3BK2A

Crystal structure analysis of the rnase j/ump complex
Total Genus 168
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
168
sequence length
549
structure length
549
Chain Sequence
QDHVEIIPLGGMGEIGKNITVFRFRDEIFVLDGGLAFPEEGMPGVDLLIPRVDYLIEHRHKIKAWVLTHGHEDHIGGLPFLLPMIFGKESPVPIYGARLTLGLLRGKLEEFGLRPGAFNLKEISPDDRIQVGRYFTLDLFRMTHSIPDNSGVVIRTPIGTIVHTGDFKLDPTPIDGKVSHLAKVAQAGAEGVLLLIADATNAERPGYTPSEMEIAKELDRVIGRAPGRVFVTTFASHIHRIQSVIWAAEKYGRKVAMEGRSMLKFSRIALELGYLKVKDRLYTLEEVKDLPDHQVLILATGSQGQPMSVLHRLAFEGHAKMAIKPGDTVILSSSPIPGNEEAVNRVINRLYALGAYVLYPPTYKVHASGHASQEELKLILNLTTPRFFLPWHGEVRHQMNFKWLAESMSRPPEKTLIGENGAVYRLTRETFEKVGEVPHGVLYVDGLGVGDITEEILADRRHMAEEGLVVITALAGEDPVVEVVSRGFVKAGERLLGEVRRMALEALKNGVREKKPLERIRDDIYYPVKKFLKKATGRDPMILPVVIEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Metal dependent hydrolase
publication title Structural insights into the dual activity of RNase J
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Hydrolase
total genus 168
structure length 549
sequence length 549
ec nomenclature ec 3.-.-.-:
pdb deposition date 2007-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07521 RMMBL Zn-dependent metallo-hydrolase RNA specificity domain
A PF12706 Lactamase_B_2 Beta-lactamase superfamily domain
A PF17770 RNase_J_C Ribonuclease J C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.580 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3bk2A03
3.40.50.10710 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Metallo-hydrolase/oxidoreductase 3bk2A02
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 3bk2A01
2P97A 4FEKA 2Y8AA 4YSLA 2BR6A 4TYTA 1DDKA 1DD6A 4C1FA 2H6AA 3DHAA 3I0VA 4P62A 3ZQ4A 3IE1A 4PVOA 2Q0JA 5AHRA 4EYBA 3T9MA 5EH9A 5LE1A 3FAIA 3SPUA 4FR7A 5HH4A 3I14A 2WYLA 2VW8A 3SD9A 2NYPA 1VMEA 3ADRA 2OHIA 4J5HA 3DHCA 2GMNA 3X2YA 3RPCA 3SFPA 4XUKA 2XR1A 5A0VA 3TP9A 4KEQA 4AWZA 2DKFA 2QINA 2BIBA 3PG4A 5KILA 4EY2A 1X8HA 4F6HA 2NZFA 3DH8A 2I7TA 3KNRA 3IOGA 2FU8A 3AJ3A 5LCAA 3BC2A 2AIOA 2WYMA 3IE0A 4Z5ZA 3F9OA 1X8GA 4EFZA 4EYFA 4YSBA 5HIQA 5B1UA 3PY6A 3AF6A 4V0HA 1QH5A 3I13A 4D1UA 2Q42A 4C1HA 4RAMA 1BMCA 4TZFA 3FCZA 4H0DA 1KR3A 5EVBA 2OHJA 1WUPA 4UWPB 5ACRA 2YNWA 2ZO4A 4AWYB 4C1DA 2FHXA 1VJNA 4GYUA 2QDSA 4TZ9A 4C1GA 4UWOB 1YCGA 5HIOA 1JT1A 3I15A 2ZNBA 5ACWA 3A4YA 2FU9A 4JO0A 5EVKA 4WD6A 4D1VA 3SBLA 2BFZA 2YNTB 2I7VA 1BVTA 3S0ZA 4RAWA 5AYAA 3VQZA 1K07A 5FQCA 5EWAA 2NXAA 5EV8A 2YCBA 1JJEA 2Y8BA 3AF5A 4ZO3A 5HH5A 1L9YA 4DILA 3T3NA 3ZWFA 5EV6A 4C1EA 5LCFA 4RL0A 5K4MA 3IEKA 2NZEA 5ACQA 4FSBA 2BFKA 3KNSA 2BG7A 4LE6A 4Z5YA 3IE2A 4ZNBA 3X30A 4NQ5A 1ZNBA 5ACPA 3MD7A 1WUOA 3WXCA 3X2ZA 2A7MA 4C09A 2FM6A 2Y87A 3G1PA 2BG2A 4ZO2A 2ZWRA 5HH6A 2WYMC 3IEMA 2Q0IA 3DHBA 4TZBA 5LMCA 3R2UA 3QH8A 2FU7A 1MQOA 5HISA 1XTOA 5HIPA 2UYXA 4GYQA 3SW3A 2M5DA 2QJSA 1ZKPA 4HKYA 5EHTA 4DIKA 1A7TA 2FU6A 2BG8A 3BV6A 2GCUA 3LVZA 4NQ6A 4AX1B 5LSCA 4HL2A 3ZR9A 1QH3A 1BC2A 1XM8A 2P4ZA 4BZ3A 2YZ3A 3I11A 5EW0A 4UA4A 5LCHA 2OHHA 1Y44A 2BGAA 5ACSA 1A8TA 5K4KA 2FHXB 4TZEA 4UAMA 3X2XA 2Q9UA 3PY5A 1M2XA 2GFJA 4UWRB 1KO3A 5AEBA 1HLKA 2BC2A 4TYFA 3RKKA 2YNVA 2BG6A 2WHGA 2BFZB 3SRXA 4C1CA 3Q6VA 3P2UA 2GKLA 2XF4A 4UBQA 4NQ2A 4D1WA 4KEPA 5ACUA 4Z67A 3H3EA 3L6NA 1E5DA 1SMLA 4AX0B 3KL7A 5AXRA 1YCHA 5IQKA 5ACVA 5DPXA 2FK6A 2I7XA 3T3OA 5KIKA 4Z6XA 4ZEJA 4XWWA 5B3RA 4D1TA 2CBNA 4RL2A 1ZTCA 4XWTA 5ACXA 5A0TA 5LM6A 5AHOA 5LLDA 1P9EA 2AZ4A 2M5CA 5K4NA 4Z60A 5FQAA 2GFKA 4GCWA 1KO2A 2E7YA 4F6ZA 5LS3A 2BFLA 3VPEA 4UWSB 4B87A 3ZNBA 2YNUA 1VGNA 4PVTA 1JJTA 5ACTA 3RKJA 5FQBA 4U4LA 2R2DA 4NQ4A 1X8IA 5K0WA 2BG8B 2P1EA 4O98A 5EVDA 3BK1A 4EXYA 4YSKA 2WRSA 2DOOA 2QEDA 5AXOA 4BP0A 4HL1A 4RBSA 1DXKA 2BTNA 4RM5A 1WRAA 2ZZIA 5A5ZA 2QDTA 2HB9A 2BMIA 3JXPA 4CHLA 4EYLA 4D02A 4EXSA 5B15A 3IELA 3IDZA 1WW1A 1YCFA 2P18A 3IOFA 2YNTA 4Z7RA 5A87A 4AD9A 2YNVB 4J5FA 3BK2A 3ESHA
chains in the Genus database with same CATH superfamily
1VE9A 5IANA 2L3ZA 1XC7A 4HH3C 3GFGA 5JRDS 1NEKB 4DHZE 1P5JA 4W9MC 5DDIP 3I14A 3AEUA 2Y1XA 4DTCA 4G4JA 5CVEA 3PUVA 5HHDG 2PNFA 4HKZE 5F3DA 5A0VA 2WFZA 2FEPA 2DZMA 5E1BA 1FP7A 4GLLA 3RBXA 1PNTA 1BE0A 3D9QX 3ZXXA 3MLBA 4AUKA 3CURA 2QIPA 1HBJA 1YIAA 3EAGA 4GWLA 1QH8B 3V05A 3DL2A 5D86A 3AIMA 1KL7A 4ZOCA 2NU9B 3VNBA 4QGFA 5B1UA 3EMDA 4OHBA 3IV6A 4JEUA 5IF9A 3G17A 4QU5A 3E56A 4D0RA 3A1FA 2O5VA 1G2OA 3GLGB 3VZCA 5THQA 2PJRA 4CLXA 1ZH8A 3KV1A 2HLPA 2PT6A 3RSSA 1U2RA 1EM7A 1G3QA 1OZAA 2G0NA 2B7BA 2DBZA 3QFCA 4A91A 2K7FA 2BPSA 3E2PA 2RFLA 3JD1A 3LT0A 4F8CB 1IY8A 3HHMA 2ZEQA 3AE8B 5G53C 2WXKA 1F2RC 3OZXA 3QVSA 5EINA 3R8FA 3H84A 4X97A 3WGYA 1EFPA 3R3UA 3ZUNA 1RWKA 4IUCS 1QYRA 3H65A 4RVSA 4ZGWA 4DRXA 4JUAA 3R76A 3IT4B 3AOGA 1AKNA 3ILYA 3OCVA 5CLIA 3IE2A 5AICA 1U2ZA 5P21A 3GWGA 2G83A 4EJ6A 4ENTA 2JEOA 5DTQA 4MLDA 5EESA 1UM9A 1KJZA 1WM1A 2VSOA 3IYLW 3GYBA 5HRUA 3ZZNA 4BLTA 5LYJB 1BDJA 1M5TA 1S96A 4N65A 1HRDA 1OEYA 3L8YA 3WHKA 5IKEA 4ZAVA 2ZUVA 1GSIA 2QW8A 1G98A 4QJBA 4KI0A 4KWHA 3KEQA 5LSCA 2JJ8A 4YI5A 1QTRA 3KR1A 5KS2A 4C0HA 4IX9A 6GPBA 4OYLA 1XEXB 3RYTC 4DFDA 5AKEA 3NHFA 1ZM3A 2OHHA 5BQPA 1P3QU 3M3JA 4XIYA 2QRZA 3DO6A 4XIIA 4TZEA 1TO2E 5FV4A 2ERXA 5JRJA 5KHOC 4PG7A 1FC0A 3AV0B 1ET6A 2OKGA 4GE0A 