2ZO4A

Crystal structure of metallo-beta-lactamase family protein ttha1429 from thermus thermophilus hb8
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
315
structure length
301
Chain Sequence
ALLPGLYLLPVPIPYPLKTVNLYLLQGAGEVALVDTALGTRAARGALELHLAELGLCFQDVKTILLTHHHPDHYGLSGFFEGLGARVFLHEEEFARGHRFWREPEAFAEASWRLFLDHGTPEETVEKTRERVHPPQNPLPLRDGEALEVAGKRLRVLWTPGHADGHAAFYLEEEGVLLAGDALLEKVSPNVGLWAYTRENPLKDFLRSLDRLADLGARVAYAGHFGPIADVRQRAEELKAHHQARLEALLALLDGPKTAWELSLHLFPRRFAFAETLAHLEYLREEGAVGRGGPPYRYFRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of TTHA1429, a novel metallo-beta-lactamase superfamily protein from Thermus thermophilus HB8.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Hydrolase
molecule keywords Metallo-beta-lactamase family protein
total genus 100
structure length 301
sequence length 315
ec nomenclature ec 3.-.-.-:
pdb deposition date 2008-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2zo4A02
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 2zo4A01
1ZYRF 3E6BA 1FZPB 2FU9A 3MCZA 4Q48A 3VEPA 3KZZA 5ICCA 2F5DA 1LQ1A 2Q0JA 5EV6A 3TP9A 2G7UA 4HDVA 4EXYA 2PEXA 3JSOA 2HDCA 4L5JA 2FE3A 4Y13A 2FOKA 4EVIA 4BHPA 2C6YA 2M8EA 2RDPA 3F8CA 2RVCA 3R4KA 4TZ9A 4DQ2A 3HOSA 1RUNA 1ZKPA 5B15A 5LEJA 5A2QZ 3CO6C 3IEMA 3G1PA 3IELA 3P9IA 2O0YA 1GXPA 1P4XA 3DQVC 4NQWA 5A2QK 4V0HA 2V1XA 4OOIA 5D8KB 2DBBA 5E1XA 2XAGA 3N4MA 2KRFA 2NYXA 2ZCWA 1FBUA 3K9TA 2PBIA 3E5UA 4M71A 2QYOA 3FMRA 1R5GA 5DUIA 4WWCA 3SFZA 4RB2C 4UWPB 1JHHA 3BC2A 2AZ4A 2DQRA 4WXHA 4Z6XA 3F3XA 5HDNA 4L9JA 1LNWA 1CF7B 2FBKA 1D3YA 2HYFA 3DXJF 2VODA 4XLPF 4TZBA 4RB1A 1SD7A 4MQ9F 4MQVA 2Y48A 2OQRA 2STTA 2QINA 4YFKF 1FBSA 3RDIA 2OHJA 4U0YA 2BR6A 1WI9A 4I7HA 4UVAA 3ML6A 2FNPA 4HQMA 3X30A 5D5WB 3IE1A 1ON1A 4L0YB 1SMYF 1TNTA 3GZ5A 5E8IA 4Z5YA 1KQ0A 4EFZA 2BV6A 1S6LA 1FYMA 4LGWA 2IA2A 4HX7A 1ZG1A 2BG2A 2EFPA 3X2XA 4B09A 3BWGA 2WWYA 4EYBA 2A6HF 5DYMA 4GGGA 2BFKA 3WGIA 1ZTCA 1R22A 2YNVB 4CZZA 2K27A 4F6ZA 1W5TA 2HQNA 2KKOA 3DEUA 3FF5A 5LGNA 1JT1A 3ZP5A 1KA8A 1S8NA 5D5UB 4YFXF 3M8EA 3JAMZ 2FEZA 4M6XA 1HW1A 5FO5A 5LHIA 4D0PA 3LSTA 3F23A 1IRGA 3AF6A 3ZMTA 4D1VA 1XSVA 5L3EA 2GFKA 3E5QA 3WTXC 1HBXG 2A68F 5ICFA 1GXQA 4UWRB 4S04A 4ENJA 2GFJA 2BGCA 4YIIA 2QEDA 1UFMA 4L9VA 3COAC 2VBYA 2XR1A 4O5VA 3M1EA 5CVIA 2YCBA 2YNWA 1MDMA 5EH9A 2VT2A 3I5UA 3DPLC 2YU3A 3TO6A 4LFUA 1FSEA 4GO1A 2LNBA 2VW8A 4M9XA 4Q47A 2BG8B 3KP7A 4GYUA 4M6YA 3I53A 5FB2A 1JXSA 3WODF 2GKLA 1TQPA 2P7VB 3X2YA 2ZFWA 1DDNA 3E6CC 2I7TA 4BHBA 1W4MA 1ZRDA 4WK8F 1C0WA 5ACQA 2FA5A 3D5LA 1O3SA 2FQ3A 1JE8A 2JTVA 3MD7A 5CVVA 4HL2A 1KGSA 3LQRA 1B59A 4RAMA 1ZG5A 4IRIA 5F1RA 2IPQX 2KJCA 4EJWA 3ABTA 1T39A 2FU7A 1OKRA 2A5YB 3TGNA 5LHGA 5E1ZB 3HOTA 2STWA 1SFXA 3M8FA 5E8GA 1G4DA 3F6OA 3J80Z 3BK2A 2QQBA 4N9HA 4TYFA 3J80K 4CGZA 4G6DA 1LEBA 1IN6A 3KZYA 2PQ8A 4AWXB 2MD5A 3TDUC 1DDKA 2QVOA 5H6RA 3RPCA 1BI2A 4L18B 3FM5A 4KEQA 5KILA 4EMSA 3GZ6A 2WV0A 3L7WA 3L00A 4G8XA 3KP2A 4CYDA 5CVRA 4KN4X 4FSBA 3DHCA 3AF5A 1MKMA 2FMYA 2FXAA 1JJEA 4F7ZA 5EEHA 4NQ5A 3DFGA 4PCQA 1SD6A 2LF7A 3BJ6A 3HRTA 2V1UA 1H9GA 4L9TA 1I1GA 2MLKA 1FLIA 2OBPA 3GFJA 2TDXA 4IXAA 4R8HA 3RKYA 3MZYA 2D1HA 4JBAA 4FX0A 2WHGA 2VBZA 3BOQA 5LRRA 4LJZF 4XSZF 3IWFA 2NZEA 2L4AA 4U0VA 2RV8A 1Q1HA 2VONA 5DUKA 3HIFA 4EQQA 5HIQA 3MAJA 1K6OA 4HLXA 4CDGA 2H6CA 3VODA 3P9KA 1DXKA 1W7PB 1QNTA 4PVTA 3WXCA 5HS7A 3LA7A 3JAMK 3QPTA 4N9IA 3F8FA 1HXDA 1B6AA 4AX0B 3VFZA 1TBXA 1IAWA 4P9FA 4RB3C 4I02A 4CHLA 4LB5A 4F6HA 2FBIA 2VOOA 1Z6TA 5FGMA 3Q6VA 4FT8A 5E18F 1O57A 5AIPA 4G6QA 5A0TA 3F21A 4RAZA 3D0SA 2ZMEB 1FPQA 4P96A 4O3MA 4U7BA 2IT0A 4HX4A 3RYRA 1TQMA 2HKOA 3WTWC 5K5QA 1TNSA 2F2EA 3KETA 2P8TA 4ESJA 4KIBA 3IL2A 2P4WA 4EM2A 4Q4ZF 4NB5A 3T8TA 1G3WA 3EUHA 1VGNA 4FHTA 3GWZA 4A0YA 1PP7U 1CF7A 3CUQA 1JGSA 1V4RA 4C09A 4KICA 3KP4A 3KL7A 3IOGA 4HAMA 2BBYA 2XAFA 4P5OA 2P5LC 2CG4A 1XMKA 3QRFF 1YW7A 4LMYA 1XSXA 5DD4A 3ISPA 6PAXA 5BPIA 2QENA 4ZZLA 2AS5F 1IN7A 2ZNBA 3T8RA 1YTYA 2P6SA 5CLSA 2L4MA 1YCHA 4EM0B 3I59B 1ZLKA 2P1EA 1YG2A 2OZ6A 1MJ9A 5LCAA 5ILSA 3DHAA 1D8JA 3FX3A 4AIJA 4QLCU 2GA2A 3TOAA 2A61A 4A0XA 1R1VA 3LFKA 3ZN1A 3V7CA 5EVBA 4OIQF 1A7TA 3TQNA 5J8CA 4GCVA 2BIBA 5DCMA 5LSCA 5L3CA 3LA2A 4CICA 2EK5A 3I0VA 4UA4A 3NEUA 2BYVE 4L9NA 3IKTA 2P5VA 1WRAA 1YS6A 1L3LA 4HYEA 1ZARA 3ZWFA 2ELHA 3FAIA 1ONVA 2ZNZA 2W84A 1O3RA 4A2UA 4HZFA 2K4BA 2NRAC 2VN2A 3F9OA 3HUGA 2AXLA 3GF2A 3F22A 2BMIA 3E5XA 4YFNF 4LG0B 4ZYEA 1B1BA 3GLXA 2OAZA 4O98A 1D5VA 5LCHA 2MA3A 1P4WA 4AX1B 3T3NA 3T0YA 4ZO2A 3BPVA 5EV8A 3GX4X 1BVTA 3ESHA 4AD9A 2Z33A 4UVBA 5ACTA 2LKPA 2JPCA 3ZMDA 4KMFA 4D1WA 2A69F 1UCRA 2H09A 1FSHA 4HF1A 4OU0A 2NNNA 3RJPA 4ASNA 2FHXA 1AWCA 1K79A 1QZYA 4Y17A 4E70A 1I1SA 4D1TA 5LLDA 4XSXF 1XCVA 4GYIA 5FFZA 2L02A 3G73A 4IHSA 1WRJA 4KYWA 1G3SA 1ZGJA 1S3JA 4MNUA 1A04A 5AYAA 2K7LA 2XASA 4RGSA 2XROA 1KYWA 1I5ZA 5A0VA 2Q8KA 4G94A 5LBQA 3WE2A 2JZYA 4I0AA 5JHUA 5EEGA 2CSOA 3M9AA 3O3KA 1UHWA 2WTEA 2M87A 3BY6A 3GW2A 3VQZA 1R1UA 1FP1D 3VOEA 4R79A 2OU2A 5FQCA 4Q5SF 3HTSB 2M5WA 2QWWA 1G3TA 2RGVA 1ZG3A 5HOOA 2CGPA 2HR3A 4IPAA 3H3ZA 2NYPA 4N0BA 4WX9A 2GAUA 1ZH5A 1LDKB 4IJAA 2XF4A 3GXOA 2JSCA 4MGRA 1WUPA 