3BK2A

Crystal structure analysis of the rnase j/ump complex
Total Genus 168
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
168
sequence length
549
structure length
549
Chain Sequence
QDHVEIIPLGGMGEIGKNITVFRFRDEIFVLDGGLAFPEEGMPGVDLLIPRVDYLIEHRHKIKAWVLTHGHEDHIGGLPFLLPMIFGKESPVPIYGARLTLGLLRGKLEEFGLRPGAFNLKEISPDDRIQVGRYFTLDLFRMTHSIPDNSGVVIRTPIGTIVHTGDFKLDPTPIDGKVSHLAKVAQAGAEGVLLLIADATNAERPGYTPSEMEIAKELDRVIGRAPGRVFVTTFASHIHRIQSVIWAAEKYGRKVAMEGRSMLKFSRIALELGYLKVKDRLYTLEEVKDLPDHQVLILATGSQGQPMSVLHRLAFEGHAKMAIKPGDTVILSSSPIPGNEEAVNRVINRLYALGAYVLYPPTYKVHASGHASQEELKLILNLTTPRFFLPWHGEVRHQMNFKWLAESMSRPPEKTLIGENGAVYRLTRETFEKVGEVPHGVLYVDGLGVGDITEEILADRRHMAEEGLVVITALAGEDPVVEVVSRGFVKAGERLLGEVRRMALEALKNGVREKKPLERIRDDIYYPVKKFLKKATGRDPMILPVVIEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural insights into the dual activity of RNase J
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Hydrolase
molecule keywords Metal dependent hydrolase
total genus 168
structure length 549
sequence length 549
ec nomenclature ec 3.-.-.-:
pdb deposition date 2007-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07521 RMMBL Zn-dependent metallo-hydrolase RNA specificity domain
A PF12706 Lactamase_B_2 Beta-lactamase superfamily domain
A PF17770 RNase_J_C Ribonuclease J C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.580 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3bk2A03
3.40.50.10710 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Metallo-hydrolase/oxidoreductase 3bk2A02
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 3bk2A01
4C1EA 3DH8A 1ZTCA 4HKYA 4C1HA 3BK1A 3BK2A 5LM6A 5B1UA 2P1EA 2WYMA 1JJTA 3ZWFA 4Z6XA 4RL2A 1HLKA 5AYAA 5HH6A 5FQBA 2R2DA 5LLDA 2Y87A 5ACPA 3DHBA 1YCHA 3DHCA 5EH9A 2OHIA 5EWAA 2Q9UA 4EXSA 4TZ9A 3G1PA 2OHHA 5ACRA 4O98A 4AWYB 4TYFA 4D1UA 2BG2A 3SBLA 3I13A 1KO3A 4UAMA 3I15A 3T9MA 2BTNA 2YNTA 4UWRB 1JJEA 4P62A 3AF6A 5A0TA 2NZEA 3DHAA 2BFKA 4C09A 3PY5A 3X2ZA 1VGNA 2YNVA 4Z60A 5EVKA 2GCUA 3AF5A 4UWSB 4TZFA 1X8HA 5KILA 4D1WA 1L9YA 2M5CA 1KO2A 2FU6A 4Z5YA 5LMCA 3X2YA 3Q6VA 2YNTB 2FHXB 2BC2A 5AXRA 2BIBA 2P97A 5ACWA 2YNUA 2P4ZA 3ZR9A 3VPEA 2DOOA 4WD6A 3SFPA 2QDSA 4NQ6A 3KL7A 5ACSA 2QINA 3I0VA 1DXKA 5K4NA 4PVOA 2Q42A 1BMCA 4PVTA 2QEDA 4EYLA 1M2XA 4RM5A 2XF4A 4D1TA 1ZKPA 2FHXA 3ZQ4A 2YZ3A 3IOFA 3IEMA 3L6NA 5ACVA 2M5DA 4YSKA 5HIPA 5A5ZA 1X8GA 4Z5ZA 4D1VA 2ZO4A 3MD7A 2BFLA 5ACTA 2BG6A 3P2UA 5KIKA 3RKKA 4TZBA 1P9EA 4GYUA 3JXPA 2H6AA 2GMNA 5EW0A 1BVTA 3SW3A 2OHJA 4RAWA 1ZNBA 2P18A 1JT1A 3BC2A 3SRXA 5EVBA 2I7XA 4NQ4A 4HL1A 1SMLA 4AX0B 5EV6A 1DD6A 3IDZA 4NQ2A 4EFZA 2UYXA 2YNVB 1QH5A 4HL2A 4D02A 3SPUA 4KEQA 2FU9A 1XM8A 2QJSA 4C1DA 1VJNA 5EHTA 2A7MA 2GFKA 4RAMA 2WRSA 3IE1A 3PY6A 4FR7A 5AXOA 4BP0A 2AZ4A 4YSLA 3TP9A 4H0DA 1XTOA 5B15A 2Y8AA 1E5DA 4NQ5A 5HISA 1YCGA 2I7VA 2ZWRA 3ESHA 4BZ3A 2FU8A 4GCWA 4UWOB 5EV8A 4B87A 1KR3A 2NZFA 1A7TA 4C1CA 4EYFA 3PG4A 5K0WA 5IQKA 1WRAA 2NYPA 4F6ZA 5A87A 2ZNBA 3SD9A 2YNWA 3IE2A 4DILA 4C1FA 5HH4A 3FCZA 2BG7A 5HIOA 4EY2A 1X8IA 4J5HA 3VQZA 5K4MA 3S0ZA 5LCHA 3X2XA 4AD9A 2Y8BA 2Q0IA 5HH5A 2BMIA 4GYQA 4U4LA 4J5FA 3KNRA 4TZEA 1K07A 4V0HA 4RL0A 3AJ3A 2YCBA 3QH8A 2GFJA 4AX1B 4FSBA 5LS3A 2GKLA 2XR1A 2DKFA 1A8TA 2Q0JA 4UBQA 3I14A 4DIKA 5K4KA 1QH3A 3IE0A 3ZNBA 4FEKA 4XWWA 5LSCA 3IEKA 5AEBA 3R2UA 3IELA 4CHLA 4EXYA 4JO0A 2VW8A 3BV6A 2WHGA 4UA4A 4F6HA 2BR6A 5DPXA 5ACXA 3RPCA 4ZO2A 4YSBA 2QDTA 5AHOA 2ZZIA 4RBSA 2BG8B 5ACQA 5ACUA 1WUPA 1Y44A 2FK6A 3KNSA 3H3EA 4Z7RA 4ZNBA 3FAIA 1DDKA 4ZO3A 5EVDA 3LVZA 4LE6A 4ZEJA 1YCFA 4AWZA 2BFZB 3T3OA 3A4YA 2CBNA 3IOGA 5AHRA 3RKJA 2WYLA 2FU7A 1VMEA 4UWPB 2FM6A 3T3NA 2NXAA 4C1GA 2I7TA 3ADRA 5FQAA 5LCFA 3I11A 1WW1A 2BG8A 4EYBA 5B3RA 2AIOA 5A0VA 1BC2A 4Z67A 3X30A 1WUOA 4XUKA 2BFZA 2HB9A 4KEPA 2WYMC 3WXCA 3F9OA 1MQOA 2BGAA 5LCAA 5FQCA 5LE1A 2E7YA 4TYTA 5HIQA 4XWTA
chains in the Genus database with same CATH superfamily
3IR6A 3DH8A 1U28C 4QRIA 4MACA 3GQBA 4K7JA 1W1WA 3EQZA 3II6X 2MBEA 1NI4B 1CZUA 2QZZA 3KEMA 3MMPA 3KTFA 3PP8A 4JJKA 1G5HA 2VH5R 4CLHA 4BXOA 1XWWA 2ZUDA 2DYOA 4YBZA 1JV2B 4NCXA 3ROPA 5LXTB 3K8ZA 3BXHA 3UI3A 3FUWA 4DBLE 3B53X 1ZJ5A 3COZA 2YJ4A 2L7RA 3S99A 4G81A 4MVJG 4KGSA 3MT7A 4LZLA 3BORA 3TEJA 1EK6A 4Z6XA 3E3AA 5CEEA 1V39A 3FNGA 3ZVLA 1IOWA 4A23A 1YN3A 1ISGA 2MINA 2QPTA 4D9KA 5JNWA 3VO8A 2JEZA 3WG9A 1N2BA 3CSUA 3DFKA 2BJVA 3OIUA 1QZUA 3A25A 5JSUA 4WK6A 3WYAA 1CG6A 4BQPA 2R5NA 4S1WA 1KLGD 3WKAA 3GZJA 3LQQA 3VYWA 4LYDA 4DVGA 3OOWA 4F12A 1C9YA 1HDYA 2WKSA 2O8EB 3BIID 2JEYA 4LGCA 5H5JA 1SR8A 3LGSA 3D7KA 5KDOA 1U1IA 3H2IA 2BGRA 4EZIA 3A9UA 2DZMA 1SURA 3P2IA 4LHZA 2IC5A 2PL5A 1A5AB 1SCKA 3E3OA 3GZ4A 3DHNA 3THOA 1A4RA 2NSHA 5J4YA 4DREA 1YU9A 3TLGA 4UAJA 5TR5A 3RYFB 2UV8A 1M6VB 2RKWA 1BFDA 4YRZA 4CT5A 2C5SA 3O94A 3HCNA 3SC3A 4L75A 1QF9A 1PCXA 1UEJA 3LXFA 2NGRA 2WSBA 2HMSA 3IUBA 4A8JA 4DR4B 3LW8A 2O8CA 1W4ZA 3ISVA 1V96A 5JHBA 3V4OA 5ADWA 2H18A 5AW7A 1YSCA 2GEDA 4PWYA 1GAJA 2Q1WA 3DL7A 4TZ9A 3TGLA 1PSZA 1WCXA 2JDIA 1QOGA 1RRFA 2GR9A 3P4PB 2C9YA 3CH5A 3GUHA 4H60A 3MIIA 1J6UA 1IIBA 1KI6B 1Y89A 2RB4A 2TMKA 3OWXA 1HXHA 4PYRA 3SLKA 4G3XB 1H23A 3N58A 3WK5A 3AM3A 5HZMA 3TLYA 4P62A 2BIFA 5JH5C 1B8OA 3U4EG 