2I7XA

Structure of yeast cpsf-100 (ydh1p)
Total Genus 158
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
158
sequence length
717
structure length
499
Chain Sequence
b'MTYKYNCCDDGSGTTVGSVVRFDNVTLLIDPGWNPSKVSYEQCIKYWEKVIPEIDVIILSQPTIECLGAHSLLYYNFTSHFISRIQVYATLPVINLGRVSTIDSYASAGVIGPYDTNKLDLEDIEISFDHIVPLKYSQLVDLRSRYDGLTLLAYNAGVCPGGSIWCISTYSEKLVYAKRWNHTRDNILNAASILDATGKPLSTLMRPSAIITTLDRFGSSQPFKKRSKIFKDTLKKGLSSDGSVIIPVDMSGKFLDLFTQVHELLFESQVPVLILSYARGRTLTYAKSMLEWLSPSLLKTWENRNNTSPFEIGSRIKIIAPNELSKYPGSKICFVSEVGALINEVIIKVGNSEKTTLILTKPSFECASSLDKILEIVEQDEDGKSFLCDNYISIDTIKEEPLSKEETNFDNLDYLKIDKTLSKRTISTVNVQLKCSVVILNLQSLVDQRSASIIWPSLKSRKIVLSAPKQIQNEEITAKLIKKNIEVVNMPLNKIVEFS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein CFT2
publication title Polyadenylation factor CPSF-73 is the pre-mRNA 3'-end-processing endonuclease.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein, protein binding
total genus 158
structure length 499
sequence length 717
ec nomenclature
pdb deposition date 2006-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16661 Lactamase_B_6 Metallo-beta-lactamase superfamily domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10890 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2i7xA02
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 2i7xA01
1WW1A 2BC2A 5A5ZA 1WUPA 3DH8A 3IELA 4TZFA 3S0ZA 2YNUA 3T3OA 3KNSA 4B87A 2YNTB 4RL2A 5K4KA 4AWYB 4C1FA 3AF5A 4D1UA 5KILA 4GCWA 2XF4A 5AHRA 1K07A 3X30A 2VW8A 4YSKA 3A4YA 5AHOA 2WYLA 2Q0JA 5LCFA 3H3EA 4TYFA 1DDKA 3ZWFA 5B15A 1JJTA 5ACPA 1VGNA 2BG8B 2QDTA 2YNVA 1HLKA 2ZO4A 4YSLA 2CBNA 5ACWA 2XR1A 1X8IA 1BC2A 2BIBA 3X2XA 1YCFA 5ACVA 1BMCA 1L9YA 5K0WA 3VQZA 5LSCA 2FU9A 4RAMA 3VPEA 5HH5A 4C1EA 2A7MA 4Z60A 3ZQ4A 4UBQA 5DPXA 4AWZA 4Z6XA 4U4LA 3QH8A 2BFKA 2BG7A 3FAIA 5EWAA 3BK2A 2DKFA 2NZFA 4ZO3A 5KIKA 2I7TA 1DD6A 3BC2A 1XM8A 1MQOA 2I7XA 5K4MA 4XWWA 4D02A 4C1GA 4EXSA 3T9MA 5AYAA 4TZBA 4UWPB 3SD9A 4J5HA 2Y8AA 4FR7A 4Z5ZA 1VMEA 2NYPA 5LCHA 4FEKA 5LCAA 2GFJA 5ACQA 2YNWA 3PY5A 3PG4A 1M2XA 4Z7RA 5HH6A 2HB9A 2WYMA 2QINA 2OHHA 2QDSA 5EVBA 1BVTA 1ZTCA 1YCHA 4C1DA 4XUKA 2FHXB 4UWRB 5HIPA 5HIOA 4C09A 4NQ5A 1A8TA 4PVTA 1WRAA 3I0VA 2NXAA 2ZZIA 3IE2A 3IOGA 3DHCA 1QH3A 2BFZB 3R2UA 4RL0A 4WD6A 2FU6A 3MD7A 5LS3A 3Q6VA 4DILA 5EHTA 5A87A 1JT1A 2Y87A 5EW0A 2ZNBA 2YCBA 5AEBA 4O98A 2BR6A 3FCZA 4EYLA 2QEDA 3I15A 1X8HA 2Q0IA 5EV8A 5LLDA 1QH5A 5HIQA 4F6HA 5FQAA 1WUOA 5B3RA 1ZNBA 3IE0A 4KEPA 3ZNBA 4D1WA 2P97A 5ACRA 4UAMA 4UWOB 4NQ6A 3KL7A 4CHLA 2YNTA 3X2YA 3I14A 4EFZA 4RM5A 1ZKPA 2QJSA 2GFKA 4EXYA 2M5DA 4V0HA 3LVZA 3JXPA 5A0TA 5IQKA 3WXCA 5B1UA 5ACSA 3X2ZA 1JJEA 5K4NA 3PY6A 4LE6A 1X8GA 2BG8A 3ESHA 2FM6A 3ZR9A 2YZ3A 2Q42A 2YNVB 2P18A 2AZ4A 3SFPA 3SPUA 4RAWA 1YCGA 4RBSA 5LM6A 5LMCA 1DXKA 3BV6A 4BP0A 1E5DA 4ZEJA 4UA4A 3L6NA 3AF6A 5ACUA 3TP9A 3AJ3A 3IEMA 2GCUA 1P9EA 2OHIA 5FQBA 1VJNA 4AD9A 4DIKA 3SW3A 3T3NA 3DHAA 5EVKA 3SRXA 2Y8BA 1KO2A 4PVOA 4JO0A 2BG2A 5HISA 2R2DA 2DOOA 5AXOA 1KR3A 4YSBA 1KO3A 3IE1A 3ADRA 2P1EA 3DHBA 4TZEA 4AX0B 1A7TA 1XTOA 4FSBA 4P62A 2FK6A 1SMLA 4XWTA 4C1CA 5EV6A 4KEQA 4EYBA 4HL2A 4ZO2A 5LE1A 2Q9UA 4HL1A 4GYUA 4TYTA 4Z5YA 4H0DA 3BK1A 2ZWRA 2GKLA 4UWSB 5ACXA 4C1HA 2BMIA 5FQCA 4Z67A 2BFLA 2FU8A 5AXRA 2WYMC 2BTNA 3IOFA 2H6AA 4HKYA 2E7YA 4J5FA 2FHXA 5A0VA 3IEKA 4BZ3A 2OHJA 2GMNA 2FU7A 4ZNBA 4TZ9A 4AX1B 2BFZA 5ACTA 2AIOA 3IDZA 2UYXA 5HH4A 4NQ4A 4F6ZA 2BGAA 2BG6A 3I13A 5EVDA 2WRSA 3I11A 4EYFA 3G1PA 3KNRA 4GYQA 3SBLA 3F9OA 1Y44A 2P4ZA 3RKKA 4D1VA 2I7VA 3RPCA 3P2UA 2WHGA 2M5CA 2NZEA 5EH9A 4NQ2A 4EY2A 3RKJA 4D1TA
chains in the Genus database with same CATH superfamily
5KSWB 3KKEA 1Z0DA 1RLMA 3U3ZA 2AS0A 4DRXA 2NGRA 5JJIA 4JLJA 4Z3KA 5JG7A 1V26A 4ISCA 4K9RA 4QRIA 1VKHA 1KQNA 3FROA 4KHZA 2Y4NA 2IOQA 2YMLA 3OY7A 1GITA 4RIFA 1A9PA 1TMGE 3EXAA 3W3ZB 3WV5A 1UUFA 2WSYB 4BNDA 3GFRA 1GGMA 1L0BA 4EG6A 1WBBA 4ZI7A 2XUOA 3E70C 3PR2B 1X7YB 3FSGA 2A0WA 2MWMA 1GRVA 3WLMA 5K8VA 3RB8A 1SJ9A 4NBWA 3EWNA 2A0UA 4RELA 4BGEA 3FWKA 4OB7A 4B8YA 3HB9A 2QUKA 3K0EA 4H77A 3G9UA 2UZ1B 1VJCA 3KK0A 4Y9RA 3AMVA 3KSAC 4C1FA 1TLTA 4AJOA 1ZX1A 3IMKA 3KQKA 4IX1A 4Y1GA 2HNAA 1RWQA 2V0GA 4B6SA 4YWJA 1T2AA 2BN4A 2R87A 2C2YA 1MHTA 2PJZA 1VE5A 4DMKA 2Z43A 4FFBA 4FMDF 3FMIA 2ZJ7A 3M49A 2GFHA 3T9BA 5TVKA 1P72A 5KKCA 4NPCA 1CULC 1FRQA 1PK9A 4LVNA 1TFRA 5ICGA 5JMWA 1A5TA 3T7RA 4MQBA 3V6LA 3ZWFA 3L4KA 5BYKA 3ZDAA 2EYQA 4A7PA 3GRCA 1JSCA 3E9MA 2AW5A 1XZFA 2ZRBA 3COWA 5J58A 1G9SA 3AEQA 3P9SA 4TTQA 3NXKA 2BGJA 5HW0A 1S2NA 1LJ8A 3C3CA 7MHTA 2JRCA 4TZ6A 3NDRA 3CNEA 3NUQA 4HZGA 1HLKA 1HV8A 2RK6A 4MRMB 4BO9A 2ZO4A 4HYYA 2AWOA 3QKRA 4JOBA 1RVV1 5CXSA 2EGUA 1LV7A 1SIUA 3ADPA 1BEZA 4HN4B 1NA5A 1WB6A 2HRQA 1L1FA 3TRFA 2WHPB 3W5VA 1E18A 1WD5A 4BEJA 1PR5A 4BECA 4ABTA 3E7XA 5JW6A 2IU4A 3O21A 3WISA 1YCFA 2I54A 1I36A 4ER5A 3CA8A 1DKRA 3PRJA 2BM1A 3CRVA 4QTZA 3VSAA 5HHTA 4UTNA 3CNBA 2IOHA 1D4OA 2H4HA 2VCYA 4BX9A 2ZLBA 1FRVA 2G04A 4KAFA 4L51A 4P4NA 4XVCA 2K2WA 4OXXA 3VU8A 1YQXA 4F9GA 4UFNA 1E0SA 4HI0E 4PZ9A 1YRAA 4BAUA 4BE7B 5L9AA 3KDSE 4AT1A 3I9NA 5KHLB 3W5CA 4N48A 1L5YA 3S0JA 3OIUA 4YI5A 5CD9A 1FJXA 3ELWA 5JD5A 1G18A 2VT7A 4TQGA 1E3TA 