2ZO4A

Crystal structure of metallo-beta-lactamase family protein ttha1429 from thermus thermophilus hb8
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
315
structure length
301
Chain Sequence
ALLPGLYLLPVPIPYPLKTVNLYLLQGAGEVALVDTALGTRAARGALELHLAELGLCFQDVKTILLTHHHPDHYGLSGFFEGLGARVFLHEEEFARGHRFWREPEAFAEASWRLFLDHGTPEETVEKTRERVHPPQNPLPLRDGEALEVAGKRLRVLWTPGHADGHAAFYLEEEGVLLAGDALLEKVSPNVGLWAYTRENPLKDFLRSLDRLADLGARVAYAGHFGPIADVRQRAEELKAHHQARLEALLALLDGPKTAWELSLHLFPRRFAFAETLAHLEYLREEGAVGRGGPPYRYFRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of TTHA1429, a novel metallo-beta-lactamase superfamily protein from Thermus thermophilus HB8.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Hydrolase
molecule keywords Metallo-beta-lactamase family protein
total genus 100
structure length 301
sequence length 315
ec nomenclature ec 3.-.-.-:
pdb deposition date 2008-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2zo4A02
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 2zo4A01
3R2UA 2LNBA 3IC7A 4MQ9F 2FU6A 2XROA 4AVPA 3CUQA 3ZMSA 4A0XA 2YNTA 5FQAA 3C7JA 2GAUA 3GFLA 1QZZA 3FCZA 1OMIA 1WQ2A 3BPVA 2P1EA 3D0SA 3J80Z 3I59B 2XASA 4IHSA 1LDJA 1DD6A 4EY2A 5D5UB 4LGWA 3OV8A 1BI3A 4CHUA 2F2EA 2P7CB 3PY5A 4KDPA 2WYMC 6PAXA 4KIBA 2A3SA 3DHBA 2WYMA 4UAMA 1ZLKA 1LEBA 2H6AA 4EV0A 4DQ2A 5HOOA 3DH8A 2VBXA 1LEAA 1RUOA 2ACJA 3IL2A 3IRRA 1IRGA 4Z67A 2MLGA 2XHKA 3ZWFA 2FNPA 2BYVE 4L9TA 1ONVA 5ICFA 1FY7A 2TDXA 3MAJA 1WKMA 4UXNA 4QWQA 2Z5UA 5A2QK 2I7TA 4U0YA 1E5DA 4LB6B 3DXJF 4ZYGA 2RKHA 4Z6XA 4BYYA 2YR2A 4U0WA 2B0LA 5HIQA 5DYMA 3TOBA 3HIFA 2VBZA 2CYYA 2GA2A 1WRAA 1YW8A 1R22A 2OA4A 1HKTA 3CLOA 4Z5ZA 2BEOA 2RDPA 3F8NA 2L54A 4N0BA 5K5QA 4OIQF 3SW3A 1IW7F 3O3KA 2FF4A 1EH6A 1XDUA 1ZG3A 4HAMA 3V8KA 2KIMA 1GHCA 3EUHA 2XV4S 4P5OA 2K86A 2QWWA 3VFZA 3VB2A 2IW5A 4O3MA 1NHAA 3T5XA 3FZVA 4LFUA 1T98A 1T38A 3L9FA 2M1BA 5K4MA 3RKJA 3LA7A 3ZMZA 3L2CA 1RIOH 3WTZA 5B3RA 1RNLA 1RI7A 4AIHA 3E5XA 4I01A 3KE2A 4ETSA 2BGCA 4FT8A 1IN8A 4IRGA 1JHHA 3IE2A 2LDUA 4JK1X 1X8GA 3SZPA 4MGRA 3H3ZA 1BC2A 3U2RA 5CVRA 2F5CA 1G4DA 1J2XA 1KQ0A 4LE6A 2F5FA 3RYRA 3M8FA 1AWCA 2R7FA 2EA4A 3X2YA 3QOPA 4Z60A 3QU6A 4WD6A 3CUQC 1XD7A 4EM0B 2FRHA 4CZZA 3WTUC 3I11A 3RPCA 5EW0A 4Z2YA 4TYTA 4UWOB 2D2WA 1YG2A 2PI0A 1TNTA 4D1VA 1BC8C 3HUGA 3SFPA 2K4BA 5D4RA 1SFUA 4EJUA 1U5TB 2K7LA 3V4GA 4CO8A 5AXRA 1BVTA 3IKTA 4UVAA 2M45A 1D8KA 2H27A 4I02A 5HIOA 3DFGA 2L3DA 2X4HA 1W7PD 5HH4A 4EJTA 4IVNA 2GWRA 2DAOA 1P9EA 4O5VA 4LLNA 4S04A 2QM3A 1XTOA 3NRVA 3WU0A 2DLLA 2P5KA 2QINA 5K4KA 4UBQA 3ELKA 5HISA 2O8XA 1SD6A 3M8EA 4TZEA 3R60A 2XAJA 3JW4A 2XAGA 1BC7C 4KNYA 2YNUA 4UA4A 3IE1A 5LEKA 4YFKF 2NNNA 5BPDA 2YPRA 2BTNA 3RJPA 4JQFA 1MDMB 4N9HA 1MJ9A 3TGNA 4RB3C 3QH8A 2BG7A 1UFMA 5A0VA 1XSDA 1I5ZA 2V6CA 3IWZA 1R7JA 5LGNA 3RI4A 1I1SA 5FD6A 2BV6A 2Q0OA 1J59A 1DXKA 5LHGA 1T0FA 3IELA 5AEBA 3GO5A 4ENMA 1U5TA 1YW9A 5LMCA 3LWFA 3JAMZ 2F5EA 3HHHA 5DD8A 5CVVA 3F9OA 1BI1A 4XWTA 3QAHA 2EB7A 1Z91A 2UXNA 3R0AA 1KQ9A 2MD5A 1XGNA 2Y48A 1J9IA 2V1UA 4G6DA 2WC2A 5TJJA 5ACWA 1KA8A 4DILA 2ZNBA 2O0YA 1RUNA 3DQVC 2K27A 4RB2C 4RBSA 3IRQA 3LQRA 2GFJA 1B1BA 3ROUA 1XGOA 3QPTA 2GKLA 1ZN2A 1HXDA 2A61A 1DDNA 5AYAA 5ICCA 3ZN1A 5K4NA 2P97A 3KP5A 1JXSA 1XB4A 4EJOA 1FP1D 4LK0F 1JT1A 2Y75A 3KZZA 2DBBA 5HDGA 5J6XA 2BIBA 1VJNA 4L9JA 2QYOA 2CG4A 1TW3A 5FQBA 2PG4A 2V1XA 5LLQA 4KA4A 1J5YA 3BDDA 2QJSA 2VBWA 4I09A 2EFQA 5E8GA 1ZRFA 2NRAC 3VEPA 3KETA 3I15A 3SZTA 5CVIA 3A4YA 3KP6A 2UWMA 4H0EA 1YFHA 4U4LA 4RAZA 3COAC 5H20A 1LVAA 2HS5A 2HKXA 2JTVA 2GMNA 1T6SA 3HRSA 3GYHX 1U8RA 1IN4A 2Q8KA 3ZN0A 4ENJA 4J5FA 1LDDA 2ZZIA 2ZFWA 2DFIA 3L00A 4O6JA 3BOQA 4KT5C 4QLCU 2OU2A 2UZKA 2Q2EA 2COMA 2XAHA 3MZHA 5AXOA 4EFZA 3FMRA 5JFRA 3WTTC 3I5UA 4AIKA 2XKOA 3KP4A 4C09A 1HLKA 2WWYA 4PCQA 5HLIA 2JSCA 1B6AA 3T8RA 1ZG1A 1ZH5A 1T2KA 4KEQA 3BJ6A 1BI0A 2D1HA 5J8FA 3P9KA 4M9XA 2HR3A 3F72A 2HFHA 2X0LA 3MCZA 5EVBA 1ZTCA 3HSRA 4ZNBA 3FXQA 1MJBA 2LKPA 4P9UA 1S8NA 2YX7A 2K02A 2P8TA 4BXUA 2RVCA 2E1NA 5HDKA 4Y15A 2CW0F 2EFWA 1R1UA 5F64A 1XCBA 3ULQB 4NQ4A 1D5VA 3V8LA 4RL2A 2EK5A 3EDPA 4KFCA 4U0VA 3U9GA 1YCHA 4B87A 4CXFA 2IRFG 3T3NA 5ILSA 2DK5A 4AWXB 2FNAA 2IT0A 1I1GA 2OQGA 5CYVA 5DCFA 2QQ9A 2W25A 3V8JA 4Z7RA 4BNCA 1DPUA 1WWXA 3R61A 3F21A 1RZ4A 2OZUA 1B9NA 4PVOA 1YW7A 3LSTA 1P2FA 1ZLJA 1O3QA 1R23A 1F5TA 2O3FA 2P5VA 2K4JA 2FU8A 1WRJA 4Q4ZF 4WK8F 5L3CA 4TV7A 3BROA 1ZRCA 1K07A 4RS8A 3SHFA 4OMYA 2DI3A 1FSHA 3FHZA 3IHUA 3S2WA 1KO2A 4GYIA 2A69F 5CJ9A 1SFXA 4AIJA 3IEKA 2A6EF 3U1DA 3IOGA 1TQMA 2DQLA 1R00A 4OINF 3LQQA 2NAZA 5EV6A 2MA3A 4AX0B 3L09A 3E3VA 3TDUC 5DUKA 3LA2A 3Q9SA 1K7AA 2PEXA 4K2EA 1I27A 3ERED 4DIKA 2M30A 4M72A 5F6FA 2D1VA 4BH9A 3E6DA 1A04A 1YCFA 4UWSB 2GFKA 5A87A 1YIOA 1KU2A 1DDKA 4AX1B 2O61A 3OOPA 3TOAA 4KN4X 5EWAA 1HW5A 1ZRDA 2LF8A 1TLHB 4EYFA 3GUDA 1JHFA 1FBQA 3I53A 4GYGA 3G73A 5FLXZ 4B8XA 2Y8BA 4GYQA 1Z05A 5ILVA 1L3LA 4UNOA 1FYLA 3ESHA 5AIPA 1FT9A 2MLKA 1LDKB 2ELHA 3IOFA 1HW1A 1O57A 5D6FA 5L3FA 4CICA 5DV5A 4HLXA 3X2ZA 4HL1A 1O7FA 2V79A 4LMYA 2JT1A 1KU3A 4A0ZA 2YNWA 1Z7UA 2JPBA 1YQAA 2FM6A 5FGMA 4F6ZA 3ISPA 5IT9Z 1BMCA 3HHGA 3FX3A 5CLSA 4NHJA 3M1EA 