2I7XA

Structure of yeast cpsf-100 (ydh1p)
Total Genus 158
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
158
sequence length
717
structure length
499
Chain Sequence
MTYKYNCCDDGSGTTVGSVVRFDNVTLLIDPGWNPSKVSYEQCIKYWEKVIPEIDVIILSQPTIECLGAHSLLYYNFTSHFISRIQVYATLPVINLGRVSTIDSYASAGVIGPYDTNKLDLEDIEISFDHIVPLKYSQLVDLRSRYDGLTLLAYNAGVCPGGSIWCISTYSEKLVYAKRWNHTRDNILNAASILDATGKPLSTLMRPSAIITTLDRFGSSQPFKKRSKIFKDTLKKGLSSDGSVIIPVDMSGKFLDLFTQVHELLFESQVPVLILSYARGRTLTYAKSMLEWLSPSLLKTWENRNNTSPFEIGSRIKIIAPNELSKYPGSKICFVSEVGALINEVIIKVGNSEKTTLILTKPSFECASSLDKILEIVEQDEDGKSFLCDNYISIDTIKEEPLSKEETNFDNLDYLKIDKTLSKRTISTVNVQLKCSVVILNLQSLVDQRSASIIWPSLKSRKIVLSAPKQIQNEEITAKLIKKNIEVVNMPLNKIVEFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein CFT2
publication title Polyadenylation factor CPSF-73 is the pre-mRNA 3'-end-processing endonuclease.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein, protein binding
total genus 158
structure length 499
sequence length 717
ec nomenclature
pdb deposition date 2006-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16661 Lactamase_B_6 Metallo-beta-lactamase superfamily domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10890 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2i7xA02
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 2i7xA01
4EYFA 3X2YA 4O98A 5B3RA 2YNWA 4AWZA 2YNTA 2BGAA 2QDTA 5ACRA 4C09A 1YCHA 3IE1A 1X8GA 4D1TA 3RKKA 5HH4A 5EH9A 5HH5A 5AHOA 1BMCA 4TYFA 2UYXA 3ESHA 4FSBA 5A5ZA 5LE1A 5ACPA 5HIOA 5ACQA 5LMCA 3I14A 2YNVB 2WHGA 2XF4A 5EWAA 2FHXB 5K4MA 4BZ3A 2NZEA 1DDKA 4FEKA 3Q6VA 4YSKA 5ACVA 4TZ9A 2GFJA 5LLDA 3BV6A 2I7TA 3SW3A 5LS3A 2Q9UA 4UWRB 3KNRA 4D1VA 3H3EA 4NQ2A 4YSLA 2I7VA 3IOFA 3T9MA 3ADRA 2HB9A 2FM6A 2YCBA 5LCHA 4V0HA 5HISA 3AF5A 5HH6A 2FU6A 3BK1A 2BG8B 3RKJA 2FU8A 1HLKA 1XTOA 3KNSA 4GCWA 5AXOA 3FCZA 2DKFA 4J5HA 4KEQA 2NZFA 3IEMA 4DILA 4J5FA 4JO0A 2FK6A 4Z5YA 3L6NA 2DOOA 5EVDA 2P1EA 2YZ3A 3JXPA 2H6AA 4PVTA 4C1GA 4C1CA 4NQ4A 2P18A 3SBLA 2BFKA 3I0VA 3G1PA 2OHHA 4EY2A 4TYTA 3DHAA 4RAWA 4EYLA 1BVTA 3SPUA 4UBQA 3BK2A 3P2UA 4NQ5A 4UA4A 2M5CA 5A87A 4WD6A 2YNUA 5ACTA 3T3NA 2Q0IA 5LSCA 4RAMA 2ZNBA 4UWSB 4KEPA 1Y44A 4EYBA 1A8TA 3IOGA 2WRSA 4NQ6A 5ACWA 4AD9A 1JT1A 2I7XA 1X8HA 1DXKA 2BG6A 3VPEA 3KL7A 5KILA 2BG2A 3BC2A 2QJSA 4PVOA 1DD6A 2BFZA 5LM6A 1ZNBA 1YCGA 4ZO3A 4Z7RA 1MQOA 1JJEA 4HL1A 5EW0A 3IELA 2CBNA 1QH5A 3LVZA 3PG4A 1YCFA 2Y87A 2Y8AA 2YNTB 4XWTA 5AHRA 2BTNA 4CHLA 4C1DA 3I13A 2GCUA 5IQKA 2E7YA 5EVBA 4HKYA 3I15A 3I11A 3TP9A 5AYAA 4D1WA 4P62A 3F9OA 5HIQA 4AX0B 4GYUA 3AJ3A 3FAIA 2P4ZA 4UWOB 3WXCA 2QDSA 1K07A 2ZWRA 4D02A 4C1FA 3S0ZA 4HL2A 5FQAA 1A7TA 4BP0A 2FU9A 2GFKA 2WYMC 4RM5A 4Z5ZA 3IDZA 2ZO4A 5LCAA 4TZBA 2BG7A 4ZNBA 3IE2A 2Y8BA 5LCFA 3ZQ4A 5EV8A 5A0VA 2GKLA 5EVKA 4RBSA 4AX1B 2XR1A 4D1UA 1WUOA 4EFZA 3ZWFA 3R2UA 2YNVA 3AF6A 4H0DA 1ZKPA 3SD9A 2A7MA 1VGNA 2FU7A 5EHTA 2FHXA 1BC2A 1WUPA 1L9YA 3PY6A 3X2ZA 4C1HA 3ZNBA 5AXRA 5A0TA 4Z6XA 2M5DA 3SRXA 2AIOA 5DPXA 2NXAA 3IE0A 3T3OA 3IEKA 4AWYB 5K4NA 4RL2A 3RPCA 3MD7A 2BR6A 2QEDA 5AEBA 1E5DA 2P97A 4FR7A 4F6HA 5EV6A 3ZR9A 4EXSA 4C1EA 1XM8A 1KO2A 1P9EA 2BG8A 4UAMA 2R2DA 3X2XA 2OHIA 2Q0JA 1X8IA 4ZO2A 2BMIA 1KR3A 2AZ4A 4TZFA 2WYLA 1QH3A 3QH8A 2NYPA 4YSBA 4GYQA 2QINA 5FQBA 4DIKA 1WRAA 4RL0A 2BC2A 1ZTCA 2BIBA 4TZEA 4XUKA 5ACSA 1KO3A 3DHBA 3VQZA 4F6ZA 4EXYA 5K0WA 4LE6A 2BFZB 2OHJA 4XWWA 5K4KA 5FQCA 3A4YA 2WYMA 4U4LA 5B15A 2BFLA 4ZEJA 1VJNA 3SFPA 3DHCA 4Z67A 1WW1A 5B1UA 3PY5A 1SMLA 3X30A 2VW8A 4UWPB 1JJTA 1VMEA 2Q42A 5HIPA 3DH8A 1M2XA 4Z60A 5ACUA 2ZZIA 5ACXA 4B87A 2GMNA 5KIKA
chains in the Genus database with same CATH superfamily
2P0AA 3TTVA 4UEOA 4F1WA 2AG1A 1I7SB 3A27A 2O2IA 1H8EA 5L7YA 4RMIA 4QWMA 2GBIA 3V4ZA 5JJ5A 2YNMD 1H2EA 3RWBA 1YZNA 4CM5A 3AHFA 5J59A 5JAIA 2Q2QA 2WFMA 4A92A 3TGPA 2PV0A 2GF2A 1X1QA 3OHPA 4HD8A 3LLVA 2F1OA 3EARA 4Q82A 1V35A 3KBBA 1D2RA 2P9EA 5AH0A 4NCBA 4XI9A 2D1RA 4L4SA 2XGOA 3FWKA 3PYXA 1XU9A 3LP6A 4PAGA 3V34A 4QU5A 1XQ1A 3TOVA 5DBHX 2P0YA 3PXAA 1OSNA 1LPPA 1JQDA 4L3VA 2VQ6A 4KH0A 3SNHA 3VTFA 3NHYA 3P4YA 1E9DA 5IJ0A 2DWUA 1KF0A 2ZRBA 3L02A 3ESQA 3R6DA 1JLLA 5LJLA 3OLZA 3Q15C 2TMYA 2QW1A 2NM0A 4LJ7A 3LHFA 3W6OA 2QMZA 3MXTA 3WWCA 1XL0A 2R6CA 2NU6B 3OQOA 2DCMA 5JQGF 1ZCAA 2F43B 3L1KA 3H0EA 2XRZA 3KT6A 3H13A 3KRTA 1P4RA 2W71A 3T4XA 4AD9A 4NBUA 1XNQB 5GJVC 2V0NA 4AS3A 4AZ3B 4YCSA 4TTJA 1I7LA 1KETA 3WBKA 5ITVA 1GN8A 1R0LA 1WXXA 4ZT3A 2XUJA 4TN1A 2AA3A 3TRKA 2C96A 2HMSA 2KBEA 1D2MA 3CTMA 4DB4A 3L9WA 2VSNA 1PS8A 1A8QA 4K9DA 3BQNB 3ZDFA 1UPXA 2CFOA 3WLQA 1G8JA 2VIIA 4QTUB 3ZHXA 2QUZA 3EA4A 3DWFA 3EVDA 3QOXA 3NTUA 4UBKA 5HE9A 1TADA 3RFUA 2ALJA 3U0VA 1BE0A 3JATB 2B35A 4IXWA 3WK7A 4DAOA 1SHKA 4R1NA 1RDFA 1GWNA 3LWDA 4U0KA 4BUJA 5CMLA 3SQMA 3TM4A 2H85A 1C29B 4M1SA 3ZWXA 2CJXA 4P6VF 3QNUA 1DKQA 3T1QA 4FQ8A 1BEEA 3KYDA 2P11A 5HK8A 1GTSA 3LXXA 2HWWA 2ZQZA 1N5RA 1TM3E 1JDUA 1W85A 5J1TB 4HAVA 1FDSA 4TL6A 3ZPXA 1ZHFA 1WU8A 3QLTA 2G9NA 3WXBA 5J2UF 2GDZA 2H63A 1XK7A 1I4EB 4WNYA 3A3YA 3L8ZA 5KHOC 3OT5A 3C6BA 3PHHA 4M9UA 2GD0A 2NZUG 4TMYA 3A4IA 4RETA 4E15A 2G40A 4RJJA 1KXZA 3E22A 2OPHA 3LBFA 4HH0A 3ZYCA 1W36D 4V0HA 3FCUB 1Z28A 2QY9A 