1ESCA 2X5OA 4WFQA 5H02A 2MEKA 4G67A 2H11A 1KFKB 1MJFA 4BNMA 2EWVA 4PVDA 2WRZA 3KG2A 1Z6YA 3MSCA 4QASA 1LF0A 4IFBA 1TUBB 4HLUA 2N9PC 2BFAA 3ZNPA 5JHHB 4M21A 1EGMB 1N62A 4YJ2B 5KBYA 4DLKA 1GOZA 1B41A 3CSFA 3RUFA 5DYIA 4YROA 3UWPA 3MTBA 3AZQA 5AH0A 4A7PA 1ZMOA 2W48A 2O5RA 5FAKA 3AULA 2GGSA 1N1MA 4HKZE 1Y3HA 2QM7A 3GYGA 4JLPA 4BPBA 4X94A 1V86A 3ZKJC 3UCFA 5DZSA 1THMA 4P35A 5HYVA 2X4IA 4QEDA 1JXAA 2AG0A 3NJ4A 3E05A 5HTKA 2A5YB 2CUNA 2DHDA 2YQZA 4RHCA 1G6KA 1YGYA 1HFJA 1VIVA 2P2NA 1OT3A 2W2NA 3DZGA 3V6MA 5CBKA 2FU6A 1O8BA 3JYUA 4PO8A 1RJ9A 3ZV6A 1ODFA 4DQVA 4GI2A 4JP1A 4RM2A 5IP4D 3CH7A 5KKCA 4C78A 3AY3A 2M0XA 4NAVA 1WVMA 2XMGA 4MWBA 2ZATA 3GY0A 1HDXA 5AOCA 3JW0X 3JRXA 5H7XA 1Q0LA 2FSIA 2OLJA 3UF0A 3LT0A 2N1MA 2H7YA 3IEXA 3OQVA 3ZJVA 4KQ6A 1RJWA 4M6WB 5C23A 1R4ZA 4S2UA 5ANRB 2ZYAA 2WF8A 1RKVA 3NBAA 5C7IO 3VPEA 4GYJA 3DKPA 2IZ0A 5CG2A 4F1JA 4BLUA 3THXA 3QYAA 3ORRA 2XEDA 4OJKA 1N9GA 1ZGHA 2D5LA 3DBVO 4LC1A 2ZI9A 2FZ5A 5AIAA 1D09A 2BEVB 3BGIA 2FZGA 3QU5A 3RKSA 3QG1A 2QTWB 3V4SA 5BSHA 2P27A 4OK5A 4PGFA 2GBNA 1L1FA 2IU3A 5E4FA 5JJLA 5BSEA 4AURA 5ESRA 2XZDA 1S6YA 1MF7A 1J97A 7AT1A 1NTRA 4ZICA 2ZZMA 4HWGA 4RGVA 2H52A 4M87A 3D4OA 3GB9A 1W35A 2PJDA 3BZWA 4NCHA 1T8YA 4DUPA 5EKTA 4DIEA 3HEBA 2X4GA 2GEFA 4PICA 5IKXA 1T0JB 3IXLA 2C8LA 2BZ1A 2X5XA 4KR2A 2FHXA 4RF1A 2HZBA 2AJCA 1LK5A 4M0UA 3WMFA 2IHVA 4HXDA 1KPHA 1G1AA 4N8DA 1YVUA 1ZINA 4KPFC 3A9KB 4Z53A 2V4MA 1DADA 4KWIA 3DS8A 5A4DA 1NC1A 1FEZA 1FX0A 1HTQA 1WCIB 3A4LA 1Z5VA 3ZV4A 1B76A 2IPMA 3BSYA 3ETHA 3K72B 2NLOA 3TMKA 4J9VA 4CKEA 4NCBA 1ZXHA 1WMBA 5BOSB 3HUDA 4JWKA 4NPCA 1YNOA 4GN1A 3GRPA 1NVBA 1HSZA 4AN0A 2SHKA 1SY7A 4EHNA 3DGFC 4K8OA 4OVZA 2WJAA 3NH9A 3F1KA 2AHOA 3O7WA 4ZAZA 4MLCA 1KVRA 2HIGA 3V34A 2EW1A 3T5PA 1U11A 3UMBA 3R8FA 1GZ5A 2BFDA 3FI9A 3I9LA 2XYPA 3IR5A 5E6UA 3ND5A 1XJQA 4MI6A 2BYTA 5F3RA 5ED4A 1QWOA 1HDGO 4C08A 4KOEC 3GRCA 3VJLA 5A5GA 2H6AA 2ZYTX 3DULA 2GMNA 1BXZA 4KIJA 4W9EA 2FKNA 1QZEA 3OM0A 1YD8U 3P4YA 4R9SA 3MLBA 1ZUIA 1BW9A 4CMGA 1M34E 5KPJA 1P9WA 2H7CA 2XVAA 3FYUB 3K73O 2OGTA 4UNRA 1U9IC 5BMVA 1ZOOA 1DLJA 1MO5A 4PYOA 3ZWXA 4EMTA 3OICA 4AKEA 2V3WA 4AZ0A 2OV4A 1TYAE 1TADA 3H1TA 4V1CB 1PZGA 4CF5A 1CP2A 2PPLA 5LMNB 4O4LA 6CHYA 1N2HA 3ZD6A 2GYUA 2XUZA 2YY6A 4KSBA 1ZY2A 5BSTA 2GH1A 3ZOKA 2C5EA 3KQLA 3PNQA 4R6WA 2OBBA 1LBHA 4BZXA 4YLGA 4G9EA 1I2DA 2NV2B 2AYOB 1KI1A 1F48A 3DZJA 4PN3A 1JIXA 2VDWB 4PINA 4ARZB 3AR6A 2QRVA 2WBLC 4HDOB 3C6KA 4S1VA 1QH5A 1G66A 3C5HA 5E0OA 2KAJA 4I8IA 5DSXA 4KN6A 2NU7A 3GCDA 3GCGA 4WPGA 1JAHA 1JG6A 4EI2A 5B37A 5JR3A 3H0EA 3WSTA 3WTBA 4BL5A 2N47A 3P26A 2FSVC 5FORA 3UFXA 1FYXA 4BQFA 3COVA 4Z7JA 4HMQA 3QW4B 5C1DA 1T5XD 1ZL2A 3N3KB 1QHEA 2ZBVA 2XLCA 3FTFA 1P72A 3FAZA 1A1SA 1AO3A 2R86A 3LK7A 5BSWA 4ZQGA 5CB4B 3GAAA 1QHYA 1JF8A 1XZHA 3QI2A 4TKUB 1U8UA 4YSLA 4LDJA 3LFHA 1JVSA 3PNMA 2QG4A 5TPZA 3VVMA 1FXSA 2VYCA 3BWCA 2ZCJA 2CJPA 4EFLA 3FA2A 3PCRB 4HRVA 1XF9A 4MV1A 3D8TA 3PC4A 4UQPA 2JFPA 4PS7A 4FCCA 4KO1S 3HUIA 2LXCA 4HVAA 4U7WA 1AVTA 5LLSA 3WAGA 3LT5A 3CY6A 2V55B 5D3KA 1UPUA 1M0WA 3V8PA 1YR6A 4WBNA 4BZ3A 4QARA 1ZZGA 4UWOB 4MRSA 1LF5A 5JAZA 5A71A 3UF8A 2XA1A 3AKEA 4D96A 4Q1EA 4TWZA 1P6UA 2ONZA 3AUKA 2VHWA 3MTNB 3PGLA 4WOPA 4Q03A 2Q5HA 5KYVA 1AZSC 1G8SA 3Q14C 2B78A 4ZQHA 1JMKC 2FJUA 3WY9A 3PFNA 2IZVB 1ZEJA 3R7FA 1K6MA 1NLYA 2JAUA 3KQMA 4N5IX 1O03A 1XZ8A 4R1OA 5T3YA 2HYDA 2J3HA 3OF2A 1AXRA 4K9PA 5CLFA 5JY1A 3G0GA 3IG3A 5J5VA 1BEEA 3GLUA 1OWLA 4JH0A 2ZYWX 1NUQA 3FF4A 3M3PA 1JLLB 4WQOB 4OQZA 4V38A 3CG0A 3JQAA 4V0ME 4RY2A 3MJ4A 5K2MA 3C5CA 1GGHA 1P8AA 1YKGA 4H16A 3EGVA 4CZ2A 1Q7RA 4YRGA 3TW8B 2NVOA 2WVJA 3ZDXB 1JTEA 4OHCA 2F3QA 2Z1DA 2HO4A 4QJIA 3FHOA 3VSCA 1D1QA 4YSXB 4OAOA 4D5EA 5KVVA 2RH9B 3T4PA 3VSDA 5MFPA 3I72A 4I1VA 4J0DA 4FJYA 4KQXA 2Q1UA 4B82A 1WZ0A 2VHTA 1O8CA 5EEGA 1N6NA 3EJ6A 1NMYA 4MJSA 3C8UA 4UVEA 5FX2A 3FTCA 1FS6A 3AF1A 4DLSA 2J67A 2MWMA 5BN5A 4ME6A 3I3OA 1YH3A 4KQKA 4ZMBA 1IHUA 1Y63A 1HG0A 2EF1A 3K35A 3OIDA 2WPDD 1HDOA 4HF7A 3UGBB 1NUPA 2C0CA 2OL4A 2YV2A 1ZDXA 3HU1A 3OY2A 2ZETA 4ZYSA 5GXGB 1MKYA 2WFLB 3AR3A 4IMJB 4QTYA 3AETB 5KYYA 2I9KA 2WJ4A 2JFZA 1P4RA 2NTEA 4TQ1A 3O13A 3GHHA 4L3WA 1Q7EA 2DR0A 3K96A 4MNTA 4E5PA 1E79D 2DM6A 3QH8A 1XWIA 3HVKA 2R8ZA 1XTKA 4X60A 4AKTA 1KK3A 3WX0A 3G6WA 5K5EA 2VKQA 1UBCA 5JSZB 3EECA 3MCWA 5T64A 3VH2A 4BVHA 5T6MA 4A8TA 1SKYE 1K0FA 1MGPA 4AOFA 2QDXA 1UFKA 4DR7B 2A14A 2WU2B 2WJGA 4P5PA 3NZ3A 3RNOA 4B6QA 5C3JB 1KH1A 1XRJA 2C7VA 2GCOB 2V45A 1YI8A 4ANVA 1CEQA 2FCSA 3FSJX 2WF7A 4FSDA 4KXVA 4O4LF 4A0GA 4B31A 3R1IA 3W8FA 2Q1TA 1OU4A 1QH3A 2Z2KA 3HB0A 2OR3A 1I30A 1U7DA 4XOUA 1C8BA 4TL6A 3IP9A 2XUAA 1XYYA 3D02A 4DSUA 4GR5A 3NVKI 3EGCA 3H86A 5KOJB 3LX8A 5K8LA 4G0OA 4MVJA 1RR6A 1TVKA 2IP4A 1E7RA 4H08A 3QLTA 2DUWA 4JUIA 4KV9A 4X54A 3FDIA 1JRLA 1V11B 1X39A 4EL5A 1C0LA 1YJIA 3R0QA 4LDAA 4HJGE 2PUCA 2EFCB 1Y3AA 1I4PA 2O2VB 2DR3A 3MJTA 5EG5A 4Z4QA 3L1HA 2PA0A 2HQRA 3AR9A 3IPRA 4HNAB 4OHYA 4DCPA 4UMFA 4USAA 3E4DA 1C30B 3GFPA 1GNVA 3IELA 1FU7A 3NP9A 5F1PA 1HT3A 3FVRA 4AJWA 4WINA 4DN6A 4DDMA 2PUAA 3KW5B 2ECOA 1JEJA 2YOHA 3ZU4A 2DXIA 2D5CA 3DONA 5F35A 1XWFA 1PJ4A 3IT2A 2IS2A 4IDGA 1OTXA 3A6EA 4D8WA 4GLSC 1P4GA 2PSJA 2DTXA 1W5SA 2BI7A 2PLAA 3KZMA 3OY7A 5JRDS 5DPXA 2E4XA 