1PDNC 1KU9A 2DPUA 4TZEA 5AHRA 3BZ6A 3SHFA 5TRDA 1HLKA 4EJOA 3V8KA 2YX4A 2I7VA 2FHXB 2RC4A 2UXXA 4J5FA 2HTJA 3KNSA 5DPXA 1O3TA 4EY2A 4WCGA 3I15A 1Y0UA 3J81Z 1R00A 4ZYDA 4Z2YA 4HL1A 3QU6A 4QWQA 2HEOA 1FYKA 2W24A 1IN4A 2FU8A 3WU0A 1WWXA 1E5DA 4LG0A 3V7RA 5EHTA 1VJNA 5HS8A 5FQBA 2XAQA 2EV0A 2FM6A 2Z99A 5L3GA 3L2CA 4WF2A 2BEOA 4UNOA 1XD7A 4RGXA 5FQAA 5ACWA 3HTUA 4LLGF 4M72A 5JR3A 2M30A 3T5XA 3KFWX 4Y15A 4ZYHA 3QP6A 1HKTA 1WSUA 2I7XA 2GIVA 1R1TA 3L6NA 3RTRA 3S0ZA 1J9IA 1HKQA 3T3OA 2FNAA 2FBHA 3ZMZA 4MHGA 2L3DA 2FU4A 1XDUA 5LGUA 4XUKA 1U8RA 4HDUA 4PZJA 5LLQA 1BI1A 5BS6A 1QH3A 2XV4S 1RUOA 2YSRA 2DK5A 4CHUA 2QM3A 3T1BA 1DPUA 1R5HA 2Q2EA 2WC2A 4RS8A 2E7XA 4LK0F 3SZTA 3J81K 3E6DA 2K86A 1R36A 3EQLF 3ERED 1QH5A 4EJTA 1E17A 1FOKA 2X0LA 3RI4A 2COMA 3O2PE 1EH6A 1G3YA 1IUYA 4GYQA 1BOAA 4TV7A 3ZMVA 4CO8A 1ULYA 2DOOA 1OYYA 3V8LA 5F6FA 5HLIA 2ACJA 1SMTA 3WTUC 4RM5A 4OINF 1ZNBA 5HS9A 2Y8BA 4YSBA 1H9TA 1LB2A 2AIOA 4D02A 5ACXA 5EWAA 1TTYA 3EETA 3M7GA 2FSWA 4C1FA 2HFHA 4R1HA 2CFXA 2G9WA 2Z5UA 2Y75A 4XRFA 1F4KA 3O6BB 2YNTA 4KT5C 5DDGA 4UAMA 4HX8A 4HA8A 3TOBA 3R0AA 1Z6RA 1RIOH 1KU2A 2HGCA 1FX7A 1I27A 1IXSB 1KYZA 1K78A 5LM6A 5LS3A 3BV6A 1VMEA 2M5CA 1S29A 2HWVA 4G7ZF 1S7OA 1FYLA 3GEZA 3GFMA 2Q0OA 4EGYA 1BJAA 3GFIA 5HDKA 5HIOA 1CGPA 4H0EA 1FBQA 3JW4A 5D4RA 1JHFA 3GFLA 2WYLA 2Q9UA 4RB0A 2IA0A 1EH7A 1ZN2A 1IW7F 3CO7C 1HSJA 3IKVA 3K1NA 2JT1A 3LVZA 5D5XB 1MJAA 3QAHA 3E6MA 5IT9K 2XKPA 5L3DA 4L5IA 2QQ9A 4M74A 1HW5A 3C3WA 3LAJA 3L09A 3B02A 5CVUA 3WE3A 2WYMC 2O3FA 2P97A 5A87A 4BXUA 1XTOA 4UUVA 4BH9A 1M2XA 5CJ9A 2A6EF 5HH6A 2V6CA 5ED4A 3K0LA 5CYVA 4HV5A 4A12A 4LB6B 1BC2A 4D1UA 3ADRA 1O7FA 5LEKA 2H27A 1YW9A 1FC3A 4WXCA 4J5HA 3TKYA 3MWMA 1P92A 2FRHA 5K4MA 5HDGA 4ON0A 1QZZA 4OIOF 3SXYA 2ETHA 3FMSA 4KIFA 2HTSA 4EXSA 1MGTA 4HF0A 5ACPA 2QDSA 3R6SA 1DUXC 4DNCA 4ZH4F 4IF4A 4ESFA 2M1BA 2XHKA 2EV5A 2P4ZA 4EJUA 4LLNA 5EW0A 2FU6A 3MQ0A 1OMIA 4HBLA 1TW3A 1ZRFA 4LE6A 4LLLA 2EA4A 2ZBKA 2Q42A 3CJNA 4I98B 4RL0A 5D4SA 2GQQA 3W6KB 3RPQA 2A7MA 2WRSA 1YQAA 2KIUA 5AXRA 4HKYA 4B87A 1WUOA 4OIRF 2XVCA 4IVNA 1YYVA 5FD6A 5DEQA 2LDUA 3I64A 4HF2A 1Z05A 3WTZA 3KP6A 1K7AA 4YG2F 5KK1A 4MEXF 1T98A 4GXOA 4NQ6A 2VT3A 1J5YA 4IRGA 1EV7A 3U1DA 1XSDA 4A0ZA 1UHMA 1HQCA 1IN8A 5DCMB 3ECOA 2GCUA 5TJJA 5BOXA 1B9NA 4PVOA 2OA4A 1SD5A 4RAYA 1BN5A 4ZO3A 3LQQA 4I01A 3KCCA 4EYFA 4MTDA 3SQNA 2ZMEA 4PGGA 3ULQB 2ISZA 1B4AA 3VPEA 3FZVA 3RKKA 1XB4A 2MH9A 2O8XA 2QBYA 2V79A 1R58A 4ENKA 3H92A 1T6SA 1W7PA 1D8KA 2ZXJA 3Q9VA 4OMZA 2PN6A 3ZQ4A 3Q9SA 3FXRA 1I6XA 2FF4A 2VXZA 4BNCA 2H6BA 2DLLA 2OD5A 4DIKA 1NHAA 4EV0A 3HRMA 3C7JA 4FX4A 5K1YA 3VB2A 2VBXA 3JTGA 1V3FA 2L54A 3H3UA 4Z60A 4FR7A 1AOYA 1KO2A 3RKWA 4XLNF 4B8XA 4L0ZB 3HSEA 1OYWA 3IC7A 3C18A 3ABUA 1OR7A 3IHUA 4O6JA 2BFZA 2HOEA 5BMZA 2OHHA 2PMHA 3ZR9A 4FEKA 1RZ4A 3PY5A 2NNYA 2YZ3A 5CVJA 3GO5A 4IHTA 1R7JA 5EVKA 2DI3A 4G9YA 2J5OA 1KQ9A 2QUFA 3NRVA 4DILA 4C1DA 5HH5A 2VE8A 3IRQA 3WTVC 2HKXA 2Z9OA 2DTRA 2E7YA 3PY6A 4ENMA 1USSA 2XUBA 1IXRC 2DK8A 1U6GA 3REOA 1WQ2A 2X4HA 1IXCA 3GVAA 2E1NA 2BG8A 4BP0A 4HW0A 2YX7A 5HIPA 1P4AA 2ZJ2A 3N97A 2DKFA 5IQKA 2ADUA 2D45A 2W85A 3V4GA 4M9ZA 3I4PA 2D1VA 3MZHA 3BROA 3FHZA 2HZTA 3FXQA 4IRHA 4KN7X 5F64A 3E97A 3FCZA 4S05A 2EFOA 4KUMA 3HRSA 1OPCA 4I09A 3WU1B 4ZYGA 2GA1A 2DU9A 3T9MA 3RKXA 3SW3A 2LSOA 4A5MA 5ACRA 2DFIA 3I13A 1X8IA 4XBFA 4A5NA 4JK1X 3J7AO 2JPBA 4KA4A 3PG4A 4RGUA 1DPRA 4A6EA 2VC0A 3SZPA 1BMCA 1LVAA 1LJ9A 2EWNA 2W25A 3R61A 4AIHA 1MJBA 1GVJA 1KO3A 2VE9A 2IP2A 4RGRA 4ENNA 4LK1F 1O7LA 4Z5ZA 2Q0IA 3SFPA 1KU3A 5D6EA 4EYLA 2MH2A 1XGSA 2A07F 2YNTB 1MQOA 5LRSA 1O3QA 1P2FA 2A3SA 4UV9A 2O61A 4UHTA 3U9GA 2KIFA 1ODDA 4U88A 1U5TC 3HRUA 3H3EA 1K07A 3I71A 3TO7A 3F72A 3HHGA 1OYIA 2V1DA 2DPDA 4OIPF 3QH8A 4NQ2A 1LEAA 2PMUA 2E1CA 1QBJA 1Z9CA 4ZEJA 2DAOA 2BG6A 2WYMA 3BJOA 1J0RA 3LA3A 4ESBA 1XGMA 2IVMA 2QZ8A 1IN5A 5AIQA 5ICGA 2CWEA 2XAJA 5LHHA 4KFCA 2H6AA 4UBQA 1YCFA 5FD5A 5D6FA 2Y8AA 1RI7A 2QDTA 4ZNBA 2FK6A 1FNNA 2QLZA 3BK1A 2EV6A 3ZN0A 3DP7A 3EYYA 5AHOA 1TLHB 1QPMA 3OOPA 4HOBA 5HVQC 3IDZA 2IA1A 1IRFA 5HISA 4UWSB 2OZUA 2RN7A 5L3FA 3CLOA 2YR2A 1E2XA 1LDJA 2PFBA 5K5OA 1J2XA 4YSLA 4ETSA 2R3SA 1BI3A 4RBSA 2O6GE 2Z3YA 3KEOA 3IE2A 5AEBA 1WKMA 2DW4A 3IEKA 1SAXA 1F1ZA 1PP8F 1YCGA 2IJLA 4BYYA 1RNLA 3I0TA 3SPUA 1F9NA 5LCFA 5BPDA 4C1CA 2PG4A 2F5CA 1GHCA 3P7NA 4YIFA 4HV6A 1U5TB 1Z91A 2M5DA 1XDSA 5HLGA 1FWZA 4KEPA 2YNVA 3KEQA 2EB7A 2M45A 3TO9A 3KLOA 5IT3A 1XCBA 5JVTA 2PI0A 2BFLA 1IF1A 4RAWA 3JTHA 1YS7A 5DV5A 5LE1A 4KDPA 2D2WA 3DV8A 3BJAA 4AVPA 3R0JA 1LDDA 4P62A 4GCWA 1QGPA 2XGXA 2K02A 4KMUX 1U3EM 2HS5A 3BDDA 1BC8C 4H0DA 4AIKA 1ZREA 2HQRA 2GXGA 2KIMA 2LF8A 4MTEA 3WTTC 4M9SA 2UXNA 3I14A 2BC2A 4EM1A 3IRRA 4AWZA 2V9VA 1KR3A 1Y44A 5EVDA 3JSPA 1A8TA 3B73A 3ZPLA 3CDHA 2W57A 2YNUA 1USTA 1BI0A 5K5RA 3K2ZA 1BBYA 2IW5A 5H6QA 3NQOA 1MDMB 3BP8A 2PLYA 3HSFA 2JRTA 3R2UA 2ZNYA 4K2EA 1QQIA 1U5TA 4MEYF 4UV8A 2NZFA 1ZRCA 3WGHA 1J7KA 1SD4A 3IOFA 1HSTA 4GYGA 5IT9Z 2QBYB 3L9FA 3CUOA 5J6XA 1XM8A 1X8HA 1KU7A 3FMQA 3JXPA 2Y0MA 3K69A 3AJ3A 1W7PD 1T0FA 2BTNA 2BE5F 5ACVA 3QU3A 4XWWA 2CYYA 4UXNA 1KQ8A 4U4LA 1VTNC 3V7SA 4TZFA 1XGOA 3KP3A 4BHCA 1T2KA 2P5KA 1T38A 