2I7XA

Structure of yeast cpsf-100 (ydh1p)
Total Genus 158
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
158
sequence length
717
structure length
499
Chain Sequence
b'MTYKYNCCDDGSGTTVGSVVRFDNVTLLIDPGWNPSKVSYEQCIKYWEKVIPEIDVIILSQPTIECLGAHSLLYYNFTSHFISRIQVYATLPVINLGRVSTIDSYASAGVIGPYDTNKLDLEDIEISFDHIVPLKYSQLVDLRSRYDGLTLLAYNAGVCPGGSIWCISTYSEKLVYAKRWNHTRDNILNAASILDATGKPLSTLMRPSAIITTLDRFGSSQPFKKRSKIFKDTLKKGLSSDGSVIIPVDMSGKFLDLFTQVHELLFESQVPVLILSYARGRTLTYAKSMLEWLSPSLLKTWENRNNTSPFEIGSRIKIIAPNELSKYPGSKICFVSEVGALINEVIIKVGNSEKTTLILTKPSFECASSLDKILEIVEQDEDGKSFLCDNYISIDTIKEEPLSKEETNFDNLDYLKIDKTLSKRTISTVNVQLKCSVVILNLQSLVDQRSASIIWPSLKSRKIVLSAPKQIQNEEITAKLIKKNIEVVNMPLNKIVEFS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein CFT2
molecule tags Rna binding protein, protein binding
source organism Saccharomyces cerevisiae
publication title Polyadenylation factor CPSF-73 is the pre-mRNA 3'-end-processing endonuclease.
pubmed doi rcsb
total genus 158
structure length 499
sequence length 717
ec nomenclature
pdb deposition date 2006-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16661 Lactamase_B_6 Metallo-beta-lactamase superfamily domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10890 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2i7xA02
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 2i7xA01
1E5DA 3ZWFA 2DKFA 2BGAA 3T9MA 2P1EA 3I0VA 4RBSA 3VPEA 3F9OA 4GYUA 2FU9A 4TZEA 5A87A 5EVDA 4UAMA 5LCFA 2FK6A 2NZEA 3RKKA 4AX0B 2WHGA 1X8IA 5KIKA 5EVBA 5K0WA 2FHXB 5HISA 1KO3A 2CBNA 3QH8A 4BZ3A 3KNSA 2XR1A 4C1CA 2WYMC 5FQBA 5ACWA 2Q0JA 3S0ZA 4Z60A 3ZR9A 4NQ4A 5A0TA 5IQKA 1ZKPA 3SD9A 5FQAA 5ACXA 1ZNBA 2WYMA 2Q42A 4YSKA 1SMLA 3X2YA 1QH3A 4ZEJA 4CHLA 5ACUA 5HH4A 2GMNA 1DXKA 2R2DA 5EV8A 4C1DA 2M5DA 1DDKA 4O98A 1KR3A 2BIBA 5LMCA 1K07A 3ZNBA 4XWWA 3BK2A 4KEPA 4F6HA 2WRSA 2AZ4A 1JT1A 2BFZB 4EY2A 2Q0IA 3IOGA 2OHIA 3G1PA 3KL7A 4YSLA 5HH5A 5ACSA 2BFKA 2GCUA 4JO0A 3ZQ4A 4D1UA 4RAMA 2ZZIA 4B87A 5HH6A 2ZWRA 1YCHA 1BVTA 3IE1A 2A7MA 5EVKA 1WUOA 1X8GA 4UWRB 4ZO2A 2QJSA 1M2XA 2H6AA 1QH5A 2BG7A 3AJ3A 3IE0A 1YCGA 3X2XA 5ACVA 2BTNA 2YNTA 2FU8A 4AWYB 3I14A 3PY5A 2Q9UA 2YZ3A 3DHAA 5KILA 2P18A 2GFKA 2BG2A 3SW3A 2BG6A 1BMCA 2OHJA 4FEKA 5LM6A 4TZFA 4J5HA 3PG4A 5B1UA 5A0VA 1WW1A 3WXCA 4ZO3A 4XWTA 2QINA 3JXPA 1VGNA 5B3RA 4EYLA 1VMEA 4AX1B 2P4ZA 3I11A 3X30A 1HLKA 4Z6XA 2Y8BA 5DPXA 2FM6A 1XTOA 2OHHA 3I13A 4C1GA 2I7XA 2I7VA 5AEBA 4RL0A 4TZ9A 4EFZA 3R2UA 2Y87A 2P97A 4V0HA 2M5CA 3RPCA 3IEMA 2UYXA 2YNUA 1X8HA 4D02A 2HB9A 2E7YA 3AF6A 4GYQA 4P62A 2ZNBA 4UWOB 4D1VA 2I7TA 4EXYA 4D1TA 2BFZA 3KNRA 2GKLA 3IOFA 4RM5A 2QDTA 5ACPA 5B15A 4PVOA 2WYLA 4C1FA 5K4MA 3T3NA 2QDSA 3LVZA 3IDZA 5ACQA 4FR7A 2QEDA 1JJTA 4C09A 4WD6A 4YSBA 4BP0A 3X2ZA 5K4KA 3BK1A 4Z7RA 1L9YA 4EYFA 3BC2A 4HKYA 2YCBA 5LCHA 1ZTCA 2FHXA 3P2UA 2YNVA 2DOOA 1WRAA 2NXAA 4EYBA 3BV6A 5EWAA 3MD7A 4UA4A 4RL2A 1KO2A 3DH8A 5ACRA 4LE6A 4PVTA 2FU6A 4TZBA 4AWZA 4GCWA 4C1EA 1A8TA 2BMIA 4NQ6A 2Y8AA 1XM8A 1YCFA 2BFLA 4DILA 4RAWA 4U4LA 3IE2A 5HIQA 5AHOA 4DIKA 3FCZA 2FU7A 3I15A 5EHTA 2NYPA 1MQOA 3H3EA 3AF5A 5AXOA 5AYAA 4NQ2A 4TYFA 4Z67A 5EH9A 3SPUA 1WUPA 5ACTA 3L6NA 4C1HA 3VQZA 4D1WA 3PY6A 2GFJA 5A5ZA 1P9EA 2ZO4A 3ESHA 3Q6VA 2AIOA 1JJEA 4HL1A 4UBQA 2BR6A 1Y44A 1BC2A 4TYTA 5LSCA 4UWSB 5AHRA 4Z5YA 4J5FA 3IEKA 5HIOA 4F6ZA 2BG8A 3DHCA 5LCAA 4AD9A 2YNWA 3SRXA 4NQ5A 5LS3A 4Z5ZA 2BG8B 2VW8A 3ADRA 3RKJA 4H0DA 5AXRA 2NZFA 4FSBA 2XF4A 4HL2A 5FQCA 3SFPA 3A4YA 2YNTB 3DHBA 2YNVB 5EW0A 4KEQA 5EV6A 4EXSA 4XUKA 3T3OA 3FAIA 3SBLA 4UWPB 4ZNBA 1A7TA 5LLDA 1DD6A 5LE1A 3TP9A 3IELA 1VJNA 5K4NA 5HIPA 2BC2A
chains in the Genus database with same CATH superfamily
1EK0A 2UAGA 4M9CA 2J33A 1CQJA 3KUCA 3WZMA 3IR6A 4KZPA 5JVDF 2PH1A 4R9NA 1I7PA 3AUAA 4B32A 3X44A 4G41A 3O2NA 2XE4A 4H35A 2O7QA 1N7GA 4RPCA 1NBME 2WJGA 5DPMA 4RK5A 3AR2A 3Q6NA 1QYDA 2FN3A 3DHVA 3SYNA 3TIFA 2NNLD 3F9OA 1O3YA 5F51A 1ZGZA 4EUKA 1O0BA 1FP7A 1SBYA 1WCWA 2QR2A 4LGMA 3FCZA 4N49A 5KX5B 4UAMA 4JUBA 1V7CA 3G59A 1QK3A 2X1HA 1XFAA 2VK2A 2ZAIA 1I5OA 2B4TO 3VH2A 3PP8A 3GLIB 3GCXA 5CYOA 4QXOA 3AX6A 1H2YA 2GTHA 2O5RA 1VHQA 1G4AE 2CDAA 2EX1A 1NUUA 1A0OA 2RKBA 1RYDA 1PT6A 1XVTA 1CP3A 3E27A 2YS7A 1P17A 4IHKA 1S1MA 3KPJA 4DV5B 2VXOA 4BV9A 2PT5A 2XEXA 1KJJA 1G8SA 1XELA 2FW9A 1XX6A 2EW2A 3KD3A 3KYCB 4CCSA 4F5ZA 5A1JA 4ENUA 2ZSJA 1E6EA 2OQIA 3EQ7A 3T7CA 4ZJYA 1SKYB 1U1GA 2QPOA 1GNPA 3P9IA 5TJHA 3TCKA 5HNKA 3RIMA 5ADUS 1JI3A 5H0IA 1DAMA 3PC2A 3R6DA 3QH8A 3ZVNA 3BAFA 2XUZA 1U5BA 1WXHA 5DWDA 5AKLA 1L3CA 2OUIA 1X39A 2DG2A 5ALGA 2ZYVX 3AESB 2C94A 2XB8A 1Y9JA 2V7TA 5DTMA 3N2GB 4GSLA 1VHWA 5ANRB 2VRCD 3TKAA 3HDTA 3CUUA 3ZIUA 4BMNA 1C1YA 4N5MA 1KETA 2NP6A 3ZE8A 1CS4C 1YJ5A 1L4LA 1XKTA 2XKAA 2YTZA 2ZTHA 3GJQA 4MB2A 3K9HA 3AF0A 4LC0A 4QBGB 5IMSA 2ZR7A 5JNVA 2IW3A 2ODWA 1MRNA 3IXLA 3NHYA 3RRFA 1OAAA 2CUTA 1PQYA 4PHGA 2G7MC 2QBYA 1ZPDA 1EE2A 3C1TA 2HK7A 3ST7A 4DWJA 4U2FA 5JNRA 2WDZA 3OY2A 1N5JA 2R97A 2RHHA 2YXNA 4N65A 1EGMB 4IS3A 5JROA 3KYIB 3R7WB 4B4KA 3NGLA 2DWPA 2EATA 1DKOA 1HE3A 4NDAA 2FCAA 3U4AA 4DCJA 1PGNA 1ZM4A 3JQGA 5AVXA 2VDPB 2WY2D 4RH0A 1C0PA 2RBKA 4EVRA 5JYDA 3ZHZA 2VK4A 1KJZA 3HJCA 4F5DA 