4XDHA 1NBFC 4HUTA 4J43A 3FN4A 4AUEA 4ODIA 3GLQA 4AG3A 1O9HA 4FMBB 2BH2A 4LKOA 2IZVB 4U02A 1TY0A 3SBOA 1WMDA 1KAHA 2IHJA 3L5OA 1E6UA 4JX1C 2VSYA 3QA3E 1TYDE 4H2DA 3PX7A 3HC7A 4C4PA 3F9IA 1V1PB 1GNUA 3GB9A 1XO3A 3G8YA 2PSSA 3FZGA 4NECA 4FU0A 5EJEA 3VUYA 2Z3ZA 4MUHA 5AJWA 5CJPA 1BSVA 1Z2AA 1W5EA 1ADFA 4JHXA 3K3PA 2VYND 1DUIA 4ME6A 1CZNA 1RCUA 4KSKC 3U4QA 2OV6A 4CV2A 4HEA1 3LZ6A 3ZV4A 2ZJ0A 1PQ4A 1K0UA 2AXNA 2H2DA 3DVSX 2GB1A 3KJHA 2EKZA 5EHQA 2FNJB 3E2MA 4DJJA 4EPXA 4MDYA 2EX4A 1TAGA 1WW2A 1J0EA 3GFVA 4U2EA 4Z7JA 2Q4TA 2Y0CA 1TF2A 1E66A 2R60A 3K70C 1QP7A 3QKRA 4IICA 2QSYA 2JD0A 1UZLA 5GWXA 1AY0A 5LBUA 3LD9A 1DDKA 5KPDA 3LUBA 1ESMA 4P62A 2A6PA 3NWPA 3PTAA 4MA5A 1ZNYA 5EKDA 5CLLA 3RFVA 1KYYA 3ZZ1A 2B5VA 2F17A 3IO5A 1ZMXA 5EP4A 2CUNA 2EQ5A 3RI3A 3H9UA 1DOXA 3W2IA 2WIBA 1FU8A 2JHGA 2XECA 2KN5A 4K46A 4RAOA 4OGWA 1RJ9A 2WSSA 2HW8A 1FX0B 4YRPA 4JQWC 2JLUA 2XDAA 4Q16A 1UQUA 2DY0A 3EE6A 4DMGA 3WBBA 1ICIA 4C80A 4PGMA 2FB9A 4YL8A 2XUGA 1CUIA 1ODTC 2L18A 2FEMA 1L0BA 4EARA 2R25B 4EDFA 2VHYA 3C3WA 5F2EA 1HE3A 2GRAA 2B0CA 1WI0A 3U9LA 2R97A 3HHEA 2N9LA 4H31A 3RRJA 5HG2A 3LB8C 2W2LD 1J09A 5ARBA 1M2VB 2ZB7A 3UMSA 4HNUA 4YRGA 3IR7A 3EVEA 4II3B 4MDKE 4K1RB 1X1EA 2OZLA 1F17A 1C3XA 2ZE7A 2OLEA 2W54A 4US8A 1PFGA 3T61A 4DCNA 2FU9A 5MN4A 2EJTA 3FLMA 4DPMA 3IBTA 3NBQA 3DOUA 4KLRA 4L6AA 2Q4OA 4UKDA 2DQYA 4EVRA 2PUVA 4Q3AA 2KWVB 2VO1A 2JLWA 1EF1A 1WMAA 3TXAA 2AZTA 4K1LA 4RF1A 4YJFB 1ZKDA 2NXAA 3Q7PA 4EFOA 4IEFB 4OGLA 4ZHQF 2XY4A 1ICEA 4TMVA 2ZVQX 2AMVA 1H2HA 1PLKA 4AJPA 4TQ0A 1XWFA 2ZQYA 5LXTF 2AYZA 3OX4A 3L46A 4CEJA 4UUQA 4W9JA 1Q7EA 1OZHA 2WDPA 3LDHA 3RTEA 1F7VA 3HTXA 1L9XA 5C2TB 4CHGA 2KTRA 2PXCA 1YQGA 2RB4A 2FRDA 2X6TA 2WJYA 4CV1A 5T6MA 4U7DA 3PVCA 1ZMRA 2E7ZA 4FW9A 2ZJFA 3W1WA 3CNEA 2JD2A 5LMCA 3ZXSA 1Q7RA 2LTAA 4DLZA 3LX8A 2YV4A 1OQRA 3K9CA 4Q21A 4C6TB 1S6YA 3EK2A 3JQQA 5B3AA 1Y8RA 4D4IA 2PXAA 1E0SA 1FRVA 5U9CA 1YI1A 2BHLA 3C3EA 3NIDB 1M1NA 1TO6A 4NJCA 3H1EA 5FDFA 2I34A 3KQQA 4KR3A 4RIHA 3QWBA 4DV3B 4M89A 3NHJA 4XGIA 1NJGA 4Y2GA 1NR5A 1I10A 3WK6A 1DG9A 1U1IA 4P92A 2WXLA 3I01A 3GRKA 1B16A 3PUJA 3ZNHB 2HTFA 1B7GO 1DUVG 1KYIA 4AJYB 2W6CX 3WWCA 2B4RO 3OPXA 2QT9A 1R37A 4FUQA 2IDKA 3KL7A 1O77A 1IEQA 3Q3VA 5KDOA 1MX1A 4FT2A 1DIRA 1VJ0A 2ZJ2A 5IKOA 1THMA 3LP5A 4AJ2A 3K71B 4HKQA 3IAUA 2YIMA 2WJ6A 5KQPA 3HV0A 4LNOA 1KGSA 4OJQA 4COKA 3LYAA 4BX2A 5ARCA 4CN8A 3T1OA 2ZI5A 1EUCA 4KIGA 2EEPA 2JVCA 4IJ6A 2FEWB 4EENA 5T57A 3ZNBA 2RGGA 2C5BA 2G9HD 1X7YA 1THGA 3RAPR 3LDGA 4RTPA 1K2WA 1G4AE 4MV4A 2W70A 1A7KA 1SE3A 1SXJA 1UT8A 1UOEA 2FCSA 1HI9A 1ZUD2 3CPEA 1XT9B 4EY5A 4G8BA 1MO2A 1PL6A 1BEZA 5LQUA 1BX1A 1HY3A 1IEWA 1OTYA 3OLWA 1YONA 4YJKA 3W9BA 1PGNA 4N0PA 4BLSA 1X1CA 1KMNA 4D9GA 4N5DA 1WXIA 1IXKA 1B6SA 3O8RA 1CQIB 4N0EA 4DLUA 2VJBA 1ZXHA 2PUDA 3A2NA 2B94A 3DMTA 1WJ4A 4V39A 4LK3A 2Z59B 1E64A 3RVBA 4JWKA 3KVFB 2G88A 3RMKC 3O65B 1NJ2A 2E4XA 4X6UA 1MB3A 3MXTA 4EZLA 3M9WA 2WNHA 2WXMA 3UXMA 1IHDA 3FPKA 3N53A 4RPHA 4O2AB 4QNMA 3PQ4A 1JZTA 3KAQA 3SZRA 1QHHB 3EUFA 4HYQA 3EVDA 4I36A 3NTXA 3ZJUA 3IOGA 2BB5A 3E7DA 3K9NA 2LR0A 1ZAKA 3RSOA 4G85A 1IBMB 4BLPA 4RF4A 5BURA 4ZAZA 3UJ8A 1SKMA 3HVHA 2H5JA 3OG5A 2Y6VA 1TGVA 2ENUA 1Z4IA 3J81A 3AUXA 3FCCA 3ZLBA 3EYAA 3QC8B 2B30A 1R66A 2JGFA 3R7AA 1G3IA 1GL9B 3R09A 4Z8XA 1BMCA 2B34A 1ZPDA 2P6NA 3LPLA 5KNDA 3A28A 5JE8A 1KPHA 3CLTC 3JASA 2OHJA 4IEIA 3OEEA 1U80A 4MT5A 1R3UA 3PXUA 2I22A 4HRSA 1E6MA 1JT1A 3SSOA 4L1BA 3GGCA 5KCMA 1YA8A 4RPKA 4BO2A 4G0YA 3LUDA 5A5DA 4D3XA 3JQ9C 1O9GA 2D1FA 4Z0PA 3MWGA 4RHTA 1PD1A 1NTRA 1WGHA 4G5RA 4URFA 3KKOA 3OKFA 2C94A 1U1CA 1EDEA 2Y1DA 2HK9A 1RRCA 3U7ZA 1Z6AA 2ACEA 4G0VA 3THWA 4TWAA 1A9ZA 2QTVB 4K9NA 3I12A 1P9WA 1SZPA 3PJFA 3L8EA 2ZIXA 4CQMB 3L1JA 1O6GA 5AW7A 3ZHSA 1Y3AA 2K8HA 2BKRB 3CT4A 3NH9A 2KNBA 3OQBA 4BZWA 3AKZA 4PIVA 3S2GA 3AE4B 2O3TA 2AMYA 2WQ6A 4IZIA 1Q1OA 4L5BA 3T8MA 3MS4A 3HFGA 5BOSA 4L78A 2PA3A 1FLVA 4ZVUA 3MG9A 1DQYA 1X1TA 4HJKA 1XT6A 1Z0UA 3F3SA 4MPPA 1DUSA 1X2BA 5TQVA 5ITZB 3LRPA 4N47A 5F3WB 1L5SA 3LP8A 3U61B 2H9IA 1NF9A 5ESXA 2H4YA 5A71A 1ZD3A 2YNVA 4JI2B 4QYIA 4C78A 1RXVA 4UU1A 1KP9A 4ASUA 1QF6A 4LXXA 4KEPA 3FCEA 3GE3C 2RG7A 2XZDA 3HEAA 4RWEA 1F60A 5JZSA 1QP0A 4IM3A 1NNSA 1NL3A 5I4BA 4NAWB 1Q95A 2XVAA 3DE5X 2X14A 3TRJA 4NJOA 4LPKA 4CM6A 3THRA 2F1OA 4ZEJA 2E6UX 2WE8A 1A7AA 1VKHA 2AWOA 3A1TA 3SQNA 5ECWA 1WCWA 4HDMB 1M8GA 1LWOA 4G1UC 2FQWA 2M5CA 4PZCA 3HR8A 4UJ5A 1O58A 5FNZA 1QF9A 3ICOA 4UWSB 2H4WA 4GM1A 1KETA 3COYA 2YJ3A 1CNMA 1O6BA 1GZ6A 1TKYA 2D07B 1TJEA 2WRZA 1ZU5A 5BQXA 4N12A 3A7EA 2W82A 1XOIA 3ODGA 1P9NA 1OKKA 4RZ2A 1WSWA 5DWQA 1KARA 1QSGA 1EB8A 1FP1D 3SFVA 2NTSA 5AIJA 1PR0A 3RU3A 1OQYA 5AW6A 3IIKA 5LP6A 3HBFA 1L4NA 2R84A 2VDUE 2KFJA 2Q2VA 3TFWA 1GGFA 3VVMA 1MHTA 2AYOB 2QA5A 4FEKA 4HFRA 4B09A 4ITRC 5K3CA 3BAZA 4W9GA 3PWZA 1DD6A 2XMDA 2OFXA 1K8ZB 3I1YA 6YASA 2R4QA 2CHEA 2B61A 4O4HA 2XVZA 4HSGA 3BJMA 1DRKA 3OZFA 3QTTA 3Q8MA 4EG3A 3KJZA 2P0AA 2XR1A 1H66A 1ZC3A 2XSZD 4C3VA 2AW3A 4D3FA 4W1RA 5FOUA 3L84A 4K7SA 3VU9B 4OH7A 2AR7A 1C0PA 1VCNA 1DCFA 3DBSA 5DNCA 3L4BC 1U4OA 5BWCA 3ZCPA 3WHLA 1G5TA 1SEVA 1Z2EA 4KV2A 1EP3B 2OCAA 4AO8A 3X3HA 1T36B 4ZREA 1NJ5A 1Z2NX 4DOMA 5ALLA 2Q42A 1V95A 5FTWA 2QQ0A 5F5NA 5DM60 2IZ5A 3G88A 4GYKA 2ZRMA 3DWEX 