1RHQA 5FUWA 3T5TA 2JI8A 5KNDH 4OZAA 1PJRA 1C3VA 3A6JA 3CLTD 1IG3A 1JYFA 3KYCA 5ALIA 1FPYA 4GDLB 2ZJ4A 3TZCA 1UWMA 2XK5B 1JDPA 1JIQA 1W85B 1XDBA 5CITA 1P6XA 1DFHA 4KX3A 3WB2A 1IBCA 5ALSA 3EK2A 4HVCA 4LF5B 4LY3A 1Y44A 1VE3A 4BFSA 1II8A 2P4QA 4EI9A 1EINA 2HPZA 4CKCA 4KTVE 3EVCA 1M6VA 1SIJA 1YUBA 3RSOA 1L5PA 3FAIA 1R9JA 2I7CA 2J07A 3LCCA 5KWIA 2E5LB 1XCLA 4OXRA 4Q7EA 4YCJA 1JFSA 4ACFA 4CE6A 1TA4A 2FMFA 2H2FA 3RHSA 3UY4A 4H1HA 1LBQA 2IYDB 2JS7A 2GD1O 3DEHA 2VIIA 3BXEA 3S27A 5BMVF 7YASA 1YCFA 3H4VA 3V3TA 4EKEA 1YAHA 2E6XA 1QCDA 1KYXA 5F9HA 3DTVA 4K88A 4NCNA 4P16A 4G0NB 1KI8A 1X92A 4XYGA 3TK1A 4OKNA 5TY0A 3KU4A 1A50B 1VLZA 4GI5A 5K01A 4UCQA 3HIZA 2SECE 2XGSA 3MJEA 3TXAA 5KVSA 1P9OA 2DFKB 3S2UA 1EWVA 3SYLA 3TDNA 1DAPA 2HK6A 3F49S 4AWBA 3P9XA 2B2NA 4YP7A 3IAFA 1KKLA 1X3LA 2RD0A 1TQ4A 1VGQA 2FXVA 1X42A 2QT0A 1X0XA 1CQPA 2KWDA 5KTSA 1E9CA 3PRMB 1GEGA 3QP9A 3T3NA 1LPOA 1PE0A 1U3WA 2V7UA 2D2VA 2IY8A 3MC8A 1C0IA 1P81A 2ZUTA 3VU8A 1JRUA 3IDOA 4YJ2A 5LCFA 2WEKA 3SYMA 2GDZA 3OZGA 2HK8A 4KQJA 1PIWA 4EAAA 1EDDA 3Q87B 3A36A 4RBNA 4RTOA 1L5ZA 4LJRA 3FUXA 3GPDG 1GXSA 1XKTA 3EQ7A 2W90A 4HDCA 2VK2A 4QYMA 2MMGA 4ZEVA 5DTJA 1BU8A 5IJWA 2WT8A 3JQRA 1A7KA 1CJVC 1V5TA 3H1BA 5IAKA 4NRDA 5AVXA 1V8OA 1WMHB 1LLUA 1W9HA 3RZFA 2Y0BA 2ZRHA 4E3CA 4F92B 4KXWA 2PRYA 4ZQFA 4XWOA 1Q7BA 3HXQA 1SXJD 3NFYA 1NAHA 1B7GO 4JXXA 2QVBA 1RHRA 1YBMA 1MB3A 3W5IA 3AFMA 4HYYA 5DULA 1LLDA 2A3RA 4M0DA 4IM3A 5CBPA 2H9YA 2Y66A 4HLDA 2WSSD 3K53A 1RHMA 4R9NA 2ZWMA 1GUZA 1TZ1A 4RXMA 4CDRA 2VP5A 1KVSA 3Q8AA 4CHKA 2D5BA 1IBRA 3FB4A 4P82A 1SRRA 3CW9A 3IMFA 3URMA 3IYLW 4IIJF 2K1FA 2FRDC 4JT4A 3WLSA 4EZEA 1RACA 2X6QA 2WXLA 2JB9A 3IJ5A 3AERB 4B73A 4KE7A 1WB4A 3HZZA 4GUDA 3S5JA 4DHWA 4TYNA 1N9GB 2GBGA 3DVLA 1P8JA 3HS3A 5LE1A 3QBTA 2C59A 1WGRA 1Q2UA 2OQRA 4QX6A 3TSCA 5AJWA 3LUKA 1DU4A 4RVOA 4BQOA 4BEWA 3CVUA 4TKNA 1DBSA 3A58B 2IS1A 3ESDA 5FYDA 3W34A 1MG8A 2ZVJA 1V5WA 2D10A 1XEWY 4YRLA 3REGA 2BTQA 1G1MA 1WAMA 4NBWA 4XYCA 2IGBA 4MGKR 2A0UA 4C1HA 3NM6B 3IHLA 3BK1A 2MW5A 3K32A 1ESEA 3AB8A 4GLLA 2N7JA 2RJOA 1FBTA 3RG2A 5AJUA 4R3UC 1M2HA 1GFSA 1BX1A 2GM3A 5L95C 5CDTA 7MDHA 5K8JB 3O2SB 3UBTA 2H1RA 4DLTA 5B7QA 5ADUS 2ILVA 2P9FA 1QZZA 3FFWA 3RK4A 2KBFA 2PY6A 1PT6A 4HGNA 1V8CA 1IN5A 3OD1A 1GKLA 3A9KA 5IT4A 1XCOA 3ISTA 3ST7A 2RGNC 1G60A 1SE9A 3FZNA 3RV4A 2YHEA 5HQ3B 1UWCA 1ZSVA 4QDTA 2VSXA 1LI5A 4NLLA 1UBSB 3HBMA 1JSRA 1JIJA 2BGLA 3S2FA 4UHFA 1DAIA 3DHCA 5L95A 2ZCVA 3FRIA 3GV0A 3IOEA 3L4BC 5CVVA 4DWVA 5SZHB 1I3OA 2IVFA 3MC9A 3BXXA 4GQBA 4JGBA 4LHEA 4YJKA 1UXOA 1Y9AA 2XQVA 1UKVY 1U2RA 1N4AA 2OCKA 3RS5A 4QODA 2YJTD 3IPLA 3P2BA 3JAKA 1FA9A 2F4NA 4O2BA 1S9DA 4UBJA 1Q77A 1GPWB 1NRXA 3FHCB 4LX0A 4AT1A 3LA8A 1ZBDA 3U3MA 3UJ3X 3ORQA 1IEWA 1Q12A 5DVZA 2ORIA 2Q3DA 4NKRA 5TT1A 3RASA 4UAMA 4HGOA 4B0MA 3S2GA 3T9MA 5DEOA 5HFAA 3G2HA 3PICA 4EJ6A 2QRJA 3KB2A 2KI5A 4JI3B 4NFSA 2WILA 5BR4A 1XOIA 2BI8A 3KJIA 4TTAA 2PGDA 1RE0A 3CN7A 3LYUA 1BKDR 4G85A 4G86A 4EWLA 1S2GA 3M1AA 1KH2A 3LUFA 3ZQ6A 1SQFA 5I4KA 4DARA 1J0GA 1L0XB 4YHHB 2YX1A 3R6GA 3ZWVA 2YZKA 3K0KA 4JQOA 2A2ZA 4LI3X 3TN7A 3HEAA 4UJ5A 4B5LA 1FCLA 2FW9A 2WUEA 5I7HA 4N3GA 1JL3A 3GJSA 1VGNA 1ECFA 1E64A 4NOMA 2OM6A 3CR8A 4INPA 2AQ8A 1NASA 4MI3A 2JGMA 5JSFA 1RXUA 3G13A 4QO8A 1X1RA 2R65A 1FUUA 3NI2A 3QVVA 1ZGCA 2JHGA 3BULA 3LC1O 3MWEB 4K9LA 2QYSA 4B85A 2WJPA 2BLNA 1WL8A 1QHXA 1WM3A 3M9XA 2AN1A 3K8QA 4JSRA 3HCRA 1Q22A 1WULS 2BKXA 4P9NA 3SOZA 2GJKA 2BR5A 4JI2B 2M19A 1M8KA 1Z6XA 1JJTA 4ZOAA 2LCIA 3VHXA 4HNSA 3FBGA 1XZCA 2D0IA 2Y2VA 4M1OA 4M3NA 1IQRA 4UPEA 1CY0A 4RQTA 2C2GA 2V7QD 4QQRA 3IRUA 5INTA 1ZM7A 3SQWA 3G5UA 3ZDEA 4KPEC 1JEOA 4RJTA 4IXNA 3ORFA 5HSGA 4N8EA 2QTNA 1QDLB 2GI4A 3GLHE 3RFZB 4IXDA 2Z95A 1ZCBA 2Z0DB 2EU8A 3LKZA 1NBMD 3WK6A 2HJ9A 2JFNA 4XM2A 2SNIE 1JFVA 2YFHA 1UBKS 3IESA 4RXTA 4WXEA 5G3YA 5HFNA 1GVHA 4E21A 2CJWA 1FNVA 1OH6A 3WQRA 3DVQX 3NTUA 4AJYB 3QPCA 1O0BA 3EOAI 5IAGA 2AQ2B 3TEZA 4WZBA 8AT1A 1W46A 2GA8A 3I8SA 2R7LA 1PF7E 4RWZA 4XASA 4ZO4A 4C06A 4R9UC 5IZCA 4IAOA 1TXGA 2B4QA 1IDN1 5LP6A 1V45E 4UHDA 3BMQB 1CFJA 1UMCA 1LNQA 5FA6A 1H0SA 5DGCA 1EX9A 5A7FA 1UBQA 3NBQA 1FLNA 1JLLA 4C1BA 3UIOB 5TQJA 1ZM2A 2FX5A 3OO0A 2QBYA 2EL9A 4N65A 4XAQA 1DUIA 1N2IA 2E18A 3JW8A 3KYBA 3ML8A 3ZHVA 2DULA 2O6HA 1RRGA 3MRVA 3OHPA 3L0CA 3P32A 4K3VA 2FETA 2RD2A 3HMKA 1EM8A 3QFTA 1S02A 4YCLA 5TS2A 3VU3A 1SBNE 1GT91 2JK1A 4OP2A 1L7MA 2J0SA 1N5LA 1B0UA 4KREA 3OP1A 1IHOA 2PTLA 1YU6A 4OSPA 4BKPA 5BPHA 2Q45A 2VBFA 3WB1A 2JFWA 2D0OB 4H77A 2XCSB 2DKNA 4OHPA 1PYOA 1A8SA 5EIAA 4PVCA 5LQRA 3UMCA 4DLNA 3IUMA 1HT2E 2MHJA 3H9UA 4FBGA 4IIEA 3UJ9A 2ZYGA 2PAAA 3KR2A 4KL8S 4MEBA 1Z39A 4F3NA 5KYYB 2BVNA 2HZ7A 4FHDA 1SQ6A 3P20A 1WZIA 1FUIA 3I01A 2PK3A 5L4LA 3E6AA 1Z33A 4F91B 3BIFA 1EA7A 1JT9A 1DG1G 2X8BA 2JFYA 9LDBA 4GGPA 5JALA 2IYRA 3D31A 5EHQA 3A1NA 5DRTA 4JK3A 3GR6A 4PQFA 4ZEOA 1G19A 5ICMA 2FE8A 3JQ8B 4W9LA 5DK4A 4RELA 1U3CA 1Q0HA 2RH4A 3QYPA 4MLDA 4V0SA 4BNKA 1ZR2A 2B83A 3A6GA 2I7XA 3E82A 5DYTA 1ZJZA 2R00A 2VI5A 3UEOA 3Q6VA 4C2BA 1WCWA 1F5SA 3B1JA 3I3TB 5CJ2A 1N34B 1E6EB 2QUBA 3PHXB 3HPQA 1F2TA 1X74A 4OMCA 3I5JC 2VCEA 1VYHA 2I4MA 2VJMB 1VZ7A 4BNVA 1JG4A 4QVGA 1WOYA 2C2ZA 1HLPA 2NM0A 3U31A 3KD2A 2WQ6A 4MUBA 1FFYA 1EXNA 1J00A 1A88A 3VZCA 