1WG8A 3CLUC 1A1SA 1NP3A 1Z25A 4HQLA 1XZBA 2ASVA 1MCZA 1E1LA 1JIQA 3L8ZA 3O0TA 1JG3A 1QCCA 2C2YA 3LQ1A 2GCPA 4PTLA 4ZCQA 4DM4A 5K03A 5EV8A 4HDKA 1XZEA 4ZXFA 4G5QA 2Q9CA 3S2IA 2BV3A 3N87A 1YU9A 5F1KA 4L5JA 1KR3A 3BHJA 2WM9B 1OGJA 3PQ4A 4P9NA 5FUXA 1YBMA 2OCIA 2Q8NA 1ZM7A 2DQYA 3TVDA 3ZWCA 4C6SA 5KWIA 1ABEA 2P9HA 4JVNA 3L7KA 4O2BB 4RAOA 4LTDA 2O0JA 5DNUA 4XWWA 2NSJA 4E14A 5CGQB 4NOMA 5JTTA 1X7YA 4G25A 4XVRA 4PBRA 4IDHA 2J6BA 3AEXA 1QYVA 2YWJA 1D6NA 3A6EA 3LHKA 1F17A 3RFCA 4PLZA 3CVWA 2WJIA 3IR7A 1EUCB 2OV4A 1UPXA 2EOAA 1E9FA 3FUCA 8LDHA 3V8BA 4JLKA 4Z4HA 3B5JA 1KH3A 3GLFB 4I3HA 5AKJA 1J33A 1THGA 3ZIAD 1N7IA 2FLVA 2K4MA 1B1AA 1PT9A 1RMQA 1T9HA 3PA8A 5J40A 4P4LA 2ZSHA 3E3OA 3ROXA 1PSDA 3W9BA 1Z5ZA 5AKKA 1RPJA 3W3AH 4ZHQB 5DXFA 1IU9A 1USIA 1IUKA 2O8FA 2ZLBA 4U00A 5T4BA 2ZAGA 3GJ0A 3O3CA 4WOJA 3G2LA 3H7AA 4KXXA 1Y34E 3GPBA 5THXA 4HDSB 3FCUB 4LX8A 3O8RA 3DLAA 1HMPA 3QUTA 3IAXA 1E3EA 2GBGA 5J9FA 1J70A 3DE6X 5A3RA 2FEXA 3MQ4A 5KC9A 1XPOA 2XGGA 3KJEA 1TI7A 1TZBA 4NE7A 3UHPA 3IAUA 1TC1A 4NBKA 1TMYA 2IDZA 2VHEA 1E4VA 2FPLA 1RYNA 1E3QA 2FW1A 4LHSA 4C4AA 3ND6A 3KKNA 3MOGA 2PLWA 4WN9A 4GBGA 2EKDA 4NCKA 1DC7A 1SAYA 4NCHA 2QENA 3HU5A 2C83A 5TMDA 1JIVA 4U3JB 3RC7A 4KO8A 4I66A 4M8SA 2F59A 4MA0A 5FDFA 2VBCA 4Q3OA 4WW0A 1ZJ5A 1ZU5A 5FOSA 4DEXA 4ED9A 1Z4LA 3CCCA 1DX6A 4ABYA 4OX9Y 1UM8A 2JEYA 1S2IA 1G2OA 4HN9A 3EXHA 2YDYA 4JB8A 1H23A 5FLEX 3VBCA 2UVPB 1XALA 2I4IA 5CXQA 4E1AA 2AOTA 1YZUA 4DGQA 5I7EA 5KWSA 2J6HA 1DEAA 2FE1A 2IEBA 3CLRC 4H7PA 3KUXA 5CGZA 4E46A 4BATA 2ZR9A 1R3UA 4CIBA 1XZJA 1DCMA 2YNTA 2OEPA 5CW2A 1I2ZA 1KVSA 221PA 1G291 3OU2A 3PY5A 1P1CA 4PZCA 3A4IA 4TWIA 1NJSA 3PITA 4URWR 5SYNA 5JO0A 1ZY2A 1Z12A 2F1KA 2O2HA 3LU1A 4FMDF 4BFUA 3TIGA 5JC8A 1A5AB 1T3TA 1LK0A 4JBYA 1WHTA 4FUQA 1DCKA 6NULA 1Q0PA 4N0PA 2HZBA 4ALIA 1TGYA 3NUZA 4R3WA 2I87A 1N34B 3K0CC 4UVDA 3GG9A 1SQ0A 2BD0A 4FOOA 4DLRA 2NTEA 1JHMA 2EDAA 3H5IA 5ER9A 3HXQA 1NG9A 4Q7EA 2BGLA 4G8DA 1YZGA 4CM4B 5CCEA 2F55A 4U7HA 5AVJA 1GRRA 1WX1A 1G20B 4TKUA 3VR5D 2WIAA 4J1TA 2PNJA 4MGIR 1K9SA 4E1BA 1A2OA 3NAMA 1GZ6A 3FY4A 3HBJA 4MGZR 3M6XA 4RF4A 1UJ2A 4RCZA 5I48A 1X7HA 1XMPA 2DR3A 2J7KA 4HATA 4IFTA 4OYLA 4L9AA 1TW3A 3TZKA 2EXXA 4D9FA 1HDXA 2JK1A 4YLYA 2QJOA 2IYSA 3D1JA 2QRGA 3D4BA 1D4ZA 1GARA 2GAAA 1I9CA 2MSCB 3MS2A 1F6WA 2C5HA 3BS4A 2PWBA 4DUYB 4ND8A 5EMLA 1VL6A 1Z4MA 2QLNA 4ND4A 1TQ2A 3DA8A 3I64A 4RHTA 3WOHA 4AZTA 2OYSA 4Z3OA 5THKA 3F2IA 1E6KA 3ZCVA 3K2QA 3EGCA 3FNIA 5E2AA 5BT9A 4EFZA 2F9MA 2X22A 3AJ9A 5E6UA 3JQ9A 1RRVA 5T6BA 2WJWA 3KQUA 5TV2A 4HB0A 3LQKA 3DV0B 4RK4A 2HKIA 2QMOA 3E35A 2GJ9A 1DHTA 3IDOA 5FTKA 3U4HA 1B2LA 4F1WA 2H29A 2OAP1 4D46A 1U7WA 5KQRA 3G0HA 3WL5A 1KF0A 1Y3BE 3GGGA 4L08A 3TFWA 1NBEA 5JATA 3RS9A 3HRIA 4LK3A 1R9MA 4JJZA 2G07A 2QLFA 1TL7C 3HBFA 4YAGA 4UWOB 1B76A 1UOEA 1T4GA 1IY9A 4XGIA 1K4YA 2KE5A 2QRUA 3Q9NA 1ODTC 4DPKA 1YVRA 3JVUA 4HGOA 1NQWA 2D4HA 2EP8A 5LXTA 2IOYA 3SX4A 1N9GB 2NVUA 3AHGA 2EAUA 4BU0A 1OI4A 1QFYA 3DL4A 3T1TA 2BFEA 1DI0A 2BR3A 3HKCA 1BXGB 3P9CA 2VSOA 1WF6A 4L0QA 3GVHA 3D43A 2C82A 3VDNB 4MVYA 2ZYTX 3U81A 1SQSA 2H7XA 3PLRA 2X9GA 1Q22A 1Y9DA 4ZVRA 2FZGA 3ULKA 3FNRA 3R9WA 1XDBA 3VR1A 2CGEA 1US8B 1UXHA 3ENWA 3HBNA 3FE2A 1G6OA 1U80A 3LWNA 4E5NA 1FDTA 1N6OA 3O7WA 1F2UB 5CB8A 4UXIA 3LVZA 2HN9A 1NMSA 3LUPA 2C2XA 3I6MA 3OSZA 4Q7KA 4IXMA 3R8FA 3K9NA 2I6QA 2PV0A 3WLPA 1M2VA 2RD2A 3P2MA 3QG5A 4LI3X 2IP1A 3B1FA 3CJQA 2VYVD 1ZUD1 3HB1A 1T6YA 1QYRA 3R3XA 3RC9A 5KNDD 3JAKB 4PGFA 4B9EA 2QLLA 2EEPA 4K9RA 1IQUA 1EVZA 2AQKA 2ZBUA 3N6RA 4RTPA 1Q92A 2QY6A 3QWIA 4ZCPA 5ALUA 5I45A 4MYRA 3ROTA 1U5AA 1ZEMA 2GOYA 4C88A 4CM9D 3TPFA 3DE3X 4RVOA 1Y8AA 5D7BA 3PR3A 2X3YA 2YXEA 2AG1A 1HNWB 5CVJA 4YRQA 2XTJA 1W581 3GFVA 1O1YA 3KJXA 1R2QA 3NTRA 1NMZA 3RASA 1EWYA 4B75A 5KINB 3F8SA 3PGA1 4LNAA 6REQA 1IN1A 3IP5A 1IBLB 1BC5A 1SA0B 1UXJA 3LYLA 3K2IA 2IE8A 4XD2A 2XYRA 4JYBA 3SY8A 3OP1A 1PEDA 4NMWA 1ISFA 5EMKA 4MUEA 2IYRA 5DBFA 3OQNA 2G0AA 2NQ8A 1GUZA 4K26A 2Y1WA 1VE9A 1N5MA 2VJMA 3RLIA 1WXQA 5DIZA 1W4LA 5ACRA 3M6UA 1Z29A 4TGLA 1TM5E 4D0LB 1O6FA 1T34A 1UBOS 1V4VA 3ETDA 4KQJA 5E3IA 1OX4B 3TMAA 1QH1A 4XH9B 1B0AA 3LUDA 3HL4A 5HKBA 5AJUA 4B09A 5KWVA 5DK4A 4GS5A 4XYLA 1I2MA 4YJDA 3HVIA 3ND7A 1M2NA 4RD6A 4Q9AA 5AHOA 3EVTA 2VS1A 1RFLA 2YXBA 4HDNA 2ODPA 3QITA 4K6CA 4N0EA 3D3KA 3ELBA 3RADC 2YMQA 3T9AA 1RPZA 1FDIA 2XB4A 2I6GA 5GOTA 1S01A 1Y7TA 4PZEA 4UBOA 1TJYA 2XT6A 4V0MA 3SR3A 4HVTA 2W0SA 1L1FA 4YMSA 1C0LA 4ZQIA 3UC9A 4MS3A 1UBTS 3JQBC 5I9SA 2Y93A 3F6SA 5A7HA 4MV3A 4YECA 2R7LA 2J9XB 1P39A 1WEHA 3R76A 2O7VA 3WLJA 4DLVA 5SICE 1CR6A 2F3QA 4CTKA 1ZJ6A 3PLNA 1EK6A 3H8SA 3C2QA 1E2IA 1OC2A 1WIWA 3COZA 1ISRA 1YIOA 3K2BA 1P2SA 1EH5A 1P8AA 3ZGVA 8OHMA 3T1YB 1SVUA 1NVKA 3C3XA 5F98A 1HEIA 1V3UA 1ECFA 3IP9A 3USES 2R66A 2HRZA 2OXCA 3QVVA 2ONKA 2FFHA 4P98A 2ZZKA 1GUAA 3BMQB 1KRHA 3AY0A 4MW4A 5EJ4A 1GZ4A 2IODA 4FFBA 4DLPA 4EWLA 5AM3A 3MBOA 3GAFA 2B3TA 2JD0A 2PLFA 3FR7A 4KGVA 3FFXA 3O6VA 3AF2A 2HJGA 4IDOA 3KPVA 3C3EA 5K51A 3NYIA 5DTIA 2EIHA 1T9CA 1B4DA 1V7ZA 2FGKA 4ND7A 4OFWA 4P8RA 4QXPA 3GN1A 4OAPA 4G26A 2OZVA 4D4MA 1SC9A 3B6MA 3ENKA 1YOVA 2IQIA 2V1XA 1TCUA 3A9WA 3HY4A 3GOQA 1RLTA 3OIUA 5CCDA 5CT6A 4JS0A 3A1UA 2CBGA 8MHTA 