA 2FEAA 2YW2A 2PUDA 1PFYA 4JI0B 4WZBE 5IG2A 1N7HA 2QPTA 4FSXA 4MWBA 2QR2A 4KQ2A 4WA8A 2G28A 4BO7A 5ALPA 2CU1A 1BVYF 5JISA 3VU1A 3WGLA 4C20A 2PUAA 4JCCA 4ER6A 2WXHA 5K2OA 1NMYA 4YROA 3ZLVA 5AW5A 3CIRB 1B1ZA 3PKZA 2R61A 3LQRA 4LVUA 2ZB7A 3LUKA 2ZW0A 3GJ8A 5I4DA 1GSHA 3QSGA 3PE3A 1CJBA 4NYMR 4YYZA 3QLJA 4G85A 1Z7GA 5FPTA 2BI7A 3OEED 5FA6A 2GFIA 3ML8A 2D4HA 4ZMSA 3EIHA 4B31A 2B4QA 3MLBA 4MV4A 4I8IA 1GR1A 1VG8A 1M5TA 4Y67A 1EGHA 1PFUA 1HNXB 3T0FA 5ELLA 3SQLA 2Q9BA 3PFIA 1LWNA 3PTFC 2QEJC 4K9PA 1J8FA 4B32A 1C4PA 3B5JA 4A91A 3SBOA 1IYFA 1PZEA 1Y8AA 4EHDA 2H0RA 2Q7DA 5FLKA 1DP4A 3UXMA 2ZSJA 1VL2A 4GS5A 2AA3A 1JFFB 4ZJUA 1X7YA 2JCBA 2I03A 3VZBA 5J43A 2PTLA 2PZLA 1QC5B 5ICSA 3QMPA 2C9BA 1NVDA 4ITUA 2XVMA 1SC9A 5TMDA 1NR5A 1QE5A 1Q3TA 2FEWB 2QA5A 2VXCA 4RYDA 3R7LA 1USGA 4HCPB 4Y7CA 3ESYA 4KGSA 4W6QA 2OWDA 5HFNA 5DP2A 2BELA 2OECA 1XN1A 2MSLA 2OYCA 1SRQA 3PPWA 2LI5A 1C1XA 3PXUA 3B1KA 3VQZA 5D51S 2JI8A 2JU6X 2DX5B 4P3PA 4QA9A 3SWWA 1EVZA 1PJAA 1HV8A 1SU4A 3AOEC 4C2TA 5HMLA 2JHPA 2W70A 3DO6A 3GGSA 3FTFA 2LWPA 2KFKB 1J2EA 4YXWA 1FZTA 1XF9A 4P32A 3GLGE 3KQNA 4NK4A 2CUKA 1G291 2QRZA 2YNMC 4KGRA 5GJWC 2IZ6A 4IG9A 4OM8A 3QOYA 4QTUB 4KQGA 4YUAA 4UDUC 4GX1A 1Q0RA 4F60A 5AYAA 1WR6E 5H9VA 1FIUA 1I0LA 2G1PA 1BYIA 4TVSA 4F3YA 2OD9A 3T3DA 2YXPX 5H0IA 1KPHA 2YWBA 4PS8A 2AG6A 4G1UC 2HD5B 2VRRB 4AO6A 1EFDN 5KTTA 3ROMA 3KYJB 3N8GA 2H2DA 2AN9A 1Z08A 1YTLA 1DMRA 5LDHA 2I2WA 1JVBA 1YASA 1YZLA 3VYTB 4F7DA 3AZPA 3P4XA 2C9YA 5EJ7A 3KTAB 1G1AA 1HQDA 1VLHA 3ND5A 3V4OA 2XUHA 2I7CA 2XOKA 3ETGA 5E6SB 1QDEA 4ZOHC 4OHUA 2DBQA 2C1ZA 2E55A 1MO3A 5L3ZA 1R8YA 4F04A 3PI6A 1NVFA 4JX9A 1HZZA 4ECEA 3M82A 4EXYA 5BXQC 2QE7D 1QGOA 5B1UA 3CO0S 4GMFA 5KKNB 2CXOA 3ZIDA 2YNTA 2AOUA 4CMCA 1F52A 4MS1A 3LYLA 1XVTA 5AICA 5F51A 3GZ4A 3L79A 3C5EA 1PR5A 1NNEA 4FLEA 