4M89A 1UMCB 4KN8A 1LI7A 3J7TA 4RZ2A 2DG2A 1AGYA 1JMKC 1KGDA 1OILA 1Z9BA 2F4VB 3AY6A 3ZWBA 4BNHA 3PGKA 2AOUB 2D8MA 5HF6A 1YE8A 5C1DA 2SECE 3G59A 2H7YA 1QHYA 2P6NA 3OM1A 2ZTHA 3T9CA 4CLOB 4RTLA 2CNOA 2JGDB 3G8AA 3BX1A 4FXPA 3ZBPA 4DT1B 2VXOA 1SQSA 3MRSA 5AR1A 1COWD 1XRLA 4Y67A 1Q7GA 2J9YB 5FWYA 4BZWA 5CTAA 3QXGA 4K9KA 4DWVA 1TM5E 3F9CA 1MRZA 1ST2A 1Q74A 2WP8J 3L05A 3WLFA 1C7JA 4E21A 1I7QB 4K8OA 2J0EA 2QAIA 4NCKA 5L51A 4LF7B 4IIGA 1I4TD 1OXMA 1R6TA 1W5EA 3Q10A 5EZ6B 1OV4A 4OPMA 4B32A 3H3XA 2FQYA 5H3LA 1ZKDA 1MOZA 3MSCA 2E0IA 3CVYA 3GJ6A 3R44A 3EXG1 2GQ0A 2Q1UA 5AUQA 4R8KA 2X5XA 3JVIA 1EGQA 4UD2A 4LQ4A 4R7TA 4CLHA 2V1UA 2ZWIA 3AKZA 2VDMB 4KXMA 1CUGA 4UBLA 10MHA 4NPHA 4B82A 1NYLA 4F56A 1ORWA 2GDJA 2RKOA 5A71A 3KSDO 4HB0A 2E55A 3VPBA 4F2PA 1FX0A 1K1EA 2BE9A 2HT1A 2VSFA 4LXUA 1UXIA 3MWEB 4XEUA 5MFPA 4U8GA 3ESCA 5CDTA 2ZRMA 4AMUA 3EGEA 1CZKA 1U2DA 5KVCA 4RIEA 3OZGA 1J49A 3TO5A 3KQMA 4NU6A 4W9MC 3SXJA 4B7CA 4P82A 3E5HA 5LP6C 1D4ZA 1M5TA 3KPYA 4OD0A 3NNSA 2X0RA 2Q99A 4D0GA 5I7FA 4KACA 4U2BA 1M6WA 2C8LA 1Q7CA 2LWIA 4H77A 4U4AA 3D7LA 5LMUB 2I1VB 2B7BA 4CF7A 2C4TA 3LBHA 1O0SA 3FFBA 2NVBA 4BX3A 5YASA 4TTVA 4J49A 3CSUA 1JFFA 2ZRCA 5CEJA 1I6MA 3R4VA 2Q0IA 4QBFA 5I9TA 1WLYA 3WLHA 3F6BX 1ZQ9A 4RVOA 5D51S 4DNOA 5K4GA 3GDWA 4TS3A 2H1LA 2YV3A 4TQAA 4PVDA 3U9TA 1NBOA 1NYQA 2ES4A 3SS7X 3BH6A 3OZIA 4FFPA 3RJ5A 4OHXA 5HKKA 2PT9A 3T4UA 1JL3A 3UXMA 2JIOA 1Y1TA 3GGCA 4AKIA 3G2QA 2WJJA 2E1RA 1CIVA 1LRLA 1QV7A 2FG5A 2PKQP 3KYCB 3VH1A 1C1XB 5L3SB 4DV7B 3IEVA 5CBPA 2F90A 2DVMA 4WJKB 2QPTA 4N0EA 1DXKA 4TVSA 2CLDX 2QMOA 1B0PA 2VZLA 1GIAA 1MABB 2WT8A 2ZXEA 1CS0A 3C6MA 1LQTA 2IODA 3G1TA 3HP1A 3K5WA 3MFQA 3MRTA 4CT5A 2ECQA 2G1JA 3D1JA 3OJFA 3O5AA 4YQZA 1DEOA 5AVKA 4IOLA 3NH9A 2JIDA 4LHVA 5F64A 1B42A 4PWZA 1ZMOA 1V9LA 1NBAA 4PHTA 2DBQA 3QYJA 2ZSFA 1VMDA 1HURA 3IMGA 1ODJA 3HADA 4YP7A 2XTZA 3IQEA 4FZJA 1NW9B 1EPUA 4H3KB 5CLFA 1E2NA 1MB9A 2HO4A 2NVWA 4LNUA 3U1TA 4CF4A 5U4XA 4EKDA 1JQBA 1GILA 5EXDA 1ZY2A 1JE0A 3MOGA 1TYCA 1OBCA 4IR7A 1TK2A 2FW7A 3KKNA 3QE4A 4U7HA 3T7CA 3LTNC 3Q9NA 4J3JA 3O21A 1EMDA 3RFCA 4EQ6A 3U7HB 1V8OA 1OUMA 4HEJA 2H4ZA 4H7IA 3DMTC 4ITRC 3CW8X 4OQEA 5EKXA 5LKAA 4P31A 1SOWA 3CJTA 4DLPA 4TOIA 2CMGA 3ZZ1A 1MAVA 1S89A 4TYYA 1N32B 3ROEA 1V39A 1ZRNA 2OECA 4FR0A 1FNMA 3UJ6A 5HYVA 2RI6A 2P65A 5M34A 3IEIA 1TX4B 2B82A 3BMCA 2GZDA 3EASA 3MCVA 1KRHA 4HZGA 2NT4A 2X8JB 3CPJB 2DPHA 2VYCA 2WUDA 3E7WA 3PUKA 4HGPA 4AJIA 5IFLA 4HKYA 5C9ZA 3CPHA 5DLPA 5LYYA 5LXTA 1A8PA 1QGAA 1SN7A 1TAHA 2Q1YA 2X4DA 5ALYA 4QPPA 3D6MA 1X7DA 4MUAA 1LTKA 3EPHA 3B8EA 4EFMA 3SDSA 2V98A 1G8MA 2YVLA 1X14A 2ZWMA 1JIVA 3AUKA 1F4LA 1YOBA 5EZ5A 4ZD6A 3RLFA 2FPGA 2ZIEA 1WB4A 3OIWA 3M49A 5K8IA 3AL0C 1EZ4A 3BAFA 4UNIA 2E6KA 4RHFA 1YRHA 5EA2A 3G2KA 1L4FA 4C7OB 4UHEA 3SY8A 2BGLA 1FUEA 2A4MA 1SZJG 2BOVA 4P35A 4PLWA 4B43A 5KYUB 1G7RA 1ORHA 1X2BA 5FWDA 2EL9A 2VRNA 4CUZA 3QFRA 2HLDA 1Z29A 1T8WA 2X19A 2JLVA 1C3OA 2PZEA 4HL2A 1KKMA 1Y1PA 1U2EA 3SK0A 2EX4A 3DOHA 1IVYA 3P45A 3C3XA 3VC2A 2VHWA 2F55A 4BP0A 2GXQA 3ZJUA 4QJBA 1DTWB 1L5RA 4J16A 3ZEAA 2H48A 3RG8A 1ZL2A 1GU7A 4MPJA 4ENQA 4RJLA 6ABPA 3AF1A 3FROA 4GKAA 4D9EA 4U8HA 4H3VA 4LC0A 1EXMA 2FLWA 2QYTA 5K3OA 4N0PA 3DZHA 4YPFA 2IKSA 4X63A 2C2HA 1VG0B 4L76A 4MX8A 4WRRA 1GPJA 3D6JA 1FQWA 4HRAA 4KYIB 5H4HA 5JZVA 3PQ5A 3RODA 4DJ5X 4RVDA 4BBZA 3PCRB 5C2JB 3CZCA 1F38A 1DDGA 1VJCA 3REGA 1M0WA 3PD7A 1LI5A 1HQKA 1XVIA 3AJAA 2ZZKA 1QGUB 1N5KA 4XQGA 4ARAA 1L7MA 5C5CA 3CH5A 4LK2A 2YRXA 4DBLC 1QH0A 2P9ZA 4YHBA 4C6RA 2BN4A 1UBMS 3QHAA 3M4XA 3A6DA 2JGAA 1DIAA 3IIKA 3NHUA 3CVUA 3I04A 1N8TA 3M9WA 4WV3A 1TOAA 4IINA 4E94A 2G06A 1I4DD 1E2MA 4YQYA 1I1QB 1AQYA 2A58A 3W2EA 2OD9A 3VO2A 4BX9A 5LQKA 3ZJVA 2D54A 3H7AA 1QKIA 2WHRA 4RIIA 1JHYA 3GB9A 5AO9A 4YT8A 1DBQA 1RWVA 4XGQA 1J42A 5K0CA 3P19A 1W52X 1XAJA 1R88A 5FBRB 2P6MA 1VSUA 2K6GA 4IIHA 2H08A 4V02A 1KRWA 1WKVA 1E8NA 3OKPA 3E2IA 4EVIA 4N1AA 3LG2A 3RIHA 5HS6A 3V7NA 3WNDA 3QRWA 1CUCA 4XB1A 2D00A 2R8OA 1FFHA 3UOAB 3ZBTA 2HYDA 5TY0A 1RHUA 4Q7QA 2V7PA 3EBLA 5JD5A 4P7JA 5B3KA 3PITA 1T3SA 2DE0X 1G6KA 3PSHA 4QT4A 4M0PA 5IM5A 3WLSA 2FKNA 5DGTA 1IRXA 3W9YA 4IDAA 4HAOA 2CLFB 2XPCA 1W5AA 4C5BA 3LIIA 1GNPA 1Y6RA 2E21A 4Y0VA 1OGIA 1AS2A 4BL5A 3UTCA 3HB9A 3MWKA 5LZ2A 2PLNA 4MQLA 5K4NA 1DXOA 3GN2A 3LKDA 3CCFA 1KFJB 3FVVA 4ETWA 4RW0A 2BR6A 2PQ0A 3EVZA 1UBRS 2OV8A 2BFEA 2ZDHA 3W3AH 4NBKA 1NW4A 2GZ1A 3P2MA 1RAEA 2Z95A 1QIDA 1XK6A 4ZQFA 4D98A 1RBQA 4XR9A 4TYMA 2FSHA 4YQFA 2I4IA 4AJJA 2A0UA 3OQVA 3VHXB 2OQVA 1RHQA 2OWDA 4H16A 1KI6B 2WWVD 4WPGA 2Y1CA 4Y18A 3MBIA 2Q5CA 1A2KC 1W7AA 5E4FA 5ITSA 4PIPA 1OB5A 4R01A 2ORWA 3OP4A 4PQYA 3THWB 4WFKA 4RZ3A 4D96A 5BSWA 3P0EA 3SM3A 2JANA 4G2NA 4L4ZA 4EPRA 4WACA 4QLBA 4ERNA 1GA6A 1JDNA 1YS4A 1NUHA 3CYFA 3DL0A 5IK2A 2HM7A 4FYKA 4G0NA 2VYFA 3HCOA 5KTYA 1DNPA 1UJCA 3NJRA 4WCVA 1TT5B 4RKQA 4ZVSA 2RCNA 1EJBA 3EZ9A 1DINA 4IMIB 4OK3A 1IQRA 1Z0JA 4EG3A 4PXAA 2W2LA 4CEIA 5ALQA 1T1GA 2C03A 1H8ED 2V97A 4IVRA 4BVAA 2ODTX 3EGWA 1OT3A 5HIAA 3TOZA 1O5OA 3QH8A 2MSLA 3LVBA 2M6KA 1E0DA 3SMVA 3G49A 3AJRA 3LY9A 2MT9A 4G5QA 3FGOA 5F33A 1L5LA 4P93A 2W2OA 2AOTB 1U0HC 3KZNA 4C29A 1XKXA 1Q19A 1V43A 5FNVB 3M70A 2FWNA 4NMWA 4X3OA 5D3KA 3I8OA 