2ZO4A

Crystal structure of metallo-beta-lactamase family protein ttha1429 from thermus thermophilus hb8
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
315
structure length
301
Chain Sequence
ALLPGLYLLPVPIPYPLKTVNLYLLQGAGEVALVDTALGTRAARGALELHLAELGLCFQDVKTILLTHHHPDHYGLSGFFEGLGARVFLHEEEFARGHRFWREPEAFAEASWRLFLDHGTPEETVEKTRERVHPPQNPLPLRDGEALEVAGKRLRVLWTPGHADGHAAFYLEEEGVLLAGDALLEKVSPNVGLWAYTRENPLKDFLRSLDRLADLGARVAYAGHFGPIADVRQRAEELKAHHQARLEALLALLDGPKTAWELSLHLFPRRFAFAETLAHLEYLREEGAVGRGGPPYRYFRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Metallo-beta-lactamase family protein
publication title Crystal structure of TTHA1429, a novel metallo-beta-lactamase superfamily protein from Thermus thermophilus HB8.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Hydrolase
total genus 100
structure length 301
sequence length 315
ec nomenclature ec 3.-.-.-:
pdb deposition date 2008-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2zo4A02
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 2zo4A01
4OIOF 3HRTA 5ACVA 2VE9A 1BJAA 2XF4A 2Y8BA 4YFNF 2EB7A 3ZR9A 2E7XA 1FSHA 1YG2A 2VT3A 3E5QA 5CJ9A 2UZKA 2EV6A 1QGPA 3CLOA 4UVBA 4S05A 1SD6A 3ADRA 3EYIA 1KU3A 3T1BA 3ECOA 5EW0A 1FYKA 3KZYA 5E1ZB 5EVKA 1J7KA 3CDHA 4LLLA 1UHMA 2BTNA 2BIBA 1W7PA 2DFIA 4WXCA 4KFCA 2DPDA 4NB5A 4OIRF 1XGOA 1O3QA 4EJOA 2QQAA 3COAC 3E6DA 2XAGA 1OPCA 2Y75A 3F3XA 5HDNA 3MZYA 1K6OA 1QNTA 1QZYA 2A5YB 3I5UA 3HOSA 4YSKA 1CF7B 2RVCA 3FM5A 2NNNA 2NZEA 2ISYA 3HTSB 3SZTA 4M6XA 4YSBA 3TOBA 2M5DA 4EGYA 1YTYA 1M2XA 1HW1A 3ZMZA 5D6FA 1BI0A 5HIOA 4UV9A 3IEKA 2FE3A 1YQAA 1F9NA 1AWCA 5DCFA 3BJ6A 3F21A 3H92A 5ACUA 4BH9A 2O8XA 2QUFA 3TKYA 3QPTA 4QLCU 3KNRA 3IHUA 3JTHA 1SFXA 3I58A 3HRSA 4UHTA 1C0WA 2STWA 1REPC 4RAWA 2JPCA 2ZXJA 1P4XA 2O6GE 1U6GA 1F5TA 3FX3A 5IT9K 5ILUA 2P5LC 3V8JA 3VPEA 2Y0MA 2F5CA 4G9YA 2QM3A 4U4LA 3T0YA 3HOTA 1I5ZA 2I7TA 2IA1A 4EGZA 4EVIA 3R6SA 4ETSA 1OMIA 5FFXA 3FHZA 3ZNBA 1VJNA 5IT3A 1IF1A 3HSEA 3Q9VA 5HLHA 2GXGA 1IXCA 2FU8A 3SPUA 3ZPLA 1E5DA 1YLFA 1TNTA 4P55A 5D5XB 3IC7A 4RBSA 3C3WA 2VODA 2MD5A 4HA8A 1WW1A 3V4GA 4A0YA 2QBYA 4B09A 1BM9A 1KA8A 2O61A 4UWSB 3WTWC 3V8KA 4TV7A 2Q0OA 4AIHA 3IWZA 3L00A 1IRFA 4I7HA 4LD5A 4L9TA 3SQNA 3CO7C 2ZBKA 1B4AA 3I59A 2DQRA 4FR7A 4P62A 5FQAA 2VBWA 2IW5A 1FX7A 3GO5A 2HKXA 3CO6C 2DK5A 1V4RA 4A5NA 2FU9A 2R3SA 1PP7U 2UWMA 4KICA 1QO0D 3SD9A 4O5VA 3V7CA 3F8NA 4OMYA 2YX4A 4P9FA 2FOKA 2R7DA 4A0ZA 1ONVA 1EH7A 2FU7A 4TYFA 4BYYA 3I11A 4MTDA 3GWZA 3LA3A 2IVMA 4LE6A 2YPRA 1R5HA 2ZKZA 2ZFWA 2XHKA 3CUQC 3CJNA 1W5SA 3ESHA 2FU6A 1G6NA 4BZ3A 2XAHA 5CVUA 3RDIA 3Q6VA 4KUMA 4LLGF 4UBQA 3ZQ7A 1HQCA 3GZ5A 5LCHA 4GGGA 1YCGA 2GKLA 2CG4A 3BC2A 3KEOA 2QJSA 3L09A 4MHGA 5AHRA 1B9MA 4BP0A 1B1BA 3LQRA 2Y8AA 5K0WA 2JZYA 1TLHB 2K4JA 3WTVC 2NYPA 3T3OA 4EJUA 1R5GA 3J80K 4DNCA 2K7LA 1VTNC 3RIRA 4JQFA 5B1UA 1I1SA 2YX7A 1ZTCA 5K5OA 4M73A 3IL2A 2BFLA 1YFHA 4GXOA 5K4MA 1HKSA 4MNUA 1R22A 2BG7A 1IN5A 1ZYRF 4WD6A 3SXYA 4HLYA 1FNNA 5ERIA 4OINF 5LBQA 4CICA 3I0VA 2BR6A 4DIKA 4XUKA 5LE1A 5FLXK 1ULYA 5AYAA 2KIUA 4UA4A 3IOFA 1F1ZA 1A8TA 3QU3A 4I09A 2YSRA 4C1HA 2OQRA 4U88A 5LRSA 2JPBA 2V6CA 1ZHFA 1MKMA 3DHCA 4ZYGA 1XTOA 1FBSA 3MWMA 2IA2A 2EFNA 2PG4A 5H6RA 3FXQA 1ZGJA 3T8RA 1ZARA 4GO1A 2UXXA 4HV5A 2P1EA 4R79A 4WCGA 1MZBA 3BPVA 2MC3A 5FQBA 2VOOA 3ULQB 4CHLA 4EM0B 2MH9A 4RB3C 2A07F 3L6NA 2P97A 2HZTA 2DAOA 2D1HA 1W4MA 3WTUC 4O98A 2AIOA 2HTSA 1MD0A 1U3EM 1H0MA 4Z67A 1SMTA 3AF6A 4PDKA 3TO7A 3L9FA 2VE8A 3SBLA 3I71A 1DXKA 3JSPA 4G6DA 3GFJA 5D8LB 3I14A 4ZEJA 4EJWA 2MH2A 4A6EA 5BS6A 4KMFA 4EXYA 1HLKA 4KIBA 2QQ9A 3F8CA 4L5IA 1T38A 4P5OA 5ICGA 3CUQA 4CZZA 4BQAA 2KKOA 5EEHA 1KU7A 3WTSC 4ZYDA 2PJPA 4FEKA 2NAZA 2GFJA 1IXRC 4HQMA 2YNTA 4PVTA 1LEBA 2OHIA 3GEZA 1YW8A 3RI4A 2FNAA 4HZFA 1GVJA 1Z91A 5BMZA 3R2UA 2ZZIA 3HYIA 2Q2EA 1EV7A 4AWXB 2H94A 5K5RA 5HOOA 3WTXC 3N4MA 2QYOA 1T98A 3RJPA 2DW4A 3KEQA 4OU0A 3OOPA 2FXAA 3QRFF 3VB2A 4EFZA 2XUBA 2NNYA 2BFZA 2DLLA 2LDUA 5EH9A 2EK5A 2HDCA 4BAYA 1RI7A 2VXZA 4FHTA 1Y0UA 2DU9A 5HH4A 1P4AA 3L2CA 4IHSA 3O2PE 1L9YA 2I7VA 3H3UA 4RL0A 4K2EA 4Z5YA 1ZNBA 2WRSA 3QH8A 3VEPA 4RAZA 2Z3YA 4GYQA 3W6KB 4PCQA 1O7LA 4EJVA 4YSLA 3X2ZA 1LJ9A 2ZJ2A 1D3YA 2Z5UA 3IOGA 4N9HA 4I0AA 1DUXC 4IRIA 4EV0A 1FOKA 2CFXA 2ZNZA 2BMIA 1ON2A 4LK1F 5KVRA 3ERED 3SHFA 3J81K 2JSCA 4TZBA 2TDXA 1PDNC 4Q4ZF 4HX7A 4M9XA 4UVAA 2KRFA 5E18F 1T39A 3BROA 3LSTA 2F5DA 1ZN2A 5A2QK 2HGCA 1T0FA 4Z7RA 4L5JA 3HUGA 5JHUA 4FX0A 1T2KA 2EFQA 4YFXF 4G7HF 2ZNBA 2P5KA 4YG2F 3E5UA 4WK8F 2LF8A 3CUOA 1P92A 2Y48A 5EEGA 3WU1B 3K1NA 5JVTA 1DD6A 3TP9A 2VC1A 2QQBA 1FT9A 4RAYA 3HTUA 2EFPA 4IXAA 3MQ0A 1IRGA 1ZKPA 4XLNF 4C1FA 5E1WA 2MLGA 3WG9A 2Z33A 4KMUX 1WWXA 4MEXF 4HF1A 1STZA 2BG6A 3GXOA 1S8NA 5DUKA 1H9TA 5FD5A 1XCVA 2YU3A 4ENNA 1RNLA 3I13A 3ZN1A 1IN8A 1KQ9A 5HIPA 5LS3A 2XAQA 3QP6A 2HKOA 5HDGA 3QPHA 3F23A 4M9ZA 1KR3A 1BI3A 4IRHA 2QDSA 3DQVC 1A04A 2HQRA 2W85A 2YZ3A 2V1DA 3F6OA 2GA2A 1TQPA 4GYGA 1FYLA 4M6YA 3RYPA 2COMA 2ELHA 3KP4A 4ESJA 4KEPA 2FU4A 3GW2A 2FQ3A 4MQ9F 5IT9Z 2KJBA 3MAJA 4AVPA 2WC2A 3FM3A 2FF4A 2PBIA 4HL1A 3FMRA 2EFOA 3BY6A 1ON1A 2V1XA 3VODA 4HYEA 2IPQX 3W6JB 2FK6A 3KP2A 5AONA 