3BK2A

Crystal structure analysis of the rnase j/ump complex
Total Genus 168
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
168
sequence length
549
structure length
549
Chain Sequence
b'QDHVEIIPLGGMGEIGKNITVFRFRDEIFVLDGGLAFPEEGMPGVDLLIPRVDYLIEHRHKIKAWVLTHGHEDHIGGLPFLLPMIFGKESPVPIYGARLTLGLLRGKLEEFGLRPGAFNLKEISPDDRIQVGRYFTLDLFRMTHSIPDNSGVVIRTPIGTIVHTGDFKLDPTPIDGKVSHLAKVAQAGAEGVLLLIADATNAERPGYTPSEMEIAKELDRVIGRAPGRVFVTTFASHIHRIQSVIWAAEKYGRKVAMEGRSMLKFSRIALELGYLKVKDRLYTLEEVKDLPDHQVLILATGSQGQPMSVLHRLAFEGHAKMAIKPGDTVILSSSPIPGNEEAVNRVINRLYALGAYVLYPPTYKVHASGHASQEELKLILNLTTPRFFLPWHGEVRHQMNFKWLAESMSRPPEKTLIGENGAVYRLTRETFEKVGEVPHGVLYVDGLGVGDITEEILADRRHMAEEGLVVITALAGEDPVVEVVSRGFVKAGERLLGEVRRMALEALKNGVREKKPLERIRDDIYYPVKKFLKKATGRDPMILPVVIEG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Metal dependent hydrolase
publication title Structural insights into the dual activity of RNase J
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Hydrolase
total genus 168
structure length 549
sequence length 549
ec nomenclature ec 3.-.-.-:
pdb deposition date 2007-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07521 RMMBL Zn-dependent metallo-hydrolase RNA specificity domain
A PF12706 Lactamase_B_2 Beta-lactamase superfamily domain
A PF17770 RNase_J_C Ribonuclease J C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.580 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3bk2A03
3.40.50.10710 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Metallo-hydrolase/oxidoreductase 3bk2A02
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 3bk2A01
5B15A 2AIOA 2BG2A 4WD6A 4HKYA 3IEMA 4GCWA 4UWRB 4F6ZA 2FK6A 4RAWA 2QDTA 2Y8BA 4UWOB 2OHIA 2WHGA 2HB9A 2BIBA 5EVKA 4AWZA 5A0TA 3ZQ4A 2FU6A 3RKJA 3SFPA 4LE6A 4YSBA 2BFKA 2YNTB 5ACXA 5AXRA 3AF6A 2P18A 2I7VA 2YNUA 5LLDA 2BC2A 2FU9A 1JJEA 5ACWA 1X8IA 1WW1A 3I0VA 3I14A 2GKLA 2WYMA 5HIOA 2XF4A 3T3OA 1YCGA 2YNWA 2FU8A 5HIQA 4P62A 4V0HA 4KEQA 3SBLA 1WRAA 2Q0IA 5K0WA 3ADRA 4Z5YA 3IEKA 4TYTA 3IE1A 1X8HA 2OHJA 4RBSA 1BVTA 3DHBA 5ACQA 5EW0A 3L6NA 4ZO3A 4DILA 3I11A 4PVTA 2Q0JA 5HISA 5IQKA 2BG7A 4RAMA 2FU7A 4NQ2A 3BV6A 5LSCA 2Q9UA 2M5CA 4C1EA 1XM8A 4BP0A 2BG8A 4ZEJA 5LE1A 5K4MA 2Y87A 5AYAA 1E5DA 2Q42A 3IOFA 4NQ6A 5DPXA 3F9OA 5LCHA 5KILA 3MD7A 4AX0B 1A7TA 4HL2A 5AHOA 4JO0A 4AWYB 3ZWFA 1DD6A 2BFZA 4ZNBA 4KEPA 1K07A 2QDSA 5KIKA 4D1WA 4HL1A 3ZNBA 2QINA 3LVZA 1DXKA 5ACUA 4UWSB 4NQ5A 5EV6A 4FR7A 2YZ3A 3X30A 2A7MA 1SMLA 4EXYA 3PG4A 1ZKPA 4D1VA 2BGAA 5HIPA 2YCBA 1VJNA 4C09A 5EWAA 1VGNA 4C1FA 4O98A 4Z7RA 4UBQA 4TZBA 2BR6A 2YNVA 1KO2A 1L9YA 4UA4A 4Z67A 2YNTA 2FHXB 2P1EA 5B3RA 5LCFA 2BTNA 5A5ZA 2FM6A 5FQAA 2GFKA 4BZ3A 2E7YA 1X8GA 5B1UA 4CHLA 2XR1A 4GYUA 4TYFA 4D1UA 4C1DA 4TZFA 4AX1B 2WYLA 2DOOA 1MQOA 4EYBA 5ACPA 3X2ZA 2BFLA 1M2XA 1ZTCA 2NYPA 1QH3A 3R2UA 3S0ZA 5LM6A 5EVBA 5K4KA 3Q6VA 5FQBA 1JT1A 3QH8A 4XWTA 4XWWA 4EYFA 2WYMC 3H3EA 3BK1A 4B87A 3DH8A 1XTOA 3A4YA 5K4NA 4U4LA 1QH5A 4Z6XA 3SRXA 2NZEA 4NQ4A 4PVOA 1Y44A 4YSKA 5LMCA 3RKKA 3AJ3A 4Z5ZA 5AEBA 3ESHA 2Y8AA 4YSLA 2GFJA 3RPCA 4Z60A 3BK2A 3T9MA 2I7TA 2R2DA 3PY6A 3G1PA 5LS3A 5HH5A 1YCFA 3IDZA 4RM5A 5AHRA 2GMNA 4UAMA 4AD9A 5EHTA 1DDKA 2P4ZA 1P9EA 3IELA 2BMIA 3IE2A 5HH6A 5EV8A 5ACSA 3SW3A 3KNRA 3X2XA 5EH9A 5ACVA 4EYLA 4EFZA 3VPEA 2DKFA 4C1CA 4H0DA 2ZZIA 4TZEA 3PY5A 4DIKA 2I7XA 2YNVB 4FEKA 4RL0A 3P2UA 4D1TA 1KO3A 5AXOA 4EY2A 3I15A 5HH4A 3ZR9A 4C1GA 1WUPA 1A8TA 4C1HA 2QJSA 3DHCA 3KL7A 2QEDA 3IE0A 2WRSA 3T3NA 5A0VA 3BC2A 1YCHA 2NXAA 1ZNBA 4XUKA 3KNSA 3SPUA 4D02A 2FHXA 2P97A 4EXSA 2ZO4A 4ZO2A 3TP9A 1HLKA 1BMCA 3FAIA 2ZNBA 5LCAA 2OHHA 3AF5A 3DHAA 2BG8B 2BG6A 3VQZA 2UYXA 3SD9A 2M5DA 4RL2A 4TZ9A 2AZ4A 2H6AA 2ZWRA 1BC2A 3WXCA 1JJTA 5ACTA 3I13A 1WUOA 4J5FA 1VMEA 3FCZA 5FQCA 2GCUA 4F6HA 3X2YA 3IOGA 5A87A 4FSBA 1KR3A 4GYQA 2BFZB 3JXPA 2CBNA 2VW8A 4J5HA 5ACRA 2NZFA 4UWPB 5EVDA
chains in the Genus database with same CATH superfamily
3EVTA 4XZ3A 4BAXA 2BG2A 3IXSA 5LQKA 2JKYA 4ECAA 3NWBA 4MVJI 5LMZA 4GBED 5C5CA 1FS4A 3ER6A 3IYLW 4WBNF 3PDIA 4BQOA 1I13A 2ZI4A 4JJGA 1YZLA 4GWLA 3ZHQA 4EVQA 1C1XA 3QKRB 4I5GA 4FOSA 1P9DU 5A0TA 3C8UA 1T5HX 3ER9A 5KJEA 4W82A 3WHLA 2QX4A 4ZOLA 2YNUA 4D9CA 2VHJA 1U8FO 5HZKA 5AH0A 3WAPA 2VSNA 4GIVA 1T2VA 1KJTA 1LSJA 2HSZA 3EPPA 3C1OA 3KBBA 1G16A 3S6JA 3SXJA 2IQIA 1TQHA 1GUFA 1OVMA 4QHTA 1J33A 4YYEA 2VDJA 2IIBA 3GVXA 3MWEB 1TAUA 3F6RA 3KYBA 4K9MA 1SELA 3MTAA 4LOHA 1FMTA 2X77A 3WGNA 1I33A 5GP1A 2BB5A 2WKSA 3KYIB 1UXKA 5D84A 1H23A 3BV6A 4MJ7A 2MSDB 3EC8A 3FC4A 2XT9A 3SU8X 3LL4A 3IT2A 5ELMA 5HIIA 1HM5A 4QECA 2JIZD 3O95A 1SVSA 3H1PA 2Z5FA 4L51A 2CBZA 2L2QA 4Q3BA 5EXDA 2PKRA 3N0VA 3PNYA 4X41A 3H16A 3E8SA 3DULA 2YZGA 3KHUA 4NE9A 3VHXA 2DHRA 4OSEA 2VJCA 2CU1A 1XRMA 3LC1O 3JASA 1XEAA 4CCSA 2FQXA 2BFEB 1NXWA 3PI7A 4BE9A 4F9GA 2A1UB 4W9KA 2YVLA 1K97A 3LRTA 1G2PA 3MS7A 1O0SA 2DR3A 1CY8A 2JW5A 4WWMA 3JVDA 2I65A 4PSKA 4PFKA 1M1NB 1YDEA 2IYOA 4BBAA 4PG4A 1Q7GA 2C82A 2J6CA 2ZIXB 4B4KA 3UA3A 1GRVA 3ZKWA 4GG1A 5K0EA 3KTAB 2P6PA 1J39A 2G9VA 3ETDA 4Y0AA 2YJGA 4C05A 1ZY2A 1KMQA 5FPSA 4FLHA 4PZAA 4LBZA 4D2KA 4Y2SA 5C46F 3AEQB 3IHLA 4AZWA 5IXYA 1YD8U 1HGXA 5A5VA 3QH8A 1QIDA 3HO1A 2PYZA 2KVRA 4ZQBA 5K09A 4U2DA 