1J5XA 3CE9A 4BVFA 1KU6A 2CLLB 4C0AC 4J29A 1YZTA 2BG8A 4F3CA 3OVMA 2HRBA 1JGTA 3ROGA 3ANNA 2GCGA 2IYWA 3HJAA 5EC8A 1PR5A 2X41A 1RWXA 2RGUA 3E03A 3JZFA 4JCOA 3S40A 3WIUA 4NQ5A 4XYBA 3QXJA 1WQ1R 2LIPA 4RJTA 1SVLA 1F06A 2CXSA 1RABA 2AOWA 2XA2A 1BXRA 1RE0A 2BR4A 4I55F 2Q0SA 2QR5A 4JOCA 3VSBA 3HCBA 1JP7A 2D5CA 3AUTA 4RHUA 5AJYA 3W05A 4DR5B 1RJFA 2XF4A 4YTEA 2VR1A 4O02B 3ABSB 2PZJA 3PCTA 4EOGA 1P9LA 4N03A 3RIHA 4IIEA 4S2EA 3SJUA 3A9RA 1LNSA 5DB4A 3RARA 5AVZA 5KJ1A 3B2NA 3DWEX 1U8XX 3AY6A 5JD5A 1XNJA 2CYAA 1C4WA 1R27A 4DJFC 3HU1A 5A4FS 1QIIA 3WK7A 5AW1A 2OY0A 4CIWA 4DA4A 3GPIA 2N9UA 1UWVA 4MAAA 2H2HA 5H3LA 5HG0A 3M1IA 4A0HA 1QU2A 2YJ4A 3I6YA 4MVJM 1GP2A 4CF7A 3NHLA 4OXXA 3INTA 2V6IA 3ETGA 4E2YA 1I0LA 2IU6A 3D4IA 1D1TA 1NRIA 1S2OA 4N7BA 5JSYA 4P3XA 1W5EA 3ZDFA 3DOJA 1NVMB 1NWCA 2NZJA 2QZZA 3KEGA 5IBPA 1E18A 1S0UA 1L5RA 3W3AD 5HKKD 2BMAA 2PBFA 1N6LA 1XU7A 2FSVA 3JALB 2F1OA 1GVNB 4JEIA 1UJCA 1T9GR 4ISCA 1OH8A 2BC2A 1OXBB 4L6AA 1ZBDA 2B8TA 2YMMA 4NARA 5CDGA 4KTTE 1QGYA 2HDNB 1NA5A 2YZMA 4MX8A 3ZVMA 3SJCA 3B38A 4IRXA 3ICPA 3A9TA 3KHKA 1IOZA 1TM3E 4Q4JA 5LXTB 1F8YA 1PEKE 3DBRB 3IVRA 4LY0A 3J7TA 3B1XA 4V3CA 3LW8A 2H4ZA 2GBFA 3KV3O 5FP0A 1BE0A 1LLDA 2Y67A 2I34A 3I2KA 3OZ7A 3DXYA 4IGFA 3V32A 2O2IA 3PBKA 1EEHA 1NZFA 3OLYA 4DA6A 1JNXX 5LCFA 2HB6A 3TTXA 4B0PA 2P9JA 5GIOE 5GM2A 3M6WA 3L7LA 3MWKA 2CD9A 4G9GA 5GQSA 3WR5A 3DD5A 1R5NA 2DBZA 1L4MA 2JJ2A 3PX3A 4CETA 2D6FA 4R1SA 13PKA 3O1HB 4OPMA 4M1QA 1J7KA 1UXOA 3QVXA 4POAA 5ARCA 1MJFA 3EPHA 1T2DA 2FMXA 3MQFA 4HF7A 1FUKA 1R37A 1E2NA 3MWDA 4MCAA 4MRNA 3IOEA 4H77A 1YL5A 4B2LA 1NL3A 1GAWA 3TS1A 2WJ6A 4QYIA 1NE2A 4ZVVA 3V3TA 1OVMA 4V1CA 2Y2VA 2YRXA 3GHHA 4PC3A 2HSZA 5KJCA 3BWVA 1B14A 3G2QA 3EZLA 4H3SA 5CM9C 1UXKA 2PIAA 3BTUA 2XUJA 3BIXA 3NKLA 2NO0A 3R4VA 4ZPJA 3I8OA 3KSZO 3WS7A 4D0NA 2VJBA 1Q14A 2WG2A 1JQKA 1VCOA 2G6BA 4PS0A 1YMUA 4MLDA 1KK0A 1ECCA 3V4ZA 2RGCA 1VIDA 2ZAOA 1NHGA 5GONA 4NG5A 4L4ZA 1OI2A 3C5EA 2F8LA 5HS6A 3WFIA 1OC4A 4FWBA 2Y1GA 5F73A 3CINA 4GX2A 5DV9A 5EJMA 1HWYA 4OAQA 3KT0A 3GDHA 4HB2A 1ULSA 1O94D 3K53A 1QPBA 3H8WA 3BFXA 4QGBA 1W36D 2AQIA 3EHEA 4CV0A 3MTEA 3K1YA 5DISB 1OHHD 4ARVA 1ZN7A 3TD6A 3BH6A 2SNIE 1HT3A 3OLWA 3YASA 5BOSB 2XNCA 3JQ7B 2NSHA 2QQ0A 4ER3A 1NXSA 4J43A 5JWOA 1WKVA 2QTZA 5COBA 4B1FA 1XK6A 1NYRA 4FDUA 3ZQJA 4MJXA 3A6GA 3DM5A 1A7AA 3LX8A 3UGQA 4TPKA 2MIIA 1KZ1A 2O2CA 3HB0A 1AQ6A 1P91A 1WMFA 1DOAA 4OXNA 4ZT5A 3ZNPA 5A6SA 1P5JA 5HJ5A 4HFJA 1APBA 1MGPA 5A71A 4UNIA 1TZCA 2WMOB 3L5KA 1MC5A 1GEEA 3GGDA 4BNLA 5BW8A 2QM0A 1TEVA 1WDTA 3NGXA 1HDRA 3CGGA 2JGDA 1SC3A 2YY5A 3K0SA 1DO0A 4PXAA 4G37A 3CZ5A 2M5DA 3TFQA 4OK3A 3CG4A 1SVIA 1CDOA 2Q3HA 5A7FA 4FM9A 4AP9A 1QNLA 4J2OA 4HNSA 5FNVB 5SYMA 2C4KA 2LTAA 1KP9A 1F2VA 3DOFA 1RZVA 2DWUA 3I9FA 4JL8A 4JI3B 5ALLA 4DCOA 4WINA 3MVEA 2OOKA 3IRUA 4XQ0A 3OZAA 3W2IA 1K2WA 1OZGA 1Z4JA 1V4NA 3CKYA 4AM8A 4RTNA 3UT0A 3PGLA 3GJSA 3WK9A 5LBUA 5KTPA 2J46A 2BFOA 2WV9A 4FB4A 4G07A 3OFND 3ZGNA 1ISMA 3A1SA 1PUJA 2VP2A 2DY1A 1F5NA 2D74A 1P72A 2A0YA 5FKJA 1G20A 1LLUA 1MA0A 1QLWA 2R8BA 1U81A 1QIGA 2F48A 4GYKA 1N0UA 4M0UA 3HO6A 5EMJA 3QXGA 4GPEA 1TEHA 3UG6A 2W2TA 2H1FA 3OIFA 3ZW8A 4L5YA 3DAOA 1DU4A 1FMJA 2GN4A 2WU4A 1L7XA 3KJGA 4MB6A 4O5AA 4R2KA 4YCAA 3BTOA 3DZ8A 1BJRE 4M37A 2AJTA 3TOCA 1NSTA 3R3VA 5HZKA 4EGCB 3BA6A 3LC1O 3ROMA 3H05A 3PT5A 1ONPA 2LCQA 2BFPA 4MMYB 5JRJA 1T6BY 5EUCA 4ZPXA 3CJRA 2ZYDA 3ISJA 3RFTA 1HDOA 2A3NA 3CGWA 2QVBA 5EQJB 1YV9A 3RU7A 5FI5A 4ARBA 2GEKA 2CLSA 4WIAA 2X77A 4M7WA 1ULUA 4GZLA 4RFSB 4GKBA 5TS2A 3TLBA 5IJ9B 5A6SB 1TO1E 3AUYA 5HFNA 1N7JA 2RGWA 3EW9A 5D2CA 3HM9A 3ZU6A 1SQFA 2GN9A 2H52A 2HHCA 4M9UA 3CR3C 4DRXB 2UUAB 2ALJA 2F8SA 3MEQA 1W4BA 2WOOA 1TC2A 2QVZX 2ZCVA 2SKEA 2IZZA 5HMLA 4C06A 1JTEA 1XRMA 2WUDA 1MPXA 4L8YA 2VHXA 2XMRA 4MGEA 1YUNA 5LN1A 4BJ6A 2BFWA 4BMYA 3AZPA 4MUXA 4H1TA 1W48A 5ALZA 5FBLB 3RM3A 2ZSBA 4AJNA 5FF9A 5KSYA 2V1UA 1EP2B 1P7ZA 2NXNA 1KE1A 1X74A 3D2BA 4MS4B 4BN5A 4F3NA 5DNYB 5HQ3A 2MDTA 5KU1A 2B5OA 2IEIA 2X40A 3AMVA 2WWTA 3P26A 1JAZA 5CNMA 5BNIA 5DT9A 3WNDA 4F2HA 3R7NA 2G4VA 3EEQA 5D6OA 1GDTA 1X80A 1FJHA 4Z9FA 5FBVB 1ZQ1A 3B7WA 3PFFA 1RAGA 5KPDA 5A62A 4TLLB 4DRYA 3AFMA 4MWTA 3U7JA 1E9EA 3OPQA 1T8UA 1UFRA 5EYPA 5I9NA 5ACVA 4R6WA 1X7ZB 3G68A 4TVKA 1UT8A 2QTMA 2CJXA 1NONA 3FRJA 1FP2A 4WJZA 2WFLA 1XRRA 3TLEA 3WGVA 5JZBA 3ZCPA 1P2TA 4PVTA 1VJRA 1KRXA 1X86B 3C7CB 4U5XA 2ON6A 2OB1A 1DAFA 1M8KA 1ND6A 1ZM2A 1O54A 3B85A 3AR3A 4UM9D 5ULLA 2PUCA 4H3HB 3QYFA 4EI7A 1BMCA 3ZG6A 3EOZA 4L8LA 2UZAA 1ZCAA 1ZOOA 1E4EB 2VJPA 3UC5A 4TL6A 4IIBA 1BN7A 1IYZA 1JJ7A 1L8XA 1LZLA 4ND5A 1FLDA 2VDWA 1UPCA 3SNHA 3GBPA 1K06A 5HWSA 1AMNA 4BHTA 1THTA 3U26A 1F4VA 2O4UX 3QQPA 4NX2A 1UAAA 2MSKA 3QVMA 1SXHA 4DAOA 3JZDA 3E82A 1G3UA 2P62A 2XD4A 1V8PA 3FDJA 1DEXA 1XTTA 4UHBA 1J2TA 5FHQA 3PPYA 1XROA 1Z18A 4CT4B 1RHKA 3CNEA 1MENA 4ISBA 3V1LA 1LI5A 2Q8QA 4R0VA 2VTEA 2WF7A 3LQ4A 3P9SA 4MITA 4N0MA 5ERYA 5J1SB 3JXPA 1N0VC 1UJNA 1KQOA 4WLFA 4Q4CA 2V45A 3PR2B 3K4QA 3TSCA 4N76A 1VMEA 2YIDA 4HKTA 5FRDA 3WVNA 4W9NC 2ZUBA 2ORYA 1FOEB 3A6JA 1H5NA 4UTXA 1Z13A 2LW7A 3AKYA 2GRAA 5TNXA 3WB9A 1KDZA 4F04A 3DGFC 4LHEA 5GZ1A 2MYNA 5JT1A 1M72A 4FSDA 1PWEA 1GRVA 3X43A 2II6A 4FR2A 5ICMA 