3BK2A

Crystal structure analysis of the rnase j/ump complex
Total Genus 168
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
168
sequence length
549
structure length
549
Chain Sequence
QDHVEIIPLGGMGEIGKNITVFRFRDEIFVLDGGLAFPEEGMPGVDLLIPRVDYLIEHRHKIKAWVLTHGHEDHIGGLPFLLPMIFGKESPVPIYGARLTLGLLRGKLEEFGLRPGAFNLKEISPDDRIQVGRYFTLDLFRMTHSIPDNSGVVIRTPIGTIVHTGDFKLDPTPIDGKVSHLAKVAQAGAEGVLLLIADATNAERPGYTPSEMEIAKELDRVIGRAPGRVFVTTFASHIHRIQSVIWAAEKYGRKVAMEGRSMLKFSRIALELGYLKVKDRLYTLEEVKDLPDHQVLILATGSQGQPMSVLHRLAFEGHAKMAIKPGDTVILSSSPIPGNEEAVNRVINRLYALGAYVLYPPTYKVHASGHASQEELKLILNLTTPRFFLPWHGEVRHQMNFKWLAESMSRPPEKTLIGENGAVYRLTRETFEKVGEVPHGVLYVDGLGVGDITEEILADRRHMAEEGLVVITALAGEDPVVEVVSRGFVKAGERLLGEVRRMALEALKNGVREKKPLERIRDDIYYPVKKFLKKATGRDPMILPVVIEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Metal dependent hydrolase
publication title Structural insights into the dual activity of RNase J
pubmed doi rcsb
source organism Thermus thermophilus
total genus 168
structure length 549
sequence length 549
ec nomenclature ec 3.-.-.-:
pdb deposition date 2007-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07521 RMMBL Zn-dependent metallo-hydrolase RNA specificity domain
A PF12706 Lactamase_B_2 Beta-lactamase superfamily domain
A PF17770 RNase_J_C Ribonuclease J C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.580 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3bk2A03
3.40.50.10710 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Metallo-hydrolase/oxidoreductase 3bk2A02
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 3bk2A01
1YCFA 5FQCA 5EW0A 1P9EA 4H0DA 4UWSB 5AXOA 2I7XA 1KO3A 4XWWA 5A0VA 2BR6A 4ZO2A 2BFKA 4C1EA 2E7YA 4TZ9A 2BFLA 4C1FA 4D1TA 2BG7A 4TYFA 2YNVA 3BV6A 2Q0IA 4DILA 2GCUA 3I11A 3BK1A 4Z67A 1Y44A 5A5ZA 2YNTA 4ZNBA 3I14A 5LCHA 5EVBA 3KNSA 2NXAA 4D1UA 4D02A 3SRXA 4EYBA 2OHJA 3DHCA 3F9OA 4V0HA 4TZBA 2ZZIA 4EYFA 4BP0A 5K0WA 2BG8B 3LVZA 5ACRA 1ZKPA 4J5HA 1KO2A 5HH5A 2I7VA 3QH8A 2BGAA 2M5CA 4RAWA 3RPCA 3KL7A 4HL2A 5ACPA 5EV8A 4YSBA 3X2XA 1E5DA 2QJSA 2WRSA 4ZEJA 2YNVB 3Q6VA 4D1VA 4TZEA 2P4ZA 1DDKA 3SBLA 2BFZB 3IELA 4EFZA 2Y87A 3KNRA 2FU9A 3SFPA 1ZTCA 4RAMA 1A7TA 5EVDA 1VGNA 2FHXA 3ZWFA 1XM8A 3AF6A 3ESHA 5B3RA 1XTOA 4RL2A 4NQ4A 1X8GA 3JXPA 4RL0A 5K4KA 3X2YA 5HH6A 4C1CA 2YZ3A 3IEKA 5EVKA 3DHAA 2DOOA 3DH8A 5K4MA 2BIBA 2AZ4A 3R2UA 2ZNBA 4FSBA 2YNWA 3FAIA 2FU8A 4C1HA 4U4LA 4UAMA 4C1GA 2GFJA 3SPUA 1DD6A 2I7TA 2Q0JA 4F6ZA 1DXKA 1A8TA 2NZFA 2GFKA 4EXYA 3FCZA 5ACTA 3AJ3A 5A87A 5HIOA 4EXSA 1M2XA 2WHGA 2WYMA 4Z5YA 5LS3A 4F6HA 2Q42A 2Y8BA 5HH4A 3PY5A 1JJEA 2YNUA 5A0TA 4NQ6A 3G1PA 5ACSA 5AYAA 4HL1A 5LM6A 5KILA 5AEBA 1X8HA 4GYQA 2R2DA 2XR1A 4O98A 4FR7A 4J5FA 3RKJA 4P62A 5B15A 3MD7A 3IEMA 2HB9A 4LE6A 5FQAA 5HIQA 1HLKA 4NQ5A 5LE1A 5EV6A 4UBQA 3SD9A 1WUOA 5AHOA 5EHTA 2BG6A 4BZ3A 4XWTA 1K07A 5K4NA 2BG2A 2P18A 2FM6A 2QINA 5IQKA 4PVTA 1QH3A 3SW3A 4PVOA 4JO0A 2YNTB 5FQBA 4UA4A 2NZEA 3TP9A 4YSKA 5ACQA 4D1WA 3P2UA 5LLDA 1BMCA 1YCGA 2FK6A 2ZO4A 4FEKA 3T3OA 2P97A 1BC2A 3IOGA 4TYTA 4C09A 4Z5ZA 5ACWA 1VMEA 4AX1B 5KIKA 5EH9A 3BC2A 5EWAA 2DKFA 2BTNA 2BC2A 4CHLA 2GMNA 3ZR9A 2BMIA 1WRAA 4UWOB 2BG8A 4GCWA 2Y8AA 3ZQ4A 2ZWRA 2YCBA 3A4YA 4RM5A 2QDSA 2UYXA 1JJTA 4Z7RA 4UWRB 4NQ2A 2QEDA 4YSLA 3S0ZA 1JT1A 3PY6A 4XUKA 4UWPB 2FHXB 1BVTA 3PG4A 2FU6A 4ZO3A 5HIPA 2XF4A 2Q9UA 4RBSA 3IE0A 3I15A 1SMLA 3AF5A 4KEPA 2BFZA 5ACUA 4EY2A 3BK2A 3X2ZA 2CBNA 4AX0B 1MQOA 4Z60A 3RKKA 1VJNA 1ZNBA 2A7MA 2M5DA 1WW1A 1WUPA 5LMCA 3I0VA 5LSCA 3IDZA 3WXCA 3VPEA 2FU7A 3ZNBA 3X30A 4Z6XA 4EYLA 2OHIA 2OHHA 2H6AA 5B1UA 1YCHA 2GKLA 2NYPA 5ACXA 3H3EA 3VQZA 4TZFA 3ADRA 2WYLA 3T3NA 5LCAA 5LCFA 2WYMC 5AXRA 2QDTA 1KR3A 3L6NA 3DHBA 3IE1A 5DPXA 3IE2A 4KEQA 5AHRA 4B87A 2P1EA 3IOFA 4AWYB 4C1DA 4HKYA 1L9YA 5HISA 5ACVA 2VW8A 4AD9A 4GYUA 1X8IA 4WD6A 4DIKA 2AIOA 3I13A 3T9MA 1QH5A 4AWZA
chains in the Genus database with same CATH superfamily
1SKBA 1ZEJA 5HR5A 1AXGA 2G9HD 4P4TA 4DJAA 4CJXA 2LWIA 4XTCS 2DQSA 3GZJA 3WZ2A 1FRRA 3ZWXA 5KAMA 2OO7A 4P8RA 4F2PA 4QDZA 3F49S 2J0JA 2V5AA 3NBFA 1UKVY 2I6SA 3L0DA 1M5RA 1T6ZA 1EP1B 3MAAC 5IHXA 1G41A 3OKCA 3QVWA 2Y1XA 4N3GA 4Y6GB 4NZNA 1RBZA 2B5OA 3L3BA 5A4JA 3M6FA 3TX6A 1YJ1A 2OO3A 1Y8RA 4JKYA 4BMPB 5K6TA 4RV9A 2IEYA 3LVZA 4M53A 4INAA 4C4ZA 1JQKA 4XEUA 1O6CA 1JG6A 5CFMA 1FQJA 2VOEA 4CL2A 2CFZA 2PTLA 1E79A 1QWSA 3T38A 1YQDA 4NARA 1FFEA 1FW6A 2K2QB 1ZK1A 1GSHA 5EZQA 3CCBA 4RTQA 1YQ3B 1JIKA 3GLTA 1QO9A 1YKSA 1UBOS 4MUJA 3QKSB 1JYSA 4UASA 3KB6A 3WL3A 2GPYA 1G18A 3BWDD 2O3TA 4H59A 1FXAA 4EB8A 2QP3A 1UBTS 5IVDA 2ZB7A 1U8UA 1P7EA 4DABA 3T34A 2I62A 1YIAA 2NSLA 3W7BA 4Q4HB 2IYXA 4B6WA 1O77A 3WWDA 1FXSA 1N2BA 5EXXA 5J59A 3CLUC 3ZE0B 2ZT6A 5K4GA 3SVLA 2FZ4A 3PE6A 2PZGA 3Q3NC 1EGVB 3WLHA 2V65A 4BNDB 3BIFA 5E6RA 3COWA 3ET4A 4GRAA 1LK5A 4QUGA 4OU5A 4RVHA 4R3UC 2JL1A 3BEDA 3B2QA 3NNDA 4NMXB 4Z4QA 2JKVA 1KFYB 1KM7A 3FUXA 1XYYA 1GV0A 4HMPA 4AF8A 3GFRA 3OM8A 3CVVA 1C9EA 1M5TA 3IAM6 1B1AA 2J7KA 1O03A 3ZVLA 5LM6A 2Y68A 2BL4A 2OECA 4QGFA 5E2BA 2HB9A 1EJ6A 4HNVA 3WB9A 3HKCB 3UEOA 2VT7A 4D80A 3A2NA 2FB9A 1WXWA 1XDBA 3O3NB 1E99A 4JSTA 3X1WA 4NQZA 2DG2A 1JWMD 3ENVA 5K4NA 2I2YA 3D0QA 4ZOQI 2HA0A 3R0XA 1LCIA 3ZH2A 4PYJA 