1H0MA 1TQIA 1FBSA 3WTWC 3NEUA 2ZBKA 3ADRA 3R6SA 1PP8F 2EV5A 1J7KA 4TZBA 3N4MA 4A6EA 5LHIA 3QP6A 3ABUA 3BV6A 1MZBA 2P4WA 1WW1A 1XM8A 4AWZA 3GX4X 2QBYA 2VXZA 3CUOA 5L3EA 3PG4A 2EA2A 4YSBA 4HOBA 3FMSA 2NYXA 5BQTA 5A0TA 2NZEA 4Q48A 3I54A 5LCAA 4HDUA 2R3SA 3BK2A 2Z33A 3KLNA 4HF2A 1QGPA 2OBPA 4LLGF 1QBJA 5EVKA 5ILUA 5L3BA 1YS7A 3E6BA 2WRSA 2IPQX 4RGXA 3IWFA 1IXCA 5JHUA 5AIQA 4KICA 1O3SA 1QNTA 5BS6A 4PZJA 1K78B 2Q42A 3ECHA 3MZYA 3P9CA 5ACVA 2UXXA 1WUOA 1ODDA 4MTDA 3TDZC 5K1YA 2HB9A 2OD5A 1TNSA 2V1DA 5HIPA 1H9TA 1WSUA 1IAWA 2H6CA 2W24A 3RDIA 3B73A 2VOPA 4G7HF 1YO5C 5K5OA 5A2QZ 2VT3A 4XLPF 2AS5F 3F23A 1PDNC 3RKKA 3FM5A 5LGTA 4EM1A 2BG2A 1ZHFA 4ESBA 2QENA 2P5LC 2VOOA 4UV8A 4I98B 2E1CA 5EHTA 4E70A 2A5YB 4ZYHA 4UV9A 5HH6A 4RAMA 3ZNBA 5LCHA 2IA2A 4C1GA 1ZKPA 2BE5F 1FLIA 4WX9A 1K79A 1KYWA 1X3UA 1PP7U 4TZ9A 3EYIA 3H3UA 1LB2A 4BHPA 5LHHA 2VC0A 1UHWA 3N97A 2RQPA 4IXAA 3H3EA 4YSKA 3WTSC 1XN7A 2FU7A 2VBYA 3RIRA 1QO0D 4BQAA 4CYDA 1Q1HA 5E1XA 3T0YA 1EH8A 2VONA 3K2ZA 1PUEE 2GA1A 2EJRA 4ESFA 2ZCWA 3SFZA 3KNSA 4A5NA 5ACSA 4JO0A 5JI6A 4ZO3A 3KP2A 1BI2A 2Q0JA 5E8IA 4IHTA 5ED4A 2BG8A 2FA5A 1USSA 2L4AA 1V4RA 2QDTA 2Y0MA 3ABTA 1QH3A 1KU9A 1KR3A 2GZWA 4YFNF 2BR6A 1ULYA 2XIGA 3IKVA 4HF0A 2ZNYA 3I71A 2MH9A 3I13A 4MNUA 2ZWRA 3R4KA 1IRFA 4RAWA 1SAXA 1BJAA 4ZO2A 4YFXF 1OKRA 2MH2A 1BIAA 1O7LA 4U88A 2QLZA 4EGYA 5DCMB 1FSEA 1KQ8A 3C18A 4OIRF 2YZ3A 4MTEA 1F4KA 4PGHA 1ON1A 2HYGD 4CDGA 1W7PB 3T3OA 2ZMEA 3GXOA 4EJVA 1K78A 3CO7C 4OIPF 4J5HA 4NQ5A 3WGIA 2AIOA 4LG0B 5LS3A 2PMHA 2P4ZA 4LK1F 3I64A 5HLGA 5H6QA 1QQIA 1Z9CA 2DTRA 4ZYDA 4FR7A 3TP9A 1G3TA 4YIIA 1ZNBA 3I0TA 1X8HA 2XVCA 1KO3A 1W4MA 1BOAA 4RGSA 1S29A 4G7OF 3R0JA 3TO6A 3FF5A 3LAJA 4C1DA 2C6YA 3I0VA 3S0ZA 3F8CA 2WTEA 2Y8AA 2EV0A 4M6YA 4RGUA 2QZ8A 4R1HA 2OHHA 3GVAA 2NNYA 2XR1A 5BPIA 5D4SA 1VMEA 2OHIA 4HA8A 3LA3A 2HQRA 3ML6A 1U3EM 2ADUA 1E17A 4Z5YA 2DOOA 4MEYF 3PQKA 2FHXA 2W57A 1QPMA 5DCMA 3BP8A 2Z99A 3Q9VA 3P2UA 4D1WA 4HBLA 2BMIA 4OIOF 4RGRA 3MQ0A 2EFOA 2KIUA 2A07F 1G3YA 2CGPA 1IF1A 3JAMK 2XF4A 1A8TA 3QP5A 4XSXF 2M5CA 2BFKA 5LEJA 2ESNA 2R7DA 3TO9A 2A68F 1BN5A 2H94A 1FBUA 3CO6C 4GO1A 2BG8B 5IT3A 2I7XA 4LB5A 3GFMA 2CQKA 3ZPLA 1MKMA 2BFZB 2FOKA 3RTRA 3WU1B 4WXCA 1S3JA 5B1UA 3ZMTA 2MC3A 4ASNA 4P62A 4KUMA 3JSOA 1KGSA 3E97A 2VT2A 2E7WA 1BBYA 3SD9A 4FX0A 2OQRA 4UWRB 3J81Z 1SMLA 1MQOA 1M2XA 4YSLA 3REOA 2G9WA 1I6XA 5ACQA 5K0WA 1USTA 1SD5A 2YNVB 1OYYA 1AOYA 4M9SA 2M5DA 4ZYEA 3DF8A 3TKYA 1BIBA 2G7HA 2IP2A 1DPRA 2P6TA 5HDNA 1FZPB 2KKOA 4I0BA 5IQKA 1CGPA 1P6RA 4Q5SF 3KZYA 2ZMEB 4FEKA 2Q9UA 4IPAA 3KLOA 5KVRA 5D5XB 2IJLA 2HYFA 3H92A 2XKPA 3HSFA 3MEXA 3C3WA 3KCCA 3I14A 5DDGA 1XSXA 2HQNA 1T39A 2HOEA 3SRXA 3WTVC 4I2OA 3VOEA 3K1NA 3GWZA 4ON0A 2DU9A 4Y13A 5HVQC 4U7BA 3P7NA 3HRUA 1KU7A 4M73A 1EV7A 5A5ZA 2FE3A 1R1VA 5EVDA 5D8LB 1YLFA 2RN7A 2JPCA 5KILA 3SXYA 2RNJA 1TW2A 1QH5A 4HX7A 2VE8A 3RKXA 4GGGA 1UCRA 2DQRA 2W84A 4UVBA 3ZQ7A 5L3GA 2DPDA 3IEMA 1S6LA 4C1HA 3VQZA 2KIFA 1REPC 1GXQA 3WGHA 4A2UA 4ENNA 3HOTA 2FU4A 1XMAA 3KP3A 3V7RA 2KRFA 2L02A 1O3RA 2HTSA 2P18A 2QBYB 1ZYRF 4HLYA 2A7MA 5LM6A 3WE3A 4P96A 2PBIA 4EVIA 3FXUA 1GXPA 5ICEA 4G94A 3PQJA 1ON2A 4BAYA 1G3SA 2BFZA 2XRNA 3VODA 5HS8A 5E20A 1U5TC 1FP2A 4HV5A 5ACPA 3ZMVA 1SD4A 5FB2A 3T8TA 1CF7B 2WHGA 1JJTA 5DPXA 1KYZA 5ACTA 1R36A 3X30A 2Z3YA 4WWCA 3JSPA 3FXRA 3CDHA 4LLLA 2YNTB 2XGXA 5BMZA 3SBLA 3WXCA 2PFBA 4YIFA 2QQAA 1FYMA 3AJ3A 4L5IA 4OU0A 1SMYF 1F9NA 5BOXA 1DUXC 2GXGA 4KMFA 4OMZA 4HDVA 5FQCA 2FBHA 2ZJ2A 4HKYA 4WF2A 4WXDA 2CFXA 4KYWA 3B02A 3HYIA 3HRTA 4KMUX 3RKYA 4HF1A 2DO7A 4XLNF 4NB5A 3J7AO 3F8BA 2MBFA 3GEZA 3JTGA 5HS7A 3AF5A 2CSOA 3BWGA 4MHGA 4FX4A 1C0WA 3FM3A 4ZH4F 3RPQA 2ZXJA 1STZA 1DP7P 3KFWX 1TTYA 2YNVA 1ZAOA 1IN5A 4NQWA 1LQ1A 2DT5A 4D1TA 3F6VA 2PJPA 3WE2A 2CBNA 3M7GA 2H6BA 2HKOA 2FK6A 4IJAA 3F3XA 4Y17A 1Y44A 3K69A 1D8JA 1U2WA 2E7YA 5AHOA 5D5WB 1R58A 5ACRA 2GIVA 4DNCA 2FBIA 3WTXC 4L0YB 1CF7A 3LFKA 4RB0A 3C1DA 3CTAA 1U6GA 5JVTA 2ISYA 1XDSA 2QQBA 3FWEA 3KNRA 4F7ZA 3KP7A 3DHAA 4EGZA 4C1FA 4RB1A 4KIFA 5LE1A 4CGZA 5K5RA 4FSBA 3BJOA 4HX4A 3K9TA 2YSRA 1FC3A 5DEQA 4O98A 2ISZA 3G1PA 4HX8A 3RYPA 1FYKA 1O3TA 2FMLA 5J8CA 5F1RA 3K0LA 5L3DA 2BC2A 5ACXA 1MJAA 2HEOA 4HW0A 2QEDA 2QUFA 4EYBA 3CUQB 2XAQA 1XGSA 3GFIA 3T9MA 2DW4A 1FWZA 2JZYA 1F1ZA 2GCUA 5EEGA 4UWPB 4BP0A 2O6GE 4CHLA 5HH5A 1MGTA 4HQEA 3HTUA 5H6RA 5D8KB 4TYFA 3BPXA 3V7SA 1ZGJA 2VN2A 3DKWA 1XSVA 2IA1A 2BGAA 2BFLA 1SD7A 4EM2A 4YG2F 3SPUA 1SFEA 4MQVA 3JTHA 2M8EA 1HKQA 1S7OA 3O6BB 4MEXF 1OR7A 4I0AA 1FOKA 3MFKA 1UHMA 2JRTA 2J5OA 2R2DA 4RAYA 2W85A 2CO5A 4S05A 1GVJA 1IZ1A 4Q47A 2HTJA 1J0RA 4L0ZB 4LG0A 1JGSA 3ZQ4A 4D02A 2M87A 1IUYA 1J75A 3GF2A 2P7VB 1OYWA 2FHXB 3J80K 2ZNZA 2XUBA 1HW2A 1IXRC 4UUVA 1MDMA 1Z6TA 5ERIA 3WG9A 2HWVA 2KJBA 3FAIA 1XCVA 1HQCA 5D6EA 3F8MA 4A12A 3Q5FA 2BBYA 2WV0A 3WODF 1ZG5A 4KIGA 1R5HA 5FFZA 4EMSA 2NXAA 3MD7A 3IE0A 4P55A 3I58A 2I7VA 4ENKA 3BJAA 4HL2A 3L6NA 1B4AA 2GQQA 5LBQA 4ZEJA 3BK1A 5FO5A 4M9ZA 2E7XA 1TBXA 3GFJA 5KK1A 5LCFA 2Z9OA 4ESJA 3GZ6A 4PVTA 2NZFA 3EYYA 5CVJA 4L9NA 5LRRA 5DUIA 4GCWA 5EEHA 4BHCA 4XUKA 3E6CC 2FBKA 4LD5A 3J81K 1Z1DA 4G7ZF 3K1PA 2L01A 2H09A 4N9IA 4HQMA 3BY6A 2KJCA 