1M2XA

Crystal structure of the metallo-beta-lactamase blab of chryseobacterium meningosepticum in complex with the inhibitor d-captopril
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
219
structure length
219
Chain Sequence
DVKIEKLKDNLYVYTTYNTFNGTKYAANAVYLVTDKGVVVIDCPWGEDKFKSFTDEIYKKHGKKVIMNIATHSHDDRAGGLEYFGKIGAKTYSTKMTDSILAKENKPRAQYTFDNNKSFKVGKSEFQVYYPGKGHTADNVVVWFPKEKVLVGGCIIKSADSKDLGYIGEAYVNDWTQSVHNIQQKFSGAQYVVAGHDDWKDQRSIQHTLDLINEYQQKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords class B carbapenemase BlaB-1
publication title The 1.5 A structure of Chryseobacterium meningosepticum Zn-beta-lactamase in complex with the inhibitor, D-captopril
pubmed doi rcsb
source organism Elizabethkingia meningoseptica
molecule tags Hydrolase
total genus 68
structure length 219
sequence length 219
chains with identical sequence B, C, D
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2002-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 1m2xA00
3SPUA 2ZWRA 4EYBA 1SMLA 5B15A 2ZO4A 4WD6A 3X2YA 3SW3A 2CBNA 4ZNBA 1WUOA 3IELA 3RPCA 2GCUA 4RAWA 5EV8A 4UBQA 2YNVA 2OHJA 4D1UA 4DIKA 4PVTA 5ACQA 1P9EA 2I7XA 5ACSA 3SD9A 2Q42A 4CHLA 3H3EA 3BV6A 2WYMA 4GYUA 5LCHA 2M5DA 1WW1A 3PY6A 3LVZA 1XM8A 5ACWA 2FU9A 4TZFA 4D02A 3T3NA 2QINA 3X30A 4EFZA 1A7TA 2BFKA 4F6ZA 2BTNA 2Q9UA 1E5DA 3ZR9A 3MD7A 3BK2A 5KILA 3P2UA 4UWOB 1XTOA 4ZO3A 5A5ZA 1DD6A 2FHXA 2P4ZA 4EY2A 3JXPA 5LCFA 4D1TA 5B1UA 3A4YA 5ACTA 1BVTA 4XWWA 2Y8AA 2Y87A 4AWZA 2P97A 2OHHA 2BC2A 4RM5A 4C1CA 4J5FA 2M5CA 2BFLA 4D1WA 4V0HA 5FQCA 5A0VA 2FU8A 3T9MA 4J5HA 2P18A 2QDSA 4AWYB 1MQOA 1M2XA 5EWAA 2BG8A 5HIOA 4BP0A 2P1EA 2OHIA 1VGNA 5EHTA 3SFPA 4C1DA 4TZ9A 5KIKA 3DHBA 1KO3A 3KNSA 4C1FA 4RL0A 5K4NA 5EVKA 3DHAA 3I14A 4HL2A 3DH8A 4UWRB 3AJ3A 1QH5A 2FU6A 4YSLA 2FU7A 5EV6A 2WYLA 5K0WA 4U4LA 5DPXA 5A87A 2E7YA 4TZEA 3T3OA 2BGAA 5K4KA 4C09A 4BZ3A 4Z5ZA 3I11A 2DKFA 2WHGA 5HISA 3BC2A 5ACVA 5LM6A 4JO0A 3I0VA 4HKYA 4C1HA 4ZEJA 2HB9A 4NQ6A 3TP9A 1VJNA 5AEBA 3I15A 1Y44A 5LCAA 3X2ZA 5K4MA 4NQ4A 5LLDA 3SRXA 4FR7A 4HL1A 2GFKA 2GKLA 4RL2A 