3I53A 4N9IA 4EM1A 2ACJA 2BE5F 1XDSA 4RGUA 4H0EA 3WGHA 2NRAC 2OBPA 5HS9A 2FNPA 2ZCWA 3M9AA 3P7NA 5E8GA 3TDUC 2P4WA 2UYXA 3H3EA 1GXQA 4I01A 3WU0A 1O3RA 2E1CA 2FRHA 3NRVA 2ZMEB 2K27A 4GYIA 3V8LA 1SMLA 4U7BA 3H3ZA 4YIFA 1BIBA 1XSVA 3BPXA 2DPUA 1I27A 1KQ0A 3ZWFA 2NS0A 4AIJA 4HF2A 4KA4A 1XD7A 4L18B 3RPCA 3LFKA 1XGMA 3G1PA 1KO3A 2V79A 5B15A 3I64A 5IQKA 1P6RA 4IJAA 2RGVA 3TQNA 3ELKA 4H0DA 3HHHA 3GUDA 2C6YA 4M74A 4MGRA 5ED4A 4DILA 2LSOA 5K1YA 1XGNA 5EVBA 2BEOA 4P96A 1HXDA 3X2XA 3P9IA 1KYZA 2BYVE 3I54A 3JAMK 1K7AA 3I0TA 4L9JA 5FD6A 2GIVA 3M8EA 1SD5A 3EUHA 1WRJA 2XVCA 2VT2A 5EV8A 2QENA 3FF5A 5CVRA 1ODDA 3RKKA 4F6ZA 1S7AA 2EFWA 5HH6A 1TNSA 5HLGA 4S04A 1ZREA 3MD7A 2EV0A 1VGNA 3GX4X 3E6BA 3VQZA 3ZP5A 4MEYF 2KIMA 1X8HA 2RV8A 1YS6A 2OZUA 4AX0B 1YCHA 3KZZA 2FBHA 3MFKA 2M30A 1R1UA 4KN4X 2A7MA 1YYVA 5D5WB 3FCZA 4EYBA 5HISA 5ICEA 1MJ9A 3FMQA 3IRRA 1BOAA 3E6CC 2HB9A 5D4RA 3J80Z 3DP7A 4A6DA 1XN7A 1U5TC 3WTTC 2VC0A 3BK2A 3HIFA 1Y44A 1UFMA 4ASNA 1X8IA 4GYUA 4IVNA 1K07A 1U2WA 3KE2A 2UXNA 2W25A 3F6VA 2XRNA 4M71A 2XAFA 3T9MA 2H09A 2O3FA 1ZLJA 3IDZA 1YS7A 1FC3A 2CYYA 2FM6A 1ZLKA 4PVOA 3J7AO 5FLXZ 3E5XA 4HX4A 4C1EA 2BC2A 1OKRA 3DKWA 3DHBA 3BJOA 1FYMA 4PZJA 5H6QA 5EWAA 2QBYB 3QP5A 3JTGA 2HS5A 4JO0A 3GF2A 4Z6XA 3E6MA 3RKXA 2IJLA 4LK0F 2BG8A 2L54A 1AOYA 1MJBA 1DP7P 1O7FA 1WRAA 2KIFA 1Z1DA 5D5VB 2OHJA 2G7HA 2ZNYA 2ADUA 2MLKA 2IRFG 5LGUA 1G3YA 2YNUA 2XV4S 2WTEA 4DQ2A 1DDNA 2X4HA 1OYYA 5LEJA 2GWRA 1SD7A 4NQWA 2NXAA 1LQ1A 3RKJA 2RC4A 2F5EA 2W57A 1DDKA 4TZFA 1UB9A 3KETA 3SZPA 4LGWA 5DCMA 2AXLA 2EJRA 3R61A 3FAIA 1ZG3A 4KIGA 3C18A 1XB4A 4HDUA 3ABUA 2G9WA 1J59A 4RM5A 3IKVA 2PFBA 3F8FA 2W84A 2BG2A 4AWZA 1S6LA 2P5VA 3BJAA 3T3NA 3Q5FA 1KQ8A 1BMCA 2GMNA 5D6EA 3P2UA 3PY5A 4BHCA 5HLIA 5HH5A 2HTJA 4TZ9A 1MJAA 5D8KB 2YR2A 4Y13A 5AIPA 3RPUA 3HRMA 2B0LA 2YNVA 5FB2A 1G3TA 3KFWX 5E20A 1JE8A 4EJTA 5K4KA 3WGGA 5LHIA 4HQEA 2Z99A 4I2OA 5DPXA 3FMSA 3RKWA 3I4PA 4O6JA 3SFZA 5J8FA 4XWTA 2K02A 3JSOA 2ESHA 2FA5A 1XM8A 4E70A 5TRDA 1SMYF 4GCWA 2QEDA 1J0RA 1U5TA 1WKMA 4Z5ZA 4LMYA 4AWYB 1JHHA 1Z6RA 1J75A 4A0XA 1W7PD 4EQQA 2PQ8A 1LB2A 1JGSA 2FMYA 3AAFA 1SD4A 4B87A 3M8FA 1KU2A 4I0BA 3F8BA 5FFZA 2BFKA 4Y17A 1QH5A 4Q48A 3Q9SA 3IRQA 2M87A 2DK8A 2EA4A 2XR1A 3RPQA 2Q0IA 4JBAA 3P9KA 4OOIA 1UCRA 3TO6A 2OQGA 4XRFA 2L3DA 1Z7UA 3V7RA 1IN4A 4HLXA 5BOXA 2FHXA 3TOAA 3BP8A 4L0YB 4LB6B 3QOPA 4RGXA 4ZYHA 5HIQA 3OV8A 4EYLA 1LDDA 4RGRA 2NYXA 1BC8C 3WODF 1FY7A 3ML6A 2ZO4A 4M72A 2WV0A 4KT5C 4O3MA 5J6XA 1O3SA 1TQIA 2MA3A 5HS7A 5FQCA 3B02A 5AXOA 5A0VA 1T6SA 4ON0A 2FBIA 4LG0A 3J81Z 4Q47A 1RUOA 3ROUA 1DPRA 2CO5A 1F4KA 3U1DA 1NHAA 1MDMA 1HSTA 2Q8KA 1K78A 2NZFA 1FPQA 4WXDA 1R58A 5A2QZ 5L3DA 2RDPA 2VN2A 1FBQA 2E7YA 4CO8A 5ILVA 2XAJA 1R36A 1YIOA 2JTVA 4CGZA 1E17A 5ACWA 1BIAA 5AHOA 2D2WA 1U78A 4MQVA 3CUQB 1BVTA 5CVJA 4NQ5A 1FP2A 3ZMTA 1IN6A 2A3SA 2I7XA 2J5OA 3ECHA 1TW3A 2Y87A 2P6SA 2QDTA 5E17F 1ZG5A 5LCAA 1EH6A 2A61A 1Q1HA 1KU9A 2QVOA 2O03A 5ACXA 1FP1D 3L7WA 3PQKA 2P4ZA 3ZN0A 1W5TA 3KP7A 5ICCA 4ZO2A 5L3BA 2HQNA 2STTA 4UWOB 2BFZB 4KN7X 3S2WA 3D5LA 3KP5A 3IWFA 1IN7A 1G3WA 4IF4A 4OIQF 1QPMA 5CYVA 2IT0A 1HSJA 3ZQ4A 4AX1B 3K9TA 3C1DA 3ZMSA 4ESBA 1B59A 2BBYA 5LHHA 2OA4A 1OYWA 4FT8A 2PI0A 2VW8A 3FXRA 5ACRA 1Z05A 1LDJA 3KL7A 4Z2YA 3RYRA 1SFEA 3TGNA 4BNCA 2JT1A 5LEKA 3N97A 3K1MA 1Z9CA 5LCFA 3IE2A 1FWZA 2CQKA 4QWQA 3IE0A 2EWNA 3R4KA 3DXJF 4D1TA 1CF7A 3RKYA 2VONA 1I1GA 4EXSA 3K69A 4U0YA 2HWVA 5L3GA 4OIPF 4TZEA 2VBYA 2DT5A 1ZRDA 2ISZA 5LLQA 5E1XA 3WE3A 3DH8A 3MCZA 1WQ2A 1IXSB 2PMUA 2H27A 2MBFA 3SRXA 2H6AA 3F9OA 3ISPA 3DEUA 3EQLF 3V7SA 1YW7A 4RB0A 2D45A 5ACQA 2ZMEA 2ESNA 4NQ2A 2M45A 3GFIA 2RKHA 4NQ6A 3KCCA 2K86A 5A87A 1D8JA 4ZO3A 4F6HA 3EDPA 4YFKF 1PP8F 5E8IA 3P9CA 1X8GA 4WWCA 4D02A 3R60A 3HHGA 1MQOA 1CGPA 4G7OF 1LVAA 2LF7A 4L0ZB 5KILA 2P7VB 4IHTA 2HEOA 4NHJA 3R0JA 3BZ6A 3RTRA 4D1WA 1MGTA 2P7CB 3LVZA 3M1EA 3JAMZ 3X30A 1IZ1A 3KLNA 4LFUA 2CW0F 4HKYA 1IW7F 2XIGA 1GHCA 2QWWA 3A4YA 4XLPF 3ABTA 5JR3A 1S3JA 1HW2A 2EV5A 5BPDA 3PFIA 1SAXA 2GCUA 2R2DA 6PAXA 3E3VA 4KIFA 1JJTA 2M1BA 1USSA 2VOPA 3LAJA 1W7PB 3SW3A 5BQTA 1LNWA 4HL2A 4HF0A 4HAMA 3S0ZA 2J5PA 5LHGA 3E97A 2L01A 1USTA 4F7ZA 1XCBA 3O6BB 1BBYA 2A6EF 2GAUA 3B73A 4PGHA 2A6HF 2G7UA 1R1VA 2DQLA 1BI1A 4C1CA 1WSUA 2CWEA 1ZRFA 3F72A 1ZGAA 2WYLA 1JT1A 4G6QA 2RQPA 3IKTA 3K2ZA 3PY6A 4G7ZF 5H20A 4J5HA 3WTZA 2RNJA 1BN5A 4ENJA 2HOEA 5LGTA 4LB5A 5AIQA 1XMKA 5ILSA 1WI9A 5FGMA 3FXUA 3LA7A 2BGCA 4LJZF 4UV8A 3VOEA 1B6AA 2A69F 3AF5A 2GXBA 2BGAA 4V0HA 5F64A 4ZH4F 5ACTA 2Q9UA 2K4BA 1IAWA 4RL2A 1J2XA 2XKPA 1QQIA 2FEZA 1D8KA 5AEBA 4KEQA 2QLZA 2XROA 2WYMC 3BOQA 5F1RA 1G4DA 3I15A 5EVDA 4FSBA 1O57A 3DPTA 3HSFA 3JW4A 4AD9A 1LEAA 1YCFA 1TBXA 5F6FA 4A5MA 2ZWRA 2FMLA 4A2UA 4HBLA 1TW2A 2W24A 1QBJA 1FZPB 2GFKA 5HVQC 1FLIA 3R0AA 2DO7A 1UHWA 3KLOA 3U9GA 4Z60A 2IA0A 4WX9A 1HKTA 4AIKA 3NEUA 5K4NA 3G73A 4N0BA 3CTAA 2FBKA 1L3LA 1YO5C 2Z9OA 1HBXG 1R1TA 1S7OA 3DPLC 2AS5F 2H6CA 1XSDA 4XWWA 2P6TA 5TJJA 4LLNA 4U0VA 1P9EA 1J5YA 1RUNA 4CXFA 1A7TA 2GZWA 2XKOA 4MTEA 4HW0A 4RB1A 4Y15A 3DV8A 2Q42A 1FBUA 2EA2A 2DOOA 3REOA 1B9NA 2XGXA 3QAHA 2DI3A 3DF8A 2L4AA 3I59B 5BPIA 3KNSA 3VFZA 3GLXA 4UWPB 4WXHA 