2ZO4A

Crystal structure of metallo-beta-lactamase family protein ttha1429 from thermus thermophilus hb8
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
315
structure length
301
Chain Sequence
ALLPGLYLLPVPIPYPLKTVNLYLLQGAGEVALVDTALGTRAARGALELHLAELGLCFQDVKTILLTHHHPDHYGLSGFFEGLGARVFLHEEEFARGHRFWREPEAFAEASWRLFLDHGTPEETVEKTRERVHPPQNPLPLRDGEALEVAGKRLRVLWTPGHADGHAAFYLEEEGVLLAGDALLEKVSPNVGLWAYTRENPLKDFLRSLDRLADLGARVAYAGHFGPIADVRQRAEELKAHHQARLEALLALLDGPKTAWELSLHLFPRRFAFAETLAHLEYLREEGAVGRGGPPYRYFRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Metallo-beta-lactamase family protein
publication title Crystal structure of TTHA1429, a novel metallo-beta-lactamase superfamily protein from Thermus thermophilus HB8.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Hydrolase
total genus 100
structure length 301
sequence length 315
ec nomenclature ec 3.-.-.-:
pdb deposition date 2008-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2zo4A02
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 2zo4A01
1IXSB 4OU0A 4KIBA 2HEOA 4AD9A 1ZHFA 2DKFA 1ZN2A 1HW5A 5EW0A 3ZQ7A 2BFKA 4GYGA 1ZTCA 4OOIA 2XAGA 5B15A 4GCVA 2Q0IA 5LGTA 2E7YA 3M7GA 1XGOA 5HLHA 3F8CA 4M9SA 3KP6A 1HBXG 1K7AA 4YSKA 1D5VA 2CBNA 2JRTA 2ZNZA 3WE2A 3U2RA 3GWZA 2XAFA 3MEXA 1T2KA 3R2UA 2CG4A 4ENJA 3MZHA 4EMSA 4Z5YA 3ECOA 2JPBA 4LMYA 3ZMDA 3GVAA 3V7CA 1K07A 3GFJA 4U0YA 2KJBA 4Y17A 2NYPA 5JFRA 1DUXC 5J8CA 1T0FA 4L0YB 4ZZLA 4ZO2A 4D02A 2VBWA 3PG4A 2M30A 2EFOA 2V79A 1VTNC 2G9WA 3RKWA 5IT3A 2FU6A 2DPUA 1YYVA 4ZNBA 4FT8A 5IQKA 5FD5A 1RIOH 3QAHA 1F9NA 3LA3A 3SZPA 4KMUX 3HTUA 5EEHA 4TYFA 5EVDA 3BJOA 1P9EA 2FMYA 3E3VA 1K6OA 1YFHA 2P4ZA 5LCHA 2YSRA 1FPQA 3G1PA 3LA2A 3DEUA 1BI2A 4UVAA 1YQAA 1ZLKA 5CVVA 4M6YA 3WGIA 5EWAA 1G3SA 4A0YA 4KFCA 5HS8A 5J8FA 1FWZA 2MD5A 2ZKZA 1I1SA 4PCQA 3EQLF 4YSBA 1R7JA 4S04A 3Q5FA 3LVZA 1BIAA 2K27A 2IT0A 1BMCA 1MJBA 5DDGA 4FSBA 2VE8A 2H27A 4NQ4A 1FSHA 3IRRA 4IRIA 1CF7B 4PGHA 3F8NA 1H0MA 1IF1A 1OYYA 3P9KA 2M45A 5ILVA 3GFLA 3EUHA 5L3BA 1W7PA 1MD0A 1WUOA 1S7AA 2FBKA 5K4NA 3ZP5A 4G9YA 1V4RA 4WXDA 4A0ZA 2PMUA 2O03A 3O2PE 2Z3YA 3SW3A 2JT1A 3D0SA 4I2OA 1R5HA 3I59B 4Q48A 2Q2EA 3WTWC 2MBFA 3FXQA 1K78A 5D6EA 1FYKA 1BI0A 2W25A 4DIKA 3QPTA 4EY2A 2DQRA 3HSEA 3CDHA 5LE1A 4LE6A 3WTSC 5JR3A 2KJCA 3RKJA 5L3DA 5BQTA 2EFPA 1HLKA 3CO7C 2EV6A 3X30A 5L3GA 4JO0A 2WYMC 2ZNYA 2NZEA 3ZMUA 2QQBA 4EFZA 3K1PA 1L9YA 3FZVA 2RDPA 4HV5A 2BG6A 5KK1A 4OIPF 1KQ9A 4TZFA 2HYGD 3E5UA 5H6RA 5D5XB 4JQFA 1TBXA 4YIIA 4A6EA 2HTJA 2YNTB 5ICFA 1O7LA 4UAMA 1IW7F 3BROA 1EH7A 2IA0A 5LGUA 4EJUA 1U5TA 3ZQ4A 2QLZA 1IAWA 3HOTA 1KU3A 5LHGA 3HTSB 1KGSA 5TJJA 2WHGA 2QBYB 3V7SA 1A7TA 5AONA 5AEBA 5D4RA 3DPLC 1WRJA 3KP2A 5LSCA 3MQ0A 2DPDA 3I15A 4EJVA 4BZ3A 3TDUC 3HIFA 1T39A 5ACTA 1OYIA 4CXFA 3QRFF 4D1VA 4UV8A 4OMZA 4NQ5A 2KRFA 2ZZIA 2P6SA 3RYRA 4RGUA 2P5LC 2VOOA 1C0WA 5EEGA 5D5UB 2ZMEA 3SD9A 3VEPA 4P5OA 1JJTA 2P7VB 3FXUA 4EGZA 4BHBA 4ZEJA 1LDDA 2IP2A 5LRSA 3IE0A 1ZLJA 1JHFA 4IPAA 2R7FA 2H09A 2FU7A 2Z5UA 4UHTA 4BP0A 3WTZA 5LLDA 2QJSA 5F64A 2MC3A 2CQKA 2GMNA 3BDDA 1ZYRF 2X4HA 1YIOA 4HF2A 2FF4A 2YR2A 4O98A 4V0HA 5IT9K 2NNNA 1ONVA 1X8GA 5D8KB 1YW7A 1WI9A 1LB2A 4UXNA 2LKPA 5FLXK 1XSXA 2LF8A 1IN6A 3GXOA 1R1VA 3LWFA 1LNWA 4MHGA 3ABUA 2ETHA 2PFBA 4UNOA 2OA4A 3F6VA 3JSOA 4EYFA 3ZN0A 4GCWA 2HTSA 3IEMA 1UCRA 2F5CA 5ACPA 1GXPA 3RPQA 4RM5A 4I0AA 2BG8B 2CO5A 5FFXA 3S0ZA 2KIMA 1Z9CA 5HIPA 2UYXA 3C18A 5D8LB 1D3YA 1BBYA 3L00A 4L9NA 4MTDA 5FQAA 3LSTA 1KR3A 2V9VA 4H0EA 4MQ9F 1MGTA 2YX4A 2B0LA 1B4AA 3HUGA 3DHCA 2Y8BA 3C1DA 4IVNA 2RC4A 6PAXA 1X3UA 2WWYA 1XCBA 2EFWA 4LB6B 1F4KA 5HDNA 3I64A 5E17F 2J5OA 3FMQA 3H3UA 2Q0OA 4KDPA 3GLXA 5FD6A 5B1UA 4Z2YA 1VJNA 1HSTA 2H6AA 2OZ6A 1JT1A 1FLIA 4LK1F 1IXCA 1XMKA 4C1CA 2A6HF 3I54A 1R36A 4R79A 1DDKA 5LMCA 1ZREA 2A6EF 2OU2A 2ZCWA 1RNLA 2K4JA 4EJTA 5IT9Z 4MNUA 3RJPA 1MDMA 3BY6A 1B6AA 2D45A 3KP7A 3QU6A 4CICA 2Y8AA 1KO2A 3ZN1A 4BHCA 5KVRA 2A07F 2DI3A 4U7DA 2ZXJA 3WU1B 2BBYA 5FLXZ 2GCUA 4C1DA 4EXSA 4DNCA 1L0OC 4P96A 3DQVC 5FQCA 4A6DA 4EGYA 1WSUA 2AS5F 4U4LA 2DK5A 2EWNA 2IA2A 2VC1A 3BK1A 5CVIA 1LDKB 2XVCA 2K4BA 1R58A 1DPRA 2QUFA 4U7BA 1XM8A 3MFKA 2DTRA 1Z1DA 2K86A 5CLSA 1DXKA 5F6FA 2XGXA 5A0TA 4AIHA 1FZPB 2EFQA 5DD8A 2UWMA 4D1TA 3IC7A 4U0VA 4TV7A 3QP6A 3F6OA 3E97A 1H9TA 4HAMA 1QH3A 2ESHA 2BMIA 1MQOA 2CW0F 3FHZA 2R7DA 4CDGA 2WYMA 4KA4A 2IRFG 4RGSA 4D0PA 2W57A 1LDJA 1RUNA 3RKKA 1YW8A 5AXRA 1I6XA 2FSWA 4O6JA 1BI3A 4HLXA 1Y44A 1TW3A 3JW4A 3BZ6A 5LEKA 3VB2A 1E17A 4Y15A 2XAHA 3E6BA 3P9IA 1FBSA 4DQ2A 1R23A 2M5WA 4FHTA 1FBUA 3WU0A 3DF8A 1KU2A 2H6CA 4HDVA 2EK5A 1DPUA 2CGPA 3CLOA 2WRSA 3U9GA 2BE5F 1E2XA 2DFIA 2RQPA 4ZH4F 1E5DA 4YIFA 4YFXF 4RS8A 4ENMA 4NQ2A 3W6JB 4OIRF 1BOAA 4TYTA 4CHLA 3E5QA 5LBQA 4LFUA 2LF7A 3P2UA 4HBLA 3T0YA 2Q9UA 3K0LA 5ICEA 3A4YA 4LLNA 3EDPA 4CZZA 2ESNA 3MWMA 2MH2A 3PFIA 3JAMK 5K4MA 1PUEE 1S8NA 5ACWA 4LJZF 4KEQA 2M8EA 3F8MA 1CF7A 1ZARA 4G7HF 1GXQA 2XAJA 5K5RA 4LGWA 1X8HA 3GFIA 5A2QK 2AIOA 4RB0A 3CJNA 1YLFA 4WXHA 1IN7A 1B1BA 4O5VA 2FHXB 2CWEA 3IOFA 3F8FA 1GHCA 3CTAA 3U1DA 1G3TA 3GW2A 3RPUA 3BWGA 4JBAA 3F21A 3AF6A 3GF2A 4N9IA 5DCMB 1W7PD 3I59A 3L7WA 3LAPA 