4P9FA 4M74A 4KEPA 3K1MA 1UB9A 2VODA 3AAFA 1K6OA 1HKSA 3L7WA 5D5VB 4EXSA 5LLDA 4HYEA 3QU3A 5FLXK 2WYLA 1VTNC 3E5UA 3T1BA 4C1CA 2OAZA 2NYPA 1S7AA 3AF6A 1IXSB 2NS0A 1YTYA 1A7TA 1VGNA 1ZREA 1D3YA 5JR3A 2ETHA 4A6DA 3GZ5A 5LGUA 2AZ4A 4XWWA 3DP7A 4L5JA 4PGGA 4EJWA 2FSWA 1H9GA 3ZMUA 5LRSA 4XBFA 3CJNA 4R79A 1P92A 5EV8A 3I4PA 4WCGA 4EQQA 1G3WA 2ZKZA 3DHCA 1MD0A 1XMKA 1LJ9A 5IT9K 2Y87A 1BM9A 2STWA 1ZGAA 4FHTA 3E6MA 1W5TA 3LAPA 3F8FA 5FFXA 4NQ2A 3I59A 3RPUA 2EWNA 4IRIA 3GLXA 1V3FA 2YU3A 5E18F 2DK8A 4WXHA 2RV8A 3HRMA 2RC4A 4A5MA 2A6HF 1YYVA 4NQ6A 3WGGA 4M71A 3DEUA 1W5SA 3LVZA 4F6HA 3BZ6A 1FX7A 1JJEA 1L9YA 1W7PA 2PQ8A 4EXYA 3KEOA 3F22A 4AWYB 3MWMA 2IA0A 2FU9A 4EYLA 4TZFA 1HBXG 5AONA 5TRDA 3TO7A 3ZMDA 2YCBA 4XSZF 2O03A 2CWEA 1XGMA 4R8HA 1WUPA 5HS9A 2VW8A 1ZARA 4RM5A 1U78A 4RL0A 5LSCA 2UYXA 4OOIA 3ZP5A 4U7DA 5FD5A 2FMYA 4UHTA 2BG6A 3BC2A 2F5DA 5KIKA 2QDSA 1QZYA 2P6SA 3O2PE 5AHRA 4ZZDA 1OYIA 5DD4A 4IRHA 4BZ3A 4L18B 2OZ6A 1HSJA 1B9MA 2YX4A 3EETA 5CVUA 2FQ3A 4KN7X 3PY6A 2EFPA 3ZR9A 3WTYC 2XAFA 1IN6A 3JXPA 1LNWA 4V0HA 4G9YA 3SQNA 2VE9A 3EQLF 1WI9A 2HGCA 4L9VA 3TQNA 4JBAA 1G6NA 4GYUA 1L0OC 2IVMA 3DPTA 4AD9A 3Q6VA 5EH9A 3IDZA 2GXBA 4G8XA 1YS6A 4B09A 2FEZA 1Z6RA 2HDCA 3G3ZA 2V9VA 1JE8A 2LSOA 5E1WA 2J5PA 2Q0IA 4D0PA 2HZTA 1P4XA 2VC1A 1R5GA 5E1ZB 1OPCA 3D5LA 3HOSA 1TQPA 2STTA 2DKFA 3F6OA 3W6JB 1B59A 4GXOA 3PFIA 3X2XA 2L4MA 4HV6A 2RGVA 2EV6A 2QVOA 4UVCA 1R1TA 4ZZLA 2D45A 2G7UA 3P9IA 4G6QA 1P4WA 3DPLC 3HTSB 4PDKA 3FMQA 5HLHA 1FPQA 5ICGA 3M9AA 2PLYA 1SMTA 3QRFF 5B15A 1YCGA 4H0DA 5ACUA 1E2XA 3V7CA 1EH7A 3KL7A 2OHJA 2DPUA 2LF7A 2ESHA 3KEQA 2ZO4A 1FNNA 1X8IA 2PMUA 3E5QA 3ECOA 1Y0UA 4I7HA 3HSEA 4BHBA 4GCVA 4C1EA 1IN7A 4M6XA 2AXLA 4IF4A 4HZFA 3GW2A 1P4AA 2EFNA 4XRFA 5E17F 3NQOA 2PN6A 2FXAA 4LJZF 4A0YA 3VPEA 4D1UA 3W6KB 3RKWA 2M5WA 3DV8A 1HSTA 3QPHA
chains in the Genus database with same CATH superfamily
3R2UA 3BTJA 2LNBA 4RLQA 1MH4A 4HNVA 3IC7A 4MQ9F 2FU6A 1HDDC 2XROA 4AVPA 2JVHA 3KYCB 2M9HA 3CUQA 4XLEA 4EEFG 2PX9A 3ZMSA 2LFBA 4A0XA 2CW8A 3RZDJ 2YNTA 5FQAA 3C7JA 3UNGC 4D9JA 2GAUA 3BR2A 3GFLA 4NC6A 1SFOJ 5AJLA 4H4KC 1QZZA 3FCZA 2R7SA 3G4SI 1OMIA 1WQ2A 3JRGA 1RC9A 3BPVA 5KNLA 2P1EA 3D0SA 4BS9A 3KEYA 2MGQA 3J80Z 1A35A 2IXSA 2KISA 3I59B 2XASA 4JX4A 4IHSA 2E19A 1LDJA 4DIQA 1DU6A 1DD6A 4EY2A 5D5UB 5E3NA 4LGWA 3VSLA 3CC4I 4A3GJ 3OV8A 1BI3A 4CHUA 2F2EA 2P7CB 3PY5A 4KDPA 2WYMC 1D0YA 1ETKA 1RKTA 3OR1C 6PAXA 4KIBA 2QEXI 2A3SA 3DHBA 4B3AA 2BY1A 1RR8C 2WYMA 1Z3YA 4UAMA 1ZLKA 4XICA 1LEBA 2BY0A 2H6AA 4EV0A 4DQ2A 4Y33A 3I56I 5HOOA 3DH8A 3HPHA 2VBXA 1LEAA 1RUOA 2ACJA 3B6CA 3TP3A 3IL2A 3IRRA 2MC4A 5DM7F 1IRGA 2LMDA 5B1BH 4Z67A 2M7AA 2MLGA 2XHKA 4M3GA 4AU7A 4B3XA 5B5EC 2P81A 3ZWFA 1T56A 5CQGA 2FNPA 2BYVE 4L9TA 1ONVA 5ICFA 1FY7A 2TDXA 4Y52J 3MAJA 4E7IA 1WKMA 4UXNA 4QWQA 2Z5UA 5A2QK 2DJIA 2I7TA 4U0YA 1E3OC 2WAEA 1E5DA 4LB6B 1ITYA 2DCEA 3DXJF 4ZYGA 3CDIA 1GDTA 2RKHA 4Z6XA 4BYYA 1R4MB 2EBIA 2V9PA 2YR2A 4U0WA 4B47A 2X6WA 2B0LA 4C3IJ 5HIQA 5DYMA 3AG2H 3RQIA 3TOBA 3OYGA 2KIQA 3HIFA 2VBZA 2CYYA 3S8PA 2O9LA 2GA2A 3CMEI 1WRAA 1YW8A 1VQLI 4E7JA 1R22A 1WH5A 4XN0A 3I4MJ 2OA4A 1HKTA 3CLOA 1NG6A 1IUFA 4Z5ZA 3F8NA 2BEOA 1M1EB 2L54A 2RDPA 3M1CA 4N0BA 5K5QA 4OIQF 4E6KG 5J3LA 1YJ9I 4CCMA 1LPQA 1IW7F 3SW3A 3O3KA 4A3JJ 1ORKA 2FF4A 2R93J 1EH6A 3FKJA 4BXXJ 1XDUA 4F3QA 1ZG3A 2R7OA 3G1MA 4HAMA 1BJZA 1JUMA 4QTRA 1VQMI 3V8KA 1V5GA 2KIMA 1GHCA 3EUHA 2XV4S 4P5OA 2K86A 3ZQHA 3WHBA 2W1OA 2ZXIA 3VDXA 1O4XA 1YJWI 2VQGA 2DMPA 2QWWA 2JRMA 3VFZA 3VB2A 1B72B 2FOWA 1LFPA 2IW5A 2V9KA 1HCRA 4O3MA 3FK6A 1NHAA 3T5XA 2O5RA 2GIZA 1T98A 3FZVA 4LFUA 3WHCA 1T38A 1YRNA 3L9FA 3N05A 3PNTA 3NARA 4A3LJ 2M1BA 2ECCA 3PNYA 5K4MA 2L9SA 3S32A 3RKJA 3LA7A 4XKCA 3ZMZA 3RQ4A 3L2CA 1RIOH 3WTZA 4G12A 4W97A 5B3RA 1RNLA 1RI7A 4DJAA 4AIHA 3E5XA 4I01A 2QSGX 3KE2A 3HGYA 4ETSA 2HOTA 3BG9A 3LSJA 1Y8QB 2BGCA 3BG7A 4FT8A 1IN8A 2EIKH 3GTGJ 4IRGA 4D7NA 1JHHA 3IE2A 2LDUA 4JK1X 1OR7C 1X8GA 1QHGA 3A02A 3SZPA 4MGRA 3H3ZA 3QODA 3U2RA 2VJ5A 1BC2A 5CVRA 2F5CA 4D7MA 3AKZA 2E2JJ 1G4DA 1DGRM 1J2XA 4B43A 2VQHA 3VYTB 1KQ0A 4LE6A 3OYAA 4M3FA 3S1NJ 2F5FA 4V2GA 3M8FA 3RYRA 1AWCA 5EYRA 2R7FA 3H0GJ 2EA4A 3X2YA 3QOPA 3CD6I 3QU6A 4Z60A 1HLVA 4WD6A 3CUQC 1XD7A 2OCCH 4EM0B 2FRHA 4CZZA 3WTUC 3M4OJ 3I11A 3RPCA 5EW0A 4Z2YA 4TYTA 4UWOB 1WJFA 2ZXWH 2ZJQF 2D2WA 1YG2A 2OF7A 3HZJA 2PI0A 4ITVA 4NDLA 1TNTA 4D1VA 1BC8C 3HUGA 3SFPA 3O8GA 1B72A 4CZCA 5J1YA 2K4BA 4UB8C 5D4RA 4EJUA 1SFUA 1U5TB 1PUFB 5J4YA 2K7LA 3V4GA 4CO8A 5AXRA 1BVTA 3IKTA 4UVAA 2M45A 1D8KA 2H27A 2JA6J 5M3MJ 2GOXB 4DZJA 2FUG2 4BXFA 1Z21A 1D1AA 4I02A 5HIOA 2ID6A 1WJBA 3DFGA 2L3DA 2X4HA 4A3DJ 1W7PD 5HH4A 4EJTA 4IVNA 2GWRA 2DAOA 2HXIA 3BR0A 1P9EA 2DYRH 4O5VA 4LLNA 4S04A 3Q0UA 2QM3A 4RLFA 5K7ZA 1XTOA 2EZKA 3A01A 3DTIA 3NRVA 3WU0A 2DLLA 3BC8A 2P5KA 2QINA 5CPRB 5K4KA 4UBQA 3ELKA 2WBMA 5HISA 2O8XA 1SD6A 4QPOA 3M8EA 4TZEA 3R60A 2XF7A 4M3DA 4CCJA 2XAJA 3JW4A 2XAGA 1BC7C 2CQ7A 4KNYA 2YNUA 3AG1H 4UA4A 3IE1A 5LEKA 4YFKF 2NNNA 2ECBA 5EZHA 1BA5A 5BPDA 2YPRA 2BTNA 3RJPA 5DM6F 4JQFA 4HRIA 1MDMB 4N9HA 1MJ9A 3TGNA 1UG0A 2KRCA 4RB3C 3BZCA 3QH8A 5E3OA 2BG7A 4LG3A 1UFMA 2A5WA 2VJ4A 5A0VA 1XSDA 