2Z8XA 4I1SA 3PUKA 4H17A 4DLBA 4EEXA 2EKBA 3M4ZA 4B6JA 5TGTA 1J9EA 5L45A 4TSKA 1IM5A 4MPPA 1MJGM 1SOAA 5B1HA 3ZCRA 2KLHA 1UEJA 2LPMA 1FS5A 1NM5C 1YR7A 2P9QA 3OLXA 3DKKA 4BCDA 5CVUA 2RHRA 3JATA 3NHSA 3QF4B 4LOHA 2UYCA 3GJXC 4A6DA 4KXQA 2HH9A 1AO0A 4B6QA 3IUPA 2VN8A 5JXHA 1GPNA 4RAQA 1CDEA 1N0WA 1TA9A 1ULAA 3ZJ4A 1SZCA 4DM3A 2VFAA 1VKHA 1NOJA 3DHEA 2OAQ1 3PIRA 2P27A 4BLSA 2I7TA 4AUNA 4C30A 2Q2NA 4CPDA 1I1NA 2PMDA 4MGKR 3SS9X 3PUVA 1OFUA 3BYZA 2IKQA 2Y6UA 3E3LA 2BFZA 3GEIA 4FFLA 4YX9A 4D1TA 3JQ7A 4IDGA 4PFJA 1NF9A 3TZBA 3UT6A 1QV7A 1TPZA 4Z6XA 3GVPA 3V48A 2I03A 1Z33A 2JZCA 1AKUA 2G63A 2XDAA 3G85A 4BO3A 4U7DA 4HK4A 5ES3A 1KSHA 1G5FA 2H3HA 3TLAA 3G1UA 1X9GA 1GADO 1U9CA 3SXPA 3DAHA 4AWAA 3OCVA 4AXHA 4Q9JA 1QYIA 2MINB 4LNUA 5FFMA 3PRYA 4IWYA 4QU5A 3LO5A 1WOYA 2K2WA 3RIXA 3V6MA 2FPWA 1S4QA 4RS4A 4EECA 4ZZ0A 1LBIA 1VDMA 3HZRA 3MGAA 3NASA 1N8TA 2GR9A 2ZE5A 3ZGLA 3OFNA 4Z53A 4I2NA 2VCYA 2X86A 2ZETA 5DXJA 2APJA 2JLCA 4WLVA 4WD6A 4BXOB 3A6DA 4KLZA 2IIPA 5DBGA 2O8DA 2PANA 1LPMA 2WWFA 5DP2A 2WT4A 1TADA 1XTRA 4PCVA 2G06A 5HHTA 3ZTYA 2FDRA 3EE6A 3JQDA 3DLCA 4QXAA 5KYGA 5HE9A 1EXNA 1K6EA 4Q18A 4L8FA 3C1AA 1G5TA 1UOOA 5LCHA 3KKEA 1QAMA 1Q74A 1PJAA 3OT1B 2WBLC 3M82A 1ZDMA 4Q4HB 5HF8A 3VPBA 5CFMA 5CDFE 2VQEB 4QLAA 2IUFA 1ONOA 4CHTA 2FPIA 4HS4A 3JQAD 4MWDA 5EWJB 1UKBA 1WUHS 2J41A 2XXBA 3B3QA 3G13A 3HCDA 3CFYA 4L07A 4S24A 1A72A 5HKAA 3DDZX 5JYBA 3LOUA 4IDBA 1SVOA 1SU4A 4HDRA 1UXIA 2HU2A 2PY6A 3GEGA 4IIJA 5FL7D 3NAGA 5C5CA 3G7NA 5JV5A 2ADFA 3AV3A 4Y1FA 3TD2A 5CFRA 3WGIA 1E20A 5I8ZA 2I1WA 1QS0B 2EKPA 2XW6A 4HLUA 5CT5A 4AP6A 1XTUA 3H2IA 3WISA 1P4JA 3QKTA 2QV7A 5LYJB 3PDJA 3LDGA 2PLRA 1K88A 3QPWA 1S89A 3R5SA 3C5CA 4OHKA 3A0RB 1C7EA 1U2EA 3EG5A 3MWLA 3NS7A 4UAUA 5JH7A 3UXEA 3AESA 1ZOIA 4IDFA 4WFQA 1SQGA 2XY4A 2PGOA 2AK2A 1PR1A 2CMKA 2MSLA 3N2IA 4KG7A 2TMYA 1CEYA 4NVRA 2FUG6 3UUEA 2X0KA 2C88A 4Y2UA 4WBNA 2IXEA 3CLTC 1RZRA 1N6IA 2C4TA 3W6NA 3NIFB 3AF5A 4EYGA 2H1RA 4DR1B 1MAAA 1ODKA 3PQEA 3U3MA 5IKPA 4FZRA 2V6FA 3GAAA 5EH9A 3LT4A 3P52A 1LW6E 3V1UA 2DCMA 4ND1A 4Z9XA 1C9KA 1PR9A 3GDOA 4C4XA 4KMSA 1A9SA 2NU8A 2IXBA 4AKSA 5F5LA 3ORYA 4RNCA 3QBVA 2X8JB 3CT4A 1LC0A 2B8EA 3NXKA 4ZODA 3SIRA 3WGHA 5IZCA 1KZHA 2DT5A 3VNQA 1ZUNB 2E18A 2PH7A 3FOAA 4IMJB 5KX5A 2ZGVA 1IM8A 3BIOA 1RADA 3G17A 2FMHA 3UMCA 3JRNA 4AUKA 1K8XB 3IIJA 1Q5PA 2G9UA 3GEDA 4KJXA 3U7IA 4ZXPA 1RQLA 3LP6A 1CPYA 3R41A 3OJXA 4KMMA 5HIMA 1IN7A 1H5QA 1NPTO 4EHFA 1K68A 4PGAA 3MCWA 1W85A 3UOGA 4AC9A 3TOVA 4JXZA 2F43A 4WY2A 4XLZA 1E3MA 1KYVA 3R3HA 1E2QA 3WGZA 1FFSA 2PL3A 2MYUA 4KXWA 5DGDA 1OW3B 1SG0A 2PFSA 3GLRA 3IEKA 3AQ4A 3ECAA 1EESA 1V3QE 2IQ5A 1Q50A 4M36A 4M3NA 4A3SA 1OV6A 1O87A 2ZT6A 4R7GA 1CBUA 5E6SA 4UMEA 3UGKA 4J3FA 2W6JA 4H0FA 4X84A 4QAJA 2GM3A 5D7NA 5JCZA 1J0BA 4QTXA 3PQ7A 4TV9B 2HHLA 3OTGA 4OHBA 2COKA 1WCIB 1SPXA 5JNUA 4CIVA 3DXXA 2JKZA 1W0JA 2PRYA 1G8GA 4FD2A 3V8EA 1ZCBA 3ZY4A 3EVZA 1T9KA 3NBYC 4HL2A 1SOMA 3IGFA 1ZXXA 4PTZA 5IJXA 1DHRA 3WDSA 4NFLA 1Z0KA 1ZA2A 4FE4A 2AOUA 1ZFNA 3LX5A 1TIKA 3NCHA 1TK3A 1WZUA 3WTBA 4ARIA 4TS1A 2C0PA 3G82C 4F9EA 5I8WA 4C78A 3HK2A 3R0VA 1YF3A 1ODJA 3PHGA 3A9SA 4IXTA 2XHZA 4RLHA 4EGFA 3VUFA 3WAGA 2V9CA 2IV7A 5MFZA 4QTTB 4A03A 2YIVX 1MW8X 1YRWA 1TO2E 1VG0B 1QZXA 2O1WA 2P3SA 3HDJA 3QBTA 4OKNA 4LFCB 3JD1A 4MZDA 2CXTA 4K3VA 3T8YA 3JQQA 4J0HA 3EDQA 1BXGA 3UJCA 3U61B 1TXGA 2DTEA 1GG9A 4P4GA 2UDPA 3U4GA 4BWFB 3EBPA 4INAA 3WSWA 1U04A 4PQGA 2Z3VA 3SN6A 1QHXA 1HETA 3OCJA 3CO0S 4US2R 5JU6A 1YZNA 1PJRA 2B1IA 2JFBA 2ZSKA 1MMFB 4CL2A 2WQZA 1IZYA 3EAFA 1PJCA 3N3AC 3T3IA 3WGNA 5I9MA 2AH5A 1KEZA 2QP3A 4JSYA 1NOIA 1E9RA 1AKWA 1OIXA 4AP5A 4BLRA 4EPYA 5IVDA 2XRZA 5AJLA 1RBQA 4BMPB 3KRTA 4J1NA 4ZV4A 1F8GA 3LDUA 2W7TA 3FYHA 3GT3A 2ZYUX 2BGMA 3HVUA 3ISTA 3JRWA 3PFWO 521PA 4G0ZA 1FYEA 1KYIA 1R0LA 3HYLA 3S0JA 3VPEA 1JBKA 4H4DA 4Z4IA 3ZWXA 3FMGA 3WDKA 3KOYA 1PJ2A 1Q0HA 4NS1A 5LUBA 4D8TA 4S1PA 2Q3LA 1ZD8A 4EAQA 4HQ0A 4HO1X 4G5RA 5COQA 3HDQA 1XNQB 3N28A 4DCNA 3BXFA 2XYVA 4D9GA 5LM3A 3VHXB 4S1OA 5ITWA 1A96A 1GRQA 4NU6A 1H2HA 1C9DB 1T26A 2NZUG 4D97A 3FNHA 1H4VB 5JJKA 2EBFX 3SF8B 1QVZA 3GLSA 2NZ2A 2H1CA 1PK9A 1AKQA 3AOGA 4Y6OA 2OHXA 2K87A 1LRLA 4LXQA 4QNNA 3DEIA 5DSZA 3DMTA 1RR6A 3BRQA 5MGBA 1ADYA 2EYQA 1FX0A 1FP4B 1FW6A 3WKAA 4IFBA 3DL7A 3L4SO 2TSYB 1BN6A 4AN0A 4ZQBA 4MQ6A 2PH5A 5EIOA 3TZLA 2CFUA 4KLRA 1Z6XA 2JIPA 1PAUA 1ZESA 4S35A 5KNBH 1KHTA 4U9UA 3EISA 3T1NA 4O4JA 1PZHA 4O4IA 5A02A 2YWRA 3QKIA 2VUSA 4X95A 4C0KA 5EIHA 3SDSA 4CF6A 5HIAA 3ORFA 1NI4A 2W4QA 3KSDO 3ZC3A 4WLNA 3OPYB 4CT5A 5JYCA 4J7AA 4WXEA 5SZHB 1O6BA 1TF2A 2QRVB 1VL5A 1QBKC 2YCLA 3H99A 3ITEA 4GR9A 4I5EA 4J0GA 4IICA 5EHIA 1DVRA 3AI3A 3UK7A 4MQUA 3HEBA 3KZXA 1QHFA 4K9MA 1FQOA 3E6AA 4YT5A 3RG2A 3AJEA 4EFNA 3VR4D 4JXKA 1G8PA 3KSMA 3BIJA 4XFJA 3WLTA 3O9VA 1DKQA 2UZ1B 4JY7A 2MINA 2J9ZB 2FEKA 1MB9A 1ZKMA 4TLDA 2ZE8A 1ZNZA 3DO6A 2EFHB 1VPLA 3IUNA 3JR3A 2IWHA 3KALA 1WR8A 2JIDA 1Y6ZA 3WSTA 1Z28A 4MVJH 4LXTA 2ZUTA 4UBMA 4KPEC 5JS1A 3EOAI 3NALA 4BPBA 3QXCA 1ULHA 4IVQA 4UAGA 3SBEA 3P0EA 4TMWA 2PE5A 2GILA 1IZ0A 2V4MA 4PYOA 1VP3A 2JH8A 4QX6A 1ILEA 4CEHA 2A0WA 4P7BA 1I7DA 2ORVA 1Z5UA 2QG9A 2XNDA 3SC4A 1E7WA 1QFXA 4MUMA 4NEHB 2OWEA 2J32A 1NURA 2HO5A 