1BM9A 3S2WA 4UBQA 1UHMA 2P6TA 1O3SA 2HZTA 3RDIA 3KFWX 2RNJA 2PI0A 3KCCA 4EYLA 3GX4X 2OHHA 3LQQA 4F7ZA 5LLQA 2YPRA 1TQPA 5ED4A 2ADUA 5CVJA 2RV8A 2ISYA 4C1GA 3I0VA 4L0ZB 4F6ZA 1ZG5A 5BMZA 1W5SA 2F5DA 3J7AO 1ZG3A 5HDGA 2FK6A 3RKXA 5EVKA 1I1GA 3SFZA 1LJ9A 3WODF 2IVMA 3X2XA 2PJPA 1KA8A 1Z05A 2P7CB 3DHAA 3WTXC 2P5VA 2YNTA 2F2EA 3JAMZ 1YCHA 1BN5A 3F3XA 1O3RA 5HDKA 4HX8A 3VFZA 4UA4A 3SXYA 5HIOA 1FYLA 2JPCA 2XHKA 1WKMA 5A2QZ 3JTGA 2QBYA 4C1HA 3GYHX 2P4WA 1SMLA 4KYWA 3VQZA 4OIOF 4FEKA 3RTRA 4FR7A 3REOA 1HW2A 1DP7P 1T6SA 2I7TA 2G7HA 4ZYGA 4AX0B 3BPVA 2PLYA 1GVJA 1R1UA 4HLYA 2WYLA 5DPXA 1AOYA 2RKHA 2CSOA 4XRFA 1KQ0A 3DKWA 4EQQA 3HYIA 4L9JA 5JI6A 4MGRA 1SMTA 5E8GA 1SD6A 3RYPA 1XSDA 3KP5A 5BOXA 3HSFA 3KEOA 2BR6A 3I11A 5E18F 4HZFA 2RGVA 4TZEA 4B87A 1V3FA 3HRSA 2LNBA 4RAWA 3K69A 4XWTA 3WGHA 2XUBA 2W85A 3WTYC 4HV6A 2YCBA 1U8RA 2OBPA 4WD6A 2EFNA 1MJ9A 1LEAA 2HQRA 3PY6A 1BC8C 4D1WA 3J80K 2D1HA 3DFGA 2DW4A 1SD7A 1FX7A 3WXCA 3F9OA 3W6KB 2FNPA 5LGNA 5K0WA 2BG8A 3NRVA 4AVPA 4KT5C 2FBHA 2I7XA 1JXSA 5EVBA 4CO8A 4BYYA 3WTTC 2Y0MA 1S3JA 2HR3A 3IKTA 2HGCA 5H6QA 4EM0B 3AF5A 4GO1A 3T9MA 1FOKA 2L54A 2PQ8A 3EYYA 1FY7A 4HF0A 4HL1A 2NNYA 1IN4A 4KN4X 1AWCA 2C6YA 4OMYA 1S6LA 2DBBA 1IN5A 4I7HA 4A12A 2QWWA 4M9ZA 3VOEA 2V1XA 3ISPA 4RL0A 1BC7C 4G7ZF 1BVTA 3F23A 1HXDA 2ZBKA 4XLPF 4ZYDA 2GFKA 3TOBA 2Y48A 2OZUA 3IELA 1ZKPA 2FBIA 1VGNA 1RZ4A 4A2UA 1IUYA 4CGZA 3M1EA 4A0XA 4LK0F 3KZYA 2XKOA 4UVCA 4EM1A 2YZ3A 4IRHA 4AWZA 5CVUA 3V7RA 4GYQA 1FYMA 4L9TA 2PEXA 3J80Z 1HQCA 4MQVA 4PVTA 2EB7A 2IPQX 3FWEA 5L3FA 3QH8A 4N0BA 5E1WA 1S7OA 2ZO4A 1BC2A 2RVCA 4ZYHA 1WRAA 2FU9A 3JXPA 5K5QA 1HW1A 4GYIA 3RIRA 2QINA 1TW2A 5HLGA 2I7VA 2YX7A 2Z33A 3ZR9A 1JGSA 2L4AA 4OINF 5B3RA 1YW9A 2IW5A 1JHHA 5ACVA 5LCAA 4Z7RA 4BXUA 3DV8A 2BFLA 5DEQA 3NEUA 5EV6A 4HF1A 1EV7A 4I98B 5FB2A 4HW0A 1UB9A 2HYFA 1SMYF 4C1EA 3TO6A 4GYUA 4PVOA 5K4KA 3GEZA 2GA2A 2QDSA 1KU9A 2XF4A 3M8FA 2V1DA 1UFMA 5ACSA 2VOPA 3BC2A 5K1YA 2OHJA 1IZ1A 4I09A 3BJ6A 1EH8A 4AWXB 1YG2A 5H20A 2FNAA 1ZH5A 4P9FA 4JK1X 1REPC 1J5YA 2VXZA 1QZZA 3K1MA 4O3MA 3SHFA 3MAJA 4E70A 2DU9A 4UWOB 3TO9A 2H94A 1Z6TA 4FX0A 4RB2C 4HQEA 4Q47A 1YTYA 3MZYA 2JZYA 2COMA 3H3EA 5J6XA 4I02A 2XIGA 3FAIA 1J75A 2J5PA 2R3SA 5ACUA 4BHPA 2BGCA 2O0YA 2G7UA 4M74A 4P9UA 2NZFA 1OMIA 4IHTA 2JTVA 3ML6A 2M5DA 2WC2A 1P4WA 1D8JA 3P9CA 4G6QA 2Z9OA 1XTOA 5DV5A 1XGSA 4NB5A 4TZ9A 5BS6A 2CYYA 4AX1B 3FM3A 4QWQA 2XASA 1QNTA 1ZRCA 4KMFA 2EV5A 1ZGJA 2K7LA 2HDCA 3J81K 1BI1A 5E1ZB 4HA8A 3R0AA 2BFZB 4WWCA 4AWYB 3O6BB 3N4MA 3BJAA 4C09A 1F5TA 1KYZA 2HS5A 2OHIA 3GUDA 4D1UA 1LQ1A 3KLNA 1KQ8A 3I5UA 3TO7A 1J59A 4M73A 3Q6VA 3IRQA 4LG0B 5ILUA 2FHXA 4EM2A 2WV0A 3E6MA 3CO6C 1JE8A 2BIBA 1ZRDA 3KE2A 2JSCA 1QBJA 4PDKA 3DP7A 3K2ZA 2TDXA 3T5XA 1O3TA 4Q5SF 2MA3A 4PZJA 1QZYA 5DCMA 4EJOA 2XV4S 3KETA 2EA4A 3TDZC 2D1VA 3C7JA 4HOBA 5E8IA 3FX3A 3LAJA 5LCFA 3ERED 4OIQF 1SD5A 3HSRA 2MH9A 1T38A 5AHOA 2XR1A 2EA2A 2GZWA 4EYBA 3V8KA 3WTUC 3N97A 4RAYA 5DD4A 4Q4ZF 1HKSA 2YNWA 3HHHA 4RB1A 5LS3A 1O3QA 3FCZA 3BOQA 1FC3A 4B8XA 1R5GA 5AXOA 3TP9A 3I13A 4G94A 2V1UA 2XAQA 3T3OA 3IDZA 2NYXA 4ZZDA 2WTEA 3ZMTA 3K1NA 4LD5A 5D6FA 2W84A 1ZGAA 3EYIA 1TNSA 2KIUA 3SQNA 2Y87A 2MLGA 4WX9A 5HVQC 2VBZA 1UHWA 3L6NA 3C3WA 3ELKA 1R22A 4L18B 3J81Z 3OOPA 3BP8A 3X2YA 4NHJA 4ESJA 1FNNA 4MEYF 1FBQA 3ZNBA 2IJLA 3H3ZA 2NRAC 5EH9A 3M8EA 5KILA 3X2ZA 3D5LA 4R1HA 2DO7A 2K02A 2P97A 1G3WA 2NS0A 1F1ZA 4YSLA 2XRNA 1YS7A 4WCGA 4CYDA 2GQQA 3F72A 2YNVB 2FQ3A 2HKXA 2BG2A 5ACXA 2ACJA 5AIQA 3KP4A 3PQJA 5DUIA 3VODA 2MLKA 1R00A 3FMRA 1RUOA 3T8RA 5HH6A 5HIQA 4RGXA 5D5WB 2QZ8A 1K79A 5DCFA 2FM6A 3MCZA 3L09A 2E1CA 2P8TA 1R1TA 1RI7A 3LA7A 5HS9A 1OPCA 2AXLA 2PG4A 1TQIA 2GIVA 5HISA 5HH5A 1MZBA 2OQGA 3IKVA 2BG7A 3FXRA 3O3KA 5FFZA 4YG2F 4M9XA 3ULQB 1B59A 1VMEA 2XROA 1IRFA 3M9AA 2A7MA 5ILSA 1Q1HA 2FEZA 3BPXA 2O6GE 2ZFWA 4A5NA 3OV8A 3I58A 4EJWA 4J5HA 3Q9SA 4Z60A 2D2WA 1ON2A 2M87A 4S05A 4RAMA 1NHAA 3ZPLA 3WTVC 4IHSA 3P7NA 5LHHA 2VONA 3AAFA 2A3SA 3EETA 2KKOA 4J5FA 2QDTA 4LLLA 5FO5A 1A8TA 4G7OF 3CUQA 4ZO3A 2HWVA 2H6BA 5CYVA 4HYEA 3GFMA 2KIFA 1XB4A 5D5VB 3SPUA 4BNCA 4KICA 1Y0UA 2FXAA 3SFPA 2VW8A 2PMHA 4UV9A 3E6CC 2R2DA 4HQMA 3LFKA 5AIPA 3KNSA 4G6DA 3DPTA 4XSZF 1PDNC 3QU3A 5KIKA 5EHTA 2DLLA 4XBFA 5F1RA 1HSJA 2XKPA 1TQMA 4Z67A 1WQ2A 3HOSA 1SAXA 1HKTA 1Z6RA 3SBLA 3RKYA 2LDUA 1YO5C 1I5ZA 1O57A 2Q0JA 3V8JA 2L4MA 2BC2A 3COAC 3K9TA 5LHIA 1QH5A 4UWRB 4RB3C 3GZ5A 2DK8A 4HX4A 4NQWA 1P2FA 4PGGA 4AIKA 2OQRA 3L9FA 4L5JA 5L3EA 3ZWFA 1XGNA 2E7WA 4XWWA 2E7XA 2FMLA 1USTA 5CVRA 3IEKA 4F6HA 4HL2A 3DHBA 4BAYA 1J7KA 1XN7A 3TKYA 2F5EA 1S29A 2FE3A 4ESFA 3I14A 3VPEA 3V8LA 1KO3A 1IRGA 5EV8A 2ZWRA 1FP2A 5JHUA 5AHRA 5LEJA 3WE3A 1XMAA 4RGRA 2M5CA 5DUKA 2DOOA 4UWPB 1I27A 3I0TA 1ZG1A 3MD7A 2HOEA 3E5XA 3HRMA 2BV6A 2V6CA 3F8BA 5JVTA 4LLGF 4KNYA 2EJRA 1KYWA 3I71A 1ULYA 5TRDA 4FX4A 5FGMA 3CUQB 1YCFA 3ADRA 2GXBA 4B09A 2O8XA 1P4XA 2F5FA 4DILA 1XGMA 1EH6A 4H0DA 1OYWA 2IA1A 3L2CA 3WGGA 3ECHA 4BQAA 2UXNA 2P5KA 5ERIA 4M6XA 4RL2A 4HX7A 5L3CA 1PP8F 1BJAA 1TLHB 2P18A 3KL7A 1FSEA 4UWSB 3JSPA 2ZJ2A 2QM3A 1P6RA 3QOPA 3F22A 2BYVE 1D8KA 3Q9VA 4K2EA 4KN7X 1T98A 1STZA 4IJAA 1WW1A 1J2XA 2OAZA 1Z7UA 