1I5ZA 3S17J 3S1MJ 2M7BA 2V6CA 3AFHA 3IWZA 4XL9A 1R7JA 5LGNA 3ZQCA 3RI4A 1ZR2A 2PJRB 1MMSA 1I1SA 5FD6A 2BV6A 4CUGA 3GCMA 2Q0OA 1J59A 1DXKA 2LREA 5IYDJ 4FQGA 2NVXJ 1D1CA 5LHGA 1RESA 1T0FA 3BTIA 5TISC 3IELA 5AEBA 1XTAA 3GO5A 4ENMA 1U5TA 1YW9A 5LMCA 3FDYA 3LWFA 3JAMZ 3PL8A 1WVRA 3MKLA 4BEHB 2F5EA 3HHHA 5DD8A 2IS6A 3BG6A 5CVVA 3LSRA 1X3ZB 3F9OA 1BI1A 4XWTA 3Q0VA 3QAHA 2EB7A 4A69C 2L9NA 1Z91A 2UXNA 3G2BA 3R0AA 1KQ9A 2CV0A 4NQWB 2MD5A 1XGNA 2Y48A 3VPRA 3HBLA 1J9IA 2V1UA 2LKXA 4G6DA 4IOAF 4DYCA 2WC2A 5FKLA 5TJJA 1KA8A 4DILA 5ACWA 2ZNBA 2Y9YA 2O0YA 1RUNA 3FKIJ 3DQVC 2K27A 4RB2C 3DTKA 3NAUA 2L7KA 2VJIA 3IRQA 4RBSA 3LQRA 2GFJA 4IEJA 3K2AA 1B1BA 2AQFA 3HOVJ 2H8WA 1WFXA 3ROUA 1RR7A 1XGOA 3QPTA 2GKLA 2NVTJ 4A3FJ 1SAUA 1ZN2A 2YS9A 3I55I 1H88C 4PFPA 1HXDA 4MFEA 2A61A 3CJRB 1DDNA 1DGWY 5AYAA 5ICCA 3ZN1A 5K4NA 3HDDA 2P97A 9ANTA 3H35A 3KP5A 1JXSA 1XB4A 5HODA 2R5ZB 4EJOA 1FP1D 4LK0F 4RMNA 1JT1A 1MBHA 2Y75A 3KZZA 5E3LA 1IV6A 1K83J 2DBBA 5HDGA 5J6XA 2BIBA 2V1NA 1VJNA 1V5FA 4L9JA 2QYOA 4F52A 4GFBA 1JUPA 2CG4A 2E60A 2CV2A 2HNHA 3MN2A 2EIMH 3K7AJ 1TW3A 2K3FA 5FQBA 1E0EA 3CCMI 2PG4A 2V1XA 4XMYA 5LLQA 2GBYA 4BE0A 4KA4A 1J5YA 4CCNA 3S1RJ 5HLTA 3BDDA 2QJSA 2QKLB 3IH2A 3EPZA 2LVSA 2VBWA 3GMEA 4I09A 2EFQA 2HVSA 2V4JC 4NBQA 1UJ8A 5E8GA 3PO3J 1ZRFA 2NRAC 2RQQA 5F08A 3VEPA 3KETA 3I15A 3SZTA 5CVIA 4LOCA 4B4CA 3A4YA 1QPIA 3KP6A 2UWMA 3MVPA 4DZPA 4H0EA 1TWHJ 3GLLA 5FRNA 1YFHA 1ZTRA 2QGUA 4CYCA 3DKYA 5FKKA 3L2QA 3FIWA 4U4LA 4RAZA 3COAC 5H20A 1LVAA 2HS5A 2CRGA 2HKXA 2VKHA 2JTVA 2GMNA 3OIQA 1T6SA 3HRSA 3OMYA 3GYHX 3CC7I 3DCFA 2AXTC 2CUJA 1U8RA 1IN4A 2Q8KA 1JGGA 3ZN0A 4ENJA 4J5FA 1LDDA 3GTQJ 2BW3A 2WB1N 2ZFWA 2DFIA 2ZZIA 1TWGJ 4V19K 3L00A 3S14J 1UZCA 3BOQA 2EZIA 4KT5C 4O6JA 4QLCU 3LNQA 2OU2A 2UZKA 2Q2EA 5C3EJ 4FE4A 2COMA 2XAHA 3MZHA 3X2QH 5AXOA 4XRMA 4EFZA 1MNDA 2NS7A 4CSWA 1JKQC 4S0HB 3FHNA 2DFEA 2MABA 3FMRA 5JFRA 2L0KA 1SC7A 2R7ZJ 3OIPA 3WTTC 2KLOA 3BCBA 3I5UA 4AIKA 4Y7NJ 2ZSHB 1Y0NA 2DA6A 2LBFB 1X1PA 1MMAA 2XKOA 3KP4A 4C09A 1HLKA 2WWYA 4N4NB 4PCQA 5HLIA 2JSCA 1B6AA 5DTDA 3T8RA 1ZG1A 1ZH5A 1T2KA 1TP4A 3BJ6A 1BI0A 4KEQA 2R5YA 4ZDOA 2CUEA 2D1HA 1AKHA 5J8FA 3P9KA 4M9XA 1FOWA 2HR3A 3F72A 2HFHA 2X0LA 3MCZA 5EVBA 1ZTCA 3CLQA 3H9GA 3HSRA 4DYRA 4ZNBA 4BQNA 2KZVA 2WV1A 3FXQA 1MJBA 2LKPA 1MNEA 1QHHD 4P9UA 2X48A 1S8NA 2YX7A 4CYCB 2K02A 2P8TA 4BXUA 1GLNA 4D5CA 3OYHA 1R6RA 2RVCA 2E1NA 5HDKA 2GOMA 1MBKA 3H5AA 4Y15A 2CW0F 2EFWA 1R1UA 1HDPA 1VF9A 2DA1A 4M6VA 4XK4A 2KRHA 1W1WE 2HI3A 3LMMA 5F64A 2OTJI 2HVQA 2IGMA 3JRIA 2WAFA 1QA6A 3OSGA 2L7MP 1XCBA 2CFOA 2OTLI 3C2HA 3CCVI 4CA0A 3ULQB 1BR1A 4NQ4A 1D5VA 2DT7B 3V8LA 4RL2A 2EK5A 3EDPA 4KFCA 1W0UA 3DBRB 4U0VA 4UB6C 5KAIC 3U9GA 1YCHA 4B87A 3F0CA 1VQOI 3BR1A 3HKZA 4CXFA 2OJED 3GBGA 4FE7A 1W0TA 3W3CA 1YHQI 2IRFG 2R7TA 2DYSH 3CJTB 5IOZA 1X1CA 3CCUI 5HNFA 4HNUA 4Y3OA 1XC5A 3T3NA 1FIPA 5ILSA 2DK5A 2CMPA 4AWXB 2FNAA 2IT0A 1I1GA 2BHYA 2OQGA 5CYVA 5DCFA 1VQNI 1JTXA 2QQ9A 2W25A 3V8JA 4Z7RA 3HC7A 4BNCA 1DPUA 3CP2A 1WWXA 3R61A 3F21A 3J7ZI 1RZ4A 3OYDA 2OZUA 2AHQA 5GPAA 1B9NA 4BBSJ 4PVOA 4UUSA 1YW7A 5KCMA 3DKXA 1P2FA 1ZLJA 2BOLA 2VPRA 3LSTA 2CG3A 1O3QA 1R23A 5M5XJ 5CQEA 1F5TA 2O3FA 2P5VA 2K4JA 4FISA 2FU8A 1WRJA 2NOGA 4Q4ZF 1GT0C 4WK8F 5L3CA 4TV7A 3BROA 1ZRCA 1UAAA 1K07A 2LYCA 4RS8A 3SHFA 5J4VA 4OMYA 2DI3A 3MMYB 1FSHA 3FHZA 3BLYA 3IHUA 3S2WA 1KO2A 2M8GX 4GYIA 3KIOA 2A69F 3SYTA 5CJ9A 1SFXA 4RM2A 2NOJB 2MYSA 2O7OA 3E1SA 4BJ5C 4AIJA 2HOSA 3IEKA 2A6EF 3U1DA 3H0DA 3IOGA 1TQMA 2DQLA 1R00A 4AUXA 1JJ8C 1ETVA 4ZTFA 4OINF 3LQQA 1IDZA 1V55H 4JOMA 3H36A 2NAZA 3PNVA 3L2RA 2MA3A 3OL4A 5EV6A 4QIWN 3L09A 4AX0B 3E3VA 2H8RA 3TDUC 5DUKA 1IO2A 3LA2A 3Q9SA 1ZR4A 1K7AA 1G2HA 2HPIA 2PEXA 1UHSA 4K2EA 4NC7A 1I27A 3ERED 2Q1ZB 4DIKA 2VXDA 2M30A 3ZQFA 4M72A 3JRFA 5F6FA 2D1VA 4BH9A 4XLAA 3E6DA 1A04A 2EPFA 2DT6A 1YCFA 1WPKA 4ABZA 4C2TA 2GFKA 4UWSB 5A87A 1YIOA 1KU2A 1DDKA 4AX1B 2O61A 1F36A 3F9KA 1BR4A 1WH7A 3HKZN 2ELJA 3OOPA 4BY7J 4KN4X 3TOAA 5EWAA 1N78A 1HW5A 1X4OA 2M4KA 1ZRDA 2R7VA 2LF8A 1TLHB 4EYFA 2OV7A 3GUDA 3LSHA 1JHFA 1FBQA 4ZJZA 3I53A 1S7EA 4GYGA 3G73A 4IO9F 5FLXZ 1YI2I 4B8XA 2Y8BA 4GYQA 3BR3A 1Z05A 5ILVA 1L3LA 4UNOA 4UUSB 1FYLA 3ESHA 5AIPA 1FT9A 2MLKA 4IKFA 1LDKB 1U0JA 2ELHA 2P0WA 1JT0A 3FISA 2R7UA 3IOFA 1HW1A 1O57A 1PUFA 2B7EA 5D6FA 2WAQN 5L3FA 1WJCA 4CICA 5DV5A 4HLXA 3X2ZA 4HL1A 1X2MA 4PJJA 1OLTA 1O7FA 2V79A 1WJEA 4LMYA 2JT1A 5J47A 5IP9J 1KU3A 4BUPA 1LKXA 1EA3A 2FJ1A 4A0ZA 2YNWA 5B3SH 2A6TA 5GP9A 1Z7UA 2JPBA 3K4BA 1YQAA 2FM6A 5FGMA 4ZYAA 4BACA 4F6ZA 1WI3A 3ISPA 4MFDA 2HXOA 4X6AJ 2W48A 2IS1A 5IT9Z 3ZXSA 1BMCA 3HHGA 3FX3A 3IAS2 4JP0A 5CLSA 3M1EA 4NHJA 3M8JA 3GZNB 1K4SA 1H0MA 3KYLA 1A5JA 1TQIA 1FBSA 1Z3XA 3WTWC 1S5LC 4KISA 2NXNB 3NEUA 2M0CA 4E7ZA 1B8IB 2ZBKA 2LK2A 3ADRA 2FX0A 3R6SA 2W7NA 3ZR8X 1PP8F 4XLHA 2EV5A 2VKVA 1VFCA 1ZELA 1LUJB 1J7KA 4AXHA 2F4OB 4TZBA 3N4MA 2CV1A 4XQFA 4A6EA 5LHIA 1MW7A 3QP6A 3AG4H 1AA7A 3ABUA 2BY3A 3BV6A 1MZBA 2P4WA 1PYVA 2X6XA 3OYIA 2DMTA 1W36D 1YJNI 4UY8I 1WW1A 1XM8A 4AWZA 3GX4X 5LD2C 2QBYA 4UUTA 2VXZA 3CUOA 5L3EA 2X1EA 4BGDA 3BG5A 1IDYA 1I6HJ 3PG4A 2EA2A 5FKMA 4YSBA 2DA4A 4HOBA 3ZQLA 3FMSA 2NYXA 5BQTA 3IH4A 