2J5PA 2GZWA 4TYTA 4AWYB 3PQKA 4G7HF 3GUDA 2XIGA 5H20A 2BG7A 5ERIA 2EJRA 2XAHA 1ZAOA 2ESNA 2BFZB 5K4KA 4YSKA 5KIKA 1HW2A 5ILVA 3F8NA 2MBFA 2O03A 1SFEA 1STZA 2CQKA 2F5FA 3AAFA 1Z1DA 5DCFA 3QOPA 4M73A 3MFKA 3RIRA 5FLXK 1XMAA 2MLGA 1WW1A 5FFXA 3PFIA 2EFWA 2NAZA 2OQGA 1H0MA 3LAPA 4C1EA 1QO0D 2P7CB 5K0WA 3ZMUA 3CTAA 5DD8A 1JJTA 1YW8A 2H94A 1BIAA 1UB9A 2UWMA 3F6VA 3LWFA 4XWTA 3EDPA 5J8FA 1L9YA 2R7FA 1U78A 4HQEA 5ICEA 4NQ4A 1X3UA 2UYXA 4PDKA 2XKOA 1YIOA 3CUQC 3MEXA 1S7AA 4U7DA 4OMYA 1ZHFA 5HLHA 2CBNA 1DD6A 3P9CA 3IE0A 3KLNA 3K1MA 1TQIA 4P9UA 2DT5A 1YLFA 5B3RA 4U0WA 3RPUA 5AXOA 2MC3A 2VBWA 1SFUA 1W5SA 2CW0F 3HYIA 3DPTA 3V8JA 1REPC 3E3VA 3ZNBA 5E17F 3G3ZA 3KNRA 2P6TA 1J75A 3ROUA 1PUEE 3DKWA 2P18A 5HH4A 4RL2A 1ZGAA 3WTSC 2FMLA 5ACUA 1BIBA 3X2ZA 1FY7A 1MD0A 2QQAA 1FP2A 4EJVA 3OV8A 3F8MA 4JO0A 5ACSA 3PQJA 3W6JB 3I58A 4UWOB 3K1PA 3KE2A 2GXBA 4Z7RA 2ZKZA 2KJBA 2R2DA 2GMNA 3SRXA 3FXUA 3IWZA 1YO5C 2BGAA 2ZZIA 1R23A 1X8GA 3R60A 2CO5A 2XRNA 1BM9A 5BQTA 3P2UA 2NXAA 4NHJA 3HHHA 4UVCA 3U2RA 4C1HA 4I2OA 2DO7A 3WG9A 4I0BA 2EA2A 3HSRA 4PGHA 1J59A 2VOPA 2GWRA 3I11A 2R7DA 1DP7P 2YPRA 2ZWRA 3F8BA 4BQAA 3ZMSA 3WTYC 5JFRA 4G7OF 3TDZC 2F5EA 5AONA 4WD6A 3I59A 4BZ3A 3Q5FA 3DF8A 5A5ZA 2UZKA 5LGTA 4Z67A 1FT9A 2K4JA 2RNJA 3I54A 3SBLA 2ISYA 3ELKA 1XN7A 5LMCA 3S2WA 1P6RA 3SD9A 1B9MA 5L3BA 2E7WA 5KVRA 5B1UA 4KIGA 4KNYA 3A4YA 4JQFA 1BC7C 5FLXZ 1SMLA 1U2WA 1YFHA 3QPHA 2QJSA 4C1GA 3EYIA 5K4NA 2OHIA 4A6DA 3BPXA 2DQLA 2EFQA 1K78B 2NS0A 1L0OC 2ZO4A 4P55A 1IZ1A 2B0LA 2HYGD 5D5VB 2HB9A 3ECHA 1HKSA 2RKHA 3FM3A 1TW2A 5E1WA 4LD5A 2PJPA 4EGZA 2Y87A 3KP5A 3C1DA 4CXFA 1ZLJA 3QP5A 3GYHX 1MZBA 2ESHA 2VC1A 4HLYA 1EH8A 3FWEA 1Z7UA 3RKJA 5E20A 2G7HA 3DH8A 3ZQ7A 4BAYA 5D8LB 2EFNA 1F5TA 1ON2A 4WXDA 2RQPA 2IRFG 3CUQB 4ZZDA 1G6NA 2L01A 3RYPA 5ILUA 3DHBA 1P9EA 5JI6A 3WGGA 1XGNA
chains in the Genus database with same CATH superfamily
1ZYRF 4F55A 4XM3A 1Y8QB 5B66C 3E6BA 1FZPB 1ZELA 2FU9A 3MCZA 4KJZA 2LG4A 4Q48A 3L2UA 3VEPA 3KZZA 5ICCA 3BR3A 2F5DA 3RQ4A 1LQ1A 2Q0JA 5EV6A 4CCMA 2G7UA 2QSFX 3TP9A 4HDVA 4EXYA 2HDDA 2FUG2 2X9DA 2PEXA 3JSOA 2X1EA 4DYCA 3ZQLA 3HOUJ 2DMNA 2HDCA 4L5JA 2JA2A 3C2GA 4A93J 2FE3A 3FK7A 4Y13A 2OCCH 2FOKA 4EVIA 1G59A 4BHPA 2C6YA 3E7LA 2M8EA 2RDPA 3F8CA 2RVCA 3R4KA 2JRMA 4TZ9A 4DQ2A 3HOSA 1RUNA 1ZKPA 2WY7Q 2BHYA 5B15A 5LEJA 5A2QZ 3CO6C 3IEMA 3G1PA 3IELA 3P9IA 2O0YA 1GXPA 1P4XA 3DQVC 3OYNA 2L7ZA 4A3LJ 4NQWA 5A2QK 4V0HA 2V1XA 4OOIA 5D8KB 2DBBA 5E1XA 2VUMJ 3QPSA 1Z77A 1ETWA 2KRHA 2XAGA 3PUFA 2KRFA 3N4MA 1B72A 3JRHA 2NYXA 2ZCWA 1FBUA 3H5AA 2PBIA 3E5UA 3K9TA 2QYOA 3FMRA 2DJIA 4M71A 1R5GA 5DUIA 2HXIA 4WWCA 3SFZA 2X6XA 4RB2C 2R5YA 4F91B 3G71I 1HA8A 4UWPB 1JHHA 3BC2A 2AZ4A 2DQRA 4WXHA 1W0TA 4Z6XA 4CA0A 3F3XA 3HKZA 3CDIA 5HDNA 4L9JA 1LNWA 1CF7B 4PJ0C 2FBKA 2R0QC 1D3YA 5EZHA 3DU5A 2HYFA 3DXJF 2VODA 3SZGA 3U1KA 2DYSH 3OMYA 4XLPF 1R5ID 4TZBA 4RB1A 4PK4A 1SD7A 4MQ9F 4MQVA 4FCYA 4C2MJ 1WZ2A 1VI0A 5TISC 2Y48A 2OQRA 1UJ8A 2STTA 2QINA 2DA7A 3OYKA 3VYSB 4YFKF 1FBSA 2LOOA 3RDIA 2OHJA 4U0YA 2BR6A 2M34A 3OR2C 5EYRA 5TGTA 1WI9A 2L9VA 4I7HA 1R71A 2B7EA 4UVAA 3ML6A 4DZJA 2FNPA 4HQMA 4HSTA 3S14J 2Z16A 3X30A 2PJRA 5D5WB 2R5ZA 1HDPA 2XF5A 4PDXA 3IE1A 1ON1A 4PJLA 2V7FA 1W0UA 3HGGA 4L0YB 1SMYF 2CG2A 1TNTA 2M4GA 1MBGA 3GZ5A 2O8KA 5E8IA 3GTQJ 3S1MJ 4Z5YA 1KQ0A 4EFZA 5CQEA 3S1RJ 2X6WA 2BV6A 1S6LA 3OYHA 1FYMA 3S1QJ 4LGWA 2F6CA 2IA2A 4HX7A 3CCQI 1ZG1A 2IS6A 2BG2A 3VSKA 2EFPA 3X2XA 2E60A 5B5EC 1DQUA 4B09A 3ESWB 3BWGA 3HUGB 2VL8A 2WWYA 1NG7A 4EYBA 2A6HF 1V5FA 5DYMA 4GGGA 2BFKA 1OFCX 3WGIA 1ZTCA 5J1YA 1R22A 2YNVB 4CZZA 3A02A 3K6GA 5HNFA 3J7AY 4BS9A 2K27A 4F6ZA 4XL9A 2R92J 1W5TA 3RCOA 5GADJ 2HQNA 2K9LA 2KKOA 3X2QH 1WH7A 2FJ1A 1Q1VA 3BG5A 2GXAA 3DEUA 3FF5A 5LGNA 5JLXA 2X6OA 1JT1A 3ZP5A 1KA8A 1S8NA 3QWLA 5D5UB 4YFXF 3OIQA 3M8EA 3JAMZ 3OS0A 2FEZA 2EZKA 4M6XA 3TW6A 1ZR4A 2KQRA 1HW1A 1DP3A 5FO5A 5LHIA 4D0PA 3ZQGA 3LSTA 3F23A 2ELJA 1IRGA 3PSIA 2RAEA 4PUSA 3AF6A 2IXSA 3LOCA 3S3MA 3ZMTA 4D1VA 4XKBA 1XSVA 2VKVA 5B1AH 5L3EA 2GFKA 2ZJQF 1PVEA 3E5QA 3WTXC 4BE1A 1HBXG 2A68F 1IUFA 5ICFA 1GXQA 4UWRB 4S04A 4ENJA 2GFJA 3L2WA 5DM6F 3EUHC 3CMAI 3S2HJ 2BGCA 4YIIA 2BHZA 1LE8B 1MNMC 3S16J 1LFPA 4B1RA 2QEDA 1UFMA 4L9VA 2DTZA 3COAC 2VBYA 4Y3OA 4BL0B 2XR1A 4O5VA 3M1EA 2W48A 5CVIA 2YCBA 1PYVA 2YNWA 2F4OB 3ZOBA 1MBEA 1MDMA 4XORA 2GOMA 3DEEA 3FXMA 5EH9A 2VT2A 2KHMA 2GIZA 4HNVA 3I5UA 3DPLC 2E2JJ 2A05A 1W36D 4D5FA 2YU3A 2Q2EB 3TO6A 4LFUA 3K70D 1FSEA 4J00A 4GO1A 2LNBA 2VW8A 3NWSA 4M9XA 4Q47A 4XRMA 2BG8B 3QOEA 5EEAA 1QHGA 1YE9A 3KP7A 4YELA 3S17J 4GYUA 1UG2A 2EIJH 3I53A 4HEA2 4M6YA 5FB2A 2E19A 1JXSA 3WODF 2GKLA 2JN6A 1TT5B 1FJLA 5F08A 3OYEA 1TQPA 2P7VB 1S9HA 3X2YA 2ZFWA 1EF4A 3JR9A 2TRTA 1DDNA 3E6CC 1I3QJ 1XX5A 1E3HA 4BHBA 2I7TA 1W4MA 4AVZA 1ZRDA 4WK8F 5IP7J 1C0WA 5ACQA 2FA5A 3D5LA 1O3SA 2FQ3A 2P0WA 4RLQA 1JE8A 2BZTA 2JTVA 4C2UA 4X6AJ 2HQAA 2LRDA 3MD7A 5CVVA 4HL2A 1KGSA 3HB9A 1ETKA 3LQRA 1LVKA 1TWAJ 4NDLA 4NBQA 1B59A 4RAMA 1ZG5A 4IRIA 5F1RA 2IPQX 2KJCA 4EJWA 3ABTA 4PJNA 5IYDJ 1T39A 3VWBA 4HNUA 2FU7A 1OKRA 2A5YB 5FKKA 3TGNA 1SANA 3BG6A 5LHGA 1T0FC 5E1ZB 3HOTA 2STWA 1SFXA 3M8FA 1Y0NA 2WADA 5KNLA 4A3DJ 