2ZO4A

Crystal structure of metallo-beta-lactamase family protein ttha1429 from thermus thermophilus hb8
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
315
structure length
301
Chain Sequence
b'ALLPGLYLLPVPIPYPLKTVNLYLLQGAGEVALVDTALGTRAARGALELHLAELGLCFQDVKTILLTHHHPDHYGLSGFFEGLGARVFLHEEEFARGHRFWREPEAFAEASWRLFLDHGTPEETVEKTRERVHPPQNPLPLRDGEALEVAGKRLRVLWTPGHADGHAAFYLEEEGVLLAGDALLEKVSPNVGLWAYTRENPLKDFLRSLDRLADLGARVAYAGHFGPIADVRQRAEELKAHHQARLEALLALLDGPKTAWELSLHLFPRRFAFAETLAHLEYLREEGAVGRGGPPYRYFRR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Metallo-beta-lactamase family protein
publication title Crystal structure of TTHA1429, a novel metallo-beta-lactamase superfamily protein from Thermus thermophilus HB8.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Hydrolase
total genus 100
structure length 301
sequence length 315
ec nomenclature ec 3.-.-.-:
pdb deposition date 2008-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2zo4A02
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 2zo4A01
2Q2EA 3VB2A 1OPCA 3IE2A 3RKYA 1K07A 5K1YA 4LD5A 1HSTA 5JFRA 1B59A 3LVZA 3WGHA 4OIQF 2O3FA 2X4HA 1RZ4A 4EYFA 2PLYA 1D8JA 4RGSA 1FP2A 3N4MA 3KETA 1RNLA 4I02A 1IN6A 1MQOA 3E6BA 4DQ2A 5KK1A 1ZNBA 4EGYA 2BFKA 1R36A 2IRFG 1E17A 5FFXA 1WKMA 1FBSA 1HW5A 1MGTA 5AHOA 1OYYA 5A5ZA 5EVKA 1RUNA 3T5XA 3R6SA 1HSJA 2V9VA 1LB2A 2E7YA 2P1EA 4YSKA 2YU3A 3FXUA 1VMEA 3NEUA 4XSZF 1FNNA 1TW2A 5E1XA 4C1EA 1QH5A 3ZMDA 2DK5A 1U5TA 2QVOA 3F22A 5ACPA 1P4AA 4EJWA 3BC2A 4I7HA 5B3RA 4NQWA 3ZNBA 2YNVB 2OZUA 5BQTA 3M1EA 3H92A 4EXYA 2VBXA 2HQNA 1SAXA 1FBUA 4LMYA 5A0TA 2NNNA 1QNTA 1YCFA 3QH8A 2WWYA 1H9GA 3BP8A 2VC1A 2V1DA 2ISZA 3RKXA 3J81K 3BJOA 2IW5A 2MLKA 3PQKA 1XDUA 4S05A 3SW3A 5CVVA 2BFZA 3JSOA 3C18A 3DPLC 1O7LA 5E8GA 4WF2A 2FOKA 1J2XA 1M2XA 2JRTA 2L3DA 1J59A 2M5WA 2Y87A 4XLPF 3C7JA 1YW7A 2IVMA 2NZFA 5HDKA 2MC3A 3TO6A 2FQ3A 2OU2A 4CZZA 3RDIA 3DHBA 1BIBA 4TYFA 5LMCA 3VFZA 4H0EA 3N97A 2RQPA 3AF6A 3IWZA 2JPCA 4JO0A 1YS7A 3RKJA 2XHKA 1MDMB 3FMSA 1Y44A 2DPDA 2ETHA 4KFCA 5E1ZB 4V0HA 1JE8A 4LJZF 2GFKA 2CSOA 1Y0UA 5ACTA 3WE2A 1XGNA 2XAGA 1T39A 1S6LA 4JBAA 4RAZA 2ZNYA 4HQMA 3KFWX 4TYTA 4AWZA 4C1GA 1HW1A 2DLLA 4LLGF 4PZJA 3F8BA 4G94A 2FEZA 2OZ6A 2RVCA 4OINF 3DHAA 4YSLA 4C1CA 1T6SA 5A2QK 4JK1X 1BC2A 1D5VA 2VT3A 1AWCA 4GYGA 3BJ6A 5D8KB 1LQ1A 3I53A 2DOOA 2GXBA 2YCBA 3TDUC 3GLXA 3SZPA 4ENNA 2DI3A 3FF5A 3P9KA 1DUXC 2CWEA 1VGNA 5DYMA 1LJ9A 3B02A 3I54A 1G3TA 2QQ9A 2R3SA 2WHGA 1LDDA 1FSEA 4WXHA 4AD9A 1PUEE 3WTZA 1EH6A 3VPEA 1Z1DA 3K9TA 5LHIA 1HQCA 4HV6A 4OIOF 3ZMTA 4RAWA 4PGGA 1FLIA 3EQLF 2FM6A 2FNPA 2D2WA 4KN4X 1X8IA 4KIBA 3HOTA 2BMIA 4F7ZA 2YNUA 1O3TA 4H0DA 4I01A 2VODA 5FFZA 1T0FA 1WUOA 2QYOA 2FMLA 2PEXA 1ZAOA 2DO7A 3ZP5A 2FU8A 1QZZA 1UHMA 2HTSA 5CVJA 5D6EA 4HF2A 3G73A 3DHCA 4J5FA 3C3WA 4LLNA 1VJNA 2Z5UA 4I0AA 1R22A 3LA7A 4BP0A 1OR7A 3S0ZA 3KP6A 4B09A 3L09A 2W84A 3Q6VA 3I71A 5D5XB 1YCHA 5EV6A 4AIJA 3DXJF 4O98A 3K2ZA 1WSUA 2HTJA 3HRMA 2H6BA 4KT5C 3AF5A 4ZZLA 3QU6A 4M9ZA 4EJVA 4ESBA 3WTTC 3A4YA 4DIKA 2P5KA 5DEQA 4Z2YA 1UB9A 5AHRA 3ECOA 4BHCA 2H6CA 1QH3A 3GEZA 4CDGA 1MJBA 3ROUA 3V8KA 1ZGAA 4BXUA 3QP5A 4BYYA 3E6MA 2EK5A 3SD9A 2OQGA 2XV4S 3QAHA 5EVBA 2A07F 2JSCA 1BMCA 1KA8A 3FM3A 2BGAA 4UV8A 2MLGA 3WTUC 4AX1B 2BG2A 1XMKA 3HRUA 4U7DA 3FHZA 5TRDA 2DU9A 3FX3A 2QQBA 2V79A 2YNWA 3GX4X 4ASNA 3OV8A 3WTVC 5K4MA 3IDZA 1W5TA 5ICFA 3WGIA 2XROA 4R79A 4Z7RA 4EJOA 4MEYF 5DCMA 4XWTA 3X2ZA 4D02A 2QEDA 3LSTA 3RJPA 3E5UA 1IXSB 4L5IA 2A61A 5DD4A 1PP8F 2O6GE 2R7FA 3F6OA 4UNOA 2W24A 1XM8A 4GXOA 5AXOA 4UAMA 3GWZA 1KU7A 3LWFA 2GXGA 2O61A 3CLOA 1L0OC 1WRAA 2Q9UA 2OAZA 1JT1A 4RL0A 2K4JA 2G9WA 1IXCA 1SMLA 1A04A 1R23A 2KJBA 4A0XA 2A68F 3OOPA 3SZTA 5E8IA 3CJNA 1T38A 2VE8A 3ZN1A 1PDNC 1U6GA 5HDNA 4U0YA 2EFNA 3V4GA 3QP6A 1LVAA 4WWCA 3CO7C 3E6CC 4Y15A 5JI6A 1G6NA 3EETA 1KQ0A 5DV5A 5LHGA 2O03A 3DV8A 4KA4A 1USTA 2DW4A 1YLFA 2DPUA 1XSVA 1GHCA 1DXKA 4AVPA 2HOEA 4EGZA 3BZ6A 1J5YA 4IHSA 4KMUX 5HVQC 4YIIA 3I0TA 1Z7UA 4RGRA 1ZRFA 3HSFA 2YNTB 1XB4A 4C1DA 4KNYA 2K02A 3MCZA 1MJ9A 2FHXB 3HSRA 2Z33A 3RPCA 4TZFA 3FXQA 4N9IA 2I7XA 2ZCWA 1H0MA 1YQAA 2YSRA 1K79A 4XSXF 1Q1HA 5L3EA 1WWXA 4KN7X 5D5VB 2Q8KA 1H9TA 1FYMA 1WI9A 1ZLJA 3BJAA 4HKYA 2PQ8A 3L9FA 2GIVA 2QZ8A 4GYIA 3QOPA 4HLYA 3FMRA 1CF7A 1K7AA 4U4LA 1X8HA 3KZYA 4M73A 3IKTA 2W57A 2STWA 5LGUA 2R7DA 5L3BA 5IQKA 2XIGA 5BS6A 2VBYA 2QLZA 2XVCA 5HS7A 3IEMA 4WCGA 5FD6A 3GZ6A 2YPRA 4D1TA 2HDCA 3E5QA 4MNUA 4HF0A 1FP1D 6PAXA 2GAUA 2Q0OA 5K4NA 3TDZC 3NRVA 3DH8A 2GA2A 4L0ZB 5AEBA 5ACVA 2WTEA 5H6RA 5D5UB 4Z67A 1I1GA 3HOSA 2XUBA 3EYIA 1QQIA 2HS5A 2F5DA 3GZ5A 4NQ2A 3MQ0A 5LSCA 3R60A 3O3KA 2VBZA 2ZBKA 4RGUA 1X8GA 4ZYEA 4HDUA 3IRQA 1S7AA 1Z9CA 4EYLA 3X2XA 3RKKA 2DTRA 5E17F 2GFJA 2L54A 3SRXA 4YIFA 2YR2A 2MH2A 3LA2A 4EM2A 3VOEA 2NS0A 1XD7A 3F72A 4L5JA 4HLXA 1I27A 3ZPLA 1KQ9A 2OHHA 3V7RA 2BEOA 1B9MA 2DFIA 5LRSA 4A0ZA 3J7AO 2YNTA 1O7FA 1HLKA 3BWGA 3M8FA 2JPBA 1O3QA 3M9AA 4K2EA 2QWWA 3PQJA 1SD4A 2PFBA 1W7PA 5EWAA 1B9NA 3FCZA 5ACSA 1J9IA 3X30A 1XGMA 2EB7A 2QDTA 2ADUA 1IN5A 4ZYGA 1U3EM 1QZYA 3DEUA 2NNYA 4M6XA 4OOIA 4Y13A 3V8LA 4I0BA 2A5YB 3CUOA 1BIAA 2STTA 5LEKA 