3SC6A 3O8CA 5C80A 1JDJA 1E2GA 1KYZA 5JMPA 2XMBA 4BMNA 1EG7A 1PFVA 3AU8A 3IHWA 2OWEA 3A9CA 4JT9A 4UZSA 5CH8A 3SJCA 3V2IA 1GTRA 1KO3A 3DHBA 4O59O 3HXMA 4ARIA 3AR6A 2A4KA 3DFMA 4BFZA 4UXIA 3L0DA 2OG2A 2AR9A 2OZKA 2PL9A 2XV1A 4OUDA 3NH6A 3UMBA 4D26A 2WYWA 1G17A 1XWFA 2YFKA 2JZNA 2WYUA 4DLBA 4DB2A 3KXDA 5EKDA 2HU8A 1SGWA 2CE2X 3PQDA 1GM5A 1EEXB 2CJWB 2R4QA 5G41A 1VGRA 2MSWA 1EX9A 1LBHA 1AZSC 1Z56C 3PYLA 1H9BA 4NJMB 5EJFA 3ZHOA 1SXQA 3LLSA 3JQAA 4OXQA 2FWJA 2WVJA 1YNOA 2QXTA 3FOFC 2UZ4A 1PEKE 2ZJFA 4BB6A 3CX3A 1ECBA 2IHYA 3PKIA 1OT5A 3QTTA 4DSUA 2Y0PA 5C8XA 2OCXA 3ECCA 3GJRA 1U9YA 4UM7A 1UIRA 2Z9BA 3BGVA 1V1MB 1NFFA 1XEWY 3GNQA 1X87A 4R1PA 4A8JA 1NM5A 1V3UA 1FFWA 5LN1A 3RKRA 3E23A 1DOZA 2PJZA 3DLAA 3E0QA 3UBMA 2DH6A 4HTFB 2NYRA 4CM8B 4WXEA 3JARA 1M2VA 1X8XA 3WYBA 3BD9A 1E63A 4JY7A 3DOUA 4LJKA 1I80A 1RYBA 4BMOB 3RR2A 4KPUB 1AF7A 2SCUB 3EF3A 4NH4A 3H5AA 4A36A 3D4NA 3FCYA 3F3KA 2REOA 2ZT6A 4C4ZA 2DEUA 4ZQCB 2OSVA 3T35A 1K4YA 4YALA 5TQ2A 1ZN2A 4LXGA 4DJJA 2ZZIA 3F67A 1EBUA 3AUSA 5D7NA 2C5LA 4YCMA 4ZZ2A 3H1FA 5ACXA 2HDNB 2X1MA 3HDTA 3S3TA 4CEJA 1KI3A 2I6QA 2XF2A 3E1KA 2IW1A 3BMQB 5KYWA 4DG8A 1E1RA 1TRKA 3EGOA 5FTMA 3FDXA 1OAOA 4RD4A 1Y1RA 1RYNA 1FXSA 1O6FA 2Y6UA 1KH1A 3KK0A 4HLUA 2E4YA 4NNOA 4OIFA 1RXYA 1PJQA 2JB9A 1KEWA 3M3HA 4M87A 4GXRA 2FR0A 3PPXA 4DHWA 1UH5A 2X5NA 4Q9AA 4X71A 3V97A 2B1GA 4Q9HA 5AVRA 5HZGA 3NVAA 4IMPA 3HTXA 1X3SA 1IB6A 4DCTA 1UPBA 1JMYA 1L7AA 2OGWA 1LDMA 1TEHA 1UBNA 4XFKA 4Y1EA 1QFXA 2UYGA 5JNUA 2C7RA 1O94C 2DPGA 2GD6A 5FL7D 4EG8A 3PC7A 2BAGA 3ENVA 3RVDA 1ZGCA 5AKZA 1SD2A 2DC1A 2NTVA 3S2UA 2IYTA 1BS1A 1H3NA 2QTNA 1U2TA 2EX1A 4LN1A 1Z4MA 4RJIA 4LFCB 3T54A 4E5PA 5HH4A 3OPYA 3ZVKA 3OZVA 5I8WA 1JZTA 3VRHA 2E4XA 2W42A 4IQ0A 3T3EA 3BL8A 1NUSA 5HH5A 3BSFA 1B00A 4FI3F 3PPWA 4ADSG 4EG6A 1X70A 3WKDA 3LKVA 3TNJA 4U7WA 4E09A 4LMPA 1HUQA 4JGGA 2WTMA 3DXXA 2XUHA 3W3AA 2Q0SA 4ER0A 5KHLB 4LFBB 2X13A 1Y5MA 3W5AA 1T3ZA 5HIOA 3DT9A 2HU7A 3JY6A 5D2CA 3H8VA 4HN9A 4OQDA 3PHCA 1HX7A 4M1MA 3CT6A 1FVHA 4LA4A 4JXZA 1E4OA 1K7EB 2AFHB 5K7SA 5CP8A 1L8QA 3BMNB 5AVZA 4XGIA 1B23P 2QQFA 1R66A 2E3JA 1CPYA 3AFGA 3ORYA 3MINB 1MKYA 4L72A 5EGSA 4JP8A 5EMHA 3TL6A 1UFRA 3KQWA 3CG0A 1CQWA 5IBPA 3TQRA 2R86A 2VH1A 3QZUA 2XRYA 4MZXA 1A8SA 1JSRA 4CKEA 2FWAA 3QV2A 1MT3A 1EE9A 1NOJA 4RDHA 2Y1DA 2REQB 4ACBA 5JJIA 1GA4A 3WYDA 3GJYA 1KJIA 3AHGA 1D2EA 1RWPA 5EL0A 5ICCA 4YRGA 4QPZA 5ADUS 4F5EA 1XX6A 4L4RA 2GA9A 3X1KA 3AL3A 4W8GA 3UJBA 3RVNA 3HCFA 4UASA 3SW3A 2QINA 4EJ0A 4EUNA 3FSEA 1ZWLA 1XOIA 1NN1A 3D9QX 1FYWA 1MTZA 5C7LO 2FSIA 3GRCA 5FOWA 2AFVA 5E3IA 4M0MA 3HB1A 1KIAA 2AOWA 4Q02A 1WDWB 2X8AA 3GGSA 2P35A 2QRMA 5EVDA 2AHRA 3HCNA 1KORA 4TT3D 2G1PA 3I53A 4WN9A 1QXSA 4Q7MB 3Q6MA 2BEVB 1X92A 1NUPA 5JUWA 1RKUA 3C2QA 3DMHA 5EMMA 4YRFA 2Y0BA 4PWYA 1T9BA 3KQYA 4F3YA 4KH1A 2PD4A 4BASA 1FP6A 3TIIA 2Z3VA 4QDJA 3CKYA 4JEIA 2Z0MA 2E4AA 4DVGA 3AXSA 2RIPA 1XZNA 4NXNB 1X7ZB 1XJQA 1YR1A 3H4MA 2FU8A 5DZSA 3JVEA 4FT4A 4TYQA 3KSAC 3NAMA 4I50A 5CCXA 1SBNE 3EGDB 4UATA 4BIMA 2ZJAA 1XLTC 1SKQA 3V8VA 3TQQA 3CX8A 3CY6A 1HYGA 4IJUA 1CIPA 4OMDA 3T7IA 2VBFA 2Q07A 4M8NE 3RIXA 3T1TA 3I2KA 5AXOA 3NT5A 2W93A 1MXHA 3GJTA 1EX6A 2J9XB 1E3TA 3NYQA 3DWEX 1J0XO 1HTTA 1KDTA 2B3DA 2OGZA 1NKTA 2VHJA 4JNKA 1H0SA 8LDHA 2XOKD 3L06A 4OU5A 4RPLA 3WSTA 3ZWDA 4A5OA 1JB9A 1OQAA 1UXGA 1XD8A 2PMFA 1FW8A 4M0UA 4GGPA 1R4ZA 2RHBA 4UVIA 3W5DA 1R16A 4DEVA 3AF0A 2P30A 5DHTA 3QEOA 4P33A 4CQLB 4E13A 1Y1SA 3IT2A 3K4HA 1YZGA 4Q9DA 1HR0B 1AKEA 3K6RA 3M1IA 1M34A 4WBNF 4C1GA 3SYNA 1OFTA 3BJRA 2AG8A 4Z3DA 4N3CA 1OXKB 1Q1BA 3GY0A 1C14A 3D7SA 2Z1DA 3MJSA 4PBRA 1PD1A 3NHKA 1S3GA 3DR3A 1RQXA 2W9XA 1W29A 4KX3A 1NYTA 3R8CA 1NJ8A 4JVSB 2OZEA 4RAWA 1E99A 4IDNA 5CB4B 4MYDA 4DUPA 1KFCB 1DIOB 1QE0A 2NW6A 5H68A 2Q27A 3VYTB 1KMNA 2CBGA 1Y3AA 1ZNQO 5A6SA 1T9ZA 3H1PA 2WKQA 3KSBC 1XE3A 1JLSA 1NQTA 3I6MA 4S35A 1ND6A 2V65A 3WK4A 2CXHA 3GJXC 3USCS 1QFYA 4ZAZA 3F97A 4YXFA 4N18A 1EP3B 3WLKX 3GRVA 5EY5B 3AIKA 1RQLA 4EZBA 2AC4A 2VTVA 4EYBA 1Q3TA 4JAVC 4CMIA 3FLAA 2WKSA 1P4AA 3M83A 3T99A 4ZTZB 3HB5X 2AQHA 1SKBA 1U7ZA 2CLKB 5IM4F 4RQBA 4LXQA 1CUHA 4G4SO 4C7VA 3UV3A 4B2PA 4MJXA 2HLDD 3EOZA 5K45A 4JR2A 2ZP1A 2R0QC 3I6IA 3K70C 3KB1A 5IEJA 4JLOA 4XRGA 5EXSA 3EF0A 3L5KA 2WHXA 4CMJA 5DK6A 3Q3GE 4FW9A 3IQGX 3HYSA 1ADJA 3SVTA 1H2YA 4ZOQI 5AQ1A 1BOFA 2JDIA 4MA0A 3MHTA 2BH2A 1ID1A 3NV9A 4CNBA 1G2QA 1B8VA 2WINI 1RBZA 1JNXX 2OO5A 2WWHA 3BMOB 3DJYA 1MOQA 4C0XA 3KTAA 2O8FA 1MIOA 5BSVA 1GXSA 2ISSD 4R1OA 3IB6A 5GM1A 2Y9MB 2HBQA 1W5TA 5EJ6A 1EB8A 1BX3A 3E6AA 4MI3A 4TYNA 2X77A 2ZGVA 3L7AA 1J20A 4ER3A 5IG2A 3ROKA 5KWSA 1IEQA 1XPUA 3W90A 4JBLA 1PFWA 2F3PA 4TRRA 3UT5B 4IMRA 4CKZA 3NX4A 1BVHA 3P2KA 3NUGA 4V0OA 3WE7A 2G4CA 1SBHA 1HQCA 3BFJA 4D9JA 4U9UA 4ABYA 4AJKA 1YFKA 4ZVLA 5JCXA 3RYFB 1RJEA 5E7JA 2NO6A 1TTQB 1O95C 3WIVA 1T2CA 1TYEB 5FOXA 1QIHA 3RK0A 3STWA 2DH5A 4HZUA 4B71A 1CWUA 5F3RA 5BW6B 4AQ7A 3OKCA 4J2OA 2CLSA 2RHGB 3DV0B 1TUBB 3LRXA 4JB8A 4H7DA 4BP1A 3PRJA 1CJTC 4HPJB 2GEFA 1TC2A 3PUIA 4QUKA 2R84A 3T0FA 5IQKA 1A8HA 5J2UA 3ZQJA 2XLCA 4IJKA 2DUMA 1MO3A 1QV6A 3LCCA 2FN7A 3T4EA 1UFKA 1A8IA 3TR6A 3DFZA 3UGJA 2Z56A 1KBOA 2BGMA 1G8AA 2X9VA 3OLWA 4MAMA 3H05A 5E9QA 1Z0ZA 