2JCSA 4GUAA 3WQSB 4G4GA 1AK1A 4K3VA 3WGHA 4PYNA 2G6TA 2C2GA 2VYND 3NC4A 1GPDG 5GJCA 3T9CA 4WAAA 1T8RA 5AVRA 4D9GA 4II3A 5AK6A 4AK9A 3SBXA 3T7RA 3HWSA 2Z8YM 4ZOHC 5ACWA 4GYKA 1KORA 5FL3A 2B1JA 3CZPA 5CGQB 1FLVA 4F8YA 5BQOA 3R2JA 2O2DA 1YQ9A 2VNAA 3NXKA 3AF3A 1I7DA 2ORYA 3ZR9A 2IIPA 5GVRA 2VNIA 5B7PA 4DSZA 3O7MA 5H8YE 4RM5A 3IV7A 1FY2A 1C1YB 1X39A 1MFWA 1WY8A 4Z2YA 1G2PA 2H11A 1MVOA 2EELA 4D98A 3OKFA 1E9CA 3M2PA 1LLCA 1NI3A 3I5YA 3QKSA 1IEWA 3MTNB 2QN1A 2XRMA 4LA4A 4MZDA 1Z5PA 5AJHA 3F6CA 1Y4DE 4PHCA 2E4UA 3LOQA 2M5DA 3D7KA 2Z0DB 4TT8A 3M6UA 3AOGA 2WWGA 4H0NA 4OHOA 3OZAA 4Q4HA 3AETA 1D4AA 4B44A 1VBFA 2C5LA 4X7RA 4C14A 1LS6A 2B5WA 1VG8A 3B52X 3GA5A 3GJ6A 1F5SA 3M2TA 2AXEA 3ZUNA 3CUWA 1KQ3A 2CE2X 5JADA 2QTMA 4L07A 4RGQA 1SC9A 2C7VA 2W83A 1QGZA 4BNDA 4E1VA 1YDGA 3RTGA 4C0WA 4F06A 1I5OA 2Z43A 3H2YA 3L9XA 1RI1A 1DAFA 4DA4A 2BF4A 2E7ZA 2WUDA 3L1IA 1FDUA 1NXOA 2MBOA 1WB4A 1ESMA 5D1NA 1Z6ZA 3O8NA 1YFZA 5CYGA 4UTPA 3WYFA 4PWZA 3T4EA 4AWBA 1L4FA 4QTTB 4F5DA 2WZBA 5IWAB 2KDIA 4X84A 1FYDA 4ND7A 1B0PA 2E7YA 5AI0A 4TQ0A 1TS5A 4RXMA 1NBFC 4PGAA 1TZBA 3WYDA 2CJOA 1DCTA 2PXXA 1YOVB 4N5DA 4F6LA 1X7WB 1ZPSA 2O8CB 4JXKA 5C7OO 2D0OB 4BLPA 5IZCA 2VDLB 3SQLA 1F9EA 2BDUA 3K9GA 4Q19A 2MIIA 3PFWO 1F1BA 3HXTA 3I9JA 4K03A 3CVYA 3TLEA 3KEOA 3FTDA 2XB6A 1T6BY 2P9CA 3H13A 3TTYA 4TZ0A 3BQ9A 1ODJA 3CLRD 3ZKAA 1JVSA 1D0VA 2DR0A 1FDSA 2YWBA 1K4KA 3V7WA 1YN5A 2GEJA 3MUOA 3IQZA 3ZGNA 5CIYA 3ZTDA 2KX3A 2GASA 1C1YA 5B4TA 5HOEA 2QZJA 5FPTA 4BY9E 4CIWA 5JMTA 2XGMA 3V1MA 4WXEA 1J24A 4ICUA 4PWYA 1VJCA 3F0TA 3KL4A 3VAWA 1ZMTA 3RC7A 4JIMA 4EG1A 2C5AA 3R7AA 1WF9A 4D8XA 3FOEC 4RJKA 4BX3A 2XHZA 3U09A 3NOVA 4C05A 2H1SA 1RMYA 3VMFA 2WHGA 1DZIA 2JCGA 5DBFA 3W79A 2CBGA 3CUUA 4JQZA 2NTYC 5FYDA 2AX4A 4LYEA 5F7XA 3WRXC 3UPTA 3TTWA 3WCQA 4EG6A 1BWQA 4E11A 4ZRJA 4EQ6B 1L1RA 1LPMA 4PVTA 5D51S 2D11A 1W94A 4FEGA 1W4AA 4IY1A 2LW7A 1R88A 3T3MB 3OU7A 4KRYA 4D1WA 1ICIA 4IGKA 2PHZA 3AM1A 3HCDA 2PR2A 2ZYVX 3JW0X 1F2TB 1P5HA 3HDVA 1YOVA 3BIXA 1EDDA 5EIBD 3U3JA 4IOIE 1X7WA 2NU9B 3Q11A 2O8CA 3LM8A 4NYMR 3QK7A 4ND3A 3WB2A 4YAFA 3A1DA 1LBEA 4XB6B 5A05A 5AM5A 3FKSA 1LI5A 3U39A 4X7BA 2KQ4X 3RTAA 2E0IA 4XIFA 2J31A 4R31A 1FW8A 1XRSB 5DPRA 2Y1GA 1E7MA 3ZCUA 3PPVA 2FQQA 1FMLA 2GKGA 1Z62A 3T7TA 2FMIA 4XC2A 1BVYF 3GLIB 1WO8A 3EZLA 1WF6A 1EDBA 4AX0B 4FHEA 4FFSA 3DZHA 4ZVKA 2O7SA 3ZY5A 1VYUA 5T5QA 1KEKA 3HUDA 3N8HA 4KO8A 1M2JA 4XX5A 4H15A 4GZLA 1DKOA 4C3VA 4N59A 3CWCA 2FMXA 1BMTA 1AGXA 2PKXA 5CW2A 4KW7A 1Z6TA 4LUCA 1UQRA 3O8DA 2C5HA 4N8DA 4AI6A 4FULA 4UMFA 4TPKA 5LP6F 4C1DA 1KZHA 5KKAA 4M88A 2R60A 1YRYE 1U90A 4JD5A 4GYUA 4G67A 4CDGA 3T7DA 3RNEC 5EE1A 5KO2A 1CY7A 3C5CA 4L6CA 3H16A 2BGLA 2HRQA 4ZDVA 1ENPA 1JW9D 2R1VA 1PV4A 1Z12A 1EBFA 1XN4A 2Q2VA 5BVHB 1BVHA 3ZLZA 3LT0A 2L0FA 5FOTA 2P5UA 1COZA 1IMOA 2CCGA 2O48X 4UVIA 3HFRA 3NRCA 1GN8A 1N2ZA 4EQ6A 3BY4B 2PGNA 2B7LA 2ZVOA 1U7OA 2PGLA 3RU2A 2GCUA 4HDAA 3Q15C 3UJ9A 1DG3A 221PA 1S3SA 4GPD1 4G5SA 1PR5A 1PSDA 3NS7A 3TVDA 2B1QA 4ARAA 4K88A 1NX6A 1RJWA 1W1UA 1F2TA 3FPSA 3UF0A 4P93A 2MT9A 2OO5A 3EFOB 4Y7CA 5IUNC 1Z0UA 2NU9A 1KKMA 1N32B 2WFMA 2PZBA 1R7RA 4Q66C 2WFZA 3I64A 1T4BA 4QVIA 3JARB 4KZPA 3RS9A 4Y0VA 4TL7A 3QX1A 2QU8A 3L0IB 4RCVA 4DJEC 2Q4RA 1SG0A 1D6MA 3OU6A 4MICA 4J3FA 2JWZA 2CKHB 3UATA 4EF6A 3EBLA 4P4GA 2IHZA 2M9MA 3JASB 1W4LA 2FRXA 2PSEA 3W5UB 3NVMB 3GLIA 1OX6A 1BRMA 1GCIA 1KA9H 3WWZA 4IC7B 3DE2X 4BE7B 4OVUA 4EJSA 2I22A 4BFZA 3QLTA 4J7XA 2N1BA 2GHIA 1NF8A 4ZDWA 3J81k 4LV8B 3I72A 4GDKB 1G3UA 3HY6A 1SU8A 3KEFA 4RYLA 4CGZA 4Q9IA 4KSBA 4FOLA 2IGTA 5A9RA 1T8PA 1KMIY 1PJCA 1VCMA 2Z98A 1K8YB 3AE6B 4P84A 1JJEA 1ISPA 4ZQGA 3DMYA 3G1PA 4XIGS 3BICA 3SN6A 4Y1RB 4DXAB 1LO5D 2Z2IA 3BGDA 3I6BA 1M75A 3U80A 1GZHB 3QKRB 5B36A 2BJHA 4EY3A 2CFSA 3TR0A 3G59A 2X4IA 2QLMA 2QD4A 4XA8A 3RTEA 3X1MA 2Z08A 2ZITA 2R68A 4ONEA 2B8EA 1OVMA 3WWEA 4NAVA 2MCNB 2AJDA 4JVMA 4N5NA 3GFQA 2Q46A 1M1NB 3NBZC 4Y9DA 2VAWA 1FA9A 3C8YA 1PDVA 5GONB 3MJTA 3ND9A 4A7PA 5ES3A 4QLAA 1SOVA 3U7JA 2GMIC 4YMUA 1V96A 2YXDA 4HX2A 1LPSA 2OILA 5B6JA 3ESCA 3BREA 4D7AA 4JKOA 1K51A 1N4DA 3C1UA 2WXLA 3D02A 3ONVA 2A9PA 2UU7A 4IWQA 3SC6A 4O63O 2DGDA 4TRNA 1ZN8A 3MJ4A 1VGQA 2WU8A 3IUJA 1CY4A 3PDCA 4I9HA 1FXUA 2VQSA 3AX6A 2JLSA 2IV7A 4MWGA 2WHRA 3G68A 4QPCA 2OOSA 3JARA 3H7SA 2FAXA 2Q9UA 2Y8EA 3D32A 4G5OA 2HTHA 3LT4A 5JR3A 3CN9A 3TPCA 3JD1A 2J6BA 1JAHA 1LB1B 3IT2A 4C76A 1PK8A 2QVYX 3CU5A 1BMDA 3IODA 5ECWA 2DYBA 3DL0A 1ZXLA 1P4JA 4G4SP 4ND4A 4WT7A 5EJGA 4PYQA 4GGQA 4CM3A 4MJ7A 1QM5A 5DBOA 3JASA 1N9KA 3KQWA 4AY4A 1FCCC 4PFJA 5BMOA 3NDJA 3LO8A 3B2FA 1VP9A 1UAGA 1GHTA 2CFTA 1NLUA 2Q50A 3AVPA 1KFEB 1T0PA 2VT3A 1BFKA 4MYCA 5FLEX 4CEJB 1JDBB 2HLDD 2V6BA 3WK5A 4GDKA 3JQCA 2VJYA 3KSUA 1J2EA 1N63A 3LYLA 1CHNA 2CY0A 2NVUA 3M5DA 1RBYA 3GLFB 2WX0A 5KNDH 3BC1A 1F52A 5TXGA 3UK1A 1KI3A 4WV3A 5DM0A 2GJKA 4MHSA 1VXRA 4Y1RA 4DXAA 5JFGA 3ED1A 1SCBA 4LGMA 5LMNB 3QKRA 3AGPA 1EINA 4EGFA 1LY1A 5KB3A 4EHKA 3PC8A 2PJRA 1T8TA 1OYYA 2DU8A 3U9SA 3OT1B 1CRZA 2HLNA 3W2TA 4TYFA 4JV5B 1L0XB 1JSCA 3BK1A 3P0FA 5A5ZA 1T5XD 3CRMA 4ZV9A 4E3WA 3GELA 2QTNA 1KYIA 3ZX5A 1A8QA 3BAZA 2CL0X 1M1NA 1PUTA 3DKIA 3DBRI 1HWYA 1MU0A 2JAQA 5GONA 2NSDA 1CBUA 1SHKA 2VAPA 2WLTA 1VYTA 3HC7A 1GL6A 3P5SA 3CE6A 