3S40A 1U6JA 4I1UA 1LDEA 2NYUA 3KFXA 4ND5A 1YGPA 4POAA 3WLFA 2Y4OA 1KI8A 3R1IA 2O3TA 4KWEA 4OO3A 3UJ6A 1FVFA 3OAAD 2XRMA 2IS6A 5CLLA 1L5SA 4HNQA 4NAHA 4U7WA 4ZIRA 3ZU2A 1KIFA 4HX2A 3L7OA 4DN6A 3JQ7A 1WMDA 3JWHA 4TGLA 1TFUA 3QKSA 1F14A 1NQVA 3PC8A 1SUBA 5AVJA 3VSCA 4EARA 1DX9A 4UBQA 2J3JA 2R6ZA 4BNGA 4OQPA 5JU6A 4Z6XA 4F7DA 4KVFA 4QG3A 4U4LA 4KVGA 1QLJA 2AG6A 1Y4ZA 4PYJA 3EGEA 4EJSA 3VSDA 5THQA 3ZE1B 3UJPA 4EYEA 4MR9A 3IBFA 5FH9A 5FAKA 2DG2A 5SZHB 2AWNA 2BG7A 3QWFA 2XCSB 2VDJA 1CY4A 3KYDB 3MWEA 2A9JA 4JUFA 1GNRA 1XYYA 4YIHA 2W42A 1OWPA 4Z99A 1N3IA 3MK31 1IZ8A 3N39C 4FYPA 3LH5A 2FWAA 1XWFA 3GD7A 1UZUA 4R1SA 1Y8CA 1YB7A 4JT9A 1CHNA 4QOEA 4KRXA 5EZYF 3SEFA 4EG8A 4ZEMA 2HHCA 3BBLA 2LRHA 1VLZA 2XZPA 4GI3A 1KP9A 3Q5EA 4ECAA 5HIKA 4ASUA 2ZREA 4JUIA 3WIUA 3P2KA 3WBKA 1WRAA 2H5IA 3E53A 3UKJA 1D5WA 1O94A 2VZ0A 5GONA 1N1EA 3GLIB 4RV4A 2H5LA 3BFXA 3LTNC 2VJMB 1KZGB 3TLYA 2ODWA 3I62A 1W30A 3RGWS 4Z4CA 4K6MA 1DCMA 2LIPA 2RIPA 5DT9A 5A7FA 1HNNA 3WXMA 4ZKDA 1GZHB 1DARA 4ZZ3A 3H9BA 2WTXA 4IHJA 3QUTA 4QU5A 4XA8A 5T4HA 3PGKA 5F2EA 1CYDA 1MEJA 2XCUA 4TL9A 4KITB 3WGHA 1QFSA 1FBTA 2OVFA 1IN5A 2BR5A 4TUYF 1LU9A 1GNVA 4NAVA 1N36B 1XXHB 5L95A 1N1MA 2HJGA 1E2GA 1E5XA 1P2FA 2VDNB 2X9GA 3GJ8A 3BJZA 4Q1FA 4WCFA 5TT1A 3VC3A 4LF4B 4PIVA 4EYOA 1JP7A 4PLTA 5KSOA 5B2EA 4HQ6A 4JR0A 2JLUA 5DLQC 4EPTA 3ZE9A 3ITEA 1O95D 1A2OA 1ZHFA 2F48A 2VYVA 3H2GA 1FZTA 3EPLA 2HQOA 4DCCA 1G8MA 2H5JA 1VHWA 3D3WA 4NPAA 2J3KA 4UE2A 2IV3A 2NZJA 4KWIA 4GLBA 1H2RS 2FHXB 1HQKA 4MS3A 1T3GA 4S12A 3UOAB 4F8YA 2JAPA 1NYRA 5AYVA 3OMLA 4RD4A 3IUNA 4WN9B 1JI3A 1YGYA 1CLEA 1V7PC 4PG5A 3QTTA 4IG4A 1Q7EA 2C4UA 1OWOA 2X14A 3LGAA 4RL4A 3L1IA 3SHTA 2WMDA 3L02A 1DCKA 4J2HA 1WPGA 4S24A 3RAEC 2YYZA 2HMTA 1ZONA 5HOEA 1LFDB 2C2BA 3R9KA 4L9SA 4OHUA 4F45A 2YCLA 1Y5NA 2GSDA 1MOSA 1CT9A 2HYDA 3F8TA 1IC6A 3MERA 4FGKA 4G6ZA 4LECA 3V3TA 1ZVVA 1RADA 4UBLA 2IIBA 2ZANA 1U0TA 3BGWA 3PXXA 3QU7A 4NDZA 4YUAA 3OE5A 1TJYA 1YZQA 4TQAA 2Q3FA 1TZ2A 3H1GA 4NBUA 4IBOA 2DWOA 3KTOA 3P96A 3ROQA 4QOIA 3VISA 5IRCD 3DWEX 3NVMB 1ZGGA 1X19A 5TEVA 1IQPA 4ER6A 5IUNC 3U61B 4H7HA 1NNEA 4O4LF 5JALA 4Y1RB 4AY3A 1O4VA 1FDUA 3I4CA 5SZJA 4MPJA 2EF0A 3ZBPA 4QQNA 3LUAA 1F2VA 3FYCA 2D6FA 3S1SA 2VNKA 3R23A 2NP7A 2V8OA 2XOXA 1WTAA 3EEIA 3FMPB 2NQ8A 3GBVA 3RAPR 2ZJBA 3EXIA 3CCBA 4UBOA 4CMCA 1I0LA 4HG2A 3OEHD 2QBYA 5IKPA 4C2UA 1HDGO 2R6HA 5B7PA 1XKXA 4IWNA 3R7WB 1Y3FE 3E82A 4U6QA 2ZJ1A 1XCOA 4Q1BA 2IVZA 5F3DA 3LHIA 1DI0A 4FR5A 3VFDA 3TUJC 2C96A 3FOEC 3TZLA 1TIBA 2C9CA 1ECPA 3HLTA 4KEPA 4G1VA 2OPHA 4IFBA 3KQSA 4NE2A 3L5KA 521PA 1GUBA 1DXYA 2P1ZA 4GXTA 1OBFO 1WB9A 5GTDA 1TF7A 3KHSA 1Y6QA 3C43A 3JQ8A 3NAGA 5IVKA 4PDXA 2HRDA 1GTL1 2NVUA 3DQZA 4B4OA 1UBJS 1E5LA 1O97C 3U7JA 2DRIA 3VYSB 2C94A 5BQOA 1SZPA 4FVTA 4P80A 4AWAA 4C08A 5C8DA 2OOSA 3N2KB 4QVIA 3M8KA 3DLIA 1E2JA 2QM3A 1FVOA 3AJRA 1KJJA 1FP6A 3B78A 4X7PA 1JEYA 2VK2A 3G2HA 5DOVA 3K1TA 1V8FA 3ANMA 4XDYA 1TGYA 4RGYA 4FBGA 4ZZ2A 4S05A 4N0DA 4GGOA 4DIDA 3IEPA 2P90A 2DHQA 1C3EA 4GO1A 2RARA 1R6AA 2YMPA 4V0HA 4DWOA 3KAKA 5DYWA 4GQBA 3VKUA 1OX6A 5JQGF 2BWJA 5CVUA 3GRZA 1R37A 3SX4A 4YCLA 2DWPA 1CQIA 3NCTA 4MV8A 5FTMA 2EZ8A 1REQB 4PYRA 3T7IA 3C41J 5B55A 3LGXA 4IJWA 1Y1LA 2DTEA 4QUKA 4INOA 4UEOA 1L4FA 1KFJB 2Z5LA 3QY0A 2E4AA 4FE3A 4PC1A 4BVLA 3R4CA 4QLOA 1EVLA 2ZJ2A 1BZYA 2BG8A 1TC1A 4K9LA 3HJGA 2YY7A 4OB6A 4UBMA 3FHTA 4ZJZA 3SDZA 4G2TA 1G16A 1G20A 1GUAA 4JLDA 2WV7A 3HR4A 4YK7A 3K4PA 1CJUC 1JR3E 2OZLB 3K05A 3R3ZA 6CHYA 1FW8A 2BVNA 1N5LA 2A4KA 1MA0A 4UUBA 2WJVA 3T5DA 1GVHA 1MOZA 1V0JA 5DGCA 4DLXA 2GMWA 2ONYA 3BREA 5AVXA 3G1TA 3GYBA 3A6EA 1M9NA 4PAWA 1RYMA 1P1IA 3HJRA 3EUAA 1C4KA 4B3JA 3G8BA 3QVJA 2P9BA 2VTKA 2QMUA 2QLMA 3IULA 3BJIC 4ED9A 5E6SB 1T9AA 4GSKA 2WJYA 4PWYA 2DXIA 1L1RA 2HL6A 3G2PA 5K0LA 2X1LA 1V11A 3C14C 2F1JA 4CN8A 3CEMA 3H8VA 1R8QA 3N07A 1KL7A 2WNIA 5LA6B 1KOFA 3QVMA 1M83A 1K5DA 3B2QA 4M0UA 4OFXA 1T4CA 3RHTA 5DNCA 4TYMA 4R5MA 2V7PA 1E2EA 1RI3A 3F5FA 4JK3A 5JD4A 1BHJA 2BKVA 1Z33A 4TKUB 5KNBA 1T0PA 1ADGA 2VJBA 5DSZA 1GFIA 3QWIA 1AS0A 3B6EA 4QWWA 1VB5A 5H83A 3U7QB 2R00C 4ZD6A 3KG2A 1WF6A 3JVVA 1DOHA 2ECKA 1MAUA 2ZRKA 5HG0A 4AD9A 2CB0A 2VSXA 4G5RA 1B4DA 2QR2A 4WWHA 2F8TA 2GNOA 1KGSA 4GVXA 2AR0A 2ONCA 4YRGA 1ZJZA 3FVRA 5KNCH 4LDAA 1KO2A 4TMZA 4QDZA 2QRJA 3HU1A 3IAXA 2B8NA 3UCXA 4DCMA 1U28A 3E9DA 1AKWA 3B7WA 3RJTA 3C3XA 4EOGA 2BEUA 1X42A 2O1XA 1X8LA 2YXDA 4A8JB 1RI2A 1XEXA 3HJTA 3PQ5A 3VBEA 4A9AA 2R2DA 4M36A 3LW7A 3X1KA 2JAUA 3W04A 1Z2AA 3BWCA 4MCIA 3VZCA 1A4RA 3HCRA 1FDRA 1VGVA 2C29D 4ZXFA 1Z56C 4W7HA 1XQ1A 1H22A 1K27A 1XTJA 4N01A 2JVJA 4QLAA 5D1NA 5DI9A 4G56A 4Y67A 1L4KA 1U7XA 1XK6A 2PPLA 2ISSD 3SVTA 4TZEA 2GFQA 2KHZA 1TTQB 2OAGA 2IP4A 4FEYA 2E3JA 1P2SA 1L5ZA 3GDHA 4OGWA 3OOHA 3RARA 3PR1A 2W2KA 3M6UA 4GGPA 4RVUA 1ZVJA 1DWQA 3WLQA 3QEMA 2H06A 1WABA 2FMTA 3FFBA 2HA2A 3T99A 4Q3CA 1J4AA 1EMDA 3Q8WA 5KOHB 4NXMB 2FGKA 4OV6B 3H18A 2GPWA 3TRIA 3UXHA 5DGTA 5H80A 3HKBA 1YSCA 2GZMA 5DIZA 5K3BA 5H3LA 4GMGA 4EYSA 1CUBA 1DIRA 1N1GA 1TRHA 2JFBA 4QRHA 3BKXA 4NBSA 1OROA 1Y98A 1GV0A 2FUEA 2OY0A 3ADOA 3CRZA 3VR3A 4C2BA 1KC3A 3TLJA 4L4ZA 4JV5B 1A98A 1K9SA 3BIXA 1U04A 3JYLA 3AEYA 2RH9B 3K09C 3JARA 4WUTA 3VO8A 2ZE6A 