1ODDA 1P4WA 1DP7P 5HLGA 4B8XA 2P6SA 3WODF 1USSA 3FMQA 5ACWA 3WTYC 4GGGA 2HYGD 2FSWA 3HRTA 1VTNC 2Q42A 4ENKA 4Z6XA 2BGCA 5ICGA 3PY6A 2D1HA 3IHUA 1KQ8A 4D1WA 1ON1A 1ZYRF 1IW7F 2UYXA 2FBIA 4L9JA 2JT1A 1OMIA 4EVIA 2M5DA 1RUOA 2W85A 3JAMZ 2WYMC 2VOPA 5LEJA 3RPUA 1TQMA 1IUYA 2A3SA 3R0AA 4DILA 5CVUA 1BC7C 4NB5A 1Z91A 1IF1A 5H6QA 4UVBA 4LG0A 1GXPA 1P2FA 2EA2A 1MJAA 4LB6B 3F23A 3ULQB 4RB2C 4A5NA 2RV8A 4Q5SF 2LKPA 3GYHX 4OIRF 5ACXA 5AONA 5LBQA 4F6HA 1TBXA 3BY6A 3EDPA 5LCFA 3KEOA 4ZZDA 5DUIA 3COAC 5KVRA 1K6OA 2BC2A 2BE5F 3IL2A 1SD6A 1EH8A 3ISPA 2QDSA 2ELHA 2Y0MA 5FQAA 4M72A 2GWRA 1ZG5A 3J80Z 5D8LB 3ZR9A 2ACJA 1YTYA 2AIOA 3HTSB 1K78B 5CVIA 2COMA 4EY2A 3IKVA 4OMYA 1EV7A 3KP4A 2IA2A 2NAZA 3FWEA 4HAMA 3M8EA 2Y48A 1R1TA 3RTRA 3K1MA 4O3MA 3KNSA 2W25A 2J5OA 2E1NA 3WE3A 5IT9K 1ZG3A 4LFUA 5D6FA 3GFJA 3P9IA 2CBNA 2ZMEB 3T8TA 1U8RA 4L9NA 1KU3A 5FB2A 4NHJA 4HF1A 3LA3A 3B73A 2XKOA 2H94A 4BHBA 1RI7A 2FMYA 2PN6A 4YFKF 1JJTA 4TZBA 2EFQA 3GFIA 2RN7A 4EXSA 5FGMA 3IELA 2JZYA 5BPIA 5D4RA 5EH9A 4ZO2A 5J8FA 2PI0A 1WRJA 2L4MA 1S29A 2VW8A 3GFMA 2YNVA 5L3FA 2CQKA 4LE6A 4AIHA 2RKHA 4CO8A 3IOFA 4CYDA 4YFXF 1S3JA 5E18F 5FLXK 4ENJA 4LB5A 1DDKA 3SHFA 3Q9SA 3I64A 2DKFA 3ESHA 3T1BA 4CHLA 5BOXA 2CG4A 3NQOA 5LRRA 5DCFA 3F8CA 3MFKA 5HH5A 5LS3A 1YS6A 4PCQA 5D5WB 2F5CA 4PGHA 3DP7A 3F6VA 3F8MA 2R2DA 2P4WA 2F5FA 1NHAA 2BTNA 3WTWC 4L0YB 5K4KA 2M45A 5ED4A 3RYRA 1ZARA 2EFOA 4ESFA 3IWFA 3CUQC 5HDGA 2FU4A 2X0LA 3KEQA 2NRAC 1P4XA 3Q9VA 4XLNF 4LK0F 2FBHA 4HV5A 2ZWRA 1K78A 1P6RA 1R58A 2BG8B 1MDMA 3E3VA 3ZMSA 3ABTA 5HH4A 1CGPA 1YYVA 4PVOA 4KMFA 4KYWA 4TZEA 2BFLA 1J7KA 4RAYA 2H09A 2UWMA 3IEKA 3J81Z 2ZMEA 2VN2A 2P5LC 3KE2A 4XUKA 4EM0B 4A0YA 4OIPF 1MKMA 2BG7A 4NQ4A 2FK6A 1O3RA 1LNWA 2P7VB 2EA4A 1T98A 2LF8A 1TNSA 4FHTA 4HBLA 2FNAA 2LF7A 4AIKA 2QENA 3I59B 1G3YA 3R0JA 2XRNA 2FU7A 3DFGA 5ILSA 1T2KA 3JXPA 5EHTA 2HR3A 2QJSA 4M6YA 2DT5A 4UA4A 1J0RA 5DPXA 2KJCA 4M71A 5FD5A 1KO3A 4IRGA 4NQ6A 2F5EA 4D0PA 1ZKPA 4ZEJA 4HW0A 4TZ9A 2L02A 4BZ3A 2EFWA 4CICA 4D1UA 4UXNA 5FQBA 1Z6TA 5DD8A 4ON0A 2QQAA 2HQRA 2D1VA 2OBPA 1P92A 4EJUA 5LGNA 3JW4A 3ML6A 3BOQA 4UWPB 3TO9A 4UHTA 5K0WA 4ZYDA 2VONA 2VOOA 4EYBA 4MTDA 4UV9A 1WQ2A 1R00A 1IN8A 1HW2A 1TQIA 2JTVA 5JR3A 4FX0A 1UHWA 5A2QZ 2GCUA 3QPHA 4IRHA 5F1RA 1JJEA 1XCBA 4BQAA 4KEQA 1U5TC 5HOOA 3TOBA 4FX4A 5LCAA 4Q48A 1IZ1A 2B0LA 5J6XA 3CUQB 2D45A 4HA8A 3KNRA 1FT9A 2DQLA 4EM1A 1L3LA 1L9YA 3O6BB 3F9OA 1XMAA 3WGGA 2BG8A 2O8XA 2OHIA 2RNJA 3DQVC 3G1PA 1KU9A 4IJAA 5HISA 4GCVA 4EMSA 1LDJA 5EW0A 4Q47A 5HS8A 2XASA 4A2UA 1FBQA 3V7SA 4UBQA 1D3YA 4CXFA 1BJAA 5LM6A 1PP7U 3HIFA 5K5RA 2NYPA 5HIOA 2ZFWA 3KLNA 5D4SA 4UUVA 4XWWA 5KIKA 1HKTA 1SD5A 4ZNBA 2E7XA 2EJRA 2H6AA 2KIUA 4G7ZF 1UFMA 3V8JA 1D8KA 1HBXG 5AIQA 5FO5A 1TNTA 4IPAA 2YZ3A 2GZWA 4RB3C 3QU3A 1BVTA 3FAIA 1GXQA 3ECHA 4Y17A 5ICEA 4ETSA 2PBIA 1ULYA 1OYIA 4C09A 1TQPA 1R5HA 1UCRA 1ONVA 3X2YA 4P9FA 3HYIA 3CO6C 1BOAA 4FEKA 1BM9A 1S7OA 2FBKA 1A7TA 2HB9A 4D1VA 2FU6A 2ZJ2A 3ADRA 3KP3A 3T3OA 3M7GA 2XGXA 4WXCA 3RI4A 3WG9A 1U5TB 2CYYA 3U9GA 4PVTA 3RIRA 4MHGA 4L18B 1HKQA 5K5OA 1QO0D 4G9YA 3I4PA 4HL1A 2XF4A 4OU0A 2ZXJA 3JTGA 1U2WA 4O5VA 1JHFA 1V4RA 1FWZA 2WRSA 3ZMZA 5HIQA 3IE1A 2XAQA 5ILVA 4G7HF 2GA1A 4BNCA 3GXOA 2MBFA 1KO2A 2K27A 2FHXA 2NXAA 5EVDA 2EWNA 3HSEA 4G8XA 5HLHA 1B4AA 2BFZB 1JHHA 1KU2A 3BK1A 3WU0A 5ACRA 2XAFA 1GVJA 1DD6A 1FZPB 1YO5C 5F6FA 2DBBA 3GFLA 3MAJA 5EEGA 5A87A 1R5GA 1IXRC 2BR6A 2OA4A 2XKPA 5CYVA 3ZWFA 3VODA 2GMNA 2I7TA 3ABUA 4I98B 3CDHA 5TJJA 1DPRA 3TO7A 3H3EA 4P55A 4G6QA 2P8TA 3I5UA 4Z5YA 2M1BA 3KLOA 1BN5A 2DAOA 1B1BA 2G7UA 2FXAA 5IT3A 1F4KA 1Z6RA 3TOAA 3PG4A 2P18A 2KIFA 3D0SA 3DKWA 2Y8AA 3I14A 2HGCA 4IXAA 1O3SA 3FZVA 1J75A 2OHJA 2IA1A 1FY7A 4FT8A 2ESNA 4YFNF 1LDKB 2ZKZA 1ZG1A 1ZH5A 4MTEA 2VXZA 2K4BA 1E2XA 3MZHA 4A5MA 4WX9A 4IVNA 3ZQ7A 1FYLA 5KILA 1BI0A 3REOA 3KP2A 5LE1A 4F6ZA 4I09A 1JXSA 5L3GA 1QBJA 5K5QA 2K86A 3AJ3A 3IRRA 2BV6A 2DK8A 2Z9OA 3LQRA 3WU1B 5HIPA 1FYKA 4RB0A 1I5ZA 3HTUA 1DDNA 1ZLKA 4LK1F 3SPUA 3P2UA 1X3UA 3WTXC 3HHHA 2ISYA 3H3ZA 1IRFA 4HZFA 1YW8A 1LEBA 3IC7A 2NZEA 2HFHA 3U1DA 1G4DA 2FE3A 1QPMA 1JGSA 1IN4A 1F9NA 2HYFA 3WXCA 3PY5A 1WW1A 3HRSA 4AWXB 3F21A 3SQNA 1TTYA 4C1HA 4MEXF 5LCHA 3GF2A 2HKXA 2ZO4A 4HX4A 2A6HF 3ZMUA 3MD7A 3SBLA 2WC2A 4ESJA 3TQNA 3RYPA 4G7OF 4CGZA 3Q5FA 2CO5A 4E70A 4UVAA 5E20A 3CTAA 5ICCA 2UXNA 2TDXA 1V3FA 2EFPA 1IRGA 1IAWA 3AAFA 2AXLA 2QINA 5BPDA 2PJPA 4GYQA 3TKYA 2HKOA 4KIFA 1ZGJA 1ZN2A 3E6DA 1HXDA 2IJLA 2EV5A 4ENMA 2P5VA 3I13A 2EV6A 5EEHA 5BMZA 3R2UA 2HWVA 1W4MA 1AOYA 1R1UA 1XSDA 4GCWA 3F8FA 1TLHB 4FR7A 3HHGA 1HKSA 2PG4A 2BG6A 5DUKA 2XAJA 2Y75A 2Y8BA 5AXRA 2VT2A 2WYLA 4A6DA 3L00A 1I6XA 3E97A 1C0WA 4L9VA 4FSBA 4OMZA 4GO1A 2A69F 3SFZA 3VEPA 4IRIA 3O2PE 2KRFA 4UWRB 2FRHA 4P9UA 2KIMA 4RB1A 1E5DA 4EQQA 2V1UA 3LAJA 1XCVA 3I0VA 2FA5A 1SMTA 1IN7A 5ILUA 2VBWA 4L9TA 1BBYA 3ZQ4A 1OKRA 1O57A 4TV7A 2PMHA 1B6AA 3KP7A 5DCMB 1FX7A 1RIOH 2WV0A 2A6EF 3ELKA 2M30A 2QUFA 2RDPA 3TGNA 3I15A 3DF8A 1G3SA 4RM5A 1YFHA 1YW9A 3LAPA 4B87A 3BPXA 4RAMA 2OD5A 5LLQA 4ZYHA 2Q0JA 2BYVE 1BI2A 2GKLA 4XBFA 1SD7A 1XTOA 4BH9A 5AYAA 2Q0IA 2IP2A 5B15A 1Z05A 2IPQX 5CJ9A 5LHHA 4LLLA 3K1NA 2YX4A 