4EG5A 3SIPA 4WWMA 1OFTA 2IXFA 1Y9EA 3RULA 2QX7A 1L7PA 5JQWA 1NV9A 3M5PA 4FQ7A 3AXCA 3HBFA 1WM2A 2AFRA 1OTRB 3QTLA 4LWOA 2PS9A 1Q3HA 4LRQA 5I4BA 2YNVB 2H1LA 2ZB7A 3GBSA 3OAAD 4KK3A 3BINA 1PG5A 4GZ6A 4Z99A 3OZUA 3PG5A 1KEVA 2HUNA 3LDHA 4XVHA 1BMLC 4Y9SA 3WL8A 1X9HA 5FWAA 2GTIA 3EVGA 4DMGA 4ZCPA 5BR1A 5C1OA 3UPTA 1F7UA 3WMWA 2QN6A 2XTZA 5BQ3A 1THZA 1KOLA 3NYIA 4OL9A 4TLEA 3ZU2A 2V65A 4W7HA 2WWVD 1JSLA 4CQLA 2ROQA 1L5QA 3AR7A 4I55A 1W0JA 4Q3DA 4D57A 1G17A 5ILOA 1YL6A 4HGQA 4AG5A 2WRSA 1RQPA 2W2OA 3K9BA 3IAXA 3P1MA 3VDMA 3KVOA 1UKYA 2VVTA 1SC1A 1Z8FA 3DDNA 2DFTA 3OMXA 4FR7A 2PFSA 1P3Y1 3WIOA 4Z4CA 3L6BA 1I7NA 3GCWA 3TIIA 4I4TB 4D4IA 1PUIA 2ECQA 3CZ9A 5IYZA 1Q1QA 3N39C 5KQPA 3DKKA 3A27A 1QQ5A 1VJDA 1HYEA 1IIRA 1YCGA 4LSMA 4DW8A 4EFMA 5HI1A 1ZVMA 1J8QA 3LC0A 3FPHA 1NNEA 4ENQA 2ZWRA 3TRFA 3AU4A 3OEHA 3LVBA 4EF6A 5FWYA 5IT9A 1KAMA 1N32B 5GONA 2AQIA 4O6VA 2ZPAA 3OQPA 4RLSA 5HGJA 3AKYA 3RUDA 1L0YB 1N3LA 1WNFA 4E2XA 4I6PA 4MP6A 5D6OA 1V95A 2AFIB 3H0KA 1YIOA 2GCEA 4HN9A 4JJ8A 4MZXA 4B3IA 3KIPA 1ZJ4A 3MJWA 5BMHA 2QU8A 1E20A 4YJ3A 2YIDA 1A3CA 1XC7A 4G36A 4K6HA 5TPZD 5TX7A 4K2HA 1U1EA 2XE8A 5AM2A 2QT9A 1R4MB 5KC9A 1FMCA 5CW2A 1WIAA 3OPXA 3I0NA 5TF4A 2I66A 1FRNA 1G18A 3M6LA 5D7GA 1R8YA 4EZLA 4G0WA 3TW6A 1YQGA 3ZW3A 3I05A 1RCUA 4N3BA 1P7PA 1FPQA 2I6UA 2YWEA 3GJ8A 2RKOA 3ICPA 4GE3A 4MWZA 4CIAA 4WAUA 1L5KA 2CG3A 1C14A 1U1FA 2VUHB 3GEHA 4C21A 5LMUB 1FMTA 1BROA 3AGQA 5A9SB 3UMSA 5KZMB 3VV2A 2IHZA 1ISSA 5JC8A 2HM7A 1J8FA 2G3YA 4E6PA 4EUKA 4RHXA 4J5HA 1U0LA 1R5BA 5DM1A 1X8LA 3ADPA 1P2BA 1T4DA 2JAPA 1ZH2A 4U0JA 2WJVA 2FN9A 4PLGA 5CA1A 3D43A 3OFVA 3ZWPA 3QWZB 2A4ZA 1IDOA 4AJLA 1N3YA 1N9ZA 4A92A 3OX2A 4DJJA 4NPHA 1L8LA 4NE7A 1ZDVA 1JLSA 1GZVA 1L4KA 1UXJA 3BXOA 3MC1A 3ITNA 1G8HA 4A5OA 1EFCA 5KHAA 4DJDC 4F2HA 1DQRA 1TTQB 2XWQA 1F4PA 2V1YA 1GG9A 3QBJA 4MUAA 4WERA 1RYJA 3FKSD 3C3JA 1PZNA 3CV3A 1WMEA 3FVWA 3KT8A 1YS1X 1K7XB 4G9GA 4IGEA 1XO1A 4L0MA 3DXZA 4OHKA 5AT1A 3CNOA 4H7FA 4TV8A 4L16A 1NP7A 4RA9B 2BN4A 1A2BA 3RR2A 4MR8B 1LSOA 1EK2A 3RU7A 2WPDA 1NULA 1WB5A 2QJRA 3EAFA 4HYQA 3ZK7A 1NXOA 2BS2B 1EXDA 1I3NA 5CFNA 4GQAA 3W8NA 2BGNA 4HYTA 1F8UA 3HVDA 4NWIA 1QQBA 5K4KA 1X3SA 1PJCA 3X2FA 4F8CB 3A1TA 5D3ZA 3JWPA 2WD8A 1X8XA 1RQGA 3BE4A 1FMJA 2LFIA 3FYDA 2W37A 2IYQA 4LEIA 1MC1A 5GM2A 1E2UA 4KGRA 2ZOSA 2WB2A 3JVDA 2HRQA 3OLZA 2RARA 3JD4A 4L27A 5CDUA 4L02A 1J20A 1NLUA 2V96A 4EJSB 5K99A 4I6JA 3UMJA 4FEKA 5F9MA 3ANTA 1UXKA 1Z17A 4BLOA 4ZQEA 1QOPB 1UDBA 2CDAA 1N5IA 3BXFA 1XZQA 2G36A 2WG1A 3H16A 5JNUA 3AUYA 3ZVNA 3THWB 3HKBB 1D8AA 1GTZA 1OLXA 4X7BA 4NXMB 2DE0X 2D6FA 3BA1A 1SIUA 4U5QA 1KO5A 4HADA 4EX6A 3H5RA 3OUUA 1AO0A 3DD1A 5KYXA 1DC4A 1QTIA 2Q4TA 2CXRA 3TQHA 3EULA 4Y2UA 2HRDA 4URXR 4S04A 1ZK3A 3ESAA 1VMAA 1XD2A 2AMJA 2GHTA 5EWJA 3OTHA 3D2BA 2X1LA 4BO9A 2K8BA 5BYQA 3IPXA 3L8EA 4I1PA 4KQ2A 4R1QA 3WLPA 3ESBA 4HAXA 3FTPA 4X7RA 1D2AA 1TC2A 3PTFC 1C4KA 4ND3A 4K2AA 4UDXX 2V1UA 1NATA 3TF5A 1T9ZA 2F3PA 3F6EX 1TO2E 4ZDKA 1MX1A 1K0UA 2ZYDA 3GWZA 2J3DA 3IT0A 2B1JA 4DQKA 4EB6B 4OQMA 1NMQA 2H00A 1Q0RA 4IDDA 1JWSD 2RHOA 2C2WA 4M8SA 1ST3A 2BMJA 1KYYA 2EZUA 2OLKA 2WJHA 2FP3A 3V1TC 2C9ZA 2JFOA 2ZAIA 3FPBA 4M37A 4NX2A 5ITZA 3IL2A 3NS1A 1O08A 5CH8A 4H0CA 1SCJA 4X97A 5LL6P 1GTL1 2J6IA 1E2BA 1PJQA 1OX5A 4DC9A 3F3KA 3QEAZ 5HX7A 5IASA 4WACA 1GUDA 4ANXA 1ESFA 2DJ5A 2WP8J 4AQDA 1KARA 4RTKA 5HUJA 1T0BA 1JWUD 2D3BA 3RAFC 3O8NA 3NNNA 4C01A 4CGYA 4EZBA 5CD9A 2JJYA 3GAZA 3RWOA 5FFMA 3UOAB 5FPKA 1S89A 2R7AA 3PNOA 4O8CA 4D6XA 5AHRA 1OYWA 2DQSA 1L7QA 2H7XA 5KWJA 1XA4A 2WYLA 1P73A 3GFFA 1E2IA 1EQUA 1I0ZA 1RKQA 1E3IA 3FMPB 4ER0A 4JCOA 1TMGE 3IXSA 4G07A 4MEMA 4A8JC 2L42A 3MWGA 1R64A 3V2UA 4FBLA 3ZGVA 5IABA 2XRZA 3N1XC 5B2EA 2EBHX 1FFBA 2HNBA 2ZU6A 2E3JA 1S3FA 3O38A 4ZEWA 3SFZA 3DE1X 3G3EA 2XXAA 4EJ2A 1K53A 1TKYA 3I5MA 1CUGA 2RCNA 4UVIA 4D2IA 4UFOA 3S7TA 2O2IA 3L10B 3HKEA 4BB9A 5ENZA 2G1AA 1A8HA 4DMHA 1GPMA 5GZ1A 5DYNA 4U9IS 2B1RA 2CHGA 4R2JA 1TM4E 3WGHA 4X92A 4ANFA 4D9NA 3OC0A 4MV5A 2AK3A 2WU0A 5F5NA 4DLBA 2V3SA 3ORSA 5I01A 2EKIA 4GMHA 1GQQA 2P69A 4IHAA 3CZ4A 4TT3D 3PHWB 1PR4A 1WXEA 1XQ6A 5SZKB 4B4WA 5C4MA 4LC0A 4DBLC 1RZRA 1IN1A 2AJLI 3X30A 1RAFA 4Y6OA 2HXYA 5TNXA 1PL6A 3FJOA 1XTIA 1FDUA 1U9CA 3AHEA 1USWA 1E7SA 1ZOPA 1D4AA 3GDWA 4MYDA 4WXHA 5T57A 4EG7A 2AN9A 2O4UX 3H3JA 3RRFA 4G5SA 2KJ6A 5AYVA 5LD2B 1WHTA 4HDQB 3VHXB 4FX2A 4MAAA 1MFWA 4C2TA 2P4SA 2DKOA 3D1LA 5BN1A 1RM6C 3WL4A 2DT5A 1M7BA 3IMCA 3PZRA 4II2A 5GWXA 4DLUA 3T5CA 2WYMC 5ES3A 1XK6A 1ZUD1 2JFBA 5TEVA 3OM1A 5KSOA 5TJ9A 4KLZA 3RFXA 3N5KA 4JYAB 5B7PA 2QLBA 4AXBA 3FVTA 2R97A 4KAXA 4F5EA 1P4HA 3HNOA 1AQJA 1Z0KA 2XVMA 2XZPA 5IF9A 1AUQA 3WANA 2ZI6A 4WA7A 1XROA 2CJWB 3AI3A 3FDFA 2H4YA 3PNSA 1WPGA 2WP9B 3C98A 2P2GA 4HWTA 2YY5A 2AQKA 4KPGA 2WSSA 4PGHA 3ZYCA 4AF6A 5GADl 3BWDD 4AMZA 1PFQA 1ILWA 4M1MA 5AK0A 4ZAGA 3JQPA 2OP0A 3NATA 4FYHA 5DWDA 1JA9A 2V9HA 5AP9A 3KQWA 1YDGA 1XQ9A 2IYFA 3JZAA 4QRDA 5K0BA 4W1QA 3P0HA 2CHQA 2ZCBA 1S8OA 3HDYA 3MGCA 3OFNA 3VNQA 4B3FX 1HEIA 2X22A 1MDBA 2ZDQA 1SUBA 2BE9A 1J2JA 1UMCB 4K40A 1JQKA 3DMGA 3F5MA 3LPNA 2Y27A 3NOBA 5H9WA 1BCSB 4L28A 4MWDA 3E0XA 4LF7B 5AW6A 2ZJ7A 2BKEA 4WKGA 3RAPR 1DNPA 1H3NA 1IXKA 1PS8A 2JUOA 5J17A 1K7EB 3DO8A 1NX9A 4Q9HA 5JG7A 3CEAA 