2RN7A 1QO0D 3T8TA 4RBSA 4QLCU 2Q42A 1M2XA 2STTA 2P1EA 5HS7A 3CUOA 2LSOA 3WG9A 1XDUA 5BPIA 1CGPA 1IN8A 2FU4A 5LRRA 1G4DA 1W7PB 2BFZA 3TGNA 5E20A 2Y75A 3DH8A 4P62A 1XSVA 2A61A 3B02A 3TQNA 4ETSA 2QENA 3R6SA 5ICCA 1SD4A 4UUVA 1MJAA 1O7FA 2ELHA 1X8IA 4KIFA 5ACQA 1DDNA 3ESHA 1U6GA 4LG0A 5LM6A 3ROUA 2QVOA 1XDSA 3KZZA 2DQLA 3SZTA 2STWA 3IE1A 1U2WA 4ENKA 2ZNBA 4R8HA 4P55A 1K78B 4Y13A 3SRXA 3GO5A 1FP1D 4L9VA 5K5OA 5HOOA 1JJEA 5HLIA 1A04A 3FMSA 3GZ6A 1ZAOA 3I53A 4YFKF 4IF4A 4HKYA 3IL2A 1IXRC 4U88A 3B73A 2YU3A 4RAZA 3IE2A 3KEQA 1LEBA 3T3NA 2QEDA 2GKLA 2M1BA 1XD7A 4BH9A 4GXOA 1LVAA 2L3DA 1J9IA 3V4GA 1USSA 1QQIA 2ISZA 2VN2A 1P92A 1B9NA 2O3FA 1SFXA 3CUQC 2GA1A 1G3YA 4XSXF 1G6NA 3H92A 1P4AA 4U0WA 2FU8A 1WUPA 3KNRA 3HRTA 1B9MA 4EXYA 1FT9A 2FA5A 4M71A 1XCVA 1U5TB 3HHGA 4KIGA 4MTEA 1TTYA 3KP3A 1YCGA 2UZKA 2A68F 2Z99A 4LB5A 2CFXA 4Z6XA 2VE9A 1OKRA 3RPCA 1U3EM 2NAZA 4M72A 2VC0A 1W5TA 3LQRA 4WXCA 4XUKA 1W4MA 4HDUA 5FQBA 3BV6A 2FRHA 3HRUA 1YS6A 4C1FA 3ZMVA 4A5MA 4L5IA 4KEPA 2L01A 2ZMEB 1H9GA 4UVBA 4ENNA 1ODDA 3G3ZA 4EV0A 2QQ9A 2NXAA 1KU7A 2YNUA 1ON1A 1WWXA 4XLNF 2PN6A 2YNVA 2HB9A 5A5ZA 2GFJA 2E1NA 3JTHA 5HH4A 3QPHA 1MKMA 4ASNA 2W24A 3T1BA 4YFNF 3G73A 2BEOA 4MEXF 1ZRFA 3R0JA 4ON0A 2DAOA 1L3LA 2FOKA 3ZMSA 3ZMZA 2VODA 3DXJF 2HKOA 1DD6A 2HFHA 3AJ3A 2GXGA 2AZ4A 2A69F 4KUMA 2GWRA 4AIJA 1BIBA 2QYOA 5E1XA 4WF2A 4CHUA 4G8XA 4NQ6A 3R4KA 5D4SA 5DYMA 4Z5ZA 2DT5A 4IRGA 2HQNA 5ICGA 2BTNA 3PQKA 1QPMA 3RI4A 2BGAA 3R61A 4ZYEA 5A87A 2VT2A 2L02A 3TOAA 5ACRA 4ESBA 3PY5A 3QP5A 4IXAA 1U78A 2X0LA 5AYAA 1ZNBA 1J0RA 4GGGA 3NQOA 3IOGA 5A0VA 5BPDA 2VT3A 2VBYA 2PBIA 3I4PA 3FF5A 3IHUA 3KLOA 2O61A 1TNTA 4I01A 3R60A 1HKQA 3IWZA 1QGPA 2OD5A 3BK2A 1U5TC 1PP7U 2EV0A 3E6DA 1SFEA 2GAUA 1SFUA 1OR7A 3ABTA 2Q8KA 4I0BA 1Z91A 3FM5A 5CJ9A 2VBXA 1MDMB 2UXXA 4N9HA 4WK8F 4TZBA 3IWFA 4EVIA 2QQAA 2A5YB
chains in the Genus database with same CATH superfamily
1IXSB 3U1KA 3Q0WA 4OU0A 3CMEI 4KIBA 2MC4A 2HEOA 4AD9A 1ZHFA 3M8JA 2DKFA 1ZN2A 1HW5A 5EW0A 3ZQ7A 2BFKA 4GDFA 4XOPA 4GYGA 1ZTCA 4OOIA 2XAGA 5B15A 4GCVA 4G6TB 1VZ0A 1ZKGA 3H5RA 1UAAA 3JCUC 2Q0IA 5LGTA 3OR1C 2E7YA 3FBNB 3M7GA 1XGOA 5HLHA 3F8CA 2XRLA 3S1MJ 4M9SA 3KP6A 1HBXG 1K7AA 4YSKA 2JUCA 1MNMC 1IRZA 5HODA 3K4KA 3CMYA 1D5VA 2CBNA 2JRTA 1ETQA 2EZHA 2ZNZA 3OR2C 3U2RA 3WE2A 1VQPI 3GWZA 2XAFA 3MEXA 1PVEA 3W2WA 1T2KA 2B63J 3R2UA 1WJDA 4XRMA 5IYCJ 2CG4A 4ENJA 1FOWA 1UG0A 3MZHA 2RQQA 4EMSA 2DA5A 4Z5YA 3ECOA 1ZELA 2JPBA 1POGA 4LMYA 3ZMDA 3GVAA 3CF2A 3V7CA 1K07A 3GFJA 4U0YA 2KJBA 4Y17A 4FETA 2HXIA 4BE2A 5JFRA 1DUXC 2NYPA 5J8CA 1T0FA 4L0YB 4ZZLA 1G59A 4ZO2A 4D02A 2VBWA 3PG4A 5J40A 2M30A 1VQKI 1JUMA 2EFOA 5C4JJ 2V79A 2DCEA 1VTNC 2G9WA 3BR0A 2YHEA 3CJTB 3RKWA 5IT3A 2FU6A 2DPUA 1YYVA 4ZNBA 4DYQA 4FT8A 2VASA 3ZGKA 1OFCX 2M0CA 5IQKA 5FD5A 4CYCB 1RIOH 4M3FA 2HVRA 3AG2H 3FIWA 1X19A 3QAHA 1F9NA 3LA3A 2KISA 2EZIA 1R49A 3CCLI 3SZPA 1VNDA 4KMUX 3HTUA 5EEHA 3DLAA 1X2NA 1R6RA 1WJEA 2KP6A 3ZOBA 3KEYA 4TYFA 5EVDA 1KONA 3BJOA 4BE1A 2AHQA 3BCBA 1P9EA 2FMYA 1Z3YA 3E3VA 1K6OA 2HPMA 2ZJRF 1YFHA 2ZSHB 5E79C 2P4ZA 5LCHA 2YSRA 1FPQA 2R7UA 3G1PA 1JT0A 3LA2A 1H89C 3DEUA 5EGOA 4FQGA 1QVUA 1BI2A 4UVAA 1IO2A 3HXLA 3BTCA 1YQAA 1ZLKA 1YRNA 2ELKA 2Y9ZA 5CVVA 4M6YA 1X58A 3WGIA 1DGRM 5EWAA 1G3SA 4A0YA 4KFCA 5IY5H 5HS8A 4OAYA 5J8FA 1FWZA 2MD5A 2ZKZA 1I1SA 1AA7A 4PSXA 2CH0A 4NURA 4PCQA 5LD2C 4XKCA 3AL0B 3EQLF 5M3MJ 2M7BA 4YSBA 4QPOA 4YIRX 1R7JA 4S04A 3Q5FA 4MLOA 3LVZA 4XR6A 1BIAA 2K27A 4BEHB 2IT0A 4XQFA 1BMCA 1MJBA 2F6CA 2JSPA 5DDGA 4FSBA 2LG4A 3MZ8A 2EINH 3HBLA 1QHGA 3QOEA 2LC2A 5TISC 2XSDC 3JRGA 3PJRA 2VE8A 5FKLA 1OQYA 3TP3A 2H27A 4NQ4A 1FSHA 3IRRA 4IRIA 1CF7B 2I5UA 4PGHA 2R7WA 2FX0A 3F8NA 3MKLA 1H0MA 1IF1A 1OYYA 3OWTA 1ETWA 2M45A 3P9KA 5ILVA 3GFLA 2K9NA 3EUHA 4PJ0C 3PUBA 5L3BA 1W7PA 3HOWJ 1MD0A 1WUOA 1S7AA 3DKXA 1BW5A 2CFZA 2FBKA 3RQIA 3JREA 5K4NA 3ZP5A 1E3PA 2CJJA 3G1LA 5C44J 2ZB9A 3K4LA 4XM3A 1MBGA 4G9YA 1V4RA 5HNFA 3L2VA 4WXDA 2UUZA 2V9KA 2PMUA 2O03A 2P81A 3O2PE 4A0ZA 2Z3YA 3SW3A 1OCRH 1D0XA 2JT1A 3D0SA 4I2OA 4B44A 1Y39A 2GLOA 1R5HA 3I59B 4Q48A 2ZXIA 4BBRJ 2XPVA 3K4JA 4KISA 2Q2EA 4CCMA 1EA3A 3WTWC 2MBFA 3LL7A 3FXQA 1K78A 3FK6A 5D6EA 2E2IJ 1FYKA 1BI0A 2W25A 4DIKA 1BR4A 3QPTA 5KAFC 4EY2A 3IH4A 2DQRA 3HSEA 3U21A 1V5EA 4IOAF 3CDHA 2W48A 5LE1A 4LE6A 3WTSC 2K9LA 4JX4A 2OCCH 5JR3A 2KJCA 3RKJA 1TC3C 5L3DA 5BQTA 2EFPA 4CH7A 2R7XA 1HLKA 3G1OA 2EV6A 3CO7C 1MBEA 1R9TJ 3X30A 2RAEA 2DOEA 2EIKH 5L3GA 4JO0A 2BHZA 1HF0A 2WYMC 3CDIA 2ZNYA 1DP3A 3IAM2 1K83J 2NZEA 2W1OA 2QQBA 3ZMUA 4EFZA 3K1PA 4NC7A 1YIJI 4XIDA 1L9YA 4KT6A 3BR2A 1UMQA 3FZVA 2GOXB 2RDPA 4HV5A 1ETVA 2IBDA 3DBRB 5J3LA 4BBSJ 2BG6A 5KK1A 4OIPF 1KQ9A 2IS4A 2MABA 2MGQA 4TZFA 2WY8Q 2HYGD 3E5UA 5H6RA 5D5XB 3OS1A 2F48A 4JQFA 5IYDJ 1TBXA 4IEJA 4YIIA 4YEJA 4C30A 3JRIA 3CCEI 4A6EA 1I39A 2HTJA 2YNTB 5ICFA 1YRNB 1O7LA 4Y3OA 2UV1A 4UAMA 1IW7F 3LOCA 3BROA 1EH7A 3TP0A 3K10A 3J7ZI 3CMAI 4A3IJ 2IA0A 2X51A 5LGUA 3PM1A 4EJUA 1U5TA 3PSIA 2HPIA 2LREA 2LBFB 3LSIA 3ZQ4A 1OISA 2QLZA 3H5AA 1IAWA 3HOTA 3A2KA 4A93J 1KU3A 5LHGA 2KDZA 3DBHB 3HTSB 1KGSA 5TJJA 2WHGA 3SFIA 2QBYB 2NVYJ 3V7SA 1A7TA 5AONA 1A5JA 5AEBA 2BVLA 5D4RA 3DPLC 