4DZTA 2G9ZA 1H94A 3I9NA 2FXVA 2XVMA 4IKOA 1W94A 4RA9A 2AOVA 1YIDA 1FE8A 1DXYA 4E1VA 1I3KA 1QNFA 4WXPA 4RACA 4ZTBA 1M1NA 2VJOA 1Z34A 3HJUA 4P38A 3VR5A 2R1VB 2QMYA 4NI5A 5E4YA 4X97A 1RBMA 2ZSBA 1H6CA 1IPFA 2UZ0A 2DUWA 3DMYA 1PL0A 9ABPA 1S2NA 2IUYA 1Z4NA 4AMYA 1UQUA 2BRUC 4G25A 4IX9A 4R2LA 4RV4A 4YMVA 1LLDA 3U4HA 4KNYA 2W2KB 3DWIA 3K35A 4QFMA 4FJ0A 1L8OA 4KN9S 1XEFA 3PL1A 2I8LA 3GRYA 2H54A 4MNTA 1NSTA 1FRZA 4X7RA 2OA0A 2C2OA 3LPNA 4YUAA 1FP4B 3A04A 2XUZA 1ODIA 2WT9A 4QARA 5HMLA 4B4WA 1ZIPA 1AC5A 1SHZA 2QF7A 3IDZA 3HL0A 4JQZA 1M1YE 4LUCA 5JCOA 4KFTA 3GC6A 2K7ZA 3MUFA 1NMQA 1QNLA 1PYGA 3FYCA 1IXYA 2R1UA 4ZNBA 3IJRA 2ZI9A 1PRYA 1WWKA 1ZPDA 3HPQA 4KREA 1EESA 2VRCA 1IEWA 3JASB 1XHEA 5JD6A 1SUDA 4HFNA 5DT9A 3I4LA 3CKKA 4DSAA 1PNQA 3DEHA 4PZ9A 1KJ9A 2O7NA 4Q47A 5GGYA 3ZLUA 5A0VA 1GPBA 4CNQA 5EVKA 5E7IA 4BKUA 3U4AA 5CCBA 2H7XA 5EXTA 2OZPA 5CIWA 2VWQA 3GDOA 3UHAA 3CX4A 1V7QA 3ZLVA 1E2FA 4OHOA 3AC0A 1O97D 2HIMA 5D1HA 4LYYA 3U61B 4EFZA 2GZMA 4R2IA 4TV9B 2R5FA 4WVFA 5KINB 4FFRA 1ESZA 1IY8A 4F84A 2GT1A 2ETVA 4S1TA 3CPEA 4Y2JA 4YJFA 1AGPA 2VQ3A 1XRMA 1X1DA 2H5EA 2C9ZA 4Y1GA 4HDRB 3H18A 4FW8A 1VLVA 3WYAA 2GAIA 4F3NA 1TO6A 1C7EA 1YQXA 4JLVA 4WY8A 3VNQA 1QRRA 3HFRA 4OGFA 4WA8A 4Q4AA 3VHQA 2H31A 3ZD9A 1T4GA 2J9ZB 3KLOA 5JCJA 4KU4A 3THSA 1YRBA 3H5TA 4V0ME 2IYXA 2NIPA 1JPNA 2JFWA 1DRUA 1YMVA 3DEIA 2RGAA 3GZJA 3HH8A 3ZOZA 5CCEA 2O59A 1JA9A 1OB2A 2R00A 1LK7A 4KQMA 5ALRA 4BNLA 1N0IA 4KXUA 4AF7A 5HISA 2PV7A 4HYEA 3GLUA 4O02B 3UMGA 3W4KA 2OESA 2QD1A 1UWLA 3CB2A 3QW2A 4HP8A 3WMGA 1EXVA 2P9JA 2DAPA 3P0JA 4H6VA 2BUCA 1K68A 2FA9A 3LQ4A 4F9GA 3GP8A 3MILA 1XG5A 4M53A 2APJA 4W7HA 3WNVA 4A2QA 3UUWA 5CFPA 1HDYA 4RZXA 3P32A 4DV4B 5DGIA 4TT8A 1E5XA 4E31A 1L5ZA 1RJWA 2VDRB 4J0EA 3MS7A 1Q0QA 1O8BA 4Q4JB 4DR3B 3U4QA 2CJFA 1PVVA 2OK8A 1BJRE 3IAHA 1GRQA 2R9VA 4M7WA 2JA1A 4NESA 5LB2A 4I5EA 1XZDA 1XRRA 4FYWA 4KNVA 3KXKA 5HX7A 2YC4C 4TKLA 1MC8A 3V6MA 1LDYA 1BWRA 4UAMA 5DX8A 2JKZA 4I4TB 4DDUA 3GRPA 3I58A 3TI7A 3I8XA 1FW6A 2WPDD 3KVYA 3IT0A 2A30A 1F5SA 1IBCA 1SCUB 3L7DA 1J22A 3V8EA 1Z3IX 3IUPA 1BVUA 3A05A 4FLMA 1TW2A 2J7KA 1PGPA 4D5EA 2YZ7A 1DO0A 4EBFA 1PJTA 4W5JA 1WMDA 1VJ5A 5HF8A 3IX7A 4MARA 1QHHB 3H1TA 1WEKA 3K9WA 1S2DA 1VG1A 2PYZA 3UATA 1QK5A 3OFNA 4O2LA 2DP4E 4ROSA 3RSCA 5KNLA 1IHPA 4CCYB 4RVHA 1FUYB 3D0QA 5BT8A 2F3RA 5CEEA 1XTSA 1V47A 2EW2A 2Z04A 3LSYA 2VEDA 1RI2A 3C7DB 4HB2A 4J6EA 1JJIA 4TM7A 2JD2A 1N2XA 4A2PA 4JVMA 2VSXA 3K0HA 1A50B 4TV8F 5B7QA 2GZ2A 1EEHA 2GO7A 2WSBA 3C14C 2EW8A 2VYNA 1PKXA 2P7IA 3FYUA 1ZBQA 3II6X 2AS0A 1WUIS 1JDVA 1ABBA 5FBWB 2BC2A 4PHGA 5G3ZA 2CVPA 4YASA 1P2UA 5HKAA 1A69A 5LOVF 3ED1A 2M5DA 4TXLA 3K9LA 4P7KA 5CURA 1WMFA 1MB3A 3VJKA 1FXUA 1Q6ZA 1SBIA 2PDAA 2UZ3A 2JLBA 1PUIA 2NZJA 4KE9A 4WBXC 4WY2A 5H0IA 3SKXA 1U0FA 5KJCA 2IYOA 3Q0EA 5KQMA 4PQFA 1YVEI 4EYSA 4YCCA 2O9JA 3GUVA 2PZLA 1XTZA 4ZHQB 4RMHA 2Q4OA 1ZCJA 1VZ3A 3B36A 5FUXA 3KT3A 1TCAA 3W3AD 2IXEA 4LBZA 4EPYA 3EG9B 5HUHA 3ZG6A 1JA1A 1BGVA 1JAZA 1BXGB 4ZEJA 3R3XA 2ZYIA 5EJEA 1QE5A 5AXCA 3IUQA 2DXIA 2VPXA 1R5JA 5FPYA 3AKDA 3TKYA 2GCEA 1A2OA 1PK9A 4DGQA 5D86A 5B1UA 3QXXA 5JANA 1QU3A 2FP4A 1DOAA 2I2AA 2VT7A 4LKRA 3IP5A 1WZIA 3P9YA 4R5MA 5AVYA 1J8DA 5MFZA 4K0KB 2COEA 2A9OA 2YZNA 4JR0A 3URKA 1SVIA 2YRFA 1W19A 4ZAYA 3SX0A 4DLAA 1BDIA 4JELA 1KEUA 1J9EA 3R5JA 3RRYA 3DH8A 3O03A 1K8RA 1NJFA 2VDVE 4ZKDA 4LRXA 2WR8A 5IH7A 4P34A 1B6TA 1IHXA 1XPOA 5K6AC 4AZ0A 4YXWA 2Q4EA 3RJMA 1OH8A 3FTQA 3EBOA 3H9QA 1CE8A 1ZUNA 2N1MA 3KV3O 3WMWA 4EJ6A 4YQEA 5MN4A 1XNJA 3DULA 2BSAA 2P4HX 2BMVA 4QODA 4EK9A 1BOOA 3NCHA 4G1CA 1RZ3A 3ZW9A 4BNVA 4UDNA 4EI2A 2BTQB 2Q6VA 1KZYC 2X7XA 3HDVA 3QLVA 2P62A 4MP3A 1DMSA 2Y1EA 3X2YA 5ELLA 3CLSD 4QYTA 5NLLA 2B6NA 3FB1A 3LPDA 2ILVA 1ZVKA 3LW8A 3OOHA 3PUWA 3R5XA 4HDNB 3ZXYA 5KSPA 1WUJS 1XQYA 5LFAA 2IP2A 1QHSA 1M1XB 2KE5A 2XDWA 4DJAA 1OBFO 2FN9A 1LVGA 4JFRA 2P2LA 4UVGA 1GQFA 1NU6A 1ZBDA 1LBQA 1THZA 1Y1KE 2CXXA 1Z6AA 3WMRA 2IV7A 1IY0A 3MTAA 4V1CA 4MWBA 4C43A 5HXAA 1A2BA 5ACRA 3C3KA 4OFBA 1RP7A 3C3EA 5DWQA 4C06A 2WG0A 1EFRD 4EUHA 3K6SA 3ICVA 4DV6B 2EDCA 1GQYA 1QTNA 3I32A 3K05A 1NLZA 5AIAA 4CM1A 3ROZA 2X0DA 3W6NA 3TD6A 2P1DA 4JK3A 2WU0A 1KA9H 3STYA 3QY9A 4YECA 3LRPA 1MB4A 1E5QA 2QDKA 4F5ZA 2ZIGA 3PU6A 5BRNA 1FYDA 1F6DA 3A9WA 5CFOA 4IRMA 1G2IA 2FJUA 4GXQA 4NZMA 3K0EA 4C0BA 3BT7A 5A5ZA 3KEOA 4H4CA 4OXRA 4YJ2F 3RSQA 5G0UA 5LMCA 3WGIA 5DK4A 5G3YA 5F9FA 2ZPTX 3K32A 2H57A 3OFKA 4ZVKA 4A0GA 3GUCA 1ENPA 2IITA 4AJ4A 1I36A 2RB4A 4PCVA 1C4OA 4EUEA 2QG9A 2C61A 1FFAA 1UOOA 3VZPA 4CKBA 5EWLB 1FP2A 4H0CA 2YJZA 4Q6BA 2ZJ4A 2CLEB 3TMKA 2Y4OA 1AU9A 2QE7A 1EHCA 4QUIA 1WBDA 1E94E 2BEJA 3COZA 3NMUF 3WFJA 4DL9A 2HHCA 5J2TF 1U1CA 2V58A 3W2FA 4B4KA 4K9OA 1PDOA 4WW0A 3FCXA 3N3AC 3DZKA 4WSOA 3Q41A 3GCGA 3ZJTA 1BCRA 1JXQA 1PZEA 4GNKA 4R2JA 4CF3A 4F6LA 3V1TC 3ENKA 4Y2QA 4EKGA 3E27A 4LK3A 1E3DA 4JODA 2DLNA 5TARA 3TCKA 1IJBA 3TAXA 4YSLA 4XOIA 1EHYA 4GT1A 2PQ2A 4I3GA 2W8ZA 3IHLA 4KE8A 4UNNA 1KSGA 4BFCA 4WLEA 1DQYA 1X80A 2OV1A 4N39A 4DADA 1ECFA 2O3RA 3ANLA 3CNBA 3OZXA 5EMNA 2IE0A 1WZCA 5AW3A 5JTUA 3VH2A 5MGBA 1P62B 1MW8X 4JB3A 2HMAA 2IVZA 2Y0EA 3LHDA 4GOOD 2FU5C 3MG9A 4BEWA 3TD2A 4EATA 2I9PA 3KB6A 4BRZA 5TPZD 4CLRA 1IPHA 1ZNYA 