3BK2A

Crystal structure analysis of the rnase j/ump complex
Total Genus 168
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
168
sequence length
549
structure length
549
Chain Sequence
QDHVEIIPLGGMGEIGKNITVFRFRDEIFVLDGGLAFPEEGMPGVDLLIPRVDYLIEHRHKIKAWVLTHGHEDHIGGLPFLLPMIFGKESPVPIYGARLTLGLLRGKLEEFGLRPGAFNLKEISPDDRIQVGRYFTLDLFRMTHSIPDNSGVVIRTPIGTIVHTGDFKLDPTPIDGKVSHLAKVAQAGAEGVLLLIADATNAERPGYTPSEMEIAKELDRVIGRAPGRVFVTTFASHIHRIQSVIWAAEKYGRKVAMEGRSMLKFSRIALELGYLKVKDRLYTLEEVKDLPDHQVLILATGSQGQPMSVLHRLAFEGHAKMAIKPGDTVILSSSPIPGNEEAVNRVINRLYALGAYVLYPPTYKVHASGHASQEELKLILNLTTPRFFLPWHGEVRHQMNFKWLAESMSRPPEKTLIGENGAVYRLTRETFEKVGEVPHGVLYVDGLGVGDITEEILADRRHMAEEGLVVITALAGEDPVVEVVSRGFVKAGERLLGEVRRMALEALKNGVREKKPLERIRDDIYYPVKKFLKKATGRDPMILPVVIEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural insights into the dual activity of RNase J
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Hydrolase
molecule keywords Metal dependent hydrolase
total genus 168
structure length 549
sequence length 549
ec nomenclature ec 3.-.-.-:
pdb deposition date 2007-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07521 RMMBL Zn-dependent metallo-hydrolase RNA specificity domain
A PF12706 Lactamase_B_2 Beta-lactamase superfamily domain
A PF17770 RNase_J_C Ribonuclease J C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.580 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3bk2A03
3.40.50.10710 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Metallo-hydrolase/oxidoreductase 3bk2A02
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 3bk2A01
4D1WA 1Y44A 2Q42A 5A87A 2E7YA 2M5CA 3KNRA 5LS3A 5K4MA 4C1EA 2YNTB 5LE1A 1SMLA 3H3EA 2YNUA 5ACVA 4H0DA 1WUOA 3Q6VA 3IEMA 2P4ZA 2QEDA 3IDZA 2BR6A 2WYMC 3I15A 5LCHA 4HL1A 2I7XA 1DXKA 3LVZA 2Y8BA 3IELA 4RL0A 5ACPA 1WW1A 4CHLA 3DHBA 2ZWRA 2Y8AA 4HL2A 4NQ2A 2OHJA 3ZNBA 2OHIA 5A5ZA 3X2XA 2NZEA 1VGNA 4P62A 3SW3A 4J5FA 2BFKA 2BC2A 5HH5A 4KEQA 4YSLA 3IE2A 5K0WA 1BVTA 3ADRA 5EH9A 2M5DA 3PY6A 2GCUA 4EYLA 3FAIA 5EVKA 3A4YA 4JO0A 4GCWA 2YNWA 1X8GA 1K07A 2BIBA 3SFPA 2FHXB 2WYMA 1A8TA 3IEKA 2QDTA 5AYAA 5EWAA 1MQOA 4Z7RA 2BMIA 5ACRA 1P9EA 1QH5A 4DIKA 4RM5A 4EXYA 2FK6A 4AX0B 1JT1A 3I13A 4UWRB 3BV6A 1A7TA 3X30A 2AZ4A 2BG2A 4RBSA 2YNVA 1XM8A 1JJEA 3DH8A 1E5DA 1YCHA 3BC2A 4F6HA 2Y87A 4V0HA 3AF5A 4UWOB 3R2UA 4EXSA 4NQ6A 5EV8A 3FCZA 4AWYB 1VJNA 3T3OA 1KO2A 5ACSA 3IE0A 1YCGA 2P1EA 4O98A 4ZNBA 3SBLA 2QINA 2BFZA 3SPUA 4UAMA 3X2ZA 2FU7A 4ZO2A 1M2XA 4GYQA 3ZQ4A 5LSCA 3S0ZA 3VPEA 1VMEA 2FU8A 3MD7A 4UWPB 5LM6A 4B87A 5B1UA 1L9YA 3PY5A 5HIOA 3IOGA 4EYBA 5ACWA 4C1CA 2WHGA 2NZFA 2Q0JA 4Z5YA 4XUKA 5KILA 3QH8A 5HIPA 3KL7A 4U4LA 4NQ4A 5K4KA 2I7TA 2VW8A 1YCFA 4TYTA 4RAMA 5AHRA 2YNVB 1JJTA 5HIQA 4D02A 2ZZIA 2P18A 3PG4A 2GFJA 4GYUA 5ACUA 5FQBA 4TZFA 4BP0A 5LMCA 3ESHA 5ACQA 4EFZA 4EY2A 5ACXA 3AF6A 4RAWA 4TZEA 3VQZA 3JXPA 4RL2A 3DHCA 2BFZB 4BZ3A 2UYXA 5HH4A 3L6NA 4F6ZA 3RPCA 4TYFA 5FQCA 3WXCA 4HKYA 4Z6XA 5B3RA 3BK1A 2NXAA 2GMNA 2CBNA 2YCBA 2YNTA 2BG8B 5AHOA 4C1HA 4UWSB 1ZNBA 2R2DA 3SD9A 3I11A 5EV6A 4J5HA 2A7MA 3IE1A 4AWZA 3I0VA 5AEBA 2XF4A 5IQKA 2OHHA 2YZ3A 4FEKA 2XR1A 2NYPA 4Z60A 4KEPA 4C09A 4UA4A 1KR3A 2BTNA 1HLKA 5EVBA 5K4NA 2HB9A 3RKJA 3P2UA 5A0TA 1ZKPA 4C1GA 4AD9A 5EW0A 1WUPA 2FU6A 3SRXA 1ZTCA 1DDKA 4DILA 2DKFA 2I7VA 3ZR9A 4ZO3A 4C1FA 1WRAA 3X2YA 2H6AA 5FQAA 3IOFA 1DD6A 1X8IA 5KIKA 2DOOA 3AJ3A 5DPXA 5B15A 5HISA 4FSBA 2FM6A 5EVDA 3T3NA 2P97A 3BK2A 4XWTA 4PVOA 2ZO4A 2BG7A 5AXOA 2WYLA 4TZBA 3F9OA 3TP9A 5A0VA 2ZNBA 4D1VA 3ZWFA 5LLDA 5AXRA 3RKKA 5HH6A 2Q0IA 4WD6A 4Z67A 1X8HA 4UBQA 1BC2A 2GFKA 2GKLA 4YSBA 2Q9UA 4YSKA 4C1DA 2FU9A 4PVTA 2BFLA 1QH3A 1KO3A 4EYFA 4D1TA 2FHXA 4AX1B 5EHTA 3G1PA 1XTOA 2BG8A 1BMCA 2WRSA 5ACTA 2QJSA 3KNSA 2QDSA 4TZ9A 3I14A 2AIOA 3DHAA 4NQ5A 4D1UA 4Z5ZA 5LCAA 5LCFA 2BG6A 2BGAA 4FR7A 4ZEJA 3T9MA 4LE6A 4XWWA
chains in the Genus database with same CATH superfamily
2F8MA 1Y37A 4M36A 3VR6A 5BOSA 1P7WA 3PR2B 1J8CA 2PG3A 1AC5A 1M8KA 2I1VB 2Q5JA 4H60A 1A9PA 4LBZA 4TWBA 4D81A 1JRLA 2X1LA 2E7YA 2Q3BA 2WHQA 2XLCA 1AV6A 3Q5EA 4KMSA 4OL0A 1VKNA 4F8CB 2GF0A 5KYVA 5HK9A 4KXXA 4WKPA 5JS8A 2QXUA 4Z4FA 4ZQIA 5B6IA 2ECFA 3E22B 4ZRIA 4FP9A 1UKBA 1ZEMA 5CTAA 4HFMA 4ID9A 2VRCD 3W4KA 1AXEA 2BWFA 1LUAA 2QX9A 4WXHA 2UZAA 4A6PA 3DCJA 2G9QA 4LQCA 2FR8A 2OBYA 4PLVA 1T3TA 2OG2A 1YIDA 1A2QA 1TKBA 4KQKA 2CEAA 2O2VB 2ONZA 3L8DA 3LL4A 1AVTA 4YHBA 1J0GA 1ANKA 1XCGB 5JXJA 1OYOA 5J2UA 4YUYA 5K3OA 2ZYHA 7AT1A 4A3OA 3MCVA 1XXGA 4I3GA 1QQBA 1PT5A 1L5SA 1TTQB 4KSYA 4PRYA 5H82A 3UK7A 4BXOB 3BA6A 4M53A 3R4CA 4N01A 3AERB 3U31A 3DL4A 1GL3A 3JYUA 2PXXA 4QU8A 1DC3A 3JD4A 4REMA 3BIFA 1ZUHA 1Q5WB 1F5NA 2XY4A 5K3FB 4D0LB 1E8YA 1A4RA 1G7SA 1JTVA 4I5FA 1Q21A 3EXG2 4N9QA 4FFBB 1P6QA 2JHFA 5GONB 4KITB 1EQ2A 5DCWA 3GJ8A 1A0OA 1AKEA 1L8AA 1M6HA 2BAGA 4OPMA 5CRIA 1AB5A 4A6DA 5JXHA 1OQQA 3KSBC 4HPLB 2Q3EA 4YJFA 3IUPA 2WXHA 4QKQA 2ZUSA 4W4TA 1AGNA 1ZQ1A 2N1WA 3OP1A 3OZRA 3ZGYA 3LLVA 1SUEA 2ERCA 4HMQA 4K2AA 4U7WA 5KCZA 3ZCPA 3N1ZC 1ZK1A 1X1MA 2FCQA 2QVYX 3LX4A 3VHRA 5IJ9A 2J0SA 4EP1A 2UU9B 2X6TA 3LKZA 4HLUC 4G37A 1RC8A 4GXRA 1XGKA 4JP1A 4IQ8A 2ZZKA 1SBYA 3QARA 4O4HA 1W88B 3A1WA 4LF7B 1R9GA 3HL4A 3L6DA 