2CW0F 4ZO3A 2Z99A 3TP9A 2XR1A 2P4ZA 3U2RA 4U7BA 5ACUA 1S8NA 3IOGA 3BPVA 4Z60A 4Q4ZF 2P97A 1FOKA 4P96A 2CGPA 3E5XA 4GYUA 5LLDA 5A0VA 1SFEA 1XSXA 2MA3A 5F64A 1FSHA 1F1ZA 3EUHA 4U0VA 2FU9A 2BIBA 3MZYA 4YSBA 3FXRA 2L01A 4N9HA 2V6CA 3I58A 3F3XA 3GW2A 4WXDA 3JSPA 5EV8A 3WTSC 4HX8A 5HH6A 3GO5A 3VQZA 3T3NA 4AWYB 3P7NA 4J5HA 1XDSA 2YX7A 1EH7A 3R61A 3LQQA 4P5OA 4R1HA 3ERED 4HYEA 2H27A 1ZRCA 2HEOA 1W7PD 2F2EA 2WYMA 5IT9Z 3QRFF 5HS9A 1SMYF 2IA0A 4DNCA 5AIPA 4U88A 5JVTA 1SFUA 1ZREA 2ZNBA 4BAYA 5LGTA 3KCCA 3W6JB 1CF7B 1TW3A 3S2WA 5CVRA 3ZMVA 2O0YA 2A7MA 1ON2A 2HZTA 2CFXA 4RL2A 3H3UA 1SFXA 2PMUA 3G3ZA 3K1PA 2QBYB 1YCGA 3MWMA 1MD0A 3K69A 3IE0A 1QGPA 4R8HA 4UWOB 4HL2A 4BHPA 5H20A 4MQVA 1MZBA 2RC4A 4UVCA 2IT0A 1KR3A 3P9CA 1KYWA 2ZNZA 2UXXA 3BDDA 5CLSA 5FQCA 3MEXA 5FLXZ 4ZH4F 2FF4A 2GQQA 1REPC 2I7VA 3C1DA 5ACQA 4RS8A 5DDGA 1F5TA 4CHUA 3V7CA 2EV0A 3L7WA 4HDVA 1FC3A 2NYXA 2M5CA 2QM3A 2AS5F 3ZN0A 1YIOA 4NQ5A 2BBYA 3PFIA 4O6JA 1U78A 1KYZA 2E1CA 2MH9A 4KUMA 4A6EA 3I59A 5HLIA 2K7LA 2LNBA 2P7CB 3KL7A 1I1SA 1W5SA 4XRFA 5JHUA 4KICA 4MGRA 1XGSA 3QPTA 4HOBA 2OQRA 4AX0B 4EFZA 4RGXA 1W7PB 3JTHA 4RBSA 4IF4A 2LDUA 1ZHFA 3D5LA 4YG2F 4WD6A 4U0WA 3JAMK 1STZA 3FM5A 3BROA 3L2CA 1LEAA 4M74A 2LSOA 4IHTA 3L6NA 4HQEA 2ZZIA 1ZTCA 5ERIA 4KIGA 4MQ9F 1G3WA 1YG2A 2J5PA 2DQRA 1P9EA 3T9MA 3T8RA 1XN7A 2XAHA 2C6YA 2Z3YA 4KEPA 4EJTA 5J8CA 3F8NA 3RPQA 4PDKA 2G7HA 3LFKA 3R4KA 2UZKA 1ZRDA 2ESHA 2M87A 2MD5A 3KZZA 2QBYA 2M8EA 5L3CA 4KDPA 1DPUA 3I11A 4C1FA 2RGVA 3CUQA 3BV6A 3HUGA 3T0YA 4Z5ZA 1WUPA 2L4AA 5E1WA 4EV0A 4LGWA 2KKOA 4N0BA 4I2OA 4M9XA 1FPQA 3EYYA 4P62A 3J80K 4QLCU 1BC8C 4WK8F 3GUDA 1BI3A 1R7JA 1A8TA 3BK2A 1BI1A 4UWSB 2P6TA 1KGSA 2AZ4A 4M9SA 3KP5A 4S04A 3RKWA 4A12A 5B1UA 3SXYA 3DPTA 1R1VA 4LG0B 3GVAA 4QWQA 5L3DA 2VC0A 2VE9A 2E7WA 1XGOA 2V1XA 3K0LA 4JQFA 3SFPA 1OYWA 4HX7A 3W6KB 4G6DA
chains in the Genus database with same CATH superfamily
4ZDOA 2Q2EA 3VB2A 1OPCA 2GBYA 3IE2A 1W0UA 3RKYA 3RSNA 4FCYA 1K07A 5K1YA 4LD5A 2V4JC 1HSTA 5JFRA 1B59A 1NG7A 2ID6A 3LVZA 2KISA 3WGHA 4OIQF 2O3FA 2X4HA 3S3OA 1RZ4A 4MFEA 4EYFA 2PLYA 1D8JA 1JUPA 3OIQA 4RGSA 4CUGA 1SANA 1D1CA 4NC8A 2XDVA 3JRFA 3GTPJ 1FP2A 3N4MA 2IEKA 4RLQA 2HOSA 3SZGA 5GADJ 1QHGA 4XOTA 3KETA 1R4MB 1VNDA 1RNLA 2ECCA 2ELJA 3Q0UA 3OL4A 4I02A 1IN6A 1MQOA 3E6BA 4IL6C 4DQ2A 3LSHA 4C3IJ 5KK1A 5EGOA 3AG4H 2ZMEC 1ZNBA 4EGYA 3A2KA 3LSKA 2BFKA 1Z67A 1R36A 3OYCA 1YOVB 3OSFA 2IRFG 1E17A 5FFXA 1WH5A 1WKMA 1FBSA 5TISC 1HW5A 3S1NJ 1MGTA 5AHOA 1OYYA 5A5ZA 5EVKA 1RUNA 3T5XA 3R6SA 1TZLA 1HSJA 4NURA 2V9VA 4GRIA 2NVUB 1LB2A 2E7YA 3GTQJ 2P1EA 2BY2A 5B1BH 4YSKA 2YU3A 3FXUA 1VMEA 2YS9A 3NEUA 1G2HA 3TEDA 4XSZF 1FNNA 4YRVA 1TW2A 5E1XA 4C1EA 1QH5A 2LOOA 3ZMDA 1X4OA 4XN0A 2DK5A 1U5TA 3GTMJ 3JREA 1SVMA 2LVSA 2QVOA 3F22A 5ACPA 3HPHA 1P4AA 4EJWA 4DBQA 3BC2A 3AG1H 2ZXWH 3DKXA 3ZQGA 4I7HA 5B3RA 4NQWA 3ZNBA 2YNVB 5LD2C 2LKXA 1W5CC 1VQPI 3H35A 2OZUA 5BQTA 3M07A 3M1EA 3H92A 3FIWA 2M7BA 4EXYA 2VBXA 2R7OA 2HQNA 1Y8QB 3FXKA 4M3EA 1FBUA 1SAXA 4LMYA 3WG7H 4BQQA 4ABZA 4B44A 2NNNA 2VI6A 4E7IA 1G8XA 5A0TA 1QNTA 1YCFA 3QH8A 3G1LA 2WWYA 1H9GA 2VJ5A 2UUZA 2EIMH 3K2AA 4BDYA 2CG3A 3BP8A 3BR1A 2VC1A 2V1DA 5KCMA 2ISZA 2XPWA 2XPUA 3RKXA 5IYCJ 3AG3H 3J81K 3BJOA 2JK3A 2IW5A 2MLKA 2HPIA 4JOMA 3PQKA 1XDUA 4S05A 3SW3A 5CVVA 2BFZA 2ID3A 3JSOA 3C18A 3DPLC 1O7LA 5E8GA 5GPCA 4WF2A 2FOKA 1J2XA 5J4VA 1M2XA 2JRTA 2L3DA 3OYAA 1J59A 1MNDA 2M5WA 3CCVI 2Y87A 4XLPF 3C7JA 1YW7A 2IVMA 2JUCA 4B1RA 3D1NI 2JA7J 2NZFA 4UY8I 5HDKA 1D0YA 1VQNI 2DA1A 2MC3A 2OCEA 2R7UA 3TO6A 2K9QA 2FQ3A 2L9SA 3CP8A 2OU2A 4CZZA 2E2HJ 3RDIA 2R7SA 1YIJI 3DHBA 1BIBA 4TYFA 5LMCA 1U9NA 1IJWC 3VFZA 4H0EA 3SJMA 3N97A 1WJBA 2RQPA 3AF6A 2DYSH 3IWZA 2JPCA 4JO0A 1YS7A 4A3LJ 3RKJA 4JYKA 2R4GA 2XHKA 3IP4B 1MDMB 3FMSA 1Y44A 2DPDA 2ETHA 4KFCA 2MYSA 1GLNA 5E1ZB 1WJFA 1JE8A 4LJZF 4V0HA 2PX9A 2CSOA 2GFKA 1Y0UA 5JLXA 1X2NA 5ACTA 3WE2A 1XGNA 2XAGA 4V19K 3S17J 1WI3A 4IKFA 1T39A 1S6LA 4JBAA 3DBRB 4RAZA 2ZNYA 4HQMA 3KFWX 2L7FP 1WPKA 3IH2A 5BNGA 4TYTA 3ZCOA 4AWZA 4C1GA 1HW1A 2DLLA 4LLGF 4PZJA 3F8BA 1A6IA 2L7ZA 1LE8B 1MMGA 3BT9A 2B7EA 1TWGJ 3ASOH 4B47A 4G94A 2ZFUA 2KT0A 4GFBA 1BR2A 2FEZA 2OZ6A 2QF7A 2RVCA 4OINF 3DHAA 4YSLA 4C1CA 1T6SA 5A2QK 4JK1X 4YIRX 4S0HB 1BC2A 1D5VA 2VT3A 1AWCA 4GYGA 3BJ6A 5D8KB 1LQ1A 4XKBA 5M3FJ 3I53A 2DOOA 2R93J 3CF5F 2GXBA 2YCBA 3NWSA 1MBKA 2FD5A 3JCUC 3A1YA 2DDAA 2NOGA 3TDUC 3GLXA 3SZPA 4ENNA 2DI3A 3FF5A 3P9KA 1DUXC 2CWEA 3K4NA 4NBQA 4XMYA 1LPQA 3MKZA 1VGNA 5DYMA 1LJ9A 3B02A 3I54A 1G3TA 2QQ9A 4DIQA 2R3SA 2WHGA 1LDDA 2LTPA 1FSEA 2QSGX 3OYMA 4CYCB 4WXHA 4AD9A 2R0QC 1PUEE 3WTZA 1EH6A 4ZTFA 3VPEA 1Z1DA 2K3PA 3K9TA 5LHIA 3CJTB 5FROA 1HQCA 4HV6A 4OIOF 3BTJA 5C4JJ 5GTIC 3ZMTA 3FXLA 4CCJA 4RAWA 4PGGA 1FLIA 2MW8A 3EQLF 4A3EJ 2FM6A 2VQGA 2FNPA 2EZHA 1DGRM 2D2WA 3HB9A 3QPSA 4KN4X 1X8IA 4KIBA 4BY1J 3OYFA 3HOTA 2BMIA 4F7ZA 2YNUA 1O3TA 3PO2J 5IPAA 4I01A 4H0DA 2VODA 5FFZA 1T0FA 1WUOA 1UMQA 2QYOA 1ERDA 2FMLA 2PEXA 1ZAOA 2DO7A 2JSPA 4OAYA 2HDWA 3Q3SA 2IXSA 3ZP5A 2FU8A 1QZZA 3HBLA 1UHMA 2IGKA 2HTSA 1V54H 5CVJA 2WAEA 5D6EA 4BL0B 4HF2A 3G73A 3DHCA 4J5FA 2JVHA 2DCEA 2IGOA 3C3WA 4LLNA 1VJNA 2Z5UA 5AIJA 1OCTC 