3K1AB 3QYJA 5ICMA 1E7UA 2V7WA 5B4UA 1PVOA 1A8SA 4MR7A 2PIDA 5KWVA 3O47A 4ZICA 2OO3A 3TMAA 3H42B 2A8YA 1DG3A 2J5QA 4RQBA 5EV8A 1I7HA 4C4SA 4AFNA 3PCXA 1RRFA 4L3OA 4HO1X 1YZUA 4UTZA 4YRAA 1NRXA 4CKZA 3E7XA 2WV7A 3FAHA 4P7JA 1I4DD 1NNUA 3GRCA 2CFOA 3N2LA 1WXGA 1GHTA 5INTA 3SZOA 4QUEA 3ZVVA 4QGBA 1A77A 1EBFA 4S1NA 4BZPA 4YJ3F 2GYWA 2J59A 3DDZX 2ARKA 5HH6A 2MH7A 2PX6A 5IDVA 5IJ0B 1KK2A 1UWCA 4LY9A 4P2GA 1WZEA 1EAMA 3GZTB 3A0UA 2WFLB 4HQFA 2C58A 16PKA 3U7FB 1TVEA 5BO4B 2R4UA 3NHAA 3EG9A 4XD2A 5EDSA 5EE3A 1GGJA 3R7NA 2HMYB 3A26A 1I5EA 2GEFA 2XAAA 1UD7A 4B5LA 3NW9A 4FHZA 3WB9A 2OPBA 1ZJ5A 3JYNA 1XTQA 4QT0A 4WL0A 3K8ZA 4M9SA 5IG2A 4HQKA 1T6ZA 4JROA 3Q7SA 4BRZA 3KZXA 4XYEA 1NU6A 2WD7B 3W9SA 5LA6B 4HXEB 5SYNA 5C8XA 4MW9A 4YDSA 5K9ZA 1FXWA 4BVHA 1UF9A 4DNFA 4ZO6A 4KMSA 1EK2A 3H7AA 4XLLA 4NCBA 2EFJA 4GBGA 2QTMA 1I80A 5AZGA 2NSJA 4RCZA 3UO8B 4KXVA 5BUQA 5GGXA 3GJ3A 1TF5A 2XUKA 5FBKA 4BRWA 1VG8A 4JJ7A 3CLSD 2CFCA 1I6WA 4X7PA 3ANMA 2VDOB 3W5AA 2ZCBA 3KAPA 2ZR9A 3AHFA 3UEOA 1VPDA 1N9GA 3AM9A 3QOYA 1M0TA 5D3KA 1W36B 4FT4A 2PGXA 2EKEC 4IJUA 1QTIA 2JDID 3VM6A 3QCAA 2WD8A 2PU5A 2ZRCA 1GNTA 4F46A 4DXDA 2C7QA 4BNZA 4JJGA 1PDVA 1NMXA 2QE7A 1A5ZA 1VGNA 3R0ZA 3SIXA 4AP9A 5BV2P 5C8YB 3SLKA 1ATZA 3N8KA 3RFZB 4R7ZA 2QLBA 4INJA 4IZHA 2BFFB 4ZQEA 5FUXA 2PUTA 1ZEJA 3K9WA 5AK5A 1TZKA 2H51A 2WJWA 3JQPA 2O4UX 4P7FA 3DUFB 2M1MA 3RKRA 2OHVA 4RD2A 5KWEA 2C04A 1V16B 4ZVVA 2PBFA 2RGFA 3QJGA 1ORTA 2I4MA 3G23A 3WGZA 1ISMA 1EG7A 3AEGB 3ETJA 1ZP6A 1LLDA 2V3WA 5E95A 2EX1A 3ASUA 1JLRA 2JJMA 1N1EA 2OCGA 1JKFA 4MYHA 3DV0B 1PGBA 1CNEA 1F1BA 3QKIA 3MWYW 1W48A 2AQHA 1R4MB 3QAQA 3L7IA 2ZJBA 1IBCA 4Z9BA 1XRLA 3IIJA 3IDAA 4XUKA 3ROQA 2HADA 4KN6A 1H2RS 2OCIA 4E2FA 1N0UA 3CZCA 3FWKA 1DWOA 2D3CA 4EITA 2IUTA 3E1SA 3H1GA 2I66A 1SUCA 1GM5A 4DR7B 2F8MA 2PWAA 2XMCA 1SCDA 4PAGA 3SJUA 5LQCA 4N59A 3EXHB 2O1XA 4NFLA 2LGYA 3R0VA 4LDAA 4QFDA 3DZBA 3UUFA 1NKTA 4D9IA 3CNQS 2NUAB 2ERCA 4Q02A 4PZPA 4F11A 2NZJA 1PUIA 5ALTA 1MJ5A 3S7TA 3JQEA 4EDHA 1PD0A 2K6DB 2VJDA 3R0XA 4D3ZA 5EVBA 1JPNA 3ZE7A 4NBRA 5A3QA 5JY1A 1BWSA 1AS0A 2X8JA 4M86A 3ZD8A 2KTFA 5HKKD 1OC2A 2Q3EA 4BBJA 2TMDA 4LXQA 1S2LA 4CPDA 1RW4A 4OAQA 1MUUA 2VVTA 1N9ZA 3L7BA 1WABA 3NGLA 4KMRA 3HDYA 3NNDA 3QUSA 2ZYSA 1WE7A 1GITA 4HN4B 4W5NA 6AT1A 4DV0B 1PEDA 4R1QA 1LPMA 2H00A 4Z9XA 4P4LA 4YFYA 5IYZA 3OUTA 4AAYA 2PMDA 3H1UA 4DS3A 1SIJA 5CFLA 2ORED 3H1AA 5FTMA 2A86A 2VF4X 1F14A 3I5UA 2K25A 1FSSA 1WR8A 1ZD1A 2XOKD 3H8VA 1PAUA 1CY8A 1NWHA 1IVNA 2XWPA 4TT3D 1LDMA 4JYPA 1DX9A 3GEPA 3QP9A 4RXTA 1YZLA 2JKYA 3ZTWA 1K6JA 5KNDH 3T7RA 4P4SA 2UYGA 4B0MA 3NM4A 2K6QA 2IZ0A 1XTOA 3ZWKA 5AKLA 3MINA 4GLJA 1U7XA 3QHAA 2WXRA 3MEQA 5CH5A 4Z49A 2AL6A 4AYTA 3O2QB 5BV8A 1ISNA 2WXJA 1T9GS 4AXHA 3DQPA 3F4KA 3ZTTA 5BT8A 2YV2A 4HL2A 2OUKA 1QH3A 3ZDRA 1XM8A 4OA5A 1HXYD 3DVNV 2NQTA 4L4YA 2AG8A 3DTYA 3QU4A 2ENWA 3OTHA 3RUIB 2HLDD 1UBIA 2NYRA 3U16A 2BT4A 3DDCA 1P6QA 4IM0A 2AOXA 4TV8A 1JV2B 1BRTA 4FYJA 3DMGA 4XKJA 4QJ4A 4PQRA 2QQGA 1Q0WB 2ZZKA 4CF4A 2ERYA 1YJXA 5CPBA 3NBMA 3ME5A 2Z58A 2RHWA 1E9RA 2G1EA 3RYCB 3KYCA 4Z8YA 5AVJA 2I38A 1LSSA 3IUSA 1EE2A 4Y9DA 5JO0A 2IV2X 3ELWA 2P9CA 1NOKA 1WYWB 1E7VA 1XF5L 5T67A 1TZ1A 3DZCA 1BRMA 4PS8A 1UBFA 1D3ZA 7GPBA 1YMQA 2Z0DB 2VAVA 5JG7A 4ZDWA 3EGXA 3L92A 3GRAA 4G97A 1KSFX 1GQSA 4B6OA 2OKCA 1P8JA 1Y9AA 1YDHA 1JEYB 2FSSA 4GPEA 1QRDA 5EZ6B 1T8YA 1SM4A 4LBWA 1UK8A 3TDNA 2IPKD 1ZM2A 5TGZA 4KHPB 2IYTA 1UCFA 2QRVA 4LTDA 3OETA 5D85A 2QUZA 1XMQB 1XP8A 3ELBA 1L3CA 2DFTA 1T0PA 2CNLA 5LWHA 3RVQA 1SUBA 5CYFA 2C5HA 3HCBA 3LOQA 1V8DA 1XDWA 2X0JA 3HRKA 4WNAA 4JGIA 2PK3A 2WRSA 3WIEA 4E7OA 1YXMA 5BUCA 5G0TA 1YQDA 1K08A 4FYYA 1NKVA 4ENQA 2ZB3A 4AF6A 5BNZA 3DTVB 3MOGA 3B1JA 2MSWA 1VHDA 2HXSA 3CZRA 2ZGVA 5IAEA 3TLBA 1JDJA 4B6PA 1K5DA 1UC9A 5HKOA 4YTMB 4KAAA 1A9RA 1POWA 4EZEA 1GZ3A 9ATCA 4RJKA 2ZWMA 1HSZA 4OA8A 3R9XB 4L22A 4U00A 2DFDA 2Q6LA 8GPBA 5GOTA 2MSCB 4WACA 3LIIA 5MFZA 1WY5A 1KMMA 3A27A 5HH4A 3V62A 1XMOB 4RL6A 2UXDB 2WDRB 3FLAA 4GZ6A 3NWOA 2CMDA 2NYUA 3D7SA 1FRDA 4KEQA 1FNMA 1ZRMA 3VUEA 1T5BA 1ABFA 4GZ3A 4PBTA 1FTGA 5JQGF 2CYBA 3BD8A 2BMJA 3A37A 1L4MA 3ZKWB 5A6SA 3T5TA 3T7JA 4RTLA 4ZYWA 1EVYA 4WCDA 5F1YA 1BDIA 1JA9A 4F9FA 1JX6A 5G41A 2HTME 2KJHB 3WWZA 3OHMA 3U4CA 3DMNA 2A57A 2O0JA 3AEXA 2H31A 2WZQA 3WYBA 1Z62A 4L0MA 1YDFA 4B31A 4D1UA 4ZRKA 3RC8A 2FEKA 1JALA 3WANA 1YRYE 1FQKA 4XVHA 1CETA 2HFJA 2YBDA 1EGMB 1IPEA 1P2BA 1LSJA 4UTOA 2AEEA 2X4IA 3E7WA 1OBOA 2ZRIA 2A84A 5DXAA 1YU6A 2QP3A 2LMCA 3L79A 3MELA 4HUQB 5AI5A 3AXCA 3GRRA 1L7EA 1S8OA 4HX5A 3HMQA 2FNAA 2QQFA 3MQ4A 2C59A 4PLPA 1Y1QA 4TQGA 2NR2A 1PUXA 1P0MA 2J9XB 3VPXA 1RKBA 2B2NA 3PI7A 4ATNA 4QXPA 2HK7A 5EWAA 3STTA 3EHDA 2JY6A 2ZBDA 4N40A 3TTTA 2GTIA 3M82A 2VAWA 2DBQA 5HKBA 1OV4A 3ORSA 3LQRA 2AK3A 2Q8NA 4CDNA 3COZA 3EEBA 5F21A 1HL7A 1Y3HA 3WDSA 3CVWA 1WJNA 1JIUA 1B14A 5I9NA 1SC6A 1CF4A 1DOIA 1P1IA 1OE0A 2H3EA 1Z0JA 1CZRA 3SDZA 3OE5A 2EGHA 1UDXA 1QANA 5LZ8A 3TMKA 4RF2A 3TZCA 1VBKA 5B4TA 1M6NA 2GXAA 2NW6A 4I4TA 1AQLA 3PT2B 4R9VA 1Z8FA 2Q9AA 2VQDA 2ZJZA 4H3VA 2AD1A 3T3GA 4ZU3A 2QB5A 1EBUA 3Q7QA 5G3YA 2DBYA 4EO7A 4HKYA 3QVMA 3PJGA 1Y9DA 2O0HA 2I5PO 3RTDA 3EWNA 2XV1A 3U4AA 3DKVA 2NU8B 3AUFA 1SQ6A 3WKDA 2LDBA 4BNXA 2PLFA 2FZ4A 4JSTA 1OCEA 