2C2ZA 2IHBA 4L1KA 1TEVA 4DHJB 2PUCA 1S7GA 3INRA 5FYQA 1PJSA 4W1RA 4ZVKA 1V0JA 2C7PA 4JYBA 1K7FB 1FW6A 4C21A 4ZYZA 2UXDB 3GLKA 1MNAA 1ACCA 3PY6A 2XA9A 4C6TB 1UBUS 3R3XA 5CVEA 3KR1A 4YIKA 3UYKA 5JYEA 2IBTA 5H8YE 2X13A 3JARA 4BC1A 5AW7A 4ZI7A 4RA6A 1BW9A 5BYQA 4XWOA 4LY9A 4UDYX 1ITZA 1G16A 1TFUA 3N0TA 3QOFA 4HNQA 3O4VA 4IUYA 2ORIA 4CV1A 1DBQA 1VGQA 2GF2A 2JBWA 2O2XA 5C5DA 4B3RB 4LE0A 1U5AA 3SVZA 4LUCA 2AHOA 1PZXA 1YR6A 1TTPB 4MR8B 1J24A 4ZEMA 2Y1XA 5E7JA 2XHZA 1J0BA 5JADA 2ANCA 5F2NA 1OXMA 1HDGO 3JWGA 5IO9A 3QHAA 4RGOS 4RF3A 5JD3A 3E15A 4PZPA 3O1JC 4UNRA 1THZA 5AYAA 1CRQA 1I3KA 4LOLA 1IOWA 1HE1C 3I5JC 3QIJA 3D6FA 3K15A 4H59A 2BTEA 1Q6YA 5BQPA 3SLGA 3WMEA 3U60B 2K25A 4Q34A 4R2JA 4YLYA 4KE9A 4G23A 1B3RA 1QOFA 3HUIA 1DC7A 2IY0B 1OI7A 2YYAA 3I0ZA 3GUCA 3CR8A 3P2OA 4HGYA 2C7BA 5F5NA 2V9HA 3CH7A 3S2YA 3A1NA 5AUPB 1V7QA 4NE7A 3GLIE 2VHJA 1Q1GA 4TKZA 1CVIA 4AKSA 4G2NA 3AR2A 1K2WA 2FK6A 4N5NA 4JX9A 3C7AA 2XCTB 1WKVA 4Z6KA 1HLGA 3NT5A 4PXAA 4I6JA 3PHGA 3IIJA 3OOWA 4L4XA 3YASA 4UU1A 3W5VB 4WPGA 3BXZA 5C1OA 2GCIA 4X84A 3F6RA 4QFCA 4F6RA 3KQLA 3P1JA 1DO0A 3LWBA 3N9IA 1T5HX 4FCVA 5CCDA 3MLEA 4F3TA 3BZUA 3FFXA 2N9LA 3ETRA 1MIOB 2DU8A 4FOLA 1C9MA 3Q8CA 1G7TA 1UMDA 2WXOA 4A8XC 1JDVA 1L1EA 1P73A 1PL8A 2GFIA 2UUPA 3DH8A 4OI1A 5JJIA 4NIMA 3RC2A 1QP8A 4JP5A 1KOJA 4PPNA 3FWNA 1R3DA 2JGNA 2E4VA 2Y9PB 4JNCA 5LQKA 1NQXA 1W1IA 3LOQA 5I7SA 1Z12A 1SM4A 3LX8A 3RB8A 4V0HA 5COBA 1EF1A 4TV9F 4D42A 3EWNA 3IBGA 1Q10A 1L5WA 3L04A 1BE6A 4YAFA 4JJEA 1YJ1A 1B2LA 1XXLA 1HDEA 3CR7A 1JHRA 4HJKA 3ROGA 1S4QA 2WYWA 3OIWA 1FRRA 4UAJA 2ZR7A 4YT2A 4YTMB 4Q1FA 2XB4A 6ABPA 2CV0A 1GNLA 1XQ1A 2NUAB 2NLOA 4FI3C 3JQAB 2HKIA 4COOA 1C7JA 3QFFA 3OU7A 1N0IA 4B46A 5E6RA 1SRRA 4J1TA 3C8YA 2P79A 2VPZA 5DASA 2W4MA 1Z6QA 5L6LB 2FQWA 2ZCVA 4ZNBA 3NS7A 2X0NA 1SWVA 4FFDA 2E48A 1XBTA 3TGLA 4ANFA 4F5ZA 1U0HC 2J6BA 3Q8XB 4JSRA 3E4DA 4N58A 2WJ6A 4U7GA 1E1CB 3WNBA 2H7XA 3UHJA 1JQJC 2XEDA 5KTNA 1FDTA 1TYGB 1H8ED 2V6JA 3JR7A 1NEKB 3LCCA 1CYEA 3SC2B 2CHVA 1XAIA 4D45A 5TGZA 2O5EA 5AUKA 1V1RB 4P84A 4MQ6A 4WVLA 3H11B 4HDSB 4TZKA 1PF7E 1JTFA 2VAPA 1YQXA 4F85A 1VCMA 4IV0A 4LC9A 3AY6A 4UUMA 4C4VA 3TD6A 2P0AA 4MUJA 3R9WA 2DM6A 3D2CA 3VNRA 4LWQA 3ZI0A 1Z8FA 4IIJB 4GC9A 1WYWB 1NQOA 2QD1A 1E8MA 3RNOA 4E3ZA 3P71T 2G9HD 1NXSA 3OFND 4JUFA 1IM5A 4B4KA 2XA1A 4L4SA 3OQMA 2IBMA 4E22A 2UZIR 3EEBA 4Z5XA 1E6UA 4MQEA 1J2TA 2L17A 4RVUA 2Q0JA 3CJTA 2RARA 1P0MA 3E0XA 2I80A 1WPRA 4FNGA 3KS9A 4UC0A 3OT4A 2C5FA 5BN5A 1JB9A 6REQB 2JKZA 2KMMA 1FLDA 3FYCA 4O4JB 4BV9A 3HDGA 1JLMA 4G8BA 2KACA 3TDMA 3H8VA 3V05A 4EUEA 1U7ZA 3ROKA 4H08A 1TUGA 1TZ2A 2UU7A 1TZCA 3CKMA 2VW8A 4CLEA 1NNLA 3TLGA 3FMIA 4C00A 3QXJA 1JIIA 4PQGA 2PY6A 4ILKA 3LVRE 3V4VB 4R84A 2H9IA 3C1TA 2R7AA 4FFRA 1KPGA 3QU5A 1L7PA 2HNKA 2QOEA 2ZBPA 3K9WA 4YI5A 1JUDA 1RQPA 5HIQA 1Z4OA 1P5RA 2YZGA 1DBRA 3ABSB 3L93A 2C0QA 2FETA 3GLRA 3PG4A 1NLUA 5AI8A 1EU1A 1TJNA 3ZTWA 3ZLUA 4BQEA 1DJNA 2RHCA 2ZIZA 1D7OA 2WP9B 4L75A 3WGIA 7GPBA 2CZGA 3FOEC 4TV8A 4BP0A 1K6EA 4W82A 5JCPA 1Q0RA 5FPKA 1HTTA 2IODA 1SGHA 4EG1A 3QOXA 3VRBB 4LGVA 5ESDA 4DRXB 3NM6B 2WSBA 3FB1A 1DJLA 1JIJA 4N9F4 3D6UA 3UN1A 6PFKA 2PM8A 4J9VA 2JF0A 4A92A 3B9QA 1G291 2FDCA 4OEHA 5IVIA 4DNQA 2PMWB 4L51A 1S2MA 2PVSA 2XXBA 1Z0SA 4RLSA 4NG5A 4W9CA 1SIFA 4X62B 3AX6A 4L95C 1PEKE 3UAOA 4X85A 1SWWA 1Y9JA 1ZBDA 3R77A 4K40A 3ONEA 2QROA 5BSUA 5IF3A 4L8LA 4EGFA 1HT0A 1RRPA 4A82A 1K6MA 2VN8A 3T7TA 1JWAD 1HXYD 3FWZA 4RS4A 3FFBA 4C7BA 1W36C 4N12A 4NNJA 3K71B 3UFXB 3BYTB 4KO1S 1I6KA 3KYIB 4G97A 4TYFA 2W8BA 4O2BB 4XARA 5TB5A 3SQXA 3KUCB 4XC2A 2B37A 4MDFA 4U6SA 1XCQL 1FQOA 1FSSA 1K5DA 1K8XB 1PGOA 1LDBA 2W2NA 3NAGA 4HLUA 2WLSA 3R7RA 4KP7A 3KALA 1T9CA 4I50B 4LSGA 3HWWA 1QX4A 4B47A 4D5GA 4U8GA 3BQNB 3S2IA 4IGFA 5AHOA 3KLOA 2P75A 3FUVA 5GY7A 3RD5A 1WB6A 3VBEA 1PK7A 4JLMA 4F4HA 1E1DA 2ZTVA 5B55A 1YD8U 3SQMA 3GPLA 2B25A 3T8YA 2TECE 2XIQA 3TCAA 4HLNA 4S2EA 2O06A 4MLZA 4UUAA 1YS2X 5IDXA 5JWRA 2OV1A 1EK0A 2ROQA 3ODGA 4MO9A 1IBMB 3IPYA 1IN6A 5AZFA 1RWMA 1NXTA 3PC8A 1T4DA 4RDCA 4RJTA 5INTA 1YJIA 1LI7A 1Z4NA 3PVLA 4PZZA 3ZKAA 1WF9A 4L6CA 4EVRA 2V97A 2QZPA 5E9AA 1JXOA 3F9CA 3HR4A 4IO1A 4KVZA 1MXHA 1NN0A 2QX6A 3L8GA 3PKIA 5YASA 2RH9B 4UFPA 5AEBA 4I1VA 4FOTA 1ZXIA 4N39A 4R68A 2G4CA 4LDTD 2QVBA 1MG8A 3MHPA 1CSEE 3QKRB 4EVSA 3H05A 3NUHB 3RADC 3PJRA 4KR2A 5TC4A 4BO2A 4LFAB 5IASA 4ACAA 1GUFA 1NR1A 1FFVA 3DNMA 5TRTA 1CR6A 5JO0A 1L7QA 4X65B 3MP9A 4Q03A 2G07A 4EQ6B 4HRSA 1SEBD 1CJKC 1ULBA 2QRHA 2YN2A 2DC1A 2H9YA 3G7SA 3JYLA 4JENA 3W2GA 3MG9A 3GELA 3GMTA 1QCCA 4XIGS 4FS8A 2L7RA 1TMYA 1GEGA 1WUJS 3PENA 3HHMA 3LV8A 2HYDA 2WYVA 5PGMA 1DBPA 2W2PA 1QVVA 3O3MB 4BFTA 4BCBA 3FVWA 2MRPA 1WYGA 1WWKA 2OM2A 2WF8A 2ZYGA 3GCGA 3KT6A 1SBHA 4BLOA 2QZZA 5IG2A 3BDIA 2WEKA 1Z3CA 3D6MA 3KCQA 4NL4H 4P4SB 4XJVA 1EIWA 4WXYB 1GTMA 4ZU3A 1F2RC 4DFDA 5DRTA 1QG2A 4I08A 1L5KA 5BV1A 2HTHA 2N3ZA 3N05A 2YXPX 4BKUA 4UUPA 3GJ6A 1JG3A 1IAQA 2AG1A 3X2SA 3VSDA 3ZUGA 2V8OA 1JLKA 2WJJA 3IULA 3P2IA 3S2FA 2VDMB 4GNRA 1KVRA 4LZPA 3B8HA 1IWBB 3IAXA 2J42A 5DW0A 3NAQA 4NC9A 4UDXX 3DMGA 1V1PA 1TU4A 4KMMA 3U3DA 4LXTA 1HZZA 2X8LA 2H51A 3ABRB 2I99A 5LMUB 1YDHA 1TK2A 2C3PA 3DW3X 3VPAA 2PMDA 4LX8A 5DPWA 4WERA 3ABOB 4D7AA 5G1NA 3H1UA 3PE4A 