3C2GA 1WRJA 3KP2A 5LSCA 3MQ0A 2DPDA 3I15A 4EJVA 4BZ3A 3TDUC 2R5YA 4UUTA 3HIFA 4BQNA 3AL0C 5B1BH 1T39A 3I4NJ 5ACTA 3ERMA 1OYIA 4CXFA 3QRFF 4D1VA 4UV8A 1IDYA 4OMZA 4NQ5A 2ID3A 2KRFA 2ZZIA 2P6SA 3RYRA 2H8WA 4RGUA 2P5LC 2VOOA 1C0WA 2W00A 5EEGA 3G1MA 5JVGF 5D5UB 2ZMEA 1DU6A 3SD9A 3W2AA 2BZTA 3VEPA 1VQ6I 4P5OA 1JJTA 2P7VB 3H9JA 3OY9A 3FXUA 2L7ZA 3B6CA 4EGZA 2OC6A 4BHBA 4ZEJA 1LDDA 1SFKA 2IP2A 5LRSA 3IE0A 2WADA 3E1SA 1ZLJA 1JHFA 4IPAA 4QSHA 3ZQFA 2R7FA 2H09A 2OUMA 3O8GA 3UNGC 3H0DA 2FU7A 2Z5UA 3EUKL 2E1MB 1OCOH 3CC7I 4BU2A 1AKHA 4UHTA 4BP0A 3WTZA 3PL8A 5LLDA 2E1OA 2QJSA 5F64A 2MC3A 2CQKA 2QCOA 5CQGA 2GMNA 3BDDA 1NH3A 1ZYRF 2X4HA 1T08B 1YIOA 3S8PA 4HF2A 1Z21A 2FF4A 2YR2A 1MMSA 4O98A 4V0HA 3OYBA 5IT9K 3SZGA 2NNNA 3RZOJ 1ONVA 2Q2EB 1X8GA 5D8KB 1YW7A 2IGMA 4M3GA 4JX6A 1WI9A 1LB2A 4XLHA 2R5ZA 2M7AA 4LG3A 4UXNA 1W5CC 4GFBA 2LKPA 1ZK8A 5FLXK 1XSXA 2DFFA 2YS9A 2LF8A 1X1CA 1IN6A 3GXOA 1R1VA 2BXYA 4YRVA 3LWFA 1LNWA 4MHGA 3ABUA 1MMAA 2ETHA 2PFBA 4UNOA 3PO3J 2HNHA 2R7ZJ 2OA4A 3F6VA 4DOZA 3JSOA 1VI0A 4EYFA 2B7EA 5BNGA 3ZN0A 3JRHA 3OYDA 4GCWA 2HTSA 4F52A 1XG1A 3IEMA 1UCRA 2F5CA 4HRIA 2IAIA 5ACPA 2D5VA 2IS6A 4JX5A 3RPQA 1GXPA 4RM5A 1ACIA 4I0AA 2BG8B 2CO5A 5IP6A 5FFXA 2CUEA 3S0ZA 4JOMA 2KIMA 1Z9CA 4E7JA 3HOVJ 2DA6A 3PSFA 5HIPA 2UYXA 5B66C 3C18A 2PMZN 1GDTA 5D8LB 1RKTA 1D3YA 1BBYA 5DTDA 1VQMI 3L00A 4L9NA 4MTDA 5FQAA 1W1WE 3LSTA 1KR3A 2AQEA 2V9VA 3K4BA 4H0EA 1VQ8I 4MQ9F 2VLAA 1WGXA 2WY7Q 2YX4A 1MGTA 4HSRA 2DOFA 2B0LA 1B4AA 1WJBA 4PFOA 4N4NB 3HUGA 3L2RA 3DHCA 2Y8BA 4XLCA 1EJ9A 3C1DA 4IVNA 2Z2SB 1WJAA 2RC4A 6PAXA 1X3UA 2WWYA 1XCBA 2EFWA 4LB6B 2MFZA 1S72I 1RC9A 3M1CA 1F4KA 5HDNA 3NARA 2OCEA 2NVTJ 3I64A 4FE4A 5E17F 2J5OA 1VQ9I 1WCMJ 3FMQA 3H3UA 2Q0OA 4KDPA 3GLXA 4EATA 5FD6A 5B1UA 2O5RA 4Z2YA 2LVSA 1VJNA 1HSTA 2XGEA 2H6AA 3IUOA 1Z7LA 2VQCA 2CQXA 2OZ6A 1JT1A 4A3MJ 1FLIA 4NC8A 4LK1F 1IXCA 1XMKA 4C1CA 2A6HF 2MYSA 1X3ZB 3I54A 4AYBA 1R36A 4R79A 1DDKA 2XF5A 4CCKA 3P5JA 5FRNA 5LMCA 1XS9A 1ZREA 2A6EF 2CV0A 2OU2A 1W0TA 3G2BA 2ZCWA 1RNLA 3BR5A 2K4JA 4EJTA 2OTJI 1N25A 5IT9Z 4MNUA 3RJPA 1MDMA 3BY6A 3RCOA 1E3OC 1B6AA 2PJRB 2D45A 1NTCA 3KP7A 4KITB 3MVPA 3QU6A 4CICA 4RLFA 2Y8AA 2JQ7A 3FXJA 1KO2A 3ZN1A 4BHCA 5KVRA 2A07F 4E7KA 3VYSB 2DI3A 4U7DA 2ZXJA 3DCFA 3BG5A 2E35A 4A3JJ 3W6VA 3WU1B 1G2HA 2BBYA 5FLXZ 2MG4A 2GCUA 5IP9J 4C1DA 4EXSA 2VQHA 3A1YA 4UY8I 2L9SA 3H3VK 2TRTA 2ZFUA 2L5QA 4DNCA 1L0OC 4P96A 3DQVC 5FQCA 4A6DA 3OYFA 4EGYA 1WSUA 1HOMA 2AS5F 4U4LA 2LLKA 4ITVA 2DK5A 2EILH 3SEZA 2EWNA 2IA2A 4B43A 2VC1A 3BK1A 5CVIA 1LDKB 2XVCA 5LFAA 4BACA 2NOGA 2K4BA 1R58A 1DPRA 2QUFA 4U7BA 1MNDA 3MFKA 1XM8A 2DTRA 1Z1DA 2K86A 5CLSA 1DXKA 3LNQA 1K61A 1LKXA 5F6FA 2XGXA 5A0TA 4AIHA 2L9RA 1FZPB 2EFQA 1ETKA 2OV7A 4CUGA 5DD8A 3TW6A 2JA5J 2UWMA 4D1TA 3IC7A 4U0VA 4TV7A 3QP6A 1YX5A 1I3AA 4IHYA 2DA1A 3MD2A 2IEKA 3F6OA 2MSYA 2OPTA 3E97A 1X4OA 3ESWB 3WG7H 1YITI 1H9TA 4HAMA 1WH5A 1QH3A 2ESHA 2BMIA 1MQOA 3HOUJ 2CW0F 3OYJA 2DJNA 2JUGA 3GTOJ 4DJAA 3FHZA 1Y8RB 4HNVA 3FISA 2R7DA 4RMNA 3OYEA 5EJCA 3UKGA 3ZR8X 4CDGA 1W36D 2WYMA 4KA4A 1X3WB 5AJLA 5EDNA 3K70C 3VYRB 2IRFG 3QPSA 3A0HC 4RGSA 4D0PA 2W57A 3CESA 1LDJA 1RUNA 3QYEA 3RKKA 3RZDJ 2VL8A 1YW8A 5AXRA 4F92B 1I6XA 2FSWA 4O6JA 3FHNA 1BI3A 4HLXA 1Y44A 2DFEA 1TW3A 3VDXA 3JW4A 3BZ6A 5LEKA 3VB2A 5FRMA 4Y15A 3JRBA 1E17A 2XAHA 3E6BA 3ZQLA 4ZTFA 3P9IA 1FBSA 4DQ2A 1R23A 2M5WA 4FHTA 1FBUA 3WU0A 3DF8A 2QKMB 1KU2A 2H6CA 4HDVA 5FLVA 2EK5A 1DPUA 2CGPA 2FD5A 3CLOA 2WRSA 3U9GA 2BE5F 1E2XA 3PFYA 1OCZH 2CW8A 2DFIA 2RQPA 4ZH4F 3DEWA 4XMYA 1E5DA 4YIFA 4YFXF 4RS8A 4ENMA 4NQ2A 3W6JB 5J47A 4OIRF 3IH2A 1BOAA 1B72B 4TYTA 4CHLA 3BR3A 3E5QA 5LBQA 2DTZA 2W7NA 3CDLA 4LFUA 2LF7A 3P2UA 4HBLA 1QHHD 2DMNA 3T0YA 2Q9UA 3K0LA 3H0GJ 5ICEA 3A4YA 4LLNA 3EDPA 3GCMA 4ZTJA 4CZZA 2ESNA 5J4VA 2R0QC 3MWMA 3ABMH 5KNLA 4BEHA 3BR1A 2MH2A 3PFIA 3JAMK 1TWAJ 5K4MA 1PUEE 1S8NA 3LSRA 5ACWA 1Z3XA 2Z1DA 4LJZF 4KEQA 5CPRB 5FROA 3OL4A 4BXFA 2M8EA 4CCOA 1X4PA 3F8MA 1SVMA 4AVZA 1CF7A 1ZARA 4CA0A 2KRHA 1FIPA 4M3EA 5DS9A 4G7HF 1GXQA 1WFXA 3OYHA 2XAJA 2E2JJ 1ZQ3P 2XB0X 5K5RA 1VQLI 4LGWA 3MN2A 1X8HA 2DT7B 3GFIA 2KQRA 5IP7J 5A2QK 2AIOA 4RB0A 3CJNA 1YLFA 2JA6J 4WXHA 1IN7A 3TL4X 2V1NA 1B1BA 2R7QA 4O5VA 2FHXB 2HDDA 1F43A 2CWEA 3IOFA 3F8FA 4I76A 1GHCA 3CTAA 3U1DA 1G3TA 3GW2A 3RPUA 3OS0A 2EIJH 1G8XA 3BWGA 4JBAA 2GIZA 3F21A 2LY9A 3AF6A 3DTEA 3GF2A 4N9IA 5DCMB 3SEQA 3Q0VA 1W7PD 3I59A 4CZCA 3L7WA 3PNVA 3LAPA 1BM9A 3S2WA 4UBQA 1UHMA 3OYKA 2P6TA 1O3SA 2HZTA 4ZDLA 1SANA 4C9YA 3RDIA 3KFWX 2RNJA 2PI0A 1TL8A 3KCCA 4EYLA 2BW3B 4HSTA 4S0HB 3LQQA 4F7ZA 5LLQA 3GX4X 3S1QJ 2OHHA 2YPRA 3CCVI 1TQPA 2HOTA 5ED4A 1O4XA 2ADUA 4XLEA 3H35A 2RV8A 5CVJA 2ISYA 4C1GA 3JRFA 1AHDP 4L0ZB 3QYFA 4BXXJ 2CFUA 3I0VA 4F6ZA 3D5SC 3Q3SA 4AU7A 2O7OA 4BQOA 1BA5A 1JUSA 1ZG5A 5BMZA 1W5SA 2F5DA 3UR3C 3J7AO 1ZG3A 5HDGA 2FK6A 2L9NA 3RKXA 3RQ4A 1HLVA 2BVMA 5EVKA 4CSWA 1I1GA 1JUPA 3SFZA 1LJ9A 3WODF 2IVMA 1TWGJ 3X2XA 1Z0XA 5FJ8J 3CMMA 2PJPA 4II2A 1KA8A 2VPRA 2M2EA 2LR8A 1Z05A 2ECCA 2JA2A 2P7CB 3DHAA 4A3DJ 3WTXC 2P5VA 1V5FA 1MMNA 2YNTA 2E2HJ 2F2EA 3LMMA 3JAMZ 1YCHA 1BN5A 3F3XA 4XRSA 2FQ4A 1O3RA 4P1WA 5HDKA 4HX8A 4NUBA 2WAQA 3VFZA 1JKOC 