5A0TA 2NZEA 4Q48A 3PUBA 3I54A 2LY1A 5LCAA 4HDUA 1D0XA 3LOCA 2R3SA 3K4LA 3OS0A 3BK2A 1BR2A 2Z33A 3KLNA 2M2EA 4HF2A 4MO7A 1QGPA 2OBPA 4JX5A 2LH9A 4LLGF 1QBJA 4ANJA 5EVKA 5ILUA 3TW7A 2X9DA 3OYEA 5L3BA 3NWTA 4PJ0C 1YS7A 3E6BA 2WRSA 2IPQX 4AVZA 4RGXA 3IWFA 1IXCA 1OCCH 2QF7A 5JHUA 5AIQA 3M3YJ 4KICA 2X85A 1JT6A 1I3AA 4GRIA 1O3SA 1QNTA 5BS6A 4PZJA 1OCZH 1K78B 2Q42A 2TCTA 3ECHA 3MZYA 3P9CA 4KITB 4II3A 3H1CA 3IV5A 5ACVA 2UXXA 1W36C 4IQJA 1WUOA 1ODDA 4MTDA 2R5YB 3TDZC 5K1YA 2HB9A 1I3QJ 2MG4A 2OD5A 1TNSA 2RNGA 2V1DA 5HIPA 4C3JJ 1IGNA 3DEWA 1H9TA 1WSUA 3FXJA 4RA2A 1IAWA 2H6CA 2W24A 3EUHC 3RDIA 3B73A 2VOPA 4ZDLA 4G7HF 1YO5C 2K3PA 2PMZA 4XM3A 5K5OA 5A2QZ 2VT3A 4XLPF 2AS5F 2L9RA 3F23A 1PDNC 2YU9J 3RKKA 2CG2A 3FM5A 5LGTA 2M3AA 4PUSA 1QU3A 4EM1A 2BG2A 1ZHFA 1IJWC 4ESBA 2QENA 3ABMH 2P5LC 3OYBA 4UV8A 4I98B 3CCRI 3QWLA 1LE8B 2VOOA 2E1CA 5EHTA 5F1JA 4E70A 4CCKA 3G71I 2A5YB 4ZYHA 2IBDA 4UV9A 5HH6A 4RAMA 3ZNBA 5LCHA 2IA2A 4C1GA 1ZKPA 2BE5F 3CDLA 1FLIA 4WX9A 1K79A 1KYWA 1X3UA 1PP7U 4TZ9A 1MH3A 1POGA 3H3UA 3EYIA 1LB2A 4BHPA 2MFZA 2VC0A 2VASA 5LHHA 1UHWA 5E79C 3N97A 2XRLA 1T33A 3LSGA 3HM5A 2RQPA 4IXAA 5EEAA 3H3EA 2JJ7A 3K4CA 4YSKA 1FIAA 5IPAA 1XN7A 1X1DA 2VBYA 3RIRA 3WTSC 2X51A 2FU7A 1QO0D 2YHEA 4BQAA 2Y0SA 1SVOA 2KMUA 1Q1HA 4AYBA 4CYDA 5E1XA 3T0YA 1EH8A 1N25A 2VONA 4IHXA 3K2ZA 1PUEE 2GA1A 2R0QC 5M3FJ 2EJRA 4ESFA 5C4XJ 2ZCWA 3SFZA 3ASOH 3KNSA 1RETA 1RRJA 4A5NA 1Z67A 5ACSA 4JO0A 5H2FC 4BL0B 1X19A 5JI6A 4ZO3A 3KP2A 1BI2A 1IRZA 3K4KA 5E8IA 4IHTA 5ED4A 2Q0JA 2BG8A 2FA5A 5IY5H 1J09A 5BNGA 1USSA 2L4AA 1V4RA 2QDTA 1BW6A 1YX3A 2Y0MA 3ABTA 1QH3A 1KU9A 1KR3A 4OAZA 2GZWA 3HGGA 4II2A 2XF5A 4YFNF 1ZQ3P 4AYBN 2OPTA 1ULYA 2XIGA 2VUMJ 3GTKJ 2BR6A 2LY9A 2CFZA 4I99C 3IKVA 4HF0A 2ZNYA 3I71A 3PM1A 2MH9A 3I13A 2ME6A 4MNUA 2ZWRA 1TT0A 2DFHA 2BXZA 3R4KA 5FLMJ 1IRFA 4RAWA 1SAXA 1BJAA 4CH7A 4ZO2A 4YFXF 1OKRA 2EINH 5EGOB 2XSDC 1ETOA 2V26A 1OCTC 2MH2A 2TRTA 2VJJA 1BIAA 3K70C 1O7LA 1XPXA 4U88A 2JA7J 2QLZA 4BKXA 4EGYA 4XOPA 1FSEA 5DCMB 4CCLA 1KQ8A 3C18A 4OIRF 4X1EA 2YZ3A 4DGWB 4MTEA 1F4KA 2CUFA 4NUBA 4BDZA 1NH3A 3TEDA 2LOOA 4PGHA 1ON1A 2HYGD 2XAUA 4CDGA 5KHDA 2LG4A 5IYCJ 2L2OA 1W7PB 1YE9A 3MZ8A 4XOTA 5B66C 3T3OA 3CMAI 2ZMEA 1UMQA 3GXOA 4EJVA 1K78A 3CO7C 4OIPF 4J5HA 4NQ5A 3DU6A 3WGIA 1JI8A 2AIOA 4IX7A 3CCLI 2E2HJ 2JQ7A 4BE2A 4LG0B 2R4GA 5LS3A 1OQYA 2PMHA 2P4ZA 3CC2I 5JLWA 4LK1F 3I64A 2GM4A 5HLGA 1GVDA 5H6QA 1QQIA 2KT0A 3S1QJ 1ETYA 1Z9CA 2HZDA 2DTRA 4ZYDA 3OYCA 4FR7A 3TP9A 1G3TA 4YIIA 1ZNBA 3I0TA 1X8HA 2XVCA 1KO3A 3BT9A 1W4MA 3D5RC 1BOAA 3CF5F 1U8BA 4RGSA 1S29A 4PSWA 4G7OF 3R0JA 2L7ZA 4HPQA 3TO6A 3FF5A 3LAJA 4C1DA 1Y8RB 3JRAA 3E0JB 3K70D 1D5YA 3FXLA 2HQ5A 4DBRA 2C6YA 3I0VA 1XMXA 3S0ZA 1MBJA 2WTEA 3F8CA 2Y8AA 2EIJH 2EV0A 2XSJC 1VZ0A 4M6YA 3S3OA 4A3IJ 3PSFA 3HUGB 4RGUA 2QZ8A 1X1BA 4R1HA 3S93A 3GVAA 5B1AH 4Z6YA 2NNYA 2PJRA 1HOMA 2OHHA 2WAQA 3JRHA 2XR1A 5BPIA 5D4SA 3L2VA 3ZQGA 3PJRA 1VMEA 2OHIA 4HA8A 4Y4RA 3LA3A 4XLFA 2HQRA 1JTYA 3W2WA 3ML6A 4RBOA 1U3EM 2ADUA 3LSMA 1E17A 4Z5YA 4XR6A 1P9QC 2DOOA 2X1DA 3PQKA 4MEYF 2FHXA 3E7LA 2W57A 1QPMA 5DCMA 1T8IA 2L7FP 2RREA 3BP8A 2Z99A 3Q9VA 3P2UA 4D1WA 5TGTA 2WY8Q 1ACIA 4AIDA 4HBLA 2BMIA 4OIOF 2HU9A 4RGRA 3FXKA 3MQ0A 3OWTA 2EFOA 2KIUA 4BBRJ 2A07F 4J01A 1G3YA 2CGPA 1IF1A 3JAMK 2XF4A 1JUSA 1A31A 3LL7A 4NC8A 1A8TA 3QP5A 4XSXF 4C2MJ 1KZHA 2M5CA 1SANA 2BFKA 1QVTA 5LEJA 2ESNA 2R7DA 3TO9A 2HYJA 2F4MB 2A68F 4XRSA 4N4OB 4V2FA 1BN5A 2H94A 1FBUA 2VB6A 3DBLB 1FTZA 3CO6C 4GO1A 2BG8B 2Y31A 5IT3A 4PFOA 3BTCA 2I7XA 4LB5A 4RDUA 2CJJA 3GFMA 3AG3H 2CQKA 3ZPLA 1MKMA 2BFZB 1U9NA 1VQ6I 2FOKA 2NVYJ 3RTRA 3WU1B 2ZFUA 3M07A 4WXCA 1S3JA 2GLOA 1MMNA 5B1UA 3ZMTA 2MC3A 4ASNA 1Z7LA 4MLOA 4P62A 4KUMA 3JSOA 3C2GA 1KGSA 3E97A 2VT2A 3FK7A 2E7WA 5J1UA 1BBYA 3HJEA 2NVQJ 1E3PA 1N75A 3SD9A 3RZOJ 4FX0A 4XIDA 2KP6A 2OQRA 4UWRB 3J81Z 2LKSA 2YUSA 1SMLA 1MQOA 1M2XA 4YSLA 3REOA 4BJ6C 2G9WA 2CQQA 1I6XA 5ACQA 3MKWB 1IG7A 1A6QA 5K0WA 1WGXA 3MD2A 1USTA 1NG7A 1SD5A 2YNVB 1OYYA 2XGDA 4M9SA 2QSFX 1AOYA 2Z2SB 3L2WA 2M5DA 4ZYEA 1NK2P 3W6VA 3DF8A 3TKYA 1BIBA 2G7HA 2IP2A 1DPRA 3D1NI 2K9NA 5F27A 5EG0A 2P6TA 5HDNA 1H89C 3Q0WA 1FZPB 3NWSA 2KKOA 4I0BA 5IQKA 3SEZA 4A3BJ 2DDAA 2LRDA 1EKEA 3HOYJ 1CGPA 1P6RA 1TZLA 5IP7J 4Q5SF 3KZYA 2E1MB 2ZMEB 1K6YA 4NNJA 2Q9UA 3IH3A 4FEKA 3CP8A 4IPAA 2IGNA 3KLOA 5KVRA 5D5XB 2B9SA 2IJLA 4XKBA 1AU7A 2HYFA 3H92A 2XKPA 1AKHB 3LSIA 1FMVA 3HSFA 3MEXA 2H1LA 2VI6A 3C3WA 3KCCA 3I14A 2NVUB 4GDFA 1NK3P 5DDGA 1QVUA 2XPWA 5FKNA 3B6AA 1Z0XA 4BQQA 1XSXA 2HQNA 3SEQA 4PDXA 1OISA 1XS9A 1T39A 1R4NB 2HOEA 1Y1VJ 3SRXA 3OY9A 4J00A 3WTVC 4I2OA 3VOEA 3K1NA 4DBQA 3GWZA 4ON0A 2E1MC 2DU9A 4Y13A 5HVQC 4U7BA 2Q2EB 3P7NA 3HRUA 1KU7A 4M73A 1EV7A 4RAFA 3C2BA 1X3WB 3SFIA 3HOZJ 5A5ZA 2FE3A 1R1VA 3PFYA 5EVDA 2Y2ZA 2E5NA 4DYQA 2XB0X 1Y56A 5D8LB 1YLFA 3O8HA 2R7WA 5FKOA 2RN7A 2JPCA 5KILA 3SXYA 3BR5A 2RNJA 1TW2A 1QH5A 4HX7A 2VE8A 3RKXA 2DMQA 4GGGA 1UCRA 4PSXA 2DQRA 2W84A 3PUFA 4UVBA 3ZQ7A 4A3MJ 2DOAA 1P7JA 4C9YA 5L3GA 2DPDA 4FETA 3IEMA 2JK3A 1S6LA 1WJAA 3HPGA 3VQZA 4C1HA 2KIFA 2KPMA 3FBNB 1G59A 1GXQA 1REPC 4QPQA 4QSHA 3WGHA 2EH3A 4A2UA 4ENNA 4BEHA 4KT6A 3HOTA 2FU4A 1XMAA 3KP3A 