3DCIA 2YW9A 4ITVA 5GQSA 1CUYA 2C2ZA 1U9YA 2FAZA 1F17A 1ZHFA 2WHXA 4P86A 4YB8A 2FJ0A 2N42A 1UBIA 1WCYA 1CW2B 4YWJA 1QE0A 1ISRA 3P27A 4LHZA 4Z9FA 5KPDA 3KH0A 2VTDA 5DM60 3WDKA 4PSUA 1MQ9A 3BWBA 2G1JA 2Q3FA 1UCFA 3GWZA 3AECB 2YEPB 1E3IA 5K3EA 4NG5A 2QR5A 1CF2O 1XCBA 1JU9A 1IBXB 4AP5A 1USVA 1EWYA 3BGSA 3L79A 2X3FA 3U3KA 2YRFA 3PFHA 3BMCB 4XUGB 1UBQA 2NXEA 3QXGA 5GOTA 4X20B 4A6PA 4QUEA 4C7XA 3D64A 5BW4A 3DQVA 5EJMA 1XB2A 4CKEB 4ZC1A 3MTIA 4WKBA 5FD8A 1E2JA 1PRYA 3HHPA 5L4NA 3V2GA 2R7LA 4NULA 2XB4A 2PMEA 2YIJA 1V9JA 2C3PA 1P80A 2XUHA 4AJIA 1YE5A 4CEJA 4XLLA 1JIJA 1AG9A 1G2OA 4QBKA 1KRWA 1ZU4A 4RVCA 2XBUA 2QTVB 4LV6A 1UC4B 2VJMB 1Z4IA 4WK0B 3CURA 3GLFA 4LE6A 1U4NA 2J9GA 1WEKA 1L9KA 4RL4A 2EIXA 3RKSA 3TI7A 2D1RA 3I5JC 3ZE9A 3RNBC 3L6UA 3L6OO 2IUSA 5ALFA 3HXLA 1YJ8A 2LZ0A 1PK7A 4OO3A 4UTZA 3KVRA 3FTQA 1QONA 3ZYCA 1MB9A 3Q3FA 3OHPA 2B8NA 5A5VA 1U7UA 1MX5A 3OT1A 4IX9A 1WETA 4LPSA 1GGJA 5HDBB 3VR5D 2XCTB 4HXGA 2AQHA 2I5PO 4LDQA 1YOBA 3GGDA 5ARBA 2IE8A 2D3AA 4LJ7A 4NJEA 3KQNA 2HRBA 5IDXA 1MB4A 1PEAA 4E2WA 2EBUA 3DF9A 3X1XA 1RACA 3H1UA 1JMYA 5DLYA 1LV7A 2PN1A 3HVKA 1XMIA 1LJ8A 3EOBI 5FULA 4GXQA 3OWXA 4DIEA 1FSPA 2N9XA 4BB5A 3UBMA 2V97A 2ES4A 2FA9A 2W6IA 1EE2A 1L5LA 3UV3A 3DDNA 1XFDA 3LE8A 4L6IA 4YHHB 4DA0A 3QU4A 1ZOYB 5IWCA 5GZ6A 3HRKA 1HZZC 4S35A 1MIHA 3EASA 2ATCA 1BH2A 4ZVNA 1RWBA 1IBXA 5B37A 1FUEA 3ZHUA 1T0QC 5G0SA 2RMMA 4LXYA 2INGX 1C4AA 5FEUA 2AOUB 3W5VB 1WABA 4OF4A 4DHEA 5E7QA 1DAHA 1JLKA 1M8KA 3BMCA 3SYMA 4FC6A 3AEUB 4J43A 4X20A 1ABEA 2B1IA 4NICA 1NFFA 1L5MA 2M8SA 3BB4A 3ZXXA 3FDFA 1FYVA 4YL8A 3ONWA 4KSYA 3BZBA 1SK9A 3KUKA 3FF4A 1PTJC 3P0RA 2AGVA 4OLFA 2GOYA 3VDRA 3S6JA 1C9KA 1Q0TA 1RPAA 5C1IA 1JHQA 3W8FA 5EP4A 4AD9A 2ON8A 1GGHA 4C4XA 3D7NA 2OM6A 5DYTA 3WKEA 4EZKA 3RVSA 3A3NA 3RIXA 2J3QA 3NDIA 1AF7A 2QTVA 2ZT8A 3N9YC 4B0EA 1OBOA 3A3PA 1JPUA 1EIZA 2VJMA 1I2CA 4LOJA 4BNVA 1M2EA 4ACFA 3O0DA 4IO0A 1Y4SA 1MV5A 1Q2UA 2VDVE 1B1ZA 3KD2A 1U2GA 4WN9B 2P6OA 3QW4B 3ADDA 4HAZA 1UDCA 2PE5A 1DEXA 5T57A 3MJCA 4NU6A 2P6MA 3KOYA 3EMDA 4ZJUA 4OLBA 1Q50A 3L6BA 2ZCUA 3DNMA 2EGHA 4ZVPA 1VOTA 2YHEA 4L2YA 1IRXA 4U6SA 5CVTA 3K8YA 1KJ9A 1XCGB 2PZEA 2G17A 2B2NA 3SSOA 4CG3A 2R87A 5TR9A 3RE1A 1XRPA 3VNUA 2NYRA 5EQTA 3L6RA 2FOLA 1E5DA 2C4NA 4KQ1A 5C18A 1OAAA 1G8MA 1Z5VA 2WSYB 4PZCA 4H3KB 2A5YB 5GONF 1UBLS 4BVKA 4EFZA 1O9GA 4WLNA 2OL4A 3U7ZA 4FFVA 4GU2A 2BMVA 2CEAA 4YXDB 1IZ9A 1ONBA 4BZQA 5LJIA 2BGKA 1AK9A 3OOEA 2PKWA 1YS4A 5K4MA 3FROA 2BONA 3K1AB 2RGDA 1ZD9A 3G82C 3NR2A 4L4YA 1L4MA 2GF2A 2NTEA 3H11B 3DA8A 2ORVA 4MVJE 2I1LA 2AOUA 4MT5A 3W5VA 1TFRA 4OZAA 4KKXB 1EGMB 3WLLA 2ONYA 5EJ9A 3Q8MA 1ZUWA 2AIRA 1MG8A 1UNSA 3KTOA 1P0FA 2R7AA 2HSWA 5HG0A 2X38A 1V7PC 2FSGA 3IUPA 5IKXA 4A2QA 3CF0A 2V1XA 1XHLA 1J7CA 1W2HA 3DKVA 3NIWA 5FWNA 3LT5A 1QK4A 3B1XA 4NSNA 2JZ3B 1V16B 3TF5A 2RCYA 2M4NA 3H2IA 5EZ5A 3IT3A 1SBBB 1ICEA 3S7ZA 4LBYA 1U0FA 3BTOA 3HR8A 2HL6A 2IQ5A 1M76A 5IQKA 4Q7LA 5FHRA 3LDZE 1CUGA 1HOTA 1BVRA 4OB6A 1DT5A 2XB9A 4IJKA 2QTLA 2WA1A 3E53A 3DBOB 2CNLA 4MWTA 4WN9A 2ZI6A 4CL8A 4RMNA 3R3JA 4REZA 3N6XA 2M32A 4LZOA 2WF8A 2Y5CA 1PJQA 2CXUA 1GRQA 2Q5HA 1IK4A 2YNMC 2X8JB 3E8SA 5D5HA 4PE5B 1DKUA 1XRQA 1CY2A 3GP3A 3W5BA 3URKA 1A7UA 3ND8A 4RVSA 4BVAA 1WKVA 3COJA 4DKJA 4MYRA 2N7EA 2AXQA 2WTEA 2OK8A 2IY8A 4GCWA 4PO8A 5BPFA 4UNIA 2BTOA 4YMLA 3CRVA 5BSMA 4AN1A 4C4TA 1E9MA 3FBWA 1JJTA 3IULA 2AJ8A 3MELA 4OHMA 4YSXB 5AVXA 1K97A 3NP7A 4RIEA 3PIIA 4EY7A 3OY2A 5L7TA 2C29D 4DW8A 1PZMA 3Q2OA 1MX3A 2QN8A 3OSUA 3L7IA 1FK8A 5JTUA 3MWYW 4OHVA 8ABPA 3Q4GA 3JSAA 2B94A 5HS6A 3IAEA 3LIIA 2PL9A 4OZCA 3OZGA 2G07A 3I0VA 2TMGA 3GJ5A 1R4MI 4F85A 3C3AA 3FCEA 4R2JA 4CDRA 2M56B 3NYRA 4HGZA 1MOZA 1A77A 4YUYA 4N49A 3LLSA 3IEIA 3PX3A 1GYPA 3K1AA 4I3HA 1LW6E 3SLKA 2C77A 4J0GA 2I7DA 2NNWB 4NDNE 2LE0A 3H11A 4HUJA 3RDPA 4HYQA 3ND5A 3N58A 5G40A 2IKQA 3S2YA 4PGGA 1NKTA 4M02A 3HP4A 5EZYB 4V39A 4H08A 2Y9PB 1DINA 1FRFS 4LG1A 2N7JA 3E2MA 3CUVA 1S8OA 2HXYA 5K0NA 2GM4A 2UZ3A 2YWXA 1H5NA 3NIBA 2WVGA 3FWZA 1SEPA 3LA6A 1V16A 2PQ2A 1F1HA 3OSZA 5FJJA 4QC2A 3NHJA 1R0RE 2BB5A 4BNLA 4JJZA 4OJNA 2QRUA 1JHUA 5C34B 2YDXA 4W9EA 5IAAA 3ML9A 2IO1B 1XZDA 3THYB 4IOJA 1I0ZA 3BFJA 1F6DA 1T9KA 3SQNA 2WQYB 3MBIA 4QG7A 1K3FA 5ULLA 3WL7A 2WYWA 1PT5A 2YXBA 4FHKA 1RZUA 2X0IA 3RS8A 5HH5A 4FMDB 2WT9A 2VNHA 3C5HA 2X8JA 3V34A 4WQOB 4TYQA 3PIRA 2Q4EA 1BMFA 1ID8A 3RRJA 2QNBA 2QC8A 4FCVA 3AINA 3QVMA 3PFIA 2B2XA 1T5SA 3SIXA 3ESRA 3FWNA 3WI7A 1EFPA 2AC7A 1T9DA 1IEVA 3WYGA 4EEKA 1N2SA 1ZK2A 1MVLA 3EW7A 4MVXA 1ZJYA 2V45A 4TROA 1WYWB 2IO2B 5GJVC 4CT4B 3WIBA 2WXGA 5DYGA 4DZZA 4B81A 3SR4A 2RCNA 5LXTF 1N2CE 5KTNA 5ICCA 1UXKA 4QKQA 2W8ZA 3GJTA 2GJ8A 2PKOA 3JWHA 3EEQA 4YGYA 1MHTA 1L5FA 1N78A 4B43A 4D8VA 1PZGA 1AGYA 1DWOA 3V3XA 1W48A 1AIPA 5CLIA 1GCAA 4HVAA 4LQ4A 3EYAA 4RABA 2JVIA 1ITZA 2XITA 1TMOA 4CFYA 3BIJA 4JDPA 3QMPA 3WGOA 5IDWA 1CIJA 3U6KA 4BLTA 4PPQA 3HSYA 4Q5IA 1N0HA 4B7ZA 4KUEA 3HY4A 1ULUA 1T5LA 5EZYA 1YQEA 1V4VA 4DKXA 2AN5A 3OLQA 1URPA 2WJ4A 1QSGA 1M73E 3W5IA 5BWOA 1S2LA 3PUWA 1AX9A 1YZUA 3UCEA 3EVDA 1SC4A 1J9GA 4JBNA 4C2UA 2P6PA 4X54A 5H3HA 2G5GX 3SSAA 1VHDA 4QECA 3FUTA 3RV4A 4B7CA 2RDHA 3BMQB 4GPBA 4FLHA 4LJLA 2NPOA 1T6XA 2JGJA 3DVLA 2F1KA 3EAQA 1EFRA 2PVOD 3SF8B 2CCJA 3THYA 