2DA6A 5E8GA 5F0CA 2JJ7A 4U87A 1G4DA 3F6OA 5C44J 3G1LA 3J80Z 3BK2A 2DFFA 2QQBA 2XPWA 2JVHA 4N9HA 4TYFA 3J80K 4CGZA 4G6DA 1LEBA 1IN6A 3HG9A 4BDZA 2DFHA 2NOJB 3KZYA 2WB1N 2PQ8A 4ITVA 4AWXB 1WJFA 3M8JA 2MD5A 3TDUC 3ZGKA 1DDKA 2QVOA 5H6RA 4RLFA 3ZQCA 3RPCA 1BI2A 4L18B 4BUPA 5HNHA 3FM5A 4KEQA 5KILA 3KEYA 4EMSA 3GZ6A 2WV0A 4ZYAA 3L7WA 3L00A 4G8XA 3KP2A 4CYDA 4E7HA 2HPMA 2TCTA 2KLOA 3SYTA 5CVRA 4KN4X 4FSBA 3DHCA 3AF5A 1MKMA 2FMYA 1SVMA 4BGDA 2FXAA 2IGNA 2MSYA 3GLLA 4OAYA 1JJEA 4F7ZA 1LUJB 5EEHA 4NQ5A 3DFGA 4PCQA 1SD6A 2LF7A 2ZXIA 3BJ6A 3HRTA 3LSHA 2V1UA 1H9GA 4CSWA 4L9TA 1I1GA 2MLKA 4GFBA 2OBPA 1FLIA 5EG0A 5EGOB 1B8IA 5FKNA 2EPFA 3A1YA 3GFJA 2TDXA 4IXAA 4R8HA 3RKYA 3MZYA 2D1HA 4C2TA 4JBAA 1W5CC 4FX0A 2WHGA 3CC4I 2VBZA 3BOQA 5LRRA 1BW5A 4LJZF 4XSZF 1YX5A 3IWFA 2NZEA 2L4AA 2NS8A 2RV8A 1Q1HA 4U0VA 2VONA 4E7IA 2HU9A 5DUKA 3HIFA 4EQQA 5HIQA 3MAJA 4GDFA 1K6OA 4HLXA 4CDGA 1NG6A 4AUXA 2L0KA 2H6CA 1IRXA 2I10A 1ETVA 3P9KA 3TL4X 3VODA 5M5XJ 1DXKA 2KZGA 1JT6A 1TP4A 4PFPA 1W7PB 3LSJA 1Z0XA 1QNTA 4PVTA 2EINH 3AL0C 1P7JA 3DLAA 1PJRA 5HS7A 3WXCA 3LA7A 3JAMK 4XMYA 3QPTA 4N9IA 3F8FA 1HXDA 1B6AA 4AX0B 3VFZA 1JT0A 1TBXA 1IAWA 4P9FA 4XICA 1X58A 2FX0A 4I02A 4RB3C 4CHLA 4LB5A 1R49A 4ZDOA 4F6HA 2FBIA 3OR1C 2VOOA 2IS1A 1AKHA 2HXOA 1Z6TA 3H5RA 2GBYA 5FGMA 3Q6VA 1NK3P 5J40A 4F3QA 4FT8A 3W2AA 4M3EA 1T56A 1O57A 3MZ8A 3OOUA 5AIPA 5E18F 3CJRB 3O8HA 3AG2H 3HOXJ 3CF2A 4G6QA 4NUBA 3B6AA 5A0TA 3S93A 3JRBA 1JUMA 1AHDP 3F21A 4RAZA 3D0SA 2ZMEB 1FPQA 4P96A 3IP4B 4U7BA 4O3MA 3FK6A 2IT0A 4HX4A 2ID6A 1SFKA 3RYRA 1BOBA 1TQMA 3BTCA 2HKOA 4MFEA 3WTWC 1VQ6I 5K5QA 2VPLA 1TNSA 2F2EA 3KETA 2P8TA 3W2WA 2PJRB 2CJJA 2DDAA 2LBFA 2R7ZJ 4DW6A 1X1BA 4XNFA 2L9NA 1FIPA 1Y56A 1RC9A 4ESJA 2LC2A 4KIBA 1OCRH 2QSHX 3D5RC 3IL2A 2E71A 2P4WA 4EM2A 5IY5H 4FTHA 4H4KC 4Q4ZF 4XK4A 4NB5A 3T8TA 3SJMA 3DBLB 1G3WA 3EUHA 1VGNA 4FHTA 3GWZA 3SDBA 2G0EA 4A0YA 1PP7U 1CF7A 1WCMJ 3CUQA 2W4SA 1JGSA 2VJJA 1V4RA 4C09A 2DA4A 4KICA 3KP4A 3LSGA 2R7UA 1WJBA 3KL7A 2KRCA 3IOGA 4HAMA 2ZC2A 2BBYA 2E1MB 2VQGA 2X1DA 2XAFA 1FOYA 4P5OA 2P5LC 2HOTA 1XPXA 2XPVA 2CG4A 1XMKA 3WHBA 3QRFF 1YW7A 4A3BJ 4LMYA 1K83J 2E5NA 1XSXA 5DD4A 3PNTA 3ISPA 6PAXA 5BPIA 2QENA 2AHQA 4G6TB 3KYDB 1P7IA 4ZZLA 3PO3J 2AS5F 3LSIA 3BG9A 2KPMA 2K9QA 3MN2A 1IN7A 2JA8J 2ZNBA 3T8RA 1YTYA 1W36C 2P6SA 5CLSA 1HCRA 2L4MA 2JQ7A 1YCHA 4EM0B 2QKLB 3I59B 1ZLKA 2P1EA 1YG2A 4FE4A 2WAQA 5GP9A 4XRSG 2OZ6A 1MJ9A 5FRNA 5LCAA 5ILSA 3DHAA 1D8JA 3FX3A 4AIJA 4QLCU 2GA2A 4CCJA 3TOAA 5M5WJ 4LOCA 1IV6A 2A61A 4A0XA 1R1VA 4ZJZA 3LFKA 3BR6A 4FE7A 3ZN1A 3V7CA 2ZB9A 3CCRI 5EVBA 4OIQF 1A7TA 2V1NA 3TQNA 5J8CA 4GCVA 4CCLA 3EUAA 3AKZA 4BBSJ 4M3BA 5DCMA 2BIBA 2BW3B 3TEDA 5LSCA 5L3CA 5J4VA 4ZTJA 3LA2A 3PNVA 4CICA 2EK5A 3I0VA 4UA4A 3NEUA 4IX7A 2BYVE 5J47A 3M3YJ 4L9NA 3PO2J 2LK2A 3IKTA 2P5VA 4B3AA 3JRAA 3BCAA 1WRAA 1YS6A 3K10A 2AQFA 1L3LA 4HYEA 1ZARA 3ZWFA 3DTKA 4BEHA 2ELHA 1Z3XA 1ONVA 2ZNZA 3FAIA 2W84A 4GRIA 4CYCB 3TP3A 1O3RA 4A2UA 4HZFA 2K4BA 1AKHB 2NRAC 3CMYA 1IDZA 1ZK8A 2VN2A 4UB8C 1WJAA 3OL3A 3H36A 3S3NA 3F9OA 4A3MJ 3HUGA 1TL8A 2AXLA 2JSPA 3GF2A 2DMQA 2JWTA 3F22A 2Y31A 3E5XA 1H89C 2BMIA 2XAUA 3PIOF 4YFNF 2WAFA 4LG0B 4ZYEA 1B1BA 2LD5A 3GLXA 2OAZA 4O98A 3O8GA 2OV7A 2QKMB 3GTMJ 1D5VA 5LCHA 2MA3A 1P4WA 4AX1B 3T3NA 4FASD 3T0YA 1UZCA 3BPVA 4ZO2A 4A3KJ 5EV8A 2RQQA 3GX4X 1BVTA 1YI2I 2W7NA 3ESHA 4AD9A 1JKQC 2Z33A 4UVBA 4E6KG 5JHFA 4A3GJ 2O7OA 5ACTA 2LKPA 2JPCA 3ZMDA 4KMFA 2DN0A 4D1WA 3E1SA 2A69F 1UCRA 2CQ7A 2H09A 2R5YB 4BACA 1FSHA 3QODA 1NH3A 1O4XA 3QYBA 4HF1A 4OU0A 2NNNA 4G12A 3RJPA 4ASNA 2FHXA 1AWCA 1K79A 1QZYA 4I99C 4Y17A 2BY0A 4E70A 1I1SA 4D1TA 4FQGA 1UELB 5LLDA 4XSXF 2Q1ZB 3HZJA 3MVPA 1XCVA 4GYIA 1G2HA 5FFZA 2L02A 3G73A 1U9OA 2EZIA 1XG1A 4IHSA 2E2HJ 1WRJA 3CP8A 4KYWA 4BKXA 1G3SA 3PSFA 2WAQN 1ZGJA 1S3JA 4AM3A 4MNUA 1A04A 1UHSA 1JJ6C 2R7QA 5AYAA 2K7LA 2XASA 4RGSA 2ME6A 2XROA 1KYWA 1I5ZA 5A0VA 2Q8KA 4G94A 2CFOA 3WE2A 5LBQA 3RQIA 2JZYA 3EUKL 4I0AA 5JHUA 5EEGA 1MMAA 3HOWJ 2CSOA 3M9AA 3J7YJ 3O3KA 1UHWA 2WTEA 4DBQA 1JUSA 2BXYA 2M87A 3BY6A 3GW2A 3VQZA 2IEKA 1UMQA 3BC8A 4N4NB 1MBKA 4B3XA 2M2EA 3DWLE 1R1UA 1FP1D 2GOXB 3GCMA 2K9SA 2NVUB 2GLOA 5F04A 3VOEA 4R79A 2OU2A 5FQCA 4Q5SF 3CZ6A 3HTSB 2M5WA 2QWWA 1G3TA 5EF6A 2VKEA 2RGVA 1ZG3A 3DBRB 5HOOA 5DM7F 2R93J 2IGOA 2CGPA 2HR3A 3BR1A 4IPAA 1UG0A 4DYQA 3H3ZA 2NYPA 3CMMA 1GV2A 4N0BA 2AO9A 3HC7A 4NC8A 4WX9A 3HKZN 2GAUA 2MABA 2PMZN 5GPCA 1ZH5A 3GTPJ 2OPTA 2D5VA 1LDKB 1GUUA 4IJAA 2R7OA 2XF4A 3GXOA 2JSCA 4MGRA 1WUPA 1PDNC 2YUSA 1KU9A 3I3LA 2DPUA 1WJEA 4TZEA 3K4LA 5IP9J 1N77A 1F43A 5AHRA 3BZ6A 2V4JC 3SHFA 3RPUD 1WGXA 5TRDA 2OCEA 1HLKA 4EJOA 3V8KA 3ZCOA 4LITA 2YX4A 1PUFA 2I7VA 2HOAA 2FHXB 2RC4A 2KL4A 2UXXA 4J5FA 2HTJA 1X3ZB 3H3VK 2R7VA 3KNSA 5DPXA 1O3TA 3BLYA 4EY2A 4WCGA 4ZDLA 3I15A 1Y0UA 3J81Z 1R00A 2CQNA 3NARA 4ZYDA 4Z2YA 1A6IA 1QA6A 4HL1A 3QU6A 2M8GX 4QWQA 3FIWA 1POGA 2HEOA 1FYKA 2W24A 1R9TJ 1IN4A 4B43A 2FU8A 3WU0A 3L2QA 1LFBA 1WWXA 1E5DA 4LG0A 3V7RA 1QVTA 1VQOI 1VJNA 5EHTA 5HS8A 3G1MA 5FQBA 3GTJJ 2XAQA 2EV0A 2FM6A 2Z99A 3HXLA 5L3GA 3L2CA 1D1AA 4WF2A 2BEOA 4UNOA 3QYEA 4Y52J 4EEFG 1K6YA 1XD7A 4RGXA 2KMUA 3M1CA 5FQAA 5ACWA 3HTUA 