4UA4A 4D7MA 4XKVA 3ZQCA 2LBFA 5C4XJ 4DZPA 3SXYA 5HIOA 4J00A 1FYLA 3GTQJ 2JPCA 2XHKA 1WKMA 5A2QZ 3JTGA 2YU9J 1J09A 2QBYA 2KZVA 4C1HA 4F3QA 3GMEA 4BDZA 3GYHX 1M1EB 2F4IA 2P4WA 1SMLA 4KYWA 3VQZA 4OIOF 3DPUA 3HOZJ 4C3JJ 3FBIB 4FEKA 3RTRA 2LFBA 1BOBA 1YJNI 4FR7A 4A3BJ 3REOA 3I55I 1HW2A 2X85A 2CS3A 2DMTA 3EPZA 1DP7P 5E3NA 1T6SA 3MKWB 2I7TA 1TT5B 2K9SA 1X2MA 1OJLA 2CUFA 2G7HA 1QA6A 4ZYGA 4AX0B 3BPVA 2PLYA 1GVJA 3SDGA 3BQZA 4Y7NJ 1R1UA 2QA4I 2BY2A 4HLYA 2ZJPF 2WYLA 5DPXA 1AOYA 1VQ5I 3DKYA 4A3FJ 2RKHA 2CSOA 3RKQA 4XRFA 1HDPA 4V2FA 1KQ0A 4B47A 1FMVA 3DKWA 1N78A 4EQQA 4DW6A 3HYIA 3S1RJ 3CD6I 4L9JA 4DYCA 5JI6A 1E0EA 4MGRA 4E6KG 1SMTA 4XLAA 5E8GA 1SD6A 3RYPA 1XSDA 3KP5A 5BOXA 1WVRA 1X1PA 3HSFA 3KEOA 4XK4A 3OYMA 2R7TA 4IOCF 3FDYA 1MSFC 2BR6A 1BW6A 3I11A 5E18F 4LOCA 4HZFA 2LD5A 2RGVA 3A02A 4TZEA 4B87A 1V3FA 3W2VA 2M4GA 2LNBA 3HRSA 4RAWA 3DTIA 4E7IA 2HVQA 3K69A 1UG2A 4XWTA 1D0ZA 3WGHA 2XUBA 3CZ6A 2W85A 2QGUA 4HV6A 3WTYC 2YCBA 1U8RA 2OBPA 1YJWI 1NK3P 4WD6A 2EFNA 1MJ9A 2HZDA 1LEAA 3K7AJ 1JT6A 1MMGA 2HQRA 4NNJA 3PY6A 2FJ1A 1BC8C 4D1WA 3J80K 2D1HA 5K7HA 4B4CA 3DFGA 3B6AA 2DW4A 1SD7A 1FX7A 3WXCA 3ZQIA 3F9OA 3W6KB 2Z16A 3FXLA 2FNPA 4ABZA 3KPHA 2EIMH 2XF6A 3ASNH 4C3IJ 1WJCA 5LGNA 5K0WA 2BG8A 3NRVA 2E36A 4OAZA 4AVPA 3MKYB 4KT5C 2DDAA 3AG1H 2FBHA 3S16J 2I7XA 1JXSA 3M4OJ 3IAS2 5EVBA 3HZJA 3ZQQA 4CO8A 2ID6A 4BYYA 3WTTC 2Y0MA 1S3JA 4QTRA 2HR3A 3IKTA 2HGCA 5H6QA 2LP0A 4EM0B 3AF5A 2WB1A 2KHMA 5GP9A 5EF6A 4XNFA 4LITA 4GO1A 3T9MA 2WAFA 2NXNB 1FOKA 2L54A 2PQ8A 3C2BA 4QIWN 3L2WA 3HGYA 3EYYA 4NDLA 1FY7A 4HF0A 4HL1A 4II3A 2NNYA 1CQTA 1IN4A 1JTXA 4KN4X 1AWCA 2JJ7A 2C6YA 4FCYA 4OMYA 2K3FA 4Y4RA 1S6LA 5F27A 2VJ4A 1BJZA 2DBBA 1IN5A 4I7HA 1T56A 4A12A 2EQRA 4PUSA 2QWWA 4M9ZA 3VOEA 2V1XA 3ISPA 4FTHA 4RL0A 2HI3A 3DU5A 1BC7C 2CFOA 2LK2A 5GPAA 4G7ZF 1Y6IA 2CUZA 3E7LA 3F23A 1BVTA 1HXDA 3HOXJ 2ZBKA 4XLPF 2LY2A 2CG3A 4ZYDA 2GFKA 3TOBA 2Y48A 3SJMA 1PUFB 1R5ID 3LSHA 3LSPA 2VQLA 2OZUA 1K4SA 4W97A 3IELA 5E3OA 1ZKPA 2FBIA 4XICA 2KZGA 5IOZA 1VGNA 1RZ4A 4A2UA 1IUYA 4B3AA 3QPLA 3GTKJ 2PJRA 4CGZA 2CRGA 3M1EA 5FLMJ 4A0XA 2F4OB 3ABKH 2Y0SN 4LK0F 3SDBA 2VJIA 2YUSA 2BXZA 3KZYA 2XKOA 4UVCA 4EM1A 2YZ3A 1X1DA 4IRHA 2KIQA 4AWZA 4BE0A 5CVUA 3V7RA 1ITYA 2XPUA 3I9V2 4GYQA 1FYMA 4L9TA 5DM6F 2PEXA 5AIJA 3J80Z 1HQCA 2XSJC 4MQVA 2EB7A 2IPQX 3HKZN 4PVTA 4M6VA 3GTJJ 2KFDA 3FWEA 1I50J 2EPFA 5L3FA 2PMZA 3I56I 3QH8A 4RAGA 4N0BA 3DU6A 3OIQA 5E1WA 2NS8A 2VJJA 1S7OA 2DA7A 2ZO4A 1BC2A 3TBIA 2RVCA 4ZYHA 1WRAA 2FU9A 4N4OB 3JXPA 5K5QA 2Y69H 2Y2ZA 3F9KA 1HW1A 2AO9A 2WBMA 1FOYA 4GYIA 3RIRA 2QINA 1TW2A 5HLGA 2COBA 1A6QA 2LRDA 2I7VA 2YX7A 2Z33A 2HOSA 3ZR9A 3S32A 1YOVB 1JGSA 4FE7A 4XORA 2L4AA 3KYCB 4OINF 4C3HJ 1QPIA 1YW9A 2IW5A 5B3RA 1JHHA 2DMPA 5ACVA 5LCAA 4Z7RA 4BXUA 3DV8A 2BFLA 5DEQA 3NEUA 5F0CA 3JRAA 4HF1A 5EV6A 1EV7A 2KPMA 4I98B 5FB2A 4HW0A 2E34A 3I3LA 1UB9A 2HYFA 1A6IA 5FKOA 2V7FA 2WAEA 4AC0A 1VF9A 1SMYF 2RREA 4CCJA 4C1EA 3TO6A 1X1BA 2X6XA 4GYUA 4PVOA 5K4KA 3BTIA 3GEZA 2GA2A 2QDSA 1KU9A 2K9MA 2XF4A 3M8FA 2V1DA 3ASOH 3CCSI 5K7FA 1UFMA 2JN6A 2NVXJ 1GUUA 5ACSA 2LKSA 2VOPA 3BC2A 5K1YA 2OHJA 1IZ1A 4I09A 3BJ6A 1EH8A 4IO9F 3PNTA 3LSGA 4AWXB 1YG2A 1JJ8C 4YELA 3S1NJ 3CCUI 4PDXA 5H20A 3CCYA 1RKWA 2FNAA 1ZH5A 2DYSH 4P9FA 4JK1X 1REPC 2XPWA 1J5YA 3L1PA 1DQUA 2VXZA 1QZZA 4QPQA 3K1MA 4O3MA 3SHFA 4AM3A 3CCJI 3MAJA 1Y1VJ 1R71A 1IDZA 3S3NA 2HQ5A 2NOJB 1ZGWA 1XMXA 4E70A 2DU9A 4UWOB 2I10A 5DM7F 3OOUA 4J01A 3TO9A 1RESA 1Z6TA 2H94A 4FX0A 5B3SH 4RB2C 4HQEA 4Q47A 1YTYA 3MZYA 2H1LA 2JZYA 4B3XA 2COMA 3H3EA 2A6TA 2F5VA 4PJLA 5J6XA 4I02A 2XIGA 3FAIA 1J75A 2J5PA 2IS1A 2R3SA 3G71I 5ACUA 2X1DA 4BHPA 3ZCOA 2BGCA 4XRSG 2O0YA 2V26A 1Y56A 2Y31A 1D1AA 3H9GA 1LPQA 4NBQA 1B72A 2O9LA 4A3GJ 2G7UA 4M74A 4J19A 4P9UA 3OL3A 2NZFA 1OMIA 5F08A 4IHTA 2JTVA 3ML6A 2M5DA 3FXKA 2WC2A 1P4WA 1D8JA 3P9CA 4G6QA 1B8IB 2Z9OA 1XTOA 3MKZA 1T8IA 5DV5A 1XGSA 4NB5A 1JGGA 3ZRGA 4TZ9A 5BS6A 2CYYA 3M07A 4AX1B 2MD0A 2R92J 4DBQA 1MBJA 3FM3A 4QWQA 3CLQA 5GAEJ 1ETYA 2XASA 3HC7A 1QNTA 1ZRCA 4KMFA 2EV5A 1ZGJA 4V2GA 1LFUP 2K7LA 2HDCA 3W3CA 3FKIJ 3J81K 1BI1A 1WH7A 5E1ZB 4HA8A 5FKNA 3R0AA 3M3YJ 2BFZB 4WWCA 4AWYB 4OWRB 3O6BB 3N4MA 2VB6A 3BJAA 4C09A 1F5TA 2E1MC 1KYZA 2HS5A 1IV8A 4E7ZA 2OHIA 4E4HA 2JRMA 3GUDA 3HPHA 4C2MJ 4FISA 1IG7A 1A35A 2DFHA 4D1UA 1LQ1A 2TCTA 3KLNA 1KQ8A 5J1RA 3I5UA 3TO7A 4PSWA 5EEAA 1J59A 4M73A 3Q6VA 3IRQA 5EYRA 1XPXA 2F4MB 4IQ4A 4E7SA 4LG0B 1TZLA 5ILUA 2FHXA 4EM2A 2WV0A 3E6MA 1JKQC 3CO6C 2OF7A 4CCNA 3JRDA 1JE8A 2BIBA 5GAGJ 1ZRDA 1ZTRA 1UHSA 3CJRB 1RRJA 3KE2A 2JSCA 1QBJA 4PDKA 4AYBN 3DP7A 3K2ZA 2TDXA 1FMWA 2ZSIB 3T5XA 1O3TA 4Q5SF 2MA3A 1JKPC 4PZJA 1QZYA 1N75A 1Y1WJ 5DCMA 4EJOA 2XV4S 3KETA 3OSGA 2EA4A 3TDZC 3BR6A 2D1VA 1ETOA 3C7JA 4HOBA 5E8IA 3FX3A 4AXHA 3LAJA 5LCFA 2GM4A 3ERED 3OYIA 1MH3A 5EZHA 4OIQF 3GTLJ 1SD5A 3HSRA 4XN0A 2MH9A 2EH3A 1T38A 5AHOA 2XR1A 2EA2A 2HYJA 2IXSA 2L2OA 2GZWA 4EYBA 3J7YJ 1R4MB 3JR9A 2H1KA 3V8KA 2BW3A 3WTUC 2WA0A 3N97A 4RAYA 5DD4A 4Q4ZF 1HKSA 3OYLA 1ZR4A 2YNWA 3HHHA 1LUJB 4RB1A 5LS3A 1NG7A 1O3QA 3FCZA 3BOQA 4H4KC 5EG0B 1FC3A 2L7MP 4B8XA 1R5GA 2M4KA 5AXOA 3TP9A 3I13A 4G94A 1BL0A 2XAQA 2V1UA 1RR7A 5M3FJ 3AG3H 