5K5QA 4HX8A 3JXPA 4BHBA 5B3RA 5A0TA 4KYWA 4TYTA 5EV6A 3GFMA 5DEQA 2VBZA 5L3EA 2HFHA 1QH3A 1WUPA 5DYMA 1V3FA 1XMAA 3IEMA 1R7JA 4CHUA 1EH8A 4ENMA 3NQOA 5D5UB 4D1UA 3TDZC 4BHPA 1RIOH 4EY2A 1S29A 4WF2A 5A5ZA 4GCVA 4IRGA 4XBFA 3T8TA 1J9IA 2PLYA 1D5VA 5CVVA 5LMCA 4HOBA 2FSWA 1E2XA 2OAZA 4B8XA 1R23A 1DPUA 3KP6A 4P9UA 2OU2A 2VBXA 4Q5SF 2CBNA 5ACSA 4A12A 1JXSA 4ZNBA 2OZ6A 2P8TA 5L3FA 3X2YA 2L02A 2BG8B 5DUIA 5ACPA 2M5WA 3MEXA 3GYHX 3G3ZA 1LDKB 3K1PA 3IELA 4FX4A 1VMEA 4HV6A 1RZ4A 5ICFA 4U0WA 3FZVA 3EETA 3F8MA 5FO5A 2DKFA 2E7WA 1L0OC 4KDPA 1I6XA 1TQMA 2WYMA 3PG4A 1PUEE 2D1VA 3BDDA 4C09A 1HKQA 2RN7A 3DFGA 2OD5A 1KGSA 5DCMB 1G3SA 5LSCA 2M5CA 4BXUA 3WXCA 2Q0JA 2CGPA 5LRRA 3O3KA 2V9VA 4I98B 3ZMDA 3GZ6A 2X0LA 3WE2A 4PGGA 2HR3A 1KO2A 2XASA 4RB2C 1P4WA 2AZ4A 4C1GA 1KYWA 4UAMA 2H6BA 3LAPA 3LWFA 3AJ3A 3ZMVA 2GQQA 2WWYA 4CDGA 3HRUA 4C1DA 2HYGD 3ZMUA 2DBBA 1ZH5A 2YNVB 2PEXA 4EYFA 2ETHA 1XGSA 5HS8A 5KIKA 1HW5A 1FSEA 4L9VA 2GA1A 4YIIA 4UWRB 2PN6A 2A68F 1YW9A 2L4MA 2LKPA 1SFUA 3F22A 1U5TB 4UVCA 1XDUA 1GXPA 4G94A 5JI6A 2F5FA 4NQ4A 4EM2A 2HYFA 3U2RA 3D0SA 3IE1A 5DD8A 4I02A 4D1VA 1O3TA 5DD4A 4UUVA 5LM6A 1BI2A 2P18A 1OR7A 2IP2A 4RAMA 5DV5A 3LQQA 5L3CA 1OYIA 4EMSA 4XSZF 3EYYA 2KJCA 4CYDA 4U7DA 5HDKA 2OHHA 4KNYA 4R8HA 2YNTB 5DDGA 3QU6A 4ZYEA 4UXNA 3M7GA 4ZZLA 1R00A 1X3UA 1BC7C 3KP3A 2E1NA 2FHXB 4OMZA 5CLSA 3GFLA 2QINA 4G8XA 4UNOA 5J8CA 3FWEA 2BV6A 1H9GA 1U8RA 1JHFA 2F2EA 3LA2A 2O0YA 4R1HA 2M8EA 5LLDA 4XSXF 5KK1A 4M9SA 4ENKA 3GVAA 4LG0B 2PMHA 4J5FA 1TTYA 3TO9A 1ZRCA 5CVIA 3K0LA 5AXRA 2CSOA 2YCBA 2JRTA 1MDMB 1K78B 1IUYA 4L9NA 4D0PA 2WHGA 2V1UA 2R7FA 3HSRA 3PQJA 1K79A 5JFRA 1ZG1A 3DHAA 3C7JA 3BWGA 4RGSA 4ZZDA 5EHTA 3T5XA 4JK1X 4RS8A 5D4SA 3BV6A 3SFPA 1P2FA 1QZZA 4HDVA 2DTRA 4ESFA 5LGNA 1BC2A 2LNBA 1ZAOA 1Z6TA 4IPAA 1JJEA 3MZHA 3WTYC 3WGIA 2QZ8A 3BK1A 1XSXA 2YNWA 1WUOA
chains in the Genus database with same CATH superfamily
4OIOF 3HRTA 4I99C 1PUFB 5ACVA 3HOUJ 2VE9A 1BJAA 3HKZA 2E1OA 2XF4A 2Y8BA 4YFNF 2EB7A 2VJ5A 3ZR9A 3ASNH 2E7XA 3CJQB 1BR1A 1FSHA 1YG2A 2VT3A 3E5QA 3VPRA 5CJ9A 2XPWA 1W1WE 2UZKA 4HSTA 2LK2A 4BACA 1YITI 1E3OC 2EV6A 1QGPA 3CLOA 4UVBA 4S05A 4B48A 4Y7NJ 3EPZA 1SD6A 3ADRA 4XKCA 5GP9A 3EYIA 1KU3A 3T1BA 2WBMA 3ECOA 5EW0A 2ZXWH 1FYKA 3KZYA 4A3BJ 5JVGF 5E1ZB 5EVKA 5IPAA 3CDIA 4HNUA 1J7KA 3CDHA 3IUOA 3OR2C 4LLLA 1UHMA 2BTNA 2BIBA 1FMVA 1W7PA 2DFIA 4WXCA 1IG7A 4UY8I 1DGRM 4KFCA 2DPDA 1SANA 3LOCA 1YRNA 2YS9A 1LVKA 4X1EA 4NB5A 2X6OA 4OIRF 1XGOA 3CP2A 2IS6A 1O3QA 4OWRB 5E3OA 3VWBA 5EYRA 4EJOA 2QQAA 3COAC 3E6DA 2IS2A 2VXDA 2XAGA 3HOZJ 3AKZA 1OPCA 2Y75A 3F3XA 5HDNA 3MZYA 1K6OA 1QNTA 1QZYA 2A5YB 3I5UA 3HOSA 4YSKA 1CF7B 2HOTA 2RVCA 2MC4A 2DMUA 3FM5A 2NNNA 4A93J 1LFBA 1WHUA 2NZEA 2ISYA 2HQAA 2X9DA 3HTSB 1OCZH 3PJRA 3SZTA 2E35A 4M6XA 4YSBA 3TOBA 2M5DA 4EGYA 1YTYA 2HOAA 4E7SA 1VNDA 1M2XA 1HW1A 1NK3P 3ZMZA 4NBQA 5D6FA 3RPUD 1BI0A 5HIOA 1ZQ3P 4UV9A 3IEKA 1UG2A 2KPMA 2O7OA 3HPGA 4C9YA 2FE3A 1P7IA 1YQAA 1F9NA 2ME0A 1AWCA 4C3HJ 5DCFA 1I3AA 3BJ6A 3H92A 3F21A 5ACUA 1G8XA 4BH9A 2ZJRF 2O8XA 3HOWJ 2QUFA 3S1MJ 3TKYA 2M2EA 3G1LA 3QPTA 4QLCU 3KNRA 3IHUA 3JTHA 1SFXA 2DODA 4A3JJ 3OR1C 3I58A 3HRSA 4XLCA 3FDYA 2NOGA 4UHTA 1C0WA 2STWA 4F92B 1REPC 3S93A 4RAWA 2JPCA 2ZXJA 3KIOA 1P4XA 2O6GE 1U6GA 1F5TA 2GLOA 3FX3A 5IT9K 5ILUA 2RQQA 2P5LC 3V8JA 3BTCA 4CYCB 4E7LA 4GDFA 1ETXA 2Y0MA 3VPEA 3OSGA 2F5CA 3B6CA 4G9YA 3HL2A 2QM3A 3HB9A 2LKXA 4U4LA 5FRMA 2I5UA 3T0YA 3HOTA 1I5ZA 2I7TA 2CQ7A 3E7LA 2IA1A 4XORA 2CFUA 3HM5A 4EGZA 3R6SA 4EVIA 5M5XJ 4ETSA 1OMIA 5FFXA 3FHZA 3ZNBA 1DP3A 1VJNA 1TT5B 4XNFA 1YJ9I 3GMEA 1QRYA 5IP7J 3FHNA 5IT3A 1IF1A 3A2KA 3HSEA 3Q9VA 1X2NA 3CP8A 4F91B 1K6YA 5HLHA 2GOXB 2GXGA 1IXCA 2FU8A 3SPUA 1K83J 3ZPLA 2GXAA 1E5DA 1R6RA 1YLFA 3CCRI 1IDZA 4NC6A 1R5ID 1TNTA 3C2GA 4P55A 2R93J 5D5XB 3IC7A 2VLAA 4RBSA 3C3WA 1VQLI 2VODA 2MD5A 4HA8A 1WW1A 3DTEA 4XLEA 3V4GA 4A0YA 2QBYA 4B09A 1BM9A 1KA8A 2O61A 4UWSB 3WTWC 3V8KA 2R92J 4TV7A 2Q0OA 4AIHA 1HC8A 3CC2I 2E19A 3IWZA 3L00A 4BL0B 1IRFA 2DCEA 4I7HA 4LD5A 3M3YJ 4ZTFA 2XSDC 1WJFA 2ELJA 3CC4I 2KLOA 4L9TA 4CSWA 1D5YA 2HXIA 5J4YA 3LSHA 3SQNA 1F43A 1OJLA 4ZDLA 3CO7C 2ZBKA 1B4AA 1IGNA 3I59A 2DQRA 1JUMA 4FR7A 4P62A 5FQAA 5FJ8J 4FE4A 2VBWA 2IW5A 3ZRGA 1FX7A 3GO5A 3OYCA 2HKXA 3HOYJ 3CO6C 2DK5A 1V4RA 4A5NA 1WJDA 2R3SA 2FU9A 3PNYA 1PP7U 4KICA 2UWMA 2DMTA 4A3DJ 1VI0A 2R7RA 1V55H 1QO0D 4A3FJ 3SD9A 2VASA 4O5VA 4MFDA 4ZC3A 3V7CA 1X1AA 5JLXA 3F8NA 4OMYA 3S15J 3OL3A 5F27A 2VJ4A 5IP9J 5IYCJ 2CH0A 2YX4A 5H2FC 3BLYA 4P9FA 2FOKA 2R7DA 4A0ZA 1ONVA 1EH7A 2FU7A 2K9SA 2DA2A 4BYYA 4TYFA 2VKVA 3I11A 4MTDA 3GWZA 3LA3A 2IVMA 2KFDA 2YPRA 1R5HA 2ZKZA 3G6EI 4LE6A 4X6AJ 3F9KA 3HXLA 1H88C 1JJ8C 2ZFWA 3QOEA 2XHKA 2DFEA 3CUQC 4BKXA 4MLOA 3CJNA 1FJLA 1W5SA 3ESHA 2FU6A 1G6NA 4BZ3A 4CCLA 3OIQA 1NH3A 2XAHA 3KYCB 4XICA 2VIXA 5CVUA 3RDIA 3Q6VA 1N25A 4KUMA 1N77A 2L9NA 4LLGF 4UB8C 1HCRA 4UBQA 3ZQ7A 1HQCA 3GZ5A 1ZTRA 5LCHA 4GGGA 1YCGA 2BW3B 3I56I 2GKLA 2MABA 2CG4A 2IGMA 3BC2A 1JKRC 3KEOA 2QJSA 3L09A 4MHGA 3OYJA 5AHRA 3Q0UA 1B9MA 4BP0A 2NVXJ 1X58A 1B1BA 4AU7A 4LG3A 3LQRA 3MKWB 4KISA 4IQ4A 2Y8AA 2JZYA 1TLHB 2K4JA 3WTVC 3G4SI 2HOSA 2NYPA 5K0WA 5GTHC 4YELA 