2WJGA 2EHDA 2OD7A 2P3SA 2CB9A 3IV6A 3P0JA 3DUFB 4OMDA 1R12A 1YVEI 1GLGA 2XQGA 4L16A 4R0VA 4UJ3A 3UB4A 421PA 4A36A 3JZIA 1DEAA 2G40A 3KM0A 3L05A 4K28A 3S70A 1FDIA 1OC2A 1C0PA 2ZJ5A 4A6EA 2BJVA 3DEJA 4N7MA 1U8TA 3EFHA 2KJQA 1HYEA 2EZ8A 4YT5A 2C7GA 5B7GA 3BK2A 3FJ1A 5FO1A 2E55A 4G50A 2X9GA 3KOOA 4C7XA 1E60A 1O3YA 4HUQA 5AXOA 5CFPA 2WXKA 2MW5A 2G6BA 2QLMA 2JNWA 1AIPA 3H65A 3LUGA 1ND6A 5AVUA 4H4DA 3NH6A 1X15A 4UTVA 3RK1A 2ZI9A 1V1OA 2D3WA 4BB5A 1OH8A 1RM0A 1F1JA 4PCAA 3B1KA 1XO3A 4R9SA 1K92A 3ML8A 1CV2A 3DDUA 2LVBA 3QCAA 4WLNA 5AXRA 2AFHB 2FVXA 4HX5A 3QE0A 4P3KA 4RMHA 3S1AA 2J3LA 2PRKA 4O4LF 5IM5A 3THXA 3I9NA 1AA9A 3BE4A 3FZGA 2V4ZA 1LRJA 4P4TA 3W7VA 3FNFA 1ZD3A 3SD5A 2L0FA 3RVDA 2OSVA 5ES3A 1SK8A 5JBIA 3S81A 1I7LA 1EFRD 1XKQA 3HR7A 3IDAA 3JRXA 2E4YA 1GITA 1E2NA 1VTKA 3GH1A 3P9NA 3R7BA 3X1DA 1A88A 3EG9B 3OIGA 2Z9BA 4ANUA 3K4HA 4DLUA 1L8LA 1OXKB 1SXHA 4BQNA 2ZAIA 3EGOA 1SUCA 4IINA 2P4EA 1TO6A 4OUKX 5BSTA 3WZLA 5KQMA 2XNKA 2MTBA 2YZMA 3QBTA 4YGXB 4RA9B 3SMQA 3FKYA 1THGA 1X9GA 2BPSA 2J6HA 4UE6A 2HCJB 5EZQA 3PPAA 1V95A 5E2BA 3UMGA 4EB3A 4N7BA 1VI5A 4TKUA 1YA6A 4W7SA 4DQLA 2WAYA 2I3BA 2AJ8A 2C9MA 3CO5A 1PR9A 1DAGA 2RHWA 1DRKA 1QO9A 3D4BA 2FX2A 3H3JA 2R7KA 3Q0TA 1BD3A 2J08A 3E84A 2OA0A 3TNYA 3UANA 2FI1A 4EELA 2BG8A 1PSZA 4V02A 3E5HA 1GKYA 1GKLA 4C6HA 3QELB 3DLPX 2XK5B 3ORSA 3AUFA 4O5OA 4UQOA 3TX2A 4DIUA 4MEJA 1MJHA 3ASUA 1KA9H 4RK0A 4XIIA 3WP0A 5BSVA 3HKDA 2F1OA 3ADKA 4PWYA 2D07B 4HB4A 5AJTA 1T15A 2PUEA 3BMCB 5DNWA 2QDSA 1W7AA 3DDSA 1WO8A 4JAVC 2H0QA 2QP3A 5LNK1 2WWFA 4LVCA 4YR9A 2Q6LA 2FJ0A 1EE1A 5CMLA 4KOEC 1XZAA 2R97A 2QR5A 4Q18A 1I5EA 1RC0A 1O58A 4KR0A 4MPTA 3WMXA 4B1FA 4D1UA 4FDLA 4B81A 2CNLA 2I0FA 4YRZA 4WCFA 1O5OA 4KWTA 5A6VA 4Y18A 3IAM1 1EHIA 3A6JA 2FZ5A 4UMDA 4B33A 2BMIA 1GN8A 5FFMA 1X19A 3R9XA 4H7IA 5KYXB 1XHEA 2IKSA 2ZYSA 3PD7A 1JMLA 4QT0A 5I7FA 3W1SC 2AXEA 2P4UA 4KWIA 4O4IA 4IDBA 1PN3A 3DCYA 2LRWA 2P11A 1ADGA 2CBGA 4EEWA 2BUAA 5LBIA 3LUKA 4FKBA 1RE1A 1YMUA 5KQGA 2W2TA 5CT5A 1NYQA 1SSNA 4QICA 3MTNB 2QD2A 4TVKA 4CV2A 2RBGA 2IZZA 1AO3A 1YIAA 2HBQA 5A3SA 4G0YA 4NOMA 5DGCA 3DOIA 4DWOA 1HI9A 4WACA 4F4UA 2ECPA 1XQVA 2AWOA 3HM2A 2AJLI 4B6QA 5KYGA 3QVVA 1U90A 2XCUA 2AFHE 1W52X 4E5PA 1UC8A 4TLDA 2H4XA 4JD5A 1G9TA 4IIVA 3ZXUB 3QQ5A 3HKBA 3H3EA 2VZLA 2PSHA 2XOKD 1EE9A 1R0LA 3M1IA 5JS7A 1W1WA 4WWHA 5IBPA 3UMVA 3ZHQA 3L0OA 3INNA 5C81A 4NJ7A 5KYYA 3C5WP 1OF1A 4HDRB 4I9UA 2QCZA 1X7XB 3IP9A 5JNSA 3F6CA 2BEVA 2QTZA 3DLTA 5AKJA 2GVDC 2VF7A 4G1MB 2KK8A 1I9GA 1LS1A 1Z5VA 1ABEA 1RU3A 1SVNA 2AOTA 3B9RA 4J2OA 2ZAMA 3TSOA 4BMNA 5C8YB 1LX7A 2VIIA 1XFAA 1GZHB 1PR2A 3S68A 1WXGA 4CLOB 2OGUA 3JQBA 1ZVMA 3FYUA 4GYKA 3AVPA 5KX5F 1GLNA 3GU3A 4R2MA 5BOSB 1D07A 2LKDA 3OY2A 5JZOA 4MM3A 2Z9CA 5K8LA 3E9MA 3HRIA 2D8AA 4ZVMA 4DGSA 4AZ0A 4XJTA 4E1AA 2NO4A 1H1LB 3I6MA 1PTKA 1JCKB 1T13A 4BYMA 5AVZA 2JLXA 1ZXBA 1TYDE 5A4IS 1F0YA 3KFVA 4DWFA 2FFBA 4JUBA 4C07A 3VVLA 3R74A 1E94E 3AESA 2HSEA 4EB6A 3MSXA 4Y1EA 1JN0A 4ZOHC 1Q83A 2IYWA 1QH8B 2XMDA 2A9KA 2ETXA 3SJAA 2PW9A 1KVSA 3BFVA 2Z2YA 3K6RA 3LFHA 5T3UA 4MJ7A 5E6OA 2CMKA 1TQ2A 1NQAO 2Y2VA 1WXWA 2DRIA 3DSRA 3ICOA 3NWOA 4U2DA 5LJIA 5EE3A 5KINB 4BRSA 2AK3A 3FOFC 1T0JB 2IF2A 2BC2A 3TRKA 2V5UA 1ISIA 2OD9A 2H08A 2YIDA 4J4TA 4AAYA 3ZJTA 2A3NA 3HVUA 1H2EA 1O08A 4ZZ2A 2RK6A 4PLYA 2V7BA 1IATA 4WIAA 1LI4A 3V3KA 4R5MA 3KAJA 5KHOC 3BJRA 2ON8A 3JTMA 2DPHA 3PTZA 4GKJB 1IHXA 3CSUA 3KR2A 5AK5A 3OCXA 5F77A 5FD8A 4JJGA 1F6WA 3QLTA 2BVCA 3HI6A 4HUTA 4ZCTA 4BZAA 2KN5A 2ZJBA 4CTJA 1TECE 1W0JA 1BX1A 1PJZA 3AO0B 1IHOA 4BIMA 2Q4RA 3F46A 3KUDB 1NU6A 1HQRD 2OFFA 2EKQA 4PHTA 5AT1A 4WVFA 1U6IA 3A1TA 3A4YA 3TKYA 1CZHA 2YHIB 4HEA6 1H1TA 2FE1A 2IPAB 4AJWA 1F0NA 3DFMA 1XE3A 4NBUA 3U7JA 4EAQA 1D5WA 3QPAA 3WQRA 4EJSB 4CEIB 3HFGA 2G5PA 3GCWA 3R8BA 1KSJA 2GETA 3LBAA 5HHDG 4OSPA 5TIIA 2FWIA 5IP5A 2HBYA 1N0UA 2QD3A 1O96A 2WJYA 3R23A 2AQIA 2X41A 1TJPB 1TS3A 1I1OA 4HK2A 2OO5C 3EOZA 1G3UA 2VEOA 4X1KB 3V48A 5HF9A 2JFHA 4BJ1A 3ZQJA 2ACEA 3CF4A 5SYMA 3HCOA 3LKVA 3OA2A 4U0KA 1JYFA 1V7ZA 2ZRIA 4TS9A 1XA0A 2QTNA 2QIOA 5C8XA 1LW7A 1ZIPA 3M6MD 1E61A 3T3MB 2VDRB 1BW9B 5WRFA 1ZHHA 2B9VA 1ES9A 1F0KA 3LFTA 4DR3B 2F8TA 4N47A 4B5KA 4L0QA 2PT9A 4N8SA 2GCOB 1VRAB 1ZESA 1WR1A 1ZWLA 3L40A 3TSZA 4HNUA 1T6BX 1ZISA 2YZ2A 2C60A 4MR8A 3HDHA 1JT1A 1ODSA 2I76A 1CS4C 1PYDA 4ZYNA 3TLAA 4EE2A 2IK8A 1JQ3A 2G1KA 3K9NA 4UM5A 2WHIA 1HDXA 4L2YA 4KSBA 4D57A 1LNSA 2JH8A 5CAEB 3ZY2A 3O75A 4Q7EA 1YJ5A 3PFGA 4J76A 2Q4TA 5EUBA 3UF0A 5FAXA 3QV2A 1JJEA 1NYTA 5AI0A 5DPSA 2C03A 2D4HA 4QRDA 2HJ8A 5AESA 1PVOA 3SQWA 4IHJA 1AHHA 3FMPB 2OV4A 1G6JA 3JQ8A 2ECQA 2J0VA 2RAUA 1N7JA 3UJCA 3ZNPA 2VJYA 4ZYWA 3UVEA 4QOIA 4KFTA 2V1XA 1JR4A 1L0YB 1WMDA 5BNTA 3LKBA 1Q1AA 1Q6ZA 2OZLB 3GLQA 4C7KA 5EMJA 5EV8A 2VJAA 2JFBA 4EXSA 1QANA 1EX1A 2QTMA 1Y8RC 5AZHA 5JZBA 4GOOD 2IYOA 2EEZA 2OZPA 3KHKA 2QU8A 5THKA 3FNIA 4MUFA 1UF9A 2EYUA 4HRYA 4KV9A 3JQ7B 2A9PA 2QMYA 3BREA 3NATA 4MRMA 4WFQA 4XCVA 4F6RB 1H0RA 4EMUA 2GPNA 2GBNA 4I99A 3PC6A 1Q1ZA 4LK2A 5HKOA 2IEGA 3CRQA 1H4VB 1Y6QA 1OJ7A 1Y33E 4GDMA 4N0DA 4BGVA 2VOJA 1AHPA 1NRXA 1UM8A 1J1IA 1YDWA 2YWGA 3F9IA 3RVJA 2FLWA 1NZFA 1RLIA 2P0EA 5IM4A 1M73E 4A6XA 3K6SA 2BBWA 4V0KA 1E79D 2BGNA 4F84A 1GPLA 4ITVA 2RGDA 5DO9A 1T25A 