3T3OA 5M5XJ 2NYXA 4ZZDA 3CCQI 2WTEA 3ZMTA 3K1NA 4LD5A 5M5WJ 3IDZA 5D6FA 1Z67A 1UZCA 2DA2A 2CV2A 2W84A 1ZGAA 3EYIA 1TNSA 2KIUA 3BZKA 4D5FA 3SQNA 2Y87A 4XOTA 2LY1A 2MLGA 4WX9A 3IH3A 4RM3A 5HVQC 2VBZA 1UHWA 3FXOA 3L6NA 1HC8A 3C3WA 3ELKA 1R22A 4L18B 5K7ZA 3J81Z 3OOPA 3BP8A 3X2YA 4NHJA 1XX5A 4IL6C 4ESJA 4UB6C 1FNNA 4MEYF 2KL4A 2KT0A 1FBQA 3ZNBA 2BY0A 2IJLA 2LOOA 3H3ZA 2QSHX 5JLWA 1U8BA 1TWCJ 3L2UA 1Y0NA 2H8RA 1TWFJ 2NRAC 4BY1J 1EF4A 1IGNA 4D9JA 5EH9A 3M8EA 5KILA 3X2ZA 4E7HA 3D5LA 2N8GA 4BS9A 4R1HA 4ZC3A 3IP4B 1MBKA 2ZXHA 2DO7A 2K02A 2P97A 1G3WA 2NS0A 1F1ZA 4YSLA 4IX7A 2XRNA 1F36A 2M34A 2ZC2A 4UUSB 1YS7A 4WCGA 3OS2A 4PK4A 4BKXA 4CYDA 1UJ8A 4BJTA 3DEEA 2GQQA 3F72A 2W82A 2YNVB 2FQ3A 2HKXA 5B1AH 4X6AJ 2V6EA 4Y33A 1FJLA 3QQAA 5CKTA 2BG2A 5ACXA 2ACJA 2LKXA 3S17J 2XB5A 5AIQA 3AFHA 3KP4A 3PQJA 5DUIA 3VODA 2MLKA 1R00A 3FMRA 1RUOA 3T8RA 5HH6A 2A05A 5HIQA 4RGXA 5D5WB 2ELJA 2QZ8A 4BL0B 2VJ5A 1K79A 4XKBA 1V55H 1MH4A 2BHYA 2ICWG 1WJFA 2HU9A 3PUFA 2ME0A 3CP2A 5DCFA 2NS7A 2FM6A 3MCZA 3L09A 2E1CA 1X1AA 1R1TA 1RI7A 2P8TA 1HCRA 4DIQA 3LA7A 5HS9A 1V54H 1MMDA 1OPCA 2R4GA 2AXLA 2PG4A 3MMYB 1TQIA 2GIVA 3FK7A 3VYTB 2CQ7A 5HISA 3D1NI 5HH5A 3S3OA 3HM5A 4AV7A 4MIMA 1MZBA 2OQGA 3IKVA 2BG7A 3FXRA 3O3KA 5FFZA 4BJ6C 3HB9A 4YG2F 4M9XA 3ULQB 2XDVA 1B59A 1VMEA 2DYRH 1WJ5A 1VFCA 1IJWC 3OYNA 2M0MA 4X0GA 4D1QA 1RPWA 2XROA 1T33A 1U0JA 3TEDA 3S15J 1IRFA 2AXTC 3M9AA 5ILSA 1Q1HA 4IQJA 3GTMJ 2A7MA 2QQ8A 5JLXA 2FEZA 3BPXA 2O6GE 2ZFWA 4DGWB 1S7EA 2DT6A 1YX3A 5F04A 3RSNA 4A5NA 1QZEA 3BCAA 1RETA 3OV8A 3CCMI 5J1YA 3I58A 4EJWA 5E3LA 4J5HA 3Q9SA 4Z60A 2D2WA 1ON2A 2M87A 3Q0UA 4S05A 4RAMA 4RLQA 1TP4A 2X6WA 1NHAA 5KAIC 2KMUA 3ZPLA 3WTVC 3GBGA 4IHSA 3P7NA 2LTPA 5LHHA 3IV5A 5IPAA 3AAFA 2VONA 2A3SA 2L9VA 3L2QA 3EETA 2KKOA 4J5FA 2QDTA 4LLLA 2KRCA 5FO5A 1A8TA 4G7OF 3CUQA 1QRYA 4ZO3A 2E5NA 2CW7A 5E3MA 1LE8B 1IC8A 2HWVA 1WI3A 2H6BA 4GRIA 1JTYA 1YJ9I 3K70D 4HYEA 1V5GA 3GFMA 5CYVA 2KIFA 4JYKA 1JI8A 1HA8A 4BGDA 1DGWY 1XB4A 5D5VB 3SPUA 3D5RC 2CMPA 4BNCA 4KICA 2CG2A 2NVUB 1Y0UA 2FXAA 3SFPA 3K2AA 5CQEA 2VW8A 2PMHA 4UV9A 3E6CC 1TWHJ 2R2DA 1WZ2A 4HQMA 3LFKA 4XLFA 2E60A 2DA4A 2VXDA 3BT9A 3VYUB 3BQYA 1ETXA 4G6DA 5AIPA 3KNSA 2EZKA 3DPTA 4RA2A 3PIPF 4XSZF 4PJNA 4XONA 2LH9A 3KYDB 1PDNC 2Q1ZB 3QU3A 1AU7A 1PUFA 3CP8A 5KIKA 5EHTA 2DLLA 1FTTA 4XBFA 5F1RA 2XC7A 1HSJA 2XKPA 2HXOA 1ERDA 1LFBA 2HVSA 1TQMA 4Z67A 1WQ2A 3TW7A 3HOSA 1SAXA 1HKTA 3TMOA 1Z6RA 2QSFX 1DU0A 4U87A 4I99C 4Z6YA 3SBLA 3RKYA 1XTAA 2LDUA 1E3HA 1YO5C 1S9HA 4IHXA 2XGCA 1I5ZA 1O57A 2Q0JA 1Z77A 3BG9A 3LSJA 1YHQI 1VQOI 3V8JA 2L4MA 3PNYA 2E5ZA 2BC2A 3ZQGA 4PJMA 2M9HA 3COAC 2M8GX 1WHUA 3K9TA 5LHIA 1QH5A 4UWRB 4RB3C 3GZ5A 2DK8A 4HX4A 1IRXA 4NQWA 4MO7A 1RR8C 1MSEC 3NAUA 4C2TA 1P2FA 2WAQN 1SVOA 3HG9A 5J1UA 3OSFA 4PGGA 4AIKA 2OQRA 3L9FA 4L5JA 5L3EA 3ZWFA 1XGNA 2E7WA 4XWWA 1P7JA 2E7XA 2FMLA 1USTA 5CVRA 3IEKA 4F6HA 4HL2A 4ZJZA 5JHFA 4B1RA 3DHBA 4BAYA 1J7KA 1FEXA 1XN7A 4PFPA 3TKYA 2F5EA 3E0JB 1S29A 2FE3A 4ESFA 3I14A 3VPEA 4A3KJ 3GLLA 4ZDPA 3V8LA 1KO3A 1IRGA 5EV8A 1IV6A 2EZLA 2XAUA 2ZWRA 1H8AC 5IOYA 4IKFA 1FP2A 5JHUA 5AHRA 3A4CA 1U9OA 5LEJA 3WE3A 5IYBJ 1XMAA 4RGRA 2M5CA 5DUKA 2DOOA 4I6ZA 4D5CA 4UWPB 1I27A 4W1UA 1EKEA 3I0TA 3S93A 4IZZA 1ZG1A 3MD7A 2HOEA 2VI6A 2X1EA 3E5XA 2GOMA 2K9QA 2VKEA 3HRMA 4RM2A 2BV6A 5GADJ 1S5LC 2V6CA 2K85A 2LMDA 3F8BA 5JVTA 1FIAA 1I3QJ 4LLGF 1KZHA 4KNYA 3GTGJ 2HQAA 1MBFA 1NK2P 2EJRA 5GTHC 2IGKA 1KYWA 3I71A 1ULYA 5TRDA 2DJIA 3LSMA 3QODA 4FX4A 3HEFA 4Y52J 5FGMA 5A23A 2IGNA 3CUQB 1YCFA 3ADRA 2GXBA 1MNEA 4B09A 4A3LJ 2O8XA 1P4XA 2Y0SA 2W4SA 2F5FA 1LFPA 4E7LA 4DILA 2QF7A 1XGMA 1EH6A 4H0DA 1OYWA 2IA1A 2DODA 3L2CA 3WGGA 3ECHA 4BQAA 5EGOB 2UXNA 2JK3A 1K6YA 3HDDA 2P5KA 3N05A 5ERIA 5J4YA 4M6XA 3I4MJ 4LIUA 1SEUA 4RL2A 3H36A 3JRCA 3KIOA 4HPQA 4HX7A 2JVGA 2VKVA 3GZNB 2BOLA 2CU7A 2Y30A 3HKZA 4PJJA 5L3CA 1BJAA 2CQNA 1PP8F 1TLHB 2P18A 3KL7A 1FSEA 1SVLA 4UWSB 1NG6A 3JSPA 2ZJ2A 2QM3A 1P6RA 3DWLE 3QOPA 3KYLA 3F22A 2DMQA 2BYVE 1D8KA 3Q9VA 4K2EA 4KN7X 4C2UA 1T98A 3FKJA 3CCRI 1OR7C 1STZA 2AQFA 2G0EA 4IJAA 3SYTA 1UELB 1WW1A 2NVQJ 1J2XA 2OAZA 2VKHA 1VQ7I 2WV1A 3BG6A 1SC7A 1SAUA 4AIDA 3GTPJ 1Z7UA 2DN0A 5GPCA 2RN7A 1YI2I 2DOAA 2CV1A 3H1CA 1QO0D 2L0KA 2QKLB 3FXMA 1N77A 3T8TA 5KHDA 1D5YA 1B8IA 4RBSA 4QLCU 3HL2A 2Q42A 1M2XA 3HJEA 2STTA 3HOYJ 2X6OA 2P1EA 1MBHA 5HS7A 1VQ4I 3K4MA 3CUOA 1D1BA 3ZQHA 2LSOA 2PX9A 1P9QC 4RBOA 3WG9A 4BQQA 1XDUA 5BPIA 2WB1N 4NQWB 1GLNA 4HNUA 1CGPA 1IN8A 3OYAA 2FU4A 2ZJQF 3A0BC 5LRRA 1G4DA 1W7PB 2BFZA 4HEA2 1OCTC 1A36A 3TGNA 5E20A 2VUMJ 2Y75A 3OYGA 3DH8A 3G4SI 4P62A 1XSVA 2A61A 3B02A 3TQNA 4ETSA 2IS2A 2CUJA 2MW8A 2QENA 2HOAA 1JJ6C 3R6SA 5ICCA 1SD4A 2EBIA 4UUVA 1MJAA 4ZDOA 3A03A 3S2HJ 2L7FP 1O7FA 2ELHA 1X8IA 4KIFA 1D0YA 1DDNA 5ACQA 3ESHA 1U6GA 4LG0A 2XGDA 5LM6A 3ROUA 2QVOA 1XDSA 3VSKA 1GT0C 1BR2A 2DQLA 3KZZA 3ONQA 3QYBA 3SZTA 3BG7A 2STWA 3IE1A 1GV5A 4XN3A 1U2WA 4BUPA 4KJZA 1W36C 3AG4H 3ZXSA 4ENKA 2ZNBA 3CJQB 4XKWA 4R8HA 4P55A 1K78B 2ME6A 1PYVA 4Y13A 3AKZA 1W0UA 1FTZA 3SRXA 3GO5A 3CF5F 4RDUA 2CQQA 2K3PA 1FP1D 1SFOJ 1T0FC 4L9VA 4XL9A 3A01A 5K5OA 3VWBA 3C2HA 5HOOA 1JJEA 5HLIA 1A04A 3FMSA 3GZ6A 1ZAOA 3I53A 