2VHZA 1GPLA 1SCUA 5CVUA 3DVGY 1QQBA 2FF7A 4R4JA 1A9YA 3NHKA 4GDMA 2YMQA 1XLNA 1Y9ZA 3I83A 3UWPA 4DQLA 3MJEA 5TT1A 1GB1A 4KN6A 5JAQA 5F1YA 4GEKA 1IMJA 1E6EB 4GBMA 4C0LA 5H70A 1VKHA 4S0RA 1N5OX 3IHPC 5F51A 4KXXA 3P9SA 4DUGA 2XKAA 5IMBA 4PLZA 1A9XB 3IE0A 3IBFA 1NBIA 2FDRA 1PYOA 5SYAA 1N1DA 3LQRA 2J67A 1HLGA 1QX4A 4ZPXA 4YYEA 2FKNA 2AYOB 2XVXA 1DRVA 4P54A 1QBGA 2R44A 2H7VA 5JSFA 1L7BA 4LF4B 3L8HA 3TGWA 4QNRA 3M5WA 2CYAA 2VSQA 4BRSA 3A4LA 2XUOA 2C4KA 4FGZA 1YZYA 4IWXA 4FYVA 4GQBA 1SO8A 1RQRA 3IVAA 4IIJB 1L2NA 1Q77A 4KNVA 3WS7A 2PUBA 1Q44A 1FP1D 3A4NA 1JT2A 3CKLA 4FC7A 1KKUA 2EZ4A 2HWYA 3QQ5A 1ET9A 3AG5A 3CN7A 3H5VA 4MYSA 2L52A 3THSA 2PRJA 4M8MA 2PR7A 2D5GA 4TWIA 2DETA 1VCHA 2EQAA 4XOIA 2OHVA 2QM3A 3JD2A 1F2UB 3OLVA 2J6HA 3FLAA 5K0EA 2Z4RA 1GA1A 1YI0A 4ZMRA 1I5EA 1XL1A 1J56A 4D4JA 3DBLI 2MHCA 1NZJA 4QXQA 2NYAA 2VZ9A 4LI0A 3IRUA 1JROA 1PVDA 4MB2A 3AC0A 2XNDA 1VTKA 1Y3FE 2VUHB 1N0VC 1HR0B 1AUVA 2E5FA 4YCDA 2HLHA 1XG5A 2GEKA 2PX6A 4ZNBA 3RSCA 1O94D 3A1SA 1PUXA 2VWPA 4QU9A 1M2OB 4M8KA 4LYGA 3BJIC 1F6WA 3OMXA 3VFDA 1BGVA 3BMQA 1CP2A 5LXHA 6YASA 1MH1A 3CLHA 4J5HA 1H5UA 3K53A 3MCAA 2PQ6A 2C94A 1R0WA 2EW8A 2JJ1A 3T54A 4YSBA 1SVMA 4W1PA 1Z16A 2QV7A 1Y3CE 2PX5A 4X24A 5EIFA 2RAFA 4Y9TA 2LASA 4AZTA 1SWVA 16PKA 2R0QC 3FCYA 1KY3A 2ZG6A 4KTVE 2G72A 2JRIB 4UAVA 1E6EA 4QTUB 3NC1C 4A8XC 4CU5A 1IOWA 3L16A 2V9CA 4UZFA 4UHEA 2D1TA 3PNOA 1A9XA 3U3ZA 3IVFA 3LH5A 1BEZA 5KQLA 3K0CC 3DC2A 4NCBA 2FOXA 3HCPA 2K6DB 3KLOA 1MHPA 3S2GA 3H9EO 2PU7A 5ICEA 1NVUQ 1OYWA 1XCTL 1WWTA 2Z2XA 5ALJA 3DBIA 5CCEA 1GG5A 4LWQA 2QW1A 5CGZA 2DBRA 4MDEA 3KPJA 1RHMA 2PKEA 2FOIA 4B6PA 2ZT7A 1JQBA 1XLWA 4QJIA 4MHOA 5T4HA 2JFHA 4MYDA 2XA2A 4YQZA 1QGED 1W75A 1KETA 1KEUA 3B1JA 4X0EA 3AUKA 2AR7A 2C59A 5CVDA 1VG1A 4IIJA 5IAOA 3W05A 3W04A 1UUPA 5LYYA 4NOLA 3GT0A 2DT5A 4Y2PA 4QGAA 4ZO9A 2Q9BA 2ACWA 2XYPA 3OFJA 1BVUA 5HIQA 2BE9A 3VC2A 3AKEA 1JJIA 1AUQA 4TWAA 2NIPA 4D3DA 5ECYA 3HEMA 2OT3B 5E6RB 5B57C 1OROA 1TI7A 2RGCA 1JPVA 4IEEA 1K07A 1F2UA 2OGTA 2I34A 2JIQA 4BEWA 3GEBA 4DCVA 1IYFA 3IOCA 4DMGA 5LYJB 3OJ3A 1UK6A 1I9GA 4ECEA 1SCQA 3FN4A 3I4CA 1MO6A 4X62B 4MEAA 4YSKA 4EENA 3C48A 2VXOA 2XMCA 3KZ1E 4JH0A 1PWHA 2GA9A 2H1FA 4URFA 4XGIA 1JHVA 1H69A 1M1UA 4H31A 1C0EA 4URHA 2D2EA 4ZHSA 1J49A 2BN4A 2ISSD 3TOXA 2Z3VA 1M2OA 1PWXA 1KK1A 1E1QD 5ER6A 4INJA 4NMMA 5BNZA 5DM70 3N2EA 2IGBA 3AL2A 2RG1A 3ZBTA 5KNCA 5D2MB 2V3CC 3W9SA 1FDIA 4EY8A 2LKCA 4EY5A 3H5AA 3GYBA 1AQNA 2HA3A 1WGHA 4II3B 4XJXA 1V6CA 1GZVA 4BPRA 2GSDA 1U3UA 1PV1A 3MXTA 2OC4A 1ISGA 3L18A 1V8PA 2W2LD 3X1DA 1X7DA 4FMDF 4RZQA 2AJCA 2LUOA 3KXDA 2G04A 4KMMA 3TZ6A 3OHSX 3OKAA 3ZW9A 3A6GA 4D0SA 3I37X 5JCJA 2WWFA 3SZOA 5F21A 4OKNA 3KPVA 1UIMA 2ZYWX 2FPIB 5A4MS 2WYMC 1J1ZA 2FP3A 3BA6A 1RKBA 4L74A 2WYOA 4UQPA 2KAJA 4QHTA 1NY6A 3KV3O 2H1IA 5G0TA 2E37A 3VDQA 2ZATA 3V60A 3SEFA 1G6JA 1FUUA 5DX0A 1W1WA 1XEAA 3LX8A 5ESXA 4KXYA 3KJXA 3AETB 3ONNA 4E30A 1LLUA 4XJTA 4BV3A 1AKVA 2K39A 2C2YA 4ZXPA 2I6UA 5HGJA 2ZBQA 3VV2A 1P1HA 4IQ4A 2JFVA 3LWBA 3AVUA 4GZ5A 3GZ4A 1P3JA 2A0WA 3BN3A 4WQMA 4BTVA 1G3RA 2IGHA 4ZRMA 5LYJA 4IUMB 4UJ3A 3ORSA 2IHUA 4RK5A 1T1GA 1SVUA 5LB4A 2ETXA 4JX1C 4EHNA 4I4NA 2ZDGA 4QTYA 3O8CA 4MGKE 1KY2A 5A6SB 3SMQA 3RVMA 4S1OA 2DFTA 4C2BA 1SUFA 4K9DA 4D0LB 1W9HA 1R18A 3ULKA 4W1QA 2M5CA 3C1TA 5PGMA 5KQPA 1WDTA 5EYPB 2FE4A 4E09A 3IT0A 3SGLA 3LB8C 3IJ5A 4HQ0A 2WDZA 2XADA 1XDSA 2P4ZA 3II6X 3L77A 3UB3A 1NZFA 4NBTA 3QX3A 2Q41A 5JAZA 3IVRA 4PG8A 4QJ5A 4WNCA 3JS5A 1BOOA 3R3ZA 3QG5A 1KWKA 4FR2A 3JXPA 3DM9B 1EO6A 1XZBA 2PT9A 2IZZA 3AH8A 4QOHA 2IT1A 3SK0A 1X1EA 2AZ4A 2XBBC 3S1AB 4OQXA 2V96A 4QWMA 2FZEA 3DHGC 5IJ0A 4JI3B 4M2LA 1CIVA 3OIUA 5IFKA 1TS2A 2VDUE 3W4JA 1EF1A 2CHXA 2VP5A 3ECCA 4RFBA 3U60B 5HZGA 1JA1A 4PHHA 2Y8BA 3W1SA 1IVNA 1VKRA 2YNUA 4IOLA 5DK6A 2FPIA 2OHFA 3GJYA 5DSXA 2G1AA 1JB1A 4DC9A 2GD0A 1FTNA 3N0TA 4EUTA 2H0AA 1OVGA 5GJBA 1CETA 4NAUA 5EIXA 5L83A 2Y5PA 2MBHA 5B1DA 3IOMA 4E70A 3M6WA 1LPBB 1PV2A 3IURA 1FU8A 5IAKA 1PIWA 4AS2A 1D8TA 3PQEA 2WSSD 3T9BA 2ZKIA 4IIJF 3AUYA 2FZVA 3IKJA 4KYIB 4KSCA 5JC1A 1PWEA 3FMFA 4DJTA 1YI8A 1UQTA 3G88A 4RSRA 1B43A 5KPJA 3ZWYA 4LQDA 3HU2A 2EL9A 4QU5A 1P9RA 3B3JA 3LGXA 3I6ZA 3MRTA 1IL0A 4LGYA 2XX3A 2DJ5A 1JI0A 2QR3A 1O6ZA 4JQCA 1AQ6A 2WP9B 1XZ8A 4BX2A 3OTWA 1XEWY 1C41A 1IFXA 3C3KA 1DDIA 1EZZA 4DBLC 1H6BA 2TMDA 1L8XA 1P7VA 5LKAA 3PGA1 3RQIA 4H3VA 5A6SA 3SKXA 4MWCA 2I3BA 4XSVA 2AF4C 3A7DA 4BATA 3AU4A 5T7BA 5C2TB 2YWFA 2JFXA 1PJ3A 3WANA 1X7YB 4GH5A 3AXSA 5EYPA 2XF4A 1VB5A 2JXTA 2W3SA 1PQUA 1V11B 4D82A 1GZDA 2JIZD 1TQHA 2ENWA 1V3QE 2PPLA 1S3SG 1JLMA 3CRW1 5IOIA 1AN9A 1Z6XA 5GADl 4EQZA 5HF8A 3FYSA 1OTXA 2HA5A 3ZKJC 3BMOB 2ZS9A 4UDOA 1UEXC 4WK4B 5I5EA 1O8BA 2MSKA 3FMIA 2CHWA 2BY4A 2RI6A 2Q5QA 1XPJA 3S1AA 4MQMA 1GXSA 1HBJA 5B1UA 1JYEA 4EMBA 3AJDA 2WTBA 2Z5LA 2V3NA 2XUFA 2XAUA 1I10A 2PQMA 2FWNA 3V8VA 1UEJA 3B08A 1SWWA 2FRDA 4TX1A 1HL3A 4PONA 4C0XA 4F86A 3VPAA 5C32A 2GM3A 2CN1A 2V5UA 5DCUA 1ZJ6A 4I5GA 3ESZA 4R9UC 2FEOA 3L8EA 1QH1B 3ZCVA 4E5VA 1HLPA 1CK4A 1Y63A 4OHCA 3GLUA 4UUOA 5J18A 2E6KA 3BSWA 1QAMA 2BW0A 4J1TC 3BF8A 1U8AA 3K9BA 1MENA 3FZYA 5COQA 1OH8A 4Q02A 4RLQA 3F90A 4FWBA 4U5QA 2YRXA 1C0IA 4D99A 3OQNA 3PRYA 4KWCA 1RAXA 3Q7PA 3PJEA 2HTME 2P27A 4FCCA 3WL6A 