4X3PA 3RKJA 1KKUA 4EO7A 5JS1A 4GI3A 4BGUA 3VC3A 1E2PA 3H0KA 3RTBA 4A1FA 2PCLA 1JXMA 1LPAB 4CTKA 4EA9A 1XTOA 5EINA 2Y2VA 4E7PA 1AG9A 3Q98A 3FVWA 3PNMA 3DLHA 4QM6A 2JDID 4G9GA 3L8CA 2X0JA 3GZTB 2D5LA 4FP9A 3HXTA 3UMRA 1EUQA 3LKBA 5H16A 2LZ0A 4UCFA 1ZJJA 3GLTA 1L3CA 2ACWA 3LDFA 4X41A 1V5FA 1XLUA 4O33A 4AROA 5B4VA 3QF7A 2W6MA 3MCWA 2QIPA 5ALNA 2DBYA 4I8DA 1VKHA 2Q2NA 2ZUWA 4O2AB 4OF4A 2PY6A 4DJTA 1OYWA 1PL7A 4FDAA 1EWKA 3V8PA 3O83A 4EJSB 3HBAA 1NI4A 3SE0A 3E58A 1BW9B 1R8XA 2OCAA 3T7KA 4JO0A 1YIOA 4AJ9A 4IEFB 4JFAA 1EP9A 5LKRA 1E8DA 4CIDA 4DABA 3CEMA 2P2NA 2NO5A 2O8CA 3B5IA 4ZC1A 2E87A 1HT2E 4OI4A 4BDTA 4K05A 2Q4BA 1JEQA 5EHGA 3UYKA 2CFZA 2P18A 4BATA 4FILA 3QW4B 4C20A 2IHNA 2BFPA 3I3SR 4EKYA 2BGJA 1XZCA 1C30B 5GV7A 4EFNA 4EG7A 1LFAA 5EJ4A 3NLLA 3UAOA 2P0EA 4BRSA 1GA1A 1I3MA 1Z3CA 4TWBA 5KOJA 2D74A 3M89A 5LUAA 3C1UA 3SEFA 5CFLA 4J7XA 3H2SA 4EVQA 1VPDA 2GEJA 3BA1A 3EIHA 2YY7A 3RGWS 3E84A 4B3DA 5AVUA 3A26A 1W6RA 2GLTA 2VTKA 2P90A 1Y5NA 5F76A 4N8EA 4JJFA 5E0OA 4YCNA 3U7FB 5IARA 1RRCA 2NVOA 5JT1A 4X6XA 1ZGAA 1T3LA 1R6DA 1UJNA 1N7GA 2R7AA 3HHPA 4MRPA 4WKNA 3DFIA 3S99A 1OTHA 4AU1A 1PE0A 3MUEA 4ZOEA 2IEAA 4DUGA 3FSGA 4BHTA 3VU9A 1II9A 6NULA 4X94A 1MENA 1D1TA 1WY7A 4L0MA 5FFMA 4F4UA 2B2CA 3HHEA 3OLQA 4DIBA 3BZWA 1SKMA 2W6OA 3O1LA 4N5DA 1EUCB 2EKBA 2YH2A 1W36C 5DHFA 1K3TA 2O8BA 4HV4A 2C8JA 4YCBA 1N6LA 3NBUA 2PZJA 3ZDYB 4CG2A 1NC1A 3QXHA 3FDJA 3IAFA 3PFFA 4OSEA 4B6JA 3ZD6A 3MYYA 4OXYA 4BFSA 2VP9A 3F0TA 3DBRA 3LXRA 3LYAA 3AHCA 1E6LA 2GRJA 1GZ6A 2BG6A 3QVXA 3M6WA 1J5PA 3G8YA 1S2MA 2WD9A 2WM9B 3OAAD 1TPZA 5E1BA 4DIMA 5JWOA 3AONB 1K0UA 3CQ9A 4R8VA 3T9FA 4YJGB 3ROPA 5GONB 3AEQA 4QFDA 1VE5A 2W2XA 2MMCA 2NU7B 1M8FA 1BRTA 1UDWA 4HVAA 1K0FA 4MDEA 3FNHA 5DP2A 2C88A 2IWHA 4L95C 1A5ZA 3J80A 3EEFA 3L84A 4UEWA 1RWWA 4L8FA 5AKKA 3B1FA 1Z37A 1UBFA 1USGA 4R31A 2PT6A 4K6FA 3FCAA 4PBTA 4BN0A 4KOEC 4TROA 3S5JA 4BX8A 4FX2A 1IL0A 2ATCA 2TMGA 3L0ZA 3LBNA 4PO8A 5C8ZA 5LNK1 4NHEA 4LIPD 3GDHA 2A0XA 1UJ6A 3C7KA 4JQOA 2QX9A 1ZOLA 2Y9PB 1BE8A 4PTZA 1WB9A 1VHQA 1RWOA 2AC7A 1Z16A 2B20A 1VLQA 2O3JA 1B0ZA 2ERYA 4MS4A 5GAJA 1N6OA 2CLLB 3RVQA 3TQCA 2E4VA 4I9UA 1SIBE 4P3YA 5FAKA 3N53A 1TKAA 3A6PC 3R9WA 1VYVA 5EHNA 1GFSA 5IJ0B 4ZHSA 3P27A 3DMFA 2I6SA 3LLUA 1X13A 1Q7EA 3TFWA 1JLLB 3OPMA 4RNDB 2G9QA 2PAAA 1BMQA 3FGNA 3KT8A 3RSGA 4TLMB 5DM2A 1OJLA 2IU6A 4W82A 3CUEF 2W6IA 4OFXA 4C78A 1DRWA 1VCNA 2FMXA 3E81A 4U63A 1E62A 5GZ1A 5EVBA 2Q4RA 2VUTA 4RD2A 2ZTUA 2PPLA 3NC0C 4JNCA 4OEHA 4RWEA 1LJ8A 2FW9A 5A9SA 3VH4A 5CDGA 4BLRA 1ZIXA 1QDUA 2V8BA 4OK5A 1YUNA 3SNKA 3GD7A 3JWHA 5I7RA 1JIUA 3G2PA 2X58A 4DRZA 2AI3A 4X84A 3IVXA 4PLFA 1IN8A 4YPOA 4HGYA 1OBOA 2I80A 3C6XA 3R0QA 1XCPA 4EECA 2NP6A 3C98A 4HB4A 2FR8A 2XDYA 2V0GA 4KQ9A 4RVGA 3GFPA 3P96A 4XWYA 1RQPA 2PUAA 4D4JA 1Z35A 3HACA 4HNQA 2GR9A 3GDFA 4AJOA 4AIRA 3G7UA 5BVGA 4QGFA 1NAHA 3OZSA 1XUOA 3GMDA 4L6AA 2Y77A 4JI7B 2BHNA 2ZUSA 5B30A 4Y7CA 2HUNA 3TCNA 3THOA 1WHTA 3DYIA 2ZVQX 4RZHA 5E38A 2RBGA 1QFSA 1K8YB 3E48A 3IP1A 1A3CA 1E7RA 1Y80A 1YL5A 2IIPA 3BRCA 3QI7A 1Y5LA 1UANA 4NECA 2ZVJA 3QGMA 5AK6A 1G3IA 1NULA 1DJPA 2VDOB 3T94A 1ONOA 3WKCA 2IS2A 1YMQA 2BG7A 4TZBA 2FYTA 1CK4A 2UUOA 1ZITA 3BGDA 4KAJA 4B5KA 1GL3A 2CDNA 3G2NA 4UUBA 1JYEA 1NP7A 4COKA 2X5JO 3FR7A 1ENZA 1W85B 1E3MA 4BNJA 2ACKA 1OTYA 2H7CA 1Q0PA 4XSGA 3PQ7A 1A77A 4A7PA 2V6BA 4WBNA 4G8BA 4LI0A 5DHUA 3X1YA 3KKQA 3NRCA 2ZR9A 1DE0A 2YJ4A 4ID9A 2I76A 3E22B 1U7HA 3R4CA 3I28A 3TZKA 2C92A 4WOJA 4BKMA 2QRJA 3IO5A 4YAUA 4RQAA 3JR7A 5EN4A 4DCVA 3QOFA 5KDDA 2IZ6A 4MKZA 2ZDQA 3OEED 3HFJA 1EFLA 2ZIXB 3LIPA 3OJXA 1KPGA 2PKYX 4HQ6A 3MPOA 2YWFA 1MAUA 1XRPA 2W4IA 4X1KB 4BQEA 4DRYA 3W9SA 3BWDD 2E5LB 1GTL1 3A25A 4CV0A 3I76A 2X4GA 1YL6A 5C7IO 2WMNB 2O2GA 4NDZA 3TQSA 5L53A 5FWYB 3GJ7A 2XMRA 2E6UX 4MDHA 2IKQA 3DMNA 1D2GA 1JR3A 4OX9Y 1XALA 3O3MB 4TKUA 1SM4A 2VPPA 4WZBE 1M34E 5IMBA 3AHHA 2XT9A 3GV0A 2RSLA 3PWZA 4P7FA 5JJCA 1MDFA 3QYAA 2YY5A 4LJ5A 1Z4QA 5DNWA 3SSMA 2CSUA 1VL0A 3UMYA 2BBOA 4HDKA 2IE8A 1H65A 3BM5A 5IM4A 1D9ZA 5CA0F 2VK1A 3IALA 4YRLA 3JAKA 5L3ZA 3WQBA 4E5DA 2P9FA 5IUKC 1NFQA 4O0MA 3OIFA 2QBYA 2JLCA 1O9HA 4L57A 4AUEA 2YJTD 1W9HA 3W3ZB 4YV2A 3B53X 2G4LA 3O1IC 2YC2C 2QZSA 4JIGA 3DCJA 2ZUFA 1GLVA 1T6NA 4GPTA 3MF4A 3S2SA 4RK0A 5I9BA 2ZYSA 3HPRA 1Q21A 4A0RA 3UWPA 3S1AB 1VFNA 1I6LA 4PO9A 3N0XA 2XB9A 3EDCA 3EG5A 3BJMA 1KI9A 1DUVG 4O4LF 1EUDB 3QELA 4RF3A 5JVDB 3GFGA 5LJIA 2BL4A 3W5CA 3UBTA 2GK4A 1SVNA 3F1KA 4Q15A 2FI1A 5IXYA 1ZIYA 3DS8A 1RYMA 4GSYA 3PR2B 4GSLA 2VDWA 2H1CA 1NMYA 5EWJA 4DJFC 5DWVA 4CKCB 5IDQA 3CLRC 1JFFB 3SQNA 4ZZIA 2WWRA 3IMKA 1B6RA 4CV3A 3N6VA 3NBQA 2HJRA 1E1QD 3BRSA 4HATA 4L28A 4F91B 2IBTA 4WOBA 2HWYA 2QEDA 3H99A 5CIYA 3B85A 2H5JA 5KNBA 2ZS7A 3GIWA 4U6QA 1SC6A 1SOUA 2W6QA 3M4JA 3OTQA 1SCKA 4OHFA 4PX9A 4R9UC 2HDHA 3H9UA 4LPKA 1Q0TA 1I94B 2D1SA 3R24A 3FIUA 1WW8A 2FMKA 1X6VA 3E2MA 3QLUC 4RGQA 2RIRA 5CXSA 1QFMA 2XE4A 2CT8A 5JD3A 2Y1KA 3K0FA 4NENA 3TKAA 1F06A 3CUVA 1DJNA 1CS0B 4KR9A 4DLLA 1II8B 2BZGA 4OIMA 5BW8A 2DCUA 4W5RA 2VAVA 3HA5A 3NHZA 3AOEC 1AMUA 4WKPA 3JS5A 4X61A 4NFHA 3D2AA 5AOAA 3OJEA 1HLFA 4YRSA 1DG9A 2G82A 5AJXA 3ZUGA 3JYOA 4QXPA 4JCOA 3GRKA 2AV6A 3ZCQA 4LNUB 5B6JA 1ZJWA 3QNMA 