3FNHA 2I71A 1JA0A 4L0DA 4EPTA 4ZCLA 2ZBUA 1VPDA 3AKCA 3W78A 4EL0A 1OYVA 2NUAA 4RV4A 4BV3A 2ZWAA 4OHRA 3TH5A 5E6RB 4M0CA 1QQTA 1ISSA 2RHGB 2Z2IA 4DLXA 1QIFA 4YQYA 4AN1A 1ORRA 3JYOA 3NAMA 1RJ9A 6LDHA 1O7JA 2G7ZA 4L9WA 1N2ZA 4P7IA 5I4BA 1JHOA 1GN9A 3JSVB 1SVOA 1MVOA 3E58A 1P1KA 3I01M 1FOEB 3SX4A 3NWBA 2C9WB 1FMTA 3LYAA 5FB3A 3SCZA 1ZMXA 3RLFA 1RCUA 1YQBA 1P1RA 4GBED 1T0IA 3IIIA 2CK3D 3LQQA 1H6AA 4YJDA 1Z0AA 2X5XA 2WSSD 4LA4A 5DISB 1Y8ZA 4CEJA 4U4LA 2VAWA 5C2JB 1V1RA 3DQVA 1GQ2A 1JS1X 5KQLA 2D5LA 2OB2A 4INAA 3WC4A 5AVRA 1XL0A 3L1KA 5GIPE 2OGZA 1TLLA 5B3KA 3K9QO 1YRLA 2VF4X 3BFPA 3R3WA 4FTWA 4XYBA 4C4VB 3FYSA 5BRNA 5CA1A 1P7EA 2XB2A 3VNSA 2HLNA 3DFUA 1KZ6A 4MWCA 4BFLA 3ZXRA 1CJUC 4CM4B 4YV7A 2A5LA 3P63A 2FXIA 2PX5A 3ASYA 4OQMA 1TO2E 2XMRA 3QMMA 2AEMA 4G5GA 1TIFA 2BWES 1T8UA 3C8MA 2L00B 5G53C 3RJ5A 4BNNA 4EAAA 2V5AA 1OX4A 1NX9A 2QU7A 1NU8A 3JD2A 5CT8A 4CT0A 1PZFA 4PAWA 3QVSA 5H59A 2LGIA 2L76A 4YYZA 4W63A 2AKEA 3L0WB 3K9CA 1MPXA 2DUNA 3EZ9A 2ZT5A 3EZ7A 1TNDA 1ZW7A 2RMMA 3L92A 3Q3GE 4U2GA 1DXQA 2Q50A 5G02A 1U8CB 1TKYA 3VTFA 2EZUA 1N2BA 3ZLZA 1SG9A 4E5SA 3UPTA 3ZLJA 1LK5A 3I39X 2GGSA 2Q3JA 4HG2A 4AQ7A 3N7AA 4ZU6X 4EFZA 4QGGA 4QXOA 1PKEA 1HMPA 4DIOA 2LVPA 3QK0A 4CLRB 1WZEA 1EFKA 1GTL1 4DCJA 1KJ8A 3DOCA 4I19A 4JELA 2OGWA 3GP3A 1VL8A 4Q5IA 4MA5A 4X1IB 5E0KB 3WBJA 4YT4A 5FWNA 2UUBB 3B6IA 1NZJA 3U09A 1MZVA 3ESDA 1CF2O 3J81k 2VA8A 4CQLB 4CEHA 2O19A 4YRIA 4QHSA 1VLMA 3TTTA 2IXFA 4DCPA 3ELWA 2J5KA 2MT9A 4XTCS 1I01A 3RS9A 3SYKA 4PN3A 3FZNA 3DONA 3CO0S 3K8ZA 4BKTA 4RTRA 4ZO4A 2QNBA 5I7UA 3MFGA 4II7A 5LZ9A 1DIRA 1EF5A 4P31A 5HBGA 2BY4A 4FCCA 3H13A 4BFYA 4W9FA 1GL7A 4FNOA 3D0OA 1IMOA 1T1IA 4NPHA 2FPSA 3DDOA 1N3BA 2ZAOA 4L9RA 5CIYA 4USAA 4XIJA 3BTUA 5IC5A 4TLBA 3TXXA 5ELXA 4MX8A 5CHFA 1JYSA 2R8YA 2XHEA 3L8ZA 1JTEA 1TB4A 1TIPA 2R65A 3WGHA 2VPQA 1BCRA 3H1BA 3VR5D 3AHGA 1E9DA 5GMVA 3CLRD 3ED5A 4IIDA 1F0PA 3PNVA 4YP5A 5KYNA 3G5AA 2PIAA 2XMSA 1WDMA 5LC1A 1PR3A 1FL9A 2Z57A 1GR1A 1E9EA 2Q9CA 3VH4B 4Q2JA 4XEHA 4CNQA 1U4AA 1YQDA 5DXJA 2N46A 4CKEB 3C85A 4Y67A 1GAJA 2PX6A 5K3CA 1RS0A 3WFIA 1SD1A 1TUEA 3IOCA 5J9FA 3IMFA 1CQVA 3IMGA 3EW9A 4HH1A 4UUBA 1MOQA 2HF8A 2WYIA 3A9SA 1X94A 3IDQA 1WY8A 2AF3C 3S8MA 1NKSA 2B82A 1JPNA 2GMWA 1K8RB 2P1RA 3FCYA 1R6UA 3KD3A 3M83A 3S7TA 1PZGA 4C09A 2Y3AA 3HO1A 2YWHA 3OWHA 3W5AA 2NU7B 4K7SA 3CXUA 2DKOA 2BGIA 4J4HA 2WOJA 4XJXA 5EUQB 3O3OB 4RETA 1FXUA 1W4RA 4YJ2F 5JSZA 1OAOC 2PMBA 5KYKA 1LEHA 2OTCA 4CKYA 2BL4A 3WWEA 3EVTA 1JT9A 1FYVA 4RC9A 2QP4A 5BUQA 1YASA 1ZKPA 4ZARA 2VSYA 1EU3A 3BIID 5EHZA 4EHNA 1UZXB 3AHJA 4U7JA 1F4LA 4JQCA 4TXJA 1AF4A 4F2PA 2AV6A 4GBGA 3ZIAA 4WWNA 4WEOA 2WG2A 2JUOA 1NAIA 1T5TA 1TMKA 1LQBA 1XCOA 1KM7A 2JGEA 3K6KA 1JAIA 5CW1A 2DLCX 1FB5A 2IU3A 4HXFB 5AQEA 3KQKA 1R5NA 3PIRA 1ZTCA 3AEEB 1KHTA 1Z4IA 4MGKE 5EXDA 3IAM6 2FIDA 3O13A 3ZIMA 2C5LA 3E70C 3ZTDA 3BVMA 1XTBA 4BO0A 3PEEA 1FFHA 3MJRA 5HMMA 2O2HA 1NVBA 4KQFA 2Y67A 4EHKA 4DV7B 1QHFA 1PYOA 1QIMA 2XT6A 1P33A 3D7MA 5B1HA 4BV8A 4DSTA 4ETNA 1GYRA 4JXZA 5DM2A 1AKWA 1FX0A 1F77A 2CHZA 3CLKA 2WJIA 2R2OA 1G8JA 1UC5B 1ZI6A 1HE8B 2W2KB 2ZJOA 3LDGA 4YIHA 1QYCA 3UUFA 1PUIA 2EKPA 1IY8A 3HWRA 1PCXA 3WQHA 1UCFA 4GP6A 1D0IA 5CYOA 2PZ8A 2EWVA 5H9VA 3GNQA 3A4LA 3OTWA 1MGPA 2DH5A 3NDJA 5HISA 3Q3NC 2YMMA 5J4VA 5JI3E 1KSFX 2A57A 3HCWA 5JSQA 3L1UA 5JYBA 3AIKA 2W6IA 2YFKA 5KTKA 2E5LB 2HZ7A 1YL5A 4G1FA 2EFGA 3EAQA 2P97A 4XWTA 2ISCA 4N8DA 4RQTA 4IDPA 5HIIA 3RT7A 3EGVA 2HU8A 1KZ9A 2JLBA 2N1VA 2E87A 4TZBA 3AZOA 4OP1A 3F9OA 4LXXA 3TP9A 3Q3JA 2NV6A 2ZLBA 2XB8A 2LZ0A 5EJAA 2J9YB 1JU3A 3EDRA 4ERXA 5K6RA 2ZWVA 4HPPA 2P41A 2FPOA 4QU9A 5HM6A 4XDHA 3UG7A 3P9PA 3LUBA 5HQ3B 3KSMA 4KRYA 1FXWF 4IY1A 4YTEA 3R0QA 3T06B 1E3WA 4FOPA 5CH3A 2POCA 4X71A 5ALKA 5A2QA 3OJ0A 3GGJA 3QM1A 5F7OA 1X8HA 3G82C 1NQUA 3KJZA 3ZY5A 3NHBA 3V7YA 3VPSA 4I9NA 2JZNA 1Z0FA 5AM2A 1BC2A 1TCVA 3ETNA 2HA5A 2C95A 4QSMA 3RSQA 3S40A 1NY5A 1OY1A 1P4SA 1IGDA 5AHWA 4GZLA 3LDHA 4HN9A 4LWPA 3QIAA 5EIAA 1WA5A 3ZKWA 2BFBA 5BXQC 2M1XA 2PFSA 5DH9A 4WGFA 5GJBA 4I4TB 1RPNA 2JVJA 4QX6A 3FVVA 3DVGY 2QUJA 1P2FA 1E4OA 3SICE 5BY2A 5D5QA 3FPCA 3FTQA 1LTKA 4E32A 2WLTA 4YRCA 1SHZA 2J8ZA 3TRJA 3B2FA 1T0YA 1MBZA 4HLEA 1NRIA 4EY5A 3NMUF 2WIGA 3I1FA 4DHZB 4M83A 4ZHQB 5GP1A 5K8JB 4D1TA 4L15A 3CX3A 1R4NI 3UJ3X 4DMGA 1QF9A 2ZBEA 3IERA 4QIHA 5CK5A 1EFPA 4D74A 3OVMA 4L1BA 1XVTA 2Q8PA 3C15C 4IDFA 4MVJM 1M2KA 1ZSVA 3EGRA 2GFQA 4KRGA 3H84A 3WB2A 1PNOA 2GTPA 3SFDB 2NYVA 2A35A 3NZUA 4K81A 1TA4A 3MWDA 3EDYA 1J70A 3LG2A 2JX5A 1T8WA 2VRBA 3D5QA 1EWKA 3DZHA 4UNSA 3V7UA 3OM1A 3PNOA 1MEOA 3JW8A 4R2HA 4DQXA 4R7TA 1R4NB 1E0ZA 1HORA 5G5GA 1MVLA 1XEWX 2C7VA 2WICA 3HBJA 3UQBA 3J9CA 4N0PA 4AECA 4KLAA 2G1JA 4CM9A 5E4TA 3K0AB 3SZMA 1CETA 5EP4A 4KXQA 1YB7A 3ZU6A 3MCAA 1RAAA 2R85A 5KVQA 1UODA 3V1NA 3GLIA 4TKUB 4XSHA 3ZU5A 4EY3A 3MRTA 3THYA 4Z2AA 3AP2A 4DMRA 3IT2A 1ADBA 2WM8A 4WWOA 5I5EA 3Q6NA 4F4FA 4B3CA 4Z5ZA 4ANVA 4I55F 1P3QU 5LCAA 1ZVJA 2NGRA 3CKLA 1NVID 3NPMA 1XF9A 1YMHE 2I4MA 5AM4A 1E89A 2Z2KA 1EWRA 1VHWA 2D54A 2Q5QA 3CF4G 4BP9A 1M75A 5MGNA 3I0NA 1PFDA 2YIJA 3DFZA 4KV2A 1Z2AA 1M2VA 1IM8A 3A1QB 4MR9B 5F1KA 3IUJA 1CW2B 3AIMA 2X9LA 5F1PA 3B1YA 3HKDB 4MB6A 3V9AA 1SJ9A 2GM5A 5G0UA 1K51A 1MENA 1KI6A 2R1TA 3SZOA 