1VRVA 3GAAA 2ZJ4A 1KNXA 4I6GA 4G2NA 1W25A 4KR3A 2J7PA 2QAGB 5FIUA 5JY1A 2OILA 1QORA 2FW0A 4JIGA 3QMWA 4FOTA 1QIHA 1YB4A 4HUQB 2BCJQ 2DLDA 3HSKA 4LBZA 4V0ME 2OFPA 4GEKA 4LYAA 5JO9A 1T4BA 4Q01A 3VQTA 5K0JA 5K0EA 3DONA 5J59A 5EERA 1L8XA 2C8JA 1PG5A 1EHIA 4BFVA 2FEWB 4LMBA 2I3ZA 1NATA 2B7BA 2AUTA 4P2BA 4DB4A 3DMYA 4LG1A 1QAMA 1J49A 4GPIB 4B7AA 4NNPA 1ZD3A 4JSRA 4CL3A 5JASA 3CPHA 2WQZA 3E27A 5G1PA 4X94A 2VJAA 1C9NA 1S5PA 3ZKWA 3I1JA 3ZIAA 4C6TA 4EL5A 3IDZA 3G5TA 2ZFUA 1J2EA 3VKVA 1VE1A 4MIEA 1D8AA 4Y18A 1JPUA 5D8DA 4X64B 4CR8A 5FWXB 1PJLA 2R8YA 2B98A 1TM2A 1Q1GA 4AXBA 4QD3A 2M32A 1E77A 2OV3A 5JISA 1GPDG 2R7AA 1E6EA 1H9AA 1SH7A 1UKCA 1MO6A 4G0PA 2XQGA 4L5AA 3WICA 2ORIA 5IZCC 1U7ZA 1UBCA 1V1RB 1XROA 1ZLXA 3F3SA 2NTNA 3KO8A 4WL0A 5FTJA 4PW0A 3UJ7A 4ZEWA 3UMRA 4CT0A 1I6MA 2JIQA 4OFBA 1XK7A 4P84A 3SJAA 1Z06A 4KUGA 1GLVA 1E7RA 1TVCA 5IBCA 1P18A 4X6YA 3TOCA 5JD6A 5LFAA 1OREA 1NNSA 1Z15A 3G0OA 3ZCUA 3P0EA 2GHTA 4MVJA 2C2WA 2C3UA 4NSNA 1NZJA 3GNSA 3F1KA 3NUGA 3QFHA 1QGUB 3CSUA 2XNHA 4TOIA 3ZD9A 1QIGA 3SXUA 4D4LA 4CQLA 1J8VA 1CVRA 1JDVA 3PYMA 4N0QA 1ZA1A 1E3WA 1Y4AE 3H1TA 2W2LA 4FD3A 5TY0A 1OU0A 2J85A 5K0SA 3EW9A 3K2EA 1CUWA 5FOWA 1QYVA 1LI7A 5FJIA 2Q5EA 1E1NA 2VLBA 3QEJA 4R81A 2H31A 3EQ2A 1QHSA 3U3KA 2YMMA 2X1MA 1UEXC 2TMDA 1JQJC 1V8OA 3DBVO 1H0KA 4GP9A 4J3JA 1U7DA 2FEKA 4LJKA 4R16A 3RFXA 4KKXB 4NDNE 2H2AA 2OGSA 2P2SA 2RH4A 3QKWA 1YB6A 4L4RA 1RM4A 5CJ2A 3AQIA 4AN1A 3T3OA 3ZD8A 3NG1A 4AMVA 1FS4A 1TZKA 1G3UA 1JIXA 1E2DA 3AI7A 1CERA 2PZ8A 3GUUA 3KALA 1EZ4A 3JQPA 4BNJA 2REBA 3I0MA 1N7HA 3AHDA 3BSYA 3I6QA 3WA7A 2VDKB 2B94A 4AJIA 4Q66C 5E4YA 2CCGA 2QXTA 1PV1A 4RVDA 2B35A 4RL2A 1BG6A 1HDCA 3N74A 1XAIA 4N6GA 4G5FA 5SY4A 5AJWA 5K05A 3RSHA 1OX5A 2H1OA 2A1TS 3UKOA 1DKOA 3LQQA 2AOTA 5AJYA 2VW8A 4LEIA 5CB8A 1GDTA 2WJAA 3HCPA 3DULA 3ZHBA 2B6HA 3NIWA 3O3NB 1DBIA 1V95A 1X7ZA 2QRKA 4IL5A 4LXGA 3TTXA 4CEIA 1NR7A 3LXRA 1YH3A 4FWBA 4E5PA 4UU7A 1F2UB 3D02A 2IDJA 1FL9A 2QD5A 1PJ2A 3E0XA 4O3FA 3K6JA 2PPVA 5IHXA 3VR6D 2BZ0A 2OXCA 2YHUA 4DKJA 2EW2A 4ARUA 1JU3A 4OY3A 1L7VC 1M66A 3AU9A 4E1BA 2WSBA 3G02A 2H51A 1Z0AA 4DQDA 2AYZA 4CFZA 4XQ9A 4LY6A 1CB0A 1TLLA 3C6KA 4EZBA 4YMGA 2FG7C 4DA4A 1I4LD 4KLRA 4WASA 3QU5A 5A02A 5I7OA 1DAKA 2CBNA 5HKLA 4ZV4A 5CW2A 3QUBA 4UUNA 4OU4A 4A27A 2JCYA 4RK7A 4OQNA 1YR6A 4FYWA 1Z47A 4I1RA 1ARZA 2VSOA 5LN1A 4CM9D 3E2PA 5KQMA 2FDCA 2IEGA 5K0CA 1QCCA 3DKRA 4LV8B 1M2OA 2X4DA 3PRHA 2C9DA 3HBLA 4WZAB 5HCUA 3IBSA 4BASA 1EK0A 5K8JB 3KJHA 2VQ3A 3KQYA 3C3AA 1PL7A 3QI2A 2CJWB 3EPHA 1AHIA 3KS9A 4US2R 2NYVA 3RIMA 4EX6A 4ZDKA 1VSBA 2WDPA 5E3JA 4Q3EA 3VZBA 2ZULA 1GZDA 1XR3A 1FVXA 4UZSA 5CJPA 3SQLA 2SCUA 5K8LA 1OZGA 1ZRSA 2XYQA 4WFKA 3VQZA 4OQZA 1I4OA 3V8QA 2FU9A 1XF9A 1XZNA 1FYVA 2R62A 2WAYA 4HOYA 4ZQBA 1Z2DA 2ZWOA 1CF4A 4LXTA 3W8DA 4B2PA 2IA5A 3PVSA 2ZVDA 5BN4A 5JLJA 3UMFA 2CNBA 4XYMA 3VDRA 4DA6A 1CE8A 2P2DA 4RU1A 1QR6A 4IO0A 1U63A 1IHOA 1WX1A 2QN8A 3CLUD 3DSRA 5ER9A 2CLCX 4BRSA 2ZPUA 1RYBA 2FPLA 3DZCA 4J7XA 5KVSA 4UM9B 2PDAA 4MSUA 2AA3A 4RTMA 1ZOOA 1GPNA 1O5TA 3VNAA 5DWQA 5EXXA 4N49A 4NK4A 2YC2C 1JLHA 3URKA 4BKMA 2BGMA 3H5WA 3FAIA 1DDOA 7GPBA 2DSNA 4IZ6A 1QDUA 3IKVA 4W5RA 4PHTA 4QGBA 4MRPA 1E9DA 2DKFA 1PQYA 2DC1A 5E2AA 1N4AA 4BKQA 4RTJA 1ZC3A 3IQWA 4RKQA 1KMHA 3F1LA 4NQZA 2RIRA 5BO5A 4IH4A 1NXSA 4QOJA 1FFBA 3RS5A 3JZAA 1B6SA 3D2AA 2C20A 2X77A 2RHGB 3FN4A 2I4NA 4HAVA 4X97A 4YDRA 4YV1A 1PFKA 3D8SA 1EXVA 4P81A 3TMAA 2PQ2A 2BTEA 4P1ZA 3WZMA 1T13A 3KJXA 1Y6JA 4A5SA 5HCNA 4R0MA 1Z5ZA 4I2VA 5C8XA 5TDHA 3TOSA 4M7WA 3GIDA 3FHJA 3H0EA 4HQOA 5K3DA 4B7ZA 3KEFA 4EHJA 1W94A 4M1YA 3LYHA 5G1NA 5FOTA 1SKQA 5HKOA 1JR2A 1JDBC 1HEUA 4NBRA 4REOA 3UUWA 3EF3A 4CQNA 1F0PA 4Q0MA 1S3GA 3KOMA 2OENG 1LBHA 4WLOA 4I1PA 4G5QA 3GMTA 3QFCA 4KXQA 2C7QA 2B37A 4NONA 4TKVA 2PUTA 4F4IA 3BIOA 4IRMA 2WIKA 2G06A 3KJGA 1O08A 1YQ9A 2EKZA 3AX6A 4IFTA 4YAFA 5DN9A 4FGLA 4LBVA 4ILKA 1YK1A 5FUVA 1RQNA 2WM9B 3ASZA 1YMUA 2QLTA 2JCVA 3NHBA 2JGDA 1XTIA 2EFGA 4WNCA 2FQXA 2QMYA 1Z6AA 3AM3A 3ENKA 3PUWA 4G0QA 2H2GA 4IKPA 4N39A 3V7UA 3B1ZA 1NVVR 5ALZA 4L8GA 4GZ6A 3OQIA 1C80A 2ZI5A 2XX3A 2HMUA 3C8DA 3RFFA 3VJLA 4IUBS 4V03A 2NU7A 3RFUA 4F1WA 1QGAA 4KN8A 4BNKA 1OV4A 2Q2WA 4TTPA 2Q0HA 3O2JA 3WRVA 3ZQKA 1GPH1 5D6OA 4ASUD 1ZGJA 3GWZA 1UANA 1HT2E 2PH5A 4ARCA 4TSKA 3K20A 1WA5A 3GR6A 1OW3B 1UT6A 4GW3A 3GFSA 3HY3A 5F51A 4KFCA 2R6R1 3H2YA 3LT1A 1JKXA 2WZBA 3NBYC 5HKKD 1E4EA 4AJ2A 4M53A 4ZYTA 3OPNA 5JNVA 1Z5UA 1SUFA 2JPDA 2RI1A 1JGTA 4EGQA 4G1CA 5KWIA 2Q6TA 2OHOA 4W1PA 3TLBA 1G5RA 4RQBA 2XYRA 4FGSA 4EEXA 2FSSA 3F5DA 1Z6QA 3WLTA 4J9UE 1GEEA 3EXHA 4DPMA 2JFZA 1ZISA 1KKLA 2N3ZA 4XR9A 4XEUA 5DISB 3KQMA 2FEAA 1PR3A 1Q5PA 3UMBA 3CB4A 1KAGA 3NIGB 4CDGA 2OBFA 4EW2A 1E1RD 1GQFA 3PHLA 3ZD7A 1RCFA 1T1RA 4YJ3B 2QM0A 3I15A 4PHHA 1F3LA 1TIPA 5DM70 1YACA 3JRNA 2QN1A 2X3UA 4QGFA 4JNKA 5FI5A 3WLKX 4GU5A 3O8QA 1ILEA 4MWGA 5HTOA 3DC2A 2VDMB 3EMBA 1CRPA 4YJGB 3L0CA 2AI3A 3WWEA 4W9NC 4UBIA 2PSSA 3HN6A 4ZCPA 4WRRA 1RI5A 3LLVA 4IEIA 1EDOA 3GJ7A 3N2GA 4ZZ1A 1NX9A 1OBHA 5J63A 4MQFB 1TVKB 1T9DA 4BVAA 2BOVA 1ZG3A 4QAJA 2IYFA 4LY9A 1ZD8A 1ZHOA 1UPTA 1ZNQO 1WUTA 3ICEA 2DQYA 2HV9A 1JHXA 1X14A 2GLXA 2Q28A 2GJ9A 5IUKC 1T2FA 2QA5A 3CLTD 4LTNA 1PT7A 