4I0AA 4C2TA 1R22A 4XN3A 3LA7A 4BP0A 2D5VA 5F04A 1OR7A 5J4YA 3S0ZA 4ITVA 2DFEA 4C30A 3KP6A 3KPHA 4B09A 5KAIC 3L09A 2W84A 3Q6VA 3H36A 3I71A 5D5XB 1CQTA 2YU9J 3BTLA 3FDYA 1YCHA 5EV6A 4AIJA 1A31A 3DXJF 4BE2A 4O98A 1FMVA 4BKXA 1RETA 3K2ZA 5J47A 1WSUA 1GDTA 1ETOA 2HTJA 3HRMA 4KT6A 2H6BA 2M7AA 4KT5C 5C44J 2VIXA 3AF5A 4ZZLA 3QU6A 4M9ZA 4EJVA 4ESBA 3WTTC 3A4YA 2VKEA 2P5KA 5DEQA 1BR4A 3S2DJ 3NARA 4Z2YA 1QVUA 1UB9A 2K9MA 4D1QA 5AHRA 3ECOA 2H6CA 4BHCA 1QH3A 3GEZA 4CDGA 1HA8A 2DOFA 1MJBA 3FXJA 3QYBA 2F4OB 3ROUA 1HCRA 3V8KA 1ZGAA 2L0KA 4BXUA 3QP5A 3IH3A 4BYYA 2WA0A 3E6MA 2EK5A 2DT6A 3SD9A 1E0EA 2OQGA 2KMUA 2WADA 2XV4S 3BQZA 3QAHA 4Y3OA 3KYLA 2A07F 5EVBA 5B5EC 3FXOA 2Z1DA 2IGMA 1V5FA 2JSCA 4W1UA 2KIQA 2OTLI 1BMCA 1KA8A 3FM3A 4ZYAA 4EEFG 3EUKL 2BGAA 2COBA 2HZDA 4UV8A 1ETXA 2MLGA 3WTUC 3CCYA 4AX1B 2BG2A 1XMKA 3HRUA 4U7DA 3FHZA 5TRDA 1BJZA 2CJJA 2DU9A 3FX3A 1NK3P 2QQBA 2V79A 2YNWA 3GX4X 4BE1A 4ASNA 3OV8A 4CYCA 3WTVC 5EJCA 5K4MA 3IDZA 1W5TA 5ICFA 1HF0A 3WGIA 3BR5A 2XROA 4R79A 4Z7RA 4EJOA 4MEYF 1BL0A 5DCMA 4XWTA 2H8WA 4RLFA 3X2ZA 3S3NA 2QEDA 3LSTA 5F27A 3RJPA 3E5UA 1IXSB 1A6QA 3PIOF 1NG6A 2GLOA 4L5IA 2A61A 5DD4A 1PP8F 3CCQI 2O6GE 3KYDB 2XF5A 2R7FA 1ETQA 3F6OA 4UNOA 1WVRA 2W24A 5B66C 1XM8A 4GXOA 5AXOA 1I39A 2GOMA 4UAMA 3GWZA 3PIPF 1KU7A 3LWFA 2GXGA 2O61A 1R5ID 3CLOA 4HEA2 1L0OC 1WRAA 2Q9UA 2OAZA 1JT1A 4RL0A 1JKQC 2K4JA 3H9QA 3ABKH 4XIDA 4BXFA 2AHQA 1IXCA 2G9WA 3BZKA 1Y6IA 2R7QA 1SMLA 1A04A 1R23A 2KJBA 4RAGA 4A0XA 2A68F 1BW5A 3OOPA 3SZTA 5E8IA 4C3HJ 1VZ0A 2E35A 2ME0A 1D1BA 3CJNA 2DJNA 1ETKA 3H5NA 1T38A 2LREA 3KEYA 2VE8A 2CFOA 2LRDA 4X1EA 3ZN1A 4B48A 2N8GA 3ZXSA 1PDNC 1U6GA 3S3MA 1Y39A 5HDNA 4U0YA 1OFCX 2EFNA 2EILH 1B72A 5IP7J 1EA3A 3V4GA 3QP6A 1LVAA 2HYJA 2B9SA 1QPIA 1OQYA 2RREA 4WWCA 3CO7C 3E6CC 9ANTA 2OV7A 4Y15A 4D5CA 1G6NA 4ZDPA 5JI6A 4C2MJ 3G71I 3EETA 4BQOA 1KQ0A 5DV5A 1H89C 5LHGA 2O03A 3DV8A 4KA4A 2DMQA 2BZTA 5IP6A 2NVXJ 3CQZJ 1USTA 4QPOA 2L9VA 2KPMA 2DW4A 3VYUB 1B8IA 1YLFA 4M3FA 2DTZA 3PO3J 2DPUA 1XSVA 5GAGJ 1GHCA 1DXKA 4AVPA 2HOEA 3BZ6A 1J5YA 4EGZA 1D5YA 4IHSA 4KMUX 5HVQC 2VASA 4YIIA 3I0TA 1Z7UA 4RGRA 1ZRFA 2ZXIA 2M34A 3HSFA 1WJDA 1XB4A 2YNTB 4C1DA 2G0EA 1HC8A 4KNYA 2VQCA 2K02A 3MCZA 1MJ9A 5GPAA 2IS1A 2FHXB 3HSRA 2Z33A 3VYSB 3RPCA 4TZFA 3VYRB 3M1CA 2LC2A 3CDIA 3W2AA 5IYDJ 3FXQA 4N9IA 2XPVA 3VPRA 2I7XA 4PUSA 1XG1A 2ZCWA 2TRTA 1YQAA 2YSRA 1H0MA 1K79A 4I99C 1JUSA 2LY2A 4XSXF 4XM3A 1Q1HA 1HOMA 5L3EA 1WWXA 2VB6A 4KN7X 5D5VB 2Q8KA 1MNMC 1H9TA 1OCOH 1FYMA 1WJCA 1WI9A 1Z21A 3DU6A 1ZLJA 1U9OA 1QA6A 4D02A 3BJAA 4CA0A 4HKYA 2PQ8A 3L9FA 1W1WE 2GIVA 2KL4A 2QZ8A 4BACA 2X1DA 4CCKA 4CZCA 4GYIA 1T95A 2W82A 3QOPA 4HLYA 1ETYA 3FMRA 1CF7A 1K7AA 2LR8A 4U4LA 1E3HA 1X8HA 3KZYA 4M73A 3IKTA 4JP0A 2W57A 3PL8A 2STWA 5LGUA 2R7DA 5L3BA 5IQKA 3UKGA 2XIGA 5BS6A 1SFOJ 2VBYA 2HOTA 1BR1A 2QLZA 2NVYJ 2XVCA 2R5ZB 1NK2P 5HS7A 3IEMA 4NNJA 4WCGA 3BG7A 3M3YJ 5FD6A 1XMXA 3GZ6A 2YPRA 4D1TA 4DYRA 2HDCA 2KFDA 3E5QA 1GV2A 1OCCH 1MMAA 3ABLH 3HKZN 4M3GA 4MNUA 4HF0A 1FP1D 2BOLA 6PAXA 2Y30A 2GAUA 5E3OA 2Q0OA 5K4NA 3TDZC 3NRVA 3DH8A 2GA2A 2WAQN 3CCEI 1PJRA 2Y0SN 1FTTA 4NC6A 1N75A 3BQYA 4L0ZB 5AEBA 5ACVA 1AHDP 2WTEA 5H6RA 5D5UB 4Z67A 1I1GA 3HOSA 2XUBA 1D0XA 1TWCJ 1D0ZA 1APLC 3EYIA 4PK4A 1QQIA 2HS5A 2F5DA 3GZ5A 3OYHA 4NQ2A 3MQ0A 3DCFA 2F6CA 5LSCA 3R60A 3O3KA 5FKLA 2VBZA 2ZBKA 4RGUA 1QU3A 3DEWA 1X8GA 4XORA 4JX4A 4ZYEA 3OIPA 4HDUA 4F92B 3L1PA 1WJ5A 2L9NA 4A93J 3IRQA 1S7AA 1Z9CA 4EYLA 2OCCH 3X2XA 4CCLA 3TBIA 3ZOBA 4CCOA 3RKKA 2DTRA 5E17F 3BG6A 2GFJA 3BLYA 3QOEA 2L54A 2BVLA 3SRXA 4YIFA 3KZIC 2RAEA 2YR2A 2MH2A 4FE4A 4HG2A 5IOYA 2KP6A 3LA2A 4EM2A 1G59A 1Y8RB 3VOEA 2NS0A 3HKZA 1XD7A 4XRSA 3F72A 2MGQA 4L5JA 3U1KA 2DMPA 5M5XJ 2M9HA 4HLXA 1FOXA 3O8GA 2VL8A 1I27A 2ZJPF 3ZPLA 2WAQA 2Y0SA 1VFCA 1KQ9A 4V2GA 2OHHA 2LBFA 3V7RA 2BEOA 1B9MA 2DFIA 5LRSA 4A0ZA 3J7AO 2YNTA 2VLAA 1O7FA 2EZKA 3KX2A 3HL2A 2KRCA 2QA4I 3IH4A 1HLKA 3BWGA 2QCOA 3M8FA 2JPBA 2VJIA 1RKTA 1O3QA 1R49A 5LFAA 3M9AA 2LP0A 3OR2C 4K2EA 2QWWA 3HG9A 5FKOA 3PQJA 1SD4A 4RDUA 2PFBA 1W7PA 2Z2SB 5EWAA 1B9NA 4PSWA 3FCZA 3S14J 5ACSA 1J9IA 3X30A 2L7KA 3CJQB 1XGMA 4HSTA 2EB7A 3S1MJ 3GCMA 2DMTA 1MW7A 2QDTA 2ADUA 1IN5A 4ZYGA 1Z77A 1U3EM 1QZYA 3DEUA 2NNYA 1SEUA 1LFUP 4G12A 3OYEA 1VQOI 4M6XA 1MMDA 4D7NA 4OOIA 4Y13A 3CCRI 2X51A 3V8LA 4I0BA 1FIAA 1IV8A 2A5YB 2ECBA 3CUOA 1BW6A 1BIAA 2STTA 5LEKA 2VKDA 1ODDA 2V7FA 1P4WA 4DYCA 3LSIA 5HLGA 1PUFB 1DP7P 4B8XA 5JVGF 5FKNA 4LG3A 1R71A 2P6SA 4NC7A 1UZCA 4FE7A 3E1SA 3A01A 3WODF 1JJ6C 1USSA 2NS7A 3FMQA 1Q1VA 1TWFJ 3H5RA 1ACIA 3EUHC 3FK7A 5ACWA 3WTYC 4GGGA 2HYGD 2FSWA 3L2QA 1BOBA 3RCOA 3HRTA 5B1AH 2E34A 2IS2A 2DOAA 1DU6A 1MNEA 1I3QJ 2L2OA 3LSJA 3JRHA 1YRNB 2L5QA 4A3IJ 1VTNC 1SVLA 2CQXA 2Q42A 4ENKA 3OSGA 4NUBA 4Z6XA 1PYVA 2BGCA 5ICGA 3PY6A 2D1HA 3IHUA 2PJRB 1KQ8A 1ON1A 4D1WA 1ZYRF 1IW7F 3OR1C 3MZ8A 2XGEA 5FLMJ 3AKZA 2R7TA 2FBIA 4L9JA 2UYXA 3CF2A 2JT1A 2HQ5A 2R7VA 1OMIA 1YE9A 4EVIA 2M5DA 4L5EA 3K6GA 1RUOA 2W85A 3JAMZ 2HNHA 2WYMC 2WB1N 5LEJA 2VOPA 3RPUA 1TQMA 1IUYA 3S32A 3D5RC 2A3SA 3I4MJ 3R0AA 4DILA 5CVUA 1BC7C 4NB5A 2Y9ZA 4PJLA 3PSFA 1NTCA 2WY7Q 1Z91A 4JX5A 2O7OA 3RQ4A 5FRNA 1IF1A 5H6QA 