1FXIA 3TD2A 2IL1A 5AM4A 4IQFA 2ZJ0A 3CKLA 4M1QA 4D3YA 1IBMB 4J0FA 4KU4A 1ABBA 1AH2A 2FWIA 2UZ3A 2XKAA 3OE7D 1GTJ1 1E32A 3L0WB 3PPAA 1T4CB 2RGFA 4FHFA 2CBGA 2P2YA 4TWBA 3TL6A 5JJBA 2MJEA 2JHCA 2RDGA 4UMDA 1C8LA 1SA0A 2BGKA 1JCKB 1X80A 2R6R1 1N7GA 1YVDA 4MH8A 1XU7A 1C9MA 1OY1A 2RDBC 1WEKA 1JP7A 1WE6A 1GJRA 1WD7A 1ZIPA 1LVHA 5BWCA 4PYJA 4KFSA 2BVCA 3EF0A 1BN7A 1AX9A 2FBWB 1QO7A 2CVFA 1NYTA 3HXLA 1UBEA 1H42A 1NUTA 1YIAA 3G85A 3JYQA 4GVPA 5LQKA 1OD6A 1EJ6A 4TS9A 2ARKA 3WRWA 4JX8A 3HYRA 4GIVA 3IQGX 3HKCB 1R3UA 3PXCX 3SBLA 3FNEA 1JDSA 4TVSA 1RS0A 3CE9A 3F71A 4YV7A 4DHJB 3I13A 1SJED 5K3EA 3BMNA 1KP3A 3Q5DA 4A6EA 3WZLA 2HTHA 1Y8RB 2ACKA 1RNLA 4FNMA 4LJSA 2D2IA 1RHJA 2FNAA 5KVQA 1A8UA 1VPEA 2Z0EB 3RUEA 4DM4A 4EJFA 2O7QA 5LPNA 3TNJA 2QR3A 4UAUA 4IF6A 5HF8A 2X15A 3I14A 3U19A 4P3OA 3HB7A 5E3IA 3RHZA 1YKSA 3R6LA 3BWXA 4DNPA 4D0NA 4BFXA 4RTQA 4AKGA 1H8HD 1T5HX 5AFSA 1VJTA 4AKHA 3TOXA 2FLVA 4PC7A 1X1SA 3E7WA 4AG6A 4CI0B 3KFXA 4JUDX 10MHA 3PJRA 2HCFA 2PVCA 3DOOA 4HWSA 3AESB 4C09A 1T3LA 2BM9A 4J8PA 4IMRA 3NO4A 4CEIA 1O6FA 2YNVA 2FP4A 3S0JA 1HPLA 2OD7A 4UWSB 1M4VA 1T29A 5THQA 1YQ4B 3AM9A 3EPPA 1VG1A 5EIBC 1WYGA 2DWUA 5EJ2A 5HIJA 2XUOA 5ICFA 3ZDBA 1Z5ZA 3DL2A 5CLHA 4DIOA 3HU3A 4M99A 3DAPA 5ALVA 4PPFA 1RPZA 1RE1A 1FK8A 2R751 3HJBA 4PT5A 3N5CA 4HDRB 1ZEMA 1V80A 1ZP6A 3B2EA 4NU5A 4XDGA 3RTGA 2L1AA 2MA9B 4DYHA 3AV3A 2BPSA 2G0AA 1AWDA 4KSLC 1YZLA 2JIDA 2SKCA 1Z45A 2W98A 4JBWA 1YS6A 3E84A 4WOCA 5ALHA 5BT8A 3I62A 1JJFA 2YNTB 3BGSA 2WXHA 5AM1A 1KZ1A 2ZAGA 1E7VA 4ZAWA 3ONSA 3KUUA 4FOSA 2V4IB 2TYSB 2FN3A 3W9BA 4AU1A 4ZCTA 2H07A 4I7EA 4D2KA 1MQAA 4HB2A 4LTMA 1C5KA 2ZIWB 1P7EA 1QH0A 2FMUA 2FWPA 3KTOA 4DLPA 1FXWA 5FBQB 3T9CA 1E1MA 1UAAA 2PSEA 3RC3A 1DOIA 3HM6X 2RR9A 2P67A 3BBLA 4L5AA 2W6MA 1GTG1 4A6XA 1FL9A 5F78A 2QHXA 4MQMA 4I1IA 5FWYB 2EELA 3IVRA 1PJ3A 5H70A 4JMPA 4PHCA 4PPYA 1IPHA 2BGUA 4BX0A 1BFUA 2CLCX 2HBRA 3FB1A 4FEAA 1YMUA 4YRIA 2C7PA 3BMCA 2RHCA 1IUNA 2AFIA 4AFNA 5BNWA 2PDAA 1G5RA 3M89A 3H8SA 2CXHA 4PS0A 4UTNA 3ZDDA 1ZUNA 2IDJA 3GVCA 4YJ3B 2GD0A 2V0GA 1XU9A 1QQ6A 4D9FA 4PVOA 4KV7A 3RODA 5KMGA 3C3YA 4BKQA 2HJ8A 1R4MA 2Z0MA 3CZRA 1P19A 3M4XA 3ZVMA 2HR1A 2GBFA 1V1OA 5IJ0A 2FW7A 2JIZD 1LUAA 4JLKA 1U7OA 3T61A 2KHZA 4QYTA 2BR4A 2A78A 3ZCVA 3GLKA 2J3JA 4CDGA 1FYFA 1E3QA 2Z4TA 3TFOA 5FTJA 3Q8CA 4ZYNA 4CQNA 1G3MA 3N7AA 1M2OB 1I10A 5C4IA 3JSVB 5KIAA 1T10A 1GRRA 2YZ3A 1TFUA 4XCXA 4KKIA 3IEMA 2Y5CA 3JQGA 3A9JA 1O6BA 4PHTA 3A8TA 3NORA 3PITA 5FI0B 1D6JA 4KKXB 2AOWA 2ZT6A 2HADA 5KINB 4FK8A 2QWXA 1ONBA 2PGIA 2UYOA 3QX7A 2M5DA 3HYTA 2PE9A 5J2UF 4FJZA 4GWGA 4FOPA 5EZYB 2OUIA 4KQIA 4F0JA 1BE8A 1X8GA 5EQDA 4D1VA 1SVNA 3MTGA 1OZAA 4TS1A 4ZO8A 1Z74A 3OQOA 4FHJA 4KZ0A 4MHOA 1QG4A 2GBLC 1ISIA 2C98A 2UZ0A 3OJWA 5NULA 3RFTA 4BRZA 2QJLA 4E1BA 3UHAA 1X1MA 4PYUA 2FTKE 4XSVA 4LWPA 5A6SA 4E4YA 1HE1C 4IXMA 5ALNA 4XR4A 1A9ZA 3EUWA 3CH4B 3ZWYA 4AX4A 1JX6A 2GUGA 4KGVA 3DGEC 1NVXQ 1QHFA 4JLJA 2VHVA 1FJ2A 1KY3A 3C70A 3U30A 1M7GA 1P44A 3DEKA 2OESA 3NXSA 3OOHA 2QAJA 4D41A 1OPXA 4BOSC 3H42B 3T7JA 2RBGA 5B4TA 3X1MA 3CNBA 3BK7A 4S2EA 3WYNA 4E07A 4RL2A 3TW0A 1AUOA 3B6IA 2EZ9A 3FCOA 3GE3C 4RA9A 2Z3WA 3BC2A 2IIVA 2FPKA 4I6LB 1V48A 3GJ7A 1SG6A 4KE8A 1YT5A 2C4KA 5AJYA 1FP4B 3KLPX 1UZLA 3U7QA 4E1VA 4KB5A 4IGAA 1SMLA 5KAPA 2QTMA 5IO9A 1OU0A 2YRFA 4ZDJA 2YBEA 2CU3A 2KX0A 1F9EA 3FLMA 3JPWA 4J3JA 4CF3A 4ETNA 3JXEA 1KOGA 4EMUA 4OOFA 2JH9A 3WGZA 2EKEC 3ROGA 4BGVA 3H04A 2CNNA 2J6BA 1RWSA 3CRZA 3LKBA 1XCPA 1VE1A 4GZLA 4MUEA 3Q2IA 3NNSA 5DHFA 4KXUA 1SN7A 2H3EA 5JMPA 1P17A 1C78A 1B4DA 2PV0A 3FPEA 4BMCA 1M2FA 1GL7A 1L5GB 3QA3E 1Z7BA 4MPTA 3U4DA 3W1YA 1E1YA 4O59O 1LLFA 3G7SA 1VLBA 2AXNA 5LYJB 4LXGA 1SQSA 1E60A 4PAWA 1ET9A 5GVSA 3THWA 4ARIA 1AHIA 1M2EA 1YACA 4Q3CA 2Z56A 4CDMA 9LDTA 5JQGA 1O3YA 4ZQIA 3EXHC 3MOIA 2QN3A 2C5GA 3MMNA 3BKWA 1O7JA 2PGJA 3PUIA 3DM5A 3RU3A 3UVEA 5MGNA 4RULA 2Q4DA 1JR3E 1R7SA 2FZEA 3CJRA 1XN4A 3PL5A 4IJWA 2GFKA 3FAHA 2HHJA 1V25A 3G8AA 5TQ2A 1OROA 2IZOA 4XWGA 3DA8A 3RU2A 1BE6A 1UBNA 1DKRA 2EHJA 4O2LA 2CKDA 1RJEA 1MO2A 1Z0AA 2QMYA 1FFGA 2BH9A 3F9IA 1QRAA 1M1XB 1P9DU 2WPNA 5FF9A 5AVUA 4KQCA 1L5WA 3DZ8A 2G76A 5E4YA 3QXJA 4KDLB 1WCYA 3RFFA 4LJ8A 2PUWA 2UVDA 4J2HA 3QXXA 4DDUA 3U7IA 5AQ1A 1EQ2A 1U0HC 1GZ3A 5AKJA 5JZBA 3FIUA 3I6IA 3WGJA 4TUYF 3UCXA 1O5OA 3GJ4A 2Y67A 4RPLA 3UJPA 4G84A 5D6NA 1RWVA 2VPZA 2XMSA 2XWPA 4CFZA 1QH8A 2GVNA 4B83A 4DEXA 5TGDA 1D4OA 3NHMA 2BF8B 2C00A 4LG1A 5DPMA 2A0KA 2EJWA 4U2KA 2BHTA 1AZLA 2K8CA 1N2CB 3OQHA 3A70A 1S9HA 1HE4A 1QC5A 3NVVA 4WWPA 1SM4A 1EE2A 2JJ1D 2O3UA 2RMKA 3KHKA 3OD5A 4WZ6A 4GDKA 3R5KA 4JLUA 2V7GA 1WX1A 3CIOA 1FC0A 3W4KA 1U3UA 2GSWA 3AZPA 3WK9A 4UHJA 1GADO 4CEJA 2DTDA 3C0KA 5CA0F 3IHWA 3M70A 5DCUA 2JRCA 1V6EA 2XCOA 5LQCA 3O21A 4ON9A 5KJEA 4DY4A 2NYPA 1GKIA 2DP4E 3DBRB 1LTQA 3SD9A 2L00B 2X7HA 3CZ5A 3IKVA 1IZ7A 2QEJC 4I1RA 1JQ4A 4OAPA 3LM8A 3R3YA 4X6XA 4DILA 1NN3A 4Z7NB 5JBNA 3FRJA 1KI7A 3T5MA 4AL4A 5CGQB 4GG1A 5BOVA 2J5BA 2QE6A 4OX9Y 4GAEA 4H9GA 3H6NA 2G71A 4US0R 1T3SA 6ADHA 3ELDA 1U7TA 3V97A 1WZCA 5EHZA 2BS3B 3CPSA 3EXFB 3PKZA 5HIOA 3SYRA 2W4MA 3FRHA 1I80A 1SC4A 1ZWLA 2FPIB 3QELA 4LOAA 4WKBA 5EESA 2WR8A 3W5SA 4BX9A 4HZUA 4BQIA 2CLFB 5EWMB 2H85A 2H8KA 2JF0A 1MO3A 2V3VA 4XLZA 2YYAA 