1XTOA 2B61A 4U4LA 2WXPA 4M0DA 2YOFA 4HF7A 4AD8A 3A6FA 4ACFA 3M34A 3UBTA 4ZV7A 1PFVA 5MF6A 3LMKA 2XCSB 4XKJA 2F9MA 3NW9A 2BTEA 4PLTA 4BFTA 1P6UA 1N6OA 1N0IA 1BXZA 1X9GA 5ES4B 1EP3B 4BLOA 2J9RA 4NU8X 1TZ2A 3AW8A 2IP1A 4G8JA 1SN7A 3GP5A 4DA6A 5D51S 4G0ZA 4OQQA 4A1OA 1FUIA 1W35A 3I53A 1GNRA 4UCWA 4UTXA 4F4IA 2GXQA 2EKQA 4HVLA 1C78A 3TQIA 2H1WA 1TM2A 3QWFA 2XEDA 1LO5D 5ICGA 3T3DA 1ZK2A 1JJBA 4DRXB 3Q69A 3ICQB 3GXOA 2OBMA 1Y1QA 5HVNA 1DUIA 4NCHA 4DV7B 1HE2A 4EYSA 1JS1X 2FA9A 4U2BA 2YWHA 1XAGA 4R01A 2Y4NA 4U6QA 3A2MA 5JXVA 4US8A 1F0PA 3TD6A 1UBRS 1PKXA 5BWCA 3EUB2 1PDOA 2YY7A 3UWPA 4HWKA 2WQZA 3OJCA 1MIOA 5LQMA 3TKYA 2OHVA 4MV7A 1QRDA 1ORRA 1GNVA 3UMCA 4GICA 3B82A 4M0PA 3L13A 1HDIA 2DFKB 4AKTA 4W5HA 2GERA 2H2HA 1XLWA 5AW7A 3BZDB 1V8FA 3OSUA 3OZCA 4D4LA 1IK4A 4RK4A 5BN4B 1W7AA 4MV8A 1E8WA 5YASA 1HLDA 1I36A 4IM2A 4B9EA 3ENEA 4ASUD 4CHGA 3CWZA 4MHOA 5J2TB 4C0KA 2NP7A 2KJ6A 3O9VA 4WJZA 2VL7A 2QT0A 3GB1A 4DCNA 4RENA 4KQGA 4BQSA 3MOIA 2YNTB 4D3FA 1KY4A 2CB0A 2C4VA 2GEKA 5J4YA 5LN1A 2G7MC 3HYTA 2H2WA 4AMBA 3RUAA 4TKVA 1G8HA 1ZD1A 1I4XA 4EEZA 2OWEA 2ZI9A 1HZ5A 5CB0A 1UINA 3ANYB 1RMQA 2EX1A 4AM8A 4EG4A 1UEIA 4ROSA 3NOVA 1T5LA 1T5BA 4LKOA 3O47A 3OJ0A 2FJUA 1W2HA 4TL7A 2Q0HA 4O2AA 3L0YA 3NY5A 1FTQA 3WBKA 1AD2A 4I6JA 4W1RA 1ECPA 1Z17A 2R1VB 3P8ZA 1A5RA 5BY2A 4MXDA 3A1DA 3SHWA 3A6LA 4QU8A 2WTMA 2AWOA 3FMPB 3SEZA 1CQVA 1N9ZA 3FGPA 5KAMA 5H02A 3LRPA 5LE1A 1XDBA 2JLCA 3RO7A 1GG3A 2WHXA 4PS7A 2OG2A 2EKLA 2ODBA 4IUYA 2PL9A 1C9JA 5TPZA 4AWYB 1DQYA 1CUJA 3SEAA 1W19A 1DO2A 1E3MA 3WX0A 1KI1A 1G63A 5DWQA 3N74A 4Z6KA 4F8CB 1K8QA 4GLBA 1Q50A 1SMLA 2JBAA 1P44A 1W59A 3ECSA 2GO1A 3TINA 3LHKA 4TZKA 3O90A 4JIMA 1G21A 2YYYA 4XUEA 4AURA 1SB8A 1WAMA 5FV4A 1URPA 3UUWA 3LQFA 1F38A 3AB7A 3BA1A 3OIVA 2AW5A 4MX8A 4OP3A 5H4GA 5IVHA 1LPBB 4DOMA 4NSNA 4FHFA 3VSDA 2ZKIA 1C81A 3X1DA 3TRIA 4LYFA 2VJQA 2QD5A 1EWQA 5F3RA 3L7MA 4OMCA 2AMJA 4QUGA 1UBJS 3VUWA 3LGAA 1RZRD 3RYFA 2VJBA 2CFIA 3BIJA 5JS8A 1KOGA 1QFJA 3ZU4A 3OLZA 3KT6A 2C4UA 1XGKA 2G09A 2IYYA 1M7HA 3SQXA 5JWRA 1J0BA 2C5FA 3BQMB 2PGLA 1Q0QA 3RKKA 3Q87B 1GOTA 3O2JA 2WD7A 4B3CA 2M2IA 2PLPA 3P94A 2I7DA 4PIVA 4TROA 1Z82A 2YXNA 5HKAA 3GT0A 3IT6B 3BHJA 1SUAA 2L0FA 3OTHA 2IYRA 1WB5A 2ILTA 2WKRA 5EQTA 4FYMA 2XE8A 3VR3A 4W5OA 4A15A 5CFMA 1N5RA 2OE2A 3GT4A 3L1KA 1Y9EA 4DMUB 4PGGA 1GVHA 1P1HA 4DQVA 5DIFA 1E4YA 4MIYA 3QTLA 5B3JC 2OA0A 4FEKA 4NU5A 2F00A 4FX5A 4BFZA 4ENWA 3PPAA 1OBHA 4PTYA 1OE0A 4N01A 2OO3A 1CS4C 1GAJA 4KSLC 1WYWB 1H0SA 1KTKA 2PQ6A 1XHFA 5EWMA 3GFTA 4TV8F 3AEEB 2O1SA 1FP1D 5IKXA 4I8IA 2GHRA 2CXXA 1WZEA 4BVFA 4OYRA 4V1CI 4KSKC 5KTTA 4DLRA 2WU5B 1PHPA 1UP7A 4LNOA 2W6CX 3DJFA 3M5WA 1QGAA 2JFZA 1XCGB 1PJZA 3MGCA 1OVGA 1YRAA 3FKSD 2DWQA 1VC2A 4F6HA 3TECE 2CK3D 2Y1LA 4XARA 4OHJA 2VW8A 4KQCA 3KV1A 5GZ3A 4NV0A 1RHRA 2AMFA 3LECA 4NQZA 3SVLA 1SXQA 4YRCA 5JBQA 1WCV1 5ALNA 2C3YA 1KDTA 3I57A 4RVUA 2OHIA 3AVTA 1OI3A 3F6SA 4QYTA 1PUXA 3T34A 3A9VA 2ZSUA 4RUKA 1QRTA 3KUDB 2Z8YA 4JSRA 1RQNA 4NCNA 1ODSA 1R6DA 3CB4A 1CUGA 1ADFA 4XH9B 4GOMD 1KZ9A 4EBFA 4Q4HA 1WSAA 5IMSA 2ZRNA 3CSSA 5LUAA 1ZH4A 1BE8A 1TK9A 2RI6A 4GLFA 1L5KA 1WD7A 3GLFB 4Y2HA 4E31A 5BV2P 4A36A 1BVUA 2HIAA 2OILA 3RJMA 2RD2A 2Z57A 1FXUA 2PR7A 2WJ3A 2IEAA 2RGAA 2I80A 4HKQA 1XMJA 3W8DA 4NJOA 5HQ3B 3OCZA 3HB0A 2PU5A 5L3VA 4ZJUA 2W4MA 2IZ1A 1TAHA 1Q0PA 1HYBA 1OYOA 5JLAA 3NO4A 3PGVA 1CKEA 2ONCA 3OOHA 5JIBA 4UDOA 3TXYA 3EVBA 1CQIB 3VH3B 3NV9A 3T41A 2IE8A 3JQBC 4BATA 1MT3A 3PWKA 3V00A 5IYZF 5I7WA 3MTGA 3C14C 4A91A 5FLYA 1L0VB 2CLCX 3TN7A 1EM7A 4M49A 2N3ZA 4IZIA 1OT5A 2KE5A 5BR4A 1O6FA 5LP6F 1MG8A 2B4RO 3CF2A 3EIFA 3IBCA 1JHDA 4G1MB 5L7WA 4WA7A 1CWUA 2PNFA 3P9IA 4WW0A 4FGWA 1JSRA 1KU0A 2DYOA 4TTAA 4GL2A 1HQCA 1QCYA 2LPMA 1T1GA 1K6IA 3NI2A 1L8AA 4Q01A 4K7UA 4ND8A 4IL5A 4YCCA 1U7DA 1TD9A 2Y0BA 1WVGA 1J49A 1GIAA 3O2SB 1P2VA 2ZBEA 3FGOA 2GD6A 5A5GA 5AW0A 4CUJA 1WYGA 3NHLA 2DAFA 1ZH2A 1Z2PX 3T3GA 3H5AA 4LRUA 4KMMA 1QHIA 4NBKA 2O2SA 3TIFA 2ZRHA 5MFPA 5IXSA 2VYVD 2IYVA 4AOFA 3H9GA 4E2ZA 3CMCO 3RTDA 2OCIA 3WL7A 3O1LA 2CVOA 2HL6A 1CY6A 3K9OB 3R3HA 3CEPB 1DEKA 3DAOA 2BHTA 4LAFA 2WFLB 2FWPA 4NY0A 3FTFA 1NY6A 2WZQA 2QEJC 4HDNA 3RHFA 5B3JA 4Z5XA 3F3MA 5I47A 4E1VA 2BI8A 5CPBA 5CAEA 2DWOA 4AS3A 1QDEA 1WMDA 4M88A 1BSVA 3QVWA 3ZWBA 4V3CA 2O8CA 3OZSA 5HP4A 1E77A 2WXNA 4YDQA 1RXSA 3T0GA 2VO1A 1P9EA 3UAOA 5HH6A 5JC8A 2SHKA 1QHHA 3C48A 1YN3A 3Q7IA 2GN9A 3GO4A 4HMPA 4RHEA 3U3RA 4L73A 2P2SA 3PY5A 3NS7A 1R9MA 2REXA 4OW0A 3ONDA 2F2TA 1LRLA 5LL6P 2IIQA 4KN9S 3ZBUA 4KAFA 1SUDA 2ZBRA 3I15A 3C45A 3LQ2A 4PHHA 2RGRA 4EEWA 4FXCA 4PZ0A 2O8FA 2W6ID 3D5EA 4TLAA 5CA0A 3WA6A 4Y6QA 1VB3A 1T0SC 3WYCA 3TYXA 4G5GA 2CUNA 5AJTA 3T7JA 5LU8A 2VQEB 1NMYA 4RMAA 1TPZA 4F12A 1Z06A 1QQRA 4HDSB 3KKEA 4N5NA 5ALVA 4UE2A 1NKTA 4Q9IA 1EM8A 1TQ6A 2X5NA 4XB2A 3C5VA 1Z8HA 1O8BA 3D1VA 1R4MB 1Q10A 3FYHA 4LZPA 1C3OA 1LK5A 3I09A 2C5BA 2O0JA 4DRYA 2VT7A 3N2EA 4R5HA 5EPUA 3A1WA 2H4JA 3Q1KA 3EUAA 1TLTA 1D2RA 2XYQA 2ZWMA 4BDSA 1T29A 4KQXA 4WWHA 4QVKA 4PRLA 4BXOB 1P1BA 3V4VB 4FYIA 3BTOA 2O0KA 2Z95A 1BE6A 3RF7A 2VSQA 2PLAA 4X8OA 3EODA 4GLLA 1MAUA 5B6JA 3BB1A 2QQ5A 4P2GA 5LR6A 1SVUA 1H2HA 1BQEA 3A6KA 1XLQA 2IZ0A 1OBFO 1XTSA 3F2VA 2ISSD 1X74A 4IILA 1DNPA 1XD3B 3JQBA 3W6PA 3GY0A 