1HBJA 5ICFA 2AFIE 2GRJA 2O2ZA 4JJEA 2X58A 4JI3B 1QB8A 4BV2A 2Q7OE 1WBDA 2V3PA 3NJRA 4C0LA 5BMIA 5MDHA 4WY8A 1N6NA 5CB4F 4CHKA 1FNMA 3IT6B 2BCGY 2KAJA 3RKKA 4RUKA 4GGOA 2UUAB 4J5HA 2IXGA 3W9YA 3GLQA 1F77A 2O3RA 2PWZA 3LBYA 4MIKA 2AS0A 4J3NA 1ZGAA 1I35A 4OK5A 4QFBA 3U2SC 1LPNA 3NCTA 1SZJG 3KVNA 1SQSA 4FCVA 3C3DA 4JJFA 1XPJA 1HTQA 3B1ZA 4G3XB 2BFEA 2IBSA 3TZCA 2JGKA 1IQ0A 2BFMA 4MELA 3NKLA 5FULA 4YSXB 4HI0E 5J2TB 1OGYA 1OGIA 2ZIFA 2O1XA 3L16A 4AULA 2B1JA 2ZK7A 5JBNA 2NPOA 1X1AA 2Q1SA 3ZKWA 1BMFA 2Q46A 4QDTA 1Y7PA 5HRAA 4QOEA 1NONA 5EHIA 3VDNB 4BB5A 4ZU6X 5FR1A 1R9MA 1I1NA 3VHRA 2O5EA 2ZPTX 4C7BA 4EFZA 4R0VA 3X1MA 5AI8A 3REQA 1RXIA 2BT4A 4AZSA 4DY6A 3LK7A 3BZUA 1SXJC 4BKSA 4OX9B 4N0EA 5AJLA 4QFMA 2Q3EA 1JDBB 1JN0A 2SCUB 3W5BA 2VJNA 4TWZA 4K40A 4TTSA 1NVBA 2D2FA 4GC5A 3V2GA 2BZGA 4K05A 1HLFA 1PT9A 4L5YA 2ZRQA 3BBLA 4DDTA 1OX5A 3T9CA 3IRUA 1QDLB 4BVAA 2YVLA 4HTAA 1FMAD 2Q07A 4F2GA 4OQLA 3LLMA 1G3MA 5HK9A 3KZCA 3NHPA 3I58A 2Y87A 1N2HA 1JTEA 1DWQA 4OKSA 2PNFA 5TDHA 4F5WA 3MCVA 2MDTA 3K9HA 2AG5A 3AL2A 1E3IA 3TLAA 2H00A 2Z6UA 3HHEA 2P6MA 1J0GA 2YQZA 4Q2JA 4G0MA 4XIYA 2C82A 3BSFA 3OF3A 3VPGA 5JS2A 3AMZA 1KMNA 3TJRA 1J0CA 5IKPA 2WY2D 2XKJE 4ZOLB 2YJ3A 2O3QA 1KI6B 5U9CA 4XEUA 3TLGA 4W9EA 4OFWA 1US8A 1AF7A 3LPMA 3O65B 4Z5YA 3PD7A 4ESOA 4EHNA 3FPCA 4KH1A 1O77A 1JAHA 1PGXA 2ZU6A 1GCIA 4HGQA 4D45A 1LA2A 3C2QA 2J87A 3HXKA 1NZDA 1UDWA 1O94A 3CTPA 1K9VF 3GFBA 4P9NA 2CHXA 1Y3DE 4QODA 4M7RA 4BNHA 3H84A 2FW6A 1DSSG 2C7BA 4L28A 1WXEA 5C5CA 3QY0A 4GXTA 4PYIA 3EPLA 1HGXA 3MGGA 3CWQA 3ES9A 1D6MA 3TB4A 1X14A 3ZYCA 2EYUA 3IT3A 2ZSFA 1M2VA 5BSUA 2XA1A 2B2XA 3AIKA 1DAEA 3K9FC 5T7BA 4P86A 4KP7A 1UBCA 1G5RA 1WXAA 2P2SA 2IUUA 2J0MA 4KGTA 4OATA 3IQHX 2IXBA 4BKQA 4L75A 4DYDA 2EP5A 3RR2A 2YVCA 1VRVA 3FCZA 2IYTA 3P2OA 3ZV3A 5HKHA 2LVOA 2FX2A 