4YFKF 2DXIA 4IF4A 4F93B 4HKYA 5F1JA 3IL2A 1IXRC 2V9PA 4U88A 3CC2I 3B73A 5M5YJ 2JA8J 4F55A 2YU3A 4RAZA 3IE2A 3KEQA 4G12A 4ZYAA 1LEBA 3VSLA 3T3NA 2QEDA 2RNGA 2GKLA 9ANTA 4BJ5C 2M1BA 1XD7A 4BH9A 4GXOA 5FKMA 4EEFG 4JP0A 1LVAA 2L3DA 1J9IA 3BZCA 3V4GA 1A31A 4RAFA 1USSA 5EG0A 1HDDC 1QQIA 3BTJA 2ISZA 2VN2A 3WU2C 1P92A 1B9NA 2O3FA 1SFXA 3CUQC 2GA1A 1Q1VA 1G3YA 3H9QA 1GV2A 4XSXF 1G6NA 3H92A 1P4AA 3S3MA 4U0WA 3QWLA 1WUPA 2ECBA 1I6HJ 2E19A 2FU8A 3KNRA 3HRTA 2X1CA 1B9MA 2VKDA 4EXYA 1FT9A 5C3EJ 2FA5A 4DZJA 4M71A 3DTKA 1XCVA 4L5EA 1U5TB 3HHGA 4KIGA 4MTEA 3S14J 1TTYA 3KP3A 1LVKA 1OCPA 1YCGA 2UZKA 2JMWA 2A68F 2Z99A 3CQZJ 5HLTA 4LB5A 2CFXA 4Z6XA 4UB8C 2VE9A 1OKRA 1Y8QB 2VQGA 3RPCA 1GVDA 2DA3A 2NAZA 1U3EM 2FUG2 4M72A 4NC6A 2VC0A 1W5TA 3LQRA 4WXCA 1MW7A 4XUKA 1W4MA 4V19K 4IHWA 4HDUA 5FQBA 2R5YB 1U9NA 3BTLA 3BV6A 2FRHA 2I8DA 1H88C 2R7VA 2QEXI 2JWTA 3HRUA 1YS6A 4C1FA 3ZMVA 4A5MA 4CCLA 4L5IA 4KEPA 3J7AY 2L01A 2ZMEB 2QSGX 1H9GA 4UVBA 4ENNA 1ODDA 3G3ZA 4EV0A 1ZR2A 2QQ9A 3ABLH 4UUSA 3H5NA 2NXAA 3NWTA 1T95A 3LFUA 1JKRC 1KU7A 2YNUA 1APLC 1ON1A 1WWXA 2JA7J 4XLNF 2PN6A 2YNVA 2HB9A 5A5ZA 2GFJA 2E1NA 3JTHA 2HDWA 5HH4A 3QPHA 1MKMA 2X9DA 1AKHB 2OTLI 4ASNA 3EUHC 1MIJA 4BDYA 2W24A 4FASD 3T1BA 4YFNF 2IGOA 3G73A 2BEOA 4MEXF 1ENHA 1ZRFA 4F91B 2O8KA 3R0JA 4ON0A 2DAOA 1L3LA 1VQNI 2FOKA 1ORKA 5KCMA 3ZMSA 3ZMZA 5HNHA 2XF7A 2R5ZB 2BY3A 2VODA 5TGTA 3DXJF 2HKOA 3BLYA 2V4JC 3CC4I 1DD6A 3A01B 2HFHA 3OIOA 3AJ3A 5H2FC 2P0WA 2GXGA 2AZ4A 2GXAA 3OIPA 2A69F 4KUMA 3HGGA 2GWRA 4B48A 4AIJA 1BIBA 2QYOA 5E1XA 4WF2A 5F0HA 2BY1A 1PJRA 1TT0A 4CHUA 3KX2A 1OLTA 4G8XA 3RPUD 3DLLF 4NQ6A 3R4KA 3VPRA 5D4SA 4A69C 4M3DA 4A3CJ 5DYMA 4ANJA 4Z5ZA 1WPKA 2DT5A 1K4TA 4IRGA 2X48A 2HQNA 5ICGA 2BTNA 3K4CA 2GBYA 3PQKA 4LIVA 1D1CA 1QPMA 3BG3A 3LSKA 4AUXA 3RI4A 2BGAA 3R61A 4ZYEA 3PO2J 2L7KA 5A87A 1R4NB 2VT2A 1QVTA 5GTIC 2KDOA 3PIOF 2L02A 2VPLA 3TOAA 2DMUA 3F0CA 2K5CA 4D7NA 4ESBA 5ACRA 3PY5A 2R93J 4CYCA 3BC8A 3QP5A 3HUGB 2B9SA 4IXAA 1U78A 2K40A 2X0LA 5AYAA 2ZXWH 1ZNBA 1BR1A 1J0RA 3K6GA 4HG2A 4HNTA 1OCCH 3NQOA 4GGGA 3KZIC 3IOGA 5A0VA 5BPDA 2VT3A 2M3AA 4X1EA 2VBYA 2PBIA 1XC5A 3FF5A 3I4PA 3IHUA 3KLOA 2O61A 4MFEA 3G6EI 1LE8A 3WHBA 1TNTA 4I01A 5FKKA 3R60A 4A3EJ 2LYCA 3S2DJ 1HKQA 1FOXA 3DBLB 3X2QH 3IWZA 1QGPA 5B5EC 2OD5A 3BK2A 3OYCA 1U5TC 1PP7U 1YE9A 2EV0A 5EZGA 5GAHJ 3V42A 1P7IA 3OMYA 3E6DA 4M3BA 2X6YA 1SFEA 1IUFA 2E71A 2GAUA 4DBRA 1SFUA 1OR7A 3ABTA 3O8HA 2Q8KA 2R7SA 2A5WA 4I0BA 1Z91A 2JVHA 2R7RA 3K4NA 2OJED 2VIXA 3FM5A 5CJ9A 3WHCA 2VBXA 1MDMB 2KLOA 2UXXA 4N9HA 2Y9YA 2R7OA 4WK8F 4TZBA 3HPGA 2DDBA 3NWSA 2FOWA 1QU3A 4MFDA 4DYRA 3EUAA 4BY7J 3IWFA 4EVIA 2QQAA 4IHVA 5F0FA 2ZMEC 2A5YB
chains in the Genus database with same CATH topology
1IXSB 4OU0A 4KIBA 2HEOA 4AD9A 1ZHFA 2DKFA 1ZN2A 1HW5A 5EW0A 3ZQ7A 2BFKA 4GYGA 1ZTCA 4OOIA 2XAGA 5B15A 4GCVA 2Q0IA 5LGTA 2E7YA 3M7GA 1XGOA 5HLHA 3F8CA 4M9SA 3KP6A 1HBXG 1K7AA 4YSKA 1D5VA 2CBNA 2JRTA 2ZNZA 3WE2A 3U2RA 3GWZA 2XAFA 3MEXA 1T2KA 3R2UA 2CG4A 4ENJA 3MZHA 4EMSA 4Z5YA 3ECOA 2JPBA 4LMYA 3ZMDA 3GVAA 3V7CA 1K07A 3GFJA 4U0YA 2KJBA 4Y17A 2NYPA 5JFRA 1DUXC 5J8CA 1T0FA 4L0YB 4ZZLA 4ZO2A 4D02A 2VBWA 3PG4A 2M30A 2EFOA 2V79A 1VTNC 2G9WA 3RKWA 5IT3A 2FU6A 2DPUA 1YYVA 4ZNBA 4FT8A 5IQKA 5FD5A 1RIOH 3QAHA 1F9NA 3LA3A 3SZPA 4KMUX 3HTUA 5EEHA 4TYFA 5EVDA 3BJOA 1P9EA 2FMYA 3E3VA 1K6OA 1YFHA 2P4ZA 5LCHA 2YSRA 1FPQA 3G1PA 3LA2A 3DEUA 1BI2A 4UVAA 1YQAA 1ZLKA 5CVVA 4M6YA 3WGIA 5EWAA 1G3SA 4A0YA 4KFCA 5HS8A 5J8FA 1FWZA 2MD5A 2ZKZA 1I1SA 4PCQA 3EQLF 4YSBA 1R7JA 4S04A 3Q5FA 3LVZA 1BIAA 2K27A 2IT0A 1BMCA 1MJBA 5DDGA 4FSBA 2VE8A 2H27A 4NQ4A 1FSHA 3IRRA 4IRIA 1CF7B 4PGHA 3F8NA 1H0MA 1IF1A 1OYYA 3P9KA 2M45A 5ILVA 3GFLA 3EUHA 5L3BA 1W7PA 1MD0A 1WUOA 1S7AA 2FBKA 5K4NA 3ZP5A 4G9YA 1V4RA 4WXDA 4A0ZA 2PMUA 2O03A 3O2PE 2Z3YA 3SW3A 2JT1A 3D0SA 4I2OA 1R5HA 3I59B 4Q48A 2Q2EA 3WTWC 2MBFA 3FXQA 1K78A 5D6EA 1FYKA 1BI0A 2W25A 4DIKA 3QPTA 4EY2A 2DQRA 3HSEA 3CDHA 5LE1A 4LE6A 3WTSC 5JR3A 2KJCA 3RKJA 5L3DA 5BQTA 2EFPA 1HLKA 3CO7C 2EV6A 3X30A 5L3GA 4JO0A 2WYMC 2ZNYA 2NZEA 3ZMUA 2QQBA 4EFZA 3K1PA 1L9YA 3FZVA 2RDPA 4HV5A 2BG6A 5KK1A 4OIPF 1KQ9A 4TZFA 2HYGD 3E5UA 5H6RA 5D5XB 4JQFA 1TBXA 4YIIA 4A6EA 2HTJA 2YNTB 5ICFA 1O7LA 4UAMA 1IW7F 3BROA 1EH7A 2IA0A 5LGUA 4EJUA 1U5TA 3ZQ4A 2QLZA 1IAWA 3HOTA 1KU3A 5LHGA 3HTSB 1KGSA 5TJJA 2WHGA 2QBYB 3V7SA 1A7TA 5AONA 5AEBA 5D4RA 3DPLC 1WRJA 3KP2A 5LSCA 3MQ0A 2DPDA 3I15A 4EJVA 4BZ3A 3TDUC 3HIFA 1T39A 5ACTA 1OYIA 4CXFA 3QRFF 4D1VA 4UV8A 4OMZA 4NQ5A 2KRFA 2ZZIA 2P6SA 3RYRA 4RGUA 2P5LC 2VOOA 1C0WA 5EEGA 5D5UB 2ZMEA 3SD9A 3VEPA 4P5OA 1JJTA 2P7VB 3FXUA 4EGZA 4BHBA 4ZEJA 1LDDA 2IP2A 5LRSA 3IE0A 1ZLJA 1JHFA 4IPAA 2R7FA 2H09A 2FU7A 2Z5UA 4UHTA 4BP0A 3WTZA 5LLDA 2QJSA 5F64A 2MC3A 2CQKA 2GMNA 3BDDA 1ZYRF 2X4HA 1YIOA 4HF2A 2FF4A 2YR2A 4O98A 4V0HA 5IT9K 2NNNA 1ONVA 1X8GA 5D8KB 1YW7A 1WI9A 1LB2A 4UXNA 2LKPA 5FLXK 1XSXA 2LF8A 1IN6A 3GXOA 1R1VA 3LWFA 1LNWA 4MHGA 3ABUA 2ETHA 2PFBA 4UNOA 2OA4A 3F6VA 3JSOA 4EYFA 3ZN0A 4GCWA 2HTSA 3IEMA 1UCRA 2F5CA 5ACPA 1GXPA 3RPQA 4RM5A 4I0AA 2BG8B 2CO5A 5FFXA 3S0ZA 2KIMA 1Z9CA 5HIPA 2UYXA 3C18A 5D8LB 1D3YA 1BBYA 3L00A 4L9NA 4MTDA 5FQAA 3LSTA 