4C1GA 1HLKA 4XWTA 4GYQA 2WRSA 4C1EA 3G1PA 3ZWFA 3KL7A 4FSBA 4UAMA 1JJEA 4EXYA 2BG7A 1YCFA 2BMIA 1ZNBA 2NZEA 4D1VA 2QDTA 4AX1B 4TYFA 3FCZA 5LE1A 1VMEA 1JT1A 4Z60A 4Z5YA 1WUPA 4YSBA 1YCGA 5AXOA 3IDZA 3ESHA 2YZ3A 2YNUA 1BC2A 5FQBA 1L9YA 2FM6A 2AZ4A 5B3RA 4EXSA 1KR3A 2QJSA 4H0DA 4KEQA 2I7VA 4B87A 3PY5A 4LE6A 5ACXA 2NXAA 3AF5A 5EVBA 2YNTB 2WYMC 2A7MA 2BFZB 2Q0JA 1QH3A 4AX0B 4NQ5A 5FQAA 2H6AA 2AIOA 1WRAA 4TYTA 1JJTA 3AF6A 5LSCA 4YSKA 5HH6A 3VQZA 3QH8A 4ZO2A 4UWSB 2Y8BA 3FAIA 3R2UA 2FK6A 3KNRA 5ACPA 5HH4A 3F9OA 3PG4A 2BR6A 2ZNBA 5HIPA 3RKKA 4RAMA 4PVOA 4DILA 2BG6A 4AD9A 2XR1A 2XF4A 3Q6VA 1DXKA 4P62A 4UA4A 4F6HA 4Z67A 3IE1A 2YNVB 5EW0A 2DOOA 4Z7RA 4NQ2A 1KO2A 4XUKA 4FEKA 1A8TA 3IE0A 4RBSA 5A0TA 3IEKA 5EH9A 3DHCA 3IEMA 4GCWA 3S0ZA 3ADRA 3SBLA 5LS3A 2YCBA 1K07A 2VW8A 4EYFA 2FHXB 5AXRA 4KEPA 3WXCA 3I13A 3IE2A 2I7TA 5IQKA 3X2XA 4TZBA 1ZTCA 1X8GA 3RKJA 2YNTA 1ZKPA 2BFZA 2NYPA 2UYXA 3VPEA 2BG2A 2GMNA 5HH5A 3ZNBA 4EYLA 3BK1A 4UWPB 2GFJA 2QEDA 2YNWA 5AYAA 5ACRA 4O98A 4Z6XA 5EVDA 5ACUA 5AHRA 2Q0IA 2BG8B 2NZFA 3L6NA 5AHOA 1DDKA 1YCHA 3IOGA 2R2DA 5LMCA 5HIQA 1BMCA 2BIBA 1X8HA 2ZZIA 3ZQ4A 3IOFA 1X8IA
chains in the Genus database with same CATH superfamily
3SPUA 2ZWRA 4AXHA 4EYBA 1SMLA 5B15A 2ZO4A 4WD6A 3X2YA 3SW3A 2CBNA 4ZNBA 1WUOA 3IELA 3RPCA 2GCUA 4RAWA 5EV8A 4UBQA 2YNVA 2OHJA 4D1UA 4DIKA 4PVTA 5ACQA 1P9EA 2I7XA 5ACSA 3SD9A 2Q42A 4CHLA 3H3EA 3BV6A 2WYMA 4GYUA 5LCHA 2M5DA 1WW1A 3PY6A 3LVZA 1XM8A 5ACWA 2FU9A 4TZFA 4D02A 3T3NA 2QINA 3X30A 4EFZA 1A7TA 2BFKA 4F6ZA 2BTNA 2Q9UA 1E5DA 3ZR9A 3MD7A 3BK2A 5KILA 3P2UA 4UWOB 1XTOA 4ZO3A 5A5ZA 1DD6A 2FHXA 2P4ZA 4EY2A 3JXPA 5LCFA 4D1TA 5B1UA 3A4YA 5ACTA 1BVTA 4XWWA 2Y8AA 2Y87A 4AWZA 2P97A 2OHHA 2BC2A 4RM5A 4C1CA 4J5FA 2M5CA 2BFLA 4D1WA 4AV7A 4V0HA 5FQCA 5A0VA 2FU8A 3T9MA 4J5HA 2P18A 2QDSA 4AWYB 1MQOA 1M2XA 5EWAA 2BG8A 5HIOA 4BP0A 2P1EA 2OHIA 1VGNA 5EHTA 3SFPA 4C1DA 4TZ9A 5KIKA 3DHBA 1KO3A 3KNSA 4C1FA 4RL0A 5K4NA 5EVKA 3DHAA 3I14A 4HL2A 3DH8A 5A23A 4UWRB 3AJ3A 1QH5A 2FU6A 4YSLA 2FU7A 5EV6A 2WYLA 5K0WA 4U4LA 5DPXA 5A87A 2E7YA 4TZEA 5AJLA 3T3OA 2BGAA 