1JG6A 5C8YA 3IIIA 3LH5A 3AEBB 1FNCA 5E6OA 3FDIA 2QY9A 5B2FA 3PA8A 3L8EA 3ILVA 5E1DA 2ECPA 4AMGA 4CHKA 1YJ5A 4HPLB 1JLMA 4S1NA 5EZYF 2BUCA 3HYRA 5BQOA 3BJEA 4BKSA 1D8TA 2J53A 1GKIA 3D8HA 1ULZA 3L7IA 2ORYA 3STUA 1D5XC 5IF3A 4Z3DA 4HDOA 4EI9A 1UWVA 1KYVA 3AF1A 1LQ2A 4WQOB 5HG0A 3AGPA 2GZ3A 2Y1EA 3PDUA 4EG6A 3KPYA 2PSSA 1BCRB 1L5OA 3BVZA 2FDRA 1EVQA 1QP4A 3EF1A 2HCRA 3ICCA 5IXJA 2XRFA 3HCEA 1V26A 2BEWA 3F1KA 1H2RS 4LNKA 3OQMA 4M53A 4L4ZA 1JDVA 1OPXA 1G21E 4O4HB 2BGFA 2PX6A 1OHHA 3WIMA 4ER5A 2C00A 1AA6A 3W3ZB 5FQNA 1EFLA 1CU1A 1K8ZB 3DV0A 2OGWA 2C7PA 2Q7DA 2HRZA 3T7DA 3K1ZA 4OHBA 4BU0A 3QQ8B 4X92A 2WTAA 1U0OC 3H75A 4M0LA 3P9PA 2PCLA 1Z45A 3AETB 1HMPA 4DA4A 3H2HA 1GTL1 2FSGA 3ZHBA 1JF8A 2ENUA 3JWPA 4ALJA 6REQA 2O7QA 3CF0A 2NADA 1T6BX 3UTCA 3GK3A 1OU4A 4C0HA 2MRPA 3N6XA 4M1MA 3S0ZA 1BDMA 3S4YA 1E6EB 1VCHA 3RIHA 3IEVA 4KXMA 3RRMA 2FWMX 3H0EA 2CB9A 2XA2A 1SRQA 4TZ0A 1QFZA 5C5EA 3SRXA 1NKVA 2JIRA 2A4MA 1FFCA 3E03A 4AL4A 4G1FA 1AU9A 3TLEA 1WR1A 2OXRA 1TS2A 4FVTA 3KELA 1D2MA 3O31A 1ISMA 1EIWA 4JEHA 4DMRA 4UNPA 4JYAB 5SYMA 2RPQA 3SAJA 4RVFA 1Y9DA 2ZLBA 3IELA 1VMDA 1WG8A 4IWPA 1DC7A 5DXJA 2IUUA 3R5SA 4BLTA 4OVZA 4YR9A 2DR0A 4A16A 3RG2A 1NBIA 2BJVA 3Q3GE 4OIFA 4NV1A 5ACVA 4FIZA 1Z0FA 3L04A 1BXRA 4D8VA 3ABIA 2VJDA 3QVLA 1TMKA 1E7RA 3NHSA 3ZU3A 5BN3B 1D6NA 4WGGA 1SG9A 3TRHA 3H1TA 4FQ7A 4DL9A 2P5UA 1TYCA 3ONVA 3KKZA 1MN6A 2PSHA 3LP8A 4NF2A 5KVCA 1RJFA 4B8YA 3QLEA 2FN8A 7MDHA 3MC1A 4FHDA 2XMCA 4BLPA 1X86B 3OPQA 4XA8A 1PR9A 2FRVA 1TKBA 3C6KA 3UXHA 1WGKA 4DS3A 5REQB 4M01A 1Q17A 3AINA 1WUIS 3EFHA 5B3AA 3EGXB 4OB8A 2GCUA 1AQUA 3USCS 2GH1A 3U7FB 1RR6A 1GSOA 1M66A 3O82A 2B3DA 2P9GA 3WGIA 1JKJA 1WCIB 2OJRA 4L5JA 3SX4A 4ZPXA 4GXQA 1UBNA 3LS2A 2CMHA 4NAUA 1E1RA 4LS3A 3FOFC 1E2PA 3U3MA 2X9LA 3C5HA 1CD5A 1FS6A 1C9FA 5DK6A 5HBGA 4Q12A 3IH5A 1Q5PA 4TOIA 4EHJA 1YRQA 5DHFA 3A1NA 2DVMA 3AT1A 1Z35A 1EBBA 1ZN8A 2GILA 2I62A 5K4AA 1Z2MA 5M3BA 5K0CA 1IMOA 1XAJA 3I01A 3SKVA 4KZKA 1H3NA 1KKMA 3DTYA 1Z36A 3HSYA 3BH7A 3OFJA 1J0AA 2FU8A 3UHAA 3AY0A 4I9NA 1VJDA 7MHTA 2FE8A 1PTJC 4ILEA 2HREA 2JI9A 4LUCA 1N36B 3AERB 5L6LB 4QDJA 4WN3A 4CM1A 1THGA 4ND4A 1R5NA 5TQ2B 1UBOS 3RU2A 4DILA 1VP3A 2HUPA 5IEJA 2WXKA 1NW5A 2H63A 2VRWA 3CQ9A 4ZYXA 5I6DA 3OZWA 4PS8A 4P34A 3NC4A 1VIAA 4I1UA 4G9BA 3UQBA 1KYZA 6YASA 4M7RA 2OBFA 2JFHA 3HMKA 3JV7A 2GZAA 2YHIA 4JHLA 1Y6FA 3DVLA 5FEUA 1XPUA 1TMYA 3JATA 1ESMA 3FN4A 4EOGA 4MEAA 5EOVA 3STVA 2P35A 1QG0A 3M2PA 4K26A 1H6AA 1MV5A 4G86A 4QPNA 2B4AA 3FB4A 4R1OA 3VR6D 2B3AA 3NUQA 2NTNA 4MRMB 2FJ0A 1SKAA 3PKZA 1T4MA 2XMGA 5F2OA 1RBQA 1HDCA 2IU0A 1L8QA 2BAGA 3TPZA 2HJSA 4QULA 1T3HA 4ZZ0A 3Q3VA 3PLVA 3DTTA 1UZXB 3PZ7A 3QWZB 3T61A 5I7EA 5G5GA 4C0LA 4YSXB 4IFEA 2Q7OE 4LXUA 2YC2C 2GYYA 2Q8NA 1LPAB 4YPFA 3FMVA 2YZ7A 1Z2CA 3EIXA 4XIFA 4GDMA 3KHSA 4JX9A 4Y1RB 1IQRA 2A9VA 5CLQA 2RGWA 3UKJA 1NN0A 4IEEA 5FD8A 3DH8A 2PKXA 2D07B 3I2YX 2RCNA 4YCLA 4GYWA 3FSGA 4RSHA 3MFGA 5EWLA 4CKZA 4OREX 4AG6A 2QD2A 4DWOA 3VVCA 2WAMA 1XDWA 5JD3A 2I78A 4GZ5A 2K1FA 5C3MA 4ZVNA 3CJQA 4YDRA 4K2HA 1YX6B 2LJIA 2JLVA 2X42A 4HCNB 3QU9A 4C7MA 1ONOA 5FJIA 1Z47A 1H9AA 4HLCA 2RE8A 3FUXA 5FOQA 1JN0A 1YQ4B 1WL8A 1CZUA 4C4VA 4QZVA 1FMLA 3TLBA 4PYQA 1DFHA 1HH4A 1QOGA 1KC3A 1PJQA 4MVJD 3BULA 4QGGA 3KNRA 2HV8A 3JWJA 1WCXA 1L0XB 5AQEA 4R9NA 1S2MA 2N1MA 5KNDH 1SBBB 5HUJA 3IDSA 1LGRA 4ZO6A 3Q1LA 1ZU4A 3VPSA 4HPMB 2BDTA 4P16A 5KCMA 2BT4A 2R1UA 3BT7A 3AUAA 2BWES 4FB5A 4MS4B 1SM4A 4CLHA 2PDAA 3V5NA 4PN7A 2HB6A 4YJ2B 2FEWB 5FWAA 4JEIA 5EHZA 2GEVA 2H1SA 2VHXA 1NTRA 2PKQP 3U56A 2RHTA 2ZRKA 1TK3A 3KUZA 3EWSA 4OV6B 3PYXA 3IPXA 1T5OA 3HDGA 3RNCC 5CDFA 2IEZA 2C7RA 4EM6A 4RV5A 5KNBD 3PPWA 3CUUA 5LOVF 3TF5A 4G24A 2QVCA 2IOYA 2ERCA 4G8BA 4X65B 5JXWA 3QA8A 2X5JO 2OXEA 1OXXK 2QJFA 2OFWA 3JXPA 4X20B 2QHOA 1PF7E 5HZHA 1XD2B 3QWIA 2HBQA 4KGTA 3E2IA 2A5UA 4U2KA 4I6LB 4GYKA 3PZDA 4RK5A 1JPJA 5E6PA 2G0AA 5F35A 5FR2A 1VJ1A 5AVQA 4RMIA 4L2YA 3BYZA 3UH0A 1LBTA 3DM9B 3KU1A 4N3NA 2RI1A 1Z7WA 5E95A 1JJ7A 2QVXX 1UDAA 5JXHA 2OOKA 3GUHA 4KPUB 1PTJA 1GCUA 5HTKA 4PRKA 2ONQA 2ZRIA 5I7SA 4IJUA 4BCDA 3HUEA 2UZ4A 1U1FA 2FN7A 3SLKA 4DCTA 3TEFA 1VL1A 2GKLA 5G1OA 4IIFA 5A2GA 2C4TA 3WHKA 2XRZA 3NHPA 4K9LA 4E2WA 1Y1SA 2GYWA 2EKZA 1REQA 4MYHA 4KWEA 1MA0A 2QKYA 3RBXA 2PRYA 4LQDA 2D13A 4KXXA 4ETNA 1X8HA 1UEXC 3CNQS 4RU1A 5L7YA 4L95C 1G2OA 1L1EA 2E49A 3DHBA 3FX2A 1I6WA 3P4YA 2ZWVA 3G2KA 4IAOA 2MQJA 3AHGA 5HF5A 2KTRB 4O4IF 3ROKA 1H5UA 4XCVA 3ZLBA 1PV2A 3T0FA 3EK2A 4EYOA 2PZEA 1RXVA 2VT6A 3RM3A 5AJVB 5KVAA 1W8IA 4DG5A 2XEXA 3A3KA 2WDVB 3QUCA 1FEZA 3AOGA 4MS1A 4FWTA 1UMCA 2Q0SA 2G5GX 3VFDA 1OAOA 3SIPA 4EIWA 2YIDA 2HKIA 5AVKA 1JDBC 4D1WA 4TKLA 4BMCA 5CXSA 4L5CA 2D2IA 2GKSA 5EQFA 2R7NA 4EFLA 1MH1A 3FCEA 4QNNA 1M34E 5IUKC 1CSEE 3B6EA 3K30A 3IDQA 4LFCB 4BNDA 4DQLA 4C0XA 1C9EA 3F96A 1XJWA 1WTCA 3TSYA 4DR1B 4YRRA 5KNLA 1XCTL 4L02A 2BHRA 1WE6A 1E7QA 4O8CA 3QQ5A 1YJ1A 3J7AC 4D6YA 2O48X 4FYKA 2P4HX 2P2DA 4URYR 3IALA 4DBGA 2WBLC 4L57A 3MILA 4FMDB 1DEHA 5LYJB 3FVQA 3RYCA 2J9GA 2VDQB 2VP4A 3RDPA 1KVRA 3AR7A 2VZ9A 4RTRA 2FXVA 3WLFA 4EJ2A 2Y1OA 1U0LA 4BQPA 2QTVA 2IPXA 4LJPB 4YT2A 2QRMA 3OI7A 3T4EA 1RAIA 2H7VA 1N2CB 1E2IA 4MPPA 1PVVA 1JU4A 1XO1A 3IDAA 4F06A 3JY6A 1SK8A 4MR7B 3OX3A 3KKMA 2IOFA 2R1TB 