3T3OA 4EJUA 1R5GA 4BQQA 3J80K 1ZR2A 4HEA2 4DNCA 2K7LA 4PJ0C 1VTNC 2XB5A 3PSFA 5FKOA 3RIRA 4JQFA 3FXLA 5B1UA 1I1SA 1RR7A 3L2VA 4BE1A 2YX7A 3J7ZI 1ZTCA 3M07A 5K5OA 4M73A 4DYRA 2X6WA 3CJTB 3IL2A 4AXHA 2BFLA 2R5YA 1YFHA 4GXOA 1ETWA 5K4MA 1HKSA 4MNUA 2MSYA 1R22A 2GIZA 2BG7A 1IN5A 1ZYRF 4WD6A 3SXYA 1UJ8A 4HLYA 1FNNA 3S17J 3G1MA 5ERIA 2B7EA 4OINF 2NOJB 3HG9A 3TW7A 1VF9A 5LBQA 1AKHB 4CICA 3CMAI 2W48A 3I0VA 2BR6A 1AU7A 4DIKA 4XUKA 5LE1A 5FLXK 1ULYA 5AYAA 2KIUA 1QU3A 3DPUA 3IOFA 1F1ZA 4F55A 3OS2A 4UA4A 2VQGA 1A8TA 3PIPF 3QU3A 4I09A 2YSRA 4C1HA 2OQRA 4U88A 1UELB 5LRSA 2JPBA 2V6CA 1W5CC 1ZHFA 3OYLA 1MKMA 4BEHA 2UV1A 2ECCA 4XMYA 3DHCA 4ZYGA 3J7AY 3MD2A 3I9V2 2M8GX 3PNVA 2M7BA 1XTOA 2LBFA 1FBSA 2A6TA 3D5SC 4RM2A 3MWMA 1JJ6C 3OSFA 4BU2A 2IA2A 1HF0A 2EFNA 2PG4A 5H6RA 5GPCA 4XM3A 3FXQA 3DBHB 3FBIB 2F48A 3D5RC 4CCKA 1ZGJA 3A0HC 3T8RA 5IP6A 1ZARA 4RLFA 4GO1A 2UXXA 1BR4A 4HV5A 2P1EA 4R79A 4WCGA 1MZBA 1TWCJ 3BPVA 2MC3A 4AYBA 5FQBA 2VOOA 3MZ8A 3DU6A 3ULQB 4CHLA 2E5ZA 4EM0B 2BZTA 2MH9A 4RB3C 2A07F 2Y31A 4II3A 2P97A 1FEXA 2HZTA 2DAOA 2D1HA 1W4MA 3WTUC 3L6NA 2AIOA 4O98A 2HTSA 4C2TA 1MD0A 4F3QA 1U3EM 1QA6A 1H0MA 2NVTJ 4Z67A 1SMTA 1T0FC 2X85A 2MG4A 3B6AA 3AF6A 4PDKA 3TO7A 4DIQA 3TW6A 3L9FA 2A5WA 2VE8A 3SBLA 3I71A 1DXKA 3PO3J 3JSPA 3K4LA 4G6DA 2CMPA 2DT6A 1A36A 2OTJI 3GFJA 5D8LB 3I14A 4ZEJA 4EJWA 1XS9A 2MH2A 4ITVA 4A6EA 1WZ2A 5BS6A 2IEKA 4KMFA 4EXYA 1HLKA 4KIBA 2QQ9A 3F8CA 4L5IA 2E2HJ 4AVZA 3LNQA 1T38A 1HLVA 1I3QJ 4P5OA 5ICGA 3CUQA 4CZZA 3H9QA 4BQAA 3LL7A 1H8AC 2KKOA 3DTKA 5EEHA 1KU7A 1B72A 3WTSC 3K4JA 4DBRA 4ZYDA 1NTCA 2CUEA 3JRGA 2NAZA 1T8IA 2PJPA 4FEKA 1LFPA 4QTRA 2GFJA 3DCFA 2X6YA 1WJCA 1NG7A 1IXRC 4HQMA 4DOZA 5GTIC 4A69C 1N78A 2W7NA 1LEBA 2YNTA 3ABMH 1YX5A 2OHIA 2NS7A 3GEZA 1YW8A 5HLTA 3RI4A 1G2HA 2FNAA 5KHDA 4HZFA 1GVJA 1Z91A 5EG0B 4J01A 5BMZA 3R2UA 1W0TA 1WJAA 2ZZIA 2L9RA 3HYIA 2Q2EA 1EV7A 3FIWA 4AWXB 2H94A 1Y8RB 3CF2A 2AO9A 5GADJ 1Z3YA 5HNHA 1RKWA 5K5RA 3U21A 5HOOA 3WTXC 3N4MA 2QYOA 2IAIA 4D7MA 1T98A 3RJPA 2DW4A 4X0GA 2JRMA 3KEQA 4I76A 4OU0A 3OOPA 4CZCA 2FXAA 3CCUI 3QRFF 3VB2A 3HJEA 4EFZA 2XUBA 2NNYA 3OYEA 2BFZA 4E7ZA 2DLLA 2LDUA 1BR2A 1PJRA 5EH9A 4F52A 2EK5A 2HDCA 1VQPI 4BAYA 1GVDA 2FX0A 1RI7A 2UUZA 3ESWB 3SYTA 1TWAJ 2VXZA 2E71A 3CCYA 3BR2A 4DJAA 2CV1A 4FHTA 1Y0UA 3VSLA 2LC2A 2DU9A 5HH4A 3OYKA 1P4AA 2KISA 3L2CA 4IHSA 3O2PE 2ZB9A 1OCTC 1L9YA 2I7VA 3GBGA 3H3UA 2IGOA 4RL0A 1VFCA 4N4NB 3TEDA 4K2EA 3C2BA 1A5JA 2DFHA 2KZVA 2V1NA 4Z5YA 3KYLA 1MNDA 1ZNBA 2WRSA 3QH8A 3VEPA 1QVUA 2HVRA 3H3VK 4RAZA 1DU0A 2Z3YA 2Y2ZA 1B8IA 1VQNI 4YEJA 4GYQA 1YOVB 3W6KB 1GV2A 2L7MP 4PCQA 1O7LA 3S1NJ 2WY8Q 4EJVA 3H35A 4YSLA 3X2ZA 4LIVA 1LJ9A 3ZQQA 2ZJ2A 1D3YA 5EEAA 4DZJA 2Z5UA 2KQRA 4FCYA 3IOGA 4N9HA 4I0AA 4IEJA 4PSWA 3Q3SA 2IGNA 3FXJA 3OYFA 2X6XA 2KDZA 1DUXC 4IRIA 4EV0A 1FOKA 2CFXA 2ZNZA 3X2QH 2BMIA 1ON2A 4LK1F 1SVLA 4M3EA 4XKWA 5KVRA 3ERED 3SHFA 3J81K 2JSCA 4TZBA 2TDXA 1OCOH 1PDNC 4Q4ZF 4HX7A 1EKEA 5HODA 4M9XA 2EPFA 5FKLA 4UVAA 2KRFA 5E18F 1T39A 3BROA 2CFZA 3LSTA 2BVMA 2EIKH 2F5DA 1ZN2A 5A2QK 2HGCA 1T0FA 4Z7RA 4L5JA 1U9OA 4OAZA 5J4VA 3HUGA 4KJZA 5JHUA 4FX0A 3CMEI 1T2KA 2ZJPF 2EFQA 4BXXJ 1FOWA 2DN0A 2BHYA 3LSKA 4YFXF 4G7HF 2ZNBA 2P5KA 4CUGA 4YG2F 3E5UA 3BQYA 4II2A 4BJ6C 4WK8F 2LF8A 1R4NB 3CUOA 2DJNA 2OTLI 2ZSHB 4JX6A 1P92A 2Y48A 1RC9A 5EEGA 3WU1B 3K1NA 5JVTA 1DD6A 2RAEA 3TP9A 3IP4B 2VC1A 2QQBA 3BR1A 1FT9A 1BA5A 4GFBA 4RAYA 3HTUA 2EFPA 1K61A 2OF7A 2DFFA 2CQNA 4IXAA 3MQ0A 3ZCOA 1IRGA 1ZKPA 4XLNF 4C1FA 4FASD 5E1WA 3EUHC 2MLGA 3WG9A 2Z33A 4KMUX 1WWXA 4MEXF 4B44A 4HF1A 2KT0A 4BBRJ 3DBRB 3PNTA 1STZA 2BG6A 3GXOA 1S8NA 1X1CA 4Y3OA 2QKLB 2K9QA 4XKBA 2VI6A 5DUKA 1T56A 2MD0A 1H9TA 5FD5A 3WG7H 1XCVA 2VKEA 2YU3A 3DLLF 4ENNA 1RNLA 1NG6A 3VYSB 3ZN1A 3HGGA 1H89C 3I13A 1IN8A 1KQ9A 2LY9A 2PJRA 5HIPA 2JN6A 4GRIA 5LS3A 2XAQA 4XKVA 3QP6A 2HKOA 5HDGA 3H36A 3QPHA 3F23A 4FTHA 4M9ZA 1KR3A 3GTQJ 1BI3A 3K4KA 4G6TB 4IRHA 4IX7A 2QDSA 3DQVC 1A04A 2P81A 3ZQLA 2HQRA 2W85A 3ZQGA 3GTLJ 2YZ3A 2V1DA 3L2UA 3F6OA 2HXOA 4C2MJ 2GA2A 1TQPA 4GYGA 1FYLA 4M6YA 3RYPA 1JKPC 2COMA 1D1CA 2ELHA 4H4KC 3KP4A 5DM7F 3OY9A 4ESJA 1QVTA 1LKXA 4KEPA 3K70D 3C2HA 4DYCA 5B66C 2FU4A 3GW2A 1I39A 2EINH 2FQ3A 4C3IJ 5J1RA 2X1EA 4MQ9F 5IT9Z 2KJBA 3MAJA 4AVPA 2WC2A 2R5ZA 1RKTA 1TWFJ 3FM3A 2RREA 2FF4A 2VQCA 2PBIA 1WJ5A 5C4JJ 4HL1A 4IHWA 4IL6C 1MBGA 3FMRA 2EFOA 3BY6A 2E34A 4XN0A 1D0YA 1ON1A 2KRCA 2V1XA 3VODA 1VQOI 4HYEA 2IPQX 3W6JB 2W00A 2JVGA 1Y0NA 2FK6A 2DXIA 2L0KA 4IKFA 3KP2A 3S3NA 5AONA 3I53A 1S72I 2OCEA 4UUSB 4N9IA 2F5VA 4EM1A 5FROA 4HPQA 2R7UA 3SJMA 2JWTA 1BL0A 2QQ8A 2ACJA 2BE5F 4QPOA 1XDSA 4RGUA 4H0EA 3LMMA 3DU5A 3WGHA 2NRAC 1R49A 2OBPA 5HS9A 4IO9F 4BDYA 5CPRB 2FNPA 2CW7A 1W36D 2ZCWA 3M9AA 3P7NA 5E8GA 2K5CA 2BY2A 3TDUC 2P4WA 1TZLA 3HKZN 2UYXA 3H3EA 2DMPA 1GXQA 4I01A 3WU0A 1MMAA 3M8JA 1O3RA 1MSEC 1X1PA 3K4CA 3BG5A 3IAS2 3PL8A 2E1CA 2QEXI 2FRHA 3NRVA 2ZMEB 4BDZA 2K27A 4GYIA 3V8LA 4J00A 1SMLA 2V4JC 4U7BA 2X1DA 3H3ZA 4YIFA 1BIBA 3NWSA 4E7KA 1XSVA 3BPXA 2DPUA 1I27A 1KQ0A 3ZWFA 2NS0A 4AIJA 4HF2A 4KA4A 1K4TA 1XD7A 4MO7A 4L18B 2V9KA 3RPCA 4YIRX 1BJZA 4RM3A 3LFKA 1XGMA 2H1LA 3S1QJ 4YRVA 3G1PA 5CQEA 2PX9A 