3L2UA 4UVBA 2L9RA 2XF7A 4LG0A 1GXPA 1P2FA 2EA2A 1MJAA 5GAEJ 4LB6B 5KHDA 3F23A 3ULQB 4RB2C 4CSWA 4A5NA 2M2EA 2RV8A 4Q5SF 2DMNA 2LKPA 4LIVA 3GYHX 4OIRF 5ACXA 5AONA 5LBQA 4F6HA 3QYFA 1TBXA 3BY6A 3EDPA 3F9KA 5LCFA 2E5NA 5KAFC 1IDZA 3KEOA 2E2IJ 4ZZDA 5DUIA 1T56A 1XTAA 1I6HJ 1IRXA 3COAC 3CCSI 5KVRA 1BA5A 1K6OA 2JA8J 2BC2A 2BE5F 3IL2A 4IHVA 1SD6A 1EH8A 3ISPA 3WU2C 5DM7F 4E7LA 2QDSA 2ELHA 2Y0MA 4UB8C 5FQAA 4M72A 2WB1A 1U0JA 2CMPA 2DA4A 2GWRA 1ZG5A 3J80Z 5D8LB 3ZR9A 2ACJA 2DA3A 1YTYA 2AIOA 3HTSB 1K78B 5M5YJ 4A3GJ 5CVIA 2COMA 3BCBA 1JTXA 4EY2A 3IKVA 3KYCB 1JKPC 1OCRH 4OMYA 3LFUA 1EV7A 3KP4A 2IA2A 2GIZA 1MBGA 2ELKA 2DFHA 2NAZA 1K6YA 3FWEA 4HAMA 2K9LA 3M8EA 2Y48A 1R1TA 3RTRA 3K1MA 4O3MA 3JRBA 3KNSA 3GZNB 2YUSA 2W25A 2J5OA 5J1YA 2E1NA 3WE3A 3J7AY 4F55A 5IT9K 1ZG3A 3J7YJ 4LFUA 3GFJA 2Y31A 3P9IA 5D6FA 2CBNA 2ZMEB 3T8TA 3ABMH 4E7SA 1UJ8A 1U8RA 4L9NA 1KU3A 5FB2A 4NHJA 4HF1A 1A35A 2ZJQF 3LA3A 2ZJRF 3B73A 2XKOA 2QKMB 2H94A 3MKYB 2HQAA 4BHBA 2TCTA 1RI7A 2OTJI 1ZQ3P 2FMYA 2Y9YA 2X6OA 2PN6A 4YFKF 2E19A 1JJTA 4TZBA 1UAAA 2EFQA 5K7HA 2RN7A 3GFIA 3G6EI 1R9TJ 4IHXA 5FGMA 4EXSA 5FKMA 3IELA 4A69C 4BQNA 2JZYA 5BPIA 2K3FA 3BR6A 4NDLA 5D4RA 4D5FA 5EH9A 2IBDA 2OJED 5EYRA 4RM3A 4ZO2A 4BGDA 2JA2A 1MBEA 5J8FA 4XQFA 2PI0A 1WRJA 2BHZA 2L4MA 1F36A 1MMNA 1S29A 4N4OB 5IY5H 2VW8A 3GFMA 1K61A 1FJLA 2FUG2 4IQJA 2YNVA 3I9V2 3UR3C 4DOZA 2PJRA 2W00A 5L3FA 2M0CA 2CQKA 3HXLA 2P81A 3ESWB 2V6EA 4LE6A 4AIHA 2RKHA 4CO8A 4I6ZA 3GTOJ 3IOFA 4CYDA 5B3SH 1X2MA 4YFXF 4A3FJ 2AQEA 1S3JA 5E18F 5FLXK 4ENJA 4QTRA 4LB5A 4AXHA 1DDKA 3SHFA 3CC7I 3Q9SA 3I64A 4XKCA 2DKFA 3ESHA 3T1BA 4CHLA 4XONA 3EPZA 5BOXA 2CG4A 3A0BC 3NQOA 4A3DJ 5LRRA 5DCFA 3KIOA 3F8CA 1VQ7I 4RM2A 3ZGKA 2EZLA 3IV5A 1QHHD 3GTGJ 5J1UA 2R7XA 5E3MA 1YJWI 3MFKA 1DP3A 1PVEA 5HH5A 5LS3A 1YS6A 4PCQA 5D5WB 2F5CA 2LYCA 1OJLA 1WJAA 3DP7A 3F6VA 3F8MA 4PGHA 2R2DA 2P4WA 4BDZA 1NHAA 2F5FA 5H2FC 2BTNA 3OIOA 3WTWC 4L0YB 2CG2A 3LOCA 5K4KA 2M45A 5ED4A 4W97A 3RYRA 4LOCA 1ZARA 2EFOA 4ESFA 3IWFA 3JRGA 3VWBA 4PJ0C 3CUQC 3BTIA 4PJNA 5HDGA 2FU4A 2X0LA 3KEQA 1Y1WJ 2NRAC 2R92J 4E7ZA 1P4XA 3Q9VA 3ZRGA 3F0CA 1IGNA 2LFBA 5F0CA 2JVGA 4XLNF 4LK0F 4CCMA 3LSMA 2FBHA 3VYTB 2CRGA 4HV5A 2VUMJ 3S2HJ 2ZWRA 3LSGA 3QQAA 3CJRB 5IP9J 1K78A 2O8KA 1P6RA 1WCMJ 1R58A 2BG8B 1MDMA 3E3VA 3AG2H 4BEHB 3ZMSA 3LL7A 3ABTA 2KLOA 2X6WA 1CGPA 4KISA 1AA7A 3GTLJ 5HH4A 4OAZA 4II2A 1AKHB 1YYVA 4D9JA 4KITB 3GMEA 4PVOA 4KMFA 3TP0A 2QEXI 4KYWA 3PSIA 4TZEA 2BFLA 1J7KA 4RAYA 2H09A 5EZGA 2UWMA 1X1DA 3IEKA 3J81Z 5HLTA 2Y69H 4BJ5C 2RNGA 3TMOA 3OL3A 3C2GA 2ZMEA 2VN2A 3BZCA 2P5LC 3A0HC 3IAM2 3KE2A 2EIKH 3CCMI 2QSFX 4XUKA 2FX0A 4EM0B 4A0YA 4OIPF 1MKMA 2BG7A 2CFUA 5CKTA 4NQ4A 2FK6A 1LE8A 1O3RA 2LK2A 1LNWA 2P7VB 2HPMA 2EA4A 1LUJB 1FIPA 1T98A 2LF8A 1TNSA 4FHTA 3ZR8X 4HBLA 2E5ZA 2FNAA 2M4GA 2LF7A 1YHQI 4XL9A 4G6TB 4AIKA 3S15J 2QENA 3I59B 1G3YA 3R0JA 2XRNA 2FU7A 3DFGA 4YEJA 5ILSA 1T2KA 1GV5A 1VQ5I 1X1AA 3S16J 3JXPA 4HPQA 5EHTA 3MKWB 2HR3A 2QJSA 3S1RJ 4M6YA 1MSFC 2DT5A 4XLCA 5JHFA 4UA4A 2HVQA 1J0RA 5DPXA 2KJCA 2CFZA 1MBFA 4M71A 5FD5A 2ME6A 4IRGA 4BXXJ 2F5EA 4D0PA 1KO3A 1ZKPA 4HW0A 4NQ6A 4ZEJA 2XF6A 4TZ9A 2L02A 4BZ3A 5FKKA 2EFWA 4CICA 4D1UA 4UXNA 5FQBA 1Z6TA 5DD8A 4ON0A 3SEQA 3OYJA 2QQAA 1OISA 4X6AJ 2HQRA 4Y7NJ 2F4MB 5KNLA 2D1VA 2OBPA 1P92A 4EJUA 1JGGA 5LGNA 3JW4A 3ML6A 4X0GA 3BOQA 1X58A 3W2VA 1K4TA 4UWPB 3QYEA 3QWLA 4CH7A 4F93B 3TO9A 4UHTA 4M6VA 5K0WA 2JA6J 4ZYDA 1R6RA 2VONA 2VOOA 4EYBA 4MTDA 3OYBA 2I8DA 3TP3A 4UV9A 1WQ2A 5A23A 3PNTA 1R00A 2K40A 3NWTA 3DTIA 1IN8A 1ZTRA 1TQIA 2JTVA 1HW2A 5JR3A 4FX0A 1ZR4A 1UHWA 1IDYA 5A2QZ 2GCUA 4BBSJ 1A36A 3QPHA 3LSPA 4IRHA 2EQRA 5DS9A 5F1RA 1JJEA 1XCBA 3K10A 3WHBA 2EH3A 4BQAA 4KEQA 2F48A 4XK4A 1U5TC 5HOOA 4XICA 3TOBA 4FX4A 5LCAA 1P9QC 2XGCA 4BJTA 4Q48A 1IZ1A 2B0LA 5J6XA 1ZR2A 1Z7LA 3FBNB 3HOWJ 3CUQB 2WAFA 3OOUA 3PNVA 4HA8A 3OS2A 2D45A 3KNRA 1XX5A 3L2WA 1FT9A 2DQLA 3S93A 2K9SA 5CPRB 4EM1A 1L3LA 3ZQHA 2A6TA 3O6BB 1L9YA 2PMZN 4BJ6C 3E0JB 2X6XA 1TP4A 3F9OA 1XMAA 3WGGA 4ZJZA 1VQ4I 3EUAA 2BG8A 2O8XA 5FLVA 2OHIA 2RNJA 3DQVC 3G1PA 1KU9A 4IJAA 5HISA 3K4JA 1AKHA 2EZIA 4GCVA 3DU5A 2XB5A 1LDJA 4EMSA 2R7RA 5EW0A 3A4CA 3HZJA 1XS9A 4RBOA 5HODA 2HVSA 4Q47A 4DYQA 5HS8A 3CCUI 2XASA 2EIJH 3JR9A 1J09A 1FBQA 2MABA 3HJEA 3V7SA 4A2UA 4A3CJ 4UBQA 1D3YA 3A03A 4CXFA 3DLLF 1MMSA 4HSRA 1BJAA 5LM6A 4ZTJA 1PP7U 3HIFA 5K5RA 3MKLA 1OCZH 4IO9F 2NYPA 5HIOA 2ZFWA 3KLNA 2HXIA 5D4SA 4UUVA 4XWWA 5KIKA 1FOWA 1HKTA 3DTEA 2LD5A 2EBIA 1SD5A 4ZNBA 1MBJA 2E7XA 1W0TA 4IZZA 3HEFA 4XNFA 1A5JA 2EJRA 3HPGA 3VSKA 4B3AA 3BG9A 2PMZA 2H6AA 2Q2EB 1SVOA 2GOXB 3AFHA 4FTHA 2KIUA 4G7ZF 1UFMA 3V8JA 1D8KA 1HBXG 5AIQA 5FO5A 3CMEI 1TNTA 4IPAA 2YZ3A 2GZWA 1JT0A 4RB3C 1EKEA 4QSHA 3QU3A 4E6KG 1BVTA 3FAIA 1GXQA 1VQKI 3ECHA 4Y17A 3ZQQA 5ICEA 5DM6F 4XRSG 4ETSA 4YELA 5HNHA 2PBIA 2LH9A 1ULYA 4IOAF 1OYIA 3HOXJ 2M3AA 4C09A 1TQPA 3FHNA 1R5HA 3L2VA 1MBHA 1UCRA 2W48A 1ONVA 3RQIA 1WH7A 3BTCA 3X2YA 4XLEA 1P7IA 2NVTJ 4P9FA 5EGOB 3HYIA 3VDXA 3PJRA 3H5AA 3DEEA 4Z6YA 3CO6C 1BOAA 1IC8A 4FEKA 2H8RA 1BM9A 4XKWA 4E7JA 1S7OA 1S7EA 2FBKA 1JJ8C 1A7TA 1T8IA 2HB9A 4D1VA 2FU6A 2ZJ2A 3K4CA 3S8PA 3ZQCA 2DA5A 1RC9A 3ADRA 4E7KA 