3V7RA 2KRFA 2KL4A 2L02A 1G8XA 5EGOA 1O3RA 3A03A 2HTSA 4PJNA 2P18A 2QBYB 1WJ5A 1ZYRF 3FBIB 5GAEJ 4PJLA 4HLYA 2A7MA 2FQ4A 2E71A 3H3VK 5LM6A 3WE3A 4P96A 3ZRGA 1FJLA 1SFKA 3VYUB 2PBIA 4DOZA 4EVIA 3FXUA 4D5FA 2DN0A 1IRXA 1GXPA 4IQ4A 2E2IJ 3ONQA 5ICEA 2XF6A 1OCOH 4G94A 3PQJA 2JSPA 1ON2A 4BAYA 4FTHA 1G3SA 1R49A 2BFZA 2XRNA 3VODA 3BG3A 5HS8A 2M34A 2QSHX 4M3BA 2R5ZA 1XX5A 3A0BC 5E20A 1U5TC 1FP2A 4HV5A 3VYSB 5ACPA 3ZMVA 1SD4A 5FB2A 3T8TA 3JRCA 5EJCA 1CF7B 3ZCOA 1T0FC 2WHGA 3G1OA 4HEA2 2JA2A 4MIMA 5C44J 1JJTA 3KX2A 1KYZA 3H9JA 5DPXA 5ACTA 2CS3A 1R36A 3X30A 2Z3YA 4WWCA 1NTCA 2K9QA 3QOEA 3A01B 4E7HA 3JSPA 3FXRA 3CDHA 5JVGF 2MSYA 5HNHA 3IAM2 1VQ8I 4LLLA 1OFCX 1RKWA 4C3HJ 3QYEA 1LFUP 2YNTB 2XGXA 3CF2A 2CH0A 5BMZA 4E4HA 4JX6A 3SBLA 4HNTA 3WXCA 3CMMA 2GXAA 1R5ID 5GADJ 2PFBA 4YIFA 2QQAA 1FYMA 3AJ3A 3VSKA 4L5IA 1H8AC 3EUAA 5F0CA 4OU0A 3GTPJ 1RPWA 1SMYF 1F9NA 2VKEA 1VQ5I 2IEKA 5BOXA 3DLAA 3OIOA 4A3CJ 1MSEC 1DUXC 2GXGA 4KMFA 3QPLA 4OMZA 4HDVA 5FQCA 2FBHA 2CU7A 2ZJ2A 4XRSG 4HKYA 4WF2A 3BTLA 1TT5B 4WXDA 1ETWA 2CFXA 4KYWA 3B02A 2FD5A 3HRTA 3HYIA 4KMUX 3RKYA 4HF1A 4XNFA 2DO7A 3ZQIA 2E1OA 4XLNF 2HVRA 4NB5A 1Z77A 3J7AO 2R7QA 2IAIA 3F8BA 2MBFA 2ZXHA 1BL0A 2I5UA 3GEZA 2XC7A 4IOCF 3HOXJ 3JTGA 2JWTA 5HS7A 3AF5A 2DJNA 2CSOA 3BWGA 4MHGA 4FX4A 1C0WA 3ERMA 1LVKA 3FM3A 4ZH4F 3RPQA 2XB5A 1I50J 1ZKGA 1STZA 2ZXJA 1DP7P 2DOEA 4F91B 3KFWX 1YRNB 1TTYA 2L5QA 1ZAOA 2DXIA 2YNVA 1IN5A 3AL0C 1R71A 3TMOA 2IGOA 4IHVA 4NQWA 1LQ1A 2DT5A 4D1TA 3F6VA 1ZK8A 3Q3SA 4XKWA 5GTHC 3HEFA 3S3MA 3WE2A 2PJPA 3M7GA 2CBNA 2X6YA 4LITA 2H6BA 2HKOA 2FK6A 4IJAA 3F3XA 3JREA 3SJMA 1VQPI 4Y17A 1Y44A 2BVMA 3K69A 1D8JA 2VKDA 1U2WA 1UELB 2E7YA 5EZGA 3JR9A 5AHOA 1F43A 4BQOA 3WG7H 5D5WB 4XONA 1R58A 5ACRA 2GIVA 3J7AY 4DNCA 3HXLA 2FBIA 3WTXC 3P5JA 4L0YB 1CF7A 3W2AA 3LFKA 4RB0A 3S16J 3CTAA 3C1DA 1GUUA 1VNDA 1U6GA 5JVTA 2ISYA 1XDSA 2K85A 2QQBA 3FWEA 3KNRA 3BZKA 4F7ZA 1X1AA 3KP7A 4HG2A 4EGZA 3DHAA 5GTIC 4C1FA 4RB1A 1GV5A 4KIFA 1YIJI 2K40A 5LE1A 4CGZA 5K5RA 1LFBA 2DOFA 4FSBA 3BJOA 4HX4A 3K9TA 3PO2J 2YSRA 1FC3A 5DEQA 4C2UA 2OCEA 2ISZA 2E5ZA 4O98A 2H1KA 3W2VA 3ESWB 3G1PA 4HSTA 2LY2A 4HX8A 3RYPA 3H9QA 1FYKA 2FMLA 2RAEA 2XGCA 1O3TA 5J8CA 4A3EJ 5F1RA 3K0LA 5L3DA 3SDBA 3CMYA 2BC2A 5ACXA 1MJAA 2HEOA 4HW0A 2ELKA 2DMUA 2QEDA 2QUFA 4EYBA 3CUQB 2W00A 5LFAA 2XAQA 3OYLA 1XGSA 3GFIA 3T9MA 2DW4A 1FWZA 3FXOA 5EDNA 4XLCA 5GAGJ 2JZYA 1F1ZA 2GCUA 2F5VA 3PIOF 5EEGA 4G6TB 3OS1A 4UWPB 4BP0A 2O6GE 2V7FA 4I76A 4CHLA 5HH5A 3RSNA 3GTOJ 1MGTA 2CQNA 4HQEA 3HTUA 5GPCA 2G0EA 4B44A 3LSPA 5H6RA 5D8KB 4TYFA 3BPXA 4U87A 3V7SA 4PK4A 1ZGJA 2E36A 4PJMA 2COBA 1P7IA 1WCMJ 5IYBJ 1B8IA 1BW5A 2VN2A 3I4NJ 2EQRA 1YOVB 3DKWA 1XSVA 2IA1A 2BGAA 2BFLA 1SD7A 4EM2A 4YG2F 3SPUA 1TWCJ 4M3EA 1SFEA 4MQVA 3JTHA 3BQZA 2IS2A 2M8EA 2JUGA 2LLKA 1JJ6C 3HB9A 1HKQA 2JUCA 2BY2A 2BHZA 2XGEA 4W1UA 1S7OA 3O6BB 4MEXF 1MBGA 1OR7A 2XDVA 4I0AA 3MFKA 1FOKA 3CZ6A 2QKMB 1UHMA 2JRTA 4YEJA 3SDGA 3S2HJ 2J5OA 2R2DA 2AO9A 2DODA 2ZB9A 4RAYA 2W85A 2CO5A 2F48A 4S05A 1GVJA 2WADA 1IZ1A 2KDOA 4Q47A 2HTJA 1J0RA 3DLLF 4BE1A 4L0ZB 4LG0A 1JGSA 1X2NA 1HF0A 3ZQ4A 4D02A 2M87A 1IUYA 1J75A 4FCYA 2Z16A 1DP3A 3GF2A 2JA5J 2P7VB 2QA4I 1OYWA 2VQLA 2FHXB 3J80K 2HPMA 4I6ZA 5KAFC 2ZNZA 2CUZA 3ZQQA 2XUBA 3DWLE 1BOBA 1HW2A 1IXRC 4UUVA 1MDMA 2PMZN 3OYJA 3AL0B 3RCOA 1Z6TA 5ERIA 3WG9A 2HWVA 2KJBA 3OYFA 3FAIA 1XCVA 1KONA 1HQCA 5D6EA 3F8MA 1I39A 2CW7A 2LBFA 4A12A 3DPUA 3Q5FA 2BBYA 3OYNA 2WV0A 3WODF 3CCQI 1ZG5A 1WHUA 4KIGA 3PIPF 1R5HA 4X0GA 5FFZA 4EMSA 4BDYA 2NXAA 3MD7A 3IE0A 2N8GA 4P55A 1XG1A 3I58A 3ASNH 2I7VA 4ENKA 3BJAA 3A4CA 4XN3A 3L6NA 4HL2A 2HQAA 2W4SA 3CCJI 1K61A 1B4AA 2GQQA 1AHDP 5LBQA 4ZEJA 5DS9A 3ZGKA 3BK1A 2V6EA 1SVLA 2Z1DA 5FO5A 3JRBA 1T08B 4M9ZA 2E7XA 2CQXA 1TBXA 3GFJA 1JKRC 1CQTA 4A3KJ 5KK1A 1VQ4I 5LCFA 2A05A 1MNMC 4ZTJA 1OCPA 2Z9OA 5M5WJ 3GZ6A 4ESJA 2NZFA 3EYYA 5CVJA 4PVTA 4L9NA 3HOUJ 2ZMEC 1OJLA 2JMWA 5LRRA 1TWFJ 2NS8A 5DUIA 1TC3C 4GCWA 3OR2C 5EEHA 4BHCA 4XUKA 3E6CC 1PVEA 2FBKA 4LD5A 1MBFA 4HSRA 4DW6A 3J81K 3BR6A 5FJ8J 1Z1DA 4G7ZF 4RAGA 3K1PA 2L01A 2H09A 4N9IA 4HQMA 1D1BA 3BY6A 2KJCA 4P9FA 4M74A 3QPSA 4KEPA 2BXYA 2MW8A 3K1MA 1UB9A 2F6CA 4C30A 2VODA 1SVMA 3FXMA 3AAFA 1DQUA 3QYBA 1K6OA 1YITI 1Q1VA 1HKSA 2K5CA 3L7WA 5D5VB 4EXSA 5LLDA 4HYEA 2R7XA 3QU3A 3EUKL 5FLXK 3H5NA 1VTNC 1SEUA 3E5UA 2WYLA 3T1BA 1A6IA 5GAHJ 4C1CA 2OAZA 2NYPA 4XORA 1T95A 4IZZA 4ZC3A 1S7AA 3AF6A 1IXSB 2NS0A 1YTYA 5FLVA 1A7TA 3DU5A 1VGNA 2K9MA 1ZREA 1D3YA 1ETQA 1UG2A 1MMGA 2MD0A 5JR3A 2ETHA 5K7HA 2DTZA 4F93B 5IP6A 3U1KA 4A6DA 3BCAA 2X1CA 3GZ5A 5LGUA 2AZ4A 1IC8A 4XWWA 3DP7A 4L5JA 2OC6A 2E35A 4PGGA 4EJWA 2B63J 2FSWA 3JCUC 1H9GA 2EZHA 3BQYA 3ZMUA 5LRSA 2HDWA 4XBFA 3CJNA 4R79A 4A93J 2VQCA 2IS4A 2DA5A 3V42A 4P1WA 1P92A 3DTEA 5EF6A 3I4PA 4WCGA 5EV8A 4EQQA 1E3HA 1G3WA 2ZKZA 3DHCA 1MD0A 1TWAJ 3GTMJ 3GTLJ 2UUZA 1S72I 1XMKA 2D5VA 1LJ9A 3RKQA 5IT9K 2Y87A 2WY7Q 1BM9A 1EJ9A 2STWA 1ZGAA 4FHTA 1D0ZA 3E6MA 1W5TA 3VYRB 3F8FA 3LAPA 2O8KA 1Y6IA 4BU2A 1MMDA 2M4GA 3TBIA 4EATA 5FFXA 4KJZA 4NQ2A 3RPUD 1Y1WJ 1FOYA 4ZDPA 2IGKA 5F0FA 3I59A 3OOUA 1YX5A 3RPUA 4E7SA 1A36A 3S2DJ 1X58A 2EWNA 2ZC2A 4F55A 4IRIA 3GLXA 1V3FA 2Y69H 