5K4KA 4C09A 4BZ3A 4Z5ZA 3I11A 2DKFA 2WHGA 5HISA 3BC2A 5ACVA 2CG3A 5LM6A 4JO0A 3I0VA 4HKYA 4C1HA 4ZEJA 2HB9A 4NQ6A 3TP9A 1VJNA 5AEBA 3I15A 1Y44A 5LCAA 3X2ZA 5K4MA 4NQ4A 5LLDA 3SRXA 4FR7A 4HL1A 2GFKA 2GKLA 4RL2A 4C1GA 1HLKA 4XWTA 4GYQA 2WRSA 4C1EA 3G1PA 3ZWFA 3KL7A 2CFZA 4FSBA 4UAMA 1JJEA 4EXYA 2BG7A 1YCFA 2BMIA 1ZNBA 2NZEA 4D1VA 2CG2A 2QDTA 4AX1B 4TYFA 3FCZA 5LE1A 1VMEA 1JT1A 4Z60A 4Z5YA 1WUPA 4YSBA 1YCGA 5AXOA 3IDZA 2YHEA 3ESHA 2YZ3A 2YNUA 4PDXA 1BC2A 5FQBA 1L9YA 2FM6A 2AZ4A 5B3RA 4EXSA 1KR3A 2QJSA 4H0DA 4KEQA 2I7VA 4B87A 2CFUA 3PY5A 4LE6A 5ACXA 2NXAA 3AF5A 5EVBA 2YNTB 2WYMC 2A7MA 2BFZB 2Q0JA 1QH3A 4AX0B 4NQ5A 5FQAA 2H6AA 2AIOA 1WRAA 4TYTA 1JJTA 3AF6A 5LSCA 4YSKA 5HH6A 3VQZA 3QH8A 4ZO2A 4UWSB 2Y8BA 3FAIA 3R2UA 2FK6A 3KNRA 5ACPA 5HH4A 3F9OA 3PG4A 2BR6A 2ZNBA 5HIPA 3RKKA 4RAMA 4PVOA 4DILA 2BG6A 4AD9A 2XR1A 2XF4A 3Q6VA 1DXKA 4P62A 4UA4A 4F6HA 4Z67A 3IE1A 2YNVB 5EW0A 2DOOA 4NURA 4Z7RA 4NQ2A 1KO2A 4XUKA 4FEKA 1A8TA 3IE0A 4RBSA 5A0TA 3IEKA 5EH9A 3DHCA 3IEMA 4GCWA 3S0ZA 3ADRA 3SBLA 5LS3A 2YCBA 1K07A 2VW8A 4EYFA 2FHXB 5AXRA 4KEPA 3WXCA 3I13A 3IE2A 2I7TA 5IQKA 3X2XA 4TZBA 1ZTCA 1X8GA 3RKJA 2YNTA 1ZKPA 2BFZA 2NYPA 2UYXA 3VPEA 2BG2A 2GMNA 5AIJA 5HH5A 3ZNBA 4EYLA 3BK1A 4UWPB 2GFJA 2QEDA 2YNWA 5AYAA 5ACRA 4O98A 4Z6XA 5EVDA 5ACUA 5AHRA 2Q0IA 2BG8B 2NZFA 3L6NA 5AHOA 1DDKA 1YCHA 3IOGA 2R2DA 5LMCA 5HIQA 1BMCA 2BIBA 1X8HA 2ZZIA 3ZQ4A 3IOFA 1X8IA
chains in the Genus database with same CATH topology
3SPUA 2ZWRA 4EYBA 1SMLA 5B15A 2ZO4A 4WD6A 3X2YA 3SW3A 2CBNA 4ZNBA 1WUOA 3IELA 3RPCA 2GCUA 4RAWA 5EV8A 4UBQA 2YNVA 2OHJA 4D1UA 4DIKA 4PVTA 5ACQA 1P9EA 2I7XA 5ACSA 3SD9A 2Q42A 4CHLA 3H3EA 3BV6A 2WYMA 4GYUA 5LCHA 2M5DA 1WW1A 3PY6A 3LVZA 1XM8A 5ACWA 2FU9A 4TZFA 4D02A 3T3NA 2QINA 3X30A 4EFZA 1A7TA 2BFKA 4F6ZA 2BTNA 2Q9UA 1E5DA 3ZR9A 3MD7A 3BK2A 5KILA 3P2UA 4UWOB 1XTOA 4ZO3A 5A5ZA 1DD6A 2FHXA 2P4ZA 4EY2A 3JXPA 5LCFA 4D1TA 5B1UA 3A4YA 5ACTA 1BVTA 4XWWA 2Y8AA 2Y87A 4AWZA 2P97A 2OHHA 2BC2A 4RM5A 4C1CA 4J5FA 2M5CA 2BFLA 4D1WA 4V0HA 5FQCA 5A0VA 2FU8A 3T9MA 4J5HA 2P18A 2QDSA 4AWYB 1MQOA 1M2XA 5EWAA 