3FXKA 1MH4A 2LVSA 4P1WA 1KO3A 2V79A 3HOXJ 1Z77A 3SDGA 5B15A 3I64A 2VKDA 5IQKA 4XOTA 4XK4A 2DMQA 1GDTA 1P6RA 1YRNB 4IJAA 2RGVA 3TQNA 3OS0A 4Z6YA 2I10A 3WU2C 3ELKA 4H0DA 2LY2A 3GUDA 3HHHA 2C6YA 3DLAA 4M74A 5M5WJ 4MGRA 3ZR8X 5ED4A 2LSOA 3KZIC 4DILA 2FQ4A 4C30A 5K1YA 1XGNA 5EVBA 2BEOA 4P96A 1HXDA 5TGTA 3X2XA 2KL4A 1YI2I 2BY3A 1Y39A 3P9IA 1KYZA 2BYVE 2OV7A 3I54A 3KEYA 5F08A 1SFKA 2KP6A 3JAMK 1K7AA 2WV1A 3I0TA 4L9JA 3TL4X 5FD6A 3A0BC 2GIVA 3M8EA 1SD5A 3EUHA 3GTOJ 1WRJA 2XVCA 2VT2A 1OCPA 5EV8A 3KYDB 3H5AA 4Y33A 3RZOJ 4IOCF 2DA6A 2QENA 3FF5A 5CVRA 1ODDA 4D5CA 3RKKA 4F6ZA 1X3WB 1S7AA 2EFWA 2JA2A 3BG3A 1TNSA 2CV0A 5HH6A 2O5RA 5HLGA 4S04A 1ZREA 3MD7A 2EV0A 4C3JJ 3OYDA 3GTJJ 4DW6A 1VGNA 3GX4X 3E6BA 3VQZA 3ZP5A 4MEYF 2KIMA 1X8HA 1X2MA 2Z16A 1MH3A 5F1JA 2RV8A 2CUFA 1YS6A 2OZUA 2ZXHA 2BW3A 4CA0A 2G0EA 4AX0B 1YCHA 3KZZA 3OYBA 2FBHA 1MMSA 3MFKA 2M30A 5LFAA 3BG9A 2VKHA 1R1UA 4KN4X 2A7MA 1YYVA 4XLHA 5D5WB 3FCZA 1SFOJ 4EYBA 5HISA 5ICEA 2E1MC 1MJ9A 2ID6A 3FMQA 2KDOA 3IRRA 1BOAA 3FISA 1D1AA 3E6CC 2HB9A 3W2AA 4BJ5C 5D4RA 2XDVA 3BTLA 3J80Z 2HDWA 1Y8QB 3DP7A 2DMNA 4A6DA 2Y69H 1XN7A 1U5TC 3WTTC 2VC0A 1E0EA 3BK2A 3HIFA 1Y44A 3CF5F 1UFMA 2XAUA 3CJRB 4AM3A 4ASNA 1FOXA 1M1EB 1X8IA 4GYUA 4IVNA 1K07A 4RBOA 1U2WA 3CCEI 3KE2A 1X3ZB 4OAYA 4A3EJ 3GCMA 5GAGJ 1DQUA 2UXNA 3LSMA 2W25A 1BW6A 3F6VA 2L9VA 2XRNA 1APLC 4M71A 4JOMA 1VQ7I 2XAFA 3MN2A 3A01A 3T9MA 3CCQI 2H09A 1UG0A 3IH3A 2R7OA 3NWTA 2O3FA 1ZLJA 3IDZA 1V5EA 4ANJA 1YS7A 1FC3A 2CYYA 4DBQA 1TWHJ 2FM6A 1ZLKA 4PVOA 1WVRA 3J7AO 5FLXZ 5E3LA 3E5XA 4HX4A 2ME6A 3EUAA 1T33A 2B63J 3AFHA 4C1EA 2X48A 2BC2A 2XF6A 4UB6C 1QHGA 1OKRA 3DKWA 3DHBA 3BJOA 4DZPA 3L2WA 1FYMA 4PZJA 5H6QA 5EWAA 2QBYB 3QP5A 4HG2A 5EF6A 3H0DA 3JCUC 3JTGA 2HS5A 3GTPJ 3GF2A 2L2OA 3WHCA 1DGWY 1UZCA 4JO0A 3FK6A 3M1CA 2R4GA 4Z6XA 3E6MA 4UUTA 4EEFG 4XLFA 3RKXA 3GTGJ 2IJLA 2KZGA 5B5EC 3S3MA 4LK0F 2BG8A 2L54A 1AOYA 1MJBA 1DP7P 3HOVJ 1O7FA 1FTTA 1WRAA 5K7FA 2KIFA 1Z1DA 5D5VB 2OHJA 2G7HA 2ZNYA 5JHFA 2ADUA 2MLKA 1Y56A 4LOCA 4PJLA 2IRFG 5LGUA 3OYIA 4NDLA 1G3YA 1Z21A 3CCVI 2YNUA 2XV4S 3U1KA 2WTEA 4S0HB 4DQ2A 3GLLA 1DDNA 2X4HA 4RAGA 1OYYA 2X1CA 3UR3C 5LEJA 2GWRA 1SD7A 4NQWA 5B1BH 4FETA 4ZJZA 4BQNA 2NXAA 1HOMA 2B9SA 1SC7A 1LQ1A 3RKJA 1OLTA 3ABLH 2LFBA 2XC7A 2RC4A 2JK3A 2F5EA 1ETQA 1ENHA 2W57A 1DDKA 4TZFA 1UB9A 3KETA 3SZPA 4ZDPA 4LGWA 4E4HA 5JLWA 4CH7A 5DCMA 2AXLA 2EJRA 3QYBA 3R61A 1ZG3A 4KIGA 3FAIA 4NC8A 3C18A 5DS9A 1XB4A 1TL8A 2MGQA 3OL4A 4HDUA 1OR7C 1Q1VA 2M4GA 2OUMA 1WH7A 2M4KA 3ABUA 2BVLA 3ONQA 5HNFA 2G9WA 3WHBA 4NNJA 3I4NJ 1KONA 2HZDA 1J59A 1I6HJ 4RM5A 3IKVA 2PFBA 1F36A 3F8FA 2DOFA 2W84A 2BG2A 4XRMA 4AWZA 4Y4RA 1S6LA 1S7EA 2P5VA 3BJAA 5J1UA 3ZQFA 1XC5A 3Q5FA 2JA5J 1KQ8A 1BMCA 5D6EA 2GMNA 5IYBJ 4XIDA 5KNLA 3P2UA 3K4NA 2NXNB 1R9TJ 2NVYJ 3PY5A 1MMGA 4BHCA 5HLIA 2R7ZJ 2HNHA 5HH5A 5DTDA 2HTJA 4W1UA 1HDDC 4TZ9A 1MJAA 5D8KB 2YR2A 4Y13A 5AIPA 4XR6A 3RPUA 3HRMA 1QPIA 3RCOA 2B0LA 5IYDJ 5FB2A 2YNVA 2BOLA 1G3TA 3KFWX 3RSNA 5E20A 3OYMA 1JE8A 1MBFA 2JUGA 2DA4A 4EJTA 5K4KA 3WGGA 5LHIA 4HQEA 2Z99A 4I2OA 5DPXA 2IGKA 1S9HA 3FMSA 3SEZA 3RKWA 2K3FA 5EGOA 3I4PA 4O6JA 5FKNA 3SFZA 2LMDA 5J8FA 1VQKI 1YX3A 4XWTA 2K02A 3JSOA 2ESHA 2FA5A 1XM8A 4E70A 1J09A 1SMYF 5TRDA 4GCWA 2QEDA 1J0RA 5GPAA 3FK7A 1JT0A 1U5TA 2R5YB 3RZDJ 1WKMA 4Z5ZA 4LMYA 4AWYB 3RKQA 1JHHA 4CCNA 1Z6RA 1J75A 4A0XA 5F04A 1W7PD 4EQQA 3H9GA 2PQ8A 1LB2A 1JGSA 2FMYA 3AAFA 2E5NA 1SD4A 4B87A 3M8FA 1KU2A 4I0BA 3CLQA 3F8BA 5FFZA 1MSFC 2BFKA 4Y17A 1QH5A 3UNGC 4Q48A 2KMUA 3Q9SA 3IRQA 2M87A 2WADA 1TWGJ 3JRDA 2DK8A 2EA4A 2XR1A 1EJ9A 3RPQA 1DU6A 2Q0IA 4XRSG 3CMYA 1S5LC 1V5GA 4JBAA 3P9KA 2D5VA 4OOIA 4C2UA 4PK4A 1UCRA 3TO6A 4BEHB 4AIDA 2CRGA 4IHYA 3JREA 2OQGA 4XRFA 2L3DA 1Z7UA 4B1RA 3V7RA 5KAIC 1IN4A 9ANTA 2Y9YA 5BNGA 4XL9A 2L7FP 4HLXA 1Y6IA 1VQ6I 4PJNA 5BOXA 2FHXA 1MBJA 3TOAA 3BP8A 4L0YB 4LB6B 2XF5A 3QOPA 5F0FA 5B3SH 3BZKA 4RGXA 4ZYHA 5HIQA 4BY7J 5J47A 3OV8A 2Y9ZA 4EYLA 1LDDA 4RGRA 2FD5A 4PSXA 2NYXA 4AYBN 1BC8C 3WODF 1FY7A 3ML6A 1RESA 4BUPA 4JYKA 3HC7A 2ZO4A 4M72A 4E6KG 2WV0A 4KT5C 4O3MA 5J6XA 1O3SA 1MBHA 1QHHD 2DA5A 1TQIA 2MA3A 5HS7A 3OIPA 5IOYA 5FQCA 3B02A 5AXOA 5A0VA 1T6SA 4ON0A 1IO2A 2FBIA 1K4SA 4LG0A 3J81Z 2L7ZA 4JX4A 4HSRA 4Q47A 4FQGA 2ZMEC 1RUOA 2DTZA 1DPRA 2VL8A 3ROUA 2CO5A 2EILH 1JGGA 1F4KA 2WAQA 3U1DA 1FIAA 3BQZA 1NHAA 2LY1A 3QYEA 1MDMA 3CC7I 1HSTA 2Q8KA 1K78A 1LE8A 2NZFA 1FPQA 4WXDA 2CW8A 1R58A 5A2QZ 5L3DA 2RDPA 4PDXA 2VN2A 4F93B 1FBQA 2E7YA 4E7IA 1T95A 4CO8A 3JRBA 5ILVA 3D1NI 2GBYA 2XAJA 1R36A 1YIOA 2JTVA 4CGZA 1E17A 5ACWA 1BIAA 4ZDOA 5AHOA 2D2WA 2M7AA 1U78A 4MQVA 4AV7A 3CUQB 3O8GA 3K10A 1BVTA 3BR5A 5CVJA 3S32A 4NQ5A 1FP2A 3ZMTA 2LD5A 4G12A 1IRXA 1IN6A 4PVTA 2KRHA 2A3SA 3BR0A 2I7XA 2J5OA 2BXYA 1RR8C 3ECHA 3FKJA 3ZQHA 1TW3A 2Y87A 5B1AH 2P6SA 3KX2A 1MMNA 2QDTA 5E17F 1VQMI 1GUUA 1ZG5A 5A23A 2ZSIB 5J3LA 5LCAA 4BE0A 5J40A 1EH6A 2A61A 1Q1HA 3LSGA 1KU9A 3GZNB 2QVOA 2O03A 5ACXA 1FP1D 3L7WA 3CCJI 3PQKA 2P4ZA 2AQFA 3TP0A 3ZN0A 4NURA 2FJ1A 3G71I 5M3FJ 1JI8A 1W5TA 3BTIA 3KP7A 3W2VA 5ICCA 1PUFA 5E79C 4ZO2A 5L3BA 2HQNA 2STTA 4UWOB 1MNMC 1OQYA 3H5RA 5KCMA 1MNEA 2KIQA 4RMNA 2BFZB 4KN7X 3S2WA 3MVPA 4M3BA 3CQZJ 