4LLGF 4M72A 1S7EA 3GTKJ 2E36A 5JR3A 2V26A 2M30A 3T5XA 2VJ5A 3KFWX 4Y15A 4ZYHA 3QP6A 1HKTA 1WSUA 2MFZA 2QGUA 1Y1VJ 4BJTA 2I7XA 2GIVA 5FKOA 1R1TA 2XGCA 3L6NA 3RTRA 1MBJA 3S0ZA 1A36A 3HOVJ 1J9IA 1HKQA 3VDXA 3LMMA 3T3OA 2FNAA 2MG4A 2NOGA 2FBHA 5HLTA 3ZMZA 4MHGA 1UAAA 2XSJC 1X2MA 2L3DA 2L7FP 2FU4A 1V55H 1XDUA 1FMWA 5LGUA 4XUKA 1U8RA 2DJNA 4HDUA 2CW7A 2HNHA 1WJDA 4PZJA 1JKPC 5LLQA 1BI1A 5BS6A 1QRYA 1QH3A 2XV4S 3K70C 4RBOA 2YSRA 2LYCA 1RUOA 2DK5A 1AU7A 3PL8A 4CHUA 1TT0A 3OL4A 2QM3A 3T1BA 2L9RA 1DPUA 4XKVA 1R5HA 2K9MA 2Q2EA 2WC2A 4RS8A 1EKEA 2E7XA 3FBNB 3OYCA 4LK0F 5JLWA 1JTYA 3SZTA 3J81K 3E6DA 3I4MJ 1MIJA 2HYJA 2K86A 1ETXA 1R36A 4D9JA 2DDBA 3EQLF 1X1PA 2A5WA 2CUEA 2L7KA 3ERED 3WG7H 1QH5A 4EJTA 1E17A 1FOKA 2X0LA 3RI4A 1Z21A 2COMA 3NWTA 1VQ7I 2ECCA 2V9KA 3O2PE 1FEXA 1EH6A 1G3YA 3LNQA 1IUYA 4GYQA 1BOAA 3DKYA 4TV7A 3ZMVA 4CO8A 1RKWA 1ULYA 1QHHD 3OWTA 2DOOA 2IBDA 1SEUA 3OSGA 1OYYA 3V8LA 5F6FA 4FETA 5HLIA 3OYLA 1CQTA 2ACJA 1SMTA 3WTUC 4RM5A 4OINF 3HOYJ 1ZNBA 5HS9A 2Y8BA 4YSBA 1H9TA 3H1CA 2H8WA 1LB2A 1E0EA 2AIOA 4D02A 5ACXA 3QQAA 5EWAA 1TTYA 3L2RA 3EETA 1ZTRA 3M7GA 1BL0A 2FSWA 2ECBA 4JX4A 2M9HA 5CKTA 5KHDA 2Y0SA 4C1FA 2HFHA 2ZXWH 4R1HA 2CFXA 2KZVA 1Y39A 2EZHA 2G9WA 2Z5UA 3IAM2 1VNDA 2BVMA 5IYBJ 2V6EA 2BW3A 5FLVA 5E79C 2DOFA 2B9SA 1J09A 3M4OJ 2Y75A 4XRFA 1F4KA 3O6BB 2L7MP 2YNTA 2OTLI 4RAGA 2R7WA 2LP0A 4BDYA 4KT5C 5DDGA 4UAMA 4HX8A 4HA8A 2M7AA 3F0CA 2DOAA 2PX9A 3TOBA 3R0AA 3IH3A 4MO7A 3AFHA 3RSNA 5IP6A 2R7TA 1Z6RA 4BU2A 1RIOH 2MW8A 1KU2A 2HGCA 1FX7A 1I27A 1IXSB 2X1CA 3DPUA 1KYZA 1WPKA 1K78A 5FRMA 5LM6A 1HF0A 4IQJA 2EIMH 2EQRA 5LS3A 3BV6A 2HVQA 1VMEA 2M5CA 1S29A 2HWVA 4G7ZF 2QF7A 1YJNI 1S7OA 3GTLJ 1TC3C 1FYLA 2EILH 1SVOA 3GEZA 3GFMA 4CCOA 2Y2ZA 2Q0OA 1BJAA 3GFIA 4EGYA 5LD2C 1T08B 5HDKA 5HIOA 3ZQIA 4XOTA 1CGPA 4JOMA 2FOWA 4H0EA 2MC4A 1FBQA 4ZC3A 3JW4A 1Z7LA 5D4RA 4DIQA 1JHFA 3GFLA 2WYLA 4M3FA 2Q9UA 4RB0A 2IA0A 1EH7A 1ZN2A 4W97A 1IW7F 1TWHJ 2CH0A 2ELKA 3DBHB 1Z67A 3CO7C 1HSJA 3HGYA 3IKVA 3K1NA 1ETYA 2JT1A 3LVZA 3A01A 5D5XB 1MJAA 3QAHA 4II2A 3E6MA 2Z2SB 1WFXA 2BY1A 4II3A 5GAEJ 1DGRM 2XKPA 5L3DA 5IT9K 4L5IA 4BEHB 2OJED 2QQ9A 4M74A 1HW5A 3C3WA 3LAJA 3L09A 2DMUA 3B02A 4D7MA 3S15J 5CVUA 1RESA 3WE3A 2LTPA 2EH3A 2UV1A 2WYMC 5J1RA 4AV7A 2O3FA 4QTRA 2P97A 5A87A 2CUJA 4BXUA 4IL6C 1XTOA 2KDOA 4UUVA 4BH9A 3SEZA 4F93B 1WJCA 5M3FJ 1M2XA 5CJ9A 2A6EF 4M6VA 1VQLI 5HH6A 2V6CA 5ED4A 2LY2A 4A3IJ 3K0LA 5CYVA 3KX2A 4HV5A 3DCFA 4A12A 4V2FA 3Q0VA 4LB6B 1BC2A 4D1UA 3ADRA 1O7FA 4XN0A 1EA3A 5LEKA 2H27A 4QPOA 1SC7A 4DGWB 1YW9A 2CW8A 1FC3A 1V5GA 2DOEA 4WXCA 4J5HA 3TKYA 3MWMA 1P92A 2FRHA 5K4MA 5HDGA 4ON0A 1QZZA 3LSPA 3TBIA 4OIOF 3OY9A 3OYFA 3HL2A 1A35A 3SXYA 2H8RA 2ETHA 3D5SC 4UY8I 2R7SA 2IGKA 1A31A 1OCTC 4MFDA 3FMSA 4KIFA 2HTSA 4EXSA 1MGTA 3GMEA 1S72I 4HF0A 5ACPA 3CJQB 4E7KA 2AXTC 2QDSA 3R6SA 2E5ZA 1DUXC 1LKXA 4DNCA 2VQHA 4ZH4F 4IF4A 4ESFA 2M1BA 3CCSI 2CFUA 3WU2C 2XHKA 2EV5A 2P4ZA 4EJUA 4LLNA 2CFZA 5EW0A 1JJ8C 1SFOJ 3OYMA 1MBHA 1ERDA 2FU6A 3MQ0A 1OMIA 4HBLA 1TW3A 1ZRFA 4RAFA 4LE6A 4BJ5C 2Y30A 2VQCA 2CUZA 3DTIA 4LLLA 2EA4A 2ZBKA 2Q42A 3CJNA 4I98B 4BY7J 4RL0A 2VI6A 5D4SA 2GQQA 3W6KB 2CQQA 3HBLA 2MYSA 3RPQA 1G8XA 2A7MA 3IUOA 4DJAA 3RKQA 2WRSA 4XLAA 1YQAA 5CQGA 2KIUA 3S1NJ 5AXRA 2CRGA 4HKYA 3D1NI 2DMTA 1QU3A 1D0ZA 4B87A 1WUOA 3FISA 4OIRF 2XVCA 3LSMA 4IVNA 2LKXA 1YYVA 4IHYA 2BVLA 5FD6A 5DEQA 2CV0A 2LDUA 3I64A 4HF2A 1Z05A 3WTZA 3EPZA 1U0JA 4DZPA 3KP6A 3CCVI 1K7AA 4YG2F 5KK1A 4MEXF 1T98A 2DCEA 4GXOA 3JRGA 3HDDA 4NQ6A 3CLQA 1MMDA 2VT3A 1J5YA 5GAHJ 1D0XA 4IRGA 1MH4A 1EV7A 4XLFA 3U1DA 4BJ6C 1IO2A 1XSDA 4A0ZA 1UHMA 2LVSA 3PIPF 1HQCA 2UUZA 1IN8A 5DCMB 3ECOA 2GCUA 5EZGA 5TJJA 1MMSA 3W6VA 5BOXA 1BA5A 1B9NA 3OS2A 4PVOA 3UR3C 2OA4A 1SD5A 4BBRJ 4RAYA 1BN5A 2WA0A 4ZO3A 3C2HA 4RA2A 1YITI 3LQQA 4I01A 3KCCA 4EYFA 4MTDA 3SQNA 2ZMEA 2EBIA 4PGGA 3ULQB 2ISZA 1B4AA 2I8DA 3VPEA 2HPIA 3FZVA 2YU9J 1TWFJ 3RKKA 1XB4A 3CCYA 4CCNA 3CCEI 2JA5J 2MH9A 3VPRA 2O8XA 2KISA 5FJ8J 2QBYA 2V79A 4XOPA 1R58A 4OAZA 4C3JJ 4ENKA 3H92A 2BOLA 1T6SA 4AXHA 1W7PA 2LLKA 1D8KA 1RPWA 2ZXJA 2K85A 2OF7A 2PMZA 3ZQFA 3Q9VA 2F4IA 4OMZA 1WH5A 2PN6A 3QYFA 1OJLA 3Q9SA 3ZQ4A 1VQMI 2WV1A 3FXRA 4NNJA 1I6XA 1GLNA 2FF4A 2VXZA 4BNCA 2H6BA 2DLLA 2OD5A 4DIKA 4IOAF 3E0JB 1OQYA 1NHAA 3ABKH 4EATA 4EV0A 1W1WE 3HRMA 2CU7A 3V42A 1PUFB 4XIDA 1HC8A 3C7JA 3PM1A 1T8IA 4AYBA 2JUGA 4FX4A 3FKIJ 5K1YA 3VB2A 1IJWC 2VBXA 3JTGA 1K61A 2DFEA 1V3FA 1X4OA 2DA5A 2CS3A 2XRLA 2L54A 3H3UA 4Z60A 4FR7A 2HVSA 1AOYA 2W82A 2QCOA 1KO2A 3RKWA 4XLNF 4B8XA 4L0ZB 1TWCJ 1OCOH 3KYLA 5KAIC 3HSEA 1OYWA 4C30A 3IC7A 3C18A 1JGGA 1YOVB 3ABUA 1IGNA 1OR7A 2XPUA 5E3LA 3IHUA 4O6JA 2BFZA 2HOEA 5BMZA 2OHHA 2PMHA 4PJMA 2IGMA 3CCMI 3ZR9A 4FEKA 1RZ4A 3PY5A 2NNYA 2YZ3A 5CVJA 3GO5A 4IHTA 4PJJA 3OYJA 3CQZJ 2R4GA 1R7JA 2H1LA 3AG1H 5EVKA 2BY2A 1RRJA 2DI3A 4G9YA 1IRZA 2J5OA 4IHVA 1KQ9A 2QUFA 4NURA 3NRVA 4I6ZA 4DILA 4C1DA 1MMNA 1VQ4I 5HH5A 2VE8A 3IRQA 3WTVC 2HKXA 4E7ZA 2Z9OA 2O9LA 2DTRA 2E7YA 3PY6A 4XLHA 4ENMA 1USSA 1X1DA 2XUBA 2KP6A 1IXRC 2ZSIB 1N78A 2DK8A 4A3JJ 1U6GA 3REOA 2HDWA 5LFAA 1WQ2A 2X4HA 4BE0A 1D0YA 1IXCA 4KITB 3JRDA 2VKHA 3GVAA 3H9QA 2E1NA 2BY3A 2BG8A 