3KP3A 2CUZA 3T3OA 4PDXA 3HM5A 3M7GA 2XGXA 1DU0A 4WXCA 3RI4A 2M0MA 1RPWA 3WG9A 1U5TB 3G4SI 1YX3A 2CYYA 3U9GA 1E3OC 4PVTA 2AQFA 3CMAI 3RIRA 4MHGA 3HGGA 1E3PA 3DTKA 2CS3A 1VQLI 3G1MA 2CH0A 4L18B 1HKQA 5K5OA 3SFIA 1ETVA 1I3AA 1WFXA 4NQWB 4HNUA 1RR8C 2JMWA 1QO0D 4G9YA 2I5UA 3I4PA 1ZELA 4HL1A 3H0GJ 1SFKA 2XF4A 4OU0A 3K70D 2ZXJA 5J3LA 1IUFA 3DWLE 3JTGA 3LSRA 1U2WA 4O5VA 1JHFA 1V4RA 1FWZA 1V5GA 2X48A 4IHWA 2WRSA 5FJ8J 3ZMZA 5HIQA 5IOZA 3IE1A 2XAQA 5ILVA 2JWTA 3A02A 4G7HF 3SDGA 1EJ9A 2KDOA 2CV1A 2DJIA 1Z3YA 2GA1A 4BNCA 2V1NA 1JKRC 3GXOA 2MBFA 1KO2A 2K27A 2R7WA 2FHXA 1X3WB 2NXAA 5EVDA 1T0FC 2EWNA 2CUJA 3HSEA 4G8XA 4B4CA 1B4AA 5HLHA 2BFZB 1JHHA 2VPLA 1KU2A 3BK1A 3WU0A 5ACRA 2XAFA 1GVJA 1WHUA 1DD6A 1FZPB 1DQUA 3FKIJ 1YO5C 5F6FA 2DBBA 3GFLA 3MAJA 5EEGA 1N77A 5A87A 1R5GA 1QRYA 3FBIB 1IXRC 1XC5A 2KZVA 2BR6A 2OA4A 2XKPA 4IQ4A 1ITYA 5CYVA 2JQ7A 3ZWFA 3K4KA 3VODA 2GMNA 2DT7B 2LG4A 3ABUA 4I98B 4IX7A 3CDHA 2I7TA 1Y56A 2H1KA 3I3LA 5TJJA 1OR7C 1DPRA 3TO7A 3H3EA 2KHMA 4P55A 4G6QA 1YX5A 2P8TA 3J7ZI 2FOWA 2BY1A 3I5UA 4Z5YA 2M1BA 3FXMA 3KLOA 1BN5A 1SAUA 2DAOA 3CMMA 2M8GX 1B1BA 4DZJA 2G7UA 2FXAA 2BVMA 3OMYA 3N05A 5IT3A 2Y2ZA 1F4KA 1Z6RA 3TOAA 2Z16A 3Q0WA 3PG4A 4IOCF 2P18A 2KIFA 3D0SA 3DKWA 4F52A 2Y8AA 3I14A 2R5ZA 2HGCA 5GAHJ 4IXAA 1ZKGA 3ZQIA 1O3SA 3FZVA 1J75A 3CZ6A 2O9LA 2OHJA 2IA1A 1FY7A 1FOYA 3I4NJ 4FT8A 2VJ4A 3BG5A 2ESNA 3AL0C 2X9DA 4YFNF 5C4XJ 4A3JJ 1LDKB 2OPTA 3LNQA 2ZKZA 1RR7A 1ZG1A 1SC7A 4DIKA 4C3JJ 1ZH5A 4MTEA 1X19A 1WZ2A 2VXZA 2QQ8A 3ZQLA 2K4BA 3HC7A 4LIUA 1GUUA 4XLFA 1E2XA 4AIDA 5AJLA 3MZHA 4A5MA 4WX9A 2ZC2A 3CDLA 4IVNA 1IO2A 3ZQ7A 1FYLA 5KILA 1X1CA 4AM3A 2QKLB 1BI0A 3K4LA 3REOA 3KP2A 1FTZA 5LE1A 4F6ZA 2HI3A 3FISA 3IAS2 4I09A 1JXSA 2CQQA 5L3GA 1YI2I 1QBJA 2DN0A 5K5QA 2NXNB 2K86A 3AJ3A 2R7ZJ 2BV6A 2DK8A 3IRRA 1MH4A 2Z9OA 3LQRA 2L7MP 3WU1B 5HIPA 3SEZA 1ENHA 1VI0A 3CP2A 3I56I 2OF7A 1FYKA 4RB0A 3DBLB 1I5ZA 4ZC3A 2O5RA 3HTUA 2CW7A 3DLAA 1DDNA 3GBGA 3W3CA 1ZLKA 4LK1F 3SPUA 3P2UA 1X3UA 2XSDC 3WTXC 1ORKA 2ICWG 3HHHA 5F0FA 2ISYA 3H3ZA 1IRFA 1VQ9I 2BY3A 4HZFA 2NS8A 1YW8A 1LEBA 3IC7A 2NZEA 4FETA 2BXZA 4RAFA 2HFHA 3U1DA 2E2JJ 1G4DA 2FE3A 1QPMA 1JGSA 1YJ9I 4FQGA 1VQ8I 1IN4A 4DGWB 1F9NA 2HYFA 3WXCA 3ERMA 1RESA 1IRZA 3PY5A 3OYDA 1WW1A 2FQ4A 3HRSA 4AWXB 3F21A 3SQNA 3G2BA 2YHEA 1Y0NA 1TTYA 2EINH 1YJNI 3CMYA 1T33A 4C1HA 2MSYA 4MEXF 5LCHA 3GF2A 2HKXA 2ZO4A 3BR0A 1JT6A 2JUGA 2A6HF 4HX4A 2KDZA 3QODA 3ZMUA 1JUMA 3MD7A 3SBLA 1WJEA 2WC2A 4ESJA 3TQNA 3RYPA 4G7OF 4CGZA 1WGXA 2A5WA 1V55H 3Q5FA 2CO5A 1VQ6I 2RQQA 5TGTA 4E70A 4UVAA 3OYIA 5E20A 3CTAA 5ICCA 1VQMI 2P0WA 1U8BA 2UXNA 4XKVA 1UG2A 2BXYA 1T08B 2TDXA 1PUFA 5M5WJ 1V3FA 2EFPA 1IRGA 1IAWA 3FK6A 2CUFA 3AAFA 2JA5J 4DJAA 3PFYA 2AXLA 2VQHA 4C9YA 5BPDA 2QINA 1AU7A 2JRMA 2PJPA 1R4NB 3JRDA 4GYQA 3TKYA 2HKOA 4KIFA 3I55I 3QPLA 4KJZA 1ZGJA 3RKQA 1HLVA 1ZN2A 3E6DA 2XB0X 1HXDA 2IJLA 2VQLA 2BHYA 4QPQA 2JN6A 4Y52J 5K7FA 2XC7A 2EV5A 1D1AA 1Z0XA 4ENMA 2P5VA 4D7MA 2I10A 3I13A 2ZSIB 2EV6A 5EEHA 3M4OJ 5BMZA 3R2UA 3DBHB 2HWVA 1W4MA 1AOYA 1R1UA 3PUFA 1UELB 1XSDA 3F8FA 3O8HA 1YRNA 1TLHB 3AL0B 4FR7A 4GCWA 2HVRA 5JLWA 3HHGA 1HKSA 2PG4A 1HDDC 2BG6A 5DUKA 2XAJA 2Y75A 5E3NA 2Y8BA 2DMUA 3OYNA 4RMNA 5AXRA 2VT2A 4A3MJ 2WYLA 4A6DA 4E4HA 1EF4A 2QSHX 3L00A 3CC4I 1I6XA 3ONQA 4BBRJ 2LY9A 3E97A 5EEAA 1C0WA 4L9VA 4FSBA 4OMZA 1F43A 3BCAA 2CV2A 4GO1A 2A69F 3SFZA 4M3DA 3VEPA 4BUPA 4UUSB 4A3BJ 2WBMA 3L2RA 2DYRH 2K5CA 4IRIA 3O2PE 2GM4A 4B43A 1K83J 2KRFA 2FRHA 4UWRB 4P9UA 2KIMA 4RB1A 2DFFA 1E5DA 1TWHJ 3Q0VA 5IYBJ 4EQQA 2V1UA 3LAJA 2XGDA 3W6VA 1XCVA 1ZK8A 4IHYA 3H0DA 3I0VA 1Y1VJ 2FA5A 2XAUA 2CU7A 4ANJA 1FMWA 4E7HA 1SMTA 1IN7A 2B63J 4J01A 5ILUA 2VBWA 4L9TA 1BBYA 3ZQ4A 4DW6A 5EG0B 1OKRA 3GLLA 1O57A 4TV7A 2PMHA 4N4NB 1B6AA 2AO9A 3KP7A 5DCMB 4Y4RA 3SDBA 2VJJA 4MFDA 3SYTA 1FX7A 1ZGWA 1RIOH 2WV0A 2DXIA 2A6EF 3ELKA 2M30A 2K85A 2NOJB 5GP9A 2QUFA 2RDPA 3OYLA 3TGNA 4PFPA 2E60A 3I15A 1K4SA 3DF8A 2WV1A 4XLAA 1G3SA 4RM5A 1RKWA 3CCJI 1YFHA 4DZPA 4XOPA 4HNVA 3PNYA 2KZGA 3JRAA 1YW9A 3BC8A 2X1EA 1X3ZB 4U87A 3LAPA 4B87A 3DPUA 3BPXA 4RAMA 4EATA 2OD5A 2BW3B 5DTDA 5LLQA 2M4KA 4ZYHA 1S72I 2Q0JA 2BYVE 1MSEC 3RZOJ 1BI2A 3BR2A 2GKLA 4GDFA 4XBFA 1SD7A 5M3MJ 3OYGA 1XTOA 1HDPA 4BH9A 5AYAA 1M1EB 1OLTA 1B72B 2Q0IA 2IP2A 5B15A 3G1OA 1Z05A 2IPQX 5CJ9A 5J1RA 5CQEA 1IV6A 5LHHA 4LLLA 2IS6A 2E71A 3IUOA 3D5SC 2DA6A 2YX4A 2CW0F 3K1NA 2Z99A 2VPRA 4ZO3A 2XR1A 3TP9A 2P4ZA 3U2RA 4U7BA 2DODA 5ACUA 1S8NA 1LVKA 3WHCA 3IOGA 3NAUA 1X1BA 3BPVA 4Z60A 4Q4ZF 1QZEA 2A05A 2FJ1A 2P97A 1B8IB 2W7NA 1YITI 2IGNA 1FOKA 3OS1A 3OY9A 2CUEA 4P96A 2CGPA 3E5XA 4GYUA 5LLDA 5A0VA 1SFEA 3W2WA 1XSXA 2MA3A 5F64A 3HOZJ 2KRHA 1H8AC 1FSHA 1LFBA 3K4BA 5K7ZA 1F1ZA 3EUHA 4U0VA 2FU9A 2BIBA 3MZYA 4YSBA 3FXRA 4DBRA 2L01A 4N9HA 2V6CA 3I58A 3F3XA 3GW2A 4WXDA 3JSPA 5EV8A 3WTSC 4HX8A 2V9KA 4MO7A 5HH6A 3GO5A 3TW7A 2HDDA 3VQZA 3T3NA 4AWYB 3P7NA 2Q1ZB 4J5HA 3B6CA 1XDSA 2LMDA 3CLQA 4UUTA 4PJJA 2OC6A 2YX7A 3VSLA 1EH7A 3R61A 4LITA 3LQQA 4UUSA 3V42A 4P5OA 1KZHA 3ZQFA 1GT0C 2K9NA 4R1HA 3ERED 4HYEA 2H27A 1ZRCA 2HEOA 4BU2A 1W7PD 2F2EA 2WYMA 5IT9Z 1FEXA 3QRFF 5HS9A 3B6AA 1SMYF 2BY0A 2IA0A 4DNCA 5AIPA 4U88A 2V26A 