1FRQA 2FR1A 2PD6A 3U4HA 4FT2A 4RWZA 4D1WA 2F1KA 4Q7KA 1IYFA 3OPYA 4RHCA 1YQ9A 5A87A 2GO7A 2HHHB 5DBIA 2C94A 4GYWA 4DLBA 2OQVA 1HETA 2JAHA 5HUJA 4JI6B 4JWTA 3T3HA 1KYVA 3VZQA 3A26A 5BV7A 5JAMA 3QBDA 4AURA 1CMXB 2WNMA 3WA0A 5FUXA 3RKSA 2YNTB 1U99A 3H5LA 1OFFA 1U3GA 4KCGA 3PFHA 1BHJA 3Q6VA 4MKGA 3PHIA 2VYFA 4FC6A 4PLZA 2V4IB 4I50F 2Q6TA 3WGNA 4E21A 4B3TB 4O08A 5FLXA 2HJHA 1L5MA 1P98A 3PB3A 4RZXA 4UOZA 5FX2A 3IEMA 4ADSG 1CUCA 3SIPA 3GAZA 4QFDA 1I6LA 1VOTA 1WUIS 1LF5A 2QG9A 3HP1A 1E1NA 2DLNA 2PR2A 3G2JA 4OP2A 2WWRA 1L4KA 3WSTA 3O8CA 1TTTA 4FSXA 1Z5PA 2HRRA 4L2IB 1MNQA 2WXIA 1WUKS 1ULTA 4OA5A 3WKDA 3HL0A 2CUNA 2DFNA 4DSNA 3QMWA 1CEQA 1B41A 1IIRA 4QOFA 2D3CA 2MSEB 3LC1O 3T1QA 1T2NA 4UW9A 3MCUA 1XMXA 1PWEA 1O6CA 2W6QA 4MW1A 5CDYA 2LEKA 2HPAA 1G3QA 3ANLA 2XV1A 3FPGA 3GO4A 1Z5NA 3OOYA 3THWB 2Y8AA 1UOOA 3Q14C 5ITWA 3PWKA 4L57A 2P62A 4HVTA 3I57A 3BDAA 3BHMA 5JG7A 2OHIA 4DL9A 4ESOA 2HDNB 5KYYB 4HWIB 3KG2A 1Y3IA 3MGCA 5TVGA 1PDXA 2BEVB 2EV9A 3T5CA 4RXTA 4CKBA 1SELA 3AXCA 1XT9B 3GPCA 1XZJA 1XZFA 1SJED 2J87A 1SCQA 3GJXC 3SJ7A 1KXZA 1I4QA 2BTOA 3WWCA 2WWVD 4FUTA 3CE6A 3FYUB 3RANA 3U7ZA 5C3JB 4Q4AA 5CA0B 3IEUA 4P1ZA 2C2OA 1AKQA 3GCZA 3VHQA 3W4JA 3QP9A 5JQGB 3AJDA 4IH1A 3NDRA 3V8NA 4FI3F 2WE8A 1V5TA 4XFJA 2ZKLA 2YFYA 3RTBA 2Z56A 4C7OB 5BYJA 1EUDB 4JS0A 1NP3A 3WGKA 3ZWWA 3T7JA 1GOZA 1EGHA 4BMCA 2NSHA 5G1OA 3CN7A 4DM7A 1SQGA 5IYZF 2O7RA 2IU0A 2PT5A 2Y1KA 1EZ4A 1TAGA 3BIXA 3ITKA 4B9KA 2IYNA 1U4NA 1Q0SA 1N6LA 3DMNA 4UUQA 4BS9A 2V6FA 3F2VA 3UUWA 5BN3B 3AL3A 1U0TA 4FR5A 1L7XA 4C3OB 4F56A 2IIVA 3M4XA 3Q6IA 4DQKA 2A1TS 1H05A 2FEXA 1TS5A 5AKGA 3RRYA 2AL3A 2EBHX 2FNAA 3RYTC 4BAZA 2LHEA 1RJDA 1HQYE 2EW1A 2FE4A 2GM9A 2J9XB 4JK3A 4J0QA 4C80A 4PSDA 4X64B 4A73A 5K0NA 1PVVA 4ZKDA 2MIIA 4WNIA 2KM1A 2Z8XA 3U7IA 5IM4F 2P3LA 4GAEA 4HQRA 2BS2B 2CG3A 1XRJA 3UTDA 2RGRA 4KSKC 4IIJF 2FN3A 1PT6A 1RPTA 4FQ7A 2GB1A 2QDTA 5B3AA 1KQGA 4HXEB 2RIPA 1J20A 3PKZA 4ZVRA 3UTCA 1YE3A 4G11A 4FGZA 4X5OA 2JT4B 3E9NA 4LHWA 4YAGA 5KWJA 4EI9A 5ACRA 1CB0A 1PW5A 2KNBA 5EKUA 2XOKA 4NHOA 4CMAA 1QH5A 3OQVA 5FPQA 3FYUC 4F92B 4Z9BA 4X9XA 3K09A 3BAFA 5SV2A 1Y1SA 1Y8CA 1WJ6A 2AOUA 4M49A 5D3QA 3M5CA 2IYDB 2RB5A 3GPBA 2WWTA 2QW1A 1FE8A 1UBJS 1R6AA 2HQRA 4E4YA 3VDMA 3HUEA 4Q4HA 1BGVA 2PRYA 5FWAA 4BHTA 3L8FA 1II8A 1XXHA 5C3MA 1U65A 2LPMA 5L3SA 1DEXA 5ALNA 1J2YA 1I2BA 2ZSAA 3KE9A 1VDZA 2PVPA 1SVKA 3QTBA 5FTJA 3AKYA 1DINA 3NS8A 1PE0A 3I6BA 3PFCA 4DVGA 1W47A 2KQUA 4NQZA 3R7WB 1DRUA 4NAHA 4RVOA 2ZJ0A 3T7KA 2P35A 3EXIB 3LC7O 2ZBDA 4HAIA 3TMKA 1QP7A 1U31A 5FI5A 1SOAA 1WCV1 2VF2A 4EG5A 5L4SA 2QX4A 3K30A 3F7NA 2ZREA 3L7NA 3KL4A 3FB4A 4UU0A 2GN4A 3VR4A 4R3UC 4LJ9A 4C5BA 1B6RA 3LRTA 3LPAA 3V1YA 2P3QA 2ZI5A 1VECA 5JI2E 1G2PA 3SX2A 4PDXA 3PPIA 3Q87B 2G9ZA 2ZSJA 5FF9A 5IARA 3DQZA 1M8PA 2W0MA 3FGPA 2NU8A 3ZNOA 4BO9A 1SKQA 3MJFA 4OGGA 5K5EA 1WW2A 2I1KA 3HYNA 3ORHA 3QUTA 3LXFA 4GDLA 1Y80A 4TSSA 1Y8RA 4C0KA 1ZY2A 1A8UA 4YGYA 3Q2AC 2GD2A 4OB7A 3SJUA 2HIAA 2YNMD 4Q6WA 4I3HA 4DIEA 1UKYA 4GFDA 5ESXA 2BGKA 5CLLA 1NLYA 1G8YA 1SKBA 2IPMA 1X1EA 3NIGB 5DBOA 5LA6F 4DR2B 3H1GA 4R1PA 4XYMA 1SZCA 2D1TA 3NV7A 4IEFB 3TX6A 1L1FA 3SQNA 3V4SA 3GT0A 1X1AA 1GPAA 4Y1GA 1ISPA 2E5WA 3D8SA 5E4JA 4HDOA 4LJ5A 4WOKA 3SXUB 1DKRA 3TLEA 1JLSA 3GDHA 3RVOA 2J5XA 1SD5A 2VHQA 5LSCA 5KJCA 1Y4ZA 4NZMA 2QE7A 5CTRC 1J2RA 1JG2A 2XT0A 5CIWA 3VHXA 1KEEB 5IH3A 4JE3B 4DDVA 5J4KA 5JHHB 1ID8A 2QJLA 1YNTE 3GUZA 3MFYA 1JWBB 1N57A 4N0QA 5TS2A 1TEXA 3RUEA 3KLBA 2WY2D 4Y6PA 1XQQA 1K75A 2X2EA 1Z39A 4G4GA 1DO8A 4OY3A 5JECA 5H0IA 4MEAA 2QS9A 4WXPA 5JDIA 1J06A 4PQEA 2IYXA 5HIOA 1ODIA 1NI3A 2PV0A 2C84A 2QUKA 4EYBA 3OZUA 4E71A 3WLIA 5AW6A 1SOVA 4HAZA 4LECA 1ZS9A 2XTJA 2Q49A 1EWQA 1XEFA 1CR0A 2LCIA 1KJJA 4YXFA 4XWGA 4NZLB 5JTUA 1FIUA 4Z5YA 1B4DA 4RGQA 2WXPA 2NYAA 2XA2A 5GQSA 2DXIA 2FW9A 3PLVA 2QT1A 3CLUD 3H9JA 1RXSA 3R09A 5JCJA 1QUFA 4KQ6A 5B1YA 3LY7A 1WJNA 3Q12A 2C3UA 5IZ4A 4NQ4A 1UBGA 4EA7A 2BYTA 2AKYA 4Q9IA 3QVWA 5FFNA 3ZK8A 5GINE 1OBFO 5AK0A 1I2AA 2E82A 3O4IA 4YPFA 1OQYA 1U8AA 2OOSA 3HJGA 1ISHA 3H2HA 4JR0A 3AMZA 4IG7B 4CMHA 2HJ1A 2WD7A 5AHRA 2EEPA 3UKOA 1I4TD 3O9MA 4MV6A 3OLMD 4TT3A 3WADA 2QTVA 1LPOA 1IVYA 1NONA 1B0ZA 4UEWA 5LOVA 3LQ4A 3NTOA 5L4NA 3AT1A 3ITDA 1U9IA 3BG5A 2RHBA 2XWJI 5EHGA 2A4ZA 3R7QA 5JLJA 1JJIA 4ACFA 2JCBA 3IUYA 5BNZA 5KU7A 1U3FA 2WMYA 3FJOA 4IAOA 4MIYA 3MK31 3AL2A 1V9CA 2C8KA 4EF5A 2PH1A 5AI6A 1LM8B 3V1KA 2JRHA 3O83A 3WK4A 5KTRA 2WWYA 1SUDA 3GL9A 4RCVA 3TJRA 4EL5A 5CLQA 1YONA 1R8SA 3F3SA 1CZNA 1MHXA 3NRJA 3ZGLA 3B1JA 1IPHA 2D6FA 3G8DA 4GI1A 2PUWA 2QJTA 2TS1A 1RYFA 2ZK7A 4XEUA 5FLKA 5IW8A 3JWPA 3RBXA 3GLHB 1KE1A 2FUHB 1YJAA 2B9EA 2OK7A 4AC9A 2IY9A 3VSCA 1YE5A 2JIMA 4RMJA 1GGKA 3QAQA 4XQEA 4C2UA 1QM5A 4ARSA 4LHEA 1IE3A 1QIJA 1Y42X 2EG5A 1KAMA 2ID9A 2QZ9A 3A33B 1F5SA 1G20E 2VI5A 3QYJA 5DXAA 3T61A 4DPMA 1CZUA 4IJ5A 1Y89A 1KO7A 1JFFB 2OAQ1 1K4KA 4FMCF 2GS9A 1G2QA 3R66C 1NSFA 2Z8YA 4UAGA 3ZHYA 4ZALA 2WXMA 2O7VA 4K1XA 2HCRA 3ACDA 1C3XA 2KFKB 1ZUIA 2UZ0A 4IJVA 1YS6A 3NVAA 4IOJA 4LBYA 2NYRA 4CLRA 3G1WA 3FF4A 4GICA 4TS3A 3U3MA 3M9LA 4EKUA 1M2EA 4MGHA 3WGMA 2RJNA 2WXFA 3R2IA 1XTIA 1U4OA 2FSHA 3BYYB 3OCWA 4V0RA 1I6MA 3WMGA 4JKOA 3C3DA 5DLYA 2YHBA 3F8SA 4FS3A 4CEHB 4C1FA 1WOYA 3F7MA 4W9JA 