3JXEA 3MJVA 3W7AA 3JAMA 2HT1A 1SE2A 2PT9A 3PDWA 4M8NE 2HD5B 2QMTA 3GZNB 1HK7A 2Y0CA 3U3DA 2GAFA 4UVEA 4PPFA 4D0GA 4EY2A 5JSKA 3THXA 4RXUA 1YZ3A 3C3XA 2W82A 2QX6A 5G0UA 4E5NA 1UPBA 1V6AA 1QUFA 1L7DA 2W3RA 4LWPA 2IBSA 3RFVA 2IZ7A 4D26A 4UHFA 3AEZA 821PA 3K31A 4IGFA 5BSGA 4OQMA 4RC9A 3RHZA 3CSFA 2WU2B 1EZZA 1GLVA 4URUR 1UJMA 3FYUB 2TMGA 3H5LA 3GPCA 4G4GA 3OP1A 4MV0A 4A0HA 5D7GA 2O3TA 3U52E 3WNVA 1KE1A 3ZZMA 2DUJA 1ZBDA 2FMXA 2PRSA 2R66A 4LWQA 3BGWA 1LBHA 1F0YA 2CVPA 1W85A 3NC0C 4XAQA 3T5MA 3G2LA 3O8CA 4EF6A 1G17A 4B6EA 1O08A 2PL5A 3ANXA 2XT6A 2ZZNA 2I6QA 2DYKA 4W9HA 2X1LA 2RH9B 2P9BA 3GNSA 1VGVA 3BAZA 5I7AA 3H11A 2UUAB 4ZTBA 3NT4A 4KQ9A 1Q1QA 3ETCA 1C41A 1DAKA 4WFJA 2OP1A 2OCPA 1IBXB 2RSUA 2GDJA 5HFJA 1L5GB 2KACA 4QVGA 4OXNA 1K50A 2R5WA 4RD3A 2EKIA 3S70A 3FUUA 3AF6A 2A4KA 3B6IA 1PFQA 5FL7A 4I4IA 3SDBA 3HCWA 5BNIA 4BGIA 3SEBA 3T5DA 4P3NA 3UGJA 2XVXA 3DFMA 1Z3CA 3QITA 1ATIA 1LDBA 3CURA 2EWMA 2G83A 4HAUA 3I58A 3HI4A 4LSZA 5T4BA 3M6XA 1KDPA 2QF7A 4MRVA 4EPWA 4DMCA 1G8KA 1QB8A 4A27A 2VDRB 4XX0A 1SC3A 3IXMA 2AH5A 2VPZA 5G0WA 1HL7A 2JLYA 3WNDA 4DZTA 1L3CA 1PZFA 3QG5A 3I05A 4NJ7A 3ZV7A 3HDJA 1T10A 2Y87A 3FNFA 4DVGA 5FUXA 1UBMS 5BSHA 4RAQA 1O5IA 3Q8MA 1N6PA 4GPD1 3MC0B 3GEIA 4L07A 2N0SB 1VLJA 3M89A 3A6GA 4CM8B 1J56A 1V9JA 2Y5CA 2B94A 3AEUA 1JG2A 5EZQA 1VE6A 5FKAC 3DF7A 5AVJA 4II2B 1NG1A 2FW0A 4D0LB 4BRSA 1RHKA 2DFDA 4P4NA 3FUWA 2ZITA 3E9SA 5HIPA 3AY3A 4KBYA 2VPTA 4WJPA 1UT8A 1Q7RA 1R0WA 3AL0C 2IYLD 4JJ6A 4BMXA 4EB3A 3KXLA 3MIZA 4RIHA 3UPDA 1XMOB 3ZE8A 2WZBA 2K25A 4YMUA 2F4VB 1G7TA 5DMXA 1KGDA 2BZ1A 5U4XA 4TYFA 1D2CA 2N7DA 1XN4A 4C1DA 3N20C 4EVRA 3D3JA 2RONA 1JKFA 4RA9B 2DOOA 1LSUA 2A0XA 3H84A 2AWNA 3ZH2A 3SFTA 2GN8A 2ZYGA 1V97A 1JT1A 3QVGA 4M9CA 4NKRA 4IJ6A 3PS6A 2NVWA 5JS1A 3EW9A 1NRIA 3U1TA 1UZMA 3EDYA 3KKPA 4Z1MD 2WP0A 2M6KA 1UFOA 5E6UB 3VQIA 3W1EA 1CIPA 3WXMA 1ZVMA 3DWIA 3EH1A 2ONZA 4PLPA 2QDXA 4IIJF 2P4UA 1G1MA 2J3JA 3HJRA 1JEQA 1YIAA 3E1GA 3K4QA 2IXEA 5FOXA 2I2XB 1YC5A 4CU5A 4ENUA 2YXBA 4YJ3B 4CGZA 1HT0A 2WJWA 4XW2A 4BGUA 3M3HA 3BICA 4TLMB 2H2IA 5EMLA 2ZDQA 2ZJFA 1NF3A 2BKLA 2HRCA 4KRFA 2L0XA 2ONJA 1I4RA 2F4NA 2HJ9A 9ATCA 1NOIA 1YCHA 3AF0A 4OAPA 2WP9B 1AHHA 2CKMA 3USZA 4P7IA 2NU6A 3I12A 4XUKA 1DOAA 3K72B 5J5VA 4U3JA 5CDFE 2PGOA 1U81A 3NVVA 1JWSD 4KCGA 2Q27A 1V95A 3G7UA 3AEAB 1UPCA 1O57A 4UE6A 4PWZA 5BSVA 3UBMA 4B3IA 3L1UA 1L4MA 3HXTA 4LV6A 2PUBA 4TRJA 1JWUD 2HDOA 4ZVVA 2WK1A 5TF4A 2JNWA 1NVKA 2GAOA 1H8HA 2LFIA 3DB2A 1ZOPA 3BL6A 4ETMA 1VE3A 2Y0PA 5ALOA 2BBTA 2WWYA 1OXSC 2EU8A 4KI0A 4IIUA 3RC1A 5CEEA 2FUG6 2GMWA 1FXWF 1BNCA 2C5LC 1P0FA 4UM9D 3C43A 1TUGA 5JE8A 1P1FA 5AI8A 3WYFA 2HW8A 3B2QA 4E03A 4J7CA 1R8QA 4DNPA 3NCHA 4M0UA 4DLNA 4OK3A 3JWIA 4P5EA 3VDMA 3ZQ4A 3G5UA 1Y8RB 2PKWA 4CO7A 5TS3A 5IABA 1IRIA 3LFHA 5FI3A 5BXYA 4HADA 1YQBA 2J3KA 2A0WA 4MV1A 5LLDA 3ZU5A 1K8YB 4BU1A 2IEDA 2E3JA 3FNIA 4HQNA 2MTBA 2AXNA 1L5FA 1N1EA 1QGUA 1Q3KA 2CLSA 4DV4B 4WLNA 5JCOC 2BCEA 2Q3BA 1MPEA 4H7KA 3GJYA 1SBCA 3CNOA 4GI5A 4FYHA 5K05A 2Q41A 1SHLA 4TYTA 3WMXA 2MP2A 3OAAD 2Z83A 5LKRA 1TXGA 4ENVA 3DDCA 1KGSA 1KQOA 1V6SA 4DV0B 1XZIA 5A1JA 2G0TA 2NUPA 1Y8QA 2E5FA 3RRJA 1BH2A 1AUOA 4GAEA 4RABA 1KRHA 4G23A 1I4QA 1BD4A 2LMCA 3KRTA 3DTVB 4FSDA 3HNRA 1E7YA 4ND2A 4KHPB 3DCIA 2R84A 3PNBA 5EJFA 2DQKA 1RBZA 4RVDA 4JYBA 4XDGA 1JP7A 4UUOA 5TEWA 3CCFA 3DUFA 5ECGC 4BKUA 1XJQA 2F8TA 1GSIA 3IO5A 5TQ0A 4NXNB 3ACDA 4OATA 2W6OA 1E5VA 3G68A 1PLJA 4BN0A 3HADA 2WNSA 3QEMB 5AKZA 3DVNV 4YT5A 5DPTA 4MKZA 3IERA 3EEIA 1T9KA 5FT9A 5HKKD 1F2VA 2H0AA 3O8NA 1U0NA 3WFZA 2ZUDA 4FYWA 2BSAA 2FX2A 2BBCA 3RZWC 1ZGBA 4KYTA 3IXQA 2BTNA 4QBIA 3S2FA 3I23A 1UKEA 2C83A 3E18A 1CY4A 3O21A 3GEGA 1I10A 4FS3A 4C7ZA 1MVLA 3HBFA 3LCJA 2HSGA 2VPPA 4YJDA 3S27A 3ZZ0A 1NVXQ 3AESB 5K4HA 4IJVA 2QXUA 3N0RA 2LGXA 3B8HA 3NG0A 3LX4A 1VSVA 4IF6A 1EJ0A 4WV3A 2F3PA 2JAUA 2H18A 2K0PA 3CNLA 3GGDA 5EN4A 4LJAA 3RFFA 1KVSA 1I4WA 1ORWA 5CYOA 5GTDA 2GOWA 4G0OA 3VBEA 3Q9LA 4TM7A 4AZ0B 3SJUA 1JLKA 4BNKA 3JRXA 3NCTA 4QPDA 1P4RA 3LA6A 2DC1A 5DZSA 4IQGA 2WWHA 3QKRA 1GPMA 2F43A 4TZEA 3WOVA 3DFFA 1PJSA 5BURA 1WS6A 4LCJA 4GI1A 1SCIA 2V6BA 2ERXA 1G5PA 5EQJB 2DWUA 1MRNA 5JSYA 3TOCA 5HF9A 2GM9A 3VISA 1G6Q1 4RTOA 4RLQA 2M4NA 1ZITA 1PR1A 3OQIA 4AMUA 2KDBA 3GLUA 1I1QB 2QI9C 1ZSYA 1QVRA 1L7AA 2ZCCA 3AL2A 3TP9A 2LIPA 2C5LA 2ZNBA 1ABBA 2XDAA 2JFOA 5DBIA 2E6UX 1EHCA 2VXBA 1I6KA 5EHNA 2JF5A 4REOA 2BJWA 4B3SB 1BC2A 1RRPA 4D0RA 4GDLB 2IBTA 3FPSA 3ZYZA 3IVGA 4NCXA 1MJGM 4B0OA 4D98A 5KNDA 2D7JA 1EX7A 2ZYUX 2PV0A 5K20A 4WPGA 1Q5WB 2QTRA 1CG6A 2W11A 4KIWA 3BEOA 3WOHA 2M0XA 2QVGA 4JP2A 2POQX 4PYNA 3FHLA 5CTRC 3VXWA 4Y0VA 2J59A 5KQSA 3Q6NA 4AKSA 2B0JA 5JCOA 4OB7A 1IIBA 4TKZA 2VAPA 2NTVA 3R8FA 4MUMA 2VCYA 5AIAA 1LFDB 1U9CA 4LDQA 3LDUA 4DF3A 4LI3X 4UUNA 3QVTA 4N3CA 1DRUA 3B2NA 2A1UA 4EFKA 3RIEA 1Q0ZA 3HUFA 1KETA 1TGYA 1CVLA 3R9XB 1MEOA 4DXDA 4WVFA 4JMPA 3TB4A 3CYFA 4WEQA 3CKLA 2OFFA 5EKUA 1TRHA 4BGEA 1G3MA 1SCKA 4L4XA 1Z6XA 1M1NA 3KH0A 3A58B 3NZUA 2PD4A 1OY1A 2RH5A 4KQFA 2QG4A 2ZIXA 3WA0A 5KREA 3CO5A 4MWTA 1N0HA 3MPOA 3STXA 5KQRA 3KTAA 3PNLA 5E4FA 3Q3OC 3S8MA 1SEVA 3CZRA 5DHQA 5FUYA 4TUYB 3PC4A 1IJEA 1U8XX 3ZIDA 4H6PA 3V4LA 1PR4A 4N7JA 4HNVA 2NIPA 3QELA 4IOJA 2Y1KA 2R11A 4F04A 1U9ZA 