1WZ2A 2YU3A 5E18F 2DK8A 2KQRA 3MKZA 4WXHA 2RV8A 3HRMA 2JVGA 2RC4A 3K6GA 4A5MA 2A6HF 3QYFA 1YYVA 4NQ6A 4YRVA 1W5CC 4YELA 3WGGA 5C4JJ 4M71A 2Y9ZA 1PJRA 5F04A 3G1LA 3DEUA 1W5SA 3I3LA 3LVZA 1U9OA 2LP0A 1DU0A 2VPLA 4F6HA 3BZ6A 1FX7A 1JJEA 2R92J 1L9YA 2XPUA 3VWBA 1WJDA 1W7PA 2K9SA 3CCSI 2M0MA 2PQ8A 1ENHA 4IL6C 2KDZA 2DMNA 2E34A 4EXYA 3KEOA 3A2KA 3F22A 2DA3A 3MWMA 4AWYB 2IA0A 2FU9A 4EYLA 4TZFA 1HBXG 2OUMA 5AONA 5F0HA 5TRDA 3TO7A 1IV8A 3ZMDA 3KZIC 2YCBA 4XSZF 2ZJPF 4CCOA 2CFUA 4FASD 1OCRH 2DA2A 2O03A 2CWEA 1XGMA 3OL3A 4OAYA 3HOWJ 2EZLA 2QQ8A 1LE8A 4R8HA 4E7LA 1WUPA 4AC0A 3TL4X 5HS9A 2VW8A 1ZARA 1MBEA 5JHFA 1U78A 4RM5A 3U21A 4RL0A 2KHMA 4F92B 3HL2A 3CCEI 4D1QA 3ZOBA 4BJTA 4J19A 5LSCA 3OYMA 3K4MA 3CJQB 1VI0A 1Y39A 2UYXA 3IP4B 2ID3A 2WA0A 4OOIA 3ZP5A 4U7DA 5FD5A 2W82A 2FMYA 3OSFA 4UHTA 2BG6A 3BC2A 3ABKH 2F5DA 2I8DA 2I10A 5KIKA 2QDSA 1QZYA 2P6SA 2JA8J 3O2PE 3ABLH 5IOYA 3K4NA 5AHRA 2R7RA 3A1YA 4ZZDA 1OYIA 2WB1A 5DD4A 3SZGA 3MKYB 4IRHA 5J40A 5A23A 4BZ3A 4L18B 2OZ6A 1HSJA 2L9VA 1B9MA 4B1RA 3DEEA 2YX4A 4IHWA 3EETA 5CVUA 2FQ3A 4KN7X 3OS2A 1VQ7I 3PY6A 2EFPA 1N77A 3ZR9A 3WTYC 2XAFA 1IN6A 3JXPA 2JN6A 1LNWA 4V0HA 4G9YA 5E3MA 1ZGWA 2F4IA 1TL8A 3SQNA 2VE9A 4IHYA 3EQLF 2XPVA 1WI9A 2HGCA 1VQKI 4L9VA 2K9LA 4JBAA 3TQNA 2ZSIB 1HA8A 1G6NA 4GYUA 1L0OC 2ME0A 4JYKA 2IVMA 3DPTA 4AD9A 3Q6VA 5EH9A 1ERDA 2LR8A 4LIUA 2GXBA 3IDZA 2UV1A 5FROA 2HDDA 1V5EA 2AQEA 4G8XA 1S9HA 1YS6A 4L5EA 3OYKA 4B09A 2FEZA 1Z6RA 2HDCA 3G3ZA 2KFDA 2V9VA 1JE8A 3WU2C 3GTJJ 2LSOA 3L1PA 1R9TJ 3CESA 5E1WA 3JRDA 4B48A 2VL8A 1HC8A 2J5PA 1JKPC 2ZJRF 2Q0IA 4D0PA 3UR3C 5J1RA 5M5YJ 2HZTA 1P4XA 2VC1A 1R5GA 5E1ZB 5EG0B 1X4PA 1OPCA 3D5LA 3HOSA 2VLAA 1TQPA 2STTA 2DKFA 2LC2A 2LD5A 3F6OA 1QRYA 3TP0A 3G6EI 3W6JB 1B59A 4GXOA 3L2UA 1VQ9I 3PFIA 3X2XA 3CQZJ 2L4MA 3CCYA 2KZGA 2X6OA 3D5SC 3K10A 4HV6A 2RGVA 2EV6A 2QVOA 1V54H 4UVCA 1FEXA 1FMWA 2BW3B 3UKGA 3A0HC 5K7FA 1R1TA 4ZZLA 3J7YJ 2D45A 4RM3A 2G7UA 2VIXA 3P9IA 1P4WA 3IUOA 4G6QA 3PSIA 1FOXA 3KPHA 3DPLC 3S3NA 4PDKA 3HTSB 1K4TA 3FMQA 5HLHA 1FPQA 4E7KA 1EF4A 5ICGA 3M9AA 2PLYA 1SMTA 5JLXA 3QRFF 4BY1J 5B15A 1YCGA 4H0DA 5ACUA 1APLC 1FTTA 1E2XA 4NURA 4XKVA 5AIJA 3H5RA 3TW6A 2ICWG 1MIJA 1EH7A 3V7CA 1MSFC 2OHJA 3KL7A 2LTPA 2DPUA 2LF7A 2ESHA 3KEQA 2ZO4A 4AV7A 1FNNA 1X8IA 2Y0SN 2PMUA 2DDBA 3E5QA 3ECOA 4OWRB 4YIRX 5FRMA 1Y0UA 4I7HA 2DA7A 3LSKA 3HSEA 4BHBA 4GCVA 4C1EA 3LFUA 2BVLA 3S15J 1IN7A 1GV2A 4M6XA 2AXLA 4IF4A 4HZFA 3GW2A 2QCOA 3I9V2 2Y30A 1P4AA 1QZEA 2EFNA 4XRFA 4AM3A 5E17F 3NQOA 2PN6A 1JKOC 2FXAA 4LJZF 4A0YA 2BZTA 3VPEA 3DBHB 3W6KB 4D1UA 1ETXA 2DFFA 3K4JA 3RKWA 2M5WA 3DV8A 3QQAA 2EILH 1HSTA 3HG9A 3QPHA 2HOAA 4LIVA 5CKTA 3KYDB
chains in the Genus database with same CATH topology
3R2UA 2LNBA 3IC7A 4MQ9F 2FU6A 2XROA 4AVPA 3CUQA 3ZMSA 4A0XA 2YNTA 5FQAA 3C7JA 2GAUA 3GFLA 1QZZA 3FCZA 1OMIA 1WQ2A 3BPVA 2P1EA 3D0SA 3J80Z 3I59B 2XASA 4IHSA 1LDJA 1DD6A 4EY2A 5D5UB 4LGWA 3OV8A 1BI3A 4CHUA 2F2EA 2P7CB 3PY5A 4KDPA 2WYMC 6PAXA 4KIBA 2A3SA 3DHBA 2WYMA 4UAMA 1ZLKA 1LEBA 2H6AA 4EV0A 4DQ2A 5HOOA 3DH8A 2VBXA 1LEAA 1RUOA 2ACJA 3IL2A 3IRRA 1IRGA 4Z67A 2MLGA 2XHKA 3ZWFA 2FNPA 2BYVE 4L9TA 1ONVA 5ICFA 1FY7A 2TDXA 3MAJA 1WKMA 4UXNA 4QWQA 2Z5UA 5A2QK 2I7TA 4U0YA 1E5DA 4LB6B 3DXJF 4ZYGA 2RKHA 4Z6XA 4BYYA 2YR2A 4U0WA 2B0LA 5HIQA 5DYMA 3TOBA 3HIFA 2VBZA 2CYYA 2GA2A 1WRAA 1YW8A 1R22A 2OA4A 1HKTA 3CLOA 4Z5ZA 2BEOA 2RDPA 3F8NA 2L54A 4N0BA 5K5QA 4OIQF 3SW3A 1IW7F 3O3KA 2FF4A 1EH6A 1XDUA 1ZG3A 4HAMA 3V8KA 2KIMA 1GHCA 3EUHA 2XV4S 4P5OA 2K86A 2QWWA 3VFZA 3VB2A 2IW5A 4O3MA 1NHAA 3T5XA 3FZVA 4LFUA 1T98A 1T38A 3L9FA 2M1BA 5K4MA 3RKJA 3LA7A 3ZMZA 3L2CA 1RIOH 3WTZA 5B3RA 1RNLA 1RI7A 4AIHA 3E5XA 4I01A 3KE2A 4ETSA 2BGCA 4FT8A 1IN8A 4IRGA 1JHHA 3IE2A 2LDUA 4JK1X 1X8GA 3SZPA 4MGRA 3H3ZA 1BC2A 3U2RA 5CVRA 2F5CA 1G4DA 1J2XA 1KQ0A 4LE6A 2F5FA 3RYRA 3M8FA 1AWCA 2R7FA 2EA4A 3X2YA 3QOPA 4Z60A 3QU6A 4WD6A 3CUQC 1XD7A 4EM0B 2FRHA 4CZZA 3WTUC 3I11A 3RPCA 5EW0A 4Z2YA 4TYTA 4UWOB 2D2WA 1YG2A 2PI0A 1TNTA 4D1VA 1BC8C 3HUGA 3SFPA 2K4BA 5D4RA 1SFUA 4EJUA 1U5TB 2K7LA 3V4GA 4CO8A 5AXRA 1BVTA 3IKTA 4UVAA 2M45A 1D8KA 2H27A 4I02A 5HIOA 3DFGA 2L3DA 2X4HA 1W7PD 5HH4A 4EJTA 4IVNA 2GWRA 2DAOA 1P9EA 4O5VA 4LLNA 4S04A 2QM3A 1XTOA 3NRVA 3WU0A 2DLLA 2P5KA 2QINA 5K4KA 4UBQA 3ELKA 5HISA 2O8XA 1SD6A 3M8EA 4TZEA 3R60A 2XAJA 3JW4A 2XAGA 1BC7C 4KNYA 2YNUA 4UA4A 3IE1A 5LEKA 4YFKF 2NNNA 5BPDA 2YPRA 2BTNA 3RJPA 4JQFA 1MDMB 4N9HA 1MJ9A 3TGNA 4RB3C 3QH8A 2BG7A 1UFMA 5A0VA 1XSDA 1I5ZA 2V6CA 3IWZA 1R7JA 5LGNA 3RI4A 1I1SA 5FD6A 2BV6A 2Q0OA 1J59A 1DXKA 5LHGA 1T0FA 3IELA 5AEBA 3GO5A 4ENMA 1U5TA 1YW9A 5LMCA 3LWFA 3JAMZ 2F5EA 3HHHA 5DD8A 5CVVA 3F9OA 1BI1A 4XWTA 3QAHA 2EB7A 1Z91A 2UXNA 3R0AA 1KQ9A 2MD5A 1XGNA 2Y48A 1J9IA 2V1UA 4G6DA 2WC2A 5TJJA 5ACWA 1KA8A 4DILA 2ZNBA 2O0YA 1RUNA 3DQVC 2K27A 4RB2C 4RBSA 3IRQA 3LQRA 2GFJA 1B1BA 3ROUA 1XGOA 3QPTA 2GKLA 1ZN2A 1HXDA 2A61A 1DDNA 5AYAA 5ICCA 3ZN1A 5K4NA 2P97A 3KP5A 1JXSA 1XB4A 4EJOA 1FP1D 4LK0F 1JT1A 2Y75A 3KZZA 2DBBA 5HDGA 5J6XA 2BIBA 1VJNA 4L9JA 2QYOA 2CG4A 1TW3A 5FQBA 2PG4A 2V1XA 5LLQA 4KA4A 1J5YA 3BDDA 2QJSA 2VBWA 4I09A 2EFQA 5E8GA 1ZRFA 2NRAC 3VEPA 3KETA 3I15A 3SZTA 