5K5EA 3HBAA 3HEMA 1BKYA 4HV4A 2DRIA 4QOJA 3LQYA 3JAWA 5T3UA 3H13A 2GO1A 1FSZA 1GZ5A 1KK1A 4MYHA 3QHPA 3WOVA 3J81A 1YJBA 2WSYB 4X44A 1XCOA 3UJ7A 4HAIA 2JLUA 1NU6A 1ZNWA 1RWVA 4UDNA 5ICFA 2XH8A 1NXTA 5AW4A 1K0UA 3NH6A 4XYMA 4KIGA 5MFPA 2WYHA 2WQ7A 2YWFA 3M70A 5DYTA 1JKFA 2XA1A 1SGWA 3NANA 3AI2A 4WT7A 4E94A 4P4TA 3TUJC 3FIUA 4JLBA 4KE6A 1PGOA 1USKA 2CNDA 1ZBQA 4LOAA 1NVUQ 3PWZA 1K6JA 4G5YA 2FJUA 3B3JA 2GZDA 2XUGA 2FFJA 3Q88A 1FA9A 5BNTA 5LDHA 1CS0B 1F0YA 4DC0A 5LIPA 3DUFA 1MJNA 4BNUA 2PUGA 2PX0A 4A2PA 3I1YA 1U31A 2W2QA 2QSZA 4OIFA 4EY2A 4KI7A 5C5DA 3IAEA 1QYWA 4JP8A 1MZPA 2Q1SA 3QIAA 2I29A 3L1KA 3EIHA 3IOGA 2CF5A 2GDZA 3TIVA 2WUEA 4WJKB 1GPJA 4PR3A 2XVMA 4X97A 1GYRA 5F77A 3WA6A 3G1PA 5EJ8A 3D8HA 1O6ZA 2QEQA 4AG5A 5EIXA 1JJAA 4OQFA 2C77A 4HAXA 3RIEA 4BIMA 3NYRA 5EI5A 4ZAGA 3M3DA 5AK6A 1Z2AA 3UW1A 5FPSA 2OESA 3BHNA 4B17A 2R62A 3RSOA 1NVVR 1X92A 1AUXA 2PH3A 1N2HA 1Y9ZA 2H11A 1ESZA 2DERA 3MFYA 4JLDA 2OQVA 2VRCA 3P9XA 1AGXA 4QXRA 5KTOA 4ZEOA 4OQDA 3D5QA 4YRIA 5JZMA 3UAXA 3E9CA 3UXMA 1R8SA 3TJMA 2V7WA 4BYGA 5IULC 3AVOA 1QHYA 4EHIA 2EJBA 2BWJA 4R40A 4RV5A 1QFSA 2XYHA 4DZTA 2B4YA 2PUFA 4PG6A 5HE8A 1HK7A 5CVDA 4QELA 2Y0BA 2J9YB 3NVKI 2IHYA 3NPAA 4I6EA 4B6RA 1PWYE 2ZSUA 1XD2A 3LPMA 4TQUS 2EDCA 4QULA 3E4DA 1X77A 3EC1A 4FQ7A 4HEHA 5LQAA 5DF1A 3WA7A 2IU0A 2BFDA 3AM5A 1RQGA 4QTUB 2ZS7A 4MKRA 1KL7A 5AD1A 2X0RA 4P1ZA 4WNIA 1TCAA 1UMDB 2J3IA 2V8OA 3DUFB 4I9NA 1MVOA 4MIEA 4QGFA 5JSQA 3B6KA 2WWYA 3IBFA 4OAOA 4YDRA 1MEOA 1QKKA 4D99A 3R9KA 1BH2A 3LCCA 2WPDD 1NIJA 4BB6A 4PYLA 3H9QA 2NYUA 5MDHA 4YRGA 3FTQA 3N86A 4BUJA 4KR3A 1MP0A 2AG5A 3UTCA 3K5IA 2VSYA 2AJCA 4V0LA 3TYXA 3DP9A 3MWDB 3D7KA 1YS2X 4HUQA 3VNAA 3VX4A 4J5HA 4QBFA 4MYSA 1O4VA 3BRCA 4YFVA 4FWTA 3P9YA 4IWNA 3WP0A 2QW1A 5H81A 3LK7A 2I2CA 1U2DA 2AFHE 1X9IA 2AWNA 2CNNA 3IUYA 1MF7A 4LVCA 5BSRA 1DAGA 1MIOA 4OFXA 1WW1A 3THWA 5YASA 3UH0A 3NYWA 3LBFA 5A6VA 1GQ2A 1Y7LA 2D00A 2JHFA 2HYDA 4XI9A 4TL9A 2I1QA 4PEVA 4AN4A 2XZDA 1I7LA 2SKCA 1BTOA 3VX3A 1II9A 4G86A 5BQFA 2XT9A 2DFTA 3Q7TA 4MQEA 3U6KA 1XZDA 1TUBA 1FP4A 2VBGA 1XB2A 3H2GA 1EUDB 3OHSX 5LU9A 3EEBA 2GBCA 4LRYA 1ZJWA 2VWPA 1ZHOA 4JUCA 3K7EA 2P7IA 3MS4A 4IXDA 2OV1A 1QANA 4JYMA 4W5TA 5JUWA 1DL5A 4Q93A 1TKAA 2OKCA 5D5QA 4S05A 4B3MB 2CLHB 2WZQA 2LKCA 4YJ2B 3N2YA 3RK4A 1HG1A 1OXUA 1XEWX 4YI3A 3U17A 4AZ0B 1CRPA 3CF2A 4UREA 3WL4A 5CA0B 1GXSB 4MVJP 2FZLA 3ASZA 3IV6A 5GM1A 3K31A 1FNDA 1UBNA 2Z4SA 3FGOA 1Y37A 3RKUA 2BI4A 2VHQA 1XG5A 5I9LA 3F0TA 3QI7A 3QNUA 3NNSA 3RPCA 3T5BA 4MJ7A 4OJMX 1IOWA 9MHTA 5LD2C 5T4FA 2LCIA 1RWKA 2EW8A 1OH7A 1XZCA 1BROA 1IK6A 1YR8A 3FXAA 2AOVA 4QDXA 4XTCS 2ZBRA 3IT1A 5BUZA 5E1OA 4JVLA 1YGPA 1FVFA 5CXUA 3EVGA 2VTBA 3KR9A 5C53B 3CMMA 2BFFA 2IEYA 1KEUA 3ENNA 1EP9A 4EJ6A 2GPTA 5LYYA 3EVBA 4LW8A 3GZNB 1SVNA 3GCWA 1G6KA 1FX0B 3K5PA 4DNQA 2A35A 4HXFB 3MT7A 1YS1X 2CDBA 3X2EA 4D9NA 2DQ4A 1IG0A 1SXGA 2DPHA 4F3RA 4B3SB 1KSFX 3GL9A 2GTIA 3QY0A 5ERXA 1GN8A 3W5HA 5FBWB 4QZVA 5B2ZA 2C5SA 1PV2A 2DPLA 3ZLTA 3F9RA 1YL6A 1NN0A 3H5WA 4NY1A 5HFAA 1AHHA 2DKOA 3WV4A 3BF7A 4D0SA 1J20A 1JAHA 1HTBA 4ZO8A 2K5UA 2YNMC 4RD2A 4MRAA 1EPUA 3L1VA 4Q4DA 4U7TB 1JF8A 3LPLA 4F2GA 3EFBA 5C8YB 2I8LA 4JXXA 1YS4A 2RHGB 2AFIB 3I9NA 3CNLA 1BXZA 5DGXA 4AZ3B 2WHRA 2JIMA 2XYPA 4RACA 3AL2A 3CRVA 3G2PA 5FOWA 1JBQA 1ND5A 1XRQA 3A32A 3I6ZA 5I01A 2G88A 1FRVA 3QLUC 3WGJA 1CQWA 1LSUA 4L15A 3X2ZA 3KYCA 5JS6A 1Z37A 1IDN1 5LP6A 2G17A 2QF7A 4YMUA 4XB1A 1AM4D 2HQRA 4BKQA 4O3FA 3D4NA 1GPWB 5U1PA 1XZGA 7REQB 5BSFA 4BNYA 1GTJ1 3TB4A 1ACLA 1DFGA 1ELOA 1Z7WA 2WJYA 2X5NA 1DKLA 3TZ6A 4F4HA 3FAKA 2GXUA 4FFBB 2ZIAA 2Z56A 1ZSNA 3MIZA 2NXAA 3A4NA 1KOFA 1GPUA 2PBRA 4AG6A 1DG1G 2CSUA 4W9MC 1AN9A 1Y5RA 4D56A 5DHUA 5J4LA 2ADMA 4GGMX 3MJ4A 4EFMA 4Y9RA 5IF3A 4BNNA 4B3BA 3SNKA 1USGA 3QMPA 3U1VA 1GL9B 1PD0A 3NJ8A 4Z0NA 1JU3A 5CDYA 3VJRA 4IDNA 3R7FA 1H2BA 3LW7A 2P35A 3PEYA 1JVBA 3ECCA 1MTOA 1U1FA 1W47A 3R6TA 4MRRA 4Q3EA 3MNFA 5DYNA 3TLKA 2GN2A 4CKEA 1Y80A 3KQKA 4H15A 3OLCX 2IYNA 3RS0A 2H5IA 4G65A 1ECBA 2JI8A 5JAZA 4XARA 2OXTA 5TARA 4DGSA 4DCTA 1OTHA 3B9BA 3MTGA 2R68A 5AYVA 2OBNA 2EG9A 1NVGA 3L8HA 1NRWA 4GHWA 2BMVA 4M1ZA 4UE6A 4AZWA 4LZZA 4B2PA 5C31A 2XZOA 3F3SA 3AUSA 4K6HA 1NF3A 3P4UA 3SE0A 3OQOA 3H3EA 1D8AA 1SUIA 2BE9A 1FRZA 2VTKA 2Q7XA 1Z0FA 2DUMA 2GD1O 2O2XA 4LYGA 2IF2A 5JJBA 3P0FA 1JFLA 1NULA 1ZEJA 3ET5A 3JQFA 4Q1CA 3WNCA 5HUHA 1WMSA 1V8OA 4FDLA 1Z17A 5IVKA 3CF6R 2XOXA 4RV9A 5DNVA 3H9UA 5JALA 3U6BA 3G88A 1IE3A 3M5CA 2X0EA 2I6UA 4ENVA 2FRVA 2HW8A 1L5OA 5A5EA 1SD2A 5KMGA 2Z09A 1RVDA 3THSA 4P7JA 4IHJB 1IRIA 1NW8A 2C3UA 3FTDA 4L9WA 3IULA 4NU5A 2IBMA 4ZAVA 2ZEJA 3IOMA 2Y1KA 4F3KA 3JQ6A 5JYEA 3PCRB 5LZ2A 4O4IF 2Z8YA 4O4JF 4WOPA 4XEUA 1FIUA 2JFXA 5EMHA 2HOQA 2CLMB 1E1DA 2CDRA 2VP3A 4UAVA 5EAIA 4UBQA 1W4ZA 3GJ8A 3PG5A 2W43A 2RGNC 5EJGA 4PPQA 1N5OX 2IXAA 3SICE 3HP7A 4UFPA 4TYTA 1M5RA 2FTKE 5HR5A 1B00A 1UPFA 3M83A 2OBBA 1M8PA 3OZFA 3IHTA 2XQIA 2PSSA 4J4HA 2AZXA 4K9LA 3AEUA 1U2ZA 2MR5A 4GE0A 2PMWB 4OKIA 2VDJA 1KAMA 5B7NA 4AECA 4Z0PA 1XJ5A 2IGTA 2R6FA 1RTTA 1UDBA 1UMCA 3C24A 3FZYA 3HNRA 3QWHA 4JZYA 4KPFC 1M1ZA 4RZHA 4V0KA 1E5VA 3B2QA 2QZ4A 5DO9A 3U7EB 4LOIA 2NUAA 1MLDA 5IAOA 5KYYB 2VW8A 4AO7A 1T8YA 4LVNA 4EPTA 4U6QA 