4W1QA 3HB9A 3TUIC 4OFXA 4NBWA 3NOBA 1V5TA 1H1TA 2ET6A 4JI8B 5G3YA 3H9DA 4Q4DA 4F7DA 4AX0B 3WJ2A 5FKJA 1SB9A 5ADVA 3K7EA 1KK0A 1K07A 4TVKA 1RLJA 1BDJA 1HSOA 2LUEA 3IHKA 2CKDA 2QX7A 1VL2A 3CX8A 4GN1A 4I9UA 3TVTA 5JVDF 1KSJA 2PUJA 3EVFA 4FQ8A 4QXAA 3DM5A 1C2TA 1VBMA 1XTRA 3LU1A 4PG5A 1A8IA 3PG4A 3C39A 2E4AA 2KHZA 1YZQA 1WU7A 4H0FA 5EWAA 3B3AA 3P45A 3N2GB 1QSGA 3FWPA 4F2GA 3BHIA 3OWOA 5BMHA 3ZLJA 4EJMA 4CMGA 2HHCA 2YOGA 2PWBA 2SICE 1BWPA 1GGJA 3VZCA 3LYLA 1NSTA 4LF4B 1UL1X 1UPAA 4HCJA 1I7LA 5KWIA 1I2BA 3IIEA 1WV0A 5IN7A 2O6LA 3AILA 3ICOA 1XCOA 1T9GR 2X19A 3D4BA 1K51A 2XQJA 3D81A 3MS4A 1W4BA 4NK4A 3I5MA 4OI0A 2LXNA 5T57A 4NECA 1IHXA 2P3LA 3H5RA 3ETGA 2J5QA 4R05A 1BDBA 4H6XA 2WA2A 4UKDA 2RAFA 4LF5B 4LCDE 4GWKA 2X4DA 1BHSA 2X0NA 4HAZA 1EU4A 3JZDA 1W8DA 3VNUA 4FGUA 4M1EA 5JQGF 1I4LD 1WJNA 4IVNA 1HA5A 4BB9A 3T7AA 1OXKB 1RJ9B 2A6PA 3NNSA 3KQQA 4MCHA 1J21A 2CUZA 1Z29A 1OUMA 2BR5A 3EISA 1F14A 1Z2NX 3ETJA 1AS2A 3R8XA 1X0XA 1NQVA 5DLPA 3IP8A 1TJPB 1RLFA 3NTOA 4HZGA 5CHVC 4YMVA 1D6SA 4PYIA 3L0SA 2NW6A 3EXEA 2C9WB 1KMHB 5D3DA 2BYFA 1QYVA 2NGRA 3SD9A 5E2AA 1GYRA 2X8JB 4OQFA 3CX3A 3H4TA 1FO4A 5E6SA 3PUZA 2VBCA 2R1VA 4W5WA 2WHQA 2ZIZA 5E9JA 3NHZA 4F5EA 4FFLA 1JLLA 1V7ZA 3CC8A 4H27A 5FHQA 1QBKC 5JLJA 3SFEB 3BBLA 3HZOA 4GGOA 3CF6E 4US0R 3C74A 3GPBA 3COPA 4INPA 5CVUA 4XM2A 5KX5B 2IDMA 4WXMA 4IEFB 1JALA 1M2HA 3WB2A 1DTWA 3KZ1E 2C3MA 5JARA 3QEBZ 2AYOB 4QOHA 4HLUC 2LVOA 2XI4A 3AZPA 3R3JA 4WAFA 4AFNA 2WJVA 5PGMA 4Y9TA 4ECEA 2IOFK 4ZI2A 2CNLA 3R3SA 2IY1B 5C4GB 1IATA 2PO7A 3C7CB 1QC5B 4BKGA 3UI3A 3OFVA 4HEHA 1D2AA 2Z43A 3WDSA 3NVZA 1CMXB 1UH5A 4MYSA 5F9HA 4BNTA 3KQNA 5CCXA 1PK9A 1NVWQ 4UAUA 2OXIA 4AY6A 1RQRA 5KTKA 2IZ6A 3PT5A 3W9SA 4KXVA 2XE7A 3L8YA 3ZXIA 3GI1A 3P27A 3NDJA 3SQDA 4CF4A 4Q1DA 1P2TA 2QR3A 2TMKA 3V1YA 4UTPA 2JZNA 1Y37A 1ZFNA 3N8NA 4IH9A 1X92A 2I4MA 1GPAA 3FM9A 3W2TA 3G85A 4FULA 1KLUD 5DCLA 4C3VA 3EAFA 4HNHA 4LNUA 4BKMA 5HHDG 3WQBA 3TLKA 4OSPA 1EJ6A 4FGJA 5L45A 1AS3A 2YX1A 1L8OA 1B43A 2ACZB 4N48A 2DH5A 1EG2A 3KT8A 4Q18A 4Q1CA 4ZYTA 2O07A 4FR7A 1NE7A 4RK7A 3HFGA 4WKNA 3D7RA 3C3KA 1NY5A 2VXOA 3HCBA 2AFRA 5EE5B 1H9BA 4CG1A 4MWDA 1LF5A 3NBMA 4DXFA 3TDNA 4UZSA 4L78A 3N9IA 5IK2D 2GN2A 4EITA 2JLXA 3L7KA 4GMGA 2ZJYA 1L4HA 5GIPE 3P2YA 5BOSB 3VBCA 4XVUA 1QFMA 1NUAA 2X38A 1QRRA 4YCNA 4MQ6A 2VTBB 1L7NA 2HEGA 3DLCA 3TNLA 2PWZA 1A5BB 3WMGA 1I4PA 3I2FA 3FYDA 4D82A 3L1JA 3RAGA 4E88A 3R6TA 3N2YA 4R1QA 5A4FS 1LQUA 3ZVKA 1O95D 2V0NA 4IKOA 3T94A 5ALKA 5AW3A 2DPHA 3GFBA 5TSDA 1C4XA 3ZV6A 1J8FA 4NYIR 2O7SA 5ELLA 5ALLA 1PJCA 2CYBA 1Z7GA 4XDCA 3UMBA 3ZYYX 3VNQA 3WWPA 4UHHA 3RRYA 5KHOC 2P2YA 1I01A 4Q3OA 1TBEA 3H5TA 1PDXA 2PXHA 3UW3A 1WRBA 1DT3A 4LJ5A 4DIMA 1L5VA 1Q84A 1SFRA 3T5GA 3A32A 4RCYA 4GXBA 3RSSA 1ISSA 5HS6A 2WSIA 3OFNA 5E9WA 4IMJB 3QXGA 2OV6A 2EQAA 1UMDB 1ESNA 3RVDA 4M9SA 2C1ZA 4FT4A 1CP2A 4DWWA 4L22A 5G41A 1EWYC 1ZHHA 2Q7XA 4K6KA 3SFZA 3P9QA 2X0IA 1QHGA 3MCAA 4WDRA 1X1BA 3U19A 3ORQA 3NOQA 3KUDA 3G49A 1RCUA 1SD5A 1ZD3A 2DU8A 2XPCA 2WFAA 2W2VA 5J18A 2CXTA 3BYYB 4CCWA 4PLWA 3RCBA 1QYIA 1MHXA 4EHBA 1A2OA 5LPNA 3U7EB 2J7PA 2NR2A 3OQVA 1T1EA 3ZIAD 2AEEA 2RHJA 4ZI3A 4HQOA 4YV2A 1SUBA 2OV3A 2I67A 1MABB 3PUJA 1Y7TA 5KCZA 1HX7A 4HLUA 4XDYA 1SCUA 1RABA 3L7OA 2WJYA 3EFUA 1KDOA 1HBJA 4X3CA 3HJHA 4UBKA 4O2BF 4DCJA 3NRCA 3VH3A 5DN6A 4P7KA 3TL3A 2XNDD 5T3UA 4PLCA 3ROQA 3AONB 4L08A 2FW8A 2VF2A 2QL6A 1G6HA 3O84A 3PV0A 5CLJA 1M0EA 3R1IA 1A8PA 3EHDA 3ZE2B 4DNQA 3CMMA 3AFOA 2WHGA 1GARA 4TQ9A 1XTZA 1F6DA 1VPWA 3ZD9A 5LDHA 4D9FA 4R3UC 3FOBA 4IC7B 5K5EA 2PMFA 3K9FC 1ZI6A 5CLGA 1H66A 4C4RA 3GLVA 5THXA 1M34A 4DPKA 1IM8A 3RSFA 3K35A 3T7KA 2RDHA 3U9SA 2JATA 1Z07A 2WIAA 3DR3A 4EB8A 5DM60 3QKTA 5EKSA 2RMMA 4WUVA 2QJOA 3HXMA 4FS8A 1OROA 5KVVA 1CUBA 3CLSC 1JJFA 5B4UA 3V32A 1G18A 1OILA 3UEOA 2MCNB 1XTIA 4FOTA 3ZJ5A 1XU9A 3HBNA 4O1MA 1B0UA 4C7OA 3GT3A 3DT8A 1M7GA 4WWOA 1CQJB 2X3UA 4ND1A 1DXOA 2HUNA 1GZ5A 4PSDA 4EW2A 4A6DA 3A1EA 4L5BA 4ZYYA 2R2OA 1ULTA 1A2QA 3I6YA 3N32A 5MN4A 2WFLA 2HTME 3AFGA 3BE5A 1L5MA 1CJKC 3GRYA 3UGQA 3KYCB 2Z9CA 2K6QA 2WJ6A 2KVZA 1PGJA 2BFZA 4ZOQI 3REQB 3ICEA 1DKLA 4AXHA 1UF0A 4CKBB 4PCLA 3X1JA 4ZDWA 1RRMA 4KKVA 3RSGA 4J6FA 4FHGA 1JPVA 1RZVA 3LG2A 4TSKA 5GM1A 1YDGA 2KWUB 3IQDB 5AKGA 3KALA 1HUQA 3TFQA 3A7DA 1YQDA 1VJRA 1G60A 4OKIA 1B26A 4M8NA 1Z74A 3KQMA 4OHXA 4FE3A 1UPUA 1HTWA 4LZAA 4J0GA 5K0LA 2V7EA 3A6DA 1N5JA 4D41A 3AVXA 2ILVA 2KWVB 2W8BA 2ZUFA 4GO1A 4PVDA 1WSWA 5WRFA 3HEBA 4CCYB 3K9WA 3DKIA 3JTEA 2VAWA 1ZTCA 4HWIB 2N9XA 1IHDA 2PY6A 4E2XA 4HDSA 5U4QA 5BWOA 2J5RA 4G3XB 1Z2OX 3WADA 4YX9A 1AA9A 2PX8A 1R4MA 3DKVA 3N8DA 1LBIA 3U17A 1U7UA 4J49A 5JSHA 5KU1A 2OENG 3CH7A 3F73A 1WB9A 4Z9XA 4N40A 4OYYA 1BCSB 4IWNA 2FPSA 4MRRA 3L5OA 1M6HA 1RWQA 1IBSA 5FA8A 2DCMA 1T4GA 2P4ZA 2BMIA 1ZR2A 3DV2A 2PX5A 1CS0B 2G71A 1E0ZA 1ZGGA 2QXYA 3C8YA 5D85A 3O7MA 1EFTA 4LK3A 5FPTA 4H1WA 2Y5PA 4FJ2A 1ECGA 4MWEA 1ISRA 3ZC3A 1WXGA 1XQXA 1WR6E 3FD8A 1CHNA 5C34B 3WC4A 5HUQA 2HLDA 1AKNA 4KDRA 2JD2A 1H8EA 2RIRA 3NP9A 5ESXA 2O1EA 1OB2A 1QLBB 3OPYI 5C9ZA 3EQ7A 5CUQA 1N0WA 2RG7A 3SJAA 3EVNA 3D3NA 4B80A 2OQVA 3L1IA 1LRKA 1GZ7A 2RHLA 2BFPA 2BF8B 1SUEA 1EG7A 2EGHA 2L00B 4OIMA 1PNTA 4QGFA 3TG8A 2HCTA 2XHEA 4KWCA 1FXTB 4E21A 3L0WB 3I1FA 2I4IA 