2BG8A 5HIOA 4BP0A 2P1EA 2OHIA 1VGNA 5EHTA 3SFPA 4C1DA 4TZ9A 5KIKA 3DHBA 1KO3A 3KNSA 4C1FA 4RL0A 5K4NA 5EVKA 3DHAA 3I14A 4HL2A 3DH8A 4UWRB 3AJ3A 1QH5A 2FU6A 4YSLA 2FU7A 5EV6A 2WYLA 5K0WA 4U4LA 5DPXA 5A87A 2E7YA 4TZEA 3T3OA 2BGAA 5K4KA 4C09A 4BZ3A 4Z5ZA 3I11A 2DKFA 2WHGA 5HISA 3BC2A 5ACVA 5LM6A 4JO0A 3I0VA 4HKYA 4C1HA 4ZEJA 2HB9A 4NQ6A 3TP9A 1VJNA 5AEBA 3I15A 1Y44A 5LCAA 3X2ZA 5K4MA 4NQ4A 5LLDA 3SRXA 4FR7A 4HL1A 2GFKA 2GKLA 4RL2A 4C1GA 1HLKA 4XWTA 4GYQA 2WRSA 4C1EA 3G1PA 3ZWFA 3KL7A 4FSBA 4UAMA 1JJEA 4EXYA 2BG7A 1YCFA 2BMIA 1ZNBA 2NZEA 4D1VA 2QDTA 4AX1B 4TYFA 3FCZA 5LE1A 1VMEA 1JT1A 4Z60A 4Z5YA 1WUPA 4YSBA 1YCGA 5AXOA 3IDZA 3ESHA 2YZ3A 2YNUA 1BC2A 5FQBA 1L9YA 2FM6A 2AZ4A 5B3RA 4EXSA 1KR3A 2QJSA 4H0DA 4KEQA 2I7VA 4B87A 3PY5A 4LE6A 5ACXA 2NXAA 3AF5A 5EVBA 2YNTB 2WYMC 2A7MA 2BFZB 2Q0JA 1QH3A 4AX0B 4NQ5A 5FQAA 2H6AA 2AIOA 1WRAA 4TYTA 1JJTA 3AF6A 5LSCA 4YSKA 5HH6A 3VQZA 3QH8A 4ZO2A 4UWSB 2Y8BA 3FAIA 3R2UA 2FK6A 3KNRA 5ACPA 5HH4A 3F9OA 3PG4A 2BR6A 2ZNBA 5HIPA 3RKKA 4RAMA 4PVOA 4DILA 2BG6A 4AD9A 2XR1A 2XF4A 3Q6VA 1DXKA 4P62A 4UA4A 4F6HA 4Z67A 3IE1A 2YNVB 5EW0A 2DOOA 4Z7RA 4NQ2A 1KO2A 4XUKA 4FEKA 1A8TA 3IE0A 4RBSA 5A0TA 3IEKA 5EH9A 3DHCA 3IEMA 4GCWA 3S0ZA 3ADRA 3SBLA 5LS3A 2YCBA 1K07A 2VW8A 4EYFA 2FHXB 5AXRA 4KEPA 3WXCA 3I13A 3IE2A 2I7TA 5IQKA 3X2XA 4TZBA 1ZTCA 1X8GA 3RKJA 2YNTA 1ZKPA 2BFZA 2NYPA 2UYXA 3VPEA 2BG2A 2GMNA 5HH5A 3ZNBA 4EYLA 3BK1A 4UWPB 2GFJA 2QEDA 2YNWA 5AYAA 5ACRA 4O98A 4Z6XA 5EVDA 5ACUA 5AHRA 2Q0IA 2BG8B 2NZFA 3L6NA 5AHOA 1DDKA 1YCHA 3IOGA 2R2DA 5LMCA 5HIQA 1BMCA 2BIBA 1X8HA 2ZZIA 3ZQ4A 3IOFA 1X8IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SPU A;  2ZWR A;  4EYB A;  1SML A;  5B15 A;  2ZO4 A;  4WD6 A;  3X2Y A;  3SW3 A;  2CBN A;  4ZNB A;  1WUO A;  3IEL A;  3RPC A;  2GCU A;  4RAW A;  5EV8 A;  4UBQ A;  2YNV A;  2OHJ A;  4D1U A;  4DIK A;  4PVT A;  5ACQ A;  1P9E A;  2I7X A;  5ACS A;  3SD9 A;  2Q42 A;  4CHL A;  3H3E A;  3BV6 A;  2WYM A;  4GYU A;  5LCH A;  2M5D A;  1WW1 A;  3PY6 A;  3LVZ A;  1XM8 A;  5ACW A;  2FU9 A;  4TZF A;  4D02 A;  3T3N A;  2QIN A;  3X30 