5JVTA 2HOAA 1SFUA 1ZREA 2ZNBA 3TL4X 3OS0A 3CD6I 3OYKA 3C2BA 4BAYA 5LGTA 3KCCA 4HRIA 2MG4A 2KQRA 3W6JB 1CF7B 4ZDLA 1TW3A 3S2WA 1TC3C 3PM1A 5CVRA 3HOVJ 3ZMVA 2ZXHA 1N78A 5EG0A 4AVZA 2MC4A 2O0YA 4II3A 1V5EA 2X6YA 4OWRB 2A7MA 1ON2A 2HZTA 2CFXA 5F0HA 3TW6A 4RL2A 3H3UA 5EZHA 5F08A 1SFXA 2PMUA 3G3ZA 3K1PA 2QBYB 2F4IA 1YCGA 3H9JA 3BG3A 3ASNH 3MWMA 4RA2A 4XLHA 1MD0A 1TT5B 3K69A 3K4MA 4PSXA 1QGPA 4R8HA 3IE0A 2V9PA 4UWOB 4HL2A 2HXOA 3MMYB 4BHPA 3JRIA 3HUGB 3GTKJ 3PUBA 5H20A 2VKHA 1MZBA 4MQVA 5HNFA 2RC4A 4UVCA 2QGUA 4AV7A 2IT0A 1KR3A 3P9CA 1KYWA 4FASD 2ZNZA 2UXXA 3BDDA 5CLSA 2MD0A 5EDNA 3MEXA 4AC0A 4XRMA 2ZSHB 5FLXZ 5FQCA 2BW3A 4ZH4F 2FF4A 2GQQA 1REPC 2I7VA 4BEHA 4J00A 4C2UA 3C1DA 3LMMA 2W1OA 2X1CA 2F5VA 2X85A 1X1PA 3E7LA 5ACQA 1KONA 2E1MC 3U21A 4RS8A 5DDGA 1F5TA 4CHUA 3V7CA 4AU7A 3DKYA 2EV0A 1W36C 3L7WA 5J40A 4BS9A 4HDVA 1FC3A 2NYXA 3RZDJ 2M5CA 2LKSA 2QM3A 2AS5F 1XPXA 3RPUD 2NVQJ 3ZN0A 1YIOA 4NQ5A 3MD2A 4QIWN 2E1OA 2BBYA 3PFIA 2HU9A 4MIMA 4O6JA 1KYZA 3K7AJ 1U78A 2E1CA 2MH9A 4KUMA 4AUXA 3H1CA 1W36D 4A6EA 2R5YB 2IAIA 3I59A 5HLIA 1H88C 2K7LA 2LNBA 2P7CB 2IS4A 3C2HA 3KL7A 1VF9A 5EF6A 1I1SA 1W5SA 3HGYA 4JX6A 4UB6C 4XRFA 1JKOC 2LBFB 5JHUA 2ZB9A 3CC2I 2VXDA 2OUMA 4KICA 4XR6A 4P1WA 1N25A 4MGRA 1XGSA 2CW8A 3CESA 3QPTA 4HOBA 4Y33A 2OQRA 4BY7J 1TWAJ 4AX0B 1LFPA 3UNGC 4EFZA 4RGXA 4FISA 1W7PB 2JJ7A 1JTYA 3HDDA 3JTHA 4RBSA 4IF4A 4I76A 2DA7A 2LDUA 3BR3A 1ZHFA 3D5LA 4YG2F 4HNTA 1OCPA 4WD6A 1Z3XA 5FRMA 2W4SA 4U0WA 3JAMK 1STZA 3FM5A 1MH3A 3BROA 3L2CA 1LEAA 4M74A 2LSOA 5CQGA 4IHTA 3L6NA 3M8JA 4HQEA 4J19A 2ZZIA 2XRLA 1ZTCA 1I50J 3FKJA 5ERIA 4KIGA 4MQ9F 1IG7A 1JI8A 2CQNA 1G3WA 1TT0A 1YG2A 2J5PA 2DQRA 1P7JA 3GTJJ 1P9EA 3T9MA 3T8RA 1MIJA 1XN7A 4AYBN 1TL8A 1ETWA 2XAHA 1O4XA 2C6YA 4F91B 2Z3YA 4KEPA 1UG0A 4EJTA 4PJMA 5J8CA 5C3EJ 2WY8Q 2DDBA 3F8NA 4V2FA 4PDKA 3RPQA 3CCLI 2G7HA 3A01B 3LFKA 4M3BA 5GTHC 3R4KA 2UZKA 1ZRDA 1X4PA 3P5JA 2ESHA 2M87A 2MD5A 3KZZA 2QBYA 2GXAA 2M8EA 3OWTA 5L3CA 4KDPA 1DPUA 3I11A 1QVTA 4C1FA 1S5LC 4CCNA 4F3QA 2RGVA 3CUQA 3BV6A 2MFZA 3K70C 3HUGA 3T0YA 4Z5ZA 4MLOA 4H4KC 1DGWY 1WUPA 2L4AA 5E1WA 4EV0A 4LGWA 1NH3A 2KKOA 3H3VK 4N0BA 4I2OA 3HOYJ 4M9XA 1FPQA 2CV0A 4A3KJ 3EYYA 2E36A 5E3LA 4P62A 3J80K 2H1LA 4QLCU 2LY1A 4WK8F 2CQ7A 1BC8C 3GUDA 2AXTC 1S9HA 1BI3A 3H9GA 1R7JA 1A8TA 1LKXA 3BK2A 1BI1A 4UWSB 2P6TA 1KGSA 2AZ4A 2EPFA 3MN2A 3X2QH 1RRJA 4AYBA 3MVPA 1GVDA 4B3XA 2E1MB 2VKVA 4M9SA 4IEJA 3KP5A 4S04A 3RKWA 5F1JA 4A12A 1UHSA 5B1UA 3SXYA 3DPTA 1R1VA 4LG0B 2DOEA 2XSJC 3GVAA 4QWQA 4PFOA 2DA2A 5L3DA 2VC0A 2VE9A 2E7WA 1XGOA 2LLKA 2V1XA 2R5YA 3K0LA 3S1QJ 4BE0A 4JQFA 1POGA 3HOUJ 2UV1A 3SFPA 1OYWA 5E79C 4HX7A 3JRCA 3W6KB 4G6DA
chains in the Genus database with same CATH topology
2Q2EA 3VB2A 1OPCA 3IE2A 3RKYA 1K07A 5K1YA 4LD5A 1HSTA 5JFRA 1B59A 3LVZA 3WGHA 4OIQF 2O3FA 2X4HA 1RZ4A 4EYFA 2PLYA 1D8JA 4RGSA 1FP2A 3N4MA 3KETA 1RNLA 4I02A 1IN6A 1MQOA 3E6BA 4DQ2A 5KK1A 1ZNBA 4EGYA 2BFKA 1R36A 2IRFG 1E17A 5FFXA 1WKMA 1FBSA 1HW5A 1MGTA 5AHOA 1OYYA 5A5ZA 5EVKA 1RUNA 3T5XA 3R6SA 1HSJA 2V9VA 1LB2A 2E7YA 2P1EA 4YSKA 2YU3A 3FXUA 1VMEA 3NEUA 4XSZF 1FNNA 1TW2A 5E1XA 4C1EA 1QH5A 3ZMDA 2DK5A 1U5TA 2QVOA 3F22A 5ACPA 1P4AA 4EJWA 3BC2A 4I7HA 5B3RA 4NQWA 3ZNBA 2YNVB 2OZUA 5BQTA 3M1EA 3H92A 4EXYA 2VBXA 2HQNA 1SAXA 1FBUA 4LMYA 5A0TA 2NNNA 1QNTA 1YCFA 3QH8A 2WWYA 1H9GA 3BP8A 2VC1A 2V1DA 2ISZA 3RKXA 3J81K 3BJOA 2IW5A 2MLKA 3PQKA 1XDUA 4S05A 3SW3A 5CVVA 2BFZA 3JSOA 3C18A 3DPLC 1O7LA 5E8GA 4WF2A 2FOKA 1J2XA 1M2XA 2JRTA 2L3DA 1J59A 2M5WA 2Y87A 4XLPF 3C7JA 1YW7A 2IVMA 2NZFA 5HDKA 2MC3A 3TO6A 2FQ3A 2OU2A 4CZZA 3RDIA 3DHBA 1BIBA 4TYFA 5LMCA 3VFZA 4H0EA 3N97A 2RQPA 3AF6A 3IWZA 2JPCA 4JO0A 1YS7A 3RKJA 2XHKA 1MDMB 3FMSA 1Y44A 2DPDA 2ETHA 4KFCA 5E1ZB 4V0HA 1JE8A 4LJZF 2GFKA 2CSOA 1Y0UA 5ACTA 3WE2A 1XGNA 2XAGA 1T39A 1S6LA 4JBAA 4RAZA 2ZNYA 4HQMA 3KFWX 4TYTA 4AWZA 4C1GA 1HW1A 2DLLA 4LLGF 4PZJA 3F8BA 4G94A 2FEZA 2OZ6A 2RVCA 4OINF 3DHAA 4YSLA 4C1CA 1T6SA 5A2QK 4JK1X 1BC2A 1D5VA 2VT3A 1AWCA 4GYGA 3BJ6A 5D8KB 1LQ1A 3I53A 2DOOA 2GXBA 2YCBA 3TDUC 3GLXA 3SZPA 4ENNA 2DI3A 3FF5A 3P9KA 1DUXC 2CWEA 1VGNA 5DYMA 1LJ9A 3B02A 3I54A 1G3TA 2QQ9A 2R3SA 2WHGA 1LDDA 1FSEA 4WXHA 4AD9A 1PUEE 3WTZA 1EH6A 3VPEA 1Z1DA 3K9TA 5LHIA 1HQCA 4HV6A 4OIOF 3ZMTA 4RAWA 4PGGA 1FLIA 3EQLF 2FM6A 2FNPA 2D2WA 4KN4X 1X8IA 4KIBA 3HOTA 2BMIA 4F7ZA 2YNUA 1O3TA 4H0DA 4I01A 2VODA 5FFZA 1T0FA 1WUOA 2QYOA 2FMLA 2PEXA 1ZAOA 2DO7A 3ZP5A 2FU8A 1QZZA 1UHMA 2HTSA 5CVJA 5D6EA 4HF2A 3G73A 3DHCA 4J5FA 3C3WA 4LLNA 1VJNA 2Z5UA 4I0AA 1R22A 3LA7A 4BP0A 1OR7A 3S0ZA 3KP6A 4B09A 3L09A 2W84A 3Q6VA 3I71A 5D5XB 1YCHA 5EV6A 4AIJA 3DXJF 4O98A 3K2ZA 1WSUA 2HTJA 3HRMA 2H6BA 4KT5C 3AF5A 4ZZLA 3QU6A 4M9ZA 4EJVA 4ESBA 3WTTC 3A4YA 4DIKA 2P5KA 5DEQA 4Z2YA 1UB9A 5AHRA 3ECOA 4BHCA 2H6CA 1QH3A 3GEZA 4CDGA 1MJBA 3ROUA 3V8KA 1ZGAA 4BXUA 3QP5A 4BYYA 3E6MA 2EK5A 3SD9A 2OQGA 2XV4S 3QAHA 5EVBA 2A07F 2JSCA 1BMCA 1KA8A 3FM3A 2BGAA 4UV8A 2MLGA 3WTUC 4AX1B 2BG2A 1XMKA 3HRUA 4U7DA 3FHZA 5TRDA 2DU9A 3FX3A 2QQBA 2V79A 2YNWA 3GX4X 4ASNA 3OV8A 3WTVC 5K4MA 3IDZA 1W5TA 5ICFA 3WGIA 2XROA 4R79A 4Z7RA 4EJOA 4MEYF 5DCMA 4XWTA 3X2ZA 4D02A 2QEDA 3LSTA 3RJPA 