3DVSX 1UBCA 5JNVA 4IIBA 2PZLA 1P1IA 3EGWA 3WWOA 1JJTA 4ID9A 2WDZA 3U5ZB 3UAGA 1E79D 1KZ6A 3DD1A 1Z39A 2OOSA 4FSBA 1M8JA 1C0PA 2K6DB 3R4CA 4Q1BA 4S0ZA 4RF4A 1NI2A 3ILSA 3UFXA 2HMUA 4MCAA 2V7QA 1K88A 3E9DA 1ZP6A 2HU2A 2ZVQX 1NNI1 3AP1A 3BTUA 4JP3A 3HQ4O 2F90A 2XODA 1QZEA 2HK8A 5CFQA 5DCNA 1ZL0A 1UPFA 3C5EA 5KSPA 1LV8A 5JJKA 2KMMA 7AT1A 1F12A 3MWJA 2OXTA 5JU6A 2C8JA 3D5TA 4TLEA 2X9NA 5BW8A 1EHIA 2DPGA 3OJ3A 2V4ZA 2VYQA 2E0IA 4ZVMA 3AETA 3LKZA 3I8XA 4MQFA 2OHJA 5FUBA 4HX2A 1G0OA 1ODTC 1IEVA 4EARA 1NVUQ 2JIPA 4OYHA 5CT6A 2QRKA 5K3BA 4TYPA 2WUFA 3ZU6A 4W9RA 3I32A 4XGQA 4ZOCA 1NIPA 4BP1A 2ZRPA 1N5MA 3TKLA 1N77A 2YDYA 1C8BA 1XZAA 2ZJZA 4JC0A 1EUYA 1T8YA 4Z7NB 1N6NA 4BY9E 1K8RA 1U7XA 1T4CA 3CR8A 3VO8A 3MWKA 2Q0QA 1U2EA 4C2BA 5HS4A 3P1MA 3L6OO 3BFJA 4FX2A 1ATZA 4LF8B 4DJTA 4IGIA 2WM3A 1QXSA 2L83A 3ZDQA 4CQJA 4J0QA 1YN5A 4JDPA 2AG5A 3QPWA 4DSZA 3IPYA 1KP9A 3M7IA 1LX7A 3H7AA 4E74A 2Z9DA 1IG3A 1F2RI 4EJFA 5JAMA 1CE8A 5BW6B 1D2HA 3Q7QA 2C8KA 3MB8A 5BN3A 4HX5A 5TR5A 2FGKA 3ROZA 3C7DB 1EK6A 1P7WA 5KOJA 4GGQA 3M1IA 1N92A 4DLKA 3Q72A 4A0GA 2HIMA 1XDZA 4B8ZA 4WZBB 4KVZA 1C3JA 2P9ZA 1HEIA 2E85A 5DLEA 4M9QA 1WUTA 4C76A 5B37A 1V71A 2XGJA 1DIOB 1ZICA 4X3PA 1ZDVA 2NZEA 1S3GA 3PTFC 5REQA 1Q1ZA 4QM7A 2VJPA 3EGXA 1E3DA 3RPCA 4ZHQB 1QONA 3NEYA 4O6VA 1Y3CE 5JZVA 4FGZA 4ATNA 1X94A 1GTVA 1WCIA 4DPMA 3HCOA 2XKBA 3KUCA 3V2GA 3QIAA 3BQNB 2QG9A 3DHNA 3KDAA 2PSFA 1OSNA 4NI5A 4FBLA 2B1QA 4L75A 4GDKB 4BOYA 5AI6A 4ZODA 1CY7A 3D8TA 1H5NA 2ZB3A 1B9RA 4QT0A 4PAGA 1IY8A 1E4VA 4OHZA 3VU8A 1T1SA 5H81A 1U65A 2WSLA 5BOVA 2BFWA 2A9JA 1Z2AA 1E20A 4WD3A 3OQOA 1X7XB 1RTKA 2JBHA 2FTKE 2O8DB 4C2UA 1RYBA 1B8UA 2M9MA 4R9VA 3DHIC 3AKZA 2ASEA 4IX9A 4XDHA 3O4GA 1W48A 2WJGA 3QHAA 4YR7A 2OSBA 2V7PA 2A0FA 4CVNA 1VLMA 4NAVA 7GPBA 5K3AA 1BXTA 4EKEA 4G9EA 3PF9A 3H5NA 1P1KA 3G82C 5COAA 3K6RA 5B1YA 3K9GA 2UVQA 4HVTA 2XAUA 4B9AA 1XALA 2YMMA 3MJ5A 1CZOA 1GPUA 1A95A 1I0IA 2YJ4A 2X1VA 4PPGA 4CYMA 3WRWA 3WK8A 4ZYNA 5EVCA 1XLUA 3M81A 3A9JB 3O91A 3PRYA 5DX0A 3A9SA 1VI5A 1T5IA 3IUPA 2XCRB 1MXFA 4JX8A 4G50A 1KYTA 4YGXB 4TXLA 4Q3KA 1DFIA 1WQ1R 1J5EB 3OZXA 4OQDA 1Q0LA 3DZFA 1X8IA 1TZ1A 4OXXA 1E3EA 1LS1A 1X38A 5DYTA 1EYZA 2PE6B 2BWJA 1JAYA 3GJ7A 3MUOA 3WL4A 3K05A 1YCDA 1QRAA 2RH4A 4WOBA 3TW8B 1RPZA 4JE3B 3REGA 3PQ7A 5DMHA 4JVSB 5CT8A 4DYDA 2FUNB 4DLTA 5EERA 2R8BA 4P36A 2PO5A 1K4KA 1XMXA 2ORED 4ZO3A 4TTTS 4UAVA 3OE7A 1EK5A 2HA3A 3ENNA 3EIQA 1VHQA 3E3LA 4XXHA 3KIPA 1PTKA 3SP1A 4L15A 4MA4A 1P7CA 5TSSA 3HBMA 3SIXA 2QE7D 4YAIA 3ORHA 4PBTA 1YMQA 3IIMA 1NYRA 1Z34A 2FR0A 4DIOA 1X42A 4HYYA 1FSFA 3GMIA 5FI5A 3D4NA 2GBGA 3BSSA 2C20A 2BGIA 2F3TA 4JX1C 2O57A 4BB0A 3LI2A 2Q4DA 5K01A 4CLRB 1T8TA 4GX0A 4R1TA 1RJDA 1XHLA 4KR0A 1IU9A 1LU9A 3L16A 2KKCA 3IEIA 5AUKA 4IV0A 4P7GA 1AQNA 3BKXA 1OEYA 3WJ7A 3FR8A 2WXJA 3FVWA 2JGEA 3N8IA 3HCPA 1IP9A 1FVHA 1BVYF 3HWSA 1KO2A 4F72A 2IUEA 1VG0B 3UMFA 1KR5A 4H3KB 2IX9A 1XVLA 4ZRNA 4HQFA 3HN7A 3ZIUA 2C2XA 1QOFA 4KNWA 4DIFA 1G66A 5KMGB 4ACAA 3MTDA 1WJ6A 1VE5A 4MS4A 2OD9A 4YJ2A 4C9BA 2AUTA 1OXBB 1L1RA 3R0JA 3W8EA 4EYEA 4NMLA 4DR3B 1SKMA 1G9XA 3KKNA 5K7SA 2H5IA 2CEKA 4EFOA 3UT5B 4LDPA 4NEGA 5B30A 5J4LA 1U4NA 1LPPA 1ET6A 2LCFA 3CG0A 4XQ9A 1SOWA 4I4CA 3PEVA 2Y8AA 3WGLA 3DD5A 1QH8A 1ZRMA 2ST1A 4AWBA 3PY6A 1XZLA 1E6WA 4OFBA 1WRDB 1PT9A 3BD9A 2RGYA 3OE5A 5AP9A 4FE7A 4B6WA 3B12A 3V3XA 3DOEA 3UT0A 3JARB 1MX5A 1FUKA 4FT2A 3DHHC 2ID9A 4G4SO 3JQ7B 1NVAA 2NQ8A 2BFCA 3FYUC 3CZMA 4PYLA 2CZQA 4TS3A 1P4HA 4JBWA 2ZZIA 5SY4A 2HF8A 2ZRDA 4HD8A 4Q7QA 5SY9A 4RL0A 1AK2A 2IZVB 3GRZA 4UHKA 1XNRB 3A28A 1JQ4A 2FMKA 3ZWWA 4I8DA 3KPUA 4G9GA 1U0HC 4FKMA 3G1TA 4C29A 2YEPF 1RC1A 3AR4A 1T91A 1QQ6A 5ER9A 5CT9A 3VYWA 1AB6A 1I1NA 1PJRA 3CH5A 2PQMA 2PFKA 3C7KA 3C19A 5K99A 5DKFA 5EL0A 1FYXA 1BEUB 2YL2A 2P97A 3A9RA 4O02B 3T9FA 4ZQGA 1W44A 3PDHA 4KE6A 2OMKA 1QVZA 2C3UA 5EE3A 1K9VF 4M0FA 1IY9A 2UV8A 3I13A 1HFWA 3TXXA 2IS4A 5ELXA 3DBVO 4MTCA 2NZJA 3TL5A 3LP6A 5I48A 4DHJB 3PRMB 3RVJA 2N7EA 1HR0B 4J0KA 1JFSA 3K0EA 2J3QA 2ID4A 3DC2A 3KQWA 2B92A 1XQ6A 2WIBA 5B3LA 2ADFA 2GBKA 3HA2A 2XF2A 2PT6A 1CNEA 3FPGA 5IW8A 2JCYA 1KH0A 2AQ1B 4XGNA 4RWZA 2JZZA 5IVDA 3RSQA 1JHOA 3SBDA 3GYGA 3HR7A 1P7YA 1HE3A 3VM6A 3TI9A 1S4QA 2REBA 2I3DA 4RTLA 2ENWA 1GPKA 2ZCVA 2YR0A 1F5SA 3RCZA 1PT8A 4HP8A 2XVZA 2PRIA 1LLFA 1FFHA 4UBJA 2HIGA 3WGMA 3NGLA 4WHMA 3STHA 3DBRA 4D9BA 1P0IA 3IBSA 1BX0A 1OGYA 1UM9B 2CXOA 3D2CA 1SEPA 1X8JA 2SKEA 1S02A 1E2JA 2GN6A 2J48A 5ACQA 4Q05A 2ODPA 3ABSB 4G2NA 3U4EG 1FM0D 1Y1KE 4G26A 2GBIA 2CGEA 2VRRB 4B31A 5HM6A 2X22A 4Q93A 4YI3A 3ENWA 3WTBA 3BFKA 1FC0A 2XF8A 1JVSA 1T0BA 1XLPA 2PFSA 2VTVA 4CL2A 3HIZA 3CLVA 5AKJA 4PC7A 2GD2A 2DLCX 4QJIA 4QDZA 4R81A 2VG8A 2AB0A 4GI2A 4XX1A 2JFNA 4OVKA 3QSYA 3OZFA 3SPXA 1UDWA 521PA 5I8ZA 4URWR 1N2CA 4ZOLF 3QMVA 2Z6AA 3H65A 3I4LA 4UHBA 3K9PB 3T54A 1P33A 3FPBA 4MR7A 4C4XA 1SG0A 4YRQA 3NHUA 2MWMA 5B4TA 4GLJA 1ZOIA 4MW1A 4P53A 4CUKA 5E2IA 2EHJA 3GZNA 3A6ZA 3VVWB 3OFKA 5B4VA 4UA4A 4PLGA 1YBVA 4PT5A 1IOWA 3U2QA 4YJFB 4NX2A 2YN4A 3DEYX 1W6RA 5JMOA 1OZHA 2R25B 4MYUA 3VSBA 4FN2A 2GJ4A 2O2VB 1BRMA 4OXQA 3TK1A 5TQVA 3FW1A 5FTLA 2NSYA 3NEAA 1D7AA 2ZXEA 4GZMA 4DG8A 4NG4A 1QIHA 1CF9A 1JHVA 3U8ZA 2FB9A 2PG3A 3H3EA 4KR9A 1QHNA 4JR2A 1XQQA 1QS0B 