1HDYA 3CW8X 3A8TA 3MGKA 3OPYI 2ZJ0A 5KAMA 3NP9A 3G5UA 3HJFA 3EYAA 5K0FA 1VHDA 1BS9A 4NBWA 4BO2A 2BEUB 2JKVA 2ZT7A 3I8XA 3ORQA 3QF4A 2YNVB 1TFUA 1ZJYA 1Y7PA 1C0KA 2B25A 2C1ZA 2PPVA 1NPYA 4XSVA 2Q9BA 2H48A 1T91A 4QEKA 3TUIC 1J0DA 2PXXA 3A3KA 3C4VA 1E64A 1MEEA 3ZK7A 4BFCA 4PWYA 2EP7A 3BE5A 2R6GA 1Y6QA 1RKXA 1QK5A 2OAGA 3UAOA 821PA 1SUPA 5JDIA 4U2KA 1D5WA 5KNDH 1EXWA 3KVVA 4KXNA 2WYLA 5ADWA 1U9YA 3MPUA 2W2LA 1A7UA 3BE8A 3PJEA 4IJUA 4ZNBA 1ZAYA 5EXSA 5ALRA 4YV0A 5KKNB 3N2KA 2F2TA 1BWRA 4FD3A 3E9NA 5JO9A 1IHOA 2BFNA 2FRXA 2FR0A 1AQYA 4KZKA 1O9HA 2ENWA 4Q3BA 5ILGA 2QUAA 3HN2A 3Q3CA 4LBZA 4UHHA 1P19A 1YMVA 2JGKA 1DEOA 4UPDA 4YRNA 4Z49A 1VJNA 2VT3A 4B6EA 3WLIA 3OURA 4IDDA 1E7YA 1UEIA 1ZGCA 3IAM6 4UUOA 5B1SA 1P3JA 2AG8A 4KNYA 1EFPB 2ZBGA 3DFKA 3QQ5A 4ZYXA 1QHHA 2XRFA 3A6HA 2XGSA 4BC0A 1P8JA 1JILA 2QMQA 1PW5A 4H1HA 4I4CA 3VR5A 1UJBA 4ZARA 4QHTA 3W77A 2BGGA 2GHIA 2JFVA 1CIVA 5TVGA 5BXYA 1GGHA 1H9CA 2HL6A 2WMNB 2FU9A 3LL7A 2P9GA 4EUHA 2O0LA 2CZCA 1EFCA 5A87A 1N7HA 4LRTB 5FI1B 4PM4A 1GD1O 2YV2A 2G5PA 1L4EA 3GD5A 2H1WA 2PGIA 1DINA 2YWXA 4RMNA 4CF5A 4DC1A 2GA9A 3IVXA 1DIOB 4Z9AA 1VSBA 2X13A 4JI5B 1LBQA 4DCCA 4F3TA 4G0XA 4MHSA 2B8JA 3N05A 3S2ZA 5B58C 4RKFA 1PJZA 4NCXA 2VZ8A 1XGKA 4G9BA 3WYAA 4AX0B 4NBNA 2XOKD 5KJ6A 2VH2A 4XM1A 3VSEA 4EYQA 2O8BB 3ILHA 4JENA 1EB8A 2WAOA 2YQ4A 2NZ8A 3ZKWA 5AM1A 4D5EA 5DYIA 3U48A 4PG5A 3R23A 4R6XA 5IS2A 4K6FA 4U7WA 3WWDA 2P3QA 1XLTA 2XGOA 4C04A 1K7YA 3LBHA 3BB3A 3QLJA 1KO7A 3QVGB 3K70C 5BV8A 1R9NA 2HEGA 4Y7DA 5FO0A 1B73A 1LVUA 3DL0A 3NDBB 2ATIA 2A9VA 1DLJA 3W1EA 5AW9A 3N07A 1KJQA 1QRRA 1O0CA 2JVKA 3QLTA 4J7XA 2TMDA 1M6VA 4YFYA 4EG7A 5CFQA 4DVGA 1QIJA 1OI3A 1UAYA 2P40A 3GLQA 3KDPA 4ENSA 3E0XA 4DZZA 3AF3A 5C8VA 1IUPA 3R3JA 3VNUA 3S0ZA 3LFUA 2P41A 4M8IA 4S2UA 1BJKA 5FPQA 1EHYA 2R8EA 5JY6A 1GNSA 5CXSA 5FUYA 4P4UA 2AMYA 1P1IA 2C9BA 3DLTA 3E9YA 1A8PA 3K9WA 3GVIA 1QG6A 4NP6A 3AUUA 2E89A 4GUAA 2GNPA 2W8BA 4OQLA 1ZZEA 4MMZB 3IA2A 4CQNA 4DTCA 3S5JA 1BJTA 1QVVA 1XLVA 1E9BA 1H3FA 3ASYA 4R1OA 4RM2A 4LZJA 1XTPA 1P74A 4YSKA 2DTDA 3HVHA 2XGJA 4A8PA 5K6AA 1S1CA 4J8PA 1K4KA 1ZC4A 4IDEA 1YRYE 3OTQA 4X3CA 2JIOA 3U7RA 3ZHQA 3BGDA 8GPBA 2ZRJA 3GJ5A 4NCIA 2X6QA 1BE8A 3GRZA 4NBVA 5K0BA 4KACA 3BVPA 5M04A 3TMYA 3X2YA 2IVFA 2OILA 3LLVA 4ML3A 3VH4A 4DHEA 2BVNA 2XNJA 4G3XA 3RC3A 4QG3A 2XCUA 4LCBA 5C80A 4AB1A 5K0ZA 3ZW7A 3TF5A 3NTVA 4AMVA 4PZYA 1QE5A 4PAGA 4JP2A 3NM6B 2FMKA 4DR4B 4C1DA 3GA7A 2VPTA 4PVCA 2JGIA 2R00A 3L9WA 4GI5A 1JX6A 4P08A 3AVUA 4KVFA 3FOWA 1M2GA 1UJMA 2ID9A 1LPOA 3SHTA 3B12A 5LMCA 2OFOA 2FRDC 3RANA 2RH4A 2VTDA 4PV7A 1MVNA 2DP4E 1Q1EA 5EIBD 3W3ZB 4EP1A 5AIBA 3GVCA 5LMUB 3UT5A 3N58A 4P7FA 3V4SA 5H83A 3PNVA 1EDEA 4TXHA 1XCJA 3OKPA 4NCBA 2CLEB 2IYUA 4PHHA 4RFSA 4HXYA 1SUDA 3Q1KA 3NB0A 3ZZTA 1U0BB 4KEPA 2HK6A 5M34A 1T0UA 2Q7DA 2C7QA 2AV6A 5BN1A 1M7HA 1DAEA 1OFGA 1XP5A 4S1VA 4AF7A 2VKQA 1F2DA 1L5QA 3D8SA 4AAYA 2ZYAA 4ZOLF 5KNCD 5IK2A 3EFEA 1GA1A 2IPMA 1K66A 3QBDA 2VSNA 2BEKA 4NZNA 4PYKA 2UYYA 2UYGA 4KE7A 3UY4A 2HU7A 5H8WA 1EG2A 2EJTA 5IUJC 3GRKA 3EYWA 4R31A 1ID8A 1RNLA 1N2GA 3JSXA 3NHKA 3WWEA 1KA9H 3UK0A 1HNXB 3BWEA 2JLYA 3NJRA 4NBTA 2GNAA 4TKUB 2AW5A 2HSDA 4ZT2A 2O48X 3IQDB 1YDFA 1V1MA 4FDTA 1OA0A 1ZYUA 4IOJA 3COJA 1G3RA 3B82A 1J2RA 4M54A 4BAZA 1Z7BA 5ALMA 5E7MA 3BH0A 8ABPA 3TE6A 1JKJA 2ODBA 3RWBA 3VZQA 4H6VA 1HYEA 3TLYA 1ZD1A 1PJLA 4M55A 1Y48E 4XR9A 1GT6A 2Q7OE 2CT8A 2IXTA 5EYPB 1XTQA 3EGIA 3F5MA 1RC1A 3BFJA 3RAJA 1QB7A 3GUCA 3H5LA 5KWJA 1T3HA 4YWHA 2WC1A 5KTNA 1TAQA 4HSGA 4DG8A 4K8OA 2ZWRA 5HILA 1JMKC 1GZ7A 3HUUA 1SU6A 3BXHA 4X0EA 1J8MF 4K9PA 4X93A 2Q29A 3OE7A 1N1EA 1YIDA 2CXRA 3FKQA 3MS7A 1DPGA 3DHWC 3RNLA 4P0PB 2JF0A 4K28A 4LRXA 1YU6A 3IE1A 3P2JA 1X8GA 1NQTA 1ZM9A 3G9UA 3LM8A 1OD6A 1XP8A 1ZA1A 2HM7A 3F6YA 4XB6B 4E0BA 3O4RA 3WLSA 2ECPA 2GXQA 5IK2D 4ALJA 2XRMA 4N5IX 4ZIRB 2PGNA 5J2TF 4BCCA 1W73A 2X2FA 3DOEA 1C41A 3HP4A 2QTHA 3K9CA 3LWBA 3TW8A 1BX1A 4A26A 4HG2A 3GUVA 1U7UA 3Q7PA 1PFUA 3FBGA 4MWOA 4NKRA 1MUUA 3QUQA 1XEXB 2AN3A 5L3ZA 4MS4A 1PYOA 3SBDA 2QX8A 3W5BA 1ARZA 3P9ZA 2F1RA 1V16A 1JEDA 4HNUA 4QSHA 5AJWA 3OX2A 1AQUA 3QLUA 4HDMA 4LIPD 2BTNA 4HR7A 4GMDA 3RYIB 4B5KA 1N2SA 1ZCFA 5EEHA 1NVDA 3R0IA 1VYHA 4AJ1A 1K08A 4J94A 2IHZA 1PR0A 4KREA 4UNRA 3EFHA 3RVLA 2YNMA 2FVXA 3A4TA 4YPVA 4E4TA 1OZAA 5E1BA 1GSAA 1PN3A 2XWPA 4IMIB 3MSXA 3VC7A 2OGZA 3HJBA 4UU0A 4KQEA 2FPXA 1DJOA 1NZDA 3CVOA 2J3KA 3MIIA 2QXYA 4XA8A 2RARA 4N3CA 1RC0A 1K8ZB 4NECA 3T1HB 3PUXA 3DDOA 1E2LA 1T3LA 2C8LA 2EJUA 1BE1A 3H4IA 3PHJA 5E9JA 4BNZA 1WW2A 2ZOSA 2VEDA 4DCSA 2JIZD 3WHLA 2GESA 5EP3A 3LT0A 3LVBA 3AB3A 4CMBA 4P4NA 5CFPA 3BOSA 4KQ2A 4RESA 4BVLA 2M5CA 1CUFA 1SBZA 2V7BA 4MA5A 5IH3A 4JJIA 5BXQC 3AVVA 3HLKA 1IN4A 3HXOA 4LKOA 4O2LA 2YN0A 1JEOA 2NU6A 1RYZA 3MXTA 3JVEA 5TX7A 3QE9Y 3QF7A 3NHAA 3PGXA 4EYLA 4MHTA 2PIDA 3L04A 3ORSA 4XOIA 3DM9B 1F6BA 1U7HA 3BJMA 1ITZA 3HCPA 3E1GA 4HNVA 3VOSA 3KEQA 1E1YA 4G09A 1YFLA 3ESBA 3SSMA 3TDMA 4XVUA 2Y05A 2H00A 3ZJUA 4PCUA 3SEFA 1GGKA 3MCAA 4XTRA 4ZOLA 1QZZA 2DLDA 2FWIA 2QY9A 3I13A 4FXOA 2GS9A 3UT5B 3OTWA 3A3OA 2HCJB 4OHMA 2WG1A 4J9VA 3H87A 1EYZA 2R6JA 4FPXA 1TZKA 3BIFA 2WQ6A 1Y33E 3CSSA 1NFFA 2GEJA 1MNAA 1OTYA 2PX6A 3F47A 4IDPA 1SCUB 4HBZA 