1KR3A 2V9VA 4H0EA 4MQ9F 1MGTA 2YX4A 2B0LA 1B4AA 3HUGA 3DHCA 2Y8BA 3C1DA 4IVNA 2RC4A 6PAXA 1X3UA 2WWYA 1XCBA 2EFWA 4LB6B 1F4KA 5HDNA 3I64A 5E17F 2J5OA 3FMQA 3H3UA 2Q0OA 4KDPA 3GLXA 5FD6A 5B1UA 4Z2YA 1VJNA 1HSTA 2H6AA 2OZ6A 1JT1A 1FLIA 4LK1F 1IXCA 1XMKA 4C1CA 2A6HF 3I54A 1R36A 4R79A 1DDKA 5LMCA 1ZREA 2A6EF 2OU2A 2ZCWA 1RNLA 2K4JA 4EJTA 5IT9Z 4MNUA 3RJPA 1MDMA 3BY6A 1B6AA 2D45A 3KP7A 3QU6A 4CICA 2Y8AA 1KO2A 3ZN1A 4BHCA 5KVRA 2A07F 2DI3A 4U7DA 2ZXJA 3WU1B 2BBYA 5FLXZ 2GCUA 4C1DA 4EXSA 4DNCA 1L0OC 4P96A 3DQVC 5FQCA 4A6DA 4EGYA 1WSUA 2AS5F 4U4LA 2DK5A 2EWNA 2IA2A 2VC1A 3BK1A 5CVIA 1LDKB 2XVCA 2K4BA 1R58A 1DPRA 2QUFA 4U7BA 1XM8A 3MFKA 2DTRA 1Z1DA 2K86A 5CLSA 1DXKA 5F6FA 2XGXA 5A0TA 4AIHA 1FZPB 2EFQA 5DD8A 2UWMA 4D1TA 3IC7A 4U0VA 4TV7A 3QP6A 3F6OA 3E97A 1H9TA 4HAMA 1QH3A 2ESHA 2BMIA 1MQOA 2CW0F 3FHZA 2R7DA 4CDGA 2WYMA 4KA4A 2IRFG 4RGSA 4D0PA 2W57A 1LDJA 1RUNA 3RKKA 1YW8A 5AXRA 1I6XA 2FSWA 4O6JA 1BI3A 4HLXA 1Y44A 1TW3A 3JW4A 3BZ6A 5LEKA 3VB2A 1E17A 4Y15A 2XAHA 3E6BA 3P9IA 1FBSA 4DQ2A 1R23A 2M5WA 4FHTA 1FBUA 3WU0A 3DF8A 1KU2A 2H6CA 4HDVA 2EK5A 1DPUA 2CGPA 3CLOA 2WRSA 3U9GA 2BE5F 1E2XA 2DFIA 2RQPA 4ZH4F 1E5DA 4YIFA 4YFXF 4RS8A 4ENMA 4NQ2A 3W6JB 4OIRF 1BOAA 4TYTA 4CHLA 3E5QA 5LBQA 4LFUA 2LF7A 3P2UA 4HBLA 3T0YA 2Q9UA 3K0LA 5ICEA 3A4YA 4LLNA 3EDPA 4CZZA 2ESNA 3MWMA 2MH2A 3PFIA 3JAMK 5K4MA 1PUEE 1S8NA 5ACWA 4LJZF 4KEQA 2M8EA 3F8MA 1CF7A 1ZARA 4G7HF 1GXQA 2XAJA 5K5RA 4LGWA 1X8HA 3GFIA 5A2QK 2AIOA 4RB0A 3CJNA 1YLFA 4WXHA 1IN7A 1B1BA 4O5VA 2FHXB 2CWEA 3IOFA 3F8FA 1GHCA 3CTAA 3U1DA 1G3TA 3GW2A 3RPUA 3BWGA 4JBAA 3F21A 3AF6A 3GF2A 4N9IA 5DCMB 1W7PD 3I59A 3L7WA 3LAPA 1BM9A 3S2WA 4UBQA 1UHMA 2P6TA 1O3SA 2HZTA 3RDIA 3KFWX 2RNJA 2PI0A 3KCCA 4EYLA 3GX4X 2OHHA 3LQQA 4F7ZA 5LLQA 2YPRA 1TQPA 5ED4A 2ADUA 5CVJA 2RV8A 2ISYA 4C1GA 3I0VA 4L0ZB 4F6ZA 1ZG5A 5BMZA 1W5SA 2F5DA 3J7AO 1ZG3A 5HDGA 2FK6A 3RKXA 5EVKA 1I1GA 3SFZA 1LJ9A 3WODF 2IVMA 3X2XA 2PJPA 1KA8A 1Z05A 2P7CB 3DHAA 3WTXC 2P5VA 2YNTA 2F2EA 3JAMZ 1YCHA 1BN5A 3F3XA 1O3RA 5HDKA 4HX8A 3VFZA 4UA4A 3SXYA 5HIOA 1FYLA 2JPCA 2XHKA 1WKMA 5A2QZ 3JTGA 2QBYA 4C1HA 3GYHX 2P4WA 1SMLA 4KYWA 3VQZA 4OIOF 4FEKA 3RTRA 4FR7A 3REOA 1HW2A 1DP7P 1T6SA 2I7TA 2G7HA 4ZYGA 4AX0B 3BPVA 2PLYA 1GVJA 1R1UA 4HLYA 2WYLA 5DPXA 1AOYA 2RKHA 2CSOA 4XRFA 1KQ0A 3DKWA 4EQQA 3HYIA 4L9JA 5JI6A 4MGRA 1SMTA 5E8GA 1SD6A 3RYPA 1XSDA 3KP5A 5BOXA 3HSFA 3KEOA 2BR6A 3I11A 5E18F 4HZFA 2RGVA 4TZEA 4B87A 1V3FA 3HRSA 2LNBA 4RAWA 3K69A 4XWTA 3WGHA 2XUBA 2W85A 3WTYC 4HV6A 2YCBA 1U8RA 2OBPA 4WD6A 2EFNA 1MJ9A 1LEAA 2HQRA 3PY6A 1BC8C 4D1WA 3J80K 2D1HA 3DFGA 2DW4A 1SD7A 1FX7A 3WXCA 3F9OA 3W6KB 2FNPA 5LGNA 5K0WA 2BG8A 3NRVA 4AVPA 4KT5C 2FBHA 2I7XA 1JXSA 5EVBA 4CO8A 4BYYA 3WTTC 2Y0MA 1S3JA 2HR3A 3IKTA 2HGCA 5H6QA 4EM0B 3AF5A 4GO1A 3T9MA 1FOKA 2L54A 2PQ8A 3EYYA 1FY7A 4HF0A 4HL1A 2NNYA 1IN4A 4KN4X 1AWCA 2C6YA 4OMYA 1S6LA 2DBBA 1IN5A 4I7HA 4A12A 2QWWA 4M9ZA 3VOEA 2V1XA 3ISPA 4RL0A 1BC7C 4G7ZF 1BVTA 3F23A 1HXDA 2ZBKA 4XLPF 4ZYDA 2GFKA 3TOBA 2Y48A 2OZUA 3IELA 1ZKPA 2FBIA 1VGNA 1RZ4A 4A2UA 1IUYA 4CGZA 3M1EA 4A0XA 4LK0F 3KZYA 2XKOA 4UVCA 4EM1A 2YZ3A 4IRHA 4AWZA 5CVUA 3V7RA 4GYQA 1FYMA 4L9TA 2PEXA 3J80Z 1HQCA 4MQVA 4PVTA 2EB7A 2IPQX 3FWEA 5L3FA 3QH8A 4N0BA 5E1WA 1S7OA 2ZO4A 1BC2A 2RVCA 4ZYHA 1WRAA 2FU9A 3JXPA 5K5QA 1HW1A 4GYIA 3RIRA 2QINA 1TW2A 5HLGA 2I7VA 2YX7A 2Z33A 3ZR9A 1JGSA 2L4AA 4OINF 5B3RA 1YW9A 2IW5A 1JHHA 5ACVA 5LCAA 4Z7RA 4BXUA 3DV8A 2BFLA 5DEQA 3NEUA 5EV6A 4HF1A 1EV7A 4I98B 5FB2A 4HW0A 1UB9A 2HYFA 1SMYF 4C1EA 3TO6A 4GYUA 4PVOA 5K4KA 3GEZA 2GA2A 2QDSA 1KU9A 2XF4A 3M8FA 2V1DA 1UFMA 5ACSA 2VOPA 3BC2A 5K1YA 2OHJA 1IZ1A 4I09A 3BJ6A 1EH8A 4AWXB 1YG2A 5H20A 2FNAA 1ZH5A 4P9FA 4JK1X 1REPC 1J5YA 2VXZA 1QZZA 3K1MA 4O3MA 3SHFA 3MAJA 4E70A 2DU9A 4UWOB 3TO9A 2H94A 1Z6TA 4FX0A 4RB2C 4HQEA 4Q47A 1YTYA 3MZYA 2JZYA 2COMA 3H3EA 5J6XA 4I02A 2XIGA 3FAIA 1J75A 2J5PA 2R3SA 5ACUA 4BHPA 2BGCA 2O0YA 2G7UA 4M74A 4P9UA 2NZFA 1OMIA 4IHTA 2JTVA 3ML6A 2M5DA 2WC2A 1P4WA 1D8JA 3P9CA 4G6QA 2Z9OA 1XTOA 5DV5A 1XGSA 4NB5A 4TZ9A 5BS6A 2CYYA 4AX1B 3FM3A 4QWQA 2XASA 1QNTA 1ZRCA 4KMFA 2EV5A 1ZGJA 2K7LA 2HDCA 3J81K 1BI1A 5E1ZB 4HA8A 3R0AA 2BFZB 4WWCA 4AWYB 3O6BB 3N4MA 3BJAA 4C09A 1F5TA 1KYZA 2HS5A 2OHIA 3GUDA 4D1UA 1LQ1A 3KLNA 1KQ8A 3I5UA 3TO7A 1J59A 4M73A 3Q6VA 3IRQA 4LG0B 5ILUA 2FHXA 4EM2A 2WV0A 3E6MA 3CO6C 1JE8A 2BIBA 1ZRDA 3KE2A 2JSCA 1QBJA 4PDKA 3DP7A 3K2ZA 2TDXA 3T5XA 1O3TA 4Q5SF 2MA3A 4PZJA 1QZYA 5DCMA 4EJOA 2XV4S 3KETA 2EA4A 3TDZC 2D1VA 3C7JA 4HOBA 5E8IA 3FX3A 3LAJA 5LCFA 3ERED 4OIQF 1SD5A 3HSRA 2MH9A 1T38A 5AHOA 2XR1A 2EA2A 2GZWA 4EYBA 3V8KA 3WTUC 3N97A 4RAYA 5DD4A 4Q4ZF 1HKSA 2YNWA 3HHHA 4RB1A 5LS3A 1O3QA 3FCZA 3BOQA 1FC3A 4B8XA 1R5GA 5AXOA 3TP9A 3I13A 4G94A 2V1UA 2XAQA 3T3OA 3IDZA 2NYXA 4ZZDA 2WTEA 3ZMTA 3K1NA 4LD5A 5D6FA 2W84A 1ZGAA 3EYIA 1TNSA 2KIUA 3SQNA 2Y87A 2MLGA 4WX9A 5HVQC 2VBZA 1UHWA 3L6NA 3C3WA 3ELKA 1R22A 4L18B 3J81Z 3OOPA 3BP8A 3X2YA 4NHJA 4ESJA 1FNNA 4MEYF 1FBQA 3ZNBA 2IJLA 3H3ZA 2NRAC 5EH9A 3M8EA 5KILA 3X2ZA 3D5LA 4R1HA 2DO7A 2K02A 2P97A 1G3WA 2NS0A 1F1ZA 4YSLA 2XRNA 1YS7A 4WCGA 4CYDA 2GQQA 3F72A 2YNVB 2FQ3A 2HKXA 2BG2A 5ACXA 2ACJA 5AIQA