A;  4EFZ A;  1A7T A;  2BFK A;  4F6Z A;  2BTN A;  2Q9U A;  1E5D A;  3ZR9 A;  3MD7 A;  3BK2 A;  5KIL A;  3P2U A;  4UWO B;  1XTO A;  4ZO3 A;  5A5Z A;  1DD6 A;  2FHX A;  2P4Z A;  4EY2 A;  3JXP A;  5LCF A;  4D1T A;  5B1U A;  3A4Y A;  5ACT A;  1BVT A;  4XWW A;  2Y8A A;  2Y87 A;  4AWZ A;  2P97 A;  2OHH A;  2BC2 A;  4RM5 A;  4C1C A;  4J5F A;  2M5C A;  2BFL A;  4D1W A;  4V0H A;  5FQC A;  5A0V A;  2FU8 A;  3T9M A;  4J5H A;  2P18 A;  2QDS A;  4AWY B;  1MQO A;  1M2X A;  5EWA A;  2BG8 A;  5HIO A;  4BP0 A;  2P1E A;  2OHI A;  1VGN A;  5EHT A;  3SFP A;  4C1D A;  4TZ9 A;  5KIK A;  3DHB A;  1KO3 A;  3KNS A;  4C1F A;  4RL0 A;  5K4N A;  5EVK A;  3DHA A;  3I14 A;  4HL2 A;  3DH8 A;  4UWR B;  3AJ3 A;  1QH5 A;  2FU6 A;  4YSL A;  2FU7 A;  5EV6 A;  2WYL A;  5K0W A;  4U4L A;  5DPX A;  5A87 A;  2E7Y A;  4TZE A;  3T3O A;  2BGA A;  5K4K A;  4C09 A;  4BZ3 A;  4Z5Z A;  3I11 A;  2DKF A;  2WHG A;  5HIS A;  3BC2 A;  5ACV A;  5LM6 A;  4JO0 A;  3I0V A;  4HKY A;  4C1H A;  4ZEJ A;  2HB9 A;  4NQ6 A;  3TP9 A;  1VJN A;  5AEB A;  3I15 A;  1Y44 A;  5LCA A;  3X2Z A;  5K4M A;  4NQ4 A;  5LLD A;  3SRX A;  4FR7 A;  4HL1 A;  2GFK A;  2GKL A;  4RL2 A;  4C1G A;  1HLK A;  4XWT A;  4GYQ A;  2WRS A;  4C1E A;  3G1P A;  3ZWF A;  3KL7 A;  4FSB A;  4UAM A;  1JJE A;  4EXY A;  2BG7 A;  1YCF A;  2BMI A;  1ZNB A;  2NZE A;  4D1V A;  2QDT A;  4AX1 B;  4TYF A;  3FCZ A;  5LE1 A;  1VME A;  1JT1 A;  4Z60 A;  4Z5Y A;  1WUP A;  4YSB A;  1YCG A;  5AXO A;  3IDZ A;  3ESH A;  2YZ3 A;  2YNU A;  1BC2 A;  5FQB A;  1L9Y A;  2FM6 A;  2AZ4 A;  5B3R A;  4EXS A;  1KR3 A;  2QJS A;  4H0D A;  4KEQ A;  2I7V A;  4B87 A;  3PY5 A;  4LE6 A;  5ACX A;  2NXA A;  3AF5 A;  5EVB A;  2YNT B;  2WYM C;  2A7M A;  2BFZ B;  2Q0J A;  1QH3 A;  4AX0 B;  4NQ5 A;  5FQA A;  2H6A A;  2AIO A;  1WRA A;  4TYT A;  1JJT A;  3AF6 A;  5LSC A;  4YSK A;  5HH6 A;  3VQZ A;  3QH8 A;  4ZO2 A;  4UWS B;  2Y8B A;  3FAI A;  3R2U A;  2FK6 A;  3KNR A;  5ACP A;  5HH4 A;  3F9O A;  3PG4 A;  2BR6 A;  2ZNB A;  5HIP A;  3RKK A;  4RAM A;  4PVO A;  4DIL A;  2BG6 A;  4AD9 A;  2XR1 A;  2XF4 A;  3Q6V A;  