3BGIA 1M33A 3LUFA 1N0IA 5B57C 1E3DA 3RRFA 1GUDA 2V03A 1YV9A 4FZVA 4EI7A 3LHDA 3BMNB 1GILA 3K3PA 4PZLA 4JC0A 1I0ZA 1TU0A 1HORA 2VBFA 3IMEA 1OBCA 1M2VB 3LCVB 3MM4A 5DIFA 3SHVA 1JA0A 1S4MA 3UJAA 3ZZ0A 2AJLI 1EUYA 2Q3DA 4EXYA 3PPIA 1VIAA 1ETUA 1S02A 2JA2A 1BN6A 2RGXA 2LCIA 2J41A 2ZUDA 3R6GA 4FFWA 2I34A 1VSVA 2XRYA 3CEPB 1VPEA 1XTRA 4KAAA 2OV4A 3VAYA 5JRDS 2ENWA 2GBIA 2IUYA 4GX5A 2F1OA 5FR2A 5K8UA 1N2CB 4R1QA 3KR2A 4YFYA 1Q91A 2WB4A 3PITA 3QEBZ 2KBFA 1X9HA 1TM3E 2ZBPA 3CEAA 4F56A 3OEEA 3OSZA 2V54A 4V0QA 2G1AA 3TUZC 3SHFA 2Q6VA 4ZO8A 1W5SA 5CHYA 3KEGA 4UEQA 2AN1A 1KDPA 3FUWA 4JD5A 4U00A 4W6ZA 3D3JA 4ZJYA 2IFTA 1F2DA 2AMJA 2JH3A 3C48A 3D7RA 5AKHA 2FG5A 5BUSA 4RHFA 2V5AA 2G63A 1U3DA 2HU2A 1B7GO 5GM2A 1X1DA 2W2QA 4DIEA 1YB5A 1H0RA 1PNTA 2ABWA 2B7LA 2EJBA 2R47A 3GUCA 2M6RA 1AKRA 1QZXA 2ZWAA 4PHGA 5C46F 4NG5A 4IW3B 2IF0A 2XUPA 1EK6A 2WJHA 1WDLA 3AH8A 3OY2A 3HWRA 4BP0A 3TLGA 3GOHA 3KE9A 3L7BA 1N2XA 3W1WA 5F4BA 5A3JA 1TCAA 2BJVA 5J1TB 1DMSA 4FLMA 2V5UA 5ULLA 1K4MA 2PZEA 5LU9A 3ZDCA 4TMFA 5ED4A 3O31A 2PUVA 2X2EA 4W5WA 4UW9A 4ZGWA 2Q1SA 2UYCA 3NFRA 3K6RA 1ZVKA 3HM9A 5JS6A 1WD7A 2RCNA 2FEXA 3OZCA 4OJYA 1UZNA 3OPYA 1YDEA 4GYJA 3FVVA 1G38A 2J9ZB 2L42A 4NTZA 3L4BA 3RI3A 5IWAB 3JYNA 3PCXA 1UKBA 4JBLA 1L5HA 3EAGA 4DV0B 1CEYA 1P17A 3FHCB 5KAPA 4D3DA 1NOKA 1JFLA 2D1YA 4RA6B 2JJYA 1RRMA 3GEGA 1EVJA 2GZ2A 4FFSA 3KWJA 3N3BC 1UH5A 4Z9FA 4U7DA 4OLBA 2H52A 4RJJA 2DKOA 4UHEA 3HEMA 3HDJA 3Q7PA 1Y9EA 2ZYDA 4JASB 4HDNA 4WKPA 1SUAA 4D2IA 1DAFA 2A94A 4K8OA 3SQXA 1GXSB 1RSZA 1U1FA 1W4CA 3JRWA 2WD7B 4WNAB 3RAGA 4MQ6A 1KPIA 2IC5A 4N0MA 4BCDA 1POWA 4M99A 2IYPA 1H5QA 2XCLA 4NBKA 2J67A 4N3AA 2CE2X 5IX8A 3C6MA 3Q10A 4JB0A 4NZMA 1AN9A 1I30A 1JX6A 2E4WA 3PGLA 4YHHB 4BUJA 4FK8A 1TKBA 4JI3B 2CDRA 5JMOA 1W0CA 3RS0A 1N9ZA 5HIMA 3UICA 1DPFA 1PAUA 2ZSDA 2Y99A 3CH6A 4GE3A 1A72A 5ENVA 3ZTTA 1OLOA 1IY2A 2G0AA 5K2MA 3EVTA 1IRIA 1VI6A 2GA8A 2NZXA 3JQDA 1B2LA 1A8SA 1A76A 2H65A 3O8LA 2NO6A 2WFLA 4DR2B 2QNBA 4NOLA 3RYHA 2AMYA 3ZDYB 2FV8A 2FSFA 1DRVA 2H0QA 5EY5B 4HRYA 5AKGA 5TJHA 2BFCA 1Z2CA 3WHKA 4LWPA 3OCUA 4U2FA 3WKBA 5L3VA 1E3MA 3KJFA 4KP7A 3NC0C 4EZIA 2VP2A 3GJRA 2IXDA 1UOOA 2OC9A 2LCFA 4WY2A 1G5IA 2HO4A 4Q05A 3VR0A 2HT1A 3Q6MA 3ZXUB 4BJ5A 3ICPA 2ZWMA 3DF7A 2RH8A 5MN4A 1NMYA 1H2WA 5C9ZA 1U9CA 1UBOS 1EPUA 1SKAA 3GRFA 3V1MA 4ZYUA 3ZJVA 2GOYA 4JI8B 1MVNA 3GCZA 1ENYA 4D96A 5KJCA 4KPYA 1XU7A 2IXEA 3DEAA 1UPUA 2PKRA 3UPUA 4PCAA 1DC5A 3Q3JB 4QEDA 9MHTA 1E9VA 3PGJA 4PS1A 1QO0A 3BJEA 3LXXA 2QGFA 4HX9A 5AKYA 2VPQA 1ZI8A 3ZNNA 3MVEA 2Y76A 1SEVA 3GLTA 1X1CA 5I4IA 3LOPA 3OO1A 2Q3LA 5AWFC 4B4KA 1S4QA 3REQA 1IN8A 2GEUA 4FLEA 3PL1A 2ZUEA 1NN1A 4N5DA 2QN3A 3OKPA 1EWKA 2G40A 1XX6A 3IALA 2GBFA 2YOGA 3QVSA 1F8FA 2VRNA 1TM1E 3PSAA 2W11A 1JEOA 2GYVA 1G9XA 3CZPA 4OEHA 3SFTA 4DUPA 1RJ9B 3IJEB 4EHAA 5K2OA 4G63A 2AOXA 3SG0A 4AZ0B 3DVQX 4KIWA 4JLSA 2LDXA 1P74A 4E21A 1JXAA 1PGNA 2BFEB 3EPJA 2ACWA 5EE5B 3BMCB 4L0QA 4OBBA 3GL9A 3V4SA 2G7ZA 4HGYA 2EZ9A 1C9MA 2PLRA 3GFGA 1GZVA 2GCNA 1NASA 1GPYA 1OIVA 3SJBA 4AP5A 2WAMA 2X8JA 3ID6C 1AMOA 3VX3A 2PIAA 1U8AA 5D3QA 1O54A 1QSGA 1CS0B 9ATCA 1K0FA 4OQDA 3JV7A 5BMVA 5CFZA 1HLDA 1TK2A 2E49A 4G0NA 2I7VA 4TV9F 2O7SA 3NR2A 5A4FS 4BNFA 2WHGA 2JGRA 2Q5LA 2IQIA 1V2HE 3K0AA 3K8ZA 4G0XA 3LE8A 2I1WA 3F0TA 3SK0A 3DTYA 4C89A 3DCIA 4EY2A 4EY3A 1SCAA 4TLLB 1UAYA 1T24A 4YP1A 3R5HA 1THMA 1FX1A 1BS1A 4TV8B 5DNYB 1M2KA 4X00A 4O6VA 2CLKB 1E2KA 1OWMA 1XQVA 2X0FA 4A1OA 2GYWA 4GI7A 3UAYA 1RWOA 2ZSUA 1F4VA 5LQAA 1ZNXA 1Z0ZA 2Q3JA 3CZ9A 1DV1A 2YZNA 2ZYVX 4J0KA 2YNUA 3KR9A 3ZWAA 1M8KA 1Q14A 5TGTA 2NAFA 1IOZA 4MVYA 4QFCA 2PT7A 4RWEA 4Z2AA 5D51S 4KW7A 3CUUA 1UOPA 3EQZA 1P2BA 4I5GA 5A9SA 4KTTE 2UUOA 1H6AA 2CWWA 1KHHA 1KVTA 4LXYA 3ZX4A 1H6DA 4D4JA 4YAUA 2F7SA 3DJYA 1XQXA 2C5SA 3ROPA 3PUIA 2FR8A 3U9TA 3LCRA 1IM5A 1PV4A 1NHGA 1WTCA 3SOZA 4X1IA 3BSSA 3KRTA 4DBVO 4GRIA 4XKJA 5EIAA 4KH0A 1VDZA 2J5KA 4E46A 1R16A 2PMKA 3LWDA 3FYUB 1K07A 4LN1A 2XBUA 2Y0DA 1W1WA 3TJRA 1TMKA 1LH0A 4AZTA 2PUGA 3OJEA 2WYLA 3I42A 1NWCA 1S96A 3CRRA 3ZDZB 2G0TA 3GG2A 2CZGA 4OD0A 1ODKA 3NEJA 4ZAGA 4ESOA 1M0EA 1FXWF 1I3NA 1VIYA 2GO1A 4OP2A 2HA4A 3COVA 4OMUA 4NCBA 1KFKB 2G1JA 1A7JA 4FOPA 4JR1A 4NV0A 4U2DA 4WESB 3EGXB 4JLPA 1ZXBA 1NR1A 1A0OA 4KMRA 4FMDB 3ANSA 2APJA 2GF2A 4LF5B 4P86A 2RGEA 2G76A 3ZHRA 1JEAA 5BSTA 3ZGXA 2XZLA 3UF0A 1HL7A 1T2UA 3A58B 4J0EA 4LKOA 4XUEA 3O8NA 1H05A 2DWUA 3TW8B 5LDHA 4BZWA 4PM4A 1R12A 2ZI6A 3LL7A 1O1YA 3DYIA 1LPPA 1XLWA 1WOYA 5IVDA 4PC3A 1FUKA 4WKBA 4RK5A 4BBPA 4JR2A 5LP6B 3FOAA 4OQ4A 3W6ZA 2O2GA 5FOXA 1MV5A 2FE1A 1JA1A 4V0LA 4K1XA 5B4UA 1KMIY 2DR2A 5C5EA 1IMOA 2GF0A 2XMSA 4QYIA 4PLGA 3UOWA 3CRQA 2KJQA 1OT5A 4GECA 4WGGA 5ECYA 5LMNB 4ZP1A 3SI7A 1MJGM 3RYFB 4CTKA 5A62A 2W8BA 2A5JA 1EYZA 1KZ9A 2OCYC 4I4TF 3PF9A 3P9YA 4HLDA 2DLNA 5LOVA 5KYYA 4XDGA 3E3LA 3U7RA 3N2IA 4D97A 2HSGA 3GJZA 4C4SA 1P6XA 1SHKA 1QTIA 1KO8A 2NPOA 3EVGA 3IEIA 4HAOA 2DJ5A 1URPA 2WIBA 3N0WA 4WZ6A 3QE9Y 3CG0A 4YRZA 1IBCA 4F86A 4W8OA 2B78A 1MC5A 4UMFA 4ZEXA 3FSJX 3O90A 4LZZA 4ZT3A 2I80A 2BH9A 1BCSA 3MINB 4RKEA 3AR7A 3EFBA 1DPGA 5L40A 1PJ8A 5HH5A 1FFWA 1PZGA 4A0GA 4ZDIA 1ONNA 2Z1MA 1N33B 1HZJA 1UXJA 5DNUA 1QH1B 2W6ZA 3U40A 1TUGA 1MLDA 