3E5UA 1IXSB 4L5IA 2A61A 5DD4A 1PP8F 2O6GE 2R7FA 3F6OA 4UNOA 2W24A 1XM8A 4GXOA 5AXOA 4UAMA 3GWZA 1KU7A 3LWFA 2GXGA 2O61A 3CLOA 1L0OC 1WRAA 2Q9UA 2OAZA 1JT1A 4RL0A 2K4JA 2G9WA 1IXCA 1SMLA 1A04A 1R23A 2KJBA 4A0XA 2A68F 3OOPA 3SZTA 5E8IA 3CJNA 1T38A 2VE8A 3ZN1A 1PDNC 1U6GA 5HDNA 4U0YA 2EFNA 3V4GA 3QP6A 1LVAA 4WWCA 3CO7C 3E6CC 4Y15A 5JI6A 1G6NA 3EETA 1KQ0A 5DV5A 5LHGA 2O03A 3DV8A 4KA4A 1USTA 2DW4A 1YLFA 2DPUA 1XSVA 1GHCA 1DXKA 4AVPA 2HOEA 4EGZA 3BZ6A 1J5YA 4IHSA 4KMUX 5HVQC 4YIIA 3I0TA 1Z7UA 4RGRA 1ZRFA 3HSFA 2YNTB 1XB4A 4C1DA 4KNYA 2K02A 3MCZA 1MJ9A 2FHXB 3HSRA 2Z33A 3RPCA 4TZFA 3FXQA 4N9IA 2I7XA 2ZCWA 1H0MA 1YQAA 2YSRA 1K79A 4XSXF 1Q1HA 5L3EA 1WWXA 4KN7X 5D5VB 2Q8KA 1H9TA 1FYMA 1WI9A 1ZLJA 3BJAA 4HKYA 2PQ8A 3L9FA 2GIVA 2QZ8A 4GYIA 3QOPA 4HLYA 3FMRA 1CF7A 1K7AA 4U4LA 1X8HA 3KZYA 4M73A 3IKTA 2W57A 2STWA 5LGUA 2R7DA 5L3BA 5IQKA 2XIGA 5BS6A 2VBYA 2QLZA 2XVCA 5HS7A 3IEMA 4WCGA 5FD6A 3GZ6A 2YPRA 4D1TA 2HDCA 3E5QA 4MNUA 4HF0A 1FP1D 6PAXA 2GAUA 2Q0OA 5K4NA 3TDZC 3NRVA 3DH8A 2GA2A 4L0ZB 5AEBA 5ACVA 2WTEA 5H6RA 5D5UB 4Z67A 1I1GA 3HOSA 2XUBA 3EYIA 1QQIA 2HS5A 2F5DA 3GZ5A 4NQ2A 3MQ0A 5LSCA 3R60A 3O3KA 2VBZA 2ZBKA 4RGUA 1X8GA 4ZYEA 4HDUA 3IRQA 1S7AA 1Z9CA 4EYLA 3X2XA 3RKKA 2DTRA 5E17F 2GFJA 2L54A 3SRXA 4YIFA 2YR2A 2MH2A 3LA2A 4EM2A 3VOEA 2NS0A 1XD7A 3F72A 4L5JA 4HLXA 1I27A 3ZPLA 1KQ9A 2OHHA 3V7RA 2BEOA 1B9MA 2DFIA 5LRSA 4A0ZA 3J7AO 2YNTA 1O7FA 1HLKA 3BWGA 3M8FA 2JPBA 1O3QA 3M9AA 4K2EA 2QWWA 3PQJA 1SD4A 2PFBA 1W7PA 5EWAA 1B9NA 3FCZA 5ACSA 1J9IA 3X30A 1XGMA 2EB7A 2QDTA 2ADUA 1IN5A 4ZYGA 1U3EM 1QZYA 3DEUA 2NNYA 4M6XA 4OOIA 4Y13A 3V8LA 4I0BA 2A5YB 3CUOA 1BIAA 2STTA 5LEKA 1ODDA 1P4WA 1DP7P 5HLGA 4B8XA 2P6SA 3WODF 1USSA 3FMQA 5ACWA 3WTYC 4GGGA 2HYGD 2FSWA 3HRTA 1VTNC 2Q42A 4ENKA 4Z6XA 2BGCA 5ICGA 3PY6A 2D1HA 3IHUA 1KQ8A 4D1WA 1ON1A 1ZYRF 1IW7F 2UYXA 2FBIA 4L9JA 2JT1A 1OMIA 4EVIA 2M5DA 1RUOA 2W85A 3JAMZ 2WYMC 2VOPA 5LEJA 3RPUA 1TQMA 1IUYA 2A3SA 3R0AA 4DILA 5CVUA 1BC7C 4NB5A 1Z91A 1IF1A 5H6QA 4UVBA 4LG0A 1GXPA 1P2FA 2EA2A 1MJAA 4LB6B 3F23A 3ULQB 4RB2C 4A5NA 2RV8A 4Q5SF 2LKPA 3GYHX 4OIRF 5ACXA 5AONA 5LBQA 4F6HA 1TBXA 3BY6A 3EDPA 5LCFA 3KEOA 4ZZDA 5DUIA 3COAC 5KVRA 1K6OA 2BC2A 2BE5F 3IL2A 1SD6A 1EH8A 3ISPA 2QDSA 2ELHA 2Y0MA 5FQAA 4M72A 2GWRA 1ZG5A 3J80Z 5D8LB 3ZR9A 2ACJA 1YTYA 2AIOA 3HTSB 1K78B 5CVIA 2COMA 4EY2A 3IKVA 4OMYA 1EV7A 3KP4A 2IA2A 2NAZA 3FWEA 4HAMA 3M8EA 2Y48A 1R1TA 3RTRA 3K1MA 4O3MA 3KNSA 2W25A 2J5OA 2E1NA 3WE3A 5IT9K 1ZG3A 4LFUA 5D6FA 3GFJA 3P9IA 2CBNA 2ZMEB 3T8TA 1U8RA 4L9NA 1KU3A 5FB2A 4NHJA 4HF1A 3LA3A 3B73A 2XKOA 2H94A 4BHBA 1RI7A 2FMYA 2PN6A 4YFKF 1JJTA 4TZBA 2EFQA 3GFIA 2RN7A 4EXSA 5FGMA 3IELA 2JZYA 5BPIA 5D4RA 5EH9A 4ZO2A 5J8FA 2PI0A 1WRJA 2L4MA 1S29A 2VW8A 3GFMA 2YNVA 5L3FA 2CQKA 4LE6A 4AIHA 2RKHA 4CO8A 3IOFA 4CYDA 4YFXF 1S3JA 5E18F 5FLXK 4ENJA 4LB5A 1DDKA 3SHFA 3Q9SA 3I64A 2DKFA 3ESHA 3T1BA 4CHLA 5BOXA 2CG4A 3NQOA 5LRRA 5DCFA 3F8CA 3MFKA 5HH5A 5LS3A 1YS6A 4PCQA 5D5WB 2F5CA 4PGHA 3DP7A 3F6VA 3F8MA 2R2DA 2P4WA 2F5FA 1NHAA 2BTNA 3WTWC 4L0YB 5K4KA 2M45A 5ED4A 3RYRA 1ZARA 2EFOA 4ESFA 3IWFA 3CUQC 5HDGA 2FU4A 2X0LA 3KEQA 2NRAC 1P4XA 3Q9VA 4XLNF 4LK0F 2FBHA 4HV5A 2ZWRA 1K78A 1P6RA 1R58A 2BG8B 1MDMA 3E3VA 3ZMSA 3ABTA 5HH4A 1CGPA 1YYVA 4PVOA 4KMFA 4KYWA 4TZEA 2BFLA 1J7KA 4RAYA 2H09A 2UWMA 3IEKA 3J81Z 2ZMEA 2VN2A 2P5LC 3KE2A 4XUKA 4EM0B 4A0YA 4OIPF 1MKMA 2BG7A 4NQ4A 2FK6A 1O3RA 1LNWA 2P7VB 2EA4A 1T98A 2LF8A 1TNSA 4FHTA 4HBLA 2FNAA 2LF7A 4AIKA 2QENA 3I59B 1G3YA 3R0JA 2XRNA 2FU7A 3DFGA 5ILSA 1T2KA 3JXPA 5EHTA 2HR3A 2QJSA 4M6YA 2DT5A 4UA4A 1J0RA 5DPXA 2KJCA 4M71A 5FD5A 1KO3A 4IRGA 4NQ6A 2F5EA 4D0PA 1ZKPA 4ZEJA 4HW0A 4TZ9A 2L02A 4BZ3A 2EFWA 4CICA 4D1UA 4UXNA 5FQBA 1Z6TA 5DD8A 4ON0A 2QQAA 2HQRA 2D1VA 2OBPA 1P92A 4EJUA 5LGNA 3JW4A 3ML6A 3BOQA 4UWPB 3TO9A 4UHTA 5K0WA 4ZYDA 2VONA 2VOOA 4EYBA 4MTDA 4UV9A 1WQ2A 1R00A 1IN8A 1HW2A 1TQIA 2JTVA 5JR3A 4FX0A 1UHWA 5A2QZ 2GCUA 3QPHA 4IRHA 5F1RA 1JJEA 1XCBA 4BQAA 4KEQA 1U5TC 5HOOA 3TOBA 4FX4A 5LCAA 4Q48A 1IZ1A 2B0LA 5J6XA 3CUQB 2D45A 4HA8A 3KNRA 1FT9A 2DQLA 4EM1A 1L3LA 1L9YA 3O6BB 3F9OA 1XMAA 3WGGA 2BG8A 2O8XA 2OHIA 2RNJA 3DQVC 3G1PA 1KU9A 4IJAA 5HISA 4GCVA 4EMSA 1LDJA 5EW0A 4Q47A 5HS8A 2XASA 4A2UA 1FBQA 3V7SA 4UBQA 1D3YA 4CXFA 1BJAA 5LM6A 1PP7U 3HIFA 5K5RA 2NYPA 5HIOA 2ZFWA 3KLNA 5D4SA 4UUVA 4XWWA 5KIKA 1HKTA 1SD5A 4ZNBA 2E7XA 2EJRA 2H6AA 2KIUA 4G7ZF 1UFMA 3V8JA 1D8KA 1HBXG 5AIQA 5FO5A 1TNTA 4IPAA 2YZ3A 2GZWA 4RB3C 3QU3A 1BVTA 3FAIA 1GXQA 3ECHA 4Y17A 5ICEA 4ETSA 2PBIA 1ULYA 1OYIA 4C09A 1TQPA 1R5HA 1UCRA 1ONVA 3X2YA 4P9FA 3HYIA 3CO6C 1BOAA 4FEKA 1BM9A 1S7OA 2FBKA 1A7TA 2HB9A 4D1VA 2FU6A 2ZJ2A 3ADRA 3KP3A 3T3OA 3M7GA 2XGXA 4WXCA 3RI4A 3WG9A 1U5TB 2CYYA 3U9GA 4PVTA 3RIRA 4MHGA 4L18B 1HKQA 5K5OA 1QO0D 4G9YA 3I4PA 4HL1A 2XF4A 4OU0A 2ZXJA 3JTGA 1U2WA 4O5VA 1JHFA 1V4RA 1FWZA 2WRSA 3ZMZA 5HIQA 3IE1A 2XAQA 5ILVA 4G7HF 2GA1A 4BNCA 3GXOA 2MBFA 1KO2A 2K27A 2FHXA 2NXAA 5EVDA 2EWNA 3HSEA 4G8XA 5HLHA 1B4AA 2BFZB 1JHHA 1KU2A 3BK1A 3WU0A 5ACRA 2XAFA 1GVJA 1DD6A 1FZPB 1YO5C 5F6FA 2DBBA 3GFLA 3MAJA 5EEGA 5A87A 1R5GA 1IXRC 2BR6A 2OA4A 2XKPA 5CYVA 3ZWFA 3VODA 2GMNA 2I7TA 3ABUA 4I98B 3CDHA 5TJJA