1DXK A;  4P62 A;  4UA4 A;  4F6H A;  4Z67 A;  3IE1 A;  2YNV B;  5EW0 A;  2DOO A;  4Z7R A;  4NQ2 A;  1KO2 A;  4XUK A;  4FEK A;  1A8T A;  3IE0 A;  4RBS A;  5A0T A;  3IEK A;  5EH9 A;  3DHC A;  3IEM A;  4GCW A;  3S0Z A;  3ADR A;  3SBL A;  5LS3 A;  2YCB A;  1K07 A;  2VW8 A;  4EYF A;  2FHX B;  5AXR A;  4KEP A;  3WXC A;  3I13 A;  3IE2 A;  2I7T A;  5IQK A;  3X2X A;  4TZB A;  1ZTC A;  1X8G A;  3RKJ A;  2YNT A;  1ZKP A;  2BFZ A;  2NYP A;  2UYX A;  3VPE A;  2BG2 A;  2GMN A;  5HH5 A;  3ZNB A;  4EYL A;  3BK1 A;  4UWP B;  2GFJ A;  2QED A;  2YNW A;  5AYA A;  5ACR A;  4O98 A;  4Z6X A;  5EVD A;  5ACU A;  5AHR A;  2Q0I A;  2BG8 B;  2NZF A;  3L6N A;  5AHO A;  1DDK A;  1YCH A;  3IOG A;  2R2D A;  5LMC A;  5HIQ A;  1BMC A;  2BIB A;  1X8H A;  2ZZI A;  3ZQ4 A;  3IOF A;  1X8I A; 
#chains in the Genus database with same CATH topology
 3SPU A;  2ZWR A;  4AXH A;  4EYB A;  1SML A;  5B15 A;  2ZO4 A;  4WD6 A;  3X2Y A;  3SW3 A;  2CBN A;  4ZNB A;  1WUO A;  3IEL A;  3RPC A;  2GCU A;  4RAW A;  5EV8 A;  4UBQ A;  2YNV A;  2OHJ A;  4D1U A;  4DIK A;  4PVT A;  5ACQ A;  1P9E A;  2I7X A;  5ACS A;  3SD9 A;  2Q42 A;  4CHL A;  3H3E A;  3BV6 A;  2WYM A;  4GYU A;  5LCH A;  2M5D A;  1WW1 A;  3PY6 A;  3LVZ A;  1XM8 A;  5ACW A;  2FU9 A;  4TZF A;  4D02 A;  3T3N A;  2QIN A;  3X30 A;  4EFZ A;  1A7T A;  2BFK A;  4F6Z A;  2BTN A;  2Q9U A;  1E5D A;  3ZR9 A;  3MD7 A;  3BK2 A;  5KIL A;  3P2U A;  4UWO B;  1XTO A;  4ZO3 A;  5A5Z A;  1DD6 A;  2FHX A;  2P4Z A;  4EY2 A;  3JXP A;  5LCF A;  4D1T A;  5B1U A;  3A4Y A;  5ACT A;  1BVT A;  4XWW A;  2Y8A A;  2Y87 A;  4AWZ A;  2P97 A;  2OHH A;  2BC2 A;  4RM5 A;  4C1C A;  4J5F A;  2M5C A;  2BFL A;  4D1W A;  4AV7 A;  4V0H A;  5FQC A;  5A0V A;  2FU8 A;  3T9M A;  4J5H A;  2P18 A;  2QDS A;  4AWY B;  1MQO A;  1M2X A;  5EWA A;  2BG8 A;  5HIO A;  4BP0 A;  2P1E A;  2OHI A;  1VGN A;  5EHT A;  3SFP A;  4C1D A;  4TZ9 A;  5KIK A;  3DHB A;  1KO3 A;  3KNS A;  4C1F A;  4RL0 A;  5K4N A;  5EVK A;  3DHA A;  3I14 A;  4HL2 A;  3DH8 A;  5A23 A;  4UWR B;  3AJ3 A;  1QH5 A;  2FU6 A;  4YSL A;  2FU7 A;  5EV6 A;  