1KF0A 2F3PA 4ENPA 3FPCA 2CLMB 2OD2A 5FHQA 4Q15A 4XQ0A 4G5HA 1UWVA 5FOVA 2IH4A 4IJKA 2PR7A 3BWXA 2N42A 5L6MB 1SELA 2EFDB 4I1IA 5E3IA 4DLPA 1MJFA 1QP0A 3F6CA 3BVPA 3GCXA 5GJVC 5ESRA 3R5TA 3DDNA 1DDGA 2J8ZA 1ZIYA 5DCUA 1ZJ4A 5LZ8A 4CV0A 3LQ2A 2F4NA 3NRBA 4P4LA 4CMBA 4CQMA 2A1UB 2NZFA 4TMTA 4V39A 3PS9A 3ZHYA 3EEQA 4DZTA 2WY2D 5ARCA 3G68A 3FTNA 3BC2A 4FFOA 2AMFA 3HXKA 3UK0A 4P7FA 3HHPA 1N5RA 3MJ4A 3FNEA 2Z83A 3TLZA 1M1YB 5JSZB 5B3KA 3B6MA 3VPHA 3WP1B 5LPNA 2J59A 2Y0CA 3GO4A 3A10A 4N5IX 1CZNA 4WXMA 3GA0A 2QUHA 4ZAWA 1TA0A 2OXIA 2WIFA 3JQEA 3C4JA 2V4UA 2XBLA 5TPWB 2JKYA 4F5EA 3OCJA 5DEOA 1AHHA 1BMDA 1WHSB 4QQRA 5BR4A 2O1EA 3TEJA 4Q6BA 1KJ9A 1GZ6A 1U2GA 3ENVA 4MUAA 5FQCA 1SB8A 3BT7A 4GYKA 1C1XA 5CVEA 1AJEA 3JQBC 3IERA 1U2QA 1YB1A 2BEVA 2J9XB 2Z4TA 4WXPA 3F7NA 4N47A 5HRUA 4TMYA 1TJNA 4UTPA 1SHLA 1VSTA 2HCFA 2WYVA 4O25A 3MAJA 4UHDA 5F3RA 1R0XA 4J3NA 2R6DA 1SD5A 3ORQA 3QYAA 3HA5A 4F60A 1X15A 2FCRA 5EXSA 2NP6A 2YMQA 3ANTA 3CXRA 4Z7RA 3BTVA 3BM5A 5EVBA 2WYMA 1ENPA 3ESZA 3WHPA 3ZGVA 4V24A 5AI0A 3L84A 3LXMA 4B6QA 5F3WB 1ZTCA 3MJEA 4KV9A 3ZI0A 3IQZA 3DAPA 5BVGB 4HLQB 5MDHA 5TARA 5HIOA 3NAQA 1F7UA 4GG1A 2C7PA 3ICCA 4PSVA 1IXSB 1TUEA 4MW0A 1A8TA 4RLQA 1GNTA 1SXJD 1T8UA 4KNVA 3D54D 5B1HA 2ZZIA 1N6NA 4HXYA 2AFRA 4GM4A 5FNVA 4UAJA 3NHMA 1NG9A 5JZVA 4FDAA 1A5AB 3R5KA 3P2IA 4MUMA 2V9ZA 4LOIA 2QF7A 1Z4MA 1RS0A 2ATXA 5MN5A 4XZ3A 3UW3A 3S2IA 4P7JA 2C9YA 3S44A 3Q6VA 3DMFA 3OIVA 4MV7A 3I9OA 4WVLA 1LV8A 1R64A 1XNGA 2CJFA 2XTAA 4XB2A 2DSTA 3ZDQA 5CB4B 1QOPB 3SBEA 1ULZA 1NYQA 4GGMX 5DBHX 2ZRMA 3THYA 4DCNA 1VKZA 4OK5A 5DYNA 2Q4DA 3M9LA 3E3OA 3D2LA 4KMOA 1O96B 2YCBA 5TEWA 3WQSB 5L53A 2PQMA 2IOFA 4NCXA 4YYEA 2BHSA 2ZB3A 4E94A 3CX3A 4QHTA 3SIPA 4EYLA 4JDUA 5KOJA 1XLTA 3B1FA 1MB0A 3GGOA 3EGWA 2ETVA 5M04A 4MA5A 1X8HA 3SMQA 1SBZA 4FCWA 4MAAA 3S6JA 1OHHA 3MPOA 3QOWA 4OJKA 1T9GS 5KYWA 4EMUA 2D2VA 1QH5A 1Q3HA 4B45A 4C0XA 1YD7A 1PF7E 2O8DA 4YECA 2X0DA 3ZY3A 5F5LA 2FGJA 5EZQA 4ZVKA 4DRXB 2OAP1 1ZNBA 3LU1A 4Q3LA 3QFFA 1NWHA 3V1LA 1JV2B 1B76A 3AF3A 3HXTA 1S1MA 2XYVA 4HBZA 1UZMA 2IELA 2NUBA 4OK6A 5CTJA 3TBKA 6GPBA 4GX0A 1N2BA 2X0NA 2AJBA 3CN9A 5EPOA 4BNDB 3OMXA 4E2WA 2MYNA 1SXQA 1ST2A 2B0JA 5ALFA 3WBBA 3R0IA 4ZI7B 1XZGA 4BO0A 4I50F 1RC1A 4ILEA 4K03A 1CZOA 3EA4A 1H2BA 1B6GA 3GFOA 4YRAA 2O5CA 3NDIA 5DM2A 1NDUA 1RAGA 3WFJA 5HILA 3G5MA 3L1KA 4YCDA 4ZPJA 3X43A 1YQTA 3ZVRA 4ZZIA 5DNWA 2O0MA 3C6QA 3HR7A 3R77A 4ZQCB 4NX2A 1QBGA 2PO5A 1XKLA 3AB8A 3KSRA 3M6XA 2EKBA 1SZJG 4Z1OA 3I73A 3BZUA 1GT6A 4X90A 1B0AA 1BOFA 2FDXA 3MCWA 5BSRA 5IZ4A 1SC3A 2XWBF 4LQDA 4RNDB 3H1EA 2N46A 3WO0A 2BM0A 4FFBB 1COZA 3AI2A 4HB4A 4CXMA 4NHEA 3HCWA 1X6VA 2IDMA 4RFSA 4BC0A 2ZPTX 3DTTA 4ARIA 1PUIA 3CRW1 3TDNA 1O6GA 3U4DA 3LY7A 1TU4A 3E8SA 4O4JA 4XYGA 3HB0A 4DCPA 1F6WA 4RJ2A 3RT9A 3BB3A 3QOYA 5DYTA 4ER3A 1Z0UA 5C5CA 3IVAA 2EARA 3ABQB 1JZTA 3NHJA 1LF0A 1JLRA 4X95A 4CKZA 3B2NA 3K2IA 4A15A 1JJAA 5AKZA 1Z8HA 2OA0A 3ESHA 5J2TA 3PU6A 2YZ3A 3N8KA 2IKSA 2VHJA 1CP2A 1K8ZB 3F9IA 3LO8A 5HR5A 1F2TA 2R6JA 3R41A 2CUZA 3BB1A 2WBLC 1CQXA 1QZ3A 4DBZA 3QKRB 5LVAA 2CXTA 2I03A 4L15A 3VVLA 2Z3WA 4IP0A 1DJNA 2H4WA 3BC1A 1NI4A 2XB8A 3TRHA 2DH6A 2H4YA 1YZ3A 2GBGA 4QJ5A 3RT1A 1FU8A 3DZKA 4OHVA 1IFXA 1KS2A 2X2FA 3SFPA 1H2EA 1YRHA 2WHEA 5EIBC 3OQBA 3CIFA 4G97A 4ROTA 4I1SA 2BBOA 2FN4A 3M2TA 4PGGA 4DWWA 1H4VB 4B34A 4XCVA 4UUMA 3S4YA 2JZNA 4E51A 3A04A 4QTXA 1ACJA 4RPCA 1ZCZA 1OWLA 2RC5A 3NBMA 5CB0A 2A9KA 2QV7A 2OFWA 1P5FA 4QXOA 3EY4A 1C3VA 4CR7A 2O2EA 4QJ3A 4OHOA 4CF7A 4GOMD 4PR0A 4DXAA 3MB5A 3U09A 2JFWA 1WNTA 2GF9A 2C84A 2PJUA 2GCUA 3OOJA 5DBFA 1L5VA 1TRKA 1YZVA 2WAXA 1D4AA 2F43A 3KPVA 3PJEA 2Z98A 3FNGA 2NSJA 4COOA 5LP6F 2A9FA 3W2IA 1LK5A 4MDYA 1GPJA 1B0ZA 2O3UA 1XB2A 1JBQA 4DLTA 3ABSB 5DGXA 4CKYA 5LMUB 1Q20A 1R2QA 2YBEA 4KDRA 3USES 1QM5A 2Y8BA 2OV6A 2H00A 4ZIRB 1N7GA 1U0RA 2WV9A 4PAQA 3W3AD 1BW9A 3ILVA 3JQ7B 1AQYA 3QKSB 3U19A 4PCVA 5H59A 3THWA 5CCDA 2BCGY 3W90A 1IY9A 3F47A 4BNWA 221PA 4YP6A 5KPJA 4ALIA 1CDDA 1X38A 3P2OA 4IFEA 4EJSB 3U2QA 5C80A 5AVZA 2IYXA 4MR9B 1F9EA 1YFKA 2LP4Y 1DTEA 4LE2A 4MOWA 3KUXA 4REMA 3SYTA 3BXGA 3I6YA 2QN7A 2BFNA 3ES9A 3O5AA 3MWEB 4Q37A 4WQMA 5AVYA 2W6PA 4PQGA 2IH5A 3ZV4A 4JUDX 2Q2OA 2IUFA 4K7JA 4V1CI 1Y1QA 1FMTA 4PZAA 1E60A 2GPBA 2R4UA 4A91A 1MPTA 4LCBA 2C00A 3A1FA 2YV4A 1I1NA 4P33A 1BQEA 3SDSA 3SXPA 1NXQA 2FUG1 2I2WA 2CJPA 3ASYA 5EJ9A 3N76A 4XLLA 1OPXA 4NZ9A 3T1VA 4EA6A 1DHTA 1YVRA 4WD3A 2FMXA 4TTTS 3EGOA 4X3PA 2VP0A 4RKYA 3P9RA 4WV3A 1TD1A 2Q3CA 3OC0A 3R09A 4LBYA 3M6LA 3QLTA 5GONB 4RTQA 4NFSA 3DBLA 2H48A 3C5WP 2ZS9A 3EZ6A 1XNJA 4NJOA 2WMNB 2XODA 3PQ2A 4ZICA 1T0IA 2V7XA 3NOXA 4S2EA 4A4DA 4ENUA 4NZZA 3WP0A 4IHJB 3ZWPA 1I7PA 4E3WA 2GETA 1WDTA 3ILXA 3IDQA 2ETXA 2QLFA 4MCAA 1IY1A 3PWKA 4BPBA 2CVZA 2J0QA 1W9MA 2I3DA 1DCFA 1NTRA 3R5FA 1IZ7A 1CG6A 1F0KA 2VAVA 2ZR8A 3QZUA 1NF9A 4K3VA 3UEOA 3V1UA 3B3AA 4QU9A 4DFDA 2O1SA 2VHCA 1HUQA 3Q7TA 1XZHA 5I7HA 3VH3A 4OG2A 1T2CA 4PLPA 4WCFB 2CDBA 5BUQA 2X7JA 4F91B 1T8WA 1Y9JA 5FUXA 4B8WA 2WP0A 3GEHA 4M49A 4B6FA 1N92A 2GLTA 2PK3A 3D3WB 1L6RA 1L4HA 3EDOA 4XM0A 3TLMA 3IFSA 1H2YA 4MS3B 2HHHB 8OHMA 1HDEA 5LQUA 2OP0A 3OCXA 2GMNA 2ZI7A 2DFTA 4IGKA 3AIMA 1GVNB 2EFEB 3MOGA 3MCUA 3VJMA 