2J41A 1CX9B 4CIWA 5JFTA 4E12A 2F7SA 4QL3A 5C8VA 4Q16A 3FYUA 5FV7A 4M0WB 5ADUS 3JYPA 2IP4A 1IPEA 4FM9A 5IVKA 2Z09A 4GMXA 3HVHA 1LDNA 1DE0A 3WE7A 3OJLA 3DWMA 4QWWA 3AM5A 3VU9B 4LYEA 1E8ZA 4KK4A 2D0OB 2AL3A 3NYIA 4BNNA 3DE6X 4RNCA 5F23A 2GTPA 1JHYA 3ELDA 1WR8A 4HX9A 2VPWA 2GASA 1ZKHA 5BSUA 2DWCA 1B0PA 3QY9A 2A2ZA 2M1ZA 3PB3A 5IDYA 3IMKA 3GOEA 1ACLA 1N6KA 1NYLA 4PSUA 4UUPA 3DWFA 2WJIA 2Q07A 1E98A 2RGBA 3DHCA 3FCOA 5B1DA 2XCQA 3BIOA 1GZVA 2WICA 1MUUA 2L7RA 4BEBA 4RKWA 4QDTA 2CL6X 1OX5A 1Z0DA 4DTIA 3RPEA 2A5JA 5B64A 1VRVA 1W36D 4B3JA 1G5QA 3FBWA 1MD9A 3FTNA 4YRJA 1Y8RC 2J0KA 2JGDA 4M2LA 1JA1A 3CRVA 3PSEB 3AH7A 1HE1C 4PIPA 2X2PA 2LE0A 4A03A 2WOOA 4ZEOA 3WIOA 3FDZB 5F1KA 1VG9B 4MMYB 4PZ9A 3WK7A 1RQPA 4LPSA 2OV1A 4DREA 4J1NA 3IEMA 1PGBA 3L8HA 3EPKA 2R65A 3D6VA 5CNKA 4N5IX 1IIRA 5JZOA 2O6VB 5DVZA 3Q3JB 3F6EX 3IAS1 4BZXA 1E0DA 1PO7A 5DHSA 1NBMD 1YI8A 1JDUA 4E14A 2ECFA 2AQ3B 4II2A 4Z9BA 3VC1A 1J70A 2IDYA 2CU3A 2PLNA 1N2EA 3AG6A 4QASA 1P77A 3LUDA 2C42A 2NOAA 4MP6A 2Q6VA 1NENB 4FDUA 1NQWA 2P0EA 3TOSA 3H1BA 1SF0A 2YNWA 5EZSA 2OG1A 1L8XA 2WSBA 2P7HA 1ZW7A 4NAWB 4CMIB 3MD0A 5AVTA 3GJ0A 3RYHB 2ZR8A 2GSDA 2Q4EA 5ABPA 1VJTA 3FSRA 5INTA 1OQRA 1I0LA 1G64A 4RA9A 4TZ6A 1XNHA 5LXTA 4DCCA 3ER8A 2AZDA 3KFLA 1VG1A 1C1HA 4LGYA 1UNSA 1Z5OA 3K5WA 5AW6A 4LXHA 2P79A 1XTJA 2FFAA 5LNK1 1F2TB 4EF4A 1ADGA 1FW8A 1GR1A 1ZEMA 3WMFA 1T24A 2AR0A 1GKKA 2QTMA 5E6UA 1A8QA 5ITVA 1J4AA 1RLUA 1P19A 1AGRA 3ZZUA 2JJ2A 1TM1E 2XV1A 1T6ZA 3CZ4A 2WSSA 2NUTA 5K3OA 5HOQA 4K6OA 5D6NA 1THTA 3HB1A 3EVAA 5F51A 1M2GA 3O8DA 1NP3A 2SBTA 4P7FA 3ZD7A 4IKPA 4UUMA 2QJLA 5KNCH 1GEGA 5DM4A 1E8NA 2WYHA 2UXBB 1YR3A 1ZL2A 2AC4A 4MEJA 2GKGA 4UBQA 5E3IA 3IKMB 4ZKDA 1TJEA 1PZXA 5KWEA 3ITEA 3P0JA 1BDIA 1UDCA 3EPJA 3AI1A 1PWEA 4O2AF 3CVOA 4HAOA 4O33A 4MPRA 4XSGA 4Q9DA 4TL6A 2OM2A 2VYND 4M3NA 1KRXA 3AWIA 4AWAA 3I8OA 4MAFA 1CRLA 1HFEL 4LXIA 4B2LA 2P3OA 2KN4A 5C7LO 1DGJA 1SURA 3BAFA 5ADHA 3Q6BA 3LLUA 3RGGA 4ZKEA 3MWEA 5T4HA 2KYRA 2XUKA 4HZUB 4AVYA 1MNQA 4IHJB 4CLDA 2FEOA 4V0LA 4AUQC 4JXJA 2ZIAA 4ISCA 5F9MA 3AI7A 3HU2A 5A9TA 2F1JA 1UQUA 4QELA 4Q0MA 1V8OA 3B78A 4DW8A 5DCYA 2RJ3A 3CEHA 3NM5A 1QZ3A 4JUFA 1IZ8A 1FQWA 2P9TA 3OWHA 4JJZA 5JSQA 4AD9A 4NZPA 5JISA 3VR5D 1T36B 1W87A 3PVZA 3QBJA 4LX0A 5KVQA 2ZB7A 2ZW9A 1RWPA 4E09A 1P29A 2YFHA 1FIUA 3HVDA 2JSVX 4GRDA 4E6PA 3TX2A 3IEPA 1XEWY 4TN5A 5L3SB 3VPEA 4LJ6A 2FSPA 3EFOB 2BFEA 1Y8RA 2VP3A 3CJRA 2YJ6A 2Y77A 2CDAA 4C0QC 2ICIA 2Y2UA 3IBTA 2Q5WD 3ZKJC 1NONA 3JQAB 3IAFA 3DOOA 2ZRBA 2JB9A 4L6IA 4ZVOA 1ZRSA 4NZZA 4RPJA 1Q1GA 1MB9A 4NMHA 1KI6B 3V60A 3RWOA 1SOUA 4ZARA 4P4SB 4EPRA 5IP4D 1RPTA 2BF4A 2O2CA 2V7TA 5IT0A 3KAPA 4RV4A 1ZM2A 2VRCA 2Z0DB 1GA4A 1AQLA 3GVPA 4BAUA 2J85A 1ZGZA 4AXXA 5CDTA 5CCDA 2H6AA 2O0HA 4QSMA 1D0VA 4QXOA 1F2UB 4UBNA 3AEQA 3R7FA 4QU5A 2FWBA 2ZUSA 4Q9KA 3PR1A 4Z2AA 5BYKA 1JR3A 4BYGA 4G0WA 4EUHA 1EA7A 2HHAA 1KH3A 4TTVA 1KZYC 3DTVA 3VH1A 4ND3A 2E5WA 5IBQA 4WXYB 2G1KA 4ZCQA 4FONA 3O3CA 4IF4A 1EX1A 4KTTE 2A67A 3EZ6A 3AB5A 3N6VA 5EHXA 4RNAA 3DKPA 3HUIA 2ZG6A 1W76A 1P7VA 1BKSB 4DSNA 3AUUA 4LE6A 4R1UA 1MDBA 4ROTA 2AKEA 4B48A 3ROEA 1YS7A 3VRBB 2P9CA 2AI2A 3V05A 3PHWB 2FWIA 1JNYA 1NASA 3ORRA 2C2KA 5FJJA 1ZM4A 4G1UC 1NG9A 3UJCA 4ME6A 3EH2A 1H2EA 1KVUA 5D5HA 5EHGA 2XB4A 1P0MA 1XZNA 3BORA 4MZDA 4DRXA 5DBOA 3OU2A 2FAZA 1KBQA 3BTSA 2MSEB 3GFGA 4RXMA 2V7VA 1E94E 1Z0KA 4R69A 4U7DA 3MGKA 4QX6A 3QTTA 4D0NA 5HZGA 4BKPA 3Q8AA 3DZJA 1H8CA 4RPHA 4U8GA 2EZ4A 1RVDA 1NA5A 1QLWA 1Z4JA 4PLVA 2HLHA 1FSPA 2ON8A 1TK2A 1T25A 4J2TA 1UXJA 3BCHA 2OHOA 3F6BX 4R0VA 5A3RA 3LBYA 1PV1A 4COKA 1E7WA 5DCWA 3OQBA 4KXYA 3VTKA 1USGA 1J2JA 1PNVA 1FY2A 2DBYA 1N2CE 4FR5A 2ZSIA 3L9WA 4LCBA 5BN4A 4HQ6A 4N0DA 5C81A 4S2UA 1L5NA 1EFCA 1UK7A 4AZ0A 3E3NA 1GU7A 2WDQB 2Z2IA 5J2TA 4O2RA 2O5EA 4UDNA 1WETA 2ZW1A 5ERGB 2FE4A 4EHHA 5BUCA 2YWDA 3ZK9A 1OAAA 3DBHB 1JIQA 1YBAA 1CJCA 4C3ZA 2YNTA 2RBKA 5BN5B 1IB6A 3BH0A 3FZQA 3TIIA 3C15C 4AS2A 5GZ6A 2VSYA 4JKIA 4ZP1A 4KFSA 2AX5A 5L9AA 1IEQA 4I50B 2W42A 4Y9DA 4OGFA 3CCCA 3DL2A 1NN3A 1H2AS 1QO0D 3L79A 2RAUA 1GPWB 3UC9A 5AJXA 4C00A 3KKLA 3AM4A 4O5OA 1M8FA 3G9QA 4OBEA 2DJIA 2EBWA 5HMLA 5AKYA 4RGTA 3F7TA 3IOYA 2FQ1A 3Q8WA 1F9EA 4YV0A 4H1TA 1BROA 4UHCA 3RJZA 2EFDB 2WQYB 1W5BA 2EMSA 2B78A 2AQ2B 5AESA 4CQMB 4HT3B 1XZKA 1UBIA 4JITA 5LQSA 1XC7A 2W2NA 1WZ2A 3KBOA 5KVSA 2F8MA 1RPJA 2I4LA 4LSWA 1WHTB 5CVJA 4KJZA 1R8SA 4QLOA 1J8MF 4PGMA 3WLNA 3PRHA 2QYSA 5GGXA 4L5YA 3PUKA 1XROA 2NZVG 1DXYA 2EWVA 2CSUA 2YXEA 2OMEA 2OORC 1Z5VA 4EG5A 3EXFB 1QNFA 2IRWA 3OTOB 1SC9A 3LVRE 1Q20A 3MRTA 5BO5A 4WK0B 2QTZA 4MDYA 4HQRA 3QVVA 4N5LA 2QUKA 2QSZA 2X14A 5BMVB 2C88A 3QV1A 3SNKA 5G4KB 3BMXA 3BGSA 5KU7A 3MTEA 5CLIA 3DLAA 1JTEA 3GV0A 5F2NA 3H3FA 2OCKA 2C60A 4O59O 3T3IA 3ZHSA 2OCLA 1WMHB 4ZO2A 2ACVA 1MAAA 1C30B 1J1UA 1H3FA 1MO4A 1BQ4A 5ITZB 5JASA 1PL0A 4A6XA 3DT6A 1IBCA 4QDOA 1QV6A 2E6XA 2VK1A 2H17A 1KO4A 1WKVA 3FNQA 1C1YB 3EHVA 4CW7A 3MCWA 5CHFA 4XWYA 2LKCA 2JLAA 2XWQA 1SZDA 4UNSA 5CB4B 4A9AA 5G55A 2GD1O 1M83A 4G5XA 3KUKA 3UG7A 3ZJVA 2IY0B 3R0ZA 4NABA 2QX8A 5H7XA 2VP2A 4EGAA 1KH2A 3JQPA 5CVVA 1AM4D 2VTEA 4J76A 1AW7A 4BKRA 3EMKA 3IQIX 1FRVA 1R27A 3T35A 2AK3A 4A7PA 3A37A 4YAKA 5HWSA 4PIMA 3EN0A 4ZVUA 1DIRA 2O59A 1JHMA 4ALMA 5C4MA 