2OXEA 3BFXA 4MPDA 4FYKA 4KO8A 2Z8YM 5HJ2A 5J63A 2GFHA 2W2MA 4EFOA 1EBUA 3WBFA 2C03A 4L2IA 3DH8A 2K2WA 3ZJ4A 3NC4A 1PQWA 2VJMB 4MRSA 1NVGA 3GJSA 3CPHA 4RHTA 5I7WA 3PNLA 3ROZA 4QPPA 5I5EA 3A3OA 2Z0DB 5IH3A 3FOBA 4M9UA 4LTUA 2J7PA 2RHGB 4RVOA 3TEWA 3Q8KA 2JJYA 3BY4B 4AV7A 3KZXA 3QIVA 3TD9A 3EYAA 3CSSA 1U7OA 3CR3C 3NBMA 5EJFA 1G59A 4U63A 1ENPA 4PYJA 1E2JA 5CVUA 2ZI6A 4UHKA 2SICE 3SJZA 4DBLE 3ZVNA 1SUAA 3SF0A 1KS2A 3QJYA 2PH5A 2R6ZA 2FZGA 3RK0A 1WGHA 1EWYA 3T3NA 4UCQA 4B6GA 2GZRA 3JWEA 4PC3A 1JPNA 1NPDA 3W5AA 4Q9JA 2YJ5A 1FQWA 4FFBA 5FF9A 2UYOA 4CCYB 2EZ4A 2RB5A 2Q0HA 3SKVA 4CG3A 1PUXA 5DBGA 2XXAA 5CU7A 2QTLA 1WXMA 2QINA 4B6SA 3CR8A 1LZLA 3GL9A 1Y8RA 4E2ZA 4NE2A 1C9MA 4TMZA 3DOJA 3TPCA 3KSDO 4K9RA 1NJSA 4MKIA 2YKGA 4LJ9A 4E15A 3O38A 1GM5A 2LPMA 3KYDB 1KAGA 1BFKA 3VI4B 2JAPA 3UKOA 4CXMA 4Z67A 2LCIA 1BVRA 4F6HA 4DDMA 1WF9A 3KXDA 3ZGYA 2H9YA 3SZ3A 1VA5A 1PVDA 1DG3A 3E3NA 4UXIA 3EEIA 3PVLA 1FMLA 1IY0A 2A86A 5CLGA 2NSLA 1C50A 5ALYA 1SIUA 2VH1A 3EXHC 3FZYA 1N7IA 5BV7A 1B93A 2WIJA 4D56A 1IU9A 4RIGA 3NW9A 2ZAIA 4JIGA 1D1TA 1CUWA 2W2TA 4RVGA 3ZD6A 4UBNA 2ZPUA 1NJGA 5I48A 3N0WA 1ZJYA 2XQIA 1GYRA 4YMGA 3ZDDA 4GHWA 2KMCA 5LZ7A 5JAOA 4OUDB 3U1BA 1C9DB 2AZDA 4X8LA 4X91A 2LP4Y 2IW3A 4HPLB 5TR9A 2Y0CA 1K88A 5CT5A 3TGWA 3SHWA 3VUFA 5IBCA 3LSYA 1FLDA 3U52E 2PANA 2WWRA 2PQ6A 2QSJA 5KU1A 1TS4A 2RBEA 3LTNC 3R7WA 1DPGA 4XCQA 2KVRA 2J3HA 1V2YA 4TKVB 4PDXA 2OYRA 3N2NA 1E32A 2GT1A 1XZDA 2KTFA 4IM0A 1U1GA 3C43A 4FYVA 4F5YA 3IERA 5LSCA 3HA2A 2FWNA 4M87A 621PA 3ZNHB 1VIYA 2FRDA 1GPBA 4HN9A 3HB4X 4CEIA 2PE6B 2JAQA 4E1AA 3GLHB 4PZAA 3F6EX 2Z0MA 3FVQA 2A33A 4LOHA 4MIOA 2XMPA 3RHTA 3BHNA 4L6AA 4CI0B 1DKLA 2JIMA 1OEYA 3UUFA 5H82A 4JP3A 1NUAA 4B3MB 4IS2A 3CG4A 2F3RA 4D4IA 2ZWIA 2QW8A 2Q1WA 4MKHA 1W0JA 3SVZA 1RLOA 3QF4B 1CUZA 1AKYA 3LZCA 2QLNA 