3D5LA 3KP5A 5DM6F 3IWFA 1IN7A 1UHSA 5K7ZA 1JUPA 1G3WA 3LFUA 4IF4A 4OIQF 1T08B 1QPMA 2QKMB 3OWTA 5CYVA 2WAQN 5E3MA 2IT0A 4PJJA 4N4OB 1HSJA 2CQXA 1WI3A 4AUXA 3ZQ4A 4PFPA 4AX1B 3K9TA 3C1DA 3ZMSA 4B3AA 4ESBA 1B59A 2BBYA 5LHHA 2OA4A 3H1CA 1OYWA 4FT8A 3DKXA 2PI0A 4IHVA 2VW8A 3FXRA 5ACRA 1Z05A 1LDJA 3KL7A 4Z2YA 3RYRA 2M3AA 1SFEA 3TGNA 4BNCA 3TBIA 2DA7A 4HNTA 4D1QA 4BBSJ 2JT1A 5LEKA 2LREA 1VQ4I 3N97A 1B8IB 3K1MA 2Z2SB 1Z9CA 2GM4A 5LCFA 4E7HA 3ASOH 3IE2A 2JA7J 1FWZA 2CQKA 1TP4A 1OCCH 4QWQA 3IE0A 2JJ7A 3CESA 1YJWI 2EWNA 3R4KA 2XGEA 2YNWA 3DXJF 4XOPA 4D1TA 4XQFA 2L7KA 1CF7A 5FLVA 2OPTA 3RKYA 2VONA 3EUKL 2FOWA 1I1GA 4XLAA 4AC0A 1SVMA 1A6QA 4W97A 4EXSA 4I6ZA 3K69A 4IHXA 4U0YA 2HWVA 5L3GA 4OIPF 2Y30A 4TZEA 2M0MA 4NUBA 2VBYA 3PSIA 2Y0SA 4V19K 2DT5A 2JSPA 2YUSA 4CCMA 3QYFA 5LLQA 1ZRDA 2ISZA 5E1XA 3WE3A 3DH8A 3MCZA 1WQ2A 3LSRA 1IXSB 1XMXA 3UKGA 2PMUA 1WJEA 5C3EJ 2MBFA 2H27A 3SRXA 1PYVA 1YCFA 2H6AA 3F9OA 4JP0A 3BG6A 3JRFA 1UMQA 3ISPA 3DEUA 3EQLF 3V7SA 1YW7A 3BTJA 4RB0A 2D45A 5FKKA 2ZMEA 5ACQA 2ESNA 3HUGB 4QPQA 2LRDA 1VQ9I 3BC8A 3LSIA 5FLMJ 4NQ2A 2XB0X 3QPLA 1Z7LA 2M45A 3ZXSA 3GFIA 2JVHA 2RKHA 3BZCA 4FISA 4NQ6A 2MYSA 4CYCA 2VQLA 3KCCA 5LD2C 2K86A 5A87A 2HVQA 1D8JA 4ZO3A 2FUG2 4F6HA 3EDPA 3AG4H 4YFKF 1TT0A 2HQ5A 1PP8F 1A31A 5E8IA 3P9CA 1X8GA 4WWCA 2GOMA 4D02A 3R60A 2R7WA 3HHGA 2ICWG 1OFCX 2K3PA 1E3PA 1MQOA 2XPVA 1CGPA 4G7OF 1LVAA 1JKOC 2LF7A 3N05A 4L0ZB 1UAAA 5KILA 2P7VB 4IHTA 3DEEA 3QWLA 2HEOA 4NHJA 3R0JA 3BZ6A 3OIOA 3RTRA 4D1WA 1MGTA 2JUCA 2P7CB 3LVZA 3M1EA 2NS8A 3JAMZ 3TP3A 3BR3A 3X30A 3PFYA 4RDUA 1IZ1A 1GV5A 5F0CA 2W4SA 3KLNA 4LFUA 2CW0F 2R0QC 4E7JA 1LFUP 4HKYA 1IW7F 2VJIA 2LLKA 3CCMI 2VPLA 2PJRB 2XIGA 1GHCA 3HBLA 2Y0SN 1IC8A 1WJBA 4A3GJ 2QWWA 5AJLA 3A4YA 3I4MJ 4XLPF 3ABTA 2MFZA 5JR3A 1S3JA 3FXOA 1HW2A 2XGCA 4RLQA 2EV5A 2Z1DA 3PFIA 1JT6A 2AHQA 5BPDA 1SAXA 2R7TA 3K4MA 2GCUA 2R2DA 6PAXA 3E3VA 1R4MB 2Q1ZB 4M3DA 4KIFA 3CDLA 1JJTA 2M1BA 1USSA 2HU9A 2VOPA 3K6GA 1U9NA 3AG1H 3LAJA 1WH5A 1POGA 1W7PB 3SW3A 5BQTA 3OS1A 1LNWA 4HL2A 3P5JA 4HAMA 4HF0A 2XSJC 3S0ZA 2J5PA 5LHGA 2JQ7A 2K9LA 1ETVA 3CCLI 2R5ZB 1VQ5I 3E97A 4BQOA 1VZ0A 3SZGA 2LTPA 3K70C 2I8DA 2L01A 1USTA 1AA7A 1XCBA 2EH3A 4F7ZA 3O6BB 5EDNA 2HDDA 3PO2J 1BBYA 2A6EF 3HZJA 3QPSA 4L5EA 2GAUA 1X4OA 2QCOA 2WB1A 1ACIA 3B73A 4PGHA 4BJTA 2A6HF 2KHMA 2G7UA 2HI3A 2E2IJ 3H0GJ 1R1VA 1FMWA 3RQ4A 2DQLA 4MIMA 2VB6A 1BI1A 4C1CA 1SAUA 2CWEA 1WSUA 2L9SA 3E1SA 3F72A 1ZRFA 3GTMJ 2EZKA 2BY0A 1ZGAA 2JMWA 2WYLA 2V7FA 1JT1A 2DYRH 4G6QA 2RQPA 3IKTA 3H9JA 3K2ZA 3PY6A 4G7ZF 5H20A 3VDXA 4BY1J 4J5HA 3WTZA 3L2RA 2RNJA 2DOAA 1WCMJ 1D1BA 1ZGWA 4A3MJ 1BN5A 1YHQI 1P7JA 4ENJA 2DJIA 2HOEA 2R7QA 2M34A 4JX5A 5LGTA 3ZGKA 1BOBA 3G1OA 3MKYB 2CG3A 4LB5A 1W36C 5AIQA 1XMKA 5ILSA 1WI9A 5FGMA 3FXUA 3JRIA 2CU7A 3K7AJ 3LA7A 2BGCA 3VYUB 2RNGA 4LJZF 4UV8A 3VOEA 3VYRB 2YHEA 1CQTA 3PIOF 4A3CJ 1B6AA 1N75A 3BT9A 2A69F 3AF5A 3PUFA 2GXBA 2VPRA 4KITB 1O4XA 2BGAA 4V0HA 4V2GA 4CCJA 5F64A 4ZH4F 5ACTA 3MKZA 2Q9UA 2K4BA 2BHZA 3SEQA 1IAWA 4RL2A 2LP0A 1J2XA 1MIJA 2YU9J 2XKPA 1QQIA 2FEZA 1D8KA 3S8PA 3A02A 4KEQA 5AEBA 1WPKA 1ZKGA 2QLZA 1MW7A 2LH9A 2XROA 1JTXA 1V5FA 2ELKA 2WYMC 3BOQA 5F1RA 1G4DA 1X4PA 3I15A 5EVDA 1AHDP 1ETOA 4FSBA 1IUFA 1O57A 3A1YA 3DPTA 3HSFA 3JW4A 2A05A 1LEAA 4AD9A 4B47A 3JR9A 1TBXA 4LIUA 5F6FA 4A5MA 2R7SA 2EZLA 2ZWRA 2FMLA 4A2UA 3FXMA 4HBLA 1TW2A 2W24A 2V6EA 3VYTB 1QBJA 1FZPB 2GFKA 5HVQC 1FLIA 2DT7B 2WB1N 3BCBA 3R0AA 2DO7A 1UHWA 2MW8A 3HGYA 3KLOA 3U9GA 4XN3A 3IV5A 3AL0B 2OJED 3JRHA 4Z60A 2IA0A 4HNVA 4WX9A 3K2AA 1HKTA 4AIKA 3NEUA 5K4NA 3G73A 4N0BA 3CTAA 1LUJB 4A3KJ 3BG7A 2FBKA 1XTAA 1YO5C 1L3LA 2Z9OA 2W82A 1RETA 1HBXG 1AKHA 1R1TA 2O8KA 3OOUA 1SVOA 3F0CA 1S7OA 3DPLC 2AS5F 2H6CA 1XSDA 4XWWA 2P6TA 3T3NA 3CZ6A 2XRLA 3NAUA 5TJJA 4LLNA 3G2BA 4U0VA 2DA3A 2PMZA 5C4XJ 1P9EA 1J5YA 1RUNA 4CXFA 1A7TA 3CD6I 1X1DA 2GZWA 2XKOA 2BXZA 4MTEA 2V26A 4HW0A 4RB1A 4Y15A 2CQQA 3DV8A 2Q42A 1FBUA 2EA2A 2DOOA 3FKIJ 2ID3A 2LG4A 3ZQCA 3REOA 1B9NA 3S2DJ 2XGXA 3QAHA 2EBIA 5EZHA 3OYGA 2DI3A 3DF8A 2L4AA 4CCOA 3I59B 2N8GA 5BPIA 2CUJA 3KNSA 3VFZA 1WFXA 3GLXA 2TCTA 4UWPB 4WXHA 5K5QA 4HX8A 2QA4I 3CMMA 1JTYA 3JXPA 2WA0A 4BHBA 5B3RA 2H1KA 3L1PA 5A0TA 4KYWA 4TYTA 5EV6A 3GFMA 5DEQA 2VBZA 1ERDA 3MKLA 5L3EA 2HPIA 1EF4A 4D7NA 1E3HA 2HFHA 1QH3A 1WUPA 5DYMA 1V3FA 5FRNA 1XMAA 2O9LA 4Y52J 3IEMA 2R7XA 1U0JA 1R7JA 1ZELA 5EZGA 2OC6A 2EZHA 4EATA 1XPXA 4CHUA 1EH8A 4ENMA 3NQOA 5D5UB 4D1UA 1ETKA 1QZEA 3TDZC 4BHPA 4BS9A 1RIOH 3A01B 2DDBA 5EJCA 3SDBA 4EY2A 1S29A 4WF2A 4B3XA 5A5ZA 1OISA 2ZC2A 3JRAA 4GCVA 4IRGA 4XBFA 3T8TA 3V42A 5TISC 2DYSH 1OCRH 1J9IA 2PLYA 4J19A 4IZZA 1D5VA 5CVVA 5LMCA 5CQGA 4HOBA 2FSWA 1FTZA 3DWLE 4RA2A 4NC7A 4QSHA 1E2XA 4M3FA 2OAZA 3SFIA 4B8XA 3GTKJ 1R23A 1A6IA 3LSJA 3J7YJ 1DPUA 2PMZN 3KP6A 4P9UA 2V9PA 2OU2A 2VBXA 3FBNB 4Q5SF 2CBNA 5ACSA 4A12A 3A4CA 1JXSA 4ZNBA 5AIJA 2OZ6A 2WY7Q 4BE2A 2LYCA 1JUSA 2P8TA 3I3LA 1A35A 5L3FA 3HDDA 3X2YA 1YE9A 2L02A 1Z67A 2BG8B 5DUIA 5E3NA 5ACPA 1EA3A 2M5WA 3MEXA 3GYHX 3G3ZA 2K9MA 1LDKB 4PUSA 1FOYA 5EG0A 3K1PA 3TMOA 3IELA 4FX4A 1VMEA 3DKYA 4HV6A 2DA1A 3M4OJ 2COBA 3W2WA 1RZ4A 5ICFA 4U0WA 3FZVA 3EETA 3F8MA 5FO5A 2DKFA 