3LA8A 2R1VB 2YIMA 1ZHOA 1Q7BA 2JYTA 4J0FA 1HC7A 2R62A 1OH5A 3D2AA 2VP6A 4OYHA 4WN3A 5ETJA 4KQIA 5AM2A 4M0KA 2FWJA 4A8HA 1E3MA 3RZFA 1UBCA 5LYJF 2WIKA 4NCKA 1U2QA 2GBPA 1J9ZA 4Q01A 4UQOA 3EZGA 4GYWA 3A2KA 5SYMA 4K6FA 5ALXA 3CEJA 3K1JA 4DJFC 3LQKA 4R0NA 1DDKA 3V1LA 4LZAA 1AKRA 1HE5A 1N57A 4FMCB 4NH0A 5G5HA 3GIDA 3HUIA 5EKSA 3OZXA 2ZIGA 3BSFA 2JFGA 1X7YA 3NT2A 1Y6FA 3D59A 3JYHA 1GU1A 1N2EA 1YQBA 1V11A 3GVIA 2IU6A 2G9ZA 1UBNA 1VJ0A 3NCTA 3A1NA 2JH8A 2BIBA 3RRNA 4CLOB 4KR6A 2C9BA 3Q9LA 1DE0A 3GIWA 2QGFA 3LHDA 3SJUA 2XCIA 3BMOA 3EIHA 4CODB 1AKEA 3DLTA 4CHGA 3M1IA 3QP9A 2C96A 2CLIB 4Z8YA 2C5BA 2WUFA 4L4UA 1ILEA 1AT1A 3G2JA 3WQBA 3C15C 1AO0A 1H4SA 4LTUA 2MLBA 3H4TA 1RE1A 3U62A 3HN7A 2HRDA 4YO7A 5KKCA 3WP1B 4B8ZA 4EDFA 3FCCA 3VKHA 3R6WA 2PH1A 1G6OA 1BCSB 2GRIA 3NYIA 4P62A 1UBEA 4WJPA 3KXPA 3IEMA 3B5JA 3TGPA 4EJSB 4S12A 2W2NA 3GMIA 4BNHA 4FYPA 3C6ZA 1OH6A 3PQ7A 2DPHA 1B42A 4IIFA 1ZI8A 5I01A 5CH5A 4PSDA 3U1VA 5TARA 2FSFA 1L5ZA 3SHFA 4FMBB 1QH1A 2LGSA 3PFCA 4RK6A 1NVGA 3KXLA 2BELA 2BPOA 4F4FA 4LF7B 2CE7A 4P4SB 3STWA 2ATVA 3Q3IA 2TMYA 5TX7A 2F4NA 4TTQA 4DV1B 1KH1A 1WCIB 1EDZA 3I9MA 3JWEA 2IOFK 4LZLA 1I7NA 3I0MA 2X14A 3NAQA 3P2BA 1K1EA 2JLWA 2DZMA 3D3EA 1SIUA 1G3IA 5KQGA 3TCXB 4GGOA 1S8FA 3ZJYA 2G36A 5B12A 3N7UA 4B73A 4DR7B 1WGYA 3F67A 4QLOA 3EAFA 4JB8A 1CV2A 3C8MA 2B3TA 2GMNA 4R8RA 3EZXA 2ISQA 2H9AA 2CSXA 4HWGA 2EJVA 2PBRA 4IRMA 1N6HA 2F9MA 2BGNA 5JS2A 1VRCA 2VVTA 4UWRB 2PK3A 3C0KA 2GXSA 3PG4A 2PMFA 4J7UA 2H52A 4PEVA 1Y82A 1IN8A 1KDPA 2PUFA 1SQGA 3KU4A 2OBBA 2W93A 4C5BA 2Z6AA 3SR3A 4TLEA 3KHUA 2QD1A 4OMCA 2KLCA 3FFBA 4IV8A 3ANYB 3MG9A 3TSCA 1QLHA 5LUAA 2Q8PA 2J7QB 3GB1A 3ZVVA 3C3CA 3HXPA 2AG5A 3L0BA 3CNHA 2KMCA 4FFOA 1ULHA 2IUUA 3Q8FA 1DEKA 2JI9A 4CLOA 4I9FA 1AB5A 3GROA 3IEPA 5C5IA 1SB9A 2RHBA 1WZCA 4E33A 1LTQA 3UWOA 1IY1A 4M9UA 2XB2A 3MSCA 4X65B 1NOJA 5CLLA 3DV9A 4FNGA 4CM1A 2QK4A 4HKYA 4PGFA 3QIAA 4YUWA 4GVPA 2WM2A 4AWZA 2WXFA 3AR3A 1H2HA 3P4YA 3LBIA 1BCSA 1UT8A 5F2OA 4UTXA 2DP4E 2G0NA 3AM9A 4PRLA 1QT9A 3R6LA 4RH6A 1YX5B 5JUWA 4ZODA 2XKKA 4LZWA 3OZVA 4H7KA 3A0RB 3BB1A 2KSQA 1II0A 5LU8A 1J2YA 4C1FA 2NVUB 1D5ZC 3JR3A 4E1AA 1V97A 3CE9A 3CEHA 2XGOA 2ZVPX 3MMZA 4BLRA 4P4SA 1V80A 3OOYA 3EEOA 2JFOA 1JSXA 2YFQA 1U0TA 3IP8A 5IKOA 4RVDA 4IDCA 2P9GA 1ZXHA 4F1KA 3ORFA 3J7AC 1WCIA 4TWJA 3EC7A 4B3CA 5CUQA 2WSIA 2DFKB 4M0PA 3VAZA 1DXHA 2Q6IA 3D6FA 1U7WA 4DCSA 2IYFA 1XZFA 3L8ZA 4PLPA 3FRHA 4O08A 3QWHA 3GRUA 1YRHA 1ZBDA 2PLPA 1AGRA 2CHVA 2RH4A 3MT7A 3PUJA 4ISCA 3ACCA 1GCGA 2DF8A 2LHDA 4MSUA 3SBLA 3P52A 3K8QA 5GV7A 2NBWB 1KC1A 4GBJA 3Q6IA 1GA6A 5L3VA 3M6AA 2CLDX 5FUQA 5K6AC 1EQ2A 2CV0A 4BDTA 5T4BA 1BTOA 1G5FA 3T7AA 1QCYA 3AF4A 2O0HA 4JSYA 3EA0A 1GNVA 5LJLA 2ZSHA 1HMPA 2K3UA 1UC9A 4RGNA 3R2UA 1D1SA 1U8CB 1KJTA 3KUDA 4JFAA 3AE3B 4OKIA 3ZQ6A 1IBRA 4US2R 3IHTA 2GUWA 2WM8A 2C0QA 1TZKA 4A91A 3WXMA 3LUKA 1R0ZA 3EXG2 2WXOA 1WF3A 2ERYA 2CDNA 3H0EA 4FZ3A 1J90A 2P79A 1D2GA 1VZ8A 1X42A 1E1RA 1QIIA 4I9UA 3CH5A 3M4NA 2OV4A 2PJDA 3STYA 1UXHA 4KLZA 1E4VA 1IHDA 4R1PA 3QXJA 5CFOA 1ISIA 5HSGA 3PGJA 5KWVA 3BG5A 3KX2A 3VPXA 4YMGA 2EX1A 3BL6A 5ENZA 1BRTA 1GPJA 2FKAA 1TEZA 2PS1A 3E9EA 4BEVA 3AP2A 4MW6A 3A8TA 1JR3E 4DSTA 3C41J 2P4EA 1GRCA 2HJSA 1OZ0A 2WICA 1SM4A 3TQHA 1DRWA 2Y76A 3IO3A 5K3FB 4XVQA 2F00A 4GZ6A 5F9HA 3LCCA 5FUMA 2LGJA 4MRVA 5HXAA 4LRYA 4MW7A 4BGDA 1U0SY 4A1FA 2XD4A 3M1YA 1AM4D 1GU0A 1KZYC 2A6PA 3KV1A 4A90A 1QB8A 4V3CA 5HA5A 1X1RA 3RK1A 3FM9A 3FKQA 4QAJA 1AD2A 1USIA 3VUEA 3UJ7A 2G08A 2XNJA 2B20A 3GJ8A 4COOA 1TECE 3TG8A 3V6MA 1YHZA 2E4ZA 1RXEA 3GZNB 1IWPB 2VPQA 4WH0A 2X2FA 3MTGA 1AZLA 1I4HA 3E70C 1COWA 4MJSB 4AECA 2DSNA 5FI0B 3HM3A 4ROTA 3LJ3A 2K5PA 2XF2A 1S7CA 2C5SA 1V95A 4OGGA 5EHNA 3KTFA 4NJEB 1ET6A 5I3CA 5AVQA 4CUZA 4RU1A 1MMFB 1XMVA 2H4FA 4ZTUB 1WW1A 1QR6A 4K1RB 3ZTCA 1XK7A 3UWMA 1W36B 3KSDO 4EP1A 4MVJA 3K72B 5D3ZA 2CLOB 5G0UA 2PGXA 4FMCF 3UAGA 3TZLA 5LCAA 3UMVA 1INLA 1TIBA 2HF2A 4QT4A 1I3OA 2J41A 3HYSA 3IE1A 1WX8A 3NHZA 2SKDA 3SQDA 3BTSA 4KOEC 4MUAA 2G5PA 5KWIA 1YD7A 1ZKMA 5LBIA 3OIWA 3FW1A 4G5QA 4H4DA 2B4RO 4G0OA 4QASA 1FC0A 2I9KA 2VOJA 3MA0A 2GAFA 3TOVA 1U28C 3AY7A 3U1TA 5I51A 5A0FA 2RAUA 2NSHA 3COVA 4HVLA 3IAXA 5KYKA 1TO1E 3VH2A 5AOAA 4I19A 1NXXA 2C1ZA 1SCAA 4Q47A 5FAKA 4ZO2A 3E1GA 3ZU4A 3M3JA 4JT9A 1TM4E 1TUGA 4ER0A 2ZBPA 1CNEA 1FFGA 3IPRA 4MRMA 3G1TA 5K3FA 2L1AA 2A1TS 3I14A 1DBPA 2O5RA 1ZNZA 4BVEA 1YGPA 3LF1A 5JH7A 4B6QA 2CLHB 4YC7A 5C1OA 4WZ6A 5J17A 3PC7A 4B9KA 4R2IA 1FFYA 3EOZA 2N9PC 4ACAA 3KT0A 1EK0A 2JF5A 1CUWA 4B71A 4L4RA 5E3HA 4U5XA 4XX1A 3U2SC 1G20B 1JJAA 2KHZA 4LWPA 3QTLA 4WY8A 4YYZA 4UVGA 1DAOA 1TGZB 3QTTA 2XEXA 4XRGA 2X42A 4KXWA 4MGZR 4DYVA 1WUYA 3GZNA 1TJNA 2H18A 2XWSA 2Y87A 1DIAA 3SFPA 3HVUA 3OEHD 4MJSA 4DMCA 4U2CA 4FFNA 3E81A 1C4PA 4RVFA 1N2CB 2HV8A 2C8VA 3CY6A 3O31A 5EVKA 4PS1A 2Q5FA 1DP4A 4ZICA 1M1ZA 4JOQA 3G1WA 4Q3BA 4E7PA 4HZGA 3UGJA 4E5MA 3T1HB 2XF8A 1O97D 3S40A 4CKYA 3DZ8A 4GKBA 2RE8A 5KYWB 1DMSA 3QLVC 2OP1A 3FHTA 4KGVA 3ZLTA 1GDHA 4DRZA 4PO3X 4WOCA 2Z6UA 1L6UA 4ENUA 3V9PA 4QU8A 1HT1E 1P4GA 1UPBA 1I4RA 5IT5A 1AKNA 5DP1A 1QOZA 4MIKA 4KGXA 3PEWA 5A5EA 4HZIA 4I7EA 1P5FA 4C2TA 5MN5A 1YV9A 1Y80A 1UT5A 1KIMA 4K05A 4QFBA 3N8IA 1MB0A 3JR7A 2R751 4AG3A 1HT3A 3T94A 4LHWA 