2PBZA 5KYKA 2FPLA 3GJZA 5CM8B 4D9GA 1NIPA 3NUZA 4I36A 1NBMA 1OZFA 3LVFO 5A05A 3DB1A 4KUGA 5H4GA 4NXMB 1D2AA 3C48A 1JWBB 4EQ6B 3AESA 1FJXA 4J4HA 1Q1GA 5AOCA 4RK5A 2AQKA 2J6IA 5ALJA 3OF3A 4FEAA 4C4TA 4DV0B 3IJ5A 4DQXA 1FLVA 3CH6A 3CNEA 4KITB 2EBWA 5IT5A 4Z51A 1HOXA 4IZ6A 1J7KA 2GF9A 1T6YA 1YS9A 2VW8A 3GG2A 4A23A 2Q4DA 3HU3A 1E2IA 3BMCB 1E0AA 1BFKA 1JF8A 1VMKA 2D5IA 5D1NA 2H1WA 1HM5A 3IQWA 4J43A 1PZXA 2HREA 4QGBA 4GM1A 4RPGA 4URUR 3TK1A 3PFNA 1YS6A 4TMZA 5LXTB 2OOSA 3H6HA 3HS3A 4QULA 5HOQA 1T2DA 4KDFA 5I4CA 4I8XA 5I7VA 1SAYA 3QEBZ 1Z7GA 3FI9A 3AERA 3GOHA 1XZFA 3HG7A 2J87A 2ZSDA 4AO6A 4BO1A 1PSZA 4JV5B 1KL7A 2B4RO 3NVMB 1GQSA 3PRYA 2JI6A 4LHZA 4QVGA 1XF1A 3QSGA 4ENUA 1I3CA 4EENA 5F7ZA 2A5DA 2V03A 2IXTA 4NU0A 4CV2A 1NXQA 3JVUA 2VJLA 3BHIA 4Y2TA 4PY2A 4Y1RA 1E79A 2ZRPA 4MRMA 3N7TA 3WX0A 4C4RA 4F97A 4O98A 5B3RA 1AKWA 1C8LA 2Y3IA 3N0RA 1ZQ1A 4WH0A 3PNVA 3SYLA 2Z83A 2HMYB 1OLUA 1C3OB 3U5ZB 1D5CA 1HRKA 3WYFA 2PRYA 4UQPA 2NO7A 2R62A 1IBRA 2YDYA 5DASA 1A7UA 2Q6OA 4RO0A 2C31A 4GE3A 2KS6A 4C9BA 2FW0A 2H2WA 3HWRA 3MJVA 3H2YA 2YW2A 5U1PA 4EUFA 1QYVA 3GPDG 4RIHA 4QOGA 4Z3KA 1IN5A 1LQ2A 4DC0A 3OLYA 5K05A 4F60A 2SKEA 4HXEB 5KYNA 3NU1A 2AGVA 1GV1A 3BSWA 4E08A 4PQGA 5HKBA 5JRDS 3W7AA 3T9BA 5K0GA 3E9MA 1GRVA 2V6FA 4KR0A 4R2KA 4PFJA 1I32A 4JP1A 3DC7A 3CX7A 3DD1A 4OFZA 5HQ3A 1XHLA 2UYXA 3QVTA 4HX9A 1PJ3A 3SFTA 1WZNA 4QU0A 4EB6A 2YUIA 2FFBA 3VYUB 3C5CA 4D8VA 4EAQA 2YXDA 3HP7A 2PMWB 4DZRA 3RM3A 1WMSA 1YRAA 5BSEA 5ACQA 2J5QA 4A10A 3N7UA 1R2QA 4NY1A 1FJGB 3UICA 4HEA1 2H2AA 2A9KA 3HEBA 4QXOA 1SOAA 3JTMA 1I2ZA 3ZI0A 3EPPA 4GYJA 1DPGA 4OHCA 4LDAA 4X20A 5DMHA 2PUHA 6LDHA 1HEIA 2BMJA 4UDXX 4LZAA 3NANA 1L7OA 3GEIA 1UOEA 1E2UA 1C9JA 4HWKA 1J8YF 1THGA 2QLMA 1ISSA 1DB3A 3H19A 1P2GA 4FN4A 5COAA 2ZXFA 2WM3A 1XNHA 4OBXA 3FNBA 1SK8A 5LUBA 3GJ8A 1A4XA 2G9RA 3IKJA 3NKLA 2A0KA 5AM1A 4NYIR 1XRSB 5FEMA 2G5PA 1D6JA 1FTQA 4QQ8A 3IMCA 4MINA 1QVVA 5HCNA 2J4DA 2R6GA 3ICQB 4CR8A 4H6PA 2EIHA 3JZMA 4KZKA 5DI9A 4MYCA 2VATA 2BFCA 1E1MA 4WZAA 4P80A 4D1VA 5C32A 2WTXA 5IHPA 5KSZA 1P0CA 1WS6A 4OHBA 1U0LA 4HLCA 4DUGD 2PUGA 3L3BA 3OOWA 4BMYA 4E6EA 1KP9A 5LOVA 2GF0A 3LP5A 3WGTA 4PINA 3VV3A 1L4UA 3V1KA 1QIJA 1TEXA 5B1EA 4TS1A 1R3DA 3VA7A 4DA4A 2HB9A 3R74A 2WQZA 3GHYA 1FUIA 3PC8A 2HUPA 2ZCVA 3IQDB 2ZBDA 3H86A 3ZHCA 4ARSA 5BUCA 2Z09A 5P21A 4BV9A 3H84A 4L74A 4ZWNA 3WLRA 1XTPA 3ET4A 1Z7BA 4HQRA 1HLKA 1YB4A 1PZFA 2POCA 3PDIA 2GNOA 4RPIA 3TSYA 5AHWA 3ODGA 1GNQA 5FYDA 4B81A 2IUUA 4HR7A 1MX9A 5HWSA 4RTNA 4JL6A 2WHQA 3DCNA 5EFZA 3RT9A 2YY6A 1OWOA 2FZ4A 2D7JA 3JPWA 4MXDA 4CEIB 3C3CA 3T6KA 3VR4A 1K6MA 4GM0A 4EJ2A 3LTEA 4BO3A 5KQSA 4BJHB 1GNRA 3ACDA 4JC5A 1MC1A 3QPDA 1YCDA 4Z0HO 1ZH8A 3OQMA 1YKFA 2PFSA 3DB2A 1FU4A 1WW2A 4PYJA 1Y3BE 5GV8A 3ZN2A 4ZPXA 1L4YA 3OTHA 4GVXA 4MQ6A 4AECA 2C59A 2OFPA 1IFXA 3ID6C 4G8CA 9GPBA 3JXPA 1D6NA 2W83A 1P6QA 2Q9BA 1R6BX 4IIJF 4X7PA 3HUEA 2GRUA 2ZE6A 4NQ4A 1NNSA 2PUWA 3ADKA 2QYOA 4JD5A 4E5MA 2VCHA 2WZDA 3F4BA 4QYMA 1K6EA 2HZBA 4U2KA 3HL4A 3MMZA 2ILTA 4GLFA 4HNGA 2IV2X 3T5TA 1JXOA 1U2DC 3TOCA 2BGUA 2WG2A 3K7EA 5AM3A 4X7BA 4CM9A 4DAEA 4H7PA 3NBMA 4OUDB 5CXXA 3B6IA 4FSHA 4CU5A 1GZ4A 3IT3A 3N8NA 1V8PA 4BLVA 4ND8A 4BX0A 4MUKA 4PCLA 2QL9A 4YONB 1HNZB 2C1EA 2PGLA 4BFVA 1IULA 4O8CA 4IFEA 3G0IA 1J2JA 4G5FA 4D99A 4PEVA 1NQOA 2A2ZA 1D2NA 5EIEA 4EF5A 1TVKA 3IHKA 1F4PA 4QICA 4CFSA 1CY6A 2PNFA 1KAEA 2O5CA 3VOTA 1RWKA 4Y6QA 1DG1G 5G1PA 1F6WA 1GQ2A 2J8ZA 1Q1QA 1NXVA 3FPEA 1Z5GA 4TLCA 4MWZA 4QFBA 3VR3D 3GGOA 1QYXA 1CDZA 3QIVA 1PLKA 4G0MA 5A5DA 3JPYA 4XDGA 2CW5A 3CTPA 1Q22A 2K2WA 3P9IA 4QBGB 4GI2A 5AXAA 3DLPX 3ZWNA 4A8JB 2DHEA 2GBGA 4NQ6A 2ASEA 4B45A 3IBCA 3ZQ6A 2QE6A 4IFBA 3N9IA 4KYVA 4MUNA 5A0FA 5JBNA 4CXMA 4N82A 1T0IA 4FMBB 1DG3A 2CDBA 3QBJA 4H1UA 4PGFA 4QU8A 4QDKA 1P9RA 3L5OA 4S2EA 4XB6B 3KSUA 2IEBA 3MJDA 2Q1XA 1GQQA 4FR2A 4IJ5A 4BLUA 3FHCB 1HT1E 3GT4A 3VQTA 1VKRA 2XQJA 4FFMA 4YJ2A 2Q3EA 3UV7A 3O4VA 4WD3A 2QJSA 1DBSA 1ZWKA 3O9MA 3A3KA 4DMHA 3EOAI 3PK0A 4Y6LA 3G13A 4CEJB 3I12A 3AB8A 4I1YA 4KK4A 4QLAA 3VHRA 1F48A 3RVSA 1Y3HA 5G1OA 1PBNA 3VJLA 2JLYA 1DPFA 3PT9A 4JVLA 3R75A 2AJ8A 4MICA 4PM4A 3HJGA 1G20A 1LS1A 5IDVA 4MV0A 5C31A 4ENSA 3AEYA 3QOYA 2LXNA 1BEUB 4IXDA 4MGEA 1L7BA 3O2QB 3PBKA 3QHQA 2C98A 1UJ2A 4KK3A 3BMXA 2CNKA 4YA6A 4R71A 1B93A 2P67A 5G0WA 4HRVA 1QM5A 3OX2A 5J2TA 3FH0A 3COSA 1UQTA 2V3CC 1WLSA 4JT8A 3BIFA 1G6HA 1JLMA 4IUCS 3ZZMA 4C1DA 1PL8A 1LCIA 1VJRA 3AM3A 3BD8A 2QV7A 3K5PA 2A3RA 3N6RA 3MRVA 3RW9A 4BU0A 1DIRA 1XRJA 4JOQA 2RGRA 1W0JD 1K06A 4UM9D 1NVTA 4UFPA 3ZVNA 1CQIA 1NKSA 2E7YA 1R0SA 2ZI3A 2BHTA 4QXRA 1JR3D 3RABA 3RF6A 4CMBA 5D3MA 3ZY6A 4UNQA 2FKAA 3I73A 4PS0A 1TE2A 1ZVQA 1URPA 2AFRA 1QBGA 2P2ZA 1VSQA 2FTKE 3ZHVA 3AY7A 1H2ZA 1PT7A 1XA4A 3DDNA 4FU0A 2IYVA 4MIKA 3LFHA 4XX0A 2ONJA 1TJNA 3TJMA 3GA7A 1AGNA 4P62A 3QU2A 3DBLB 2QA5A 1E20A 3OCVA 3R3HA 4HH4A 4MVJM 4RORA 1AKNA 1BWSA 1AB5A 4Q9IA 1WNFA 1ZOIA 3P2OA 3PKZA 4JGBA 4TVOA 3GHHA 4PLGA 1KQFA 2XEDA 3FAIA 2JAQA 3NIBA 3LC2O 2ST1A 4WOCA 4EELA 2X3YA 1WXGA 4I9NA 5CH3A 5T5QA 1XU7A 3FGPA 4CKEB 4M0KA 4Q9JA 2VK8A 1E0SA 4GBJA 2XYHA 5DRYA 1UBTS 1VPTA 3SWWA 3K1AA 1N2OA 1WPGA 5I6DA 3Q9UA 3WWZA 1I01A 4Z4FA 3C74A 3HBNA 2G5GX 4NAVA 5HBRA 