1HQRD 3IP1A 4UMFA 1NW4A 1GU1A 2I3BA 5A7HA 3LQKA 1FFGA 3BXFA 5K03A 5CA0F 3G8BA 5LC1A 4PHFA 5DDIP 3NGXA 3E2MA 5ITSA 3QA9A 3LPMA 6PFKA 4ILKA 2QMEA 1A2BA 2BGNA 4J0IA 1O9GA 3HCCA 3QEJA 5JCJD 2ZYTX 1II9A 1ZONA 3MWYW 3MOGA 2YWJA 4LRTB 5I01A 3OF2A 5DT9A 3W04A 3WKAA 2BGMA 3IE1A 2BBSA 2C97A 4HNAB 5LA6B 2WX0A 1U1EA 4G8CA 4J2HA 4TL9A 2PUDA 4HL6A 4HUQB 1FDIA 1HXHA 2K2WA 1KPGA 4U7JA 1Y6ZA 1GPXA 1X1TA 2WUVA 4NEQA 3B6MA 4KX5A 4CLOB 1Y4UA 2QZZA 2JEOA 3LVQE 1MB4A 1SE4A 3NRBA 4N5HX 4AJ4A 2YIJA 3DYBA 2I1VB 3PZBA 2RGNC 2CLHB 2D10A 3PTAA 1JWAD 4TT8A 3O2NA 1QBGA 4EZKA 5CJ2A 1NE2A 4RFVA 5T3YA 5LB4A 2CHZA 4HUTA 4PO3X 4CMKA 2QW1A 5DGCA 4PAWA 4G63A 4MUFA 3BWYA 5JV5A 1A7JA 5GZ1A 3DLBA 4ZZIA 3IA7A 4WFKA 1VA5A 4Q66C 1P8AA 1T2EA 1SXJB 3KEFA 1MFWA 1YI1A 1KQGA 5K3CA 1WY7A 1FRZA 4EG0A 4ER3A 3RFUA 4FYVA 4R1NA 2R2QA 3HM2A 4D97A 3QU5A 4PC6A 1TZJA 3WGQA 5C8YF 2B7LA 3H6NA 5KTPA 4CI9A 4ZZ2A 3P32A 1SJED 5BWMA 1HDRA 3GGGA 3Q3HA 3O94A 2JJQA 3KKOA 1XTBA 1X3LA 4NQRA 4D9MA 3W3AA 1IUEA 4ZVKA 1BO6A 1Y6QA 3R76A 5EXEA 3SHQA 4A23A 1JEJA 2IODA 2F3UA 3GLFA 3FI0A 1WVMA 3KOZA 1KMHA 4I1PA 2ZWPA 4LBWA 2C95A 1TA9A 4CR7A 4DLPA 2OORA 2K3UA 1GQFA 2DQZA 5HDQA 1CUSA 4NQ4A 5AW5A 2AK2A 1S3SG 5HQ3A 1CY2A 1E32A 1IK6A 2B6HA 1EGMB 3IQZA 1RI1A 5AEBA 1S1MA 5GJWC 2VZKB 4GLSC 1FFSA 3BMOB 5B1IA 4S0RA 1CQIA 1NW7A 1EFVB 4A2WA 2OV2A 3KX2A 3KSZO 4KLNA 3H7SA 4PTLA 4IICA 3NHEB 3QKWA 2Y9PB 3Q8XB 1DDKA 1Z4OA 5AKIA 2DHCA 1M6EX 3CF4G 4TV3A 4RE5A 3DCJA 3ITNA 2NVUI 3TX6A 2ZJAA 2VF8A 3SLRA 4LWZA 1YJBA 3FETA 3GLHB 3ZTDA 1SU8A 1MKYA 1BJTA 4K9SA 4YUZA 1FRNA 2ZI3A 4B6PA 1J8DA 1K7CA 3WWEA 1BWQA 4DMLA 1KO3A 1I51A 1ORTA 4PXSA 4K05A 1OD6A 4IWYA 5E9AA 3EOAI 3NDIA 1YAHA 2H1VA 1Q1BA 3TCXB 1ZC4A 1N4DA 1WXDA 1MORA 1NC3A 3CKKA 5DU2A 4HXYA 3U4MA 4HJXA 2PUAA 3ZNPA 3VKWA 4EUNA 3NYRA 1EFHA 1S2LA 3IOMA 3EZNA 1XA3A 5LMUB 3TCAA 3LRXA 3K8QA 1RCTE 4EGFA 1IPFA 1JWBB 1JR3E 1R16A 2HF2A 1WZCA 2AE1A 2E87A 1XCLA 1CHDA 1T2UA 1YB1A 3PV1A 3PGJA 1X1RA 2CXNA 4C87A 1WY5A 1VRCA 1HE8B 3U7JA 3IQWA 2RCYA 4G2TA 3EZXA 2CNNA 5ICMA 3EMBA 1U2TA 2BMFA 4F3CA 1P9LA 1RWSA 1EM6A 2LIVA 1DDOA 4B75A 1UWMA 1QF6A 2QTGA 4LDZA 3MINB 4JL9A 1WGHA 3M6VA 3BDIA 1SJHD 3BE8A 5ACXA 1COWD 3SBEA 4YAOA 3TZ6A 5ALQA 2EG9A 4J0HA 3AMVA 5AZFA 2XZLA 3EXHB 2YWEA 3I63C 1Y56A 3EOBI 3ZWMA 3RKSA 1YI0A 4CV3A 4OBBA 2LW7A 2FKNA 1VIVA 4PLFA 3C3PA 3VR4D 4HQKA 5JD5A 5BOSA 3SYTA 2RGNA 1X7WB 2P2LA 3TXAA 2YUIA 5EC8A 5KHOA 2WM9B 3CW8X 2OY0A 1XSEA 3VZPA 2Z2XA 4D4KA 2RG1A 4R83A 1SCDA 4B3DA 1UJ5A 2IGGA 4Y6RA 2BSQA 4HS4A 3RNGC 4B2PA 4TMTA 2GVNA 2GBNA 1YF3A 2PJZA 1PFGA 3WG9A 3PEUA 1EP2B 2PD3A 3M83A 3E58A 5ED0A 1PT6A 3PQ4A 2QN9A 2CNDA 1UZUA 3B52X 1EWYA 2H06A 2XXBA 2AGVA 4PVCA 2QRZA 1R1DA 3UGKA 3V7FA 3TUOA 2B5WA 3BY4B 3HXPA 3O8RA 5C1ZA 3HA7A 1I24A 4CUZA 3T1OA 3OQJA 2NX2A 4L2IB 2NU7B 1KMMA 3HY6A 2QV0A 3SGLA 2JGAA 5CB8A 1AUPA 3IP5A 3FJOA 4CN8A 4ALLA 1UMDA 4BXOA 3CNHA 4U2EA 5HZMA 2WJAA 2KAJA 2W70A 4E1BA 1CDZA 1R5BA 3B6KA 1LXDA 4E5KA 5CYPA 3WHIA 5EXXA 5KYXB 1CP3A 1U3TA 4F6RB 4GSWA 1VFPA 4LZJA 3NETA 4O4LB 4I1YA 1TI7A 1FNDA 1QPZA 5CH3A 2J3DA 1VKNA 3W9UA 1XA0A 3O1HB 2CDBA 4X95A 2TYSB 3DP9A 4MPDA 3AC0A 5E0KB 4GSYA 3W6UA 3KQ4A 3NXSA 1V16B 2R6GA 1U6KA 2GB1A 1EX6A 4H60A 2ZI6A 5JO0A 3ODGA 2JRCA 1IZZA 3KCQA 4M1QA 4KI7A 3CWCA 1TO2E 4MUAA 4CFZA 4YRGA 1ZOOA 4M38A 1O96B 1NL3A 3P5SA 3K8ZA 4S3MA 3HBJA 1GAXA 5KNCA 4JWUC 2QRVB 4LYAA 1ZD2P 4BFXA 4YSKA 1FNWA 3BCRA 5LMCA 1V7PC 1JIKA 4IYRA 4JC8A 1CZNA 4HYEA 3TKAA 4YB8A 1RM4A 5IP5A 1Z83A 4CKCB 2OFPA 1UJNA 3Q11A 1H3EA 1QLJA 1LBEA 2JEYA 4F93B 1AMUA 3SQOA 2ZVPX 3STYA 1D09A 3GCXA 3A4LA 3AEDB 1SHJA 3I83A 1BCRA 3M5DA 1YO6A 3QYFA 4P1BC 3SW3A 3NVDA 2KDFB 1X0VA 3MAAC 4WFQA 2I34A 3EWAA 3W4JA 5IVIA 2TS1A 5CNJA 1GGFA 3QV2A 3VAAA 5CGZA 5KKCA 2VIIA 5IMBA 1J2TA 4O4HA 5HJEA 3D6TB 5HH4A 5IASA 2G7ZA 1ILWA 2GSWA 3EC1A 3GELA 5KZMB 1P2FA 3EYAA 4I36A 3OICA 2CVFA 1C76A 3OKCA 1ICEA 1MNAA 2B37A 3O5AA 3CIFA 3KQPA 2Q2VA 5ARBA 3T7CA 5CG1A 1L7XA 3RIMA 3NKFA 4BBNC 3NXKA 1SQGA 4BMZA 2YV5A 3GAAA 3PXBA 3V34A 2JFXA 3EGRA 1XDGA 4H1VA 1WUJS 1ZSVA 4TMXA 4ENPA 1UBKS 1AGPA 1E6EA 1MHPA 1B2LA 4R2XA 4IV8A 1CQJA 1QO7A 3QVXA 1ZYUA 1BMFD 4RJ2A 1TFUA 3EXAA 1DOXA 1ZDXA 2K39A 3OOJA 2CNBA 4Q03A 1ULSA 1PL8A 1E9RA 2QOEA 4AV7A 1XTPA 2AMLA 3K2BA 2X0KA 4JL6A 2V4UA 2F64A 3X2FA 3ES9A 2DGDA 3REQA 3IILA 1WF6A 2YXLA 4HDAA 3RNEC 5JXJA 5FEMA 2IF2A 3E3OA 3QM1A 5JH5C 2UDPA 4YSZB 2Z5VA 2X86A 5JSUA 2AN5A 3NTQA 5ALJA 3QNWA 4HLQB 4PZLA 2WF6A 3G9UA 2HMVA 4Z4FA 1WXSA 1XEXB 4W5TA 5KYVA 2P2NA 3AY6A 3O7WA 2YWFA 4X7PA 1PG5A 4J07A 4YCBA 1M74A 4KB5A 3H9EO 1C9YA 3ND5A 4L3VA 3OWXA 2QQFA 4LDNA 4AP6A 2C07A 2ZJ7A 2M56B 3FNGA 4P5DA 4FFSA 4QEKA 4YAJA 1B0ZA 4BLUA 2PRJA 3VTVA 4WY5A 4DLUA 1FXAA 2Z4RA 4F84A 3CUVA 1IPHA 1DBWA 2KPOA 4F5YA 3OUUA 2BHNA 5LIPA 2BUAA 2CHGA 2J9FB 2D54A 4AZ3B 4G3XA 3L3BA 3IOFA 1GNLA 1A9QA 1EUZA 3NBQA 1FU7A 1Q12A 1N32B 2Q1UA 5KOIA 3GJQA 4PZZA 3UWMA 3WL8A 1RYNA 1BCSA 2GEFA 4EW3A 2HBYA 2KZRA 5LZ4A 2SCUB 2QINA 2DCUA 3M33A 5A5DA 2AZTA 4YCMA 3T4XA 3FRJA 3CRMA 3CHYA 3RSLA 2A7MA 3VPHA 2D5GA 1BS9A 2JUOA 1FS5A 1QB7A 1DOYA 1Q3TA 1TS3A 1JZQA 3UYLA 3O8LA 1QCZA 4BQQA 1SU6A 3FTQA 1OGJA 4HXFB 5A05A 2PEZA 1DQRA 2R3SA 3EPLA 1MHHE 4EQZA 3SSMA 4Q82A 5F7OA 4AY5A 3PBKA 4YCSA 5B1UA 4PANA 1J8CA