4BP0A 3IAS2 4HW0A 2YX7A 5HIPA 1P4AA 2ZJ2A 3N97A 2DKFA 5IQKA 4E7LA 2ADUA 3ABLH 2D45A 2KDZA 3RZDJ 1RR7A 2W85A 5EJCA 3MKLA 2ICWG 1YRNB 2ZMEC 3V4GA 4M9ZA 1MSFC 4IO9F 3I4PA 1APLC 2D1VA 3MZHA 3BROA 3FXQA 2HZTA 2VIXA 4IRHA 4KN7X 1ETQA 2XB5A 3E97A 5F64A 3FHZA 4BXXJ 1OLTA 2VPRA 4LIVA 3FCZA 4V2GA 2EFOA 2ZSHB 3ZXSA 2K9NA 4KUMA 4S05A 2W00A 3DKXA 3HRSA 3A0HC 4QPQA 1OPCA 4I09A 3WU1B 4ZYGA 2GA1A 2DU9A 4YRVA 3T9MA 3RKXA 3SW3A 2LSOA 3SDGA 4PSWA 4A5MA 5ACRA 2K3PA 4D1QA 2DFIA 5J1UA 3I13A 1GVDA 1X8IA 4XBFA 3KYCB 1YIJI 4A5NA 4JK1X 3J7AO 4ZDPA 4UUTA 1HLVA 3H9JA 3IV5A 2JPBA 4KA4A 3PG4A 4RGUA 1NK2P 3DU6A 1DPRA 4A6EA 2VC0A 3SZPA 1BMCA 1LVAA 1LPQA 1MH3A 1LJ9A 2EWNA 2W25A 3R61A 4CUGA 3ASOH 4AIHA 3H35A 4I76A 1MJBA 1GVJA 3FDYA 2WAEA 4QIWN 1QPIA 1KO3A 2VE9A 1K4SA 2IP2A 4RGRA 4ENNA 4LK1F 4C9YA 1O7LA 4BXFA 4Z5ZA 2Q0IA 3SFPA 3TW7A 2K40A 1GDTA 1KU3A 5D6EA 1JI8A 4EYLA 2MH2A 1XGSA 4IEJA 5C4JJ 1ZGWA 2A07F 2E1MC 2HI3A 1R4MB 2YNTB 1MQOA 3PNYA 1BJZA 1FOWA 2FQ4A 5LRSA 3BQYA 4E7SA 2IAIA 1O3QA 2B63J 1P2FA 3OIPA 1WVRA 2A3SA 4UV9A 3HPGA 2O61A 4IZZA 4PSXA 1N75A 4UHTA 3OYAA 3U9GA 2KIFA 2DT6A 1ODDA 5K7HA 4U88A 1U5TC 2X48A 3HRUA 3H3EA 1K07A 3I71A 3TO7A 1BW6A 2EIKH 3F72A 3HHGA 5A23A 3L1PA 1OYIA 2V1DA 2DPDA 5F0FA 4OIPF 3QH8A 4NQ2A 3BR5A 2M0MA 4X1EA 2RNGA 3H9GA 5BNGA 1LEAA 2PMUA 1D5YA 2E1CA 1QBJA 3N05A 1Z9CA 4ZEJA 2Z1DA 2DAOA 2WB1A 2LR8A 4F52A 2XF6A 1J0RA 3BJOA 3LA3A 3Q0WA 4ESBA 2BG6A 2WYMA 4XLCA 1SAUA 1XGMA 3OYBA 2IVMA 2QZ8A 5M5YJ 3A4CA 1IN5A 5AIQA 4JX5A 3FHNA 5ICGA 2E1OA 2CWEA 2XAJA 4M3GA 5LHHA 4KFCA 3AG3H 2H6AA 2CV1A 4UBQA 1YCFA 5FD5A 1IC8A 5D6FA 1VQPI 3P5JA 2Y8AA 1RI7A 2QDTA 3MKWB 4ZNBA 2FK6A 5F27A 4UUSB 1FNNA 2QLZA 4E4HA 2ZJRF 2EZLA 3BK1A 2EV6A 3ZN0A 3DP7A 3EYYA 2HOSA 1VFCA 3VYRB 4BQQA 4DBRA 3LSRA 4IKFA 3K4NA 4RMNA 4BQOA 5AHOA 1TLHB 1QPMA 2X6YA 3OOPA 1A5JA 4HOBA 5HVQC 3BCBA 3IDZA 2IA1A 1IRFA 2LKSA 5HISA 2DXIA 3BTJA 4UWSB 1X1AA 2XGEA 2OZUA 2RN7A 5L3FA 3CLOA 2YR2A 5JVGF 3ZR8X 4ABZA 1E2XA 4LIUA 1T33A 1D1CA 1LDJA 2PFBA 5GTHC 1J2XA 3K4KA 5K5OA 3I55I 3PUBA 5AIJA 2CMPA 4YSLA 4ETSA 2R3SA 1BI3A 3H0GJ 1MNEA 1JKOC 4HRIA 4RBSA 2O6GE 2Z3YA 3KEOA 3IE2A 5AEBA 2LH9A 3CC2I 1WKMA 2DW4A 3IEKA 2JUCA 1SAXA 4C3HJ 1F1ZA 4HPQA 1EJ9A 1ITYA 1PP8F 3KPHA 5H2FC 4FISA 5DS9A 1SVLA 1YCGA 2IJLA 4BYYA 2VB6A 3MKYB 5DTDA 3OSFA 2ID3A 1Z3YA 2FD5A 1RNLA 5EDNA 4DOZA 1R6RA 3I0TA 3SPUA 1F9NA 5LCFA 5BPDA 4HNTA 9ANTA 4C1CA 2PG4A 1VZ0A 2WY8Q 2M7BA 2F5CA 1GHCA 1WJ5A 3P7NA 3W3CA 1N25A 3BZKA 4YIFA 4HV6A 1U5TB 1Z91A 2M5DA 1XDSA 5K7FA 1WI3A 5HLGA 3S8PA 1FWZA 2N8GA 3CESA 4KEPA 4B47A 2XGDA 3KEQA 2YNVA 3TMOA 2EB7A 2R7RA 2M45A 4CCKA 2DMPA 3TO9A 3KLOA 5IT3A 1ETOA 1XCBA 5JVTA 2PI0A 1FTTA 2BFLA 1IF1A 4RAWA 3JTHA 1YS7A 2NVYJ 1ZR2A 3HOZJ 5DV5A 5LE1A 4KDPA 2Y69H 2D2WA 3DV8A 3BJAA 3GTOJ 4IHXA 4AVPA 3R0JA 4BY1J 1LDDA 4P62A 4GCWA 1QGPA 3I56I 1TZLA 1OCZH 4N4OB 2XGXA 2K02A 4KMUX 1U3EM 2HS5A 3BDDA 2NVQJ 1BC8C 4XKCA 4H0DA 4JP0A 4AIKA 1ZREA 1VQ9I 4NQWB 1U8BA 2HQRA 2XC7A 3B6CA 2GXGA 3WHCA 4XRSA 3FXJA 4JX6A 2KIMA 5B1BH 1YRNA 2LF8A 4MTEA 3WTTC 4M9SA 2UXNA 3I14A 2BC2A 3DTEA 4EM1A 3HM5A 2CG3A 1T95A 4S0HB 3IRRA 3FKJA 3CC7I 4AWZA 2V9VA 1KR3A 4IHWA 1E3OC 1Y44A 5EVDA 3JSPA 1A8TA 4RM3A 3TP0A 3B73A 2E34A 3ZPLA 3CDHA 1NTCA 2W57A 3CMEI 2YNUA 1USTA 1BI0A 5K5RA 3K2ZA 1BBYA 4XONA 2IW5A 2M0CA 5H6QA 2V9PA 3NQOA 2L2OA 2XDVA 1MDMB 3BP8A 2PLYA 3HSFA 1YJWI 2JRTA 4D7NA 3ZQQA 1E3PA 3R2UA 2ZNYA 4Z6YA 3GZNB 4K2EA 5IOZA 3C2BA 1QQIA 2KFDA 5E3MA 1U5TA 4MEYF 1KZHA 2VJIA 4UV8A 2NZFA 1ZRCA 1Y1WJ 3CJTB 3WGHA 1J7KA 1XTAA 1SD4A 4RDUA 4B44A 3IOFA 1HSTA 4GYGA 5IT9Z 2QBYB 3I4NJ 3L9FA 2DT7B 3IH2A 3RZOJ 1ZKGA 3CUOA 5J6XA 5K7ZA 1XM8A 5F1JA 1X8HA 3HPHA 1KU7A 3FMQA 3JXPA 2Y0MA 2L5QA 5KAFC 3OS1A 4Y4RA 3HJEA 4F92B 3K69A 1XMXA 3OYDA 3FBIB 4D5CA 2GM4A 3AJ3A 1W7PD 1VQKI 1DU0A 3S32A 3G1OA 1T0FA 2BTNA 4AC0A 2BE5F 2DA3A 5ACVA 3QU3A 4XN3A 4XWWA 1KONA 3IH4A 3ZQHA 2F48A 2CYYA 4UXNA 1KQ8A 4U4LA 1VTNC 3V7SA 4TZFA 1XGOA 3KP3A 4BHCA 1T2KA 3CCLI 2P5KA 2NS7A 1T38A 2J5PA 2GZWA 3GTGJ 3UKGA 1FMVA 4LG3A 1FOXA 4TYTA 3PQKA 4AWYB 4G7HF 3GUDA 2XIGA 4E7JA 5H20A 2BG7A 5ERIA 2EJRA 2XB0X 2XAHA 1ZAOA 3ABMH 1ORKA 1ACIA 2ESNA 2ME0A 2BFZB 5K4KA 4YSKA 2NVTJ 1M1EB 4BE2A 3H5NA 3KZIC 5KIKA 4IOCF 3BQZA 1OCCH 1HW2A 3BT9A 5ILVA 3CD6I 2NXNB 2MBFA 3F8NA 2O03A 3A2KA 5J4YA 2H1KA 3SEQA 2JA6J 1SFEA 1STZA 2CQKA 5FKLA 2F5FA 4XQFA 3AAFA 5AJLA 1Z1DA 5IYCJ 5DCFA 3QOPA 4M73A 3MFKA 3JREA 3J7ZI 3DLLF 3RIRA 2IS2A 3W2VA 5FLXK 1XMAA 2LY9A 2MLGA 1HOMA 1WW1A 5FFXA 4Y33A 3JCUC 3PFIA 2EFWA 2NAZA 4L5EA 2OQGA 1H0MA 3LAPA 2QA4I 2WBMA 4C1EA 4PFOA 1QO0D 2P7CB 5K0WA 3ZRGA 1K4TA 3ZMUA 3CTAA 2LMDA 5DD8A 3MKZA 4MIMA 1JJTA 1YW8A 5GPAA 3OIOA 2KIQA 2H94A 1BIAA 1UB9A 2UWMA 4YIRX 3BTLA 2L9SA 2DA2A 3F6VA 3LWFA 1LE8A 4XWTA 1BR2A 3EDPA 4RM2A 3UNGC 5B3SH 5J8FA 1WHUA 1L9YA 2R7FA 1U78A 2M4KA 3VYUB 4HQEA 3AG4H 5ICEA 4KT6A 4YEJA 4NQ4A 3GBGA 1X3UA 2LY1A 2Y9YA 4PDKA 3BR0A 2XKOA 2ZFUA 4P1WA 2UYXA 1R4NB 4BQNA 1YIOA 3CUQC 1XS9A 3MEXA 1S7AA 4U7DA 2LFBA 2O5RA 4OMYA 1ZHFA 5HLHA 2CBNA 2A6TA 4A3EJ 3H0DA 1RR8C 1DD6A 1QZEA 2VXDA 3P9CA 1H8AC 3PJRA 3IE0A 3KLNA 1S5LC 3K1MA 1TQIA 4P9UA 1BR4A 2DT5A 2XSDC 1YLFA 5B3RA 4U0WA 3RPUA 2VJ4A 3K7AJ 