4HI0E 4WWHA 4A91A 4ZVRA 4CUJA 2WKPA 3U44A 3ECSA 3IXLA 3I2FA 1KFKB 4ZO4A 3GLGA 5HJ7A 4G36A 3P20A 4ZO6A 3WL7A 4IGKA 5KQPA 4X8OA 4QGSA 4UBNA 1V11B 1Q77A 1X1CA 4JSTA 3X0DA 4HWSA 4OLJA 3UXEA 2PVPA 3DTVD 3IE2A 2BISA 4HWOA 4BJ5A 2FMIA 2O8VA 1WTAA 2E1PA 2RK6A 3HSYA 1T1SA 4M55A 2P3LA 1AQLA 2QT9A 4LWQA 1KMQA 1LWNA 1WCV1 4UULA 4UUQA 1PU2A 4HFMA 4K9RA 3OZUA 1OZAA 1ZL0A 3AVUA 4QPNA 3AVXA 1U5BB 3SAJA 4HADA 4KI7A 2MR6A 2YV1A 1EM6A 5KNBD 1RYYA 1VLHA 4OHMA 4WN9B 1XLVA 1EK0A 1OIVA 2AT1A 2IX9A 2AMVA 3A37A 4GZ6A 2XW6A 4M1QA 3SC2A 3WB2A 2PU7A 5E6SB 2WHEA 5K0WA 1RZUA 2PX0A 3DKIA 3OQIB 4FUTA 5EIWA 5G0SA 4MH0R 5FTJA 4MIOA 3PUHA 5D8DA 1SD1A 4QHYA 4AXBA 6ADHA 3DLBA 5T6MA 2VNHA 1KXJA 2C4WA 3CLKA 3WK6A 2IPAB 4YX9A 4XH9B 2FSGA 5DMXA 1ZKPA 1WUTA 2ZYHA 3RVKA 2PKWA 2BDTA 4JLUA 3ZEIA 3U60B 5FO0A 2IYFA 2ZJBA 4DDVA 2II6A 5KAMA 4TLBA 1GUFA 3CS3A 4WEQA 3ICEA 5D6NA 1AJEA 5ADHA 3BXZA 1GPNA 2QTWB 1FU8A 1XPJA 5K8JB 4IWNA 3TFOA 3KDPA 4C1HA 5HTKA 1P4GA 1M0SA 5KYVA 1H2XA 3EVTA 4IW3B 5KSWB 5LVAA 1A71A 2OAQ1 2X0EA 7MDHA 3KAJA 3DXZA 2B2XA 1IBKB 1FTGA 2BKXA 1PFUA 3GAAA 1HI9A 4N6GA 4NE9A 2HCFA 3PUYA 1UPTA 4L6CA 3RANA 1QF6A 1EK2A 1P1IA 2XBLA 3NCTA 1NBMD 3AGQA 4U2FA 5EQDA 1DI0A 4DYDA 1PR4A 2GPJA 5DULA 2JG3A 3QQ5A 2NXAA 1E9VA 5JO9A 2ERXA 1EBFA 4TTQA 2O5EA 2BFMA 3KVOA 1W88B 1DO2A 2M6SA 3L0CA 3B3JA 1E6CA 1Z0FA 3A7DA 3CVXA 2RGNA 3GRZA 3S28A 4LF6B 2VAXA 5HM8A 4M0DA 3I62A 1J2EA 2QVZX 4FZ5A 5EPEA 4ZVVA 5JYBA 3PXGA 2CLOB 2Q2WA 4BMPB 1RXCA 3KR1A 4ZMRA 5IAOA 4GICA 1SBZA 2QMHA 5DHAA 1Z6TA 5IBQA 3SZMA 1XM8A 1LQUA 3RBXA 2VNIA 5LWQA 1PR1A 3NHLA 4JYAB 2UXCB 2NUBA 4L85A 4NWIA 4AKSA 3CZ5A 5KJFA 4KO3S 5A6SB 2GCIA 4ZEOA 3TTSA 3EDOA 4GOJA 1G60A 1NXWA 3LC1O 4YCLA 4IJQA 3TL2A 4GDFA 4Q9NA 5AHKA 4WHMA 2RGUA 3SG0A 2QTCA 1SBQA 2BV3A 3HE3A 1AKUA 1NQAO 4H6XA 4J1TA 3SHOA 3QQPA 1PR0A 5DKFA 1V9CA 3LGAA 4PN7A 1QIGA 2E2WA 1TQHA 3Q5DA 4IIXA 5K0FA 3G8CA 1TTTA 3G88A 4AY2A 1XCLA 4CMIB 4IDFA 3ZDCA 1E4EA 1F2TA 2FV8A 3CE9A 2MU1A 1BA2A 1LBSA 2UV8A 3NC4A 4MAFA 5BWNA 3GLIA 4TMXA 1E79D 3PVSA 3OU6A 2HRRA 2JBHA 2GNAA 4ED9A 2HGZA 2R48A 3JD1A 4PAQA 3FPLA 3RVOA 4IIBA 4RXUA 4N7BA 4URWR 1TZKA 4ALMA 1PNOA 1K92A 3HGQA 2UZIR 2FFJA 3LY7A 4P5DA 1SUSA 3NBAA 3KELA 2IFTA 1WRAA 5ED0A 1PV1A 5JQGB 3VVCA 1SZDA 3TFQA 4Z9AA 3WB0A 1XMSA 1YDWA 2NSJA 4RADA 2VCEA 5EESA 3M9LA 2W2PA 4HLQB 1D0IA 4YMTA 1ZTCA 1XDUA 5TQ0B 1HLPA 1T4CB 3PFBA 2GN6A 4E4RA 3AFHA 3K53A 3KQOA 2G7ZA 3A1TA 4R1LA 3KTAB 4L27A 2J6HA 2O8FB 1MIOB 1W8IA 2OBNA 2FZKA 3CFYA 1F9AA 2FNAA 2I3DA 3RBAA 4HGQA 2FRXA 3KV1A 3PNQA 4Y6SA 3VC1A 4Z7QB 1IY1A 5KX5A 5A9TA 1QGOA 2HKIA 1MD9A 2O7RA 3JQDA 1WV1A 1NY5A 4RE6A 3L01A 5J9FA 4LCEA 1QJ4A 5EZYA 5IBRA 4LSMA 4LYHA 1N0HA 5BYKA 4FWBA 1KYVA 3R23A 1QCDA 4ZQGA 3A4VA 2GZRA 2PZAA 2X4IA 1SIOA 5TLSA 3AQ4A 1Y9DA 4D44A 4O5AA 3VR0A 4ILEA 5BN3A 1V5WA 3LXMA 2ZOSA 5SV2A 5E7MA 3SF8A 1NMXA 1WW1A 1XZHA 4ER7A 4HZUB 2QPLA 4GG1A 4JI1B 4BAGA 3OCYA 1ZXXA 1SMLA 2FEXA 4MDFA 4A8JC 2IGTA 5CITA 1Y3DE 4IHAA 4KLNA 5FEUA 5BPHA 2MYPA 4JBHA 3KB2A 1W4ZA 4Z7OB 3T9EA 1ZO8A 2DERA 1EQ2A 1VJ0A 3C87A 221PA 3THYB 3BQMB 5L3QA 2W4QA 4AZSA 1GKUB 4W5NA 2A5JA 1GT6A 4KL8S 1N3LA 1XQ9A 2FAXA 2IEIA 3IP7A 3KR0A 4GEGA 3WIUA 1JYSA 4HDMA 3GARA 4RA9B 3GEDA 1O0CA 1I1HA 1YO6A 4PZDA 2YYSA 2RI0A 5TB5A 2H00A 3HUTA 3ZBQA 2BYTA 1QMGA 2YTZA 2GHTA 3EWSA 1EVJA 1M1NB 1NQWA 2YJGA 3N2ZB 3BC1A 1RQ7A 3PFGA 4GSKA 4B87A 5BV7A 1NW6A 2HIHA 4E07A 5TIIA 4W5OA 1R74A 2ONKA 3ORSA 5DN6D 1EU1A 4TLLB 2WPNA 4DLSA 4ZI2A 3PA8A 4PZLA 2P6UA 3MT9A 1OAOC 4ZVMA 1SXJA 5T6BA 2HA3A 4HLUC 4AJNA 5BY2A 2BKLA 3NHBA 4MW1A 1L5NA 4H7JA 1OBHA 3QVSA 2BFFA 4FEEA 2XMZA 3Q8XB 2VP4A 2PSFA 2WT4A 5BVHA 1SHLA 3A8TA 2XYRA 2R7MA 2DFLA 1DWQA 4W1QA 2VF7A 1TYAE 3O92A 4YCDA 4I5GA 4XXHA 3GLHB 3KFXA 1RWNA 3TINA 4CIBA 2DFDA 3GJ3A 1S3IA 1R6XA 3OX1A 4DVJA 2G0NA 2DHRA 2OCGA 1LBTA 4TKZA 2CXQA 5HE8A 1E3QA 5CA0A 4AJPA 4C14A 1BD3A 4GZ5A 4I7EA 2WSLA 5CLHA 3RKKA 2GTHA 3HR7A 4B1FA 1N34B 1S4MA 1NXSA 1EKXA 1UXJA 2IGBA 4UTNA 3SDZA 2OBXA 1JFSA 1M8PA 1ZM9A 4KLCA 1XJ0A 1TTHA 1V4VA 2AMFA 4AWXA 2C5EA 5IW8A 1S3FA 5EZSA 4FX5A 3EXAA 3MC1A 3VKWA 3WO0A 2XY4A 4JT4A 3VR4D 4DSZA 4DV1B 1XJ5A 3HUDA 2CNWD 2G25A 3CF2A 4NMLA 4IGAA 3ELYA 3B52X 4MI1A 4Q1CA 5GINE 4HYQA 3TLCA 5F7OA 3ISVA 5SICE 3RWOA 5A5FA 4KB5A 4O4LA 4ZEXA 3OM9A 5C7OO 1DDOA 3LMKA 3K1JA 2WHGA 5IXSA 1WHSA 4GW3A 4DZZA 4GRDA 1PJ8A 2PVCA 4YJFB 1DBVO 2WUFA 3KHSA 1P29A 2PX2A 3AYZB 3ZUPA 1UEJA 2QX7A 1OBVA 4KXXA 3REQA 1DC3A 4Q4AB 4AN4A 3PDHA 1KE1A 1VHWA 2QOEA 3LL7A 3TSAA 9ATCA 2I6XA 2VPYA 1WKBA 3O8OB 1RP1A 3V2UA 4XWAA 1KQGA 2YXPX 3DBIA 2L69A 1FPMA 3LOPA 4OQPA 5FJIA 5C4MA 1KQ3A 3BK7A 1C0IA 2BDUA 3EDMA 3ZWOA 2OORA 2O7QA 1LZLA 1ZN9A 3MGCA 2XUPA 3PKJA 5LS3A 3EXIB 3U39A 3WYEA 4CCWA 4CLEA 4LBYA 1FY2A 3NAGA 3KTDA 4NQ2A 5L4LA 1SVKA 1FZTA 1NUQA 4MJ3A 1JRLA 1N2IA 1KQPA 2EATA 2MSCB 3O8QA 2UZ1A 4LXYA 3TPZA 3I1FA 1DHTA 1X1RA 2FLVA 1UT5A 1GVNB 2JNWA 3LQYA 4UTVA 2I7VA 4JL8A 2V7XA 2MHCA 4RDIA 2CJPA 3EFEA 1UBCA 1GUBA 2HSWA 5B5SA 3N0TA 4US2R 3RU2A 3MW8A 4RULA 1NG9A 4CU2A 4RJTA 5JATA 3HKBB 3O47A 5K3AA 1L8AA 2W6PA 4HPWA 1O6CA 1PEAA 2I55A 3F1LA 5CT5A 2HNBA 3VR6H 3GLFA 1LEHA 4LC1A 4LOKA 4OGGA 2H1RA 3AINA 4GR4A 1ZVJA 2Y1GA 3EB9A 4XM1A 1OD6A 5DYNA 4S04A 3VZBA 