2H89B 5BT9A 1HWYA 5DI3A 1C80A 3PTZA 3P1MA 4RLSA 5EWMB 3ZWOA 4R0MA 3W5UA 2FHSA 2YRXA 1YFZA 4GI7A 2K9XA 2NP6A 3KEFA 2TECE 4DNXA 5G0VA 2XB8A 5B1DA 4QELA 2C7PA 1P1KA 3A1QB 3BHJA 2QRKA 3R7RA 2CB9A 3OIDA 2YXLA 2B8EA 4JCCA 3HM6X 4EKGA 1E5DA 1Y4DE 3DSRA 3JWGA 5CLJA 2JCSA 4LI3X 2AW5A 1ESFA 1HT2E 1E3IA 5GIPE 1W76A 3QX8A 4YIKA 3SM9A 3RHZA 2HZ7A 1IHYA 3WGOA 1BAPA 1RQRA 4OHWA 5ER6A 2XQGA 5HCIA 4ZOAA 2VRWA 1IHPA 5HP4A 2VTBB 1UBRS 3PR1A 1Y1KE 4CKCB 3ZTYA 1BGWA 3JX9A 3SFTA 1DKPA 1NURA 3OSUA 4HVTA 3A1NA 2JJ1D 1VL8A 3H5TA 1JFLA 1IM8A 5E0OA 3HGQA 1FXTB 1MH1A 3H83A 1TT7A 2NV2B 1K06A 2UDPA 4Y6QA 5EKUA 3O4VA 4HDSB 1FCLA 1I01A 5B55A 2W2KA 4FB5A 4D41A 2X19A 2Y93A 2UAGA 1YKSA 3S99A 4F3TA 1N61A 4M0UA 4TTQA 5BVGB 1E96A 1E98A 3TLCA 3HJBA 4NZNA 4M49A 4TUUA 4XLTA 1TI7A 4U2CA 5BNTA 1P80A 1OYVA 2HPVA 2Q99A 3ZVRA 4CM1A 2LRHA 1HFKA 5KSYA 4G5FA 3UJNA 2IU4A 1TJ5A 3A8TA 5LXHA 4MWBA 3KAKA 4B74A 4LJRA 5GJBA 4FNMA 4G56A 5EMHA 4FB4A 4RU1A 13PKA 5KJEA 1NATA 2M56B 1DX4A 1U9JA 3SG0A 2BDUA 3VAYA 4LDTD 1NX9A 4E5DA 3FPAA 5C8DA 5FLEX 2ADMA 3G5UA 3CEMA 3DE3X 2IE0A 2FSPA 4EQZA 1JR3A 2MR5A 1MO4A 3O1HB 4Y0VA 5JMTA 3N75A 1LBSA 2C9WB 5H81A 2ZYRA 2JLCA 3TTUA 3AF6A 5KB3A 2PBRA 5SYMA 2ZT7A 1XLOA 4ZVTA 5A04A 2XUJA 3N8DA 2ZXUA 2WIGA 4D0NA 2VZLA 1I0IA 4G2TA 3HB7A 1DAPA 2C7MB 2CNOA 3WRYC 5FPHA 1RHJA 3IKVA 1RC8A 2D13A 1IBRA 4H6WA 4B7CA 1NXXA 1VL0A 1MFZA 4DJDC 5CB4A 1YE3A 1TEVA 1TYBE 1VZ6A 3P2OA 3L7AA 1WKVA 5L83A 4EG4A 2PZFA 4BZXA 4NURA 4Z1MA 4Q7QA 3OG9A 3UN1A 3AF3A 5GONB 4LV5B 1I7SB 2WVHA 1OA0A 3TQRA 1W1IA 2FZGA 3TL6A 2VHQA 1A88A 2J7KA 5H4GA 2W8BA 4B7XA 3DFUA 1Q0UA 3DLAA 1W5FA 4AN0A 2II6A 3ICVA 5AHXA 4UVEA 4PXAA 3L4KA 2H1CA 5H0IA 5HYVA 3MJWA 2L42A 3QITA 1XEEA 5EMNA 4Q3DA 2GETA 3UK7A 4RFSB 4DVGA 2OG2A 2ETVA 4G9EA 3EFEA 4UBKA 3FMPB 4JH0A 3ZWCA 3Q10A 3TQQA 4K3CA 3HLKA 4CUKA 4OI0A 4X44A 3U49A 3AECB 3DHBA 5AWFC 4YSZB 3PEFA 1KOGA 4U5QA 5LYJF 1GDTA 1GIAA 3OURA 1TE2A 1WHSB 3GRFA 2QRGA 4JXJA 5JHAA 2DUWA 1SK9A 1ECGA 3JAKA 1J5PA 4MR9A 1XPJA 3S6JA 3TXXA 2BC9A 3E9YA 4JCOA 3IAAA 1E2KA 3HEBA 2J6CA 2BGNA 2HC9A 4GWKA 4IQGA 3BGOS 3A31A 4QZVA 4IH4A 2EJCA 3UPUA 5HIAA 4AJEA 3PREA 3V6CB 2QZ4A 2Z98A 2X0RA 2FY8A 2EJBA 2GFJA 2J9FA 3TTYA 1YD8U 1EM6A 5F2NA 5AYVA 4H60A 1IULA 4JI7B 4IWNA 2XA2A 1U2PA 1R2QA 3NFRA 1KAQA 3V00A 1VE5A 1RFLA 3AETB 2FF7A 1ULZA 2WUDA 3H7SA 4PTZA 1QNFA 1USUA 3L16A 1VG0B 2VYQA 2YWJA 4OZAA 1LLCA 2I9KA 1P74A 3A3OA 1TX4B 5TC4A 4IM7A 5LYYA 1ZSYA 4G0MA 4IJQA 2XNHA 1SKAA 2V7PA 4HQRA 1DBQA 4UAGA 1WLYA 3AVWA 2ZRNA 3IURA 1B42A 3WLAA 3OE7A 3T3EA 5JMOA 1AX9A 3CRMA 2HSGA 1JJTA 3B3FA 2JXTA 2Z8ZA 5CVUA 4Y1RB 1BXGA 4MEAA 4DXGA 2PR7A 3ZHQA 3CJRA 3C6BA 2PNJA 3PHCA 1BWRA 1E2BA 2B21A 1G19A 5EJ8A 1Y9JA 2IVZA 5C8VA 2FWJA 3K09A 5AJZA 5JPIA 1A9SA 5BN4A 2VP5A 5DGHA 3WR5A 5CA0A 4EZBA 4X66B 2WAXA 4HH0A 1SRQA 5CTAA 3Q88A 4BLQA 2WV9A 4QO7A 5FJIA 4M0DA 3VUXA 3E5NA 1E6EB 2Z5GA 1DJPA 1D1SA 5EKTA 3OZAA 1LDEA 1M8FA 3AR6A 3R5JA 2C7NB 2ID4A 3ITKA 2V6IA 1DV1A 2Y77A 2WXOA 3OOYA 3IT2A 3VV3A 3K73O 2E89A 2YWHA 3RT3B 3AP1A 4NZYA 1E1MA 2PGOA 3A9SA 3UI3A 1M33A 3I9V1 2D2VA 3E8SA 3M4YA 2NTJA 2ZBVA 5KYYB 2BMVA 1U4AA 3UIPB 2J3EA 1T24A 2LBPA 4KLCA 5GINE 1U9IC 3TFQA 2BIBA 4Q19A 2REXA 3SDLC 3WJAA 3ROMA 5JSKA 4YUAA 1GDDA 1CIJA 1Z0DA 2ZDQA 1IRXA 4V0OA 3T1TA 4AURA 3OZIA 3A3KA 2M6LA 1VPLA 3NV7A 1YF3A 2AFVA 1X7XA 4RCYA 1ILWA 2IYFA 4KVZA 1TMYA 1T9BA 3B6IA 4KAJA 4JL6A 4TVKA 5AOVA 2FLVA 2XMGA 4ZVPA 5K0FA 5T8KC 1T2FA 2BP7B 3NG1A 3CSUA 1QDUA 3I9JA 1SHJA 4H3SA 4D7AA 2V4UA 4A26A 2FR0A 1DIGA 1DVRA 1CW2B 2DFVA 2QZSA 4DWFA 1UZXB 2PZEA 3IPYA 4C7XA 2DHRA 1NXOA 4BO3A 3O26A 1RZVA 1N2SA 4HGYA 3DFIA 3FXAA 3EXG2 2UUAB 1UP7A 4GOMD 2MCFA 2EZUA 5EQTA 4RDHA 3PSAA 5TMBA 3CW8X 3MJRA 4NI5A 5SY6A 1WMHB 1MIHA 2B99A 3RV4A 1NR1A 1R8XA 3D8NA 1YS4A 4TS9A 5JLAA 4XZ3A 1XZAA 2OCDA 3KJNA 3RIXA 2P41A 2V65A 3BM5A 1XX6A 1P9RA 1RDFA 2JIOA 2O2SA 1QO0D 1T8RA 1OIWA 3M5PA 3W1VA 1V1RA 4Z53A 3UNXA 3QIJA 1VRCA 4YJGA 2ZITA 3WK5A 3BYZA 5B5SA 2SCUA 2WXIA 3EIWA 5PNTA 5K6TA 2V7QD 5DYYA 121PA 1I4GA 4CYEA 3LGSA 4LGCA 4BBAA 1ZNZA 2FWIA 3SF8A 1KERA 4QSMA 5F1OA 1ULSA 1M10A 1XTTA 3M2PA 1GVNB 1AQNA 4ZKEA 4KR0A 1BMFD 3SLGA 2JHAA 2YIVX 5DHSA 3TW8A 1UP4A 3DBRA 1V26A 1P1CA 2JIRA 1YKFA 4X6LA 4KXXA 4NNPA 4K5QA 3R7SA 3Q41A 1E9VA 1YACA 2VZKD 2X5JO 5JSFA 5JCJA 5CHEA 1OI3A 4B5KA 3B1VA 3G7NA 3MTGA 4XJXA 4NARA 2D06A 3W7VA 4CMCA 1OWOA 3K0HA 4XUCA 4I3FA 1G42A 3TS1A 4KGVA 2INGX 2XTAA 3FY4A 4NEHB 3I63C 2HV8A 4H1VA 4E5YA 5FL3A 2PKWA 1STEA 3QKSA 1NVGA 2RDBC 5FV7A 4KCGA 2Y27A 4ZEWA 1GU7A 4MVJP 2AIRA 3GJ0A 1JS1X 2XEWA 4ZYNA 1J0DA 3M89A 3QV1A 4H16A 1J2YA 2VT3A 2V5AA 1B1CA 4XYGA 2C5AA 3BK1A 2MINB 4MQ5A 4I55F 3WAMA 4DCGA 5ADHA 3FVWA 3U7IA 1C7IA 2WOJA 4CR8A 2ANBA 5FIUA 3M3PA 4LHYA 2QD1A 4NNJB 1V96A 5BSMA 2QMZA 2KQUA 3T1NA 4KIJA 4TV9F 4BP1A 1V3UA 2BR3A 2Y5CA 4PHHA 1A9XA 4G81A 1VMAA 1W47A 3HBJA 3RT9A 2JI6A 4ZI7B 4G8JA 1G17A 3LBHA 1UT6A 4C4YA 1OB2A 1BKYA 4I2NA 4RSHA 1VB3A 4O2BB 5BNIA 3GMIA 3KTFA 3DAHA 4D8YA 4I46A 4P22A 2B3DA 4CHTA 2ZIEA 1RAFA 2ZXEA 2FV8A 3NTQA 4FGUA 5KI6A 2F3RA 5DX1A 4BFRA 2O0KA 5ALVA 1P1JA 4FNGA 1FMTA 3IMGA 1HDOA 3FOEC 4UVIA 3ZR4B 1HPLA 1ZK2A 5A7GA 3QBVA 2WTXA 3KRTA 3M3HA 5F7OA 3KT3A 4DT1B 2E48A 2QMQA 4FSXA 1R3DA 3WP1B 5IVDA 1OASA 1N77A 