4E70A 2YS6A 1JHOA 1VDZA 3BE4A 3FZNA 2ZT8A 3HO8A 3NBMA 3AH8A 4DR7B 3KT6A 1RWQA 1W35A 4S0ZA 1H1TA 1QGED 2EKLA 2Q1TA 3IDQA 4D02A 4B3GA 2AYZA 2CZGA 3B1JA 1T8WA 3TLCA 3O2JA 1C3JA 3WK8A 4G5HA 4QREA 1WV0A 3KJNA 1DADA 4KHZA 4BEBA 2BMFA 4TTAA 4BJ1A 3F78A 4YJKA 1DO8A 2BTOA 1XCLA 3QEMA 4FWIB 4BE9A 3RROA 5DK6A 2E55A 5BR7A 2R2GA 3SVTA 4GSYA 1KYWA 4FCTA 2JAOA 3IOFA 1YJXA 2OO5C 3EZYA 3ZQ6A 2GF0A 3SLGA 3UK2A 3S8EA 1CF2O 3UNXA 3M3PA 1SRQA 4XX1A 4BO9A 2E4VA 3KWLA 4HRYA 1VYTA 3RVDA 4W4TA 2OM6A 1DNPA 3HUTA 2DXIA 4AS1A 4FN4A 1UQUA 1R4MB 2R87A 3O31A 3ZWOA 3FFAA 2O3JA 3REQB 3E70C 4CLOA 1PDWA 4ON9A 4LRUA 1ZO8A 1XMSA 2HLPA 3LECA 1CZUA 4MS3B 2V59A 2D1FA 3D02A 4RQTA 5DRTA 3ZLVA 6AT1A 4PYJA 1D2HA 1RWMA 4B83A 1QXSA 3E7WA 4AYXA 1IG3A 1PQ4A 2D2EA 2WIBA 3ANXA 4HYYA 2ZSDA 5SZIA 4Z4CA 2QN6A 1M2EA 1BEZA 3KJFA 2AN5A 3B6ZA 5AK0A 3GPCA 4R1LA 5ER6A 4XCXA 4KVAA 4ASUD 5C37A 4ZOEA 3B6JA 4YS6A 1C30B 4FNAA 2BRUC 4G4IA 2R8YA 3FTFA 4TV9A 2OO5A 1SEPA 4MWBA 3MCUA 4RLFA 4CM8A 2JJ1A 3IPXA 1X0XA 3WL8A 1I2CA 1U1DA 3GD7A 3KQHA 2QTAA 1FBNA 2FPPA 2ZJ8A 1OT5A 4GF5A 4REQB 3BGSA 1V26A 4QECA 1F3LA 4QD3A 4EYBA 2P5SA 2QAJA 2WYOA 2C1EA 2P3OA 3LXMA 3NHPA 1KMHB 3FLEA 4NMHA 4MVJA 4P22A 2ESRA 1EBFA 4WASA 4UU1A 3Q6IA 5KOYA 3TW0A 2CJWA 2ANBA 4C08A 1YS6A 1AVTA 4LNHA 3DE0X 3ROFA 3LHIA 3N0RA 2XDQA 5AW6A 1JSRA 1Y7HA 4ALNA 2OGSA 2UUOA 5FPTA 4JSTA 3DMHA 3HFGA 3RVNA 3UAVA 3HLTA 3BREA 4L8VA 5FEUA 2IYYA 2KS6A 2X3UA 4OD0A 2UUBB 2FPGB 4JLNA 4QBHA 3SYTA 4AD8A 4GCWA 1A7JA 1BRMA 1T5DX 4U0JA 3WIOA 4DMRA 1SCDA 5CJPA 3FN4A 2G9VA 2VJYA 1TU4A 1P0MA 2BFLA 3G0GA 1ZHHA 1ABBA 3N75A 1G8HA 5HIQA 1I0IA 3S55A 5BOSA 4D4GA 1VZ2A 2CWWA 1VOTA 4A0GA 4RHFA 4KDRA 3QSGA 1ESDA 4KU4A 2F00A 4N1AA 3OCCA 4F9TA 2JIBA 3PL1A 2MMGA 5GVRA 3THYA 1PVOA 1VA5A 1RYMA 2NZVG 5F9FA 1G5PA 4WN3A 2QUBA 4WKBA 4ZMRA 1VKRA 3OM9A 3E5HA 4FC7A 1O8BA 4MQ4A 2HHHB 3L7NA 3M4YA 1GZUA 1LX7A 1WU8A 2V03A 3OETA 4FYHA 4GX0A 4H7JA 4X20A 5DP1A 4GYWA 3LXRA 1V96A 1JSLA 4CM4A 1Q3KA 3ZV7A 1IJKA 2P69A 3SI7A 3CWQA 1UJ4A 3OH8A 3ZXYA 1I2BA 4BWYA 1DJMA 2E4XA 3QKRA 5LLTA 4QYSA 3T38A 5I7VA 2NN3C 2WTAA 2IV2X 1G98A 2R6HA 3D3JA 3GCGA 2ZO4A 3R3YA 2FUEA 1F14A 2KBEA 2G28A 1GG5A 4J07A 5G4KA 3TVTA 1Z4NA 1R0ZA 2BUAA 4OXIA 3OC6A 4CFZA 1JYFA 3DZDA 2XPCA 4EF5A 1JJEA 4DHWA 3KTAA 2XOKA 3UMSA 3BD7A 3RHFA 5JI3E 4YJ3A 2O23A 1ZGGA 3LA8A 4LSZA 3AP1A 3Q5DA 3D9QX 2FV8A 3BXOA 2ZRCA 4FONA 4IWXA 3VYSB 5CPFA 4Z5YA 3IVMA 3FWPA 3KSAC 5HIOA 1I32A 1VJGA 5KEIA 1QB8A 1CUIA 4QJIA 3LT1A 1MIHA 1DKPA 1E2UA 1NU8A 3KAQA 3ONFA 1XVLA 4F6RA 3OMXA 4NHOA 4LF9B 1FQWA 2F67A 2HIGA 3UK6A 1KMCA 2BZGA 2GUGA 4R1PA 4YQEA 5B57C 1T0HB 3IKJA 3SRXA 4K88A 2H6EA 3OIYA 3W2GA 2QLJA 4BQFA 2CJPA 3LPAA 2GN8A 1IAVA 5FWXB 2Q4RA 1HFKA 3K1ZA 4OV6B 5K8TA 2VF4X 3EZFA 1JDZA 4XIJA 1NR1A 2RK3A 5DULA 2GN0A 2VOEA 2NZFA 3D2CA 1JQBA 4K7JA 3SAJA 4BFTA 3E4CA 2NO7A 2V7EA 1FYVA 1WE2A 2KYRA 1AZSC 3BMQA 4E22A 1WPQA 2H4FA 1DOHA 3HWSA 5LR6A 5T67A 3EJWA 3C1OA 1IQRA 4QFCA 1U8ZA 4GR4A 3UVEA 4YRBA 3CU5A 5KHLB 1E3SA 1VSUA 1PHRA 3O3NB 4GD3Q 2DPGA 3R6WA 5CURA 4HAZA 3EIXA 3OE1A 2YVLA 3H2ZA 3IP7A 2GJAA 5L3VA 2AZMA 3RVPA 1RKQA 1QSGA 3H8VA 7ABPA 3FZQA 2V7PA 3DYBA 3ZW9A 2WIKA 1JWAB 4YXWA 4UWPB 2X0DA 2PAAA 4LF5B 4LC9A 5IXJA 4LY6A 3T5TA 4UOZA 3VVCA 5LLDA 1R18A 4R0MA 2ZRFA 3B8HA 4PF1A 4PLHA 4N8SA 2CLDX 4MR8B 2NU9B 3UJ9A 2B7LA 1F48A 2Z4TA 3G8YA 3M34A 4QGHA 3VYWA 3R2UA 4NL4H 3DMTC 4WZBA 1OB2A 5EWMB 3QOWA 4DCPA 4P7KA 3DTVA 4EFDA 3BMNA 1C0EA 4BL5A 1IEWA 2K7ZA 2V96A 4HJXA 1BWQA 1Q1ZA 1U99A 4FVTA 1J0XO 2IU3A 1OBFO 2WFLB 3D8RA 1XJ0A 4D9JA 2GCOA 3F5DA 1GPDG 2B61A 1W49A 1QAOA 4W9RA 2AYYA 2VDKB 2WA1A 3T9FA 3ZWQA 4CFYA 4EEKA 2EBHX 3QIVA 4EUFA 3NBXX 4OHVA 4DYDA 1J1ZA 3SC3A 2BISA 3IP8A 1W2GA 4LCJA 2I91A 3I8SA 3ZH2A 2HRQA 4HB3A 2XIJA 2O50A 4JDUA 2X1LA 4WCFB 4GLOA 1Q20A 5K1ZA 5HCIA 3IEPA 4MW9A 2QXUA 4RF2A 5FWYB 3RCBA 3SMVA 4MPRA 3A31A 1QORA 1X15A 5FIUA 2HJWA 2Y0CA 1QX3A 1CERA 3PXEA 2WWXA 4BE4A 5C1OA 3FPJA 5EFZA 4XYGA 5L4LA 4CBVA 3FCCA 3RF6A 4FHCA 4DIDA 4PR0A 3RVJA 3UYLA 3VMFA 5KX5F 2PX2A 4F92B 1VM6A 4I3GA 5AVWA 3COSA 3RYCA 2I2FA 3WGKA 3V8RA 4KJZA 1FMFA 1PZNA 4F97A 9ATCA 4U02A 2PUDA 1X7XB 2PU5A 1IY0A 2EYUA 2R25B 5D6NA 1GG8A 4MV6A 4JLJA 1TF7A 4QYWA 4EZBA 2GERA 4NG4A 4GPBA 3MUFA 4NK5A 3VU9A 2OOSA 4F4FA 1OU0A 2R6ZA 1MIOB 3PEFA 2OSVA 4OBXA 3C5VA 4DQLA 1KIMA 4F96A 2A84A 2I62A 2QX4A 4X63A 3HDHA 2GYUA 3N5KA 5KTTA 2X0IA 2XUIA 4P3PA 4YYEA 5F1YA 2P7HA 4TLBA 4R2MA 1YONA 2Z4RA 1GPKA 1V1JA 2OWDA 3AHIA 3CUSA 3U7QA 2Q0JA 5DM0A 1A7KA 4OI0A 3R2JA 2YXPX 2QZSA 3TI7A 4CR7A 4GU5A 1HQYE 5ALKA 1Q6YA 3ZU4A 1L7NA 1S02A 2FUCA 2X2EA 3L7BA 4HADA 4PFKA 1Y1SA 2EV9A 4OHZA 5C7YA 3V7UA 2I9KA 2A5GA 1RWPA 2IY9A 1C29B 1TMOA 3U3RA 2RG1A 2IHUA 3AC0A 1NBAA 2Q6IA 3HMQA 3KR1A 3RQSA 3BL6A 5I47A 3PKZA 3KIPA 4LGCA 1OUMA 2IHBA 3N6VA 4EVIA 1K9VF 1AT1A 3KQQA 1EFHA 1ZINA 3EIEA 1OLUA 1QX4A 1KDPA 2W6IA 4EG1A 3O0DA 2ZWMA 1NVFA 3MJHA 3NIDB 4O2BA 3DDCA 1GV1A 3ZHXA 3VAAA 4LHYA 4LJ4A 2GZ1A 4TN1A 4E3WA 2EZTA 2AMFA 3WQHA 4F21A 3OJCA 1UBLS 4EKDA 1XRPA 8AT1A 1UDRA 3TIIA 4IRMA 2FEMA 1GILA 1JG2A 3ER6A 4YJ3F 3VV3A 4LXGA 3DV0A 3H1TA 1X8LA 3E5RA 4EG0A 2XCLA 4AO8A 4OCZA 3E9ZA 5DNDA 3I45A 3KQOA 4JOQA 4ANFA 1U2QA 1JHVA 1SURA 4B47A 1I24A 2YWDA 3U19A 