2WYVA 2HW8A 1IM8A 3O3NB 4YBZA 3V3KA 3HBLA 3LC0A 1ZM2A 1GJRA 3V4LA 3ZTWA 4AD8A 4FKMA 2VNKA 3LY8A 1JIXA 4RNCA 3T0IA 1BMDA 4JC0A 2I1WA 3LUGA 1U0RA 3HDQA 1TK3A 3MXOA 4G84A 1XYVA 4MW9A 1EUZA 2GJ8A 5DNEA 3H8JA 1P4JA 5HRUA 3UT0A 1R0KA 3BFVA 5B4UA 1MZPA 1KMMA 2ZRDA 3W9BA 5LZ7A 2N1BA 3DMRA 3QX3A 2XUKA 4BMXA 4HB3A 1X74A 1N3YA 1HG0A 2GXUA 4J0IA 2DQSA 3A9VA 5G1NA 5EWMA 3P9PA 2GM4A 1XNRB 2DOOA 4ZCLA 4MUIA 1V8FA 4EPTA 2SKCA 4QUAA 3FYUB 4RIFA 4UE3S 3FPJA 1P45A 1QANA 1J90A 1W87A 2G70A 5HG0A 4RK1A 3BJIC 3ADPA 3EVFA 3RBZA 2FEAA 1LRJA 2XSZA 4Q3DA 3OLCX 3SP1A 2EL7A 3I0VA 1P1HA 3Q7RA 4YROA 1XL1A 4F2GA 3OE4A 1GAEO 1FPQA 3IBGA 3H9JA 3LPAA 2F43A 1F0NA 1JI3A 1ZA1A 3E53A 3PNBA 4GPIB 5FPSA 4AZ3A 1HYQA 4IXTA 1I3OA 4P22A 1DX4A 4RSMA 5EI5A 3BK2A 3WP0A 1Z2PX 5HDQA 1FTSA 3V9AA 1S8OA 4Z0NA 2BGTA 2FUG1 1R00A 1T2UA 2HJVA 1VHJA 3RVPA 3QPVA 4UREA 5AT1A 5AJTA 3ENQA 3ETDA 1TIKA 1YJXA 4N5IX 2HCTA 3LECA 4UHDA 1O57A 3LUJA 4EQZA 1VHLA 2WU1A 4PR3A 4AL4A 4AN0A 4MMXB 2GBPA 3K1TA 2QL7A 3MTDA 4KEPA 4UWSB 3GCZA 1GUDA 3L0YA 2EKQA 4B7AA 1SKUA 1JU9A 1BDHA 2FP4B 3JATA 2B61A 4KE6A 2ZKLA 1M33A 4HWPA 5B1SA 2G8LA 1FS4A 4B2YA 3UK6A 2MIIA 5DX0A 1KOJA 4A27A 3M4NA 5IT0A 1JT1A 4TLDA 1C3LA 3I83A 2QM0A 2JJ1D 3ZY4A 4EGFA 2JJQA 2QLJA 3FR8A 2IEZA 3CCBA 2HSDA 3LYLA 4LS3A 4DA9A 5HNKA 5HJEA 2CXSA 2H2DA 3KL7A 1T4BA 3AXTA 3IV7A 4HL6A 1UC8A 2J4CA 4IZHA 4WESB 5C51B 2VH2A 4LGYA 1IRIA 1Q0HA 4JEMA 4M9CA 2WZCA 3AT1A 1DXHA 2Y67A 4AZ0B 4AURA 1ODFA 1RM4A 5CHEA 1CE8B 1XJCA 1ZUNB 2O48X 2I34A 3E1GA 7REQB 2CVFA 5J43A 1KU6A 3UAVA 3ZLTA 4ZIRA 1SULA 2Y05A 1E9CA 1A9TA 4E5VA 4WKCA 1II0A 4BP8A 2IRWA 1YDMA 4C3OB 4E03A 5L9AA 1J23A 3WBFA 1UKZA 1A88A 3L07A 4CM6A 4ZJZA 4BC0A 4NF2A 3P0RA 4J94A 2AOUA 1PG0A 4YVFA 3VMFA 1NURA 2O8DA 4IH9A 4CLOA 3NP9A 3OT1A 4DT1A 2XBUA 1QWSA 5LZ8A 3UCFA 2Z8YM 1WVIA 2DBVO 4RPKA 1ZRMA 4X6YA 5EMJA 3IEUA 4A6DA 1OAKA 3R3SA 1MTOA 1VMIA 3QVKA 2A67A 3FFXA 3ZWKA 2W4MA 1B43A 4XD2A 3K6SB 4ZAVA 3DOCA 4XLTA 3UC5A 4EY7A 5K4HA 5JH7F 4GQBA 1IXSB 1WG8A 1XN1A 2IZ7A 3BERA 2O0LA 3G2OA 3VDQA 4O08A 2E5WA 3IPAA 5UKDA 1H0KA 1MA0A 1G16A 2VDUE 1I0IA 4YGYA 5A3SA 5FT9A 4L9SA 1EFVA 3RFTA 1S7CA 2GASA 1A1VA 3RVLA 2VF4X 2ZJOA 1N9ZA 1TYZA 3SICE 4D45A 3ZGNA 2DULA 3SLKA 3TL3A 3ZXIA 4AQDA 4NONA 4KAAA 4KPYA 4QHSA 2C4UA 4JX8A 3PJFA 121PA 1EI9A 3HJRA 1DUIA 2EAUA 1MAAA 4LGVA 5TVKA 3V33A 1DWUA 1TU0A 1POWA 2P4ZA 1ZD4A 2BONA 1Y7LA 3A9TA 3KFLA 4IDHA 1TVMA 4UAUA 5E3HA 3L1VA 3BHNA 1QO0D 1K07A 4P4NA 1RTTA 2LE0A 3B5EA 2JHPA 3AJ8A 4J0CA 2BBSA 4WZAE 1R8JA 1FFGA 2I3GA 2P8JA 3F7MA 4RQTA 3F96A 1AV7A 3SQOA 4QTYA 4B6FA 4LRUA 4ZYTA 2GM3A 3IBSA 2DYKA 3PWKA 1LX6A 2CFSA 4YJHB 4BNZA 4MV1A 1M2GA 3ROMA 3M2TA 2QSUA 4O2BB 2XH8A 4N3AA 1TJ3A 2GJKA 5JCOC 3WFZA 3NAZA 1LD3A 1GCAA 1BCRB 1JTEA 1W5SA 4L73A 3EE6A 3L4JA 2UUBB 4C0HA 2F8LA 3CLUC 3CMCO 3R8FA 3P8ZA 5AVVA 1P1BA 3QUCA 5AWFC 2IH2A 2ATVA 4LF5B 4OKSA 3L6UA 4HNAA 2JH9A 2VJDA 3LP8A 2AJTA 2MDTA 4I19A 4AYWA 4CR6A 3UMCA 2O5VA 1X80B 3LK7A 1TGYA 2ANCA 1B2LA 1JDBC 1GZDA 2I4LA 1P5FA 1XCOA 2XR1A 3R41A 1O8CA 2MSEB 4UBJA 1CF9A 3FYTA 3PX2A 4K26A 4DA7A 2CDRA 4BWGA 3FNIA 1U6KA 1HXHA 2C2ZA 3ZCVA 4MO9A 4L8VA 3OURA 1CSEE 4WJLA 3GCXA 2YNVA 3IQIX 2G9VA 3ORFA 4JT2A 4LISA 3UJ7A 4CLRB 1A9SA 4OJYA 1CZLA 1P7VA 3IERA 3W5BA 1VGNA 3PHBE 2PT7A 3BSSA 3A31A 3DVAB 5E1OA 3M33A 4BZQA 5AVOA 4ZT2A 3EIUA 2IU3A 5JBQA 5KUTA 4Q24A 1R64A 4K6MA 1UOQA 4D7AA 1L9YA 2GCGA 2HXSA 4QBTA 4ETNA 3TLEA 1C0PA 4RBNA 3X2ZA 4UZFA 5AJHA 5CIQA 2EW1A 2HK8A 3DAGA 2OQ2A 1TUGA 3DM5A 1TA0A 2XVAA 3HCDA 2I87A 3OEWA 4MEJA 3TSOA 3THXA 1O9GA 3OKFA 1ULBA 2QRPA 5LQCA 1HNXB 3PCXA 1XKQA 1WL8A 2P91A 4UZEA 4V24A 3V6LA 4Z6XA 4C3VA 4JC4A 2XNSA 5AI5A 5EP2A 5A03A 4NEGA 4G26A 2R00C 1SCDA 3O84A 2YN0A 4NHOA 3QHPA 1SOMA 2XOEA 4PZAA 3RAEC 1SC4A 1QOQB 2GAJA 3G89A 3O1HB 4YAKA 4FGZA 2XA9A 2XNKA 4M0LA 1NHGA 3JU3A 3OIYA 4KVFA 2CN1A 4IYJA 4UJ5A 4WUTA 3RTDA 1FFYA 2O8CB 1MMFB 2NADA 2I2DA 4AJEA 3C1TA 3TOXA 3CNQS 3OCUA 4UC0A 1JEQB 1UMBB 3I9JA 1EA5A 4XDHA 4BXOB 1TA4A 1VLZA 1N25A 3BXFA 1CFZA 3S4YA 4RTMA 1RXVA 4MJ7A 2PS3A 3LYHA 3DOIA 5KOJB 1ZK3A 4YAGA 1KEZA 1ZICA 2DMRA 4RJ2A 4EGSA 1LGYA 4D4MA 1CEXA 2BG8A 2XLBA 2GK7A 4J75A 3PPYA 2GN9A 3AR8A 3PQEA 4NAUA 3DLCA 1W47A 3C7TA 3JCZA 2WU4A 3JW8A 4LDRA 5I9SA 3RAPR 3BVPA 4FJ1A 4PX5A 4Y2SA 5ALPA 3ROGA 2SICE 4PICA 3SYTA 4UUAA 3L0IB 1Q2XA 3I64A 1QIIA 1V41E 3KVNA 1OX4A 5F1PA 4BFTA 3HZZA 4WXRA 1H2WA 5KYUA 1E6WA 2OCBA 4OK6A 1SXPA 2QUIA 1KAHA 3VU9B 4NYMR 1YJQA 1SWWA 1ETUA 1KY4A 1M66A 1N2SA 1W4BA 3KPVA 1V4NA 3CZRA 3K2IA 4CHGA 4UM8B 2WIFA 2ZBRA 3AILA 4GMXA 4JEUA 1SXJD 1KS2A 4MW7A 4R6WA 3DAFA 4JBXA 1RQNA 3LHSA 4E1BA 2VZ0A 3HUUA 2JLAA 2EFGA 2ZE7A 1O9BA 3NOQA 2V6JA 2CXNA 4KUHA 2EJTA 4NMXB 2XUIA 1KWKA 2CBZA 1WCYA 4DUZB 3DBRB 4MEAA 4GYQA 3DJFA 4LWZA 4QDXA 5G0TA 4TYWA 3L9XA 4U7FA 5JMWA 3EZ7A 2AUNA 1SWVA 2PKCA 3FYUC 1RXWA 2HA0A 4II7A 2X5KO 1ZI6A 1C1HA 4MMYB 2VAMA 4FONA 3T3PB 3VPDA 1U8XX 3CVJA 4RK4A 2PZGA 4E70A 1ADCA 2AN1A 5BN1A 2RG7A 3TWOA 3AEQB 4EARA 3V4OA 5JNTA 3QVVA 1M7BA 1WA5A 3A1EA 3WSVA 1GPDG 1YQGA 2R6AA 3GO4A 1NV9A 1I2MA 3EEIA 3GNLA 3RGGA 3VPSA 3ET5A 1H1DA 1FU7A 1UL1X 4DQ0A 3I9LA 1NR7A 5FD8A 2ZRQA 4ISBA 4Q1FA 4JSYA 3GCDA 3UAWA 5EFOA 1T2EA 1EB9A 4S1NA 3W5SA 1ECJA <