4EVQA 1NVTA 1SKYE 1NX6A 5DOVA 3HV2A 5GP1A 4P1ZA 4H7PA 3S3TA 1A8IA 3K0BA 3WTCA 5KHAA 3NXKA 2C0PA 4M02A 1WX7A 3B2NA 2GERA 2Q3BA 1H23A 1XK7A 1HDEA 2IU3A 3QVTA 3E48A 5AT1A 4E4YA 5JNWA 5LZ5A 3X1KA 4FN5A 1XTKA 4DMCA 3QVJA 3JW8A 5F2OA 1E3MA 1W30A 1YBHA 4O4JF 2QRHA 4CO7A 2YR0A 2IODA 4XE0A 5SICE 2C61A 3T7SA 2X0EA 4NBVA 3GLFA 1FS5A 4YTEA 3LTEA 3UY4A 3U7GA 4LE2A 2R2AA 2MW5A 1FNUA 3ZGXA 3GBSA 1XZBA 4Y2XA 2X77A 1TPZA 3GPLA 2GK6A 1QB7A 1Z56C 1KI9A 4IGKA 2G04A 1ZOIA 4MB6A 4GC9A 4Z4IA 1T1EA 1O0BA 5BNFA 3IEPA 1JQBA 5KYUA 1F4VA 2GN8A 4IGFA 3Q2IA 2PX5A 1CT9A 2IWHA 4RKRA 4FVTA 4FCWA 3ORQA 3OICA 1U7HA 4EG5A 4UFNA 5J9FA 1DWPA 5AJLA 2V5VA 1OAOA 1AHPA 5JC8A 4X00A 4M8NE 3GVHA 1KYTA 1O95A 1HDZA 1STOA 1LV7A 1H8HA 1TK9A 1D4ZA 1SCIA 3H04A 2R3SA 1PG5A 4AF7A 2B4AA 2Z2XA 3FF1A 1YVEI 4MKRA 2GJ9A 2GPYA 1UJMA 2WHYA 1I3OA 3QARA 1Q83A 1Q3KA 1JHDA 1RKXA 2IGTA 3OIYA 1OLUB 1MX3A 1P61B 3NDPA 4NYJQ 3ZVKA 4P4GA 4C1BA 3VDQA 1ZKHA 2X58A 4S04A 1N5RA 5D2CA 3UICA 3EPJA 5KSOA 1N2CE 5IK2D 1UBHS 2YOHA 1TL7C 4C05A 3OUZA 3N0VA 2CNKA 1JSRA 1WW3A 2UVPB 4QPJC 3IVMA 4FONA 4QUJA 3KOYA 3RCBA 3JWIA 4WA7A 4AKGA 4Q6WA 5DCLA 2FN7A 2O2CA 2ZTSA 3C3MA 4JSYA 2PMWB 3NY5A 4YP1A 3ENNA 3FI9A 2ROQA 5HS6A 3N07A 2GYVA 2N9UA 2ZTUA 4FIZA 2VYVA 3FE2A 4GMKA 6Q21A 3BB1A 4PHGA 3QLEA 4JB3A 2QD5A 1TS4A 4ZAGA 5FOVA 1G2IA 1YB4A 3K72B 4G09A 4C14A 3EB9A 1I35A 3LQKA 4LYHA 3KUDB 1P7VA 3NT4A 3GWZA 2OXEA 3L54A 4FFDA 1Y63A 4HN2A 2XKAA 1F2TA 3RHFA 1WD5A 2NUPB 4U4LA 1X7WB 4AT1A 2IY7A 4R1MA 3VYWA 4N3GA 3ZW7A 3UAWA 2ZS9A 2KK8A 4D79A 3W5DA 2B25A 3A10A 3MHPA 2WHQA 3GJZA 3GU3A 2XB9A 3QLJA 2V7XA 1ISJA 3WGMA 1RYNA 2OZVA 1FNCA 1MAUA 4KNWA 4M46A 1OWPA 1N34B 2FX2A 1T3LA 2JPHA 2IGGA 2JBWA 1QOFA 2ZUDA 2K8CA 2YXEA 2J6HA 4TTPA 1Z35A 5BW8A 1J0XO 4CQNA 1G21A 5CAEB 4JJIA 4D96A 1C30A 1SQSA 2O3JA 4HXYA 721PA 2ZREA 4LJ9A 5A23A 3TBLD 5GM2A 2Z5LA 2V6FA 2WD9A 2Q1UA 1XTPA 3CX4A 4H1HA 1L5PA 1COWD 3PEVA 3FUWA 3RSLA 1BEEA 3JYUA 3AH8A 4WNYA 2YV1A 3COJA 3EXFB 4II2B 4RJLA 4LNNA 4MUBA 1N36B 2P7IA 1A5SB 3R3SA 5T5QA 1WRIA 2A5FA 1DPFA 2ZS7A 5C3JB 4PR3A 3BXOA 3LZCA 2WP9B 4WX2B 2A5GA 2ZBUA 3WICA 1BVHA 4FR5A 1Z0AA 4RXUA 3ZNQA 1UADA 3KQ4A 2M4NA 4RMGA 2GO1A 1VL2A 3P4UA 3V1NA 4EX7A 2X0KA 4NYIQ 1TMGE 4LY0A 4HGNA 1ACLA 1QU2A 2WAOA 5ABPA 2AJLI 3URYA 1J7JA 2Z1MA 4C6SA 5LXIB 3ELYA 3JVVA 5ALMA 3VSAA 1D0IA 1M9NA 5B7PA 1EVKA 4BGDA 1WKBA 5EIHA 4ND4A 1NW8A 2B1GA 4I5FA 1J19A 1R10A 1CC1S 1E5WA 1H2XA 4KR7A 1KJIA 2C4KA 4L6IA 3J7AC 2CVQA 3ZDQA 3QMWA 5EHIA 2FHPA 2VNKA 1C1YB 2DWUA 4RJIA 4TKZA 5K3BA 3ZCRA 2WI8A 2AI3A 3I52A 2PYZA 3ZWXA 3CINA 1F0PA 2Y67A 4HDOA 2HRCA 1KQGA 2EZ9A 3E3LA 3SN6A 1EU3A 1O3YA 1GPLA 4REOA 2XXAB 5E1DA 4ZD6A 2X22A 2QN1A 1Y8QA 5K6RA 4AWJA 2VDMB 4ANUA 4KACA 1SCUB 5TF4A 2W00A 4HPLB 1J6UA 4P80A 2C5LC 1FDTA 2WZCA 5K0SA 2O05A 5BWMA 5IMBA 4E2WA 1NVBA 5BYKA 5HKAA 1ZGZA 1DKLA 2VZEA 4XVRA 1C4CA 3UJCA 1E2PA 1HA5A 4PEVA 3UVEA 1OI2A 4P2BA 3H5VA 4M7OA 4A5SA 1Y1PA 3MWEB 3UAVA 3ZHRA 4HDCA 1I14A 1BC2A 4B48A 2C78A 3EIFA 4DREA 2WHPA 3FETA 3RUDA 3VYUB 1NY6A 3U5TA 3WK7A 4CKWB 5DHQA 1R0ZA 3UKOA 4D2KA 4ER6A 3FNIA 3E5MA 2H88B 4WY5A 3VC3A 5JCOC 4KX6B 3S4YA 4RH0A 2WT9A 2BVCA 2E4ZA 2N3ZA 4UEOA 5LA6F 5AHWA 3HUIA 4YAOA 5D84A 1NW3A 3M4ZA 3E1GA 4DJEC 3IPCA 2ZU0C 4FDAA 4NV1A 4PPNA 4XVUA 5KKCA 1V2GA 2Q5IA 1E1NA 4UE3S 4UBQA 2NIPA 3W5CA 4TPKA 3QMPA 5BN5A 1MNQA 5EQDA 3W0LB 1NW5A 5TF0A 4ZOBA 4LVCA 5A3VA 3RF6A 2O59A 4BMSA 2BJHA 3H9DA 1NGSA 1OA1A 1S8AA 4NPCA 5ALSA 2ZYWX 2I7XA 3THYA 3U2QA 4CF3A 3A4IA 2I3GA 4B4DA 4HWPA 4PY2A 5AESA 4PC7A 3BULA 4PS7A 2B4TO 2CLFB 4NMXB 3PNBA 3OMXA 5EWJA 4JVSB 2CKDA 2GMWA 4O1MA 4PO1A 3E9RA 4EW2A 4U7JA 4EYSA 2WYVA 6CHYA 4P1BC 1GPWB 4CGZA 2E85A 2P2YA 4WBXC 2XDQB 4MLZA 1XCGB 4I81A 5C8YF 2JFYA 3RTAA 3FSEA 2PKCA 4D8VA 2PGIA 2V98A 4F9TA 2RAPA 3H2GA 1UMCA 2OAP1 1V5EA 1ECLA 3ZDAA 3HXPA 2SICE 4MSUA 1RAXA 1E0KA 5L95C 4X1YA 2IQ5A 1L7NA 1YN4A 4WBNA 1P4JA 1H5UA 1V7CA 4JB2A 4YCSA 1Y37A 3P4YA 1EFKA 3EZ7A 1EFRA 3W3ZB 4KFSA 1TYZA 4GDLA 1A8QA 2ZSFA 1XVIA 3IBEA 2Z3WA 4XUEA 4G0NA 2WHEA 4EEZA 4TS1A 1RLTA 3KJGA 3AV3A 3GAFA 1XCMA 4PVOA 2JFBA 3U7JA 5KJFA 4BV8A 4L8WB 1NYTA 1Z39A 5JSZB 4ZYXA 2R6AA 3RPCA 3SFPA 3EFOA 5IJ9A 5JADA 4PLFA 4NU6A 4OU4A 3OTQA 4HF7A 3I64A 1MNAA 2E9SA 3EIHA 4B3XA 3V55A 4BO7A 2HLHA 2C8VA 5AUNB 2O4CA 4A8PA 1RHQA 5CHVC 2LV8A 4FILA 2OAQ1 3LCMA 4FEGA 2L05A 1TM7E 3KKQA 5E8RA 2LUOA 1T3QA 4FLEA 4GDMA 1V3QE 3KLSX 1VD2A 4UZFA 2P4SA 1QRRA 1SB8A 2FR1A 3OI7A 4DLTA 1DAFA 4IQ4A 2FZVA 4C5AA 5AKXA 2ZJYA 3AY3A 1T0BA 3ZS9A 3SR6A 5KCZA 4FD2A 1MEEA 3PX2A 4XWKA 2WSYB 5BYAA 2FPGA 2WM8A 4ZI3A 4YY3B 4IL5A 4JXXA 1F1JA 3MMNA 5AVSA 4JQCA 5CX4A 1V9CA 4MNTA 1AB6A 3EUB2 4CQLB 1T4GA 2DPXA 3CCFA 2KDIA 2A5YB 2SEBD 1T6XA 1KNXA 3KR9A 3BXFA 3S2SA 1NBMA 2ODNA 4YUWA 2P91A 1UNSA 3ZV6A 3VNUA 1CCWA 4LC1A 1J0GA 4RNCA 2HREA 4FJZA 2QE6A 1GTG1 1DKOA 1K5HA 4KK4A 1H3NA 1UC8A 5I9LA 1XNHA 4J03A 2UZ1A 3EG5A 1EWTA 3HKBA 2JATA 2IP1A 4BPBA 5K8TA 4WKNA 3A9TA 4MCHA 1PEKE 3L7DA 4JBLA 4JT9A 1ZUHA 1V25A 2N9EB 1PLJA 3IEUA 2VSQA 2GM5A 4GC5A 4IWQA 4GWGA 4JHLA 1DBWA 3VBEA 3CUTA 2R4TA 2ODBA 1QG2A 3SW3A 1FBNA 3DMFA 4IOIE 4LYGA 4OB6A 1QQ7A 3TWOA 1XK6A 1X2EA 4LKRA 3FTNA 2DECA 2C7VA 1IY0A 5DJ5A 1L3BA 2C7GA 3AUJB 3OAAA 2QRMA 3SYMA 5LQAA 2W71A 3JAWA 2C7RA 3AEKB 3PIDA 