5FLMJ 3BG3A 3LFUA 5AXOA 2MC3A 2VBWA 2OTJI 3U21A 4JYKA 1SFUA 1W5SA 2CW0F 3K4JA 3HYIA 3Q3SA 4AU7A 1RETA 3DPTA 1X19A 1XC5A 3JRFA 3V8JA 1REPC 1Y8RB 3E3VA 2JK3A 3ZNBA 3QPLA 2HZDA 5E17F 2I5UA 3G3ZA 2CUFA 4C3IJ 3G2BA 2ZXHA 3KNRA 2P6TA 4NC6A 4ZTFA 3ROUA 2DODA 1J75A 1PUEE 3DKWA 2R5ZB 4KISA 5IOYA 3G6EI 2K3FA 2E2IJ 1VQ8I 2P18A 5HH4A 1FTZA 2MD0A 1MMGA 4RL2A 1ZGAA 2CQXA 1X4PA 3VSLA 3JRIA 3WTSC 2FMLA 3HEFA 1BIBA 3X2ZA 5ACUA 3BR2A 1FY7A 1MD0A 1D1BA 2QQAA 1FP2A 2R7XA 3A0BC 3OYGA 1JUPA 1X2NA 4EJVA 3S3OA 3OV8A 5M3MJ 3F8MA 4JO0A 5FROA 3G4SI 5ACSA 3PQJA 3W6JB 1I6HJ 3S2DJ 1MNDA 3I58A 2M3AA 4UWOB 3K1PA 1U9NA 5C4XJ 3KIOA 3KE2A 1JKRC 5F0HA 1RKTA 5EG0B 2GXBA 4Z7RA 2ZKZA 1IG7A 1JTXA 2KJBA 2LBFB 2R2DA 2GMNA 3SRXA 3FXUA 3IWZA 1YO5C 2BGAA 1VQNI 2ZZIA 3ASNH 3BZCA 1BR1A 1R23A 1X8GA 4CZCA 2Y9ZA 2JA7J 1F36A 3R60A 3BTIA 2RREA 2CO5A 3BG7A 2XRNA 1BM9A 5BQTA 2HQ5A 4CH7A 4J19A 3NAUA 3CF5F 4B48A 4HSRA 3CDLA 3P2UA 2NXAA 4X0GA 4NHJA 3HHHA 4UVCA 3U2RA 4UB6C 4C1HA 2COBA 4W1UA 2VQLA 4I2OA 2DO7A 3WG9A 4I0BA 2EA2A 3HSRA 4PGHA 1J59A 2IS4A 1I3AA 2VOPA 4Y7NJ 3JRCA 5HODA 2QSGX 2W1OA 1AA7A 1V5EA 1VF9A 2X85A 3A03A 2GWRA 2LREA 1P9QC 1YHQI 3I11A 2R7DA 1DP7P 2YPRA 2CV2A 2ZWRA 3K4CA 4UUSA 3F8BA 4BQAA 2QQ8A 2K5CA 1DGWY 3K4BA 3ZMSA 3WTYC 5JFRA 4G7OF 3TDZC 2F5EA 5AONA 4A3FJ 4A69C 4WD6A 3I59A 4BZ3A 3Q5FA 3DF8A 1I50J 1A6QA 2E35A 5A5ZA 2UZKA 1H88C 5LGTA 4Z67A 1QVUA 3LSKA 1FT9A 2VLAA 2K4JA 1TWGJ 1IDYA 2RNJA 3I54A 1I39A 2ISYA 3AL0B 3SBLA 4A3CJ 3ELKA 1XN7A 3I9V2 5LMCA 3SFIA 1LFUP 3CP2A 3S2WA 1P6RA 3SD9A 1B9MA 1MBFA 5L3BA 2E7WA 4DYRA 3OYIA 5KVRA 5B1UA 2KT0A 4KIGA 4KNYA 3A4YA 2JVGA 2Y0SN 2BXZA 4JQFA 5FLXZ 2QEXI 1BC7C 1SMLA 4OWRB 3CCUI 3FXLA 1U2WA 4IQ4A 1OCPA 2P81A 1YFHA 5EGOA 1B8IB 3QPHA 2QJSA 1ZQ3P 4C1GA 4MLOA 3CCJI 3EYIA 1ENHA 3LL7A 3PFYA 2OC6A 5K4NA 4V19K 1X3WB 3DEWA 2OHIA 2F4MB 4XKWA 5GAGJ 4A6DA 3BPXA 2DQLA 2EFQA 2YS9A 1FIAA 3K2AA 1K78B 2NS0A 5GTIC 1GV5A 1L0OC 1OISA 4B4CA 4CYCA 2ZO4A 5E3NA 2VASA 2VKDA 4P55A 5FKMA 4M3DA 1IZ1A 1IV8A 2B0LA 2HYGD 5D5VB 1MSEC 5IPAA 3ONQA 3ECHA 2HB9A 1HKSA 2JMWA 2RKHA 2HVRA 3FM3A 3ERMA 1TW2A 4ANJA 5E1WA 4LD5A 4AIDA 2AQEA 1YJ9I 1YX3A 4EGZA 2PJPA 3KP5A 1MW7A 2Y87A 3C1DA 2MGQA 3K4MA 4CXFA 4HG2A 1ZLJA 3F9KA 3QP5A 3FXOA 3GYHX 5KCMA 1B72B 2F5VA 1MZBA 1GT0C 2ESHA 3FXKA 2VC1A 5E3OA 2ZJPF 4HLYA 1EH8A 1X1CA 3VYTB 3M07A 1DU6A 2NVXJ 3FWEA 3MMYB 5J3LA 1Z7UA 3RKJA 3MD2A 5CPRB 5E20A 5C3EJ 2G7HA 3A01B 3DH8A 4QSHA 4AYBN 4XR6A 3ZQ7A 2DYRH 4NC7A 1VQ5I 4BAYA 5D8LB 2EFNA 4J01A 1F5TA 2YHEA 2OUMA 3Q0UA 1HDDC 1V54H 1ON2A 2DA1A 4WXDA 2RQPA 2IRFG 3CUQB 4ZZDA 3L2VA 1G6NA 2X51A 1OR7C 2L01A 3RYPA 4XLEA 5ILUA 2XF7A 3DHBA 1P9EA 5JI6A 3WGGA 1Y6IA 1XGNA
chains in the Genus database with same CATH topology
1ZYRF 3E6BA 1FZPB 2FU9A 3MCZA 4Q48A 3VEPA 3KZZA 5ICCA 2F5DA 1LQ1A 2Q0JA 5EV6A 3TP9A 2G7UA 4HDVA 4EXYA 2PEXA 3JSOA 2HDCA 4L5JA 2FE3A 4Y13A 2FOKA 4EVIA 4BHPA 2C6YA 2M8EA 2RDPA 3F8CA 2RVCA 3R4KA 4TZ9A 4DQ2A 3HOSA 1RUNA 1ZKPA 5B15A 5LEJA 5A2QZ 3CO6C 3IEMA 3G1PA 3IELA 3P9IA 2O0YA 1GXPA 1P4XA 3DQVC 4NQWA 5A2QK 4V0HA 2V1XA 4OOIA 5D8KB 2DBBA 5E1XA 2XAGA 3N4MA 2KRFA 2NYXA 2ZCWA 1FBUA 3K9TA 2PBIA 3E5UA 4M71A 2QYOA 3FMRA 1R5GA 5DUIA 4WWCA 3SFZA 4RB2C 4UWPB 1JHHA 3BC2A 2AZ4A 2DQRA 4WXHA 4Z6XA 3F3XA 5HDNA 4L9JA 1LNWA 1CF7B 2FBKA 1D3YA 2HYFA 3DXJF 2VODA 4XLPF 4TZBA 4RB1A 1SD7A 4MQ9F 4MQVA 2Y48A 2OQRA 2STTA 2QINA 4YFKF 1FBSA 3RDIA 2OHJA 4U0YA 2BR6A 1WI9A 4I7HA 4UVAA 3ML6A 2FNPA 4HQMA 3X30A 5D5WB 3IE1A 1ON1A 4L0YB 1SMYF 1TNTA 3GZ5A 5E8IA 4Z5YA 1KQ0A 4EFZA 2BV6A 1S6LA 1FYMA 4LGWA 2IA2A 4HX7A 1ZG1A 2BG2A 2EFPA 3X2XA 4B09A 3BWGA 2WWYA 4EYBA 2A6HF 5DYMA 4GGGA 2BFKA 3WGIA 1ZTCA 1R22A 2YNVB 4CZZA 2K27A 4F6ZA 1W5TA 2HQNA 2KKOA 3DEUA 3FF5A 5LGNA 1JT1A 3ZP5A 1KA8A 1S8NA 5D5UB 4YFXF 3M8EA 3JAMZ 2FEZA 4M6XA 1HW1A 5FO5A 5LHIA 4D0PA 3LSTA 3F23A 1IRGA 3AF6A 3ZMTA 4D1VA 1XSVA 5L3EA 2GFKA 3E5QA 3WTXC 1HBXG 2A68F 5ICFA 1GXQA 4UWRB 4S04A 4ENJA 2GFJA 2BGCA 4YIIA 2QEDA 1UFMA 4L9VA 3COAC 2VBYA 2XR1A 4O5VA 3M1EA 5CVIA 2YCBA 2YNWA 1MDMA 5EH9A 2VT2A 3I5UA 3DPLC 2YU3A 3TO6A 4LFUA 1FSEA 4GO1A 2LNBA 2VW8A 4M9XA 4Q47A 2BG8B 3KP7A 4GYUA 4M6YA 3I53A 5FB2A 1JXSA 3WODF 2GKLA 1TQPA 2P7VB 3X2YA 2ZFWA 1DDNA 3E6CC 2I7TA 4BHBA 1W4MA 1ZRDA 4WK8F 1C0WA 5ACQA 2FA5A 3D5LA 1O3SA 2FQ3A 1JE8A 2JTVA 3MD7A 5CVVA 4HL2A 1KGSA 3LQRA 1B59A 4RAMA 1ZG5A 4IRIA 5F1RA 2IPQX 2KJCA 4EJWA 3ABTA 1T39A 2FU7A 1OKRA 2A5YB 3TGNA 5LHGA 5E1ZB 3HOTA 2STWA 1SFXA 3M8FA 5E8GA 1G4DA 3F6OA 3J80Z 3BK2A 2QQBA 4N9HA 4TYFA 3J80K 4CGZA 4G6DA 1LEBA 1IN6A 3KZYA 2PQ8A 4AWXB 2MD5A 3TDUC 1DDKA 2QVOA 5H6RA 3RPCA 1BI2A 4L18B 3FM5A 4KEQA 5KILA 4EMSA 3GZ6A 2WV0A 3L7WA 3L00A 4G8XA 3KP2A 4CYDA 5CVRA 4KN4X 4FSBA 3DHCA 3AF5A 1MKMA 2FMYA 2FXAA 1JJEA 4F7ZA 5EEHA 4NQ5A 3DFGA 4PCQA 1SD6A 2LF7A 3BJ6A 3HRTA 2V1UA 1H9GA 4L9TA 1I1GA 2MLKA 1FLIA 2OBPA 3GFJA 2TDXA 4IXAA 4R8HA 3RKYA 3MZYA 2D1HA 4JBAA 4FX0A 2WHGA 2VBZA 3BOQA 5LRRA 4LJZF 4XSZF 3IWFA 2NZEA 2L4AA 4U0VA 2RV8A 1Q1HA 2VONA 5DUKA 3HIFA 4EQQA 5HIQA 3MAJA 1K6OA 4HLXA 4CDGA 2H6CA 3VODA 3P9KA 1DXKA 1W7PB 1QNTA 4PVTA 3WXCA 5HS7A 3LA7A 3JAMK 3QPTA 4N9IA 3F8FA 1HXDA 1B6AA 4AX0B 3VFZA 1TBXA 1IAWA 4P9FA 4RB3C 4I02A 