1XL0A 3DPSA 1YDEA 4B6EA 1RZ3A 1CY6A 4LWZA 3DCGA 2ACZB 2XVYA 1O0CA 3FDXA 4HDQA 3ND7A 3AHJA 2KWUB 4C5CA 2LVBA 3BWYA 1P98A 3GP5A 1ADCA 4YCDA 5CXXA 2GPWA 1P44A 2I4MA 1HDRA 4AECA 4KREA 5JPIA 1AN9A 7ADHA 2RHJA 2QGNA 3F3YA 1VIVA 3VU8A 1FW6A 5BYRA 3CY6A 4L85A 3EHEA 4BX0A 2QTFA 1RMYA 2FY8A 4MEMA 1Z6XA 1L5WA 3GRPA 1CNFA 5CDHA 4ZYTA 4UEWA 4KO1S 3HUTA 3NKVA 2IDJA 4H1WA 1P31A 3GMDA 5TGZA 4V0NA 3N87A 3ER9A 4HADA 3TE6A 3IPLA 3T5PA 3VFKA 4H35A 2OXIA 4DA8A 1Y3AA 2HJVA 4Q9HA 1W9MA 1XCPA 3OIDA 1P61B 4BZWA 2W82A 4CM1A 3EMKA 2BFCB 3DEJA 4IJ5A 1W6RA 4G4JA 2H5LA 4BNIA 4BDSA 5F23A 2JGDA 5JXGA 3TTSA 4EITA 4RYLA 2PLWA 5DBEX 3O95A 3JU3A 3BXOA 2V8OA 2NVUI 4QU9A 1E69A 4AM8A 4DIEA 5FOSA 2CVFA 2W4QA 3DGEC 1YX5B 2QRUA 1WMEA 4NPNA 4DMRA 3WA6A 2IO2B 2I4RA 2ZT7A 1NIPA 1H1LB 1RM0A 1RAFA 2R8RA 4YYEA 3EBOA 5FQBA 3ZQUA 2C1XA 1JL3A 1YK1A 5DNWA 2OVFA 1RYNA 1P7FA 4Q9KA 3EF1A 3VU9A 3EN0A 4DL9A 4HV4A 1KEEB 3OPYB 4ARZB 1UM9A 4HR7A 1GGHA 3HV0A 4YCAA 1W35A 4NMWA 5DYGA 1MJDA 1QHHA 4UJ5A 3DHYA 2LVQA 3DWGC 2R2QA 2QRGA 3I6YA 1YRYE 2LFIA 1B0UA 1NE7A 3KAQA 1Q1NA 1PE0A 1LPMA 2O59A 3WIEA 3ANXA 5BRNA 2GYVA 1OY1A 1F0YA 5DWQA 1DC5A 2P77A 1ZJ5A 4C0HA 3AKZA 2VJYA 4HB2A 4FR2A 4RTSA 3T7TA 3IP9A 3BUSA 3LDGA 3LRTA 3LD9A 4I8DA 4Q93A 3LVBA 5D8DA 2UZ0A 3ZRFA 1MC1A 1VB3A 3AVQA 3SQMA 1GZSA 5ENVA 4O2BA 2G8NA 1EX6A 3EC8A 4ZU1X 3WB2A 3ABSB 3QE0A 5K0ZA 3FNFA 2GZ1A 4X92A 1Q5PA 1WJ6A 4MSUA 3KR9A 2BKRB 2QGZA 1ZVJA 3OCXA 3R2TA 4P31A 3REOA 1A9YA 5JWRA 2W0MA 5BV2P 1P3DA 3O0TA 2DYBA 2P4EA 3MCUA 3FYCA 3EVAA 3I57A 1V71A 3WNDA 3DZGA 4D9CA 4B47A 1TIFA 3D8SA 4NWIA 4WZAB 2AUTA 1FU4A 1LFDB 5CFRA 1QLBB 3HCDA 1EINA 1OI7A 2BHRA 3EPKA 2GRIA 1HDIA 1B16A 2V7UA 2JVIA 5DBIA 4PLPA 4CLRB 3WZMA 4DV3B 3KV3O 2XT0A 2R60A 1I2MA 1RXCA 1HNNA 3S8EA 5ALVA 1YD8U 3ZU4A 1S3FA 2HNAA 5KC8A 2QUBA 1FD6A 3PUJA 