3K9GA 4XIIA 3K32A 3WGKA 2PY6A 5FOUA 3V46A 2NUAA 1UBHS 3KPJA 2BFZA 2V7EA 4L5JA 3BCUA 3FRHA 3BILA 3DAOA 3JZIA 3ESBA 3LAWA 1JDUA 4DIOA 1JXOA 5FL7A 1WKVA 4M0MA 4OOEA 2ONZA 4G9EA 2ZI9A 3VYTB 1YZHA 3T06B 4MV3A 1N0HA 4LSMA 2X0JA 1ICIA 5EZ6B 4DNXA 5I7WA 4WECA 2O8NA 4EGFA 2Q2VA 4UPDA 1YTUA 3FOBA 1G64A 2HNKA 2MMCA 5D6NA 2X9QA 2PCLA 4CMJA 3FAZA 4EHNA 1DUVG 4O8ZA 1AKUA 4D46A 1TMOA 4FS8A 4JJFA 2QVYX 4ZT4A 4JL6A 3SJUA 4ALJA 2VVTA 2W6NA 1TYAE 1DLJA 3CZRA 3IV6A 4HAYA 5BSEA 4JSYA 2CK3A 1EFAA 3H4IA 3ZWOA 4YBRA 2QBYB 3EXIB 1SRRA 2GA9A 2PKQP 4PX9A 5EMLA 1CS4C 1GAQA 3K53A 2AVNA 3OVMA 2FJUA 3P94A 4R8KA 1OAAA 3P4XA 3FLBA 1V5EA 2XYHA 1Z63A 3FG9A 2BF7A 1HT3A 1XYVA 1P1RA 1UEJA 2R84A 3NIBA 3SBDA 4C4TA 4HVCA 5LNK1 3AVWA 1AM4D 1E32A 1WUKS 5KILA 1SCNE 3FFXA 1X8JA 3JQAD 2C07A 2EFJA 1D2RA 3RC9A 4DDHA 1BVHA 4EFNA 2IS4A 4OATA 1UKYA 1ZUWA 5I8PA 1P9OA 5A3QA 3KU4A 3WKAA 2GN2A 4MWZA 4D74A 4CKCA 3HKDA 1DRWA 4PIMA 3X1WA 5DNVA 3JQ8B 3R9WA 4IXTA 5AOCA 2NVUB 1NV9A 4HN2A 1PDWA 2WWFA 3EIOA 1QRUA 2OG1A 1ZH6A 4CM8A 5BSKA 1HMYA 4BQQA 4HWKA 1GLNA 2VRWA 4ZO4A 1CIVA 3UT6A 2IPAB 3D3QA 3RODA 4YJ2A 1EXNA 2J1LA 2J9RA 1PQWA 2ZUBA 3AF5A 2CXXA 4GCWA 3RBZA 1QIDA 1JEYB 4LC9A 4Z7QB 4ZCLA 2JEZA 1M5TA 3NHZA 4DG8A 5FFNA 5A1TA 2QW0X 1WXIA 2VA9A 3MAAC 4LUCA 2F90A 2OD7A 1VL2A 2GUWA 5L4NA 3GT3A 2OK8A 4HQRA 4QOHA 5F35A 3U4IA 3H3EA 4TYFA 1PL0A 3CF6R 1II9A 4FB5A 4LNUA 5E6RA 4K5QA 2O0JA 2Q21A 5I9NA 2YVAA 1CQIB 4P3NA 2HF7A 2DT5A 4IX9A 4PFSA 3R76A 1SIWA 5FQOA 5IXYA 5JI3E 5E1MA 4IPTA 4KBGA 3M70A 3OCWA 3NC1C 3SR3A 5LXTA 1Z6YA 1Z7BA 3TAHA 1GADO 4CMEC 4RZQA 2BG8B 1P39A 3O0TA 3FR7A 3OZUA 2PKYX 4FNAA 4QXMA 4RW0A 4AW9A 4GKVA 1E7MA 2JI7A 2G9NA 5JYEA 2B20A 1G20B 3G5LA 1LDBA 4JKIA 4ETIA 4NZPA 5HDBB 2ZTHA 2XR1A 4C87A 2I6SA 3D0RA 2PMFA 1Z25A 3IUMA 3W5SA 3M82A 1SHZA 1W46A 3O26A 1AF7A 1H8ED 4IZIA 2O2YA 1F1BA 2YICA 2BLNA 2YFYA 4I4NA 3C3PA 3U9SA 4CLHA 1HZZC 1Z4KA 1ZMOA 1D4ZA 2OYSA 4BO3A 1SHJA 1C4WA 1N8TA 3CEJA 4HATA 5DSXA 4W5NA 1WU8A 3I09A 1C9EA 1XO1A 3KC2A 4G1FA 3PQ7A 1XTVA 4MW6A 4QPDA 3EG9B 1ILWA 4W82A 1OBOA 4IS3A 3L8CA 4RD0A 1YRLA 1YZFA 3IQGX 4H7IA 3PA8A 4TL8A 2H4XA 1V11B 3MA0A 1QZUA 4KPGA 1S2LA 2CLHB 1UK6A 5ALDA 1FSZA 2VIIA 2WPNA 2AYXA 4X93A 3EQ7A 1SCQA 1WCV1 3CNOA 1AIPA 1T4CB 1IXRC 4LSWA 2I1QA 5EJ8A 2HU5A 4BLUA 1USKA 3TTSA 1F7VA 2ACEA 4P35A 1YZTA 4QKQA 4N9QA 1E79D 1R10A 1ZSVA 2QTWB 2J32A 3M4JA 4GRDA 2KSQA 1L4NA 2JLRA 5ALLA 1W4LA 2FI1A 2Q50A 3UUGA 2RKBA 3UJNA 3W9SA 2XQVA 3BTUA 1UBUS 2IZOA 4KRFA 1LI5A 5L3RA 4BNTA 4N65A 4OAOA 3RS8A 3WI7A 4AWZA 3H9QA 3UPTA 4F71A 2BEUB 2QN2A 1XEXB 2C2OA 2ZS8A 2NG1A 4XSGA 4R31A 5COBA 2VNJA 1GGEA 1NLZA 2OV1A 3E03A 1ESZA 3ZZUA 1U1EA 1RHJA 1LK0A 3LP8A 3OFKA 5A1JA 1PE0A 3KXPA 5JD3A 1GG9A 1C1YA 4Q03A 3Q3HA 3TAUA 4R8SA 5M7EA 4UD6A 1DEXA 3G8CA 3GHYA 1G2QA 3UANA 9ABPA 3KU1A 4AKHA 1HE2A 1QZTA 1PT9A 3ESAA 5ELMA 3T54A 2I7TA 4J1NA 4QSHA 4LMPA 1IXKA 1LQTA 5AO9A 3SJ7A 1TYEB 2W2KB 2HHJA 4ZCTA 2QGNA 1TA4A 3QEMB 5J4LA 3IUQA 5DCYA 2HXSA 3NM6B 4W9RA 5IN4A 3HCEA 1JVSA 2NWQA 5LQKA 4JLOA 4FP9A 3QA3E 1KJ8A 3ENQA 5AVQA 3QU2A 3HKBB 1SUCA 3TPFA 1PJAA 1L3BA 2F64A 4QTTB 1TAHA 3NHAA 1MVLA 2QRGA 3R75A 1BWQA 4XVHA 4A8HA 1XEWX 4FCVA 1K3TA 2ZAYA 4AWXA 3CEHA 1K4KA 4B84A 4C7KA 3RTDA 2BBWA 3JARB 1VLQA 1HK7A 1YQWA 3NHWA 3ROMA 1SVOA 1FEZA 3Q2OA 4E3ZA 2YNWA 2FZGA 2JIDA 4HTFB 2GJAA 4I08A 4IOKA 2HEGA 3K16A 4QZVA 2GHIA 4RWZA 1J23A 5BR7A 1GZ4A 4C0QC 2Z2JA 2HMWA 3NU1A 2BELA 4B48A 1J56A 1IY8A 5K01A 1LS1A 1BKDR 1V9CA 3L9WA 4X45A 1ABFA 4GDFA 1QOZA 3FOWA 1I7DA 4C43A 3UJ3X 5H9WA 1IOVA 5K0ZA 3J80A 4N5HX 3D0QA 3OF2A 4KE8A 4YGYA 1DMRA 2KWIA 5CH5A 4ZQHA 3UENA 2FZVA 2IOFK 5EP1A 1NVGA 1ES9A 3TKAA 1QV9A 5AKEA 1I51A 4KPEC 2Z6QA 4TXHA 1L9KA 4WHMA 3LPLA 4RZHA 2I5PO 3HCNA 3KEMA 3MJDA 4GBGA 5HBRA 2PANA 3DA8A 1RJFA 2N1MA 4EG0A 4HVLA 4MAMA 1W5BA 1IDN1 4I0WB 4EB8A 4C6TB 3AP1A 5DHTA 3ZKWB 2DECA 1LS6A 3W2FA 2QK4A 1QU3A 5EXPA 1FK8A 1ZP6A 2FZKA 2P69A 2AHRA 2D74A 3UAZA 4GX1A 2NADA 4EG4A 3PF8A 3REGA 4B17A 3M3PA 3FCOA 1E5QA 2HGZA 1XBTA 1NOIA 3C70A 4MIOA 4ZQGA 3NNSA 4QU0A 4ZRMA 3AZOA 2P5YA 2UZIR 1RHMA 1R0WA 4LC1A 4B81A 2WA2A 1GLGA 1J25A 2G4CA 2MMGA 3AM5A 5A5FA 3CX8A 2AXEA 1G42A 1V4NA 3NS7A 4MW5A 4A8TA 2AQHA 4AJNA 3D2BA 1NBMD 5EW0A 4N5MA 5F5NA 2KX7A 1CYEA 1QHFA 2ZVPX 2GZDA 5BMOA 1IEQA 4GWGA 4HAZA 1E89A 2Y1FA 1MB9A 3SXUB 1GKLA 3AU8A 5JAQA 1W5FA 4CQLB 2GERA 1E3WB 3DBHA 3DMRA 3I23A 2Q45A 4BMNA 3P0JA 2V59A 3R7AA 1YVDA 1U6KA 4BRUA 1JQEA 4YXWD 2Z08A 1FFGA 5LLDA 2H4JA 3PD7A 1JKJA 1QYWA 1MT0A 4GOJA 1MFZA 3TO5A 2G6BA 2HDHA 5DNEA 3AKDA 3Q88A 3I8OA 5AUPB 2XRZA 3S1LA 3R3YA 3OLCX 3U3MA 3JZMA 4RESA 3MOIA 5CLHA 3VMFA 2I3AA 2WYOA 3KQQA 2JAOA 5ACRA 3KOUA 4MXDA 1Q7BA 2QLLA 3WYGA 2ZPAA 1KH1A 2GT1A 1B00A 3BEDA 2BFDA 4R2WA 3PKIA 4TLCA 1Q6ZA 1MO2A 1RKQA 3IJPA 3OFSA 1TPZA 3N1UA 5EEGA 4GLFA 4KIGA 3BN3A 5HF8A 1ZC4A 1RZVA 1DIAA 1RP7A 4B31A 4HDQB 5F21A 1CP3A 2IZ5A 3R74A 3I14A 5AK0A 2WZCA 4B2LA 1X7XA 4YDQA 2GN9A 4EH1A 5AW1A 5IHPA 5EESA 4EFKA 4JYPA 2AOTB 1K6EA 4NZYA 5HQ3A 4GOKA 2HSJA 5F12A 4IUYA 3NHRA 5EUMA 3UATA 4DSTA 3AJEA 1EESA 1NN0A 2VWHA 2HWKA 3T0FA 1X7ZB 2X6QA 3L49A 3BICA 3O1HB 4GI5A 4R98A 2IWHA 4GICA 1NV8A 2OCPA 3LVZA 4UM5A 1XTZA 4DUGA 2MSLA 3KJQA 1OHHD 4BTLA 1O9BA 