5CVIA 3A4YA 3KP6A 2UWMA 4H0EA 1YFHA 4U4LA 4RAZA 3COAC 5H20A 1LVAA 2HS5A 2HKXA 2JTVA 2GMNA 1T6SA 3HRSA 3GYHX 1U8RA 1IN4A 2Q8KA 3ZN0A 4ENJA 4J5FA 1LDDA 2ZZIA 2ZFWA 2DFIA 3L00A 4O6JA 3BOQA 4KT5C 4QLCU 2OU2A 2UZKA 2Q2EA 2COMA 2XAHA 3MZHA 5AXOA 4EFZA 3FMRA 5JFRA 3WTTC 3I5UA 4AIKA 2XKOA 3KP4A 4C09A 1HLKA 2WWYA 4PCQA 5HLIA 2JSCA 1B6AA 3T8RA 1ZG1A 1ZH5A 1T2KA 4KEQA 3BJ6A 1BI0A 2D1HA 5J8FA 3P9KA 4M9XA 2HR3A 3F72A 2HFHA 2X0LA 3MCZA 5EVBA 1ZTCA 3HSRA 4ZNBA 3FXQA 1MJBA 2LKPA 4P9UA 1S8NA 2YX7A 2K02A 2P8TA 4BXUA 2RVCA 2E1NA 5HDKA 4Y15A 2CW0F 2EFWA 1R1UA 5F64A 1XCBA 3ULQB 4NQ4A 1D5VA 3V8LA 4RL2A 2EK5A 3EDPA 4KFCA 4U0VA 3U9GA 1YCHA 4B87A 4CXFA 2IRFG 3T3NA 5ILSA 2DK5A 4AWXB 2FNAA 2IT0A 1I1GA 2OQGA 5CYVA 5DCFA 2QQ9A 2W25A 3V8JA 4Z7RA 4BNCA 1DPUA 1WWXA 3R61A 3F21A 1RZ4A 2OZUA 1B9NA 4PVOA 1YW7A 3LSTA 1P2FA 1ZLJA 1O3QA 1R23A 1F5TA 2O3FA 2P5VA 2K4JA 2FU8A 1WRJA 4Q4ZF 4WK8F 5L3CA 4TV7A 3BROA 1ZRCA 1K07A 4RS8A 3SHFA 4OMYA 2DI3A 1FSHA 3FHZA 3IHUA 3S2WA 1KO2A 4GYIA 2A69F 5CJ9A 1SFXA 4AIJA 3IEKA 2A6EF 3U1DA 3IOGA 1TQMA 2DQLA 1R00A 4OINF 3LQQA 2NAZA 5EV6A 2MA3A 4AX0B 3L09A 3E3VA 3TDUC 5DUKA 3LA2A 3Q9SA 1K7AA 2PEXA 4K2EA 1I27A 3ERED 4DIKA 2M30A 4M72A 5F6FA 2D1VA 4BH9A 3E6DA 1A04A 1YCFA 4UWSB 2GFKA 5A87A 1YIOA 1KU2A 1DDKA 4AX1B 2O61A 3OOPA 3TOAA 4KN4X 5EWAA 1HW5A 1ZRDA 2LF8A 1TLHB 4EYFA 3GUDA 1JHFA 1FBQA 3I53A 4GYGA 3G73A 5FLXZ 4B8XA 2Y8BA 4GYQA 1Z05A 5ILVA 1L3LA 4UNOA 1FYLA 3ESHA 5AIPA 1FT9A 2MLKA 1LDKB 2ELHA 3IOFA 1HW1A 1O57A 5D6FA 5L3FA 4CICA 5DV5A 4HLXA 3X2ZA 4HL1A 1O7FA 2V79A 4LMYA 2JT1A 1KU3A 4A0ZA 2YNWA 1Z7UA 2JPBA 1YQAA 2FM6A 5FGMA 4F6ZA 3ISPA 5IT9Z 1BMCA 3HHGA 3FX3A 5CLSA 4NHJA 3M1EA 1H0MA 1TQIA 1FBSA 3WTWC 3NEUA 2ZBKA 3ADRA 3R6SA 1PP8F 2EV5A 1J7KA 4TZBA 3N4MA 4A6EA 5LHIA 3QP6A 3ABUA 3BV6A 1MZBA 2P4WA 1WW1A 1XM8A 4AWZA 3GX4X 2QBYA 2VXZA 3CUOA 5L3EA 3PG4A 2EA2A 4YSBA 4HOBA 3FMSA 2NYXA 5BQTA 5A0TA 2NZEA 4Q48A 3I54A 5LCAA 4HDUA 2R3SA 3BK2A 2Z33A 3KLNA 4HF2A 1QGPA 2OBPA 4LLGF 1QBJA 5EVKA 5ILUA 5L3BA 1YS7A 3E6BA 2WRSA 2IPQX 4RGXA 3IWFA 1IXCA 5JHUA 5AIQA 4KICA 1O3SA 1QNTA 5BS6A 4PZJA 1K78B 2Q42A 3ECHA 3MZYA 3P9CA 5ACVA 2UXXA 1WUOA 1ODDA 4MTDA 3TDZC 5K1YA 2HB9A 2OD5A 1TNSA 2V1DA 5HIPA 1H9TA 1WSUA 1IAWA 2H6CA 2W24A 3RDIA 3B73A 2VOPA 4G7HF 1YO5C 5K5OA 5A2QZ 2VT3A 4XLPF 2AS5F 3F23A 1PDNC 3RKKA 3FM5A 5LGTA 4EM1A 2BG2A 1ZHFA 4ESBA 2QENA 2P5LC 2VOOA 4UV8A 4I98B 2E1CA 5EHTA 4E70A 2A5YB 4ZYHA 4UV9A 5HH6A 4RAMA 3ZNBA 5LCHA 2IA2A 4C1GA 1ZKPA 2BE5F 1FLIA 4WX9A 1K79A 1KYWA 1X3UA 1PP7U 4TZ9A 3EYIA 3H3UA 1LB2A 4BHPA 5LHHA 2VC0A 1UHWA 3N97A 2RQPA 4IXAA 3H3EA 4YSKA 3WTSC 1XN7A 2FU7A 2VBYA 3RIRA 1QO0D 4BQAA 4CYDA 1Q1HA 5E1XA 3T0YA 1EH8A 2VONA 3K2ZA 1PUEE 2GA1A 2EJRA 4ESFA 2ZCWA 3SFZA 3KNSA 4A5NA 5ACSA 4JO0A 5JI6A 4ZO3A 3KP2A 1BI2A 2Q0JA 5E8IA 4IHTA 5ED4A 2BG8A 2FA5A 1USSA 2L4AA 1V4RA 2QDTA 2Y0MA 3ABTA 1QH3A 1KU9A 1KR3A 2GZWA 4YFNF 2BR6A 1ULYA 2XIGA 3IKVA 4HF0A 2ZNYA 3I71A 2MH9A 3I13A 4MNUA 2ZWRA 3R4KA 1IRFA 4RAWA 1SAXA 1BJAA 4ZO2A 4YFXF 1OKRA 2MH2A 1BIAA 1O7LA 4U88A 2QLZA 4EGYA 5DCMB 1FSEA 1KQ8A 3C18A 4OIRF 2YZ3A 4MTEA 1F4KA 4PGHA 1ON1A 2HYGD 4CDGA 1W7PB 3T3OA 2ZMEA 3GXOA 4EJVA 1K78A 3CO7C 4OIPF 4J5HA 4NQ5A 3WGIA 2AIOA 4LG0B 5LS3A 2PMHA 2P4ZA 4LK1F 3I64A 5HLGA 5H6QA 1QQIA 1Z9CA 2DTRA 4ZYDA 4FR7A 3TP9A 1G3TA 4YIIA 1ZNBA 3I0TA 1X8HA 2XVCA 1KO3A 1W4MA 1BOAA 4RGSA 1S29A 4G7OF 3R0JA 3TO6A 3FF5A 3LAJA 4C1DA 2C6YA 3I0VA 3S0ZA 3F8CA 2WTEA 2Y8AA 2EV0A 4M6YA 4RGUA 2QZ8A 4R1HA 2OHHA 3GVAA 2NNYA 2XR1A 5BPIA 5D4SA 1VMEA 2OHIA 4HA8A 3LA3A 2HQRA 3ML6A 1U3EM 2ADUA 1E17A 4Z5YA 2DOOA 4MEYF 3PQKA 2FHXA 2W57A 1QPMA 5DCMA 3BP8A 2Z99A 3Q9VA 3P2UA 4D1WA 4HBLA 2BMIA 4OIOF 4RGRA 3MQ0A 2EFOA 2KIUA 2A07F 1G3YA 2CGPA 1IF1A 3JAMK 2XF4A 1A8TA 3QP5A 4XSXF 2M5CA 2BFKA 5LEJA 2ESNA 2R7DA 3TO9A 2A68F 1BN5A 2H94A 1FBUA 3CO6C 4GO1A 2BG8B 5IT3A 2I7XA 4LB5A 3GFMA 2CQKA 3ZPLA 1MKMA 2BFZB 2FOKA 3RTRA 3WU1B 4WXCA 1S3JA 5B1UA 3ZMTA 2MC3A 4ASNA 4P62A 4KUMA 3JSOA 1KGSA 3E97A 2VT2A 2E7WA 1BBYA 3SD9A 4FX0A 2OQRA 4UWRB 3J81Z 1SMLA 1MQOA 1M2XA 4YSLA 3REOA 2G9WA 1I6XA 5ACQA 5K0WA 1USTA 1SD5A 2YNVB 1OYYA 1AOYA 4M9SA 2M5DA 4ZYEA 3DF8A 3TKYA 1BIBA 2G7HA 2IP2A 1DPRA 2P6TA 5HDNA 1FZPB 2KKOA 4I0BA 5IQKA 1CGPA 1P6RA 4Q5SF 3KZYA 2ZMEB 4FEKA 2Q9UA 4IPAA 3KLOA 5KVRA 5D5XB 2IJLA 2HYFA 3H92A 2XKPA 3HSFA 3MEXA 3C3WA 3KCCA 3I14A 5DDGA 1XSXA 2HQNA 1T39A 2HOEA 3SRXA 3WTVC 4I2OA 3VOEA 3K1NA 3GWZA 4ON0A 2DU9A 4Y13A 5HVQC 4U7BA 3P7NA 3HRUA 1KU7A 4M73A 1EV7A 5A5ZA 2FE3A 1R1VA 5EVDA 5D8LB 1YLFA 2RN7A 2JPCA 5KILA 3SXYA 2RNJA 1TW2A 1QH5A 4HX7A 2VE8A 3RKXA 4GGGA 1UCRA 2DQRA 2W84A 4UVBA 3ZQ7A 5L3GA 2DPDA 3IEMA 1S6LA 4C1HA 3VQZA 2KIFA 1REPC 1GXQA 3WGHA 4A2UA 4ENNA 3HOTA 2FU4A 1XMAA 3KP3A 3V7RA 2KRFA 2L02A 1O3RA 2HTSA 2P18A 2QBYB 1ZYRF 4HLYA 2A7MA 5LM6A 3WE3A 4P96A 2PBIA 4EVIA 3FXUA 1GXPA 5ICEA 4G94A 3PQJA 1ON2A 4BAYA 1G3SA 2BFZA 2XRNA 3VODA 5HS8A 5E20A 1U5TC 1FP2A 4HV5A 5ACPA 3ZMVA 1SD4A 5FB2A 3T8TA 1CF7B 2WHGA 1JJTA 5DPXA 1KYZA 5ACTA 1R36A 3X30A 2Z3YA 4WWCA 3JSPA 3FXRA 3CDHA 4LLLA 2YNTB 2XGXA 5BMZA 3SBLA 3WXCA 2PFBA 4YIFA 2QQAA 1FYMA 3AJ3A 4L5IA 4OU0A 1SMYF 1F9NA 5BOXA 1DUXC 2GXGA 4KMFA 4OMZA 4HDVA 5FQCA <