4JYZA 1QO0A 2X8XX 3ICCA 4JDPA 1T24A 1G3QA 3I04M 4N4AA 4OQEA 2BW0A 4OJNA 2VZKD 4DA4A 3KRTA 4C76A 4W8OA 3UHOA 3VHRA 3D4NA 2Q8PA 1QE0A 3W7VA 4R2XA 2XB2A 4B17A 1HX7A 3WLIA 2WSIA 1OTYA 4PWZA 2HMWA 2ZSAA 3NW9A 3D3WB 4P54A 1ZITA 2PG3A 3TUZC 2V9PA 1ZMBA 3STUA 2VPQA 3ET5A 3OQIB 2I6SA 3AHFA 5EC8A 3NV9A 3IBCA 3OC6A 5JZVA 3TFQA 2G06A 2IP2A 4NBKA 5IX8A 3THYB 3AI1A 4ZO7A 4F5WA 1GG3A 1FU4A 5ECDA 5FI5A 3P4XA 5H81A 4DSNA 1KR2A 3A0UA 3B70A 3TAXA 4ILEA 2R8BA 2ZKIA 2ZSDA 4UPDA 2WM9B 5LYYA 3ABSB 4NR0A 2YFQA 1H9CA 5CFQA 3F5QA 4HAWA 3VISA 3EWNA 3ZRCA 2FYTA 3ONFA 3GEEA 4FNAA 3V4PB 3MUNA 4JBLA 1EVKA 4KI7A 3NONA 5FNVF 4GOXA 3UM9A 7REQA 2IQIA 2YINC 2ZB3A 3DLAA 3LP8A 3RT9A 3ANXA 2CHXA 2ZJ3A 1N25A 3O4FA 1VSTA 2HLDA 3WK8A 3L8ZA 2P2ZA 3QITA 4K6MA 1XN1A 3SSOA 3QX3A 4OGFA 1G64A 1Q1EA 1XXHE 3LE8A 3WLJA 1F52A 3K0SA 1OGYA 1SUWA 4XIIA 4XWWA 1AURA 1XDSA 1DRVA 1ZS9A 3NWPA 4NYMR 2FK8A 2HRBA 5LDGA 5DWVA 4RJLA 1UJ6A 1UR5A 1IULA 1JLKA 4AD8A 4YUXA 2JZCA 4CCAA 1JH8A 2DY0A 1E8WA 2KQ7A 1Z6TA 2Y99A 5KTKA 4MM3A 2GM9A 2FN8A 1CQWA 3I9FA 2NUAB 2IWRA 1QGDA 2PHZA 3K2IA 3BD7A 3QFFA 4RZQA 5JJIA 4E70A 4I5FA 5KUTA 4ZVOA 3TNYA 3ZWCA 3U4HA 3S5UA 3KJGA 5PNTA 1AMNA 4UZSA 3P4QB 2VR1A 3E81A 2ZZIA 1ZGZA 2VAVA 2IVZA 3NV7A 1ZSYA 4R05A 4QA9A 1HY3A 1NSFA 3OJOA 4A6QA 4N0PA 4B6PA 4XYBA 4BQNA 3U7GA 2ODEA 1SXTA 4KKJA 3U52E 1X0VA 1K8ZB 3KOUA 1KBZA 1B8NA 1PL0A 3AHHA 3KWMA 4ONEA 2DZIA 2LGYA 3VXKA 3VKUA 1WTCA 3A06A 4D25A 4TZTA 1Z06A 4R54A 5REQA 4DIMA 4ERXA 3U2QA 3RSZA 4Z9YA 4HQOA 2Q62A 3G49A 4XD2A 2G9QA 2KANA 1BA3A 1QAOA 3M49A 4MVJF 4U9UA 4XQEA 4BLPA 1KEPA 2I3BA 1SUSA 3U3DA 4A36A 1ZUD2 1PFGA 4Z3KA 3PREA 1YBAA 1Z2CA 4UNQA 5C3UA 1TZBA 3U8ZA 3BWYA 3CUYA 2Q0SA 3IJRA 3OEYA 4AJPA 4Z4HA 1G5FA 4CQMA 2H8GA 3DHEA 2Z9BA 4G0YA 4K6KA 1HTBA 2ZVNA 3PUWA 1R6UA 3GGPA 1EFPA 4Q3BA 4MR9B 3QKRA 4U39A 4GU2A 5EE9A 3K9FC 1KI3A 5GJBA 2BD0A 3KWLA 4G5OA 4JLOA 2WM8A 3KKEA 5AZFA 5DHQA 5C7OO 5AVZA 3DMFA 3V3XA 2LCFA 2Q3CA 4OQDA 4Q9KA 1DRJA 5AVTA 2JNWA 2UKDA 2C7NB 4JT9A 2DHZA 3JRWA 5I47A 4D1WA 1UKEA 2QF7A 5FQAA 2NXWA 2GXQA 1DOHA 4JLSA 3WO1A 4PAMA 2P9QA 1EEHA 4L5IA 4ARUA 4EGFA 1TYBE 2WXPA 2D3WA 5K3DA 4A91A 3VZQA 4LNIA 2Q1SA 4CLEA 4LJOB 2DBRA 1NXTA 3OP4A 4OEHA 5D3MB 1J90A 1UZAA 1ZIOA 2FGJA 3RS3A 2GPSA 1FTWA 1RQXA 3X1XA 1FDTA 1R0KA 3QHPA 3K09C 3NY5A 3RAJA 3RSLA 4RAOA 1W30A 4HTAA 1Z6PA 3CGGA 3H75A 1UDCA 3EFUA 5ALEA 5IBPA 2G4DB 4HDRA 2VBIA 3TUIC 2C5LA 4JJ6A 4F21A 2OYCA 4PR0A 1VTKA 3WV5A 4PC3A 2P4HX 4KGZA 1EWCA 3PUXA 2ZB2A 2NVWA 2F00A 5FPYA 3KV1A 4N5HX 5LD2C 1KNXA 5DCWA 4R2WA 4BJ6A 1YASA 2JLBA 2CYBA 5CVCA 5GPBA 4G4IA 1B14A 1JH9A 4K05A 3K4QA 4Y1FA 1U63A 1GL9B 4DKJA 1GG2A 1RZRD 1XI2A 5EHGA 3BH7A 4Y1EA 2DBZA 1XQXA 2JKVA 3B1WA 4PX2A 1RIFA 5DE3A 1MQ8B 5HCIA 3V6CB 4JJEA 3OT5A 1TM3E 3PXDA 5GP1A 2XKKA 1GL6A 2E7YA 2BFFA 4ZOLA 2Q9CA 2G1UA 2BBCA 1KPIA 4LUCA 1HNNA 4TWIA 1G5QA 3QA8A 2YNMD 3WYGA 2WXFA 1FYEA 2HGSA 1AQYA 3FC4A 1T1RA 2WUFA 3BMCB 4ZKEA 3TLGB 3ZGLA 5BV7A 1WETA 5ABPA 4PONA 3CWQA 1GZ6A 4DZRA 4BEJA 3CWZA 3WLNA 4IUYA 2BHRA 1KU6A 5TMBA 4MA5A 3K7EA 4OQYA 3CF6E 1VRVA 3A3PA 1DIOB 5JD3A 5CH5A 2GS9A 2I55A 4R8KA 1A7UA 4QU8A 3I76A 3L18A 3MCUA 2CFOA 1WZNA 2CJXA 3M6FA 5CNMA 4D4HA 3ZRFA 3EVBA 2C7QA 3W3AA 4P5DA 1KMCA 3LYYA 2RFLA 3FD8A 4NHOA 4NS4A 5ALDA 3WRYC 3ESCA 2Q6OA 3ORHA 1GFWA 1HDZA 3VPHA 1JWBD 2GZ3A 1RLOA 3P27A 3CNLA 4BKTA 4Q3AA 4KNYA 4P3PA 1MZVA 1CTQA 3JQGB 4QFBA 5D3IB 2WIBA 2M9MA 5BSGA 2IJ0A 1FU8A 4O5OA 1S8AA 4R2KA 3JVUA 1G38A 5JANA 3CF4G 4KNVA 3JWHA 3ZDTA 1NZFA 1C1DA 3BB3A 3HCPA 3QNWA 4EY8A 3K9NA 3HJUA 5DXJA 1W87A 4UEOA 3SXPA 1UL1X 1EFTA 1TU0A 3A1DA 4CKBA 2A5UA 3D5EA 4PGGA 1QH9A 4TSRA 4XA8A 1F2DA 4AJ2A 5KVCA 1LQTA 4Y2SA 1FMFA 5DPTA 3ZBPA 1I7PA 3R6WA 4IIDA 3HJAA 1R0RE 4D9BA 1DMSA 1XIVA 2C94A 1R4MI 2PXXA 4N6GA 4MHSA 2JLAA 3T9FA 1ZPSA 3LLMA 3OE7A 4HLCA 1EVIA 5CX3A 2WTUA 4J4HA 2CLOB 5HVNA 3F3SA 1JW9D 2INPE 2I87A 1SHLA 4GPEA 5JD6A 5LKAA 4LMRA 5TEWA 3KKMA 2QXTA 5J58A 2PZMA 2WXJA 1F2UB 1KY5A 3C3PA 4WVFA 2E2WA 5CIQA 4PLZA 1OJLA 4TZKA 2REBA 4GOKA 1PNTA 3G17A 2J3KA 3VNAA 4U6SA 3BQ9A 1SQ5A 1IBSA 1WQ1R 4FXCA 3WWOA 5KB3A 1WOMA 5HS6A 4YP6A 2FUHB 1JECA 1YR8A 1MO4A 4CKWB 2HLNA 2R8OA 4R9RA 4U5XA 3UGQA 2JFXA 2E1PA 1U2GC 1W94A 5IP5A 3EQ2A 4LJ9A 1JFTA 2WXIA 3DFZA 1ZHOA 3FTNA 2GZSA 5EZYF 4F5ZA 3OPYA 1FNBA 3DE4X 4FDMA 1K8RA 4OYHA 4AP4C 4I81A 4R98A 4NJMB 4WVLA 4KAJA 3SK0A 4Q05A 1FNDA 2A3NA 4LHXA 1GKYA 1H8CA 2VRCD 3D1JA 3K31A 3OLCX 4HDSB 5ALLA 5BW4A 3CO5A 1ZU4A 2XB4A 4W63A 2FSFA 3V42A 1D2HA 3ZY2A 1WB6A 4L8WB 1Q1AA 3GUVA 4ZDVA 1T1GA 3OKFA 4RFSB 2AI1A 5C8YA 1L7YA 1F1BA 4J03A 1DTWA 1H8HA 3QPBA 1ENOA 4NPNA 1JXOA 5LA6F 1Q20A 3BVGA 2C7MB 1ZK4A 4KXLA 5KOIA 1EQAA 1Z68A 2EV9A 1CJSA 1VI5A 2ZSEA 4FW9A 4GOND 4KQFA 1SBCA 3UZUA 1R6DA 2AH5A 1MR3F 3CZMA 1TEVA 2ZBEA 4LZAA 4LKOA 2FHXB 5C1BA 1G291 4D82A 2BC2A 5DIFA 5B6IA 4PC2A 1A5SB 3I1YA 1XTVA 2HSJA 3UT0A 4CBVA 1HR0B 1X8KA 3R0JA 4MR7B 4YJ3F 1LSUA 3CE6A 3SIXA 2YNUA 1FNWA 1GN8A 1I0IA 3GEPA 3GOHA 3AUJB 3SC2A 4ASUA 4CCSA 1AA6A 4LQLA 5DHTA 2PGOA 3UUFA 1F51E 2VWGA 2CCKA 4ZHQB 1Z0DA 3IJPA 1ZRMA 1O5TA 3L8CA 1V3TA 4JJFA 1DKLA 1BRTA 4HXYA 4M0LA 4BFLA 1AK9A 2UYZB 3ZCQA 1WYWB 4U7GA 5HMLA 1XMIA 4CVNA 3AU9A 1BSVA 1N2CA 1CIPA 1Y7IA 1QNLA 1KEEB 2NO6A 3FMOB 2Z1NA 3PNPA 4XXHA 3D1VA 