4XRSA 2E7WA 2M9HA 4PFOA 1FIPA 1L0OC 4NQWB 4KDPA 1I6XA 2HVSA 3S14J 1TQMA 3S16J 2WYMA 3PG4A 1PUEE 2D1VA 2AXTC 3BDDA 4C09A 1HKQA 2RN7A 3DFGA 3QQAA 2CJJA 1IV8A 2ZJQF 2OD5A 2K85A 1KGSA 2LOOA 4KT6A 5DCMB 2NVQJ 1Y1VJ 1G3SA 5LSCA 2CG2A 2M5CA 4BXUA 3WXCA 3AG2H 2Q0JA 4D5FA 2CGPA 5LRRA 3O3KA 2V9VA 4I98B 2L5QA 3ZMDA 3GZ6A 2X0LA 1V54H 2HPMA 4B43A 1X1BA 3WE2A 3PUBA 4PGGA 2CUZA 1I50J 3QODA 3H5NA 2HR3A 2CV2A 4A3LJ 1XX5A 1KO2A 3VSKA 2XASA 4RB2C 1P4WA 2ZFUA 3JRCA 2EQRA 2AZ4A 4C1GA 1KYWA 1NK2P 2LBFB 4UAMA 2H6BA 4M6VA 3LAPA 2W1OA 3MMYB 3LWFA 3AJ3A 3ZMVA 1JKQC 1IDYA 2GQQA 2OCCH 2WWYA 3W3CA 4CDGA 1TC3C 3HRUA 4C1DA 2HYGD 5CKTA 3ZMUA 2LR8A 2DBBA 1ZH5A 2YNVB 2PEXA 4DGWB 2E36A 3I55I 4EYFA 2ETHA 2BY1A 2QGUA 1GT0C 4XONA 2R7VA 3OYAA 1XGSA 5HS8A 5KIKA 5EGOB 1XG1A 1HW5A 2E1MB 1FSEA 2DOEA 2XF7A 4L9VA 1ETYA 4B4CA 3PM1A 5K7HA 2GA1A 4YIIA 4UWRB 3S3OA 2PN6A 4A3IJ 2A68F 1YW9A 3OMYA 2L4MA 2LKPA 1SFUA 2H8RA 1SEUA 1U8BA 1P9QC 1U5TB 3F22A 1Y1WJ 4BGDA 2EZIA 2QSGX 4UVCA 3ERMA 5IY5H 1XDUA 1GXPA 4G94A 5JI6A 3IAM2 2F5FA 4V2FA 4NQ4A 4EM2A 2HYFA 2LKSA 3U2RA 3D0SA 2E2JJ 3IE1A 5DD8A 2P0WA 1Z3XA 4IOAF 2E60A 4I02A 5J1YA 4D1VA 4MFEA 1O3TA 3OYNA 5DD4A 4UUVA 5LM6A 2H8WA 3L2QA 3NARA 1BI2A 2P18A 2XGDA 1OR7A 2IP2A 3A03A 4LITA 5M3MJ 4RAMA 5DV5A 2HYJA 2WAFA 3LQQA 1Z0XA 5L3CA 1WGXA 1OYIA 4EMSA 2AQEA 4XSZF 5F0HA 1LPQA 3EYYA 1MMDA 1B72B 3BCAA 2KJCA 4CYDA 5GAEJ 2K9NA 4U7DA 5HDKA 2OHHA 1ITYA 4KNYA 4R8HA 3IH4A 2F4OB 2YNTB 3W6VA 5DDGA 2F6CA 3OYHA 3O8HA 3QU6A 3E0JB 3ZQIA 4ZYEA 4UXNA 3M7GA 3HPHA 4ZZLA 1R00A 2IXSA 1X3UA 1BC7C 3KP3A 2DDAA 2E1NA 2FHXB 4OMZA 5CLSA 3IH2A 2Q2EB 3GFLA 5C44J 3DEWA 1YJNI 2QINA 4G8XA 5GAHJ 4UNOA 5J8CA 2JA6J 5FKMA 1HDPA 3FWEA 3ABKH 2BV6A 2IBDA 3BR6A 4D9JA 3S1RJ 4IQJA 3Q0WA 2X51A 2VQHA 3DBLB 3ZOBA 1H9GA 1U8RA 1JHFA 2F2EA 3LA2A 2O0YA 1HA8A 1D0XA 2F4IA 4PJMA 1G59A 2F4MB 4R1HA 2M8EA 3RQIA 5LLDA 4XSXF 5KK1A 4M9SA 5M5YJ 4ENKA 4HRIA 3GVAA 4LG0B 4DYQA 2PMHA 3Q0VA 4J5FA 1TTYA 3TO9A 1IV6A 1ZK8A 2M0CA 5CVIA 4ZYAA 1ZRCA 2QSFX 3K0LA 4QIWN 2CSOA 3HEFA 5AXRA 2ECBA 1R71A 1KZHA 2YCBA 4FE7A 2JA8J 2JRTA 1W0UA 1MDMB 3KPHA 1VQ8I 1LE8B 1K78B 1IUYA 1RRJA 2TRTA 1RPWA 4L9NA 1MBKA 2EIJH 4D0PA 1IJWC 2VUMJ 2V1UA 2WHGA 2R7FA 2WAEA 3HSRA 3PQJA 1K79A 5JFRA 1ZG1A 1PVEA 3AG3H 3DHAA 3C7JA 4RAFA 2CFOA 2EIMH 2IS4A 3BWGA 3DTIA 4RGSA 3K4BA 4ZZDA 5EHTA 3T5XA 1D0ZA 3S2HJ 2XPUA 4JK1X 4ZTJA 4RS8A 4ABZA 5D4SA 5KAFC 1P2FA 2CS3A 2QF7A 3BV6A 3SFPA 1QZZA 4HDVA 2DTRA 2NVUB 4U87A 1ZR4A 4ESFA 4M3GA 2QSHX 5LGNA 1BW5A 1X19A 1BC2A 2K40A 1YIJI 3AL0C 1GLNA 1ORKA 2LNBA 4UUSA 1ZAOA 1Z6TA 4IPAA 1JJEA 3MZHA 3WTYC 2VJJA 2ZXIA 1MBEA 4BXFA 1IRZA 3WGIA 2QZ8A 3LSPA 3BK1A 1XSXA 3CCSI 2IS1A 5IOZA 1WUOA
chains in the Genus database with same CATH topology
4OIOF 3HRTA 5ACVA 2VE9A 1BJAA 2XF4A 2Y8BA 4YFNF 2EB7A 3ZR9A 2E7XA 1FSHA 1YG2A 2VT3A 3E5QA 5CJ9A 2UZKA 2EV6A 1QGPA 3CLOA 4UVBA 4S05A 1SD6A 3ADRA 3EYIA 1KU3A 3T1BA 3ECOA 5EW0A 1FYKA 3KZYA 5E1ZB 5EVKA 1J7KA 3CDHA 4LLLA 1UHMA 2BTNA 2BIBA 1W7PA 2DFIA 4WXCA 4KFCA 2DPDA 4NB5A 4OIRF 1XGOA 1O3QA 4EJOA 2QQAA 3COAC 3E6DA 2XAGA 1OPCA 2Y75A 3F3XA 5HDNA 3MZYA 1K6OA 1QNTA 1QZYA 2A5YB 3I5UA 3HOSA 4YSKA 1CF7B 2RVCA 3FM5A 2NNNA 2NZEA 2ISYA 3HTSB 3SZTA 4M6XA 4YSBA 3TOBA 2M5DA 4EGYA 1YTYA 1M2XA 1HW1A 3ZMZA 5D6FA 1BI0A 5HIOA 4UV9A 3IEKA 2FE3A 1YQAA 1F9NA 1AWCA 5DCFA 3BJ6A 3F21A 3H92A 5ACUA 4BH9A 2O8XA 2QUFA 3TKYA 3QPTA 4QLCU 3KNRA 3IHUA 3JTHA 1SFXA 3I58A 3HRSA 4UHTA 1C0WA 2STWA 1REPC 4RAWA 2JPCA 2ZXJA 1P4XA 2O6GE 1U6GA 1F5TA 3FX3A 5IT9K 5ILUA 2P5LC 3V8JA 3VPEA 2Y0MA 2F5CA 4G9YA 2QM3A 4U4LA 3T0YA 3HOTA 1I5ZA 2I7TA 2IA1A 4EGZA 4EVIA 3R6SA 4ETSA 1OMIA 5FFXA 3FHZA 3ZNBA 1VJNA 5IT3A 1IF1A 3HSEA 3Q9VA 5HLHA 2GXGA 1IXCA 2FU8A 3SPUA 3ZPLA 1E5DA 1YLFA 1TNTA 4P55A 5D5XB 3IC7A 4RBSA 3C3WA 2VODA 2MD5A 4HA8A 1WW1A 3V4GA 4A0YA 2QBYA 4B09A 1BM9A 1KA8A 2O61A 4UWSB 3WTWC 3V8KA 4TV7A 2Q0OA 4AIHA 3IWZA 3L00A 1IRFA 4I7HA 4LD5A 4L9TA 3SQNA 3CO7C 2ZBKA 1B4AA 3I59A 2DQRA 4FR7A 4P62A 5FQAA 2VBWA 2IW5A 1FX7A 3GO5A 2HKXA 3CO6C 2DK5A 1V4RA 4A5NA 2FU9A 2R3SA 1PP7U 2UWMA 4KICA 1QO0D 3SD9A 4O5VA 3V7CA 3F8NA 4OMYA 2YX4A 4P9FA 2FOKA 2R7DA 4A0ZA 1ONVA 1EH7A 2FU7A 4TYFA 4BYYA 3I11A 4MTDA 3GWZA 3LA3A 2IVMA 4LE6A 2YPRA 1R5HA 2ZKZA 2ZFWA 2XHKA 3CUQC 3CJNA 1W5SA 3ESHA 2FU6A 1G6NA 4BZ3A 2XAHA 5CVUA 3RDIA 3Q6VA 4KUMA 4LLGF 4UBQA 3ZQ7A 1HQCA 3GZ5A 5LCHA 4GGGA 1YCGA 2GKLA 2CG4A 3BC2A 3KEOA 2QJSA 3L09A 4MHGA 5AHRA 1B9MA 4BP0A 1B1BA 3LQRA 2Y8AA 5K0WA 2JZYA 1TLHB 2K4JA 3WTVC 2NYPA 3T3OA 4EJUA 1R5GA 3J80K 4DNCA 2K7LA 1VTNC 3RIRA 4JQFA 5B1UA 1I1SA 2YX7A 1ZTCA 5K5OA 4M73A 3IL2A 2BFLA 1YFHA 4GXOA 5K4MA 1HKSA 4MNUA 1R22A 2BG7A 1IN5A 1ZYRF 4WD6A 3SXYA 4HLYA 1FNNA 5ERIA 4OINF 5LBQA 4CICA 3I0VA 2BR6A 4DIKA 4XUKA 5LE1A 5FLXK 1ULYA 5AYAA 2KIUA 4UA4A 3IOFA 1F1ZA 1A8TA 3QU3A 4I09A 2YSRA 4C1HA 2OQRA 4U88A 5LRSA 2JPBA 2V6CA 1ZHFA 1MKMA 3DHCA 4ZYGA 1XTOA 1FBSA 3MWMA 2IA2A 2EFNA 2PG4A 5H6RA 3FXQA 1ZGJA 3T8RA 1ZARA 4GO1A 2UXXA 4HV5A 2P1EA 4R79A 4WCGA 1MZBA 3BPVA 2MC3A 5FQBA 2VOOA 3ULQB 4CHLA 4EM0B 2MH9A 4RB3C 2A07F 3L6NA 2P97A 2HZTA 2DAOA 2D1HA 1W4MA 3WTUC 4O98A 2AIOA 2HTSA 1MD0A 1U3EM 1H0MA 4Z67A 1SMTA 3AF6A 4PDKA 3TO7A 3L9FA 2VE8A 