1RIFA 4DXDA 5I7SA 2WSBA 2PUHA 4PLFA 4LJ6A 3O3OB 1UDXA 1EVLA 2Z2KA 3PV1A 5ALWA 4FYWA 2HDEA 2E85A 2JIDA 3BILA 1GRNA 1PYDA 3QAQA 4HH0A 4OGWA 2JU6X 1XRRA 1PS8A 1E0KA 2JZOA 3LC1O 1Q0PA 3S2UA 4EZLA 3WGGA 3KJNA 2NZJA 4M9CA 1E5VA 1XPOA 2GPAA 1EJ2A 2WUVA 3NHYA 4WFJA 1PYWD 4EHAA 3NH9A 2DUNA 4TN1A 1NRIA 5BN4B 4PC6A 2WUEA 3PNBA 1LXCA 2Q6OA 4GF5A 2Y6UA 2NWQA 3P4UA 5K0GA 3MJDA 1CD5A 4BNGA 4W5OA 1XT9B 2RB4A 4KPFC 4KH1A 5FEMA 3PB3A 1DC7A 4N3NA 4PRKA 1QYWA 3MC1A 1WRIA 5CDFA 3A6KA 1G20A 1KQPA 4BGUA 2K4MA 1GQQA 5EJ5A 4IJ5A 2GB4A 1IJFA 2VCHA 1YSCA 3CGGA 4X66B 4EHLA 5F3RA 4UEKA 3TSSA 5K5EA 2P9EA 1TD9A 3G5AA 3H2ZA 2EU8A 4WVLA 4MW9A 1N2CA 2MR5A 3UC9A 4Q4AB 1MGOA 3VU0A 2FUEA 3HG7A 4TRJA 3EGCA 4EYKA 2MOKA 1WUTA 2R8OA 2SCUB 4HSGA 4INOA 4YUVA 4PR0A 4XGNA 2P9BA 5KYWA 3P9PA 4XWOA 1MVKA 2OSBA 2HA4A 3KG2A 5JALA 3IOFA 5KWSA 4MV0A 4CV0A 3HCBA 3O5AA 2QRZA 1OFUA 4MVJF 4GIVA 4G65A 3G8YA 1GVNB 3TL6A 3L01A 1YL6A 4PX2A 1WWKA 1UC5B 1YBFA 2L00B 1K9VF 3DBHB 1ODCA 4L9WA 4UWSB 2R00C 2WYQA 3LNTA 4R68A 1P7YA 1ZFNA 1V86A 4FSDA 2BFKA 1S2NA 1E98A 1NG1A 4LSZA 4XW2A 1T2DA 1W9MA 3RN9C 2AEEA 1QB7A 1TKRA 3OLXA 4QOFA 9LDBA 4KDLB 4JYCA 1LEHA 1LDEA 3WIVA 3WC4A 2KK8A 1B6GA 3JVEA 2YIVX 3N7AA 3WYCA 3HGQA 2W54A 2HGZA 3C3BA 3A3KA 2EMTA 3N3AC 3K8ZA 3O8QB 2J3KA 4NOJA 1DWUA 1VKJA 4PRZA 5K8VA 2XGGA 3TSYA 1UWKA 3FLMA 5BN4A 2P5TB 2O8BB 3WZMA 2OB2A 5JDCA 3HQ4O 3YASA 1JGTA 4UQLA 1I1OA 3GS2A 2HSEA 5A5DA 1GO2A 1IJBA 2FEPA 4W1RA 3KNRA 3KWVA 5IXSA 2R79A 4WWHA 4M0DA 4B4UA 3VTVA 1DFIA 1LU9A 4NZLB 3PC6A 3OX3A 4GI7A 1WUIS 1WB9A 4P83A 3ICQB 3Q8LA 2OBYA 1NYQA 1AKQA 4C87A 4MQFB 4UPVA 3RT3B 4HJXA 1XKQA 4RF4A 1H65A 2ZJ8A 4R7GA 1RQ7A 2XMRA 4CYEA 3F98A 5J2RA 5EMNA 1C7JA 2NUTB 3K4HA 2AC4A 4Q4AA 2G3QB 4CV3A 3TW4A 3WY9A 1EFPB 3GUUA 2VDKB 4GKKB 3CCCA 3DF7A 1WIAA 3OJEA 2D0PB 4IWYA 3HTXA 2SCUA 2AZTA 2D1SA 5CLHA 3GUHA 1TC1A 4IQGA 2HRZA 2BUCA 1IY0A 4BCCA 3TXXA 2XBLA 1VC2A 2FLWA 2L3ZA 4GYQA 3QCAA 1U9ZA 4NAHA 2QMZA 2FQYA 4PQYA 1RRVA 1TKYA 2JAXA 4OL9A 5DTMA 1MB2A 1UH5A 3IP6A 3OTGA 5B4UA 1E61A 5B1IA 4JP1A 1KNXA 4MDHA 1D04A 3L4JA 2C4HA 5G0WA 4DCOA 1EX7A 1OUMA 3LPCA 1TU0A 5CU7A 3DBHA 2C07A 2H65A 1L7XA 2IY7A 3GEHA 3PGKA 2CWWA 1AN8A 1PJAA 4OD0A 2YEPF 3SR0A 4UA4A 1JHRA 4D44A 4RTNA 3H65A 1K7SN 1UWCA 2ORIA 5LD2C 2YJ6A 1LJUA 1DBQA 2ZRQA 3JQ9C 2DBQA 1P31A 4ENTA 1EP2B 1NVFA 2QE6A 2MWSB 1JEOA 2WWRA 4HP8A 4KX6B 1MD9A 1PBTA 2DHQA 3BXXA 2Y99A 4XDDA 2KE5A 2YZNA 3LLCA 3OCVA 4GNRA 2C5FA 2ZUVA 1J0XO 1QTQA 3P8ZA 3OJ0A 1Z5ZA 2NXJA 3WICA 3O8QA 2DKOA 1NVID 4Z7RA 3FTPA 4NV3A 2RIPA 1K68A 2FSPA 5JNLA 2O8BA 2O1EA 4RFSA 1PG5A 5GMOA 4AROA 3JWIA 1SBHA 1SCUB 4BTEA 1HZ6A 5EE0A 2Q9AA 3RT7A 2K8BA 1ZM9A 4HWKA 4M3NA 3NJ4A 4IG4A 3UJCA 3HVIA 1VE3A 2BSQA 1PKEA 3Q8AA 4MQFA 2H1LA 5FNVB 1CDOA 1XTIA 2ZBRA 4TQUS 3WYBA 1RWQA 3ZH9B 3O83A 5JZBA 1TA0A 2IYPA 1ZM2A 5JOQA 3LXUX 1OREA 2NUTA 2O3QA 5JZOA 2E89A 2ADOA 5DI3A 1L5NA 1WCWA 5CNIA 4R5HA 4MH0R 3LNCA 1A27A 2E49A 5TS3A 2O54A 2J32A 1P2BA 3E9RA 2HMUA 1EZ4A 4IV5A 3RZWC 1U2TA 1SHJA 3WHLA 1Q15A 5EMHA 1KWGA 4DWVA 1TAUA 1D6JA 3BMNB 3OUTA 3OO0A 2GCOB 4ESHA 2CZQA 1JTVA 3R75A 1AQJA 4KV2A 1A8UA 3EPRA 2EERA 3G8CA 1RPTA 1A98A 4B48A 5IC5A 4GOOD 1VSUA 1KYXA 1JU4A 4MI6A 1M8JA 2QLLA 2JANA 4K0RA 1NLYA 2FEKA 2BEKA 3KBBA 3L04A 4GPEA 1F2RC 2BFBA 3GJZA 1WUKS 2JVJA 3J7TA 5FTWA 3KLMX 5FPKA 1PR3A 4LY3A 3ZIMA 1MZVA 1ZAYA 4TXMA 3V42A 2Q9CA 1U9IC 4LTDA 2SICE 2ENUA 3A9JB 1Y1RA 5B1SA 2COEA 2QHXA 1PL0A 4PSKA 3CLVA 4IHAA 1MXFA 3O2QB 4DXHA 3HNRA 3BXFA 4JC8A 2ZW1A 4QVGA 2ZS7A 4LN1A 4ARBA 2XMGA 1DBVO 3AUSA 4TTIA 3AF6A 3ON5A 2OG1A 2PAAA 2VKTA 3ZIAA 5TRTA 3UHOA 1WBJB 1OQAA 1FCJA 2ZTMA 1RVDA 3DH0A 1TLFA 2AFHE 3BGOS 1SUIA 4BFRA 3CVWA 4IDNA 4QO7A 1R6BX 5F77A 3HJUA 1REQB 2JJ2D 2R1UA 3DHYA 5FNVA 5BQ5A 4BGIA 1RWOA 3RRBA 4F6HA 3T5CA 4R7TA 5EJAA 4NKRA 3KAQA 1HH4A 5E4JA 1YC5A 4NTZA 2YVUA 4DBZA 4Z9AA 1NVMB 1HGXA 1SQ0A 4ANWA 1N2JA 4D9BA 1L7RA 2Y1LA 4Q39A 4ZYLA 3H7IA 1B6TA 3RUEA 4MLDA 3S3TA 1E69A 3K16A 3ESQA 3D8BA 1RM5A 2QIEB 3ZTWA 3NS8A 3KLNA 4I1PA 1M2WA 1HXHA 3PGEA 3PI6A 4YT8A 4IVNA 4F5ZA 1Y89A 1V25A 1MQAA 4UAJA 4H27A 4PFKA 1F06A 4TT3A 2GKSA 1GL9B 1R4ZA 1HEIA 3RAGA 3ST7A 1FFCA 2BGGA 3BMNA 2W6ID 3N75A 4K9QA 1MR3F 2GCOA 2MCFA 5K3AA 3O74A 2NYUA 4W9MC 4ASUA 4NYIQ 4X6LA 4KR0A 4BX0A 3SEQA 1W6UA 2VYFA 3MLBA 5CB6A 4S05A 2ZIWB 4FS8A 2J30A 4NK5A 2GVZC 2NP7A 1U2ZA 4D42A 1F0ZA 4S04A 1RCFA 4LZZA 1JWAB 4OSPA 1TVKA 3HB5X 1WRAA 3WTCA 5CJ2A 2GRAA 2KDBA 1TF2A 1WYGA 2HHJA 3O4FA 5GIOE 1CZHA 2W2OA 1L5HB 3LLVA 1T26A 5L45A 4ZCSA 5KOIA 4R1NA 3A9JA 3P9NA 5JS7A 5AXDA 4AOFA 5M2QA 3GJXC 2OZLA 5L40A 4PG5A 2XEWA 4QBTA 2ZANA 1NV8A 2Q6VA 1U7PA 5MGBA 1DRJA 5AVSA 4NU5A 1PNOA 2G9NA 1NF3A 1SUEA 1EIWA 2V7WA 3VR1A 1Z28A 3H5RA 2QRKA 3N5CA 3SDBA 4JL9A 3SSMA 3K4PA 1O8CA 1G9TA 3D5QA 3QHAA 1X70A 4JWKA 3TYXA 4RWEA 4IIYA 5KNDA 3DVRX 1WBDA 2GYWA 2P2YA 5CITA 3KQ4A 4BMVA 4RZUA 2FUNB 3GA7A 1QDUA 5H4HA 1HDOA 3F5SA 3IE2A 1REQA 3B9PA 1MBZA 2OR3A 4QRDA 1IP9A 4X91A 4ZYSA 3WWCA 1TCVA 2QVGA 1QHHA 3DEHA 3I2JA 1WVMA 2JCVA 1RTTA 2N1WA 4AL4A 3IXSA 1PLKA 1IPFA 1EP3B 3UMMA 3JAWB 1PZFA 4E5UA 4TV9B 4GKAA 4JR1A 5TEWA 5DNUA 5EVJA 4JBYA 5CYPA 2FLVA 1RKXA 4QQFA 3G3EA 1V1OA 4Z7NB 1FP4A 2XKBA 4HMOA 3D0RA 5CPBA 1KJ8A 1Z6GA 5KNBA 1H6AA 4XYMA 3VA7A 1QG2A 2PUVA 