3WJAA 4AJKA 5IQKA 1Z7YA 4S0ZA 1WMEA 3V8BA 4IIYA 1BS2A 1LB1B 3LP5A 4FHFA 3PBKA 4MLDA 1P8JA 2WU3A 3T9DA 1UC4B 3KETA 2FHPA 2K87A 2IHZA 2I6FA 1ZH4A 2QY6A 3K6SA 1SXJE 2Z3ZA 1TJ5A 1N77A 1NJ6A 1U2RA 3R7DA 4F85A 3GMIA 2IZ1A 3RBXA 4WZAE 4C3UA 5B58C 1CFJA 3A0UA 4JEIA 1YT5A 4FDLA 3IT1A 4JLVA 3LUCA 4Y0VA 2E82A 2CUNA 2OCGA 3H8SA 3BXHA 2AI2A 1IAVA 1MD9A 1ZIXA 1QRRA 2IP1A 3SC6A 1SVKA 4CIDA 3GP8A 1EP3B 5CT9A 3W9UA 5ESXA 4F4JA 1M2OB 4NU8X 3IPYA 1SXPA 4WY5A 5J5VA 4QT4A 1U3WA 3W5UA 2ACKA 1N3LA 1DXKA 4JELA 1BKSB 3KWMA 3KYCA 2HA0A 2PWZA 1UK7A 2VJCA 3LDUA 4D4HA 3KAPA 1VIDA 3KZVA 3SZUA 1P0PA 3L6NA 5ALJA 3OE7D 4Y2JA 1LPOA 8ADHA 5FBLB 1L8OA 2CYCA 1K4YA 1PJTA 3JR3A 1UFQA 1WXHA 4ROSA 4B83A 5JWHA 1UMCA 4LXQA 5AVVA 4N3BA 1M75A 1KJNA 3HB7A 3VI4B 2V6JA 3O7WA 1F60A 1QXSA 3TQHA 3QMMA 2EERA 1RXSA 1U9JA 1VJ5A 2D5CA 1L1QA 2UZ4A 3DL4A 2O4UX 2PUWA 4BB0A 4IZOA 2FOIA 1RR6A 5BN4B 4NATA 4ZRDA 1AUVA 4UHBA 1PJRA 3UYLA 1BCRA 1CE8B 4IWXA 4RK4A 3UUEA 4NMLA 2ZR0A 3WLNA 4UQOA 3RS2A 1EG2A 1BX1A 1PEDA 3BL8A 5KEIA 1TI7A 4I5IA 3INNA 2PS3A 3CLSD 1CEQA 1F12A 2B30A 3HYCA 1OXKB 2CD7A 5JPDA 1FNBA 1GTVA 1Q44A 4MIKA 4XW2A 4MKRA 2QV0A 2XGGA 1FDSA 1JDPA 3UH1A 3ZCSA 4JI0B 1UQUA 4IMJB 4MW4A 5G0VA 5GGXA 5C8YA 3U4MA 2P1EA 2OGWA 1T8YA 4CEJA 4AX0B 3M1IA 4WFQA 3S8EA 2ODBA 3C8UA 3BB4A 2OWEA 3DDZX 4XD7A 4P62A 5J4HA 4H3HB 4CTJA 4R3UC 4Q9AA 4CLRA 2B5OA 2AC2A 5KWVA 3FIUA 4RGVA 4FHDA 3OKAA 4MUHA 4YCBA 1IL0A 4QXPA 4ZZ0A 1HI9A 4N7JA 1BN7A 1G41A 1WSBA 3EA5A 1MW8X 4NEQA 4QGHA 2QUZA 5AOAA 2PG3A 5CNJA 3U3DA 1WXFA 5F52A 5JY6A 3I61A 3ZD6A 3A1NA 3B8HA 3TRJA 5FEUA 5TJ9A 3L8EA 3ZBTA 1JSZA 1WP9A 3HXMA 2O2ZA 5AUQA 2IYYA 4WDRA 1IPFA 1DQRA 1U98A 2IZ6A 2RAFA 3TR0A 2ZWRA 2OMKA 3AR8A 3FRIA 3WWDA 3ETGA 3DOIA 4TKVB 1P33A 3V8EA 4B32A 1L9XA 4UNSA 3A1CA 4IEEA 1W96A 4L6AA 1EBFA 3FOCA 3N8HA 1R0KA 2E48A 2BFAA 3ACDA 4GRAA 5T6MA 1EUCA 3BBPA 1QVWA 4F06A 5BY2A 5CDFE 4ZTZB 4IDCA 5AEBA 4IUCS 1KVSA 1DAPA 3UVEA 2ATVA 4LYYA 3ESCA 3BRQA 4ARAA 4U1RA 1QHIA 3IOFA 1OXVA 2JGDB 3VJKA 1DRUA 1E2FA 3H86A 4LYHA 4PQEA 2GR9A 1KZ1A 3ROKA 3ZVLA 1BMQA 3ZLVA 3SAJA 4BV8A 1IMJA 1SBNE 1G5PA 5JXJA 4KN5A 2AN9A 1IUKA 2WF9A 3KOOA 1WY7A 4KAJA 1EK1A 2OHJA 2NU7B 4R6WA 1NQUA 2FU7A 5B1DA 3CZ4A 3T7JA 1MX5A 3GLGE 5KYKA 3I39X 3ML1A 1WETA 3LOQA 3BD9A 2R5WA 2CFUA 2GKOA 1Z0SA 3HCAA 4HDMA 2KLBA 4UAUA 4CT4B 3WIEA 5MFZA 3ZLJA 3G5AA 4Z8XA 1JJIA 1JSRA 2XNDA 3UHPA 1WZIA 1PG2A 3N8IA 4B1FA 2AF3C 1KKUA 2B2CA 3FTCA 1XEWY 3A11A 4B4UA 2I8CA 1Z16A 1E4EB 1QQ5A 1W6UA 3KVYA 5SV2A 2H5EA 3C6BA 2D06A 1TT5A 3CWQA 4XGIA 4WFJA 3C7DB 3GLFE 1GNQA 4B82A 3ZU5A 1W34A 1T5OA 1XRPA 2DH5A 4KR0A 4Q6WA 4ZU1X 3PX3A 4IFIA 2DTDA 4EF5A 1OC4A 5I5GA 2ZRGA 1IJBA 5CT4A 4J0QA 3DKVA 2XADA 4GQIA 3TSYA 2RB5A 3EXHB 4ZHQA 4UNPA 4AI6A 5HS6A 4NEGA 1CSEE 1K92A 1LVHA 1XT6A 2RGNC 4GNKA 5EFZA 2P6NA 1A8QA 1R0CA 4K9QA 4U0KA 3QVXA 2FFQA 1V4VA 1XOIA 2I6QA 2VNSA 3AUXA 1QK5A 1V8ZA 3TPCA 1VYTA 2VL7A 5CTAA 3SM3A 2QSYA 1QNFA 2XGSA 1S2GA 3R24A 1ZINA 3V80A 5IT9A 2ZITA 3O1IC 1JXMA 1T10A 1FP1D 2XMBA 3FJOA 5K6RA 1NJ8A 5JH7A 3O8QB 3UGJA 1QHYA 3PWZA 5FD8A 1QHHA 3O8BA 4LZWA 1GO2A 1DEOA 3ZQUA 4YUXA 5E2IA 3GUHA 5ANRB 4Q02A 3WMXA 5L4SA 4XYBA 2ILTA 1WF3A 2P8JA 3RU7A 3DH8A 3QKIA 2FMKA 4KODA 4G1MB 4RS4A 3NETA 2ZM5A 3N2GB 1MIOA 1ST3A 3KL2A 3QBJA 3BPSA 4PGAA 4CFSA 2ZIXA 2W70A 1IG0A 4HLCA 4I9FA 4U8GA 2ZRJA 1AQJA 4RLHA 5KNCD 3A31A 1U8TA 3SQMA 2QMEA 2FXVA 4GBMA 4RZXA 4KLNA 2V0NA 3AVQA 2C1XA 4A8JC 2YASA 1E9AA 5FXMA 2VUSA 4KQ9A 4OGGA 2Z9BA 5CDYA 3FGZA 4ER7A 2BKXA 1N2CE 2YWRA 3PFBA 1UJMA 5AHRA 5ALPA 5DDIP 2UYQA 4R84A 5BP7A 4JI7B 2FA9A 1R66A 2W83A 1N2GA 2PN1A 4LYDA 3MWLA 4C5BA 2XF8A 1EFCA 1U0FA 4W1SA 3TFQA 4R69A 3E2MA 4JC8A 4WEOA 2NXEA 1R7RA 3B48A 2O19A 2P5SA 1IBRA 1SUSA 1WZ2A 3PHBE 4YMTA 3MS7A 1ZNYA 4OSEA 4QODA 5E7IA 2XCQA 1ZCJA 3V2UA 5HIAA 2OBLA 3TLAA 3DXXA 4P7KA 3INGA 4L9AA 3IBCA 2AK3A 1TZCA 2QVLA 2G0NA 3K9BA 1KE2A 2YHSA 3ANLA 3KR0A 3LPCA 5KVVA 1T35A 1ZVMA 1LEHA 2R7KA 4FGZA 3JQGA 1CJSA 4ENRA 5ACPA 1FY2A 3HKEA 1YZYA 5A4MS 3WYEA 1MZVA 3OE1A 2OXRA 3Q5DA 4KG7A 5K8IA 2NX2A 4J7CA 5ACWA 1QIFA 4MR7A 3ZCVA 2BUCA 4A3SA 5HUHA 4UHFA 2PGAA 4PN7A 5EVJA 1G7TA 3DAFA 3GGPA 5GJWC 1HKHA 4Q39A 3BXZA 5EI5A 4Y6SA 2OQVA 5C1PA 3TWOA 5DHAA 3GW8A 2RAUA 2OB2A 2QZZA 3C97A 1H4SA 3PX2A 1KRHA 3H83A 3K5IA 3OETA 3SJCA 2IBMA 2ZQYA 3EXFA 3EZ7A 4LSZA 3GLHA 1P4HA 4X1KA 5DTRA 1TX4B 2BTQA 4BLVA 4CUZA 1P5RA 2HZBA 3FNHA 4QVGA 1UR5A 4FEGA 4JQCA 2EX4A 3TLGB 2BGLA 4F11A 1NY5A 5DF1A 5H68A 3W34A 2D59A 3ENNA 2V6BA 1T2NA 3PYXA 4F3RA 2JAWA 3ANYB 5E7QA 2QZPA 2VJOA 3E9NA 4IIFA 4UDNA 3HNPA 1OXBB 1JG6A 2IZZA 2BJWA 4O4IF 3UCEA 4ALMA 4LJRA 4GFDA 4IGFA 1QCZA 2GHQA 3NJ8A 3B6IA 5IEBA 3WNZA 5A4KA 1UPAA 2O54A 1A27A 5BSUA 1UBKS 3W4IA 2BE7A 4BDSA 5CFOA 5A7GA 4K9SA 1P9LA 3O9VA 4ICIA 4BXOA 3I6ZA 1L5HB 3CG4A 2UXDB 1QX4A 2NTYC 5ADHA 3PP8A 3GP3A 4C7OA 5KTKA 4K9OA 1H69A 1YR2A 2JJ2D 3MRSA 2HT6A 1SCIA 1RTKA 2E4XA 1EK2A 3HG7A 4V02A 1PR1A 4AMUA 4MUNA 3T1NA 4Q82A 4UZEA 4YVFA 4G0VA 4HDNB 4OOFA 5BNZA 3SIXA 1JB1A 4B6RA 3H4TA 2Z8YM 3GZJA 1BNCA 2UYYA 1E1QA 3TVDA 3ONEA 1DD6A 3L92A 3HK2A 1E3SA 2PXXA 4BLOA 3QP9A 4E1VA 4I6JA 1MQOA 4DCSA 5DX1A 4JLNA 3L40A 4BV2A 4OXRA 2JK0A 4TMKA 5JS8A 4C4PA 1ZO8A 2NTVA 4B3HA 5JAUA 4EXSA 4AM8A 