1ACJA 3V1LA 2MSCB 2R87A 2KDIA 1SRQA 2GN1A 3VU1A 1PFKA 4BEVA 3O94A 3S29A 3KB1A 4NYIR 4RPCA 4ZAGA 3V97A 1SVWA 2QVCA 1IB0A 3A4NA 5A4FS 4BXOA 2PLFA 3TUJC 5ICEA 4YMHA 1FX1A 2JBAB 2WFMA 1U2DC 3H5IA 1GEEA 3AXTA 4CGZA 4NRDA 5BYBA 3KJQA 3H5TA 2IZ5A 2X0FA 1UZMA 1TJ5A 1BEEA 5EIFA 2UXBB 2R62A 3OH8A 2ZIEA 2IPKD 2YOFA 2DG2A 3MMZA 5AWFC 4BNJA 1UINA 3NGLA 3ONFA 4Z4GA 4NZZA 1N7HA 1F6BA 1S4MA 3ND9A 4GW3A 3DHGC 3FPJA 4D25A 1KJTA 4AY5A 1XNRB 3VC2A 1HLKA 4QYXA 1VYHA 5FOXA 2NO6A 5K4NA 4AJ2A 4GM4A 2Y71A 4Y6OA 1BE0A 2IT1A 2XOEA 3VXKA 3WIDA 3ZY4A 1E0JA 5K0SA 3N39C 2VXOA 4X7PA 1UJ6A 1HDZA 4AD9A 2NXEA 1HYBA 3L1HA 4QQFA 2MHJA 1E7MA 1YU9A 1FDSA 1ZIDA 4YXWD 5ALOA 4QBTA 1MJNA 4FNAA 3WWPA 1Z4MA 2A94A 4WOBA 1N6HA 4O4HB 3KKLA 1YN3A 2CY0A 1GSAA 1UWLA 1YU6A 5H1YA 4PG8A 1PL7A 4B95A 1K8RA 3IT4B 1XYVA 4L4RA 1UQRA 8MHTA 1IC6A 2Y6UA 3AEUB 3WI7A 1DG1G 4NCNA 3ZG6A 2OK8A 4KXWA 2B76B 4WDRA 2LBPA 3Q3CA 1TX4B 4XR9A 1EDDA 4AMGA 3RYCA 1FNSA 1NQTA 4LBVA 2HH9A 2ZR8A 3WLSA 2H0AA 3I4CA 1RPZA 4TKMA 3BZBA 2FP3A 1BDHA 3GLFB 3SDLC 1DG9A 2W37A 2AG0A 5FHRA 1GNVA 2C8VA 1ULUA 1RJFA 5TEVA 4IDHA 4BLRA 4IDIA 3AV0B 4OHXA 1ABBA 1TJ4A 2M17A 1YR7A 4MQ4A 5DTRA 4ZAYA 3SLKA 3DBLI 1CIPA 4UCFA 3T3IA 2A0XA 3M5DA 5B15A 3GMIA 2JI6A 3DT8A 4N7JA 2I4IA 3ZNHB 3NHFA 1X8KA 4GSKA 3DUWA 4IEEA 4P7JA 1J7CA 2DERA 2FG5A 5AH0A 1AUQA 2VP2A 3W6NA 2V6MA 2RGNA 4DJDC 3NJ4A 2AD5A 4A15A 5ECDA 4H1UA 2DP4E 2ZAYA 2REXB 4O8ZA 3REOA 2WF5A 2JS7A 4IIBA 3PX7A 3C97A 3T9CA 3P2KA 3MWEB 3IV7A 2DF8A 3B52X 1ENZA 4LK3A 4MTLA 3GUHA 5CHWA 2J48A 4OFBA 4U00A 3JAKB 3V3XA 4LF6B 3A3YA 2OKCA 4G5SA 5GWXA 1UDWA 3OX3A 2R8RA 4YC7A 2VQ6A 1I4RA 3BD6A 4G07A 3U9TA 1K7CA 1OZAA 4HTAA 2AQ2B 1E2EA 2QSDA 2EVWX 4L5BA 4E88A 4D44A 1Z8DA 2Z6QA 3W3AD 3V9PA 2APJA 1FYFA 4RQBA 1MO5A 3KQSA 5BPFA 4P1BC 4MCIA 4YCBA 3W5VA 3ROFA 4YEDA 3O65B 1OHHD 2RAPA 4LEIA 3T1TA 5COAA 3H87A 2HQBA 4JMPA 5ALUA 1W30A 1CLEA 3AR8A 1IY1A 3PXEA 4FZRA 1BS9A 4CMBA 3L06A 4K26A 4KGSA 1FMCA 2O1WA 3MMPA 4JIGA 3ZW9A 3SC3A 1OAOA 3L4JA 2J9GA 1ELOA 1UMDB 2K6GA 4J2HA 4AY2A 3NVKI 1Y3DE 4BFSA 1C0IA 3UBMA 1YFZA 2REQA 3ACCA 5LLIA 3GJ0A 1Z0UA 3BHNA 3JVZX 1NW7A 3N9YC 1SIOA 3BTOA 3K16A 1Y5RA 5CGZA 1TK9A 3RREA 3QKSB 5LZ4A 4DCNA 1L0VB 1QLJA 3QLVC 3T6KA 5CB6A 4TRMA 2PLWA 3E9RA 3JSXA 4NZYA 4Q3NA 3TL5A 1U7OA 1RI1A 2H85A 2I3DA 1YBVA 2IHTA 4GLBA 4RH3A 3AE1B 4J0FA 3N07A 4WA7A 5M04A 1WM3A 4RZUA 3GOQA 1K86A 5EN4A 1WKCA 1ZJWA 4MEBA 2JVIA 5AUNB 4AZWA 5CH8A 1C4XA 2RH4A 3DEAA 5TDHA 1E1RD 1AN8A 3L07A 4LISA 3AI2A 4MP3A 3A2NA 4FR0A 4AICA 4C2TA 1SE4A 4EJ2A 4DXAA 3W9CB 5HOQA 1L5YA 5AKIA 3UT0A 3A11A 3ZKWB 3EQ7A 1KFBB 1WOMA 1W2WB 3A9KA 2OESA 3ZQ6A 3ZXYA 3FDJA 4M9UA 2ID8A 2XEWA 4BOZB 4V03A 4LYYA 1GKIA 2COUA 4C0QC 1Y4SA 2N7JA 2KDFB 4GHWA 4WN9A 1W5BA 4ZOLF 3JZDA 1PG5A 2D0PB 3KZNA 1W4AA 1YQEA 2ASEA 3RUFA 4RVHA 2AIOA 3M8KA 6GPBA 2ZYAA 2VNIA 4LJKA 3C45A 4OGKA 4BE7B 2ZG6A 3HMQA 2VJKA 3N0WA 1ZIYA 4HDSA 1VCOA 4ZRPA 2HSWA 4EPRA 5LCFA 4Q3KA 2O2IA 5KQPA 1RLMA 3OOHA 3MWDB 2ORYA 5AXBA 3GEEA 4PCUA 2FN9A 3WB9A 1T1SA 4K6HA 1LSSA 2R6HA 3RF6A 2IC5A 4X24A 1NVWQ 4QJBA 4RXMA 2VDWB 4A8TA 5TT0A 2PYZA 1I36A 1R4NA 1CFJA 4FFVA 4Z1MD 2EL7A 4I9HA 4C0BA 1W36D 1ZMTA 4XUDA 2A3RA 1R3UA 2BM1A 2G45B 4M1QA 4OK3A 1DZ3A 4DCSA 4PYJA 2Q4EA 1E2UA 1YZVA 5AZGA 1ZFNA 3EODA 2H1RA 3O9VA 1IVSA 4MYTA 2H2WA 1DAKA 3CN9A 4R51A 1UP7A 5J5VA 1NJSA 4HLDA 3T0FA 4ENTA 1IH8A 2NQ2C 2LTAA 2CJOA 4IM0A 1C7EA 1O5IA 4LYEA 1ZLXA 1UXJA 5D5PA 4DCUA 1J97A 1PS8A 2YHSA 1LC0A 1BU5A 1E79A 4H6WA 4XE0A 1L1RA 4M0FA 1NI4B 5FORA 1RAFA 4RMAA 2FPIB 3TLGB 1D6EC 1XMOB 3AM9A 1U63A 1NXQA 3E3LA 4M7WA 5HA5A 3HXOA 5ACVA 1M2OA 2QM8A 1T6YA 1V37A 3SS8A 2WZDA 2JA2A 2Z1NA 1JECA 1M2NA 2LCQA 3U62A 4R9UC 1WH3A 4EUNA 4BMXA 3SF0A 2HJGA 2VXBA 3ZWOA 1ISRA 2J0UA 4N3BA 4P3PA 4RTJA 1N0WA 4WINA 2F8LA 1UBCA 2A7QA 1LV8A 2FTKE 2ZSUA 3LSTA 5K4GA 2BR6A 3G9UA 1DAOA 3VTKA 3HM9A 1E9FA 3I15A 3V2GA 2I6SA 3G2IA 1ENFA 1DXKA 2W3SA 1TLFA 1U2GA 2OHGA 3AH8A 4UTZA 3RS3A 4B48A 2WM3A 2ZQZA 2IYZA 4WZAE 2C7MB 1KARA 1DFIA 2HJWA 3OBIA 2YIVX 4F12A 2NU9A 2QNIA 3FKSA 2AR7A 3IC5A 4RK4A 5F2OA 4YMLA 1I3CA 3KOMA 1A97A 1PV1A 1W2GA 3L1JA 1MH9A 5T8KA 1USWA 1VMKA 1NG9A 4A2PA 4C06A 1BXTA 2WIBA 5JJLA 3SI7A 2FKNA 4KWHA 2PRIA 2QJFA 2ERXA 1HKUA 1WJGA 2WG0A 3FXAA 2FF7A 2FZKA 3OMLA 4UUOA 4PO8A 4WV3A 4ZQGA 5ERXA 4UTPA 3RWOA 5KUTA 3M1AA 4DV2B 4TWJA 2VPWA 2C2XA 2JFFA 1B6SA 3MBIA 1VZ3A 4M0DA 4NE2A 5AI9A 1Y34E 3MM4A 3AWDA 4JI7B 1QT9A 1ZD5A 4P0PB 5L53A 1LB1B 1MW9X 1V45E 3H42B 1CUJA 4UVGA 3VYRB 4CNBA 5TMPA 2OBXA 3UOWA 3J80A 3UIPB 3K7EA 3M7IA 4YSLA 4II3B 1DXOA 4CM8A 4QOJA 4PXYA 4JI5B 1RW4A 4KUGA 5K2OA 5CCXA 4W8GA 3SEBA 2F9LA 1O9GA 1X1RA 1YIWA 1L5RA 3EMKA 2RHJA 3F73A 5EH9A 1DC4A 3BRCA 3F96A 3TCXB 3QX8A 2D1QA 2WV7A 2VK1A 3IVXA 4DZZA 3QW4B 2F43A 2Q5IA 2RDMA 1T0UA 1ZVKA 3TNJA 2RC6A 5A05A 4IICA 1TUIA 1H2YA 2XIJA 2Q07A 1EX9A 5EXPA 4Y2PA 4J3JA 1O95D 4OJQA 3KRTA 1EX6A 3OZXA 4LJAA 3QPCA 3DMPA 4M01A 3PBKA 2IHJA 2OUIA 1X8GA 1UXIA 4DR5B 1XLTA 3T3DA 1K07A 5L3ZA 1N34B 3R1IA 3AUKA 2G8LA 3W04A 4Z3OA 2FHXB 2OP1A 4HVLA 3SC4A 4BGIA 1G3IA 1VJ0A 3KQYA 4MV7A 4C7OA 2Q5HA 4ZHPA 3UGBB 3W1YA 4DXFA 1BH2A 2D2EA 1KJWA 2VH5R 1Q3TA 1I7PA 3H9UA 4M7RA 1H6BA 1DL5A 1KY4A 4QFMA 4R8KA 5IS2A 4POAA 3OZFA 2ZYWX 3VV2A 3JQRA 2WUEA 2WP8J 4D8UA 