1W8IA 2HHJA 4XIGS 3CS3A 2PEZA 3CF6E 5AEBA 3JALB 1GKIA 4HP8A 3SEFA 5G0WA 1RWPA 3CQ9A 1W73A 1AGNA 1W581 3PQ8A 4MDHA 2WU2B 2WEKA 2QXTA 5KAPA 3SC3A 4CMIB 1TQHA 5DO9A 1SB3C 2H11A 4RFVA 5AHKA 2VXYA 2QY9A 2C5EA 5CK4A 2QT1A 1EINA 1NVID 3ESZA 5ICGA 3M4JA 2WKSA 4NNOA 4JYMA 2H4JA 4A0SA 2CBNA 5TVGA 1DSSG 3EVFA 5ACXA 1HR0B 4DDGD 4QX6A 4TLEA 3VBCA 4Y7DA 1UJ2A 4AIIA 1UJBA 3UM9A 2CEKA 1TQ6A 2Q1TA 3PTFC 2WS3B 4US9A 2GYYA 4YT0B 2O23A 4NC9A 2EZ4A 3FMIA 4IIUA 1GPAA 3NZ3A 2QN6A 3ORYA 4ROTA 2B69A 1XQYA 2H1WA 2WIAA 4QFMA 3ZVLA 1F5NA 5LDHA 1YTLA 2D3WA 2RK4A 3JAMA 2EBUA 3V1TC 5MN6A 5DNYB 3PO0A 1PJZA 5KJ1A 4ZJPA 5IC5A 1JIQA 4TYWA 4CHLA 3ND5A 5AKJA 2D3BA 1FVXA 2I03A 4MEJA 4JVMA 1EVIA 4X94A 3FUUA 5KHLB 1CRQA 3BF8A 3FWPA 1Q2UA 3OP1A 2HU5A 1GQRA 2QF7A 3A1VA 2GX6A 3RRYA 5EJ5A 4L8YA 4E7PA 1ZD2P 4ICIA 1D07A 2IY8A 1OFUA 2V03A 2L17A 5B2ZA 2BKLA 2GD2A 1NW4A 4DLPA 3UHAA 1TVKA 1XDGA 4NJEB 4U7PB 1GNLA 3OM8A 5FD8A 5CHFA 1BHQ1 1L5QA 3GJRA 2QINA 2ALJA 3LHKA 4X71A 2IRWA 1TFRA 3ZLZA 3K94A 4V03A 1CR6A 1I4QA 2PBZA 5FBZA 1EGQA 4K6OA 2AIOA 2CKHB 1E1DA 1LFDA 3DEKA 1SXJD 4PVCA 4LIPD 4S1VA 1X38A 3DYIA 3PUIA 3H75A 3TLGB 4ZRPA 2QX7A 4GOJA 3KUCB 4OUKX 3VH1A 2LE0A 5KQGA 1U90A 4A6DA 4ZRJA 1IB0A 4PZ0A 5AVKA 2W6JA 4ALLA 5DLDA 3H3JA 4ZARA 2C07A 1B2RA 3L08A 4UMFA 5AKIA 4CR6A 1HG0A 4MROA 3HQ4O 3U7EB 5ALXA 1T8PA 1EU4A 4J2OA 4HG2A 4FC6A 1WXAA 3DCNA 3EGCA 1WSBA 4XGQA 5DTJA 3RBZA 3PE4A 3L6DA 2ZETA 1XZHA 1CUWA 1D1PA 1K0FA 5G1OA 5EVKA 4XDZA 4CEIA 2E3JA 4J6IA 1T9AA 1Z12A 2A59A 4X62B 1MB2A 5CD1A 2G5GX 1SPBS 3CE9A 4PTLA 2O5CA 5TVKA 5BRJA 1NIJA 1XLNA 3LHSA 4GBJA 2JRLA 4NAVA 4W5WA 4YT8A 3C3JA 2HBQA 2C2BA 2BI8A 3UQAA 1M2OA 4XX1A 3RVNA 4BMOB 3BIOA 5EIAA 3HEMA 2CCGA 4P7GA 1EFTA 4H0FA 7AT1A 3VPBA 2B8WA 4XVCA 4XOIA 3ZQUA 4LHEA 3GLHB 1C78A 2QLLA 3QNMA 2AG6A 4AJ1A 3F5FA 3VUWA 3ADBA 3CWIA 3NOBA 1R5BA 8MHTA 5KNDD 5AM3A 5HRCA 4YWHA 4IJVA 4OHOA 2J3JA 3OEED 3MYRA 4DB4A 3EC8A 1VLBA 2FU6A 2XKBA 1U02A 2BEJA 2C4MA 1FJGB 2WNMA 2ZU6A 1DU4A 1WJUA 5HQ3B 4PNZA 1WP9A 3L8FA 4JFRA 5CT8A 4QTXA 2ZAMA 1Z6QA 3JQFC 4M54A 2VQEB 4UUAA 1E4EB 5UKDA 1BYIA 2HMWA 4UWRB 4PLWA 1AKUA 3ZY4A 4A15A 4N3BA 1FPMA 5H8WA 3F8TA 3HYCA 4IHAA 2IUFA 4KKXB 3PYMA 4BFCA 4QO8A 4DA9A 4Z3KA 3W8DA 2WQZA 1DFHA 5CHYA 4X8HA 1H6DA 3T7CA 2QTAA 2O2VB 4RK1A 3Q3JA 2O0MA 4AMVA 3ODPA 2ADFA 4RHFA 2MWSB 1V11A 4WWPA 2EATA 3L3BA 2R6FA 3V4LA 1KYQA 5BRNA 2WWRA 3H5RA 3QOXA 1O97C 2ZB2A 4R1LA 2EMTA 2XNSA 1Y7TA 5DLQC 2ZYGA 3OWXA 4K9PA 5IUJC 2YMMA 5KX5F 4OEHA 2PVPA 4IIJA 2IKQA 1DBPA 3CUUA 2OSBA 1MGPA 2V5UA 1GU1A 2D1TA 1DOHA 1II0A 1Y4AE 5DPMA 2L0XA 2MHCA 4NYMR 1VYVA 4EB6A 2EP7A 3RM3A 1EWKA 3ZCQA 4U9HS 1UBNA 1SOWA 4PTYA 5FWYB 3WYNA 3T7AA 5ERXA 2ZUCA 3CLRD 2PVSA 1W19A 3HR7A 4HL1A 3SXUB 4XDDA 2KLBA 3NBAA 2RAFA 4PIMA 4XQGA 4UE2A 2EIXA 2HDOA 3FOBA 3E0QA 3TVYA 3GLIB 4D98A 3DONA 2X5XA 5ED4A 3BWBA 1OTRB 1TJNA 2B76B 4JBHA 2OAEA 2R79A 3RG8A 3LKDA 4I1IA 2CUKA 1IPFA 2J0QA 4I5IA 2AK2A 421PA 4C3ZA 2BGRA 1P1AA 3BCSA 2O8FA 5FBRB 2M0AA 1RBYA 1WNTA 3VI4B 1PJSA 4XPIA 1BKDR 1WB9A 2DB3A 4TT8A 1VMEA 4UJ3A 3PDUA 4O4LA 1J7CA 3VJMA 4BWFB 2QR3A 4EPTA 5CCBA 4MP6A 1X1AA 1R9GA 3B6MA 1JDSA 1OYOA 3BWUD 1ESEA 4BB6A 3IAM6 1CE8A 2VT7A 4LE0A 4RA9A 2O2HA 3CT6A 2HQSA 4EY2A 1JDTA 4OREX 1ZOPA 4Q7MB 1HZZA 1RJGA 3CWCA 4O6VA 3T34A 2NXJA 4DBGA 5HTKA 1FW6A 1WIAA 3TEXA 3DE2X 1GGEA 2BTQB 4RGMA 1JWLA 2IXBA 3K96A 2DYMA 4CETA 2CXSA 3QYFA 5KYWB 1OKKD 3C1OA 5EMLA 3E3AA 1D5WA 3HADA 4RULA 2OO7A 1QVVA 1DGJA 3QPBA 4PSAA 3NZSA 3NMUF 2WF7A 4NDZA 1JIVA 2PFSA 3D81A 3UXEA 3LY7A 2D7JA 3AERA 4B76A 2WUVA 3FB4A 1KI3A 4WWHA 2AQ3B 2EKDA 3PFBA 3QBTA 1BMQA 1UDRA 3N2NA 4QGSA 2P3SA 3H0CA 3UAYA 4MUXA 1B8UA 4WIAA 4EHAA 5FA6A 2ZO4A 4CMAA 1H2EA 1M8JA 1SQGA 4AJ4A 5D6JB 1RYJA 1XKTA 5KZMB 1O89A 1SUPA 5TGDA 2XB2A 3X0WA 2NOAA 3M6WA 3KZOA 1EFVB 4RYLA 1TS2A 2LVOA 4NMLA 1MF7A 4B44A 4I1PA 2IEYA 4QYTA 1RAAA 5FQCA 1HSOA 4G37A 2YHEA 5GONF 3NUHB 3MTJA 4POOA 3JSVA 4OVUA 1K9SA 3PC4A 5BMIA 1RABA 3OT1A 5HH5A 4I66A 3QFTA 4GDFA 3IQEA 1WMFA 1GTRA 1JB9A 2YRWA 4GPIB 1XN4A 5D7NA 3TB6A 3GJYA 1NQUA 1WCYA 5TS3A 1V3VA 3DZHA 3M33A 2FJ0A 2KX7A 3I8SA 4MGIE 2A7MA 4H1WA 3U7QB 2CBZA 5LQMA 3TIXA 4KPUB 4R8MA 1DADA 2ZWRA 1BCRB 2B4YA 1KZ4A 1FYVA 4G0UA 5JDCA 4H08A 1E3WB 3L18A 5U4XA 2VI5A 3ZDFA 2VJPA 3Q7EA 1JLLB 3OE1A 2JHFA 3MC0B 2PKQP 4UEKA 4NCJA 3H9JA 4M1QA 3OPYA 3N8NA 3ESAA 4QUAA 5I3ZA 2J3IA 3NJTA 2FDCA 3CLHA 1AKMA 3UMRA 3L4JA 1E7SA 5J4YA 3QH4A 4RIIA 4B6JA 3N30A 4WY8A 1ZH0A 1T1SA 5I7FA 3ABZA 1T0IA 4IDEA 3UGBB 1ONOA 4RH1A 1Q0LA 5IUNC 3K7EA 1CHDA 3PRZA 2QUBA 3CKLA 3JD4A 1XZQA 4REQB 2F8TA 5BYQA 3GUUA 3KEMA 3MJSA 5BSEA 4UAJA 2WTUA 3C48A 2PD3A 4KQMA 4DLNA 4CXMA 4EUSA 3WL4A 4TROA 2GESA 1DE0A 2WFMA 2O8CA 4F7DA 3PRPB 1CJUC 4C0AC 3QHQA 5IJXA 4YALA 1C3JA 4PLZA 3VYTB 1NN3A 2X1MA 4N9QA 3UH1A 5DIFA 1FXSA 4MWCA 4NCHA 3CLUC 2XIJA 3F5DA 3NWJA 4I2VA 1QLJA 5DSTA 2PZMA 3ZC3A 2CK3D 1HKUA 3I32A 1BU8A 1D4FA 3GJTA 2GPJA 3G3EA 2ZRPA 2WE7A 1RM5A 5JDIC 4ZK6A 1SA0A 5J58A 2ZRLA 2OCPA 3OLYA 3RCZA 1RAEA 3OY7A 1QGZA 4MA4A 2G6TA 3OIUA 2GBRA 3C5HA 3KQLA 5FFMA 2OD9A 1WHTB 2MJDA 1YBFA 1O08A 2I1KA 4ZCIA 4RM5A 4GW3A 4JA2A 3CNLA 1K4KA 2DAFA 4UM7A 2FR8C 3UHJA 4RVUA 3D31A 5D87A 3MB8A 1YD7A 3WWYA 1JXOA 2NPOA 1NQAO 1WMSA 1Z6YA 4PYOA 4F4DA 4I1VA 4B84A 