1KQFA 4BFYA 1M6WA 2CSUA 4K9DA 3VYVA 4CR6A 2DPLA 1BC5A 3F97A 3HA3A 4OKIA 5LP1A 3DH0A 2VK4A 2PL9A 3OCCA 4L02A 2GCIA 3F90A 4J2TA 4NURA 3E9CA 3LBYA 2R9VA 2WFLB 1V6AA 3L1JA 3RYHB 3BIFA 2QW1A 1GAWA 1Q7CA 1ZN7A 4GR4A 3MC1A 4OVKA 1HNWB 2DUNA 2BFCB 1O6BA 1I2MA 2QAIA 3BJRA 5AP9A 2YV1A 3I5MA 3ZE6A 5KVAA 4Z5ZA 4MUYA 2P9FA 2QE7A 4DAOA 2GHRA 1RRGA 1B73A 1MC1A 2P4EA 5DMHA 1GSHA 1GAXA 1VPVA 3TQOA 2J46A 1KMMA 3QSYA 2Q6KA 3U44A 4FB4A 1JYSA 2VK1A 3A37A 4GR9A 2NXNA 3UWPA 4B71A 4GXNA 5BQXA 3SCZA 4OQMA 1DJPA 1AF4A 5ECDA 3Q72A 4RFLA 5EYPB 3MHPA 1KMCA 3RU3A 1Y4DE 2GJ8A 3WB9A 1LQUA 1QKKA 1U9YA 1MGOA 1PU2A 1YCHA 3UGTA 4BFZA 4R9UC 1E6UA 4EL0A 2ZJFA 4MRNA 4ALLA 2IEYA 3KSMA 4NESA 3SWWA 3MJHA 4QXRA 1XVVA 4YACA 4AXXA 4EI2A 3REQB 3CFYA 3R3UA 3DEZA 3RJ9A 3CVVA 4BX0A 2OXEA 4EBBA 4JVOA 3PNLA 2QKYA 4MARA 3IOGA 2C2XA 1A9TA 4AYTA 1UC5B 1RRPA 1UBTS 1W19A 2HDOA 4TVKA 3R2UA 4B3GA 3V34A 1UZAA 3AT1A 4HGRA 3LOUA 1V43A 5ISMA 4P7GA 5A5GA 4WCDA 3ZHVA 5C52B 4J16C 1TEXA 2MSWA 2P5UA 4JODA 2J45A 3IXQA 3GUVA 3SHQA 3LWZA 4C4XA 3T1TA 4BBAA 4P32A 1HFKA 4HY3A 4P6VF 1XMJA 4M8IA 1VBNA 4MVJP 4NI5A 3TD2A 2HWYA 5JVDF 3PUKA 4Q3AA 1RLIA 1X2BA 2EU8A 4E08A 4PG4A 2X8JB 5A87A 2PH7A 2A1IA 1XRLA 3B85A 4JX8A 3FETA 4FEEA 4XWOA 5DN6D 1TU3A 4BTEA 4DMUB 3AJAA 3BWBA 5CHEA 5BMVB 4NMWA 5T7BA 3DJFA 1VDMA 1SXJC 5KHAA 3ESRA 1Y3HA 3TNYA 3STVA 3NBUA 5JTUA 2C7RA 4OQFA 4X84A 3SICE 2BBTA 2Y67A 2YFHA 2EWMA 3ZGNA 5CA1F 2Q0IA 5F7XA 3K0AB 3RVLA 2ATIA 3QE2A 4RVFA 4D0NA 5TC4A 1SPBS 4D9KA 5JQWA 1ZUHA 3F96A 3EZ9A 5G02A 2DVMA 3FD8A 4ZJUA 3KV1A 1ID8A 4POOA 2EGHA 1E1KA 2VDWA 3UY4A 3QU9A 2XMRA 4EKGA 5C3MA 1QQAA 2QG9A 3QX7A 4QBGB 1EGQA 3FNRA 3NIDB 1LBIA 3WO1A 1ZESA 4BN4A 2FZLA 3ZNBA 3L8MA 5LZ5A 1VQ1A 4KDCA 5DH9A 3STHA 3UBMA 4PXYA 3ZH9B 1L4LA 3QFTA 4DYHA 1W4AA 1PLKA 1Z5NA 1KFCB 2Q5OA 4XVRA 1VC2A 4Y9SA 3TQCA 3A6GA 3K0CC 2FZCA 4N8EA 4FXOA 1D0VA 4NMHA 1NLUA 4WACA 3MNFA 1PR2A 5JDIC 5JBQA 4I19A 5AK4A 4IEFB 5A9SB 4P9NA 5IEJA 1ZR2A 3HCOA 2JHAA 2C0QA 4R1UA 4Y7DA 4JI4B 3VHRA 2DFVA 5LU8A 1YI0A 2EP8A 5GVRA 3SY8A 3ZV5A 1NW9B 1ZK4A 1V48A 4G5XA 3U1VA 1FUYB 1JWBB 2PZKA 2YQ4A 3FKJA 1MXFA 3KUUA 3MGCA 4X1IB 3VGJA 3BQNB 1J90A 2CHGA 1JG1A 1ETHA 3CVWA 2NZYA 4Y6LA 2IPMA 1TVMA 3L8DA 2JH9A 3KDPA 3G59A 1T1EA 2XY4A 3C85A 2ZTSA 2N47A 3WFZA 1VXRA 4NP6A 3BH7A 3LPDA 1I4TD 3KTAB 4O2BF 2RHBA 4TTAA 1WHTA 1SUIA 3BAZA 4OI0A 4OGFA 2XMGA 4YMSA 2VPWA 1F51E 5H02A 2AL7A 1YAJA 4RKRA 5ELLA 3ZWKA 3WGUA 1WSAA 2HJ9A 1EVKA 1JDNA 2PGOA 1OY1A 3OFJA 2RGDA 4RVNA 4EVSA 5MHTA 1S2DA 2OCXA 2QEQA 2V7QA 3I9MA 3OU2A 3TQIA 4GXQA 1Z5GA 3FZEA 3A1EA 4RQUA 4YJHA 3STYA 2Q42A 4Q1EA 3UFBA 3NYWA 4LOKA 5G1OA 3RVPA 3ZI4A 4MVXA 1VHJA 1BS9A 3GHHA 5EINA 5HOQA 2BM9A 3T41A 1AV7A 3RU2A 5MFPA 1UDCA 1B6RA 2WMOB 9GPBA 5KCZA 1JT2A 1OVMA 1X3SA 1SC6A 3A2NA 1RYNA 3EASA 3X44A 4ZU6X 3WIBA 2Q9AA 2CLEB 2YW2A 4KK4A 4QPCA 4KWHA 4TSFA 5ALEA 2AZ4A 3MJVA 4D0GA 1CK4A 1YJAA 1H2AS 2JJ8A 1U8FO 2Z5GA 2W6QA 2UUAB 1RAFA 1X77A 3IOCA 3NVDA 3S2ZA 1SOVA 4QYIB 5A5DA 5B3JC 1YQDA 4DRYA 4D26A 3I5AA 4LYEA 1PWZA 4Z2YA 1XZCA 2J6IA 3QWBA 3OJLA 1FB5A 1NBME 1Z35A 2A67A 4B3IA 3T1QA 1EGVB 3PT9A 3D6JA 1FYXA 3D3NA 3FTEA 2A7XA 3N2EA 5LOVB 5KYYB 2HHLA 4QECA 3AL0C 1VE6A 4ANFA 3AG6A 1ONPA 2D7DA 1U7OA 1V5FA 2V6GA 4IVQA 3K70B 4AKIA 4N12A 3ZNQA 2VJYA 4G4SO 3W79A 1HBJA 4DLAA 3Q6IA 5C35A 2G83A 3J7AC 2CHQA 3H42B 1J9EA 1BCSB 4RH0A 1X0VA 5DLYA 3RBVA 3HRIA 5HIJA 3D59A 1KDRA 4H4DA 2CL7X 1V37A 1U81A 3OZWA 4H18A 4IXMA 4LJ7A 4RUKA 3UJHA 2OFOA 2O8BA 3U13A 3KXKA 3VR4H 3N59A 3PT5A 1J0BA 5JJLA 4WZBA 1YIOA 4AJ4A 4EHDA 1MJNA 1PZHA 3CYFA 3JD0A 4HNAA 5DRTA 5C1OA 1QG6A 1USGA 2WHYA 3W2EA 4YPOA 1OSNA 5CEEA 2IUEA 3ZH2A 3UW1A 3IE1A 2A59A 1I14A 4HUTA 5KO2A 3GROA 4HTAA 3ROZA 5EWMA 2ECOA 1UXKA 4P58A 3WAKA 3OURA 5KKNB 4CQMB 1HEYA 4TROA 3THRA 1RZUA 5ILGA 3QVWA 3L8GA 2CXQA 1W1UA 5T4EA 2MSKA 1SMLA 2I3GA 2HA3A 4QXQA 3ADCA 3PGA1 5BW5A 4GI1A 2ZS7A 4FYKA 2YV2A 4CW7A 3GPLA 4PLHA 3HP4A 2G9RA 3A9VA 3QI7A 4MUXA 4OBEA 5EV6A 4OUDA 3IOMA 3QWAA 2AFHE 5DWVA 2XIJA 2LBPA 2P75A 1HLGA 2G77B 1IUPA 1F5NA 2ZRQA 4WBNB 2D13A 4UOQA 3WZ2A 2QTRA 3K0SA 2ZIEA 2IIPA 4MAFA 4DW8A 1C1XB 3FCSB 3DEHA 4O33A 1UPBA 2PS1A 4IVPA 1JYEA 4URHA 4C05A 4UTRA 6YASA 2BEVB 4HO1X 3MHTA 3O83A 5AHXA 1Z73A 1ZOIA 1O8BA 4G67A 1OILA 4DDUA 3Q1LA 5AJZA 4W5OA 1VP9A 2QN6A 1XN4A 4BX3A 3OTWA 1MUUA 1BDHA 1QK4A 1FS5A 5AXRA 2CJYA 4HLNA 4EITA 3VYUB 4BNHA 5C2JB 2JCXA 1OX4A 3I3OA 2IPNA 4ZYLA 5IULC 1EFHA 1RACA 4N5LA 3MXOA 3WGTA 1OD6A 1VL5A 2NV0A 2QRLA 3NKLA 1TT7A 1WRBA 2BKAA 2VAMA 3PFCA 3Q7SA 5GADl 4M1WA 3R8CA 4LHWA 2O3QA 1KDOA 4K6OA 3O3MB 1VGQA 2BKEA 3EIEA 3QITA 1N4DA 4RM2A 1OKKD 1EGMB 5CK5A 5FBKA 5KQLA 2Q7XA 1P19A 1IH8A 2D0PB 1VP3A 1KDVA 5FNVB 1MPXA 4WTOA 5AXDA 5GZ3A 4J49A 4F2WA 2DBYA 5FV7A 1EUQA 3S7ZA 1P4SA 4EW6A 4PCUA 5LM3A 1PEKE 2A84A 3IJ5A 1K5HA 4C04A 1OU4A 5K0NA 3LRXA 5BXYA 3I5XA 2V4ZA 3IXMA 1SK8A 4V38A 3FX2A 3CUEF 4JNCA 1PK8A 3JQ6A 4ACAA 1TMYA 4D4MA 5IF3A 3SZMA 3NTQA 3ZVKA 4GXRA 1U0EA 2FLWA 5KI6A 1QE3A 3THYB 4H0FA 4C0KA 3DNPA 3E1KA 5B30A 3QBTA 3G1PA 4EGJA 4UVIA 1NVFA 5CAEA 1ZOPA 1MBZA 5EHGA 2Y1XA 2CN1A 5DWDA 5ALUA 2R7MA 2HFKA 2VFAA 4GE0A 4J91A 4AJ9A 3W8NA 4DC1A 2VYNA 3RTEA 3OZTA 4W5HA 1BD3A 1J2JA 4S1WA 4Z9XA 3HBJA 3WJ1A</