1XD3B 5K8VA 3O8QB 3LCVB 5LU9A 3ER8A 1NBHA 3ZIDA 2HTFA 2DPXA 3M4JA 4TTRA 1A96A 1LU9A 4DC1A 2XSZD 2D11A 4DIKA 5HIAA 1WMSA 3RBZA 3ERCA 1BHO1 2GEDA 2ZI7A 5ALLA 4ZV4A 2E18A 3M6WA 4NBKA 3ETJA 1E96A 4IMRA 2R7LA 4EY6A 1T5SA 5CFNA 4M0EA 2EJVA 4DF3A 2SCUB 4TRNA 1J39A 1Y7LA 3LFUA 4J16A 1ZNWA 3TEMA 3HP4A 3GOHA 1KK0A 2JLSA 3RW9A 1EWYC 5AW0A 4KAJA 4MUEA 2OGTA 1JG7A 4WQMA 1FQJA 2P6NA 2AW5A 4QAYA 1E2IA 3MC1A 1Q7RA 5DNAA 4OVUA 4DV5B 1XQWA 1S9DA 3OLWA 4FBMA 1M7HA 2XXAB 1FMJA 2G67A 4OIFA 1ZD2P 3LRPA 4UU8A 5DT2A 5J58A 2WKPA 3G23A 3VMFA 3B5JA 3EIOA 1CUXA 1SXIA 2HADA 2P2CA 3QEJA 1QF6A 4XCXA 4DZRA 4DCMA 3I9OA 1YF3A 3SEQA 3PRMB 1QF7A 1SKAA 1XMVA 1B0AA 4MSUA 4YMGA 2WWWA 4X8HA 1URPA 4DCOA 4IXNA 3NHZA 2OO7A 5CNJA 3LA8A 1DT3A 4GOMD 4KVAA 1ZNXA 2XJ9A 5E1DA 2Y1DA 2X42A 4G0NB 4EVQA 3C3MA 1U98A 2IXDA 2GBGA 3UG6A 1B26A 2W2XA 5DHUA 2JEOA 3WSVA 1MX1A 4KH1A 5BMHA 2BM9A 1Y98A 3O2SB 1BXGA 4ICIA 3VO8A 4KXLA 2JLZA 2PSEA 1FFYA 1Z26A 1FCLA 1OREA 1QS0B 2O1EA 4KTVE 3V2HA 2WXRA 1S2GA 3DYIA 2ZVNA 1K2VN 3KQVA 3UMMA 1C1YA 3R3UA 4JHLA 3DMHA 1TVKB 1Z5GA 5B53A 1UBQA 1AQYA 4M1SA 3G2MA 4FMCB 5ADHA 2SEBD 3BZWA 5AW1A 1SUIA 3AYZB 3F90A 3G7NA 1Q2UA 4W6ZA 5EWJA 5JFOA 3E5NA 3FRHA 5DHTA 1IG0A 5LQDA 3K5IA 3RZFA 4RGVA 2NSLA 4RL4A 1QLHA 1YB5A 3HCAA 4GL2A 2NO9A 1QV9A 2BMWA 1SIWA 3F4BA 3KJXA 4Y1RB 3HVDA 3GZNA 4UTOA 4RKEA 1Z22A 3OU6A 1E8XA 1ZA2A 1THTA 3S55A 1OV6A 4JLDA 4LFBB 3VOBA 4AMYA 1FNUA 4EZKA 3A6EA 4H7JA 4JWKA 3CUWA 4Q48A 4BQQA 4F96A 5FJJA 3RRZA 3SEZA 5AIJA 4G3XA 2I22A 2V0CA 4OYLA 3DDWA 2A9FA 2BONA 4HB2A 2QBYB 2AMFA 1J0CA 2XCIA 2JVCA 3IA7A 5AIAA 3ENEA 3D3JA 2QV7A 2C5EA 4JB3A 1PVDA 5ALMA 2A9QA 2AVNA 3DCNA 2KW5A 2OR3A 2Z2ZA 3NFYA 2VP0A 5JWHA 3DP7A 3VPFA 3ZWQA 1JWSD 4DKXA 5CB4B 3HB9A 4WZAA 1XCJA 1Z75A 1JU4A 3TSSA 5JAHA 2CUTA 1MC1A 2QTWB 4GP7A 4RW0A 2B20A 1GHTA 1U6KA 3LY8A 2UXCB 4YRJA 2Q2QA 2A4KA 3FPLA 5REQA 4G84A 1JJTA 5A9SB 1GARA 3EXFB 4OREX 3DPIA 3F6BX 4S0RA 3STUA 5GAJA 1WBBA 2SICE 1E8WA 1WJ4A 1WG8A 3MBKA 2OCKA 5HYVA 4QC2A 4ATNA 4YRTA 3TUOA 2QX8A 2AG6A 3MTEA 7MDHA 2JLUA 4TMKA 3HYRA 5BR1A 3UBTA 1V8PA 2VPXA 4B6OA 2CZCA 4YV1A 1E63A 1WX1A 2I1LA 1V11B 2B1IA 2M2IA 5A7FA 2IO2B 1OAAA 4LZAA 4H18A 5LMCA 4HNSA 4HC4A 2CJNA 4AI6A 2GEFA 1VCBA 4ZT4A 1N32B 4PS8A 2MOKA 1C77A 4FWIB 5JNUA 4FHJA 3EC7A 2J52A 4INJA 4HH3C 4WCFB 3ZDMC 2DUJA 4JLCA 1XZCA 3PF8A 2INPE 4A90A 2B1GA 2I6QA 4XQ0A 4Q3AA 4BX9A 3KH0A 1WB4A 1R0CA 1T9AA 2JLQA 1YRQA 4JDPA 5CHYA 2KQ7A 4YCNA 3FPBA 3W1SA 4OG2A 3JY6A 4DLRA 3A3NA 1I35A 1QKIA 2OBBA 3GLFE 1XN1A 3S1SA 4RL2A 5EIBC 4IWQA 1OA0A 3AETB 4GGMX 4NE9A 3IAS1 1KYIA 4YWHA 2BMEA 2WJ3A 2ZDGA 4E08A 3SBDA 3EXHC 3EGCA 1KI7A 2WA2A 4PYIA 1HTQA 3RNCC 2QV0A 4I4IA 3LYHA 2WOOA 1A9RA 2H1CA 5J17A 2D3GA 1K3FA 3L8HA 3HYLA 5B2ZA 1VKHA 4QM6A 1TIBA 2DWPA 4BB0A 2WWZA 1O8CA 2EIXA 4KFSA 1VYVA 4QWWA 5CG1A 1VIAA 3OZSA 3ZHXA 3EB9A 3DWGA 2A30A 2YV4A 3LHIA 3I05A 4IMPA 2BRUA 1T0BA 3TLJA 3ZC3A 4E4TA 2PQ6A 2QN9A 3TQIA 1WZUA 4UMFA 3HM3A 1M9NA 2HLHA 3QY0A 4J49A 3TUZC 1AN9A 1H66A 1G63A 3PL5A 3S28A 3OJEA 3BS4A 4BO4A 3EIHA 1GNUA 3I01A 3U4CA 3WNDA 1LSJA 3K5PA 4NDAA 1R8XA 4NU8X 1IIBA 3VR9B 2C5HA 1KEPA 3ZDBA 1G3MA 5AKYA 3OO0A 5C8YA 4GUAA 3ZYZA 2WC1A 1NI5A 3GEPA 3ZOKA 3OCYA 4LG1A 4CLOA 1WXXA 3R9KA 5ICSA 1VG1A 2DEUA 4TM8A 3NTUA 2ZZPB 3O3NB 5JZMA 3U6KA 1LVGA 4YR7A 1ZR2A 1YULA 5DNDA 3KDAA 2C9BA 2VWGA 2VDOB 3HCDA 5AJZA 2Q1YA 5ECGC 1NVUQ 5D3KA 1VKRA 5D84A 4AZ0B 4F4DA 1O6GA 1XVAA 1OH7A 3ZK7A 3SSMA 4TL6A 3T38A 1DOYA 5EKXA 4NDNE 1FP4A 2BW0A 4QASA 5D3MB 4EEXA 4XD7A 1EK5A 1C8VB 1GAEO 1TVEA 2VTDA 3AESB 4RENA 4C3ZA 4ZQBA 4MVJE 1UBEA 2BEWA 4ROSA 3VNAA 3Q8FA 2JWZA 4FHKA 1OE0A 2RJ3A 4HTFA 2O2DA 1N2CE 2HPHA 2PGOA 5T4BA 4A0HA 3DWMA 5C52B 3HACA 5AM3A 5L3QB 3COJA 4EHJA 5EI5A 1MFPA 3O4GA 1WVIA 2BMAA 2XKBA 3GEGA 2PHZA 3W34A 4GIBA 1JG4A 3QF4B 3E53A 4LZZA 3CPEA 3U3XA 5KHOA 1P4GA 4PLHA 5C53B 3LK6A 1W25A 5ABPA 3ZY6A 3E3AA 2GWHA 3O0DA 3WK8A 4IVNA 2NVOA 3ILSA 4YSYB 3PZ7A 1R00A 4J0HA 4R98A 2QYTA 4JI8B 1SIJA 1NXOA 4INPA 4QREA 2EZ9A 1DKMA 3AEDB 1G66A 3D2LA 2W6JD 4G56A 2IIBA 4OSOA 3SS9X 3DAGA 2UUOA 3D9QX 1V16B 3GRYA 4HH4A 3FH0A 3ROPA 4QBGB 2N42A 2OSBA 3QIVA 2HFJA 4PFSA 5A3JA 1AT1A 2RHTA 2ZTLA 5GGXA 3W8FA 3KTFA 1KO1A 2D3BA 1E20A 1KI1A 1UQTA 3PI6A 2P4SA 4EJSA 1SAYA 3HB0A 3R0XA 1V1JA 1CQPA 3INTA 2B4QA 1AS0A 2ZNVC 3DHIC 2MYTA 1ZONA 2REBA 3SSNA 2WNSA 5EVDA 4HFJA 2QQGA 4MRPA 4RMGA 4NKRA 2B34A 1E4EA 2VJNA 4J03A 3MHTA 1E2LA 3V46A 2OQRA 3IXQA 1RFLA 5JH7A 2IF0A 2D1SA 5AKLA 2LVOA 1G19A 1SUWA 1ZOPA 2DETA 1NDDA 2F17A 5EHXA 4KNVA 3C14C 2GBLA 3E9ZA 1REQB 3HNRA 2X4LA 4HH0A 4QXRA 1Q1OA 1MRZA 4ZREA 5IC4A 3QSYA 4G9GA 4YCDA 4K8OA 4WA8A 1DCTA 4O1IA 3KOUA 5IOIA 4UHDA 3WHLA 1ECPA 2GCOA 2VDNB 4LGCA 1V5FA 3PLRA 1QIIA 1ADJA 4AS1A 3C5VA 4EY8A 2V7VA 5CJJA 1L4BA 5EWLB 3SX0A 4IQ0A 2OJRA 3N1XC 4QBKA 4ZCIA 1ONPA 1XAJA 4JUAA 1JR3E 4AMUA 1DB3A 1GPWB 4W9RA 2N0SB 1E6EA 1V1MB 2F1IA 4JX8A 4GBMA 4KZCA 4PIMA 4Q3BA 3P5SA 3W5IA 4M2LA 4MVJD 4C9BA 1VCIA 3ABIA 3FWPA 3GG9A 4AVYA 1TA9A 3O2NA 2NUPB 4FZVA 3KWJA 1F48A 1G4UR 4IHJB 1TYAE 4DWJA 4WZBB 3AE8B 3PDHA 5JY6A 1Y6ZA 2X1MA 4EG8A 4F4CA 5ILOA 1E66A 1M10A 1P2VA 5KYUA 5KWSA 1YGPA 4D3FA 2Q1UA 2IGDA 3GARA 1KI3A 4XW2A 2B8WA 4K9SA 5C23A 4PLWA 3GAFA 4ZOBA 1HZZC 7REQB 1FTSA 5E8JA 1OXBB 2PANA 5IKMA 