4FHKA 4RUKA 1J39A 2O0KA 2DPGA 3CB4A 4AI6A 1NOJA 5KYUB 3BUSA 5FKAC 3CX6A 3ZY5A 3NIDB 4MRAA 2PZJA 4NP6A 1JTFA 1BMCA 5CP8A 4B8ZA 2J09A 3DBRA 4CM3A 1SHTX 2DRIA 4OJMX 5CA0A 4Q5IA 3SJCA 4ARSA 3K5WA 3NBMA 4YRNA 1P0PA 2O57A 1PVVA 4YRFA 4YCAA 4AY6A 3OLMD 2Q4BA 3PFBA 2PFGA 5EJGA 2BTOA 2I8LA 4KN5A 1ZKPA 4HL6A 3KCNA 4HEA6 5F4ZA 4TMFA 5A4KA 3I5YA 3AEQA 2KN5A 4W1SA 1P77A 2MINB 3DF9A 2CGEA 3W6UA 3SD7A 3WHLA 2QI9F 2J48A 2B21A 1PZFA 2RGWA 1MAUA 3QJZA 1V1MB 2RI0A 3DVAB 3L7BA 5E3JA 3QLEA 4J43A 4TUYA 3T7AA 2N9XA 4V1CA 3DE2X 1K98A 1KZ6A 2Q8QA 4N8SA 4NBNA 1N8SA 2CVPA 1XFDA 3B12A 3LUHA 4HZUB 3IVFA 2NO7A 3LGAA 3R9KA 3RV3A 4LNNA 1GNLA 1TO1E 3HUEA 2ESRA 2XDWA 1ISJA 1M74A 2GJ8A 4YGYA 2VQEB 1DBQA 5LXHA 3BL8A 4TSKA 2PMEA 3PQCA 4KIFA 5G53C 3H1EA 3SKYA 3RYTA 1OEYJ 3KFVA 3QIJA 4R2HA 4Q0MA 3LDUA 4C4ZA 4YMUA 1IYZA 3K0FB 5F7ZA 1PFWA 1ODTC 3O03A 4O4IA 4IIHA 5DNEA 3UXMA 4YRAA 3QPDA 2PX5A 3A7EA 1KIFA 3OSUA 2DETA 1PJAA 3WA7A 1X7DA 1F77A 3OLYA 1IHPA 3DOWA 2AW3A 4IMIB 4QOFA 4DFDA 3QVTA 2EFHB 4BJ5A 1U0SY 3NTXA 2QMTA 1HG1A 3KLOA 4GH5A 3RC9A 4XIJA 1IVYA 3WC4A 1JAYA 3HFJA 4UBOA 3DW3X 3GNSA 1RP1A 1L2TA 4RF0A 2LIPA 4HXGA 3VYRB 2PMBA 3O3MB 4K3CA 1ZGGA 3IEVA 3EC7A 5HILA 2LD4A 1AK2A 4FN2A 1ZNYA 2GFHA 4TL9A 5G5HA 1Q17A 1QYCA 3QK7A 1MB9A 1MVOA 1R6TA 3IV7A 3PNYA 3WYEA 3MBKA 2ZSBA 2R2QA 1WXHA 2ZBRA 1NKTA 3BB1A 1B1ZA 3QUAA 4C07A 4ZTZB 1UC4B 4UASA 4TLCA 1PT9A 3HP7A 2BHNA 4W9MC 1RMYA 7MHTA 1EP3B 3UMYA 3H3XA 4L08A 4N12A 4YPOA 3DV0B 3Q40A 4AMVA 2ATEA 3WGTA 3N2YA 1WXQA 1KQ3A 4ZOHC 2GZ2A 4H0FA 4FD3A 1XLPA 3UC5A 3PHHA 5TE9A 2XT9A 4HAZA 2VP2A 4XDDA 1KZ7B 1ODLA 4CIXA 3BICA 3GF4A 4DIDA 2AE1A 3C16C 1PR0A 5B1IA 4ZJYA 3U4QA 4HJKA 1AK1A 1FTQA 1NSTA 5IOIA 2HK7A 4B3CA 3V7UA 4C0BA 4JLCA 3CLUD 5DNVA 2XKJE 2ZBGA 3DUWA 3FIJA 4FGUA 3W8RA 2X9NA 3GA5A 2G4SA 2HCJB 1CR6A 4JR2A 1HEUA 4MM3B 1BMQA 3DJFA 3HA3A 4NK4A 1KJNA 2F1OA 3MUEA 3DPSA 3ZI0A 2ATXA 4ZC1A 4L76A 4OGKA 2FZ4A 1IUEA 1RRPA 3UC9A 1XLQA 1PBTA 4RGNA 1SXHA 1UPTA 1WMAA 1SWVA 1DAGA 2YV1A 3ONWA 1PEKE 4HLQB 4MS4B 5AUKA 3BFXA 4AXXA 2FWAA 1Q5WB 5CB4F 1KQPA 1KGDA 2P3LA 2WKWA 4GX1A 2IE8A 3ZI7A 1XTOA 3KUCB 2WJ6A 4V0NA 2BR3A 5HP4A 1ODKA 2R68A 3D3KA 1SUPA 3MWDA 1S8FA 4M46A 5J2TB 3VHTC 1BXKA 4MKZA 3DMHA 3CINA 4OPMA 3ZHOA 4H6XA 2NXNA 1MB2A 3F96A 3JD0A 4O63O 1VE9A 1R7RA 4EQZA 1EKXA 3C39A 2ZT8A 4PYZA 2ZUSA 3ESHA 3JZFA 3LUJA 4S35A 5E9WA 3GJZA 2OY0A 1QGED 1V37A 3QX9A 4I50F 5BN5B 1GNUA 2YOFA 1KTKA 2PJZA 2W6CX 2VSQA 4PX3A 4CLOB 4QGSA 3T7EA 1FLDA 4K86A 4IGIA 5JO9A 3HCEA 4XJSA 3B1ZA 4G0QA 1XTRA 3AEGB 4OHZA 5FRDA 1EP1B 3JAWA 1RTKA 3GLHA 3ANMA 3B6ZA 3BVZA 4EOGA 4BX3A 1I4GA 1VBFA 1CQIB 5TRTA 5IQKA 1LM8B 3VNBA 2A9OA 1NIPA 1XRRA 2ZTUA 3C7TA 4W7IA 4QDZA 5HK9A 2UZIR 1KMIY 3QKRB 2NYUA 4DJTA 5AVYA 2V6JA 4XLTA 4IDIA 1TUEA 2QQFA 2BFNA 3IAEA 1KP9A 3QLVA 1BVUA 3V48A 4WZBE 1H2AS 1BKYA 4FGSA 2CY0A 2D11A 1UP4A 2YFKA 3IPYA 3KOYA 4IUMB 1ES9A 4QUGA 5GONF 1F3LA 2LE0A 5K0LA 3HJFA 4G6ZA 1T2UA 3G2JA 2KWVB 1OZFA 2G67A 1KJ9A 2W8ZA 1CP3A 1CZNA 4RSMA 5HEKA 4F6LA 2VJDA 3ESQA 3T7DA 1FIUA 1OLSA 3OIVA 3QQPA 4UM8B 1PJLA 4W6QA 4ZT4A 5IVIA 4PAQA 1Z6ZA 1MTZA 3RHFA 1UNSA 4WCDA 3WIBA 3VQZA 4CKEB 2QJWA 4BPRA 3FZGA 4J9UE 5DBOA 3N2NA 2PEAA 4BP9A 4RC9A 3RVRA 5FTLA 1OPRA 3E70C 2G5GX 1JKXA 2EWWA 3OPQA 4HT3B 4I9UA 4CMCA 2NO1A 3OZFA 4TZEA 1DX4A 3EFOB 5EE5B 4X6YA 1TS5A 5ERYA 2O2VA 1OYYA 2Y1DA 3NOQA 3WBJA 2NWQA 3N20C 4RXUA 3Q6BA 4BKSA 4HWOA 4YP9A 4YUAA 2KTRB 4LHVA 4JODA 5DJ5A 1KPGA 4M49A 3QUQA 2D5AA 4C7MA 4IRUB 1RT9A 1J9EA 5F1OA 3CPHA 1VD2A 2Z2ZA 3SVZA 5E3HA 4DUGA 1J24A 2B9EA 2JFQA 4KODA 2IV7A 3GJ5A 5K8UA 3OCUA 2GN9A 5KYWA 4U3JB 1ISHA 2YV5A 1T8UA 2R62A 2R87A 3AUFA 4MJ3A 4OLHA 4QD3A 4GZMA 2MSEB 5G02A 3IQFA 2FU5C 4YT8A 4BWGA 2G1JA 1U0BB 2OLEA 5BMVB 1BDBA 2WUDA 5ITWA 5HJ5A 4D9EA 3BMOA 3L6CA 4RANA 1DCFA 3ZZ0A 4DIKA 3AVQA 3M6XA 4U7HA 3BWMA 5EMKA 3C85A 4JC4A 3BWEA 3GRUA 4DNXA 4ZZIA 1FW8A 2C9CA 1COZA 1E2QA 2N1BA 2VQSA 3JQ9C 4G1UC 4BO2A 1QP0A 1T8TA 3M8KA 5F12A 1EFDN 3FYTA 2PR7A 2HQ1A 1BC5A 2OXFA 3ODGA 4XFJA 3UPDA 3L7CA 3LQ1A 4TL7A 3VHLB 1PR2A 2X6TA 3HFSA 5D7NA 1T8WA 4L8LA 4P81A 4MTLA 1XZPA 1YC2A 4N01A 2H9IA 3DUFB 3KETA 1O54A 4HDOA 2Q8NA 3NG1A 5GJCA 2ZBQA 1GCOA 2PIDA 4KVGA 4C7XA 2GBLA 1PLJA 4GZ5A 4MWTA 1JA1A 3K9QO 4DGQA 3OJ0A 1QYIA 3UJHA 2PLPA 3VFKA 1GPNA 4C4VB 2I6XA 1UD7A 2WIDA 4NBUA 3DBHI 1BS1A 4IGKA 1C81A 4NQRA 5LJIA 4JO0A 4M60A 1E98A 3TRJA 2VK8A 3U3JA 4N6OA 5IKEA 4UA4A 1KMHA 4IWNA 2NO0A 4WWHA 3FX2A 4QC2A 1X1TA 2EG5A 2PXAA 3GP5A 3MHPA 1WXWA 3HPRA 3EMKA 2W0MA 5TGTA 3WNBA 1XZGA 2JBAA 5AKHA 4R3DA 1FNMA 3TKLA 4P1BC 4C7ZA 2BP7A 2EJVA 3NRBA 3RVQA 2ZTSA 4M9UA 1KF6B 4ICIA 4JDUA 4KXXA 2Z3ZA 3NHBA 5EP1A 4C88A 5AD1A 3EGEA 4CIVA 5K9ZA 4LY0A 1YQEA 4D9MA 2DX5B 1Q19A 4JLNA 5E6SB 5L3QB 2Q5OA 5ESDA 4QM7A 1WUPA 5DYGA 1LEHA 2VYVD 2R11A 4I6EA 4A0QA 1OAAA 4CHTA 5KYGA 1EP2B 3QI7A 3OH8A 3D32A 1CUHA 3FMIA 2MWSB 1QLHA 1JS1X 3Q8WA 4D4MA 3P1JA 4ER5A 2X9GA 3RSQA 2NVBA 1UCFA 2LRWA 5E4JA 1ZI9A 2FRVA 4MV6A 5LLIA 2A6PA 5DM70 5JRJA 1ZH6A 4GC9A 1GM5A 4ZEJA 1I7LA 4GP9A 4A27A 3V05A 1GV0A 2P9EA 3IP5A 1SB8A 4YFVA 4FZ5A 1T1EA 4ODIA 4C5CA 5JS8A 4FLFA 1IUPA 4KI0A 3IOGA 1RHKA 1RYHA 4HRSA 2P4UA 2VN8A 1V97A 2XWSA 2ZWIA 3HXTA 4LHYA 4E1AA 5IJ9B 4B0OA 1NBHA 3MTQA 1T0SC 3APFA 2XPCA 3KJHA 3GFBA 4K6GA 