4CHLA 4LB5A 4F6HA 2FBIA 2VOOA 1Z6TA 5FGMA 3Q6VA 4FT8A 5E18F 1O57A 5AIPA 4G6QA 5A0TA 3F21A 4RAZA 3D0SA 2ZMEB 1FPQA 4P96A 4O3MA 4U7BA 2IT0A 4HX4A 3RYRA 1TQMA 2HKOA 3WTWC 5K5QA 1TNSA 2F2EA 3KETA 2P8TA 4ESJA 4KIBA 3IL2A 2P4WA 4EM2A 4Q4ZF 4NB5A 3T8TA 1G3WA 3EUHA 1VGNA 4FHTA 3GWZA 4A0YA 1PP7U 1CF7A 3CUQA 1JGSA 1V4RA 4C09A 4KICA 3KP4A 3KL7A 3IOGA 4HAMA 2BBYA 2XAFA 4P5OA 2P5LC 2CG4A 1XMKA 3QRFF 1YW7A 4LMYA 1XSXA 5DD4A 3ISPA 6PAXA 5BPIA 2QENA 4ZZLA 2AS5F 1IN7A 2ZNBA 3T8RA 1YTYA 2P6SA 5CLSA 2L4MA 1YCHA 4EM0B 3I59B 1ZLKA 2P1EA 1YG2A 2OZ6A 1MJ9A 5LCAA 5ILSA 3DHAA 1D8JA 3FX3A 4AIJA 4QLCU 2GA2A 3TOAA 2A61A 4A0XA 1R1VA 3LFKA 3ZN1A 3V7CA 5EVBA 4OIQF 1A7TA 3TQNA 5J8CA 4GCVA 2BIBA 5DCMA 5LSCA 5L3CA 3LA2A 4CICA 2EK5A 3I0VA 4UA4A 3NEUA 2BYVE 4L9NA 3IKTA 2P5VA 1WRAA 1YS6A 1L3LA 4HYEA 1ZARA 3ZWFA 2ELHA 3FAIA 1ONVA 2ZNZA 2W84A 1O3RA 4A2UA 4HZFA 2K4BA 2NRAC 2VN2A 3F9OA 3HUGA 2AXLA 3GF2A 3F22A 2BMIA 3E5XA 4YFNF 4LG0B 4ZYEA 1B1BA 3GLXA 2OAZA 4O98A 1D5VA 5LCHA 2MA3A 1P4WA 4AX1B 3T3NA 3T0YA 4ZO2A 3BPVA 5EV8A 3GX4X 1BVTA 3ESHA 4AD9A 2Z33A 4UVBA 5ACTA 2LKPA 2JPCA 3ZMDA 4KMFA 4D1WA 2A69F 1UCRA 2H09A 1FSHA 4HF1A 4OU0A 2NNNA 3RJPA 4ASNA 2FHXA 1AWCA 1K79A 1QZYA 4Y17A 4E70A 1I1SA 4D1TA 5LLDA 4XSXF 1XCVA 4GYIA 5FFZA 2L02A 3G73A 4IHSA 1WRJA 4KYWA 1G3SA 1ZGJA 1S3JA 4MNUA 1A04A 5AYAA 2K7LA 2XASA 4RGSA 2XROA 1KYWA 1I5ZA 5A0VA 2Q8KA 4G94A 5LBQA 3WE2A 2JZYA 4I0AA 5JHUA 5EEGA 2CSOA 3M9AA 3O3KA 1UHWA 2WTEA 2M87A 3BY6A 3GW2A 3VQZA 1R1UA 1FP1D 3VOEA 4R79A 2OU2A 5FQCA 4Q5SF 3HTSB 2M5WA 2QWWA 1G3TA 2RGVA 1ZG3A 5HOOA 2CGPA 2HR3A 4IPAA 3H3ZA 2NYPA 4N0BA 4WX9A 2GAUA 1ZH5A 1LDKB 4IJAA 2XF4A 3GXOA 2JSCA 4MGRA 1WUPA 1PDNC 1KU9A 2DPUA 4TZEA 5AHRA 3BZ6A 3SHFA 5TRDA 1HLKA 4EJOA 3V8KA 2YX4A 2I7VA 2FHXB 2RC4A 2UXXA 4J5FA 2HTJA 3KNSA 5DPXA 1O3TA 4EY2A 4WCGA 3I15A 1Y0UA 3J81Z 1R00A 4ZYDA 4Z2YA 4HL1A 3QU6A 4QWQA 2HEOA 1FYKA 2W24A 1IN4A 2FU8A 3WU0A 1WWXA 1E5DA 4LG0A 3V7RA 5EHTA 1VJNA 5HS8A 5FQBA 2XAQA 2EV0A 2FM6A 2Z99A 5L3GA 3L2CA 4WF2A 2BEOA 4UNOA 1XD7A 4RGXA 5FQAA 5ACWA 3HTUA 4LLGF 4M72A 5JR3A 2M30A 3T5XA 3KFWX 4Y15A 4ZYHA 3QP6A 1HKTA 1WSUA 2I7XA 2GIVA 1R1TA 3L6NA 3RTRA 3S0ZA 1J9IA 1HKQA 3T3OA 2FNAA 2FBHA 3ZMZA 4MHGA 2L3DA 2FU4A 1XDUA 5LGUA 4XUKA 1U8RA 4HDUA 4PZJA 5LLQA 1BI1A 5BS6A 1QH3A 2XV4S 1RUOA 2YSRA 2DK5A 4CHUA 2QM3A 3T1BA 1DPUA 1R5HA 2Q2EA 2WC2A 4RS8A 2E7XA 4LK0F 3SZTA 3J81K 3E6DA 2K86A 1R36A 3EQLF 3ERED 1QH5A 4EJTA 1E17A 1FOKA 2X0LA 3RI4A 2COMA 3O2PE 1EH6A 1G3YA 1IUYA 4GYQA 1BOAA 4TV7A 3ZMVA 4CO8A 1ULYA 2DOOA 1OYYA 3V8LA 5F6FA 5HLIA 2ACJA 1SMTA 3WTUC 4RM5A 4OINF 1ZNBA 5HS9A 2Y8BA 4YSBA 1H9TA 1LB2A 2AIOA 4D02A 5ACXA 5EWAA 1TTYA 3EETA 3M7GA 2FSWA 4C1FA 2HFHA 4R1HA 2CFXA 2G9WA 2Z5UA 2Y75A 4XRFA 1F4KA 3O6BB 2YNTA 4KT5C 5DDGA 4UAMA 4HX8A 4HA8A 3TOBA 3R0AA 1Z6RA 1RIOH 1KU2A 2HGCA 1FX7A 1I27A 1IXSB 1KYZA 1K78A 5LM6A 5LS3A 3BV6A 1VMEA 2M5CA 1S29A 2HWVA 4G7ZF 1S7OA 1FYLA 3GEZA 3GFMA 2Q0OA 4EGYA 1BJAA 3GFIA 5HDKA 5HIOA 1CGPA 4H0EA 1FBQA 3JW4A 5D4RA 1JHFA 3GFLA 2WYLA 2Q9UA 4RB0A 2IA0A 1EH7A 1ZN2A 1IW7F 3CO7C 1HSJA 3IKVA 3K1NA 2JT1A 3LVZA 5D5XB 1MJAA 3QAHA 3E6MA 5IT9K 2XKPA 5L3DA 4L5IA 2QQ9A 4M74A 1HW5A 3C3WA 3LAJA 3L09A 3B02A 5CVUA 3WE3A 2WYMC 2O3FA 2P97A 5A87A 4BXUA 1XTOA 4UUVA 4BH9A 1M2XA 5CJ9A 2A6EF 5HH6A 2V6CA 5ED4A 3K0LA 5CYVA 4HV5A 4A12A 4LB6B 1BC2A 4D1UA 3ADRA 1O7FA 5LEKA 2H27A 1YW9A 1FC3A 4WXCA 4J5HA 3TKYA 3MWMA 1P92A 2FRHA 5K4MA 5HDGA 4ON0A 1QZZA 4OIOF 3SXYA 2ETHA 3FMSA 4KIFA 2HTSA 4EXSA 1MGTA 4HF0A 5ACPA 2QDSA 3R6SA 1DUXC 4DNCA 4ZH4F 4IF4A 4ESFA 2M1BA 2XHKA 2EV5A 2P4ZA 4EJUA 4LLNA 5EW0A 2FU6A 3MQ0A 1OMIA 4HBLA 1TW3A 1ZRFA 4LE6A 4LLLA 2EA4A 2ZBKA 2Q42A 3CJNA 4I98B 4RL0A 5D4SA 2GQQA 3W6KB 3RPQA 2A7MA 2WRSA 1YQAA 2KIUA 5AXRA 4HKYA 4B87A 1WUOA 4OIRF 2XVCA 4IVNA 1YYVA 5FD6A 5DEQA 2LDUA 3I64A 4HF2A 1Z05A 3WTZA 3KP6A 1K7AA 4YG2F 5KK1A 4MEXF 1T98A 4GXOA 4NQ6A 2VT3A 1J5YA 4IRGA 1EV7A 3U1DA 1XSDA 4A0ZA 1UHMA 1HQCA 1IN8A 5DCMB 3ECOA 2GCUA 5TJJA 5BOXA 1B9NA 4PVOA 2OA4A 1SD5A 4RAYA 1BN5A 4ZO3A 3LQQA 4I01A 3KCCA 4EYFA 4MTDA 3SQNA 2ZMEA 4PGGA 3ULQB 2ISZA 1B4AA 3VPEA 3FZVA 3RKKA 1XB4A 2MH9A 2O8XA 2QBYA 2V79A 1R58A 4ENKA 3H92A 1T6SA 1W7PA 1D8KA 2ZXJA 3Q9VA 4OMZA 2PN6A 3ZQ4A 3Q9SA 3FXRA 1I6XA 2FF4A 2VXZA 4BNCA 2H6BA 2DLLA 2OD5A 4DIKA 1NHAA 4EV0A 3HRMA 3C7JA 4FX4A 5K1YA 3VB2A 2VBXA 3JTGA 1V3FA 2L54A 3H3UA 4Z60A 4FR7A 1AOYA 1KO2A 3RKWA 4XLNF 4B8XA 4L0ZB 3HSEA 1OYWA 3IC7A 3C18A 3ABUA 1OR7A 3IHUA 4O6JA 2BFZA 2HOEA 5BMZA 2OHHA 2PMHA 3ZR9A 4FEKA 1RZ4A 3PY5A 2NNYA 2YZ3A 5CVJA 3GO5A 4IHTA 1R7JA 5EVKA 2DI3A 4G9YA 2J5OA 1KQ9A 2QUFA 3NRVA 4DILA 4C1DA 5HH5A 2VE8A 3IRQA 3WTVC 2HKXA 2Z9OA 2DTRA 2E7YA 3PY6A 4ENMA 1USSA 2XUBA 1IXRC 2DK8A 1U6GA 3REOA 1WQ2A 2X4HA 1IXCA 3GVAA 2E1NA 2BG8A 4BP0A 4HW0A 2YX7A 5HIPA 1P4AA 2ZJ2A 3N97A 2DKFA 5IQKA 2ADUA 2D45A 2W85A 3V4GA 4M9ZA 3I4PA 2D1VA 3MZHA 3BROA 3FHZA 2HZTA 3FXQA 4IRHA 4KN7X 5F64A 3E97A 3FCZA 4S05A 2EFOA 4KUMA 3HRSA 1OPCA 4I09A 3WU1B 4ZYGA 2GA1A 2DU9A 3T9MA 3RKXA 3SW3A 2LSOA 4A5MA 5ACRA 2DFIA 3I13A 1X8IA 4XBFA 4A5NA 4JK1X 3J7AO 2JPBA 4KA4A 3PG4A 4RGUA 1DPRA 4A6EA 2VC0A 3SZPA 1BMCA 1LVAA 1LJ9A 2EWNA 2W25A 3R61A 4AIHA 1MJBA 1GVJA <