1UOOA 2ERCA 4NBRA 4ZHOA 3VQTA 2D4HA 3NVKI 4E5KA 1WG8A 2DUMA 3AVTA 5HHDG 2UXCB 4IZHA 3H6HA 1YIOA 1RHKA 2AG0A 3FMOB 3B9JA 2DHCA 4URWR 4H7EA 4BKRA 1Z15A 2BR4A 1Y56A 4NS1A 4HGPA 3QVLA 1AKWA 2WRSA 1EXDA 4YRDA 3TD9A 1IXKA 3UCFA 1PG0A 5HUQA 2BHSA 2CVQA 1L5HA 2Y77A 3CUSA 4FDLA 2L42A 1SNYA 4EYSA 2YY5A 1G5HA 1U3VA 5EZYF 4RD2A 5B5SA 2WXNA 9LDTA 4ARVA 2PAFA 1KVQA 3DW3X 4TMWA 1T0HB 5DVZA 2J4XA 4FILA 3PTFC 3G5UA 3LW8A 4QPPA 1K6JA 1JX6A 2YN0A 2PZAA 5DLEA 2MBBB 1RKUA 3PQ6A 2A4MA 1KVUA 1K86A 2DSTA 3JQPA 1R0SA 1N8TA 5DXAA 4QM6A 5LR6A 3I42A 2B9EA 2KYRA 3TWOA 3RRFA 1BE8A 2AFIE 3KC2A 1O1YA 2Q5OA 3ZCSA 3AEFB 2X4GA 1Z2DA 2AQ2B 4G1MB 5A9TA 3RG8A 4D6XA 1HOXA 1JFSA 1EFUA 2OV8A 2ZJ6A 1CJUC 2WPDA 3LVFO 4ABYA 3GBVA 2RGYA 3QUCA 1CR0A 5ELXA 2NS5A 2GFQA 3VXKA 3VNRA 5FNVF 4BNFA 2GZSA 1LC0A 3PDUA 4HAVA 1QNLA 5IJ0B 5DKFA 3VJLA 1U0HC 4WINA 3EGRA 4MQ6A 1E2FA 3MJHA 4OX9Y 4OU4A 2CD9A 5B6PA 4W1SA 4AZSA 3JAWA 4TV9A 5FR1A 3CF6R 5F3DA 4LE2A 4WWOA 5HUJA 3EPLA 4ZZIA 1Z4JA 2QL5A 1LPNA 1Q5PA 3FY4A 4TS1A 4PT5A 1J5EB 3KSBC 2OCAA 1GGMA 9GPBA 4P36A 5AXCA 5KINB 4BZZA 3FPBA 4E2ZA 1Z4LA 3SI7A 1NRWA 1HSZA 2J5XA 4D45A 4FSXA 1MC4A 4PGMA 1L2TA 3KLPX 3T0IA 1GZ6A 1WV0A 2GVDC 4AX1B 3KKQA 1JEDA 1G8HA 2X8XX 1LS1A 4ZCQA 2QAIA 2B8WA 4YTNB 1NBHA 3MJWA 4L27A 1P0MA 2OZVA 4F3TA 5H83A 2Z2JA 4NE9A 2FG7C 4Y1FA 3COPA 3K0BA 2O5VA 3SWWA 2J3JA 4Z1MA 5B3KA 1X1TA 1S6YA 3W90A 4QUIA 1KH2A 5ALIA 3F6RA 4KEPA 1EHYA 5E9JA 2J33A 3VZRA 2VBIA 2FQXA 2F3PA 3ZHCA 3PPYA 4GRDA 1G7SA 1CJEA 2O50A 2A94A 3D6VA 4YH1A 1JVBA 1QZZA 1JWBD 3EVZA 2KTFA 1I4PA 4FJYA 2MJLA 1VHJA 2ZSEA 1SD1A 2VATA 4HQFA 3RK0A 1DB3A 1RJFA 5AESA 3TGLA 4KXUA 4J1QA 1KR3A 3DHBA 4KQFA 2PGAA 1YKGA 5CFLA 4I1VA 2VJCA 2VXBA 3MD9A 3W2DA 4EZIA 2EBFX 2AKAB 4ZI2A 1J7AA 3SG0A 2YJ3A 3M7IA 3RSSA 1RAAA 3FYUC 5CT9A 1ORWA 3DT6A 2ZSJA 1XXHE 3AVOA 3V80A 1GXSB 2HMSA 1NE7A 3B2GA 2BFNA 2AVNA 3PQCA 5FUYA 4ND5A 4NR0A 4YUAA 4HLDA 5A3RA 4FZ5A 2ZKLA 2BGJA 3IUEA 1ZIOA 2HADA 2B36A 3Q3OC 2KBEA 4FS3A 1WQ3A 1WS6A 2J1LA 3BSSA 1ZONA 2Q0QA 2ZJYA 4NMLA 1CU1A 4BOSC 3KNSA 1P29A 1C0KA 1L5KA 4WECA 3FAKA 3TW6A 5B7GA 4TXJA 2FG6C 1SBCA 2SKCA 4DCTA 3ER9A 4ZT4A 3FSGD 2C92A 3JZDA 4OXQA 4JB3A 1VPTA 1Y1PA 1N6ZA 3DCJA 2QYTA 1KSJA 4DMUB 1UDBA 5JYDA 2PJUA 3UICA 4D8WA 2BKXA 3SYRA 1WLYA 2EGUA 4MOWA 1UBUS 2NTVA 3TKLA 4UDUC 4J1NA 4B2LA 2Y4OA 1ECFA 3D8NA 1KYVA 2IZ0A 4B4VA 3C8DA 4V03A 1WP4A 5DP2A 3LP6A 5JFOA 3GLRA 3BD6A 4Z9YA 2I2XB 4RLFA 3JRXA 2FW0A 3ZYZA 1TDJA 3N2IA 1C1DB 3NC0C 4B6JA 3E3AA 3TMYA 3EE6A 1DKMA 2Y71A 2KTRB 1ACJA 3TI9A 3B1ZA 4PCLA 2H5JA 4BN0A 3D0OA 2WF5A 1U5CA 1PNVA 1ZN9A 3TPFA 4IAOA 1PP4A 4YECA 2Q3BA 3LO5A 4IIHA 3T6KA 3VTWA 2H4HA 3DMTC 2NZWA 1YZ3A 2HEIA 3TEMA 4Q34A 1S9HA 5IVPA 2KWVB 1K6XA 1ISSA 5KCZA 1JRUA 3CFYA 4YWHA 4F72A 2VH5R 2V4IB 4GB9A 3N32A 3QEJA 1QRSA 5C1DA 2ZREA 2WKPA 2DC1A 3WDMA 3I73A 1XELA 3JX9A 3PNMA 2J0EA 2XQVA 4TUUA 3IIEA 2I9PA 4N6NA 3O75A 2IPXA 1QRUA 4YGXB 4PXAA 1EFDN 3OQHA 4DUGD 2CNWA 1MX9A 5CM8B 1H4RA 1T2NA 1A71A 4FQ5A 3HS3A 1HA3A 4DWWA 2GTIA 1I8TA 5H02A 1V1JA 4DV7B 1J99A 1UWMA 2K25A 5AKIA 2PSSA 3FNBA 3W06A 1R3DA 4TV9F 1OGYA 1RP7A 5C9ZA 3TLGA 2YV5A 5IRCD 2WTXA 1DQZA 1N7HA 3VDXA 4N6OA 1UZAA 5BYKA 1ZD2P 2ST1A 3KWLA 1GJRA 2RH5A 3WKAA 5B2EA 4CF6A 4XB1A 2BMEA 1PT8A 4LK3A 3TOZA 4EYEA 4JLPA 2PE9A 2ZAOA 3CZRA 3RRYA 4E08A 3E48A 1BXKA 3OM0A 3KKOA 3VKUA 3TUZC 4P5EA 1ZL2A 1JKMA 3DDUA 3VNVA 4XZ4A 3RC3A 5HPYB 1C5KA 1GRVA 4MCIA 3QPAA 5ITWA 4LXTA 3TQIA 2F3RA 1K3TA 4LPKA 3VPEA 1XMSA 4JPSA 4D4GA 5T41A 3BHIA 4DPKA 1L4ZB 1DIBA 1AUPA 3IP5A 1C1DA 3EW9A 4PXYA 3PYXA 3WRVA 2ZYTX 1CF9A 2KTRA 2D59A 5BO4B 1XJWA 2HQSA 1YQQA 3N8KA 4KBFA 1G19A 3EY4A 2GBLA 2HLPA 2IDYA 2G1UA 4QODA 5TMBA 5ALZA 2O5EA 4V0ME 3WHPA 1LF0A 1RJDA 2UKDA 3AVWA 2IHYA 4D2KA 3Q3EA 2J3LA 2XQIA 2BUAA 4IOMA 4JVLA 1OT5A 3EZNA 4BQNA 2QM0A 4G56A 2WV9A 4V2UA 1L8LA 3RSHA 1XPRA 1ZINA 3R41A 1JR3A 2YOGA 4D25A 1NJGA 3GUCA 1G7TA 4B5LA 3H9CA 1LX6A 4IMPA 2AN4A 4W9NC 1VIVA 4RNCA 3L4KA 3PSHA 1TD1A 4DIDA 3HB4X 2OHGA 4DLZA 3MC9A 2PXHA 4KFCA 1RM4A 2GK3A 3I2GA 1K0FA 3H1BA 4HYEA 4X8OA 1OXUA 2CVOA 5HE9A 3PPAA 1JRLA 2AWOA 3K94A 1XEFA 3KUUA 1X0XA 4AS3A 5FAXA 4Y6QA 1P33A 1T6BX 4L57A 3LUHA 1R0BA 2BUBA 1XZKA 2CD7A 1ISNA 5EP3A 2FEAA 1AMUA 2VCYA 2OKCA 2J5QA 1Y7IA 5C35A 4D4MA 2C3MA 1VD2A 2H4JA 2PKYX 1DBRA 1T0BA 3K5IA 3RRZA 1CIPA 2O07A 5DT2A 2VPTA 3UMCA 3UZUA 3BE8A 3F6EX 3O73A 3MCTA 4C1CA 1T10A 1Z39A 4ZOLB 3UJ6A 3HU1A 4ZU6X 1RRMA 3B6ZA 1XU4A 1CR1A 3CYFA 4RPIA 2KQUA 2CUNA 1Q0LA 2HWWA 4OFXA 2DHRA 2JFQA 1KLGD 5T4FA 4CM9D 3JALB 3K70C 5A87A 3CEPB 4LTMA 4BYGA 1KNQA 4WXMA 1YS6A 2Q42A 1OD6A 4MEJA 1Y8QB 1FJGB 5TSSA 5FXMA 1BE0A 2L0TA 2PLAA 3R4VA 3IR5A 4WI1A 5LFAA 1XDWA 1Q84A 1WW2A 3U17A 1XTBA 1X7HA 4J2HA 1QVZA 4IGFA 2O2CA 4FXOA 3OQ6A 2KACA 2QE7D 2EZUA 3KUDB 3FZEA 4F5EA 5JY1A 1NU6A 3H9DA 3SS7X 4TTRA 1R64A 1WXMA 1D1PA 4MVJG 2P67A 3DGEC 3IP7A 1T4DA 1HXYD 1FRQA 5KNCD 2M6RA 1GGNA 3P2MA 5CG2A 2F6RA 1Z06A 1FNBA 2AVDA 5CLQA 2FX2A 5E7MA 5AVJA 4CN9A 4JJGA 1QZXA 2OUIA 2LHEA 3RK4A 2XT6A 4GOKA 5IN4A 1EUDA 1AA9A 5IHPA 3MGAA 1JDUA 1TQ8A 3E7FA 4IICA 4BOZB 1H2BA 1PFVA 1IOVA 2L76A 3K0SA 2DFLA 2WJZB 3JD4A 3KVFB 1YZVA 2BTNA 3C14C 4ETWA 1J0EA 4TTPA 4CHLA 2H1CA 2GEFA 1B93A 4LRSB 4NAWB 3AV0B 1A2OA 1YQGA 5JCJD 1KU6A 5EEHA 3FNHA 1E79D 