4MP8A 2ZPAA 2MCNB 1A4UA 1KJNA 3L6UA 1IHUA 3NEYA 3QXCA 1VYHA 1TQ4A 2P78A 3B85A 1KI4A 1DEHA 4S1TA 3ANLA 3EAFA 1V5IA 4RVNA 1V1MA 3REQA 4ZEVA 2OGZA 3MJFA 4D74A 3G9TA 3ZD9A 1P9DU 4CUJA 4HB2A 1GZVA 3GAMA 4YB8A 1RE0A 1N6OA 4OBWA 4WZBB 3UK6A 3GJ8A 4BV9A 1DAKA 5AI4A 1WCIA 4IWPA 4YQFA 3RRXA 4GU5A 3RQSA 1I4OA 2NNWB 4UHEA 3JYOA 1NPYA 4HX9A 3REOA 4U0KA 1XVUA 4KUHA 1QH5A 3I53A 3ELDA 1VA4A 1N63A 1EFHA 3KHUA 1JBEA 4IV8A 5G55A 3EY9A 5CNIA 4L5IA 1VP9A 1VSVA 3I34X 3DBRI 2PO5A 2F9FA 3SQWA 1D4BA 2Y3IA 4JODA 1XJ5A 4XQEA 4YUYA 4NTZA 1X9HA 1KI7A 3SQXA 1ZHOA 3ZV5A 5BMVB 3ANXA 1V49A 5EHNA 5EJGA 3SOPA 1E8WA 1PKXA 1MXFA 2P2SA 4QQKA 4KIFA 3MF4A 2NT3A 3IP5A 1XKQA 2HFKA 1XTUA 1GJRA 4OATA 2C29D 3VH2A 2KOXA 5J4HA 4RADA 3LXMA 3OCWA 4MGYR 2PR2A 1RPNA 3MJVA 2DR2A 4US2R 5IWAB 4ADSG 2QORA 3SKYA 5THKA 4DK5A 4I14A 4RAQA 5TQ0A 4C08A 4Z4QA 4FZJA 5ED0A 3D8HA 4NQ5A 5KQMA 1YJIA 4KVFA 4J0HA 3EVZA 4OXXA 2XBLA 5JXGA 3H2JA 4RTMA 3O4GA 2VH5R 3ND7A 4MELA 2FQYA 2X86A 2DLBA 4EY7A 4FE3A 4MEMA 5E9WA 3R2UA 1JSCA 5LB4A 2QLMA 5H8YE 1JIXA 2JFQA 3QXXA 4DUGA 4YUZA 1N7JA 5K99A 4LDTB 3ZG6A 2V9PA 2MSED 1CZOA 3VVWB 1KFJB 4F72A 3T9AA 2DJIA 4WZAA 3QX7A 3ZCVA 4D9HA 3THSA 1NULA 3TR6A 5FAXA 1E2JA 3IOEA 4M00A 3W5JA 5JS8A 1NPDA 2WIFA 1PR1A 3EVGA 1R12A 2GFQA 5EW0A 1OPXA 1P0RA 4F5YA 3DOHA 5E6UB 4OBEA 4YP0A 1XTJA 4BHTA 4HAIA 4BKUA 3CEJA 3GT3A 3HSYA 3DAPA 3NCTA 5C1OA 2W3RA 4MS1B 3A2LA 1UELA 5F9MA 1OFFA 2G6BA 2G9UA 1V81A 2RR9A 2GF2A 5EMMA 5KNLA 4NBLA 3UHFA 4ZZ2A 4DLVA 4JC0A 2C7HA 1JKJB 1J5EB 3UUGA 3BMCA 1W0JA 1U8TA 4PSDA 2FDXA 2CFUA 1AKTA 3B08A 1M5UA 1GCAA 4JE3B 3L0WB 3KDPA 5IF3A 4JJEA 4IIGA 1E10A 3O8LA 2JANA 2TSYB 1ECBA 1G8KA 1BOOA 2UU9B 4R81A 3MBOA 2Q7XA 3L06A 4YIHA 3NKFA 5I5GA 5E3JA 4C7BA 1Y80A 5HIJA 4NRDA 5KVQA 4JJAA 1GNQA 2A1UA 1E2GA 1JBKA 4XYLA 2VDLB 2RHJA 3QFRA 1ZEMA 2YDXA 3G59A 4IUDS 1BNCA 1W4LA 4ZYYA 4CIBA 5L9AA 4WIPA 1E3DA 4HDRA 4GBED 1I4LD 1DLIA 5FX2A 2B6NA 2FZ5A 3DVGY 1V6EA 3MCAA 3N28A 4LRUA 4LCEA 5AXOA 4EGQA 1E2HA 2GKSA 3HPQA 3K1JA 3FYUC 3NIWA 3FNRA 1C5KA 3AMZA 2EFYA 1VL5A 3RYHA 4CF6A 3BVMA 4KZCA 1DPGA 1EAYA 3S7ZA 4DCTA 2YV3A 3VJRA 3IUYA 3R3ZA 1FOEB 3KYCD 3PSEB 3H7PB 1UEJA 3PT5A 4RZ3A 3LX6A 4M0WA 3NX4A 1E58A 3LBNA 3D2LA 1C2YA 3P94A 1PI3A 3AESA 3EWAA 4LDZA 1JDPA 2AQ1B 2I2CA 3HZZA 4O2BF 2Y1FA 1QK5A 3EN0A 1VPEA 4AL4A 5C9ZA 3ILSA 1WZ0A 4R3UC 3B51X 3DDOA 2GBLA 3BPSA 5ERGB 1Q5PA 2HXGA 3AUAA 2PSDA 2YHAA 1QXSA 1FFXB 2XITA 4DWOA 1YKGA 2D5LA 3CUVA 3PHHA 1L0XB 1HO3A 4JI4B 4LJAA 1FDUA 4BO8A 3RFCA 3R2IA 2QP4A 4AXBA 3SPXA 3CLKA 4DXHA 4FFBA 1L7AA 1SE4A 3GFBA 1ZRSA 1H6AA 3K9QO 5JROA 3WYAA 9ABPA 1P6UA 5EP3A 3W06A 3K32A 1Z7GA 1KR3A 4NXNB 1Z6PA 4YJ2A 5IP5A 1ID1A 2K3UA 1PFQA 3AOEA 4TX1A 2KYWA 1D2HA 1QHXA 2FMUA 3A4YA 4N8DA 2EV9A 2AFHE 1BXKA 4Q4JB 2J07A 4M55A 2EFCB 1INLA 4WD6A 4S0ZA 1ZIXA 1UAGA 2QILA 4AP4C 1QRSA 1SXIA 3UPDA 4R54A 4D3YA 3S81A 1JFRA 1ZZGA 3GUZA 1TTTA 3ZHCA 1HC7A 1ETHA 5DYIA 1DRJA 2H9AA 3GP7A 2VHTA 2FWPA 2R8RA 1PUTA 3GQBB 1GB1A 5TV2A 2WT8A 2AH5A 1KEEA 1AQYA 1OD6A 5JYDA 4MV9A 3R8BA 1S8FA 1JQ3A 4KK3A 1P9OA 1X80B 1W25A 3WMWA 1DI0A 1CR0A 4E32A 2F1HA 4I1UA 3D6VA 4QARA 3S1LA 3PEUA 3E84A 1X8JA 5SY4A 4DGQA 4FFLA 2NO4A 2WSLA 3ZUGA 4BFSA 1JR2A 1PRYA 3GLTA 3PF9A 5GAJA 3T9LA 1QFMA 3GHHA 5ELMA 2BLLA 1FDOA 5BW5A 1NMEA 4DMUB 1F77A 2E18A 4NENB 3PE3A 5KTTA 4LK2A 1C8BA 3JVUA 5LCHA 1OQQA 2QAGB 4EJMA 3BSFA 1KWKA 4G0QA 2HA2A 3MQ2A 5L7YA 1E77A 4XVQA 4CF7A 1LPOA 4WT7A 2NYAA 1KO8A 2GA9A 1HEZE 5AUOB 3AZQA 2ONCA 2FPMA 4TOIA 1I30A 1B6RA 4R01A 3PA8A 4LF4B 4MVXA 4MRVA 8ABPA 4UEQA 4CW7A 4D25A 4ZDKA 1SXQA 4H0NA 4GX0A 3ACBA 4INOA 1JLKA 1II8B 4M98A 4MKIA 3LLSA 3UCFA 3R3XA 2FPWA 3CUYA 4QWWA 1R4NA 2XGOA 1YL6A 3I37X 5LVAA 4AY6A 3FWNA 1ZL0A 3MFYA 4O2AF 4Q39A 3ZHVA 2XTZA 3ABRB 4XPZA 2DE0X 4MQLA 4YHHB 1H1LA 1WUHS 3RSCA 3LF1A 4WLUA 5EUBA 5CT9A 4IIYA 2QRUA 4INAA 1D3AA 4J0QA 3FMFA 4Z0TA 3OQ6A 1HRKA 3KSDO 5HE8A 1DKUA 2OQIA 3MJ5A 1YZTA 3HABA 3WRWA 1NKSA 3M4NA 4Q3LA 1VYUA 4UVGA 1JQ4A 1JQ5A 2CXUA 1E9DA 1A5RA 1VLJA 4ZVQA 3G1TA 4Q4DA 3IILA 4P58A 2HHLA 2ZAOA 5D5PA 3RSQA 3BHNA 5BPFA 2GI4A 5DT2A 4O8ZA 4ERNA 4U7GA 1R74A 3TRFA 2YH2A 4HGZA 4MS3B 1B0UA 3UB3A 3PKZA 4P3YA 2JGMA 1UPAA 1WV0A 3DE7X 1IXRC 4GT1A 3GRUA 3WO0A 4EEKA 3TUIC 1WH3A 1D2GA 1ISHA 2J4DA 2LXAA 2ZANA 1I1OA 1KZYC 3CZPA 2PKXA 2J45A 3F49S 3FUXA 5BSGA 3FHTA 5ENZA 1VM6A 3OIGA 1XVAA 2EAUA 2HDNB 4FR7A 2ZUWA 3ZXRA 4FADA 3WNCA 3CM0A 3MCWA 1QUEA 2YWDA 2A5DA 2AEFA 1O94C 4DMMA 3KSMA 5FUBA 2C2GA 4A1OA 1E2QA 1MT3A 4PWZA 1WBBA 4TKLA 1E8NA 1ISRA 4W9HA 1QVWA 5FORA 2R6GA 5EFOA 2H16A 2I6GA 2HRZA 1USWA 2KMLA 4GS5A 3IXLA 2ZTLA 2FW9A 4B3GA 1K6IA 4XZ4A 4M1YA 1CMXB 1HTBA 1NSTA 3KVYA 3DDSA 1WZCA 4OV6B 1EVLA 1U5BA 3RAGA 2VUIB 4MKHA 2GLUA 1C9JA 4D5EA 4KLZA 3UQZA 2V8BA 2KYRA 4Z4HA 3AY0A 5E7JA 1D2CA 3GLKA 4YC7A 2GRJA 1MJGA 2K6GA 3UBMA 5LP1A 3QTBA 1JHPA 5FBQB 3JXEA 3AU8A 3HNOA 4CVNA 1WUPA 3JQ7A 3U37A 3V80A 4L4XA 2HA7A 5DW0A 4LF6B 2LVBA 1T4CB 4PDXA 2REQA 1I2BA 5HIOA 5G4LA 1RWVA 3D3WA 1M67A 1YZFA 2D5CA 1FSGA 2AOWA 5HE9A 1WULS 1L5KA 2YV5A 3R5HA 4NAHA 2UUBB 4B4UA 3SR4A 3ER9A 3K2IA 2V59A 5DSZA 3QVLA 3F5QA 1XG5A 4TXLA 4ACBA 3LUFA 3ZY3A 2WAMA 4MVJG 1AK9A 3PRHA 4K28A 3T52A 2EEZA 3GPIA 3V60A 4G01B 3AE9B 2G09A 1Z15A 3OX3A 5B30A 1JR3D 3VPDA 7REQA 1Z0ZA 