2WYL A;  5K0W A;  4U4L A;  5DPX A;  5A87 A;  2E7Y A;  4TZE A;  5AJL A;  3T3O A;  2BGA A;  5K4K A;  4C09 A;  4BZ3 A;  4Z5Z A;  3I11 A;  2DKF A;  2WHG A;  5HIS A;  3BC2 A;  5ACV A;  2CG3 A;  5LM6 A;  4JO0 A;  3I0V A;  4HKY A;  4C1H A;  4ZEJ A;  2HB9 A;  4NQ6 A;  3TP9 A;  1VJN A;  5AEB A;  3I15 A;  1Y44 A;  5LCA A;  3X2Z A;  5K4M A;  4NQ4 A;  5LLD A;  3SRX A;  4FR7 A;  4HL1 A;  2GFK A;  2GKL A;  4RL2 A;  4C1G A;  1HLK A;  4XWT A;  4GYQ A;  2WRS A;  4C1E A;  3G1P A;  3ZWF A;  3KL7 A;  2CFZ A;  4FSB A;  4UAM A;  1JJE A;  4EXY A;  2BG7 A;  1YCF A;  2BMI A;  1ZNB A;  2NZE A;  4D1V A;  2CG2 A;  2QDT A;  4AX1 B;  4TYF A;  3FCZ A;  5LE1 A;  1VME A;  1JT1 A;  4Z60 A;  4Z5Y A;  1WUP A;  4YSB A;  1YCG A;  5AXO A;  3IDZ A;  2YHE A;  3ESH A;  2YZ3 A;  2YNU A;  4PDX A;  1BC2 A;  5FQB A;  1L9Y A;  2FM6 A;  2AZ4 A;  5B3R A;  4EXS A;  1KR3 A;  2QJS A;  4H0D A;  4KEQ A;  2I7V A;  4B87 A;  2CFU A;  3PY5 A;  4LE6 A;  5ACX A;  2NXA A;  3AF5 A;  5EVB A;  2YNT B;  2WYM C;  2A7M A;  2BFZ B;  2Q0J A;  1QH3 A;  4AX0 B;  4NQ5 A;  5FQA A;  2H6A A;  2AIO A;  1WRA A;  4TYT A;  1JJT A;  3AF6 A;  5LSC A;  4YSK A;  5HH6 A;  3VQZ A;  3QH8 A;  4ZO2 A;  4UWS B;  2Y8B A;  3FAI A;  3R2U A;  2FK6 A;  3KNR A;  5ACP A;  5HH4 A;  3F9O A;  3PG4 A;  2BR6 A;  2ZNB A;  5HIP A;  3RKK A;  4RAM A;  4PVO A;  4DIL A;  2BG6 A;  4AD9 A;  2XR1 A;  2XF4 A;  3Q6V A;  1DXK A;  4P62 A;  4UA4 A;  4F6H A;  4Z67 A;  3IE1 A;  2YNV B;  5EW0 A;  2DOO A;  4NUR A;  4Z7R A;  4NQ2 A;  1KO2 A;  4XUK A;  4FEK A;  1A8T A;  3IE0 A;  4RBS A;  5A0T A;  3IEK A;  5EH9 A;  3DHC A;  3IEM A;  4GCW A;  3S0Z A;  3ADR A;  3SBL A;  5LS3 A;  2YCB A;  1K07 A;  2VW8 A;  4EYF A;  2FHX B;  5AXR A;  4KEP A;  3WXC A;  3I13 A;  3IE2 A;  2I7T A;  5IQK A;  3X2X A;  4TZB A;  1ZTC A;  1X8G A;  3RKJ A;  2YNT A;  1ZKP A;  2BFZ A;  2NYP A;  2UYX A;  3VPE A;  2BG2 A;  2GMN A;  5AIJ A;  5HH5 A;  3ZNB A;  4EYL A;  3BK1 A;  4UWP B;  2GFJ A;  2QED A;  2YNW A;  5AYA A;  5ACR A;  4O98 A;  4Z6X A;  5EVD A;  5ACU A;  5AHR A;  2Q0I A;  2BG8 B;  2NZF A;  3L6N A;  5AHO A;  1DDK A;  1YCH A;  3IOG A;  2R2D A;  5LMC A;  5HIQ A;  1BMC A;  2BIB A;  1X8H A;  2ZZI A;  3ZQ4 A;  3IOF A;  1X8I A; 