1C50A 2L18A 2P4UA 3PS9A 3UMMA 1G59A 4DMKA 5IX8A 5B3KA 3LBAA 1Q57A 2FSHA 3BUSA 5JFOA 2FZ5A 3BK2A 3NAZA 1D2GA 2XCTB 2OP0A 2EZ9A 4JI4B 1VIVA 3BQMB 3TJZA 4DJJA 1M54A 4F6HA 1TK2A 1QCYA 3BGOS 4WZAE 3I9V1 1JT1A 2C5EA 4IGKA 2YC2C 2QYTA 2VAMA 5E4JA 1ZK4A 1QH0A 3Q3GE 4N4AA 2RDMA 3I52A 4RCVA 1Y5LA 1E7SA 1R5OA 3ANSA 2D1QA 2VNAA 1GXSA 4FMPA 2YOFA 4EI8A 3D3EA 5LNK1 2QMYA 2O3TA 4GBJA 4RMJA 4I36A 3L4BC 3ZV6A 1B6SA 2YINC 3PUIA 5B55A 1I30A 1EJBA 1PIWA 1QTIA 4MW5A 3RG8A 5D5PA 2WTNA 3BQNB 4XAQA 4O1IA 2VKTA 4RTQA 3SQNA 1PDVA 2ANCA 1A8SA 1M2OA 3K20A 5TQ2A 3T7KA 3QWAA 1MC4A 4CKBA 5LQMA 4QU8A 3W8RA 3TD9A 5JDIC 3W5DA 4C7VA 2HF7A 3QVKA 5CTJA 4YCSA 4Y6SA 1ZICA 4BLQA 4LN1A 3Q41A 4KRGA 4ZT6A 3R3SA 4CR8A 2X4LA 4J2HA 1SBCA 5H7XA 4CQLB 5HRAA 5L8VA 1J97A 2XB9A 4UUQA 1I1HA 3UAWA 1IY1A 5CCXA 4UMVA 4RZ2A 3ZLBA 1W59A 2SHKA 4U2GA 3A1DA 3HYRA 3KAPA 3LLMA 1ZLXA 2KBFA 4LGYA 3LQRA 1DAHA 1X70A 4Y2JA 5LP6F 4B79A 1JIXA 3SZUA 2FDCA 5FYDA 1AURA 5EQDA 1K1EA 1RWBA 1HLGA 5F33A 4X85A 4OOFA 3UATA 2CBZA 1F2TB 2BBWA 5LBTA 3ZU5A 3ZZMA 1IRXA 4F38A 1RXEA 3URMA 1YCGA 4DBZA 4MQ5A 1UK6A 2IX9A 2WF5A 3DCIA 1Z63A 2B8WA 2ZAYA 3PUHA 3RBXA 1BS1A 3CH5A 4WKCA 4F4JA 1YBAA 4Q1AA 3SBOA 2C9CA 2XKBA 3LFTA 3DMRA 3NFYA 4TS4A 4P33A 4PSAA 2Q9UA 4I08A 1VB3A 4O4HB 3PFGA 3WWPA 4BFZA 4CM6A 1EA5A 1LBSA 1YK1A 3PIIA 5GJBA 2DPMA 3DTVB 5KDOA 2D7DA 1PFGA 2RGNA 5ARBA 1SIOA 1T1JA 4JKYA 4V02A 1P0FA 4X41A 4LF6B 4EVQA 1FU7A 5EXTA 4GVPA 4H6WA 4LYAA 1I2DA 4C2UA 3O8QB 1KRWA 3RS7A 3TO5A 3FTCA 1CJBA 4W5OA 1DWPA 2O8NA 2Y76A 2P8SA 3PNPA 5G2OA 4AY6A 4ENTA 3ROEA 2PMBA 3L0DA 5BYAA 1XYYA 4DE5A 4J16C 4MRVA 1LLCA 3QENA 4DNFA 4CKWA 4O4LB 2R7KA 4INOA 3A28A 3B9PA 4OHXA 1DMSA 2PGDA 3BWMA 1IOLA 2VHVA 3DAFA 1SD5A 4V0NA 4C6HA 5BWCA 2OCAA 3G5MA 3V4RA 1SBIA 1HV8A 2CZQA 2E49A 2QP4A 3RSLA 2ZCJA 2QINA 5LQUA 2B0JA 2JIQA 2FSFA 4Z2AA 4AJEA 2QJRA 4DUZB 1XKQA 5F21A 5LU8A 4ETMA 1VGNA 1DT3A 1OASA 3L7DA 4QL3A 3CR7A 3I01M 4JH0A 3JQFC 3RF7A 3MWYW 4UHDA 4JSRA 4CTNA 3LOQA 4CEJB 1JHUA 2CNBA 4I6JA 4JJEA 1G5HA 1QHEA 3RYCB 2XTZA 4JQCA 5LQDA 1SEVA 3IKLA 1V4BA 1EX7A 1T2CA 1FFHA 3R20A 1P4HA 3WIBA 2G9ZA 1YA8A 1YJQA 2GBPA 2BKLA 2QYOA 3BRSA 2C7RA 2B98A 4NYIQ 1E3TA 2PFKA 2RBGA 3L6EA 4PE5B 4JP1A 4Z54A 4K3UA 2UZIR 4ZO9A 5F64A 3HKDB 1WUYA 3O4VA 5JJCA 5MN6A 4QIHA 4XUEA 4D57A 4PU0A 4WNAB 1AUVA 3KZNA 2HTEA 3GNSA 4MEAA 1OVGA 5AHXA 1L5VA 1VJ1A 1T0JB 1XA0A 4JGIA 2EERA 1FK8A 1LVGA 4RULA 4K6GA 2X4GA 3W6OA 1IMOA 2Z8YM 4BRWA 2AN1A 5CT8A 4C4TA 4D26A 2HLDA 3IEMA 2ZJYA 4H18A 5H82A 4LMAA 4OSEA 2R48A 3RU2A 1NR5A 1JG4A 5EGNA 2GWRA 2Y4OA 5KJEA 3PHLA 1M6NA 1KJWA 2ZUUA 3ZHUA 5BRJA 4IRUB 4PRYA 4H7EA 1KFEB 2JJMA 4BRSA 1FVHA 1Y8QA 4Q02A 3S5UA 1O95D 4QTZA 1E9SA 2Q4DA 3SKVA 1ULTA 4GG1A 4LJRA 2NPIA 3ASVA 2QTNA 2OM2A 3HCOA 4UM8B 4I4TA 1K5GA 3NU1A 3QPDA 2Z9CA 2HNKA 4CWAA 3ESQA 4IBOA 3WGOA 2H54A 1W75A 3H4MA 4MSUA 1NVXQ 3OJFA 3S2GA 2VHYA 5IHPA 5E3JA 1PD1A 2FJPA 3E1KA 3V1NA 4LDNA 5BURA 3LC0A 1DS6A 3G0DA 3AEQB 3K0HA 4Q6WA 5BSGA 1B8UA 1QFJA 2GPWA 4DL9A 3ZXXA 4ZFNA 3M4NA 3O2QB 4HX9A 2VEOA 4N8DA 4Q7MB 5TMEA 5JNLA 4FR7A 3HYNA 1HDCA 4YPOA 2W37A 1X7XA 2BY4A 3K0KA 4J7CA 4YT2A 1XD8A 3IMFA 1HE2A 4EG6A 1COWD 1XKXA 3NTLA 4RMGA 3VPCA 3EUFA 1Q1QA 3LS2A 2H2IA 3D4OA 3T5PA 2R5NA 1WB6A 3R5FA 4L5BA 4F6LA 2XJ9A 4KTVE 1XA4A 4WJLA 1JMVA 4NZZA 3QJ5A 4TUYF 1WETA 3VJMA 4OH1A 4KQWA 3X2FA 3VKGA 2ZRKA 3CX7A 1ZTCA 2XQFA 1T1SA 2RHCA 3GNQA 3NAQA 3BBLA 4KAAA 3DE2X 4R69A 5JSHA 3LX6A 4NYJQ 2ZZMA 2IUYA 1JEQB 3HYCA 5JVDB 3DPIA 2O8BA 1DQNA 1KYZA 1B8PA 1Z6PA 3HA3A 1NLUA 2VA9A 4OXYA 2G4CA 4FNMA 4H3VA 3L49A 4RMHA 4IF6A 3NRBA 4EA8A 2W6ID 2WEKA 1W0KD 5EWAA 2CKMA 3E3AA 2EBWA 4G9EA 3JYNA 3LHFA 4Z3KA 1VB5A 3U2QA 1M9NA 3NT5A 2R86A 2DE0X 3WHIA 2HMVA 2FU6A 1DLIA 3PRJA 2HU5A 4XWYA 4LJLA 3ML1A 4TYYA 3GRPA 3N3BC 3PC4A 3R9XA 4RAWA 3VNBA 3SXUA 1S4MA 1VMIA 3IUSA 3LP8A 5DN6A 5IZ4A 1QYCA 1IXKA 3ROQA 1PW7A 4NAVA 1YRQA 1P77A 2CLCX 1ZRMA 3GJZA 1F3OA 4CKCB 3FMPB 3CCBA 4YRDA 2W2XA 2NAFA 3COWA 5TJ9A 2QUHA 4GM0A 3DULA 4TTPA 2NUAB 1K2VN 4RDXA 5DBOA 5KYYA 1C80A 4IHQA 1L7RA 5REQA 2EL7A 2Q49A 1ZVQA 3D8UA 1M75A 1FTWA 1W34A 2C96A 3ETHA 1ZMTA 3T7EA 3AY7A 4C0QC 2RHBA 3SPUA 2HPZA 3GNTA 2NO4A 4Q4AA 5I4BA 3FYUB 5HF9A 2X76A 2XTNA 3QW4B 4MYTA 3N7UA 4Z8YA 4ZDWA 3WNBA 1KZ9A 4UTRA 1JRLA 1UC5B 1WXIA 3MUEA 3KM0A 4L7VA 4PWZA 5HIJA 2JBWA 4FFVA 4L3WA 4LX0A 2XMCA 3JARA 3I3SR 1CUZA 3FSRA 1TJ4A 1D09A 3NBAA 3EZ6A 4I4IA 3T7SA 2IY8A 4ZKDA 1U8CB 5T3YA 4JB0A 4L6CA 1SHKA 2XLBA 1L4HA 1SK9A 1IN5A 1NI5A 2GMWA 3DBRA 3A3NA 2EX0A 5KI6A 2GN1A 4BFXA 4HL1A 1A9OA 1DX4A 5T7BA 1HNZB 4NWIA 2W48A 5TQ0A 3T7AA 4YUXA 3WJ2A 3WRVA 1YFJA 4OK5A 1DWOA 2N47A 2RHJA 3JSAA 1C1DB 3T52A 1RQ2A 2ACKA 3RBVA 4ZDKA 2VPZA 4UXHA 2YBDA 4YCLA 2PZGA 2R11A 3L06A 4L6IA 3RNOA 2QTWB 4PNHA 4TUYA 4ZQGA 3N6XA 4BQSA 4FP9A 1U28C 4MW1A 2C98A 3HRKA 2P1RA 5CB6A 5AM0A 3MB5A 4HDCA 4MUHA 4P3YA 1R5BA 4ATNA 1T0PA 3HDGA 1NASA 3QELA 4YJFA 5G0VA 2AL7A 3STHA 1LD3A 2VNSA 2AJLI 1HYBA 1YTLA 3FLMA 4LDQA 1O58A 4OMUA 2QTLA 3LHDA 5D3KA 2XVXA 4KYTA 5WRFA 3ADRA 1XN1A 2IXFA 4PG4A 1WP9A 2J48A 4OK6A 2RG7A 3WKCA 5CK4A 1YOVB 3HUFA 4FSBA 3JVVA 3UMYA 3MK31 4JOSA 3AI7A 4QNRA 2ILVA 4I8DA 1Y3FE 1E2FA 4X00A 2X8BA 2BELA 4OJQA 2NZYA 2IXDA 1MRSA 2ZTSA 3PJDA 421PA