2O3JA 3HDJA 4KN5A 4HCJA 4RGVA 3S0ZA 4DJ5X 4BFSA 4XVHA 1KQGA 1NW4A 10MHA 2EFCB 4U2GA 1I80A 1YBAA 4QSMA 4JEHA 3V32A 2KN5A 5DTRA 3RODA 4GMHA 4JC5A 3C19A 4INZA 4HVBA 4YCLA 4ZYVA 1FFWA 3Q8CA 1RADA 1OXBB 4ZOLA 1LI4A 1C9DB 3X30A 1CZRA 2XSZA 4UJ5A 4DMHA 3UO8B 4RTJA 2WKRA 1G4UR 4RANA 1MA0A 2C78A 4Q1VA 2FZLA 1E32A 2Q1WA 3C74A 3ZVNA 4KE6A 4N8EA 2VEDA 3U7RA 3SEZA 4AO6A 1EUQA 2PSFA 5MN6A 2BIFA 3HO6A 1O5TA 3OAAA 3JALA 2XHEA 2HSZA 1YNTE 2A5UA 3HYRA 4UXHA 3AUUA 1DBWA 3VRBB 1Y8QA 1T2AA 3MBOA 3RVOA 2NZYA 3KQHA 2KB0A 3REFA 1XT6A 2G70A 3LRXA 1S3IA 1OX4B 1YCFA 3RU7A 1K9SA 1JBEA 4EIWA 4NE2A 3H2HA 1LI7A 4R98A 2C2MA 4BX9A 2I7XA 4W5TA 4DEVA 1NXVA 4YCJA 2ZRGA 2D3TA 5A0VA 4NG4A 1VCIA 4JI5B 2C9MA 2VHJA 3DHVA 1OB2A 3KYBA 1H3EA 4X7MA 3OKPA 2YN4A 3M82A 1G66A 3C3MA 2D8AA 2AD1A 5EJIA 5FYQA 1V5OA 2KQ7A 1ADCA 3QWFA 3GXOA 2GOWA 5DHTA 4FZVA 3WOVA 4AY3A 2GZDA 1U8ZA 2IH5A 2OMEA 2YYZA 4G0UA 3A6LA 5ECGC 1DG9A 4YMHA 3ETNA 1M6WA 1AYFA 1V5FA 1U2SA 2R7KA 2X9GA 3BHNA 1I4XA 2ZTVA 1YBMA 3OIGA 3KP1A 5FOVA 2YY7A 4CHKA 4NAWA 1E2LA 1Z4OA 1GUBA 4NQLB 1N0IA 4TZEA 3A2LA 4MRMB 1XRNA 2ZUFA 4HAYA 4C07A 1E2HA 3AVQA 5JH7B 1ESNA 1A95A 3ECIA 2A3NA 5C7LO 4G5HA 4J1SA 3ZV5A 2VDWA 2QXYA 3Q12A 3REQA 4RD0A 2BM8A 4AKIA 3V8EA 3CRZA 4LC9A 1IN7A 1Y4ZA 3DP9A 3ZW8A 3L6DA 3TJRA 4BDSA 3Q2AC 3PRPB 1LSOA 2R85A 1W1IA 3F47A 3WAMA 1DC8A 2YVQA 4ZK2A 2X9NA 3JRNA 3L1JA 3ESYA 3OP1A 1SVWA 3R3XA 2JY6A 1ZX1A 2ZCJA 4L22A 3AEAB 3LUAA 3EMKA 2FIFA 3AG6A 2KNBA 4F3YA 3AONB 3UQBA 2WAYA 4CKWB 5BWNA 3I5AA 4H0CA 2FMKA 2HBZA 1TT5B 1KSHA 5J43A 2AWTA 3DULA 3GCGA 1HSOA 4RFLA 2QI9C 3S81A 4JVSB 2GAJA 3O4GA 3Q40A 1KPGA 2R4TA 5BWCA 1XA4A 1OX4A 5BQXA 4OXYA 1FQOA 2H9IA 2CK3A 4PZPA 1NQUA 2WDQB 2ZETA 1VIAA 1P7ZA 2XT0A 5K99A 4BO1A 1WAMA 2GBGA 4K6CA 3W8DA 4A1OA 5H82A 3K5WA 3HVZA 1JR4A 1V7QA 3AR2A 3WV5A 5JFTA 1F14A 3LSTA 2XCSB 2VL7A 4R05A 4AYXA 5EOVA 1ZCZA 4A15A 4FEKA 3T3OA 1PT6A 1XN1A 4MPJA 3VYSB 2VDPB 3WGQA 4YUXA 3ECAA 4PINA 2HDHA 4JP8A 1IGCA 5BW8A 4A0HA 3RH0A 3TDKA 4HVTA 3MF4A 3VX4A 1TK3A 1QVVA 2Y6VA 1A8PA 1HE1C 4ZOEA 2WNSA 1NBME 5JHHB 4MLCA 1S2OA 4F1JA 4C06A 1FTWA 3T0FA 4OG2A 3G6WA 1SE2A 4CNQA 3SCZA 1TL7C 3PUHA 3D5TA 3MC8A 2Q29A 1D7AA 2NOAA 3SS9X 1NV9A 4UTRA 2G7MC 3UPUA 4J0QA 2O2VB 4XWAA 1CUHA 1V4NA 5AJUA 2M19A 1YA4A 4NCAA 4OI0A 1TQ4A 3E7XA 5AIBA 3EPPA 3OECA 1OI3A 2ZXUA 3TNJA 4C0HA 3D1JA 2X0FA 2Z4TA 5BNWA 4B79A 5JAUA 2HN9A 2DYOA 1G9XA 3U1BA 3AR4A 3H3EA 4D97A 2IOHA 2CXSA 2DKNA 1DO2A 3EZYA 3EG9B 1EXWA 2JGIA 3U4GA 1KAQA 2J9RA 1VCBA 3OPXA 3IPYA 1JQEA 3ABIA 4B3FX 1PL6A 1L5PA 2P7HA 4F46A 3DOOA 3T5PA 1G3QA 5CW1A 4HJRA 3SPXA 4E6EA 5LQMA 1XTQA 3ZGZA 4CKWA 2I55A 4YRRA 2IYRA 1RYBA 1TT5A 1PZNA 3GFVA 2WZDA 1OU4A 2RHOA 1NVVR 3U61B 3QLJA 1U65A 4RX1A 1VLHA 1V0JA 2VP0A 4BZAA 3SQXA 1DMRA 5KU7A 2RPQA 2H51A 3N59A 3ZDTA 2R2OA 3O1HB 1GPKA 2VPXA 3UY4A 1QQTA 1U7DA 3T0GA 4Q00A 3H1EA 1I2AA 1VYVA 1XKXA 1GQ2A 3DEJA 3WYNA 3TZHA 5K0WA 2IO0B 1UJMA 2FX3A 3LCUA 4YJFA 1I3KA 4S1NA 1KMNA 2BDEA 5DI9A 4I81A 3QWAA 4GPZA 3RUIB 4RAWA 421PA 1R5JA 1GG8A 2BHLA 3BDAA 4PSAA 3FKSD 1EH5A 1AGPA 3CSUA 4A6XA 1NMXA 3FZNA 3VU3A 3JQEA 3ETGA 2WBLC 4HNSA 1OFVA 2I1JA 2C20A 2NSYA 2P4UA 2BHRA 5AUOB 2RKOA 1VE1A 3PHLA 4Y2JA 1SRQA 5KQMA 4H35A 1Z0AA 3U52E 1JYFA 4DG8A 4RH3A 2CJNA 3K9LA 2G71A 3LSYA 1L4NA 2W2VA 1FX0B 1XF1A 4OXRA 4HGYA 2ZQZA 3LJKA 2O2VA 1T9GS 1CP3A 2IHVA 2B69A 4WCDA 3TRHA 1ES9A 3FUVA 5AYVA 1CPYA 2AMFA 2IEGA 4HS9A 1CUXA 3DL4A 4KK3A 4QOJA 4L4ZA 5C3UA 3PVLA 1MEOA 2PD6A 2DR2A 3PNYA 4Z5YA 2ICIA 1LNQA 2HYIC 4TYMA 2Q3DA 1FNWA 2JD1A 3QHPA 2Z0EB 1Q95A 4ZHQB 4UAUA 2I1KA 3GXBA 3WADA 2IEDA 3FWYA 4BMSA 1XZHA 2XWQA 3EG9A 4RPLA 4FR7A 1USGA 1WXVA 2IY1B 4X93A 4XE5A 1IC6A 3DZBA 4UZEA 2Q2NA 1WGDA 3AEGB 1TUEA 1RKQA 2ZE7A 5M34A 1YS2X 1K3UB 1EEXB 2DAPA 1XALA 4EPWA 2P75A 2EJTA 1BS1A 1TRKA 3O8BA 1ISMA 3J81A 5JDIC 1T35A 4ILEA 2ZWVA 3HFGA 4BO8A 4FLEA 1U2DC 5GGXA 4PFSA 1F9AA 2YWHA 2RR9A 2G1PA 3TEZA 1H2EA 1X0VA 3KQTA 4J76A 3Q3GE 3LQQA 5ILQA 4XDYA 2CFUA 2HWUA 3ZK7A 3NKVA 621PA 5E7IA 4XM2A 2BI8A 2Y3AA 4EW6A 4FEAA 1X86B 4JI2B 4G4JA 1RWNA 3F97A 4OV6B 1XO3A 1MJ5A 4DBLE 1VGRA 1PGOA 1ORRA 2JFZA 3GD5A 1NQVA 4NENA 5U4QA 2D7CA 2YWRA 3LBNA 1YCDA 4M1WA 3KK0A 4X1IB 4JNCA 3ONDA 1CS0A 3N0RA 2OQVA 3BKXA 4HDNA 1PGJA 3RUIA 1ZH6A 3VTKA 4UBNA 1WIWA 1MORA 3G9XA 2SECE 3CPJB 5K4AA 3D6JA 1BU8A 3UA3A 3WNCA 4G0MA 3LT1A 4PV7A 5DV9A 1MT0A 1XWWA 1WJGA 1II8B 3H9QA 1TJPB 3DYBA 1JNYA 2UZ0A 4LYHA 3T7EA 3U7HB 1FX0A 3ABVB 5IA7A 2ZULA 3EBOA 2I99A 3W9UA 1YJBA 3M5PA 4R8SA 2AEHA 5JH7F 4ZQBA 4Y7DA 3TRIA 3AESB 4RFSB 5DPXA 5KDLA 1PJRA 2QTBA 3ROQA 2FPLA 3IGFA 4MP6A 3QBTA 1EHCA 3AR5A 5TSDA 3EZ7A 3PXCX 3GRPA 2WXPA 2GA8A 4G36A 3EC1A 3NOOA 3KJGA 5HX7A 4ZHQA 1J8YF 1P19A 1EXNA 4E88A 1U98A 1J0GA 2W5UA 3REGA 4R8LA 4CQMB 3I2HA 1VLMA 4LDAA 2UWQA 5HJEA 4OREX 2OXIA 4QOGA 1Y8CA 2RK3A 4KQMA 1GTVA 2ORWA 3SQOA 3BWCA 1DGQA 4YT0B 5DI3B 3NDPA 3PLVA 1MRZA 1RWVA 1HFWA 2Q3JA 2PFSA 1TTHA 3OTHA 4G0WA 1L5GB 4OVKA 4RVOA 3AJ8A 1CUZA 5I6DA 2VTEA 3K5PA 3OM9A 1EM7A 3A1WA 5A3SA 3V8BA 1MG4A 1VZ7A 4CLEA 5AK0A 1GD1O 1WXQA 2ZZIA 4PHTA 2IVFA 4BWFB 4N54A 1QZTA 4AKHA 2XUQA 4RAQA 3WGUA 3ZKWA 2PJHA 3QXSA 2WAXA 3R7WB 5KC9A 3L7LA 1T8YA 3JWPA 4LNUB 4XXHA 2BMWA 2QX7A 3H9BA 3HZOA 5EKTA 2Z8ZA 2EFEB 2OFPA 1JFFB 4X1IA 3OETA