1J9GA 4L8FA 4UHKA 5SV2A 4F3YA 5L4NA 3R9XB 3OBBA 2DFNA 1J2RA 3I28A 4GXTA 4UNSA 2FM6A 2Z5VA 4CKWA 3LOQA 5BSVA 4P7JA 4UHEA 1DAOA 5KU1A 3SLRA 3SN6A 1V16A 2O9JA 1EUVB 3D6HA 2IH5A 4DSZA 1EMDA 3RT3B 1HSOA 2XZTA 1OHHD 1QZXA 3TQOA 1B8PA 2QMQA 3FCXA 4W9CA 2HSWA 5TR9A 2W2PA 5JD5A 3I0MA 4QJBA 4MV8A 2A7QA 4U8GA 3DE0X 1IQPA 3G0DA 4HDSA 4ZCMA 4JBYA 1EPUA 2ODAA 2PVPA 4IDCA 1QDEA 5KHOA 3F2VA 2CDRA 3LKDA 3B08A 3LMKA 4I4LA 5FP0A 3O0DA 2GTHA 2PKEA 4IRMA 1DC7A 1KA9H 1U9JA 1I6WA 2ZJ8A 3KOZA 4L4SA 4NYIQ 4U9HS 3RREA 3BWUD 1QFYA 3TSAA 5HJEA 3BHMA 2JD1A 3KBBA 4B7AA 2PMDA 4DHEA 5B55A 3VR4D 1DXOA 1AF7A 3BSSA 3IH5A 3BZUA 1JVNA 1O4WA 3PC3A 3TS1A 1UOQA 2ZTMA 2INCC 1B93A 2P75A 4TQAA 1X1DA 2J08A 3D54D 4U2DA 3L8MA 5AK4A 3EBOA 3P9IA 3CSTA 1VB3A 3RTAA 1DJPA 3VV3A 2I4IA 2O8NA 4YL8A 2PRJA 4MR7A 2A88A 2PH3A 1L3CA 2OXTA 3E9MA 1IE3A 3DOCA 3C19A 1ZXLA 2W00A 4JROA 4U8HA 4CL0A 4UC0A 1C0PA 2PX6A 1VIAA 3VR8B 1AKMA 2QZ9A 3H2SA 3KX2A 1G2QA 3P71T 2B98A 1M1UA 2Z6VA 1VI2A 2C88A 1KL7A 1FDRA 2AIRA 1IUKA 1TPZA 2X2PA 4Y8VA 4JASB 1I36A 3DT8A 4E4RA 3QUCA 1H6DA 3TKAA 2Q41A 1ZJYA 2WYUA 5HIQA 3OPVA 3AF0A 1NWCA 2J46A 4TS4A 2IYOA 4CF4A 3ODPA 3SOPA 3L3BA 4YH1A 1ZGBA 3CZAA 1D04A 1YZVA 1YA4A 3FGPA 3M34A 2K0PA 2VSNA 5FH9A 4CEHA 4F6CA 3PIIA 2DBYA 4HPLB 1TVKB 3HDTA 5G0WA 5SY4A 5I4IA 3WAJA 1J5EB 2MLBA 3EIHA 3BK2A 3EXIB 2P11A 3PHJA 2F90A 2R1UA 5D00A 5B1UA 3RWBA 4NABA 4ZO6A 3KJNA 4FXPA 3MPOA 4B4DA 2P1EA 4EVSA 2CKHB 3JQBC 1FJXA 3ZWFA 3ASYA 2QRLA 4EPTA 5BWLA 3WP0A 1SCQA 4K3UA 4Z7QB 1XZKA 2YNMA 3AEQB 3IQWA 1Y7HA 1E5XA 1W93A 2NO9A 3CWCA 2F8LA 3MF4A 2F3TA 4G11A 3W0LB 1CF4A 1FP6A 2II6A 4M54A 3LSTA 4RABA 5PGMA 1HLKA 1VFNA 2WG2A 2ZBPA 4E51A 4R8LA 1SFRA 5DTIA 2QX9A 2P65A 3JTEA 3KVVA 2GUWA 1K08A 3GX1A 3SS7X 4OFBA 4ZU6X 5BUQA 4Y6LA 4RL6A 5BYJA 3GVPA 2XK5A 1V49A 5ACPA 4B74A 1IZ0A 1MX9A 2N75A 4DM3A 4JU8A 1ORVA 2OOBB 4CU2A 3P4SB 4G2TA 4LTDA 5IVDA 2DUMA 5B3KA 5FHRA 1YZYA 5EWAA 1PGOA 2D54A 2VSFA 3DZCA 2O3SA 3LBAA 3ZU6A 4EXSA 3DBHA 1PS9A 1T35A 1CT9A 2QD3A 2E4WA 2AGVA 3SF8B 2R8PA 2F8TA 1DRUA 1QM5A 3PGKA 4FN5A 1TYGB 2YIVX 3HI6A 2G72A 3SMQA 2QL9A 5ACRA 2UUCB 1MH9A 5K6AC 1BHO1 1UT5A 1TX4B 2BY4A 1P2TA 1PWYE 3SQOA 3DE5X 5C37A 1QNFA 3VH3A 3A4SC 1TQDA 4B44A 5IVKA 2QR5A 3F5DA 4JL5A 2AG1A 3MWJA 3W5HA 2XVZA 3NDRA 4R8SA 3E0QA 2DSTA 2JD2A 3IA2A 4OA5A 1FZTA 3M6WA 4YMIA 2GEVA 4NAWA 2QX8A 4JR1A 4R2MA 2R61A 1R9NA 4MB2A 5EHIA 1MT3A 1FFUA 2CFCA 1AGRA 5BNFA 3QJGA 5DBFA 2IYTA 1GPXA 4UKDA 3O73A 4TROA 3NVAA 5DLQC 3EXAA 1KZHA 3FHTA 4KGTA 3DV0A 3WYCA 3ELWA 1EF1A 3GT3A 2BUAA 4UE2A 4G8JA 2WX0A 1EXWA 3WRYA 3CVVA 3P42A 1L8XA 1PV1A 2A1UA 4YGXB 4GF5A 3OEWA 3GUCA 2WJZB 3FFBA 16PKA 1Z4QA 2G1KA 2C4NA 3PQ6A 2RGEA 1D4FA 3R7NA 1O94C 3HMQA 3KH0A 1SU4A 5DTQA 3RBZA 3BRWA 5LXTF 2MHCA 2B0CA 2XMQA 1C7QA 1XTUA 4EZJA 2NNWB 1Y1RA 2QJTA 2WJJA 3AL2A 3CTMA 3GRRA 3D5QA 5E6RA 3IURA 3O75A 3R75A 3ZEIA 4EABA 4XX0A 1N9KA 3CTPA 2DFDA 1D0VA 2IKQA 1O4VA 2FF5A 4O0MA 1GTVA 1HMPA 1UPCA 4M00A 4CMIB 3HHMA 3LO8A 3UHJA 2LZ6A 2F9FA 2P90A 4YAWA 5LB2A 2QBYB 1C0KA 4INOA 1ULZA 1CF2O 1XPRA 3ZHQA 1NW9B 1UM8A 2REOA 4MSQB 4NENB 1RZUA 3LPDA 4MUHA 3V9AA 4I8XA 5DTMA 3AKZA 1ZKDA 2PLRA 3MD0A 3MINA 2FG7C 4XB2A 1OCEA 4XVCA 5EMHA 1A69A 1WI0A 2CNOA 4FHGA 1FFXA 3MTIA 4G0PA 1XU4A 2J4CA 5CNIA 1XP8A 1U8TA 1V1JA 3WGNA 3MMXA 3V4RA 3VR9B 1FQKA 4HNRA 3JAMA 4RM9A 3NEPX 4ZK2A 5JEDA 3A1UA 3FWHA 2I67A 2LASA 2C5LC 3ASZA 1GQYA 4F96A 4V0MA 3PNKA 3WWZA 2I7DA 1TK3A 1Z88A 3AK4A 4CLDA 3PTZA 2NYVA 3L0BA 3OZ7A 3JAWB 3EH2A 3ZWQA 5K4NA 1Y6QA 2P3SA 4IG4A 2ID4A 2ID9A 1N8TA 3RPFC 1TUGA 2CNWA 2DCUA 3N7TA 4QOSA 2PKRA 2B8EA 2Z30A 4BAZA 2FQQA 2QQ0A 1IWOA 3V46A 1VL1A 2FX3A 4R0NA 2OCDA 1FCCC 1AGPA 3DDUA 1T0QC 1NL3A 5CCDA 3SEQA 1N6ZA 2ZS9A 2C57A 4XD7D 3FSRA 2KDEB 3HRKA 3FPLA 5CDGA 5I7FA 2PWPA 5DRYA 4CCWA 3U4AA 2FPGB 1P61B 2YWBA 1QR6A 3PEEA 1D8TA 1HEYA 4JPSA 2DY1A 3NLLA 1K5PA 1YFZA 4P7FA 2KZRA 4Q3KA 1NVMB 3ZWAA 1NPYA 3HWRA 2PNFA 1ECJA 2HFJA 2VZEA 3PXUA 4PGMA 3ROFA 2OZEA 4F7WA 5H16A 1FTGA 2LGJA 1VDMA 4QU0A 1QANA 4RO0A 5SZJA 3WLTA 5ECWA 2N9UA 4MGEA 2RIRA 3PQDA 4M8KA 5A5ZA 3ZZTA 4ZEXA 2V7BA 4IW3B 2OWEA 1ZK1A 2O2HA 2QTGA 4IDPA 2R0QC 4XJVA 3FUVA 2LZ0A 4CIYA 1ZSNA 4DUYB 4YV2A 5C46F 3D6TB 2AEEA 2WDTB 2Y9MB 1TU4A 1V1RA 2AFHB 3HVZA 2ASVA 3WTCA 2QE7D 5IDWA 3DMPA 1GC7A 3T0IA 4E5VA 3PVLA 2DEUA 4R6XA 3BJIC 4ZRMA 3MNFA 1TRHA 2NU8A 4LXUA 3R3WA 4XUEA 4W9GA 1T5BA 1DE0A 3M1IA 3O2QB 1IWPB 4LQCA 4RKFA 4DCGA 3G0HA 2XCIA 3UYLA 3EF3A 1Y5NA 4HGYA 4IJ6A 4JP2A 3ZNOA 1PTJC 4C87A 4RAWA 1IMJA 3PZ8A 1D5XC 4HHEA 1CB7A 2VUIB 1L1EA 1XL1A 2QB5A 4BZZA 4YX9A 2NYAA 4WTOA 3KT3A 3BMOB 3DNMA 4PYKA 4XFKA 1UQTA 1KVTA 2OJWA 4J7CA 2NQTA 3NDJA 3HRDD 5C8VA 2N9KA 1F17A 4K9RA 3WXMA 2JLRA 2EGUA 1N2OA 1WNTA 3QX1A 3VDZA 3IDZA 3L54A 2R6AA 4KV2A 4PAOA 4LOIA 1TT7A 2V54A 3HZOA 1C3LA 1G4AE 3K3PA 3WGIA 5TLSA 1YOVB 1YS4A 4RF5A 5THXA 2BFMA 1C1HA 4P4LA 2EEZA 2OGWA 4PCVA 3HWSA 5A6VA 1N63A 2WWHA 2D13A 2H6EA 4KVGB 1Z3IX 3AHIA 1KFYB 1QK4A 3K6RA 4HCJA 3GLRA 2OCXA 3LFUA 4BE4A 4JOSA 4KEQA 1UBLS 2PSFA 5T67A 1L7RA 3AY0A 3I6BA 1LFDB 4W9JA 1F2VA 3CLVA 4GRDA 5IPFA 5H3HA 4B79A 3ZCTA 1V71A 2BFPA 1PDVA 3FFTA 3MUOA 3DZBA 4KQ9A 1DVRA 4NE9A 3ZDZB 4DA8A 4RFLA 3I2GA 3ESRA 2I2BA 3HM2A 1L5OA 2H57A 1QO9A 3EA0A 4N0MA 3G0BA 5J9FA 2PZBA