1WXDA 1TEHA 3ZDTA 2QIPA 5H70A 1FDRA 4FMPA 5FJIA 2H7VA 1CE8A 4TT8A 2AQKA 4MRMB 1QOBA 3WA6A 3EJ6A 4G36A 4BNDB 3G1PA 3IT1A 1M67A 5EE5B 1BDIA 1DO2A 3IT0A 3ZW3A 1E1LA 1KMMA 5HWSA 1B43A 1C7FA 1P3Y1 4M37A 3N53A 3OM9A 3KTDA 1K8YB 3DMDA 1N4AA 1US8B 4DLVA 2FWAA 1C3EA 2KYWA 2AJTA 2R8PA 3U44A 3B13B 4N41A 4TV9B 2V59A 4J2TA 2EATA 2QJSA 1U8EA 2IXTA 1ORDA 3WKBA 3AU5A 5FI1B 3L5OA 5AYVA 3ZVMA 1V6SA 2O52A 5IJZA 4EECA 2DFPA 1VZ7A 3C3EA 3M9XA 3QKSA 1IEXA 4RGTA 2HC9A 5CJ2A 1SVIA 3ZE2B 3I5XA 1DDIA 3CZRA 3QWZB 4GLLA 5HOEA 4U2EA 2RD0A 4IJQA 4HXDA 1E18A 4M1MA 5AW4A 4EI8A 4QXAA 4QO7A 5IT9A 3LQ1A 4P22A 2VYVD 3LBFA 4X00A 5EL0A 2ZB3A 2V6IA 2MMGA 4XVCA 1NXWA 5D87A 1EWTA 3HCBA 4PC7A 4Q1AA 4FR2A 1KKMA 5E3IA 1LLFA 3U0VA 1O4VA 1YQUA 2VYQA 2OBLA 3LL7A 4DXAB 4PYKA 4UHKA 3G0CA 2CYCA 3KO8A 1P5JA 4ZIRB 2EQAA 5BV2P 3R7FA 4QUJA 4CG1A 1YA8A 2Q2WA 4IZIA 2FRDA 1YQ3B 1M1NA 4IVQA 1N1MA 4O1HA 4ZRKA 2GASA 1FDOA 4EJ0A 3BCSA 4URUR 3TNLA 4GOCA 1LFAA 5FWYB 4BVUC 2GCPA 4BMPB 5DTJA 1WP9A 2HBRA 1XAGA 5SZJA 3HZOA 2R6GA 3CLTD 3IUBA 1V49A 2WDVB 4NFLA 4XPIA 5KAMA 4FHFA 1SB8A 2C4WA 1J1UA 4KTTE 4C4TA 3KNRA 3LUCA 1AXRA 1U2TA 3FSRA 4CF7A 3VQTA 5I7EA 1E59A 4FA6A 3PQ7A 2NV2B 1GQQA 1CHDA 1EP9A 1W48A 1E4YA 2ON6A 4J1QA 4ZTUB 4CM4A 2EDAA 2CCJA 4IZOA 4XFKA 5H9WA 1OI2A 1WL8A 2YV5A 3V8QA 1JDUA 1P8AA 4Q82A 2VDWA 1NVDA 4JP8A 1G20A 4C1BA 5BXYA 4TT3D 5ELMA 2QRZA 4QUDA 4MGKR 3TSCA 5KHQA 1ZGAA 3A4IA 1MJFA 2LUEA 1YQ4B 2I2DA 2EP5A 1WQ1R 2PGXA 4B2PA 1VA5A 5KOYA 1RRGA 3D3QA 1GGMA 2EYQA 5C5IA 2IX9A 3PWTA 1FEZA 5LCHA 4UTRA 4WZBE 1L0BA 2KXJA 1S7CA 4ZDWA 3UINB 2JASA 1U3CA 2V7UA 2ZJFA 3KT8A 3T1VA 4CDRA 3ZD9A 3HWSA 1O89A 2H4HA 5HMLA 1TM4E 3IP3A 2CNWA 3JAWA 4DA0A 2HCFA 1HY3A 4W9IA 1V3QE 1WUHS 2GR9A 2GOWA 4BDSA 1GGHA 3E35A 5IXJA 3FBTA 1P6XA 5JEEA 3ZNBA 1X9HA 1OYYA 3G1UA 2V7QA 1XWIA 3BMNA 2RHOA 1NW9B 3S2UA 3Q2IA 5BN4A 4NXMB 5KCMA 3SVLA 4IUDS 3A1CA 4OHVA 2WYHA 3H7PB 4KGZA 2CVPA 4MAAA 5EPOA 2Q7XA 1DRJA 4RFSA 2VTVA 1NG1A 4DPKA 2H2HA 4MUBA 5DJ5A 3HCCA 4GSWA 2A2ZA 1KRHA 1JR6A 2JRIB 3I3TB 1K6JA 1Z0JA 4RKYA 4MWTA 4D98A 1GADO 1RM3A 1U8ZA 1W73A 4P35A 3V1TC 1V6EA 5GM2A 1XZGA 2JBHA 1TMGE 1EA5A 3ZY3A 5KDOA 5DBHX 3V4RA 3NIDB 1W75A 2B69A 4LDJA 2WMNB 5CT6A 5K0JA 5K09A 3NANA 2GZAA 2NU9B 5CVTA 4GD3Q 4CN8A 1ECLA 2C4HA 4LJ4A 1XAHA 3H8SA 3Q1KA 2KC2A 1X1BA 2BZ1A 3BQ9A 4R6XA 5CW2A 3B85A 3WE7A 4JFAA 4RHYA 4L3WA 3OT5A 5FUWA 1UDAA 3DE5X 3DXYA 4MWZA 1H93A 2NTSA 4MMYB 4RANA 5B7PA 1CYDA 1OVMA 4Q9DA 4A5SA 4ZJPA 1SC4A 2YXNA 2YICA 2QLTA 3O4FA 3KW5B 3WYAA 1H2HA 3SGLA 3FAIA 3U7RA 5EVKA 2CVHA 3DW1X 1T2AA 1L5HB 1NYLA 3HKEA 4XDDA 5FPHA 3DT9A 4MHTA 3RDPA 1MA0A 1OX5A 3ILXA 4GRIA 4KQ9A 2ACVA 4QOGA 4GDKA 5KOIA 1YOVA 2LE0A 3WV4A 4CM8B 3L7OA 3L7JA 4HADA 3B1WA 2CKHB 1RLFA 4PS0A 3PHJA 1GRNA 2BBOA 1KTVA 3RODA 2J6CA 3W1VA 4MW6A 4CI9A 5JFTA 4HT3B 4N59A 4PV7A 4Y30A 4JIMA 1E77A 3A6HA 4JP2A 1P29A 2J4FA 1EUZA 2DBYA 1TYCA 3KEMA 4JLNA 4YRRA 7ADHA 2ICIA 1HNZB 3H04A 2I8LA 3KHSA 4JLWA 2AE2A 3UA4A 3EASA 3H6NA 2WZCA 3S2GA 4JNKA 4BNZA 2IIQA 4HJGE 3Q5DA 4QNMA 3VKFA 3WWOA 4ZZ1A 4E0BA 3T7EA 4YRQA 2WI8A 2HB6A 4B7ZA 2P2YA 3FMOB 5TQ2B 1GJRA 3E7FA 2XVXA 1F52A 3I13A 1RZRA 1UXOA 1Y7IA 3RNEC 2JGKA 4XAQA 1EGAA 2F9FA 3EZ2A 3EGWA 5EPEA 3WV5A 1B1ZA 4OHCA 3RC9A 5IKCM 5CU7A 4B9AA 2X0RA 2NTTA 1BMFA 3VYTB 5KYTA 1JRUA 1NX6A 3OSZA 1DIGA 1WU7A 5ETJA 4LVOA 3O8QA 3U4QB 1ID1A 2XKKA 3AEKB 3IAS6 1USKA 3BF8A 1BZYA 1EFUA 4PBSA 1GNPA 3DEYX 5MN6A 1TM1E 2YWEA 3Q3IA 4D9HA 4JN6B 3RC1A 4ALJA 5KZMB 2Y87A 1XU4A 1JDTA 2UZ1B 4D9NA 1XWWA 3PDWA 4UWOB 1MXFA 1KQPA 3PE6A 3R2UA 3FCZA 1RBYA 5SZHB 1PYWD 2SCUA 3R3HA 1WR8A 2DSNA 2DZDA 1L7VC 2YQ4A 1UUPA 4Q01A 4UDOA 5DTIA 4QVIA 3AR4A 3GLUA 3COYA 4TQGA 4NZPA 1KTIA 2NNLD 4BAXA 2JLVA 3A2KA 1V9LA 3A3KA 5LA6A 3EPLA 3PRZA 1H5NA 5CFZA 2GRJA 3G49A 4UREA 2IOYA 4OA8A 5TV2A 3WZMA 2PQ0A 4EHHA 5ACSA 1IEVA 1NGSA 3AZPA 3O0TA 1P5FA 3PUZA 3NZ3A 1I7NA 5CX4A 1XRQA 1NVKA 5A7HA 3ST7A 1VE1A 4I1OA 4DR7B 2Z58A 3MTJA 4FYYA 5CM2Z 3SPUA 1EWCA 4KDRA 4P3XA 4WUTA 5JDCA 2JFOA 1ZPSA 3D1JA 4HGZA 3RRJA 2FBWB 3F6SA 5FAKA 3CVWA 1E1YA 4EK9A 3DBRI 2AOVA 4HYQA 3VPEA 4PG4A 4MNTA 3UJ7A 2CZQA 1UBHS 2WTBA 1YFJA 1R0SA 1IOZA 2O3SA 2C2KA 5ARCA 4YLGA 5HTKA 2ZW9A 2PKQO 2QTAA 1WGRA 2ONYA 2XEXA 3Q7IA 5HE8A 3SHFA 4C3VA 4ITKA 2DLDA 2VAXA 2VPYA 5DT9A 2L83A 1GRRA 2GT1A 2XNAC 1T91A 3DFKA 2X0EA 1P2BA 2XYVA 4I5DA 3HBMA 1E32A 2I55A 1Z2DA 2I1WA 1Z7YA 1OLUB 1M1UA 4YMSA 5EIHA 3RJZA 3D5EA 2O8CA 3C6XA 2CLEB 4A0FA 2AN1A 2W2MA 4FNMA 1C1YB 4ND5A 2BFEA 2RK4A 3GRKA 3Q40A 3UHOA 1WSPA 3DOFA 4ESEA 3VR0A 1XTKA 2HY7A 3UGJA 5DYGA 3GGSA 5J23A 4WY5A 4XRRA 3PS6A 4KBYA 2BRUC 1QOZA 4PGHA 4WZ6A 3QH8A 2K6QA 3IVCA 4ZHQA 1ZCZA 5K8CA 2J41A 1DV2A 3EHEA 4KW7A 3WTBA 1EGQA 4BCCA 1C14A 2XMZA 2EL9A 5JNRA 1AUVA 1T3ZA 1WRBA 1M33A 3CLSC 5H80A 3N2ZB 4HOYA 2ZPNA 4A27A 3OZIA 5LXIB 5BSGA 1IBKB 2GK4A 4OLBA 1EDEA 1MQSA 2E5FA 4N6NA 4N3CA 4Y1RA 5LKRA 1KK2A 4HGNA 1Z5ZA 2VDQB 3C7DB 2V3CC 3I3OA 2O6LA 2YNVB 3EN0A 1CJMA 2PZJA 4K0KB 3JVDA 1OPXA 3AP1A 3FTEA 2F4VB 2WHXA 3CLSD 1DZIA 1SUPA 1U7XA 1T6BY 2PLNA 1QHHB 4ZRQA 2NVUA 1N2IA 2OXEA 2H57A 4GMVA 4MT5A 3NY5A 2I4RA 1VLLA 3CUUA 3NETA 1J2UA 1RCFA 4JBYA 5C1ZA 1PAUA 4JSYA 1VE3A 1ZO8A 1DKQA 2MBBB 3ICWA 1OR8A 4YFYA 3MJVA 1O95A 1CQJA 3E7PA 2IQIA 4XJSA 3S2AA 5GV8A