5EJ5A 2DZIA 1WB5A 4C0QC 4NI5A 1JLMA 4RK4A 1XT6A 5B1IA 2F8TA 4TTTS 5ISMA 4KRFA 2V97A 4O2AF 1WFYA 5IM5A 2X5KO 1YI1A 5EWJB 2VWHA 1L2TA 4Y8VA 3HDQA 1UJCA 4OMUA 4NAWA 4PFJA 4LHSA 5L40A 1CF9A 4IHJF 5LZ5A 4B8YA 2KQ7A 5J3JA 1TNDA 4TQ1A 3ETRA 3ZWFA 1L5HB 1WUIS 5NULA 5FWDA 2BQQA 4F56A 3DE7X 1ZUNA 2GHRA 5K3FA 1M2WA 4JC5A 4LVNA 4TTRA 3O03A 2FCRA 2H88B 5C1PA 2OCKA 4IQGA 2YC2C 4BFTA 1EG7A 1EDDA 2CSXA 2WXFA 4LJOB 1CUBA 4I5FA 5I4IA 4TUYF 1SCKA 2NO7A 3SS9X 3WADA 4LY3A 2OMEA 5B1SA 3GP3A 3QW4B 2ZIGA 2WSYB 4G24A 2H2HA 1YMHE 1XRQA 1G2QA 1V6AA 3RPCA 3RJ5A 4TXMA 2QJFA 3LYAA 4WLNA 1XF1A 4DRXB 2H85A 3VR6A 4PYKA 3O8QB 2ZZKA 3CFYA 5KYYB 3VNRA 3M2TA 2HDEA 3RSHA 4L8FA 2BEVB 4YMIA 3CVWA 3B20A 4YJGB 3N1XC 2D8AA 4DNQA 3RAPR 2ZXUA 2NBVB 2QUIA 5FBHA 3L0SA 3RUIB 3PDUA 2BTQA 3ZDCA 1WXGA 4UFOA 3WLOA 1MKYA 3ICEA 2XD4A 3K32A 4ND5A 3IBCA 5AKHA 5FL7A 1QP4A 2EWWA 1VE3A 1DTWA 4JVOA 3GARA 3OTQA 3HHPA 5GZ3A 1TM1E 3KQ4A 5H92C 2FPRA 1I3MA 1W49A 4Z0PA 1OFVA 4FMCB 3LBIA 1F2DA 1M2JA 2AC2A 4JVSB 1LVGA 3AR6A 3SRXA 1CUAA 2H1RA 3AULA 3RVJA 1KLGD 1BCSB 3ZHOA 1V1OA 3RT1A 1VSUA 4MGZE 4RPKA 1HURA 4WOBA 2O3UA 4G0VA 1KTIA 3DLBA 5I7RA 1TDJA 1GTVA 2GYWA 3VNUA 2WYIA 5AUIA 1IUKA 3M9XA 1QIKA 4JJ6A 3INYA 4LXIA 1COWD 2BCEA 3EIWA 2K5PA 1RYDA 3HKBB 3ETNA 2FHXA 1O6FA 3EDQA 4HLDA 2HZBA 3M1IA 1KVTA 3BYTB 1IWPB 2Q3HA 3JX9A 1E5WA 3EGXA 4LHWA 4M88A 4XX0B 1N6HA 4G26A 5JH7B 1FDWA 5BYBA 1JNXX 6GPBA 2ZB2A 4YV2A 4AMGA 3K05A 2C4NA 2ZI7A 5HUHA 1ADBA 1JHZA 2OOBB 3GROA 3JAWA 2QDSA 2ZVQX 2M98A 1SBTA 3AJAA 2BBOA 5D87A 4I55F 1PNRA 4URZR 2WHGA 3W6OA 3WYDA 1G8SA 2P9FA 2A5YB 2OO7A 2FG7C 3MFGA 4XCXA 3S2FA 4EENA 4YFYA 2GDZA 1IBSA 4KU4A 5JZSA 3VRHA 4OHOA 3EQ9A 1EWKA 2OEPA 2I8AA 4IQFA 3TTWA 1YBVA 5H02A 3KZOA 4MV9A 2L0XA 2EEZA 1M10A 4KDCA 1NJ6A 1V1MB 2V3VA 4JP1A 4POOA 5CVCA 3I11A 2AR0A 1K5DA 3BAZA