2ODQA 1GZ5A 1IQRA 1GPBA 4MVJE 1F5SA 2NMVA 1KF0A 1L5FA 3WXCA 1QYIA 2G63A 1WZIA 2EBFX 3BGDA 4F3KA 2RGXA 4XFDA 1M2GA 4R69A 3VC7A 3AUTA 3JZAA 2X23A 3AE1B 4ND3A 1FXUA 1BGXT 1Q11A 5FO0A 1NQVA 1N60A 1RFAA 1ISIA 3BRQA 1H0HA 3WXBA 2MEKA 2W2VA 1ZUWA 4QECA 3VPHA 2G80A 1PK8A 3IPLA 1R15A 4HAYA 1YU9A 2IDYA 1Z5VA 2X5KO 4MQFA 4Z1MD 3ER8A 1QGUA 1LF5A 1IZZA 3V46A 4F2DA 1Z8NA 2XGSA 3TX6A 3LXUX 5AP9A 2VKTA 2XI4A 4U8GA 1VE1A 4KFTA 1PJRA 3NEAA 2CVPA 4KTVE 5LDDC 1W52X 2VTKA 1FMAD 5IM4F 3VX4A 2AV6A 1UBKS 2UZ4A 4D9KA 1IBXA 2KVZA 2PZGA 4KTTE 1SUDA 3RANA 4OU5A 2POCA 1VDVA 3ZOKA 5EN4A 2JGRA 4BKSD 2ASEA 3SC2B 1HURA 2WU4A 3NAZA 4IH1A 4NULA 1KQ3A 1QF7A 1PEAA 3C5WP 4ZAXA 1IATA 1PWEA 3ESYA 2VH2A 2F55A 1N5IA 4CM9D 4EOGA 2HDEA 1OT3A 4Q1BA 4QVGA 1Q1QA 3PICA 1I8TA 3PPXA 1N5OX 3G9ZA 4P54A 3W8FA 2OZEA 2ECKA 3HL4A 4QDOA 3AR2A 3B5EA 3MPUA 3C6XA 3EQ7A 4JEMA 4A8JA 1PR4A 3RKJA 1K2VN 1YS6A 2OQVA 4WXEA 2QMEA 2B5OA 3COVA 2R61A 2AX5A 4N9F4 1TJYA 3K2EA 3EGVA 3QPUA 2Q5EA 2PN1A 4B6QA 5AJUA 4S35A 4F56A 3AKYA 1EU1A 2Z0EB 1K8XB 1AV6A 3PL1A 4OK6A 3NTUA 5TY0A 2BFEA 1TU0A 1OV6A 4ND6A 3AULA 2NQ8A 4LHWA 4ND5A 4KQWA 4ZAWA 4BKPA 1ZCAA 3GPDG 3H1PA 1LNSA 4ZK2A 4IDDA 3ILXA 1B74A 1IJKA 4A1FA 4AZ3B 5JJBA 5HDBB 2EFEB 2G1KA 1B8NA 4ED9A 3UFXA 2JLVA 2HSJA 4J49A 3V7YA 4L5AA 2R68A 2VYCA 3EOZA 3ZQ4A 5EH9A 1A9QA 4KO3S 3G02A 1IK4A 4QWMA 3A06A 4IVNA 1QQRA 3QVUA 4ZT3A 3R9KA 4WASA 4AWZA 4KZ0A 3OE7D 3C3CA 3K0CA 4FKMA 2R1ZA 3NHUA 3ROZA 3QU9A 1TGZB 2X15A 5TPZA 3VYRB 2I29A 4E1BA 3EEQA 4WI1A 2JL1A 4B4KA 5IN4A 4KPEC 3DYVA 5DYNA 1I6KA 2VDQB 1YX5B 2QM3A 4KSLC 3PXAA 3ZYZA 2Z2KA 2ZJAA 3KLMX 2XE6A 3IKJA 1UUPA 2FMTA 5FWNA 3LI2A 1I7QB 1AF7A 4YRTA 3H9GA 3IEIA 2AF3C 2XMZA 3RYIB 2BWFA 4CTKA 2CU3A 4N18A 4MS4A 3VDZA 4X61A 3LLUA 1NSYA 1U6JA 1VCBA 4MJSB 2DAJA 3M6AA 2J9ZB 2F8LA 2HRQA 4ZYVA 1TCCA 4M1TA 2R86A 5HF6A 3KQHA 4C2AA 5JMWA 1KSJA 3E22A 1P60A 4X92A 4B3RB 2NWQA 1KO7A 2YCBA 4YROA 3BRWA 1A71A 3D7LA 4HTFB 2PV7A 2Q4EA 1JHRA 4BNWA 4P9NA 5F73A 4CM4A 1WXMA 1Y3CE 1QHNA 4I4IA 1XCQL 1N6PA 3OCUA 3HI6A 3HYLA 2NZEA 4U7HA 2OBLA 4LE6A 1QMGA 3O94A 1PU2A 3P9QA 3CRRA 1N1DA 3ZJ5A 1PZNA 1C3OA 4ND2A 1DX6A 5DZSA 5IMSA 3DFMA 4OHKA 4US1R 2O1SA 1DWQA 1HYEA 1Y3FE 4AI6A 3HDQA 3HRIA 1G8MA 4N39A 5JNTA 4J4BA 4FGLA 3IBCA 3R66C 4G86A 3IRVA 4TM7A 2XQJA 1V47A 2Z8YM 2GCUA 4NQ6A 1XD3B 4JBWA 5AXBA 3QX9A 2IXFA 4C0QC 3I11A 2KDEB 2JW5A 5CURA 4UA4A 1P5ZB 2MDTA 4OFBA 3OLMD 1G20E 2AFRA 5J43A 4LNFA 4UAMA 2H7VA 3FYCA 1LS6A 4P3PA 3HBNA 5HBGA 3LY5A 2H29A 3RUCA 3NJRA 1JHVA 1I13A 3ZQKA 1WVMA 3PUXA 4IKEA 1JI0A 1VXRA 2EKIA 3A4SC 1DC5A 4KZKA 1OLSA 1NI4A 2X7HA 1BXRA 3I2JA 1V9SA 1VZ3A 1Z83A 2VXOA 4BTEA 2OEDA 4KQXA 1HE1C 8OHMA 4DPKA 1C8LA 5A1TA 1MC8A 4X3CA 1TS5A 1HTTA 4CKYA 3JQ8B 3AF4A 5LFAA 1QRTA 2QUHA 2AOTB 4Q7KA 2DPHA 3BFJA 1LLFA 1KQNA 3FNGA 2E55A 4B9EA 5CFMA 1Q7GA 4ETMA 1XA0A 2GLTA 5EVJA 2WSBA 5FI1B 3QXHA 1J39A 4AMBA 3R7BA 4WFJA 2RAVA 2I1WA 3DHEA 4S24A 4NQ4A 1Q0RA 2HX1A 5AW2A 4CM3A 4AJNA 3EC1A 3FPSA 2Q07A 1GY8A 5K3DA 4WLEA 1PYOA 1FXIA 5JW6A 1GUZA 3JARA 2NVUB 4A73A 2YS7A 3L1HA 1HE4A 3NVDA 4ZZ1A 2D6FA 1SG0A 5TB5A 3WX0A 4HPWA 2PT5A 4TZKA 1G6OA 2IZ7A 1T43A 2P3QA 3ZXIA 2OBXA 2OK8A 4KVGA 1RD4A 1MI0A 3HKEB 3LL7A 1G1AA 2DX5B 2PW9A 3BMOA 4CBVA 4EG8A 5EZSA 1B26A 3KUKA 5IOIA 3P20A 2VJLA 2I4TA 5C53B 1ABEA 4BEWA 2LUEA 4RTRA 4QOGA 2ZRBA 2OY0A 4ITVA 3P8ZA 1ZA1A 3C3DA 3WGGA 4RJJA 1RRPA 3OF5A 3L6OO 3SJ7A 4OIMA 1M4VA 4HV4A 2WSSD 1F8UA 2VHCA 4BMPB 2ZPNA 1S3FA 2J7QB 4R41A 1K8RB 5ISMA 3A4TA 2GYUA 2JFWA 4GX5A 2WX1A 2R1VA 2QRLA 4L8GA 1RLMA 1G0NA 2G70A 1X8HA 1PKEA 1TTQB 4Q7LA 3ZWNA 4JYBA 3JYHA 5IJAA 1VFNA 3FCUB 1N8NA 1G8HA 1BWQA 3EW7A 1VZ8A 2VNSA 2BEWB 3HCNA 4HQ0A 1C4PA 4RTQA 4X64B 1M34B 3OESA 1D4AA 1J21A 2BFWA 2HV9A 2Q7DA 3USZA 4RS4A 4KRGA 1C0EA 2EIHA 4L95C 2GNOA 3FTQA 4RD4A 2BGJA 3FCZA 1QIJA 4L4UA 1L8OA 3IXMA 1WY7A 3ECSA 4KMMA 4ARIA 4I7EA 4RE5A 2ZJ6A 3UV6A 1AC5A 2FHXA 1BS1A 4D4HA 5MDHA 4KNVA 3LXFA 1GUDA 1C77A 1ZCJA 5K0NA 3T7DA 3EWIA 3ZY5A 4PVDA 1RCTE 1IXSB 4DIUA 1B3RA 5MN5A 2QMHA 2JAQA 1OZ0A 4A3PA 5JPDA 1AA9A 4B3JA 4HS9A 1P1HA 4XDGA 4QQFA 3D3JA 3GYGA 3P9ZA 1K7FB 5T3UA 1IWPB 3AX6A 3H17A 1TYCA 2JLAA 4YBRA 4ACFA 2V9HA 4J1SA 4CG1A 1XDSA 4TKMA 4KN5A 4X8LA 3T9DA 1AO3A 3KLOA 4GRAA 2GQ0A 5FR3A 3IEMA 3QUTA 3QZUA 1BN7A 4GI3A 3C7CB 1WU8A 3JQGB 3QH8A 1TT5A 4DLKA 3FILA 4BN4A 4WHMA 3NBFA 4GMDA 1TC1A 2M5DA 1WX8A 1BFKA 2AX4A 3G8CA 4GGPA 4CU5A 1KSHA 3O91A 2PWPA 1V9JA 3WSVA 3RVDA 5I47A 4DR1B 1ZK4A 2QYHA 4USAA 5G2OA 1T9ZA 1BJTA 4B3MB 2JBAA 3CW2A 3EGIA 3MTIA 3MHSD 4X20A 3WNBA 1V7ZA 4K7UA 3P4XA 4R2HA 3F7TA 3M2TA 4N6OA 1DJLA 3FFTA 5THXA 5AW5A 3K92A 3C3AA 5ALWA 1R6UA 4N3CA 4RFLA 4K7JA 2GOWA 4DPLA 3QKRB 4E51A 3MWKA 2VF8A 2EGGA 3M49A 1GLGA 3VR6A 5J23A 3CBGA 1BW9A 4I50B 1O57A 2AI2A 5B6PA 1KNQA 1L7PA 4RKEA 2EBHX 2PZLA 3N76A 4IDQA 5ACUA 4O3FA 4HBZA 3HKCA 3H6NA 3ISVA 3CF4G 4AJWA 2ZRGA 1H9BA 3TQHA 5CDUA 1RJ9B 3AN1A 1XYGA 5NLLA 4OOFA 2F64A 2FUEA 4BNKA 5A4JA 1B73A 1Z13A 4IDGA 3N70A 4ZGGA 4I19A 2Q5JA 1KI1A 2B98A 2WIJA 2Y6UA 1T91A 3QJZA 2ZBGA 2AE1A 3EXAA 2NUBA 3V7NA 1B3BA 1O95D 3M6VA 4ZGBA 1H8HD 5JAZA 4HPJB 5EQFA 2C4WA 3KL4A 2NM0A 4LWOA 1JEDA 1C8KA 2KX0A 3FBTA 2VBCA 2P1EA 5FKAC 1OY1A 2F90A 4QNNA 3GN1A 4KX5A 3GJ7A 1E4OA 1E9CA 3GP8A 5CXUA 5K4GA 3R2JA 5A5GA