3SBLA 3I71A 1DXKA 3JSPA 4G6DA 3GFJA 5D8LB 3I14A 4ZEJA 4EJWA 2MH2A 4A6EA 5BS6A 4KMFA 4EXYA 1HLKA 4KIBA 2QQ9A 3F8CA 4L5IA 1T38A 4P5OA 5ICGA 3CUQA 4CZZA 4BQAA 2KKOA 5EEHA 1KU7A 3WTSC 4ZYDA 2PJPA 4FEKA 2NAZA 2GFJA 1IXRC 4HQMA 2YNTA 4PVTA 1LEBA 2OHIA 3GEZA 1YW8A 3RI4A 2FNAA 4HZFA 1GVJA 1Z91A 5BMZA 3R2UA 2ZZIA 3HYIA 2Q2EA 1EV7A 4AWXB 2H94A 5K5RA 5HOOA 3WTXC 3N4MA 2QYOA 1T98A 3RJPA 2DW4A 3KEQA 4OU0A 3OOPA 2FXAA 3QRFF 3VB2A 4EFZA 2XUBA 2NNYA 2BFZA 2DLLA 2LDUA 5EH9A 2EK5A 2HDCA 4BAYA 1RI7A 2VXZA 4FHTA 1Y0UA 2DU9A 5HH4A 1P4AA 3L2CA 4IHSA 3O2PE 1L9YA 2I7VA 3H3UA 4RL0A 4K2EA 4Z5YA 1ZNBA 2WRSA 3QH8A 3VEPA 4RAZA 2Z3YA 4GYQA 3W6KB 4PCQA 1O7LA 4EJVA 4YSLA 3X2ZA 1LJ9A 2ZJ2A 1D3YA 2Z5UA 3IOGA 4N9HA 4I0AA 1DUXC 4IRIA 4EV0A 1FOKA 2CFXA 2ZNZA 2BMIA 1ON2A 4LK1F 5KVRA 3ERED 3SHFA 3J81K 2JSCA 4TZBA 2TDXA 1PDNC 4Q4ZF 4HX7A 4M9XA 4UVAA 2KRFA 5E18F 1T39A 3BROA 3LSTA 2F5DA 1ZN2A 5A2QK 2HGCA 1T0FA 4Z7RA 4L5JA 3HUGA 5JHUA 4FX0A 1T2KA 2EFQA 4YFXF 4G7HF 2ZNBA 2P5KA 4YG2F 3E5UA 4WK8F 2LF8A 3CUOA 1P92A 2Y48A 5EEGA 3WU1B 3K1NA 5JVTA 1DD6A 3TP9A 2VC1A 2QQBA 1FT9A 4RAYA 3HTUA 2EFPA 4IXAA 3MQ0A 1IRGA 1ZKPA 4XLNF 4C1FA 5E1WA 2MLGA 3WG9A 2Z33A 4KMUX 1WWXA 4MEXF 4HF1A 1STZA 2BG6A 3GXOA 1S8NA 5DUKA 1H9TA 5FD5A 1XCVA 2YU3A 4ENNA 1RNLA 3I13A 3ZN1A 1IN8A 1KQ9A 5HIPA 5LS3A 2XAQA 3QP6A 2HKOA 5HDGA 3QPHA 3F23A 4M9ZA 1KR3A 1BI3A 4IRHA 2QDSA 3DQVC 1A04A 2HQRA 2W85A 2YZ3A 2V1DA 3F6OA 2GA2A 1TQPA 4GYGA 1FYLA 4M6YA 3RYPA 2COMA 2ELHA 3KP4A 4ESJA 4KEPA 2FU4A 3GW2A 2FQ3A 4MQ9F 5IT9Z 2KJBA 3MAJA 4AVPA 2WC2A 3FM3A 2FF4A 2PBIA 4HL1A 3FMRA 2EFOA 3BY6A 1ON1A 2V1XA 3VODA 4HYEA 2IPQX 3W6JB 2FK6A 3KP2A 5AONA 3I53A 4N9IA 4EM1A 2ACJA 2BE5F 1XDSA 4RGUA 4H0EA 3WGHA 2NRAC 2OBPA 5HS9A 2FNPA 2ZCWA 3M9AA 3P7NA 5E8GA 3TDUC 2P4WA 2UYXA 3H3EA 1GXQA 4I01A 3WU0A 1O3RA 2E1CA 2FRHA 3NRVA 2ZMEB 2K27A 4GYIA 3V8LA 1SMLA 4U7BA 3H3ZA 4YIFA 1BIBA 1XSVA 3BPXA 2DPUA 1I27A 1KQ0A 3ZWFA 2NS0A 4AIJA 4HF2A 4KA4A 1XD7A 4L18B 3RPCA 3LFKA 1XGMA 3G1PA 1KO3A 2V79A 5B15A 3I64A 5IQKA 1P6RA 4IJAA 2RGVA 3TQNA 3ELKA 4H0DA 3HHHA 3GUDA 2C6YA 4M74A 4MGRA 5ED4A 4DILA 2LSOA 5K1YA 1XGNA 5EVBA 2BEOA 4P96A 1HXDA 3X2XA 3P9IA 1KYZA 2BYVE 3I54A 3JAMK 1K7AA 3I0TA 4L9JA 5FD6A 2GIVA 3M8EA 1SD5A 3EUHA 1WRJA 2XVCA 2VT2A 5EV8A 2QENA 3FF5A 5CVRA 1ODDA 3RKKA 4F6ZA 1S7AA 2EFWA 5HH6A 1TNSA 5HLGA 4S04A 1ZREA 3MD7A 2EV0A 1VGNA 3GX4X 3E6BA 3VQZA 3ZP5A 4MEYF 2KIMA 1X8HA 2RV8A 1YS6A 2OZUA 4AX0B 1YCHA 3KZZA 2FBHA 3MFKA 2M30A 1R1UA 4KN4X 2A7MA 1YYVA 5D5WB 3FCZA 4EYBA 5HISA 5ICEA 1MJ9A 3FMQA 3IRRA 1BOAA 3E6CC 2HB9A 5D4RA 3J80Z 3DP7A 4A6DA 1XN7A 1U5TC 3WTTC 2VC0A 3BK2A 3HIFA 1Y44A 1UFMA 4ASNA 1X8IA 4GYUA 4IVNA 1K07A 1U2WA 3KE2A 2UXNA 2W25A 3F6VA 2XRNA 4M71A 2XAFA 3T9MA 2H09A 2O3FA 1ZLJA 3IDZA 1YS7A 1FC3A 2CYYA 2FM6A 1ZLKA 4PVOA 3J7AO 5FLXZ 3E5XA 4HX4A 4C1EA 2BC2A 1OKRA 3DKWA 3DHBA 3BJOA 1FYMA 4PZJA 5H6QA 5EWAA 2QBYB 3QP5A 3JTGA 2HS5A 4JO0A 3GF2A 4Z6XA 3E6MA 3RKXA 2IJLA 4LK0F 2BG8A 2L54A 1AOYA 1MJBA 1DP7P 1O7FA 1WRAA 2KIFA 1Z1DA 5D5VB 2OHJA 2G7HA 2ZNYA 2ADUA 2MLKA 2IRFG 5LGUA 1G3YA 2YNUA 2XV4S 2WTEA 4DQ2A 1DDNA 2X4HA 1OYYA 5LEJA 2GWRA 1SD7A 4NQWA 2NXAA 1LQ1A 3RKJA 2RC4A 2F5EA 2W57A 1DDKA 4TZFA 1UB9A 3KETA 3SZPA 4LGWA 5DCMA 2AXLA 2EJRA 3R61A 3FAIA 1ZG3A 4KIGA 3C18A 1XB4A 4HDUA 3ABUA 2G9WA 1J59A 4RM5A 3IKVA 2PFBA 3F8FA 2W84A 2BG2A 4AWZA 1S6LA 2P5VA 3BJAA 3T3NA 3Q5FA 1KQ8A 1BMCA 2GMNA 5D6EA 3P2UA 3PY5A 4BHCA 5HLIA 5HH5A 2HTJA 4TZ9A 1MJAA 5D8KB 2YR2A 4Y13A 5AIPA 3RPUA 3HRMA 2B0LA 2YNVA 5FB2A 1G3TA 3KFWX 5E20A 1JE8A 4EJTA 5K4KA 3WGGA 5LHIA 4HQEA 2Z99A 4I2OA 5DPXA 3FMSA 3RKWA 3I4PA 4O6JA 3SFZA 5J8FA 4XWTA 2K02A 3JSOA 2ESHA 2FA5A 1XM8A 4E70A 5TRDA 1SMYF 4GCWA 2QEDA 1J0RA 1U5TA 1WKMA 4Z5ZA 4LMYA 4AWYB 1JHHA 1Z6RA 1J75A 4A0XA 1W7PD 4EQQA 2PQ8A 1LB2A 1JGSA 2FMYA 3AAFA 1SD4A 4B87A 3M8FA 1KU2A 4I0BA 3F8BA 5FFZA 2BFKA 4Y17A 1QH5A 4Q48A 3Q9SA 3IRQA 2M87A 2DK8A 2EA4A 2XR1A 3RPQA 2Q0IA 4JBAA 3P9KA 4OOIA 1UCRA 3TO6A 2OQGA 4XRFA 2L3DA 1Z7UA 3V7RA 1IN4A 4HLXA 5BOXA 2FHXA 3TOAA 3BP8A 4L0YB 4LB6B 3QOPA 4RGXA 4ZYHA 5HIQA 3OV8A 4EYLA 1LDDA 4RGRA 2NYXA 1BC8C 3WODF 1FY7A 3ML6A 2ZO4A 4M72A 2WV0A 4KT5C 4O3MA 5J6XA 1O3SA 1TQIA 2MA3A 5HS7A 5FQCA 3B02A 5AXOA 5A0VA 1T6SA 4ON0A 2FBIA 4LG0A 3J81Z 4Q47A 1RUOA 3ROUA 1DPRA 2CO5A 1F4KA 3U1DA 1NHAA 1MDMA 1HSTA 2Q8KA 1K78A 2NZFA 1FPQA 4WXDA 1R58A 5A2QZ 5L3DA 2RDPA 2VN2A 1FBQA 2E7YA 4CO8A 5ILVA 2XAJA 1R36A 1YIOA 2JTVA 4CGZA 1E17A 5ACWA 1BIAA 5AHOA 2D2WA 1U78A 4MQVA 3CUQB 1BVTA 5CVJA 4NQ5A 1FP2A 3ZMTA 1IN6A 2A3SA 2I7XA 2J5OA 3ECHA 1TW3A 2Y87A 2P6SA 2QDTA 5E17F 1ZG5A 5LCAA 1EH6A 2A61A 1Q1HA 1KU9A 2QVOA 2O03A 5ACXA 1FP1D 3L7WA 3PQKA 2P4ZA 3ZN0A 1W5TA 3KP7A 5ICCA 4ZO2A 5L3BA 2HQNA 2STTA 4UWOB 2BFZB 4KN7X 3S2WA 3D5LA 3KP5A 3IWFA 1IN7A 1G3WA 4IF4A 4OIQF 1QPMA 5CYVA 2IT0A 1HSJA 3ZQ4A 4AX1B 3K9TA 3C1DA 3ZMSA 4ESBA 1B59A 2BBYA 5LHHA 2OA4A 1OYWA 4FT8A 2PI0A 2VW8A 3FXRA 5ACRA 1Z05A 1LDJA 3KL7A 4Z2YA 3RYRA 1SFEA 3TGNA 4BNCA 2JT1A 5LEKA 3N97A 3K1MA 1Z9CA 5LCFA 3IE2A 1FWZA 2CQKA 4QWQA 3IE0A 2EWNA 3R4KA 3DXJF 4D1TA 1CF7A 3RKYA 2VONA 1I1GA 4EXSA 3K69A 4U0YA 2HWVA 5L3GA 4OIPF 4TZEA 2VBYA 2DT5A 1ZRDA 2ISZA 5LLQA 5E1XA 3WE3A