#chains in the Genus database with same CATH homology
 3SPU A;  2ZWR A;  4EYB A;  1SML A;  5B15 A;  2ZO4 A;  4WD6 A;  3X2Y A;  3SW3 A;  2CBN A;  4ZNB A;  1WUO A;  3IEL A;  3RPC A;  2GCU A;  4RAW A;  5EV8 A;  4UBQ A;  2YNV A;  2OHJ A;  4D1U A;  4DIK A;  4PVT A;  5ACQ A;  1P9E A;  2I7X A;  5ACS A;  3SD9 A;  2Q42 A;  4CHL A;  3H3E A;  3BV6 A;  2WYM A;  4GYU A;  5LCH A;  2M5D A;  1WW1 A;  3PY6 A;  3LVZ A;  1XM8 A;  5ACW A;  2FU9 A;  4TZF A;  4D02 A;  3T3N A;  2QIN A;  3X30 A;  4EFZ A;  1A7T A;  2BFK A;  4F6Z A;  2BTN A;  2Q9U A;  1E5D A;  3ZR9 A;  3MD7 A;  3BK2 A;  5KIL A;  3P2U A;  4UWO B;  1XTO A;  4ZO3 A;  5A5Z A;  1DD6 A;  2FHX A;  2P4Z A;  4EY2 A;  3JXP A;  5LCF A;  4D1T A;  5B1U A;  3A4Y A;  5ACT A;  1BVT A;  4XWW A;  2Y8A A;  2Y87 A;  4AWZ A;  2P97 A;  2OHH A;  2BC2 A;  4RM5 A;  4C1C A;  4J5F A;  2M5C A;  2BFL A;  4D1W A;  4V0H A;  5FQC A;  5A0V A;  2FU8 A;  3T9M A;  4J5H A;  2P18 A;  2QDS A;  4AWY B;  1MQO A;  1M2X A;  5EWA A;  2BG8 A;  5HIO A;  4BP0 A;  2P1E A;  2OHI A;  1VGN A;  5EHT A;  3SFP A;  4C1D A;  4TZ9 A;  5KIK A;  3DHB A;  1KO3 A;  3KNS A;  4C1F A;  4RL0 A;  5K4N A;  5EVK A;  3DHA A;  3I14 A;  4HL2 A;  3DH8 A;  4UWR B;  3AJ3 A;  1QH5 A;  2FU6 A;  4YSL A;  2FU7 A;  5EV6 A;  2WYL A;  5K0W A;  4U4L A;  5DPX A;  5A87 A;  2E7Y A;  4TZE A;  3T3O A;  2BGA A;  5K4K A;  4C09 A;  4BZ3 A;  4Z5Z A;  3I11 A;  2DKF A;  2WHG A;  5HIS A;  3BC2 A;  5ACV A;  5LM6 A;  4JO0 A;  3I0V A;  4HKY A;  4C1H A;  4ZEJ A;  2HB9 A;  4NQ6 A;  3TP9 A;  1VJN A;  5AEB A;  3I15 A;  1Y44 A;  5LCA A;  3X2Z A;  5K4M A;  4NQ4 A;  5LLD A;  3SRX A;  4FR7 A;  4HL1 A;  2GFK A;  2GKL A;  4RL2 A;  4C1G A;  1HLK A;  4XWT A;  4GYQ A;  2WRS A;  4C1E A;  3G1P A;  3ZWF A;  3KL7 A;  4FSB A;  4UAM A;  1JJE A;  4EXY A;  2BG7 A;  1YCF A;  2BMI A;  1ZNB A;  2NZE A;  4D1V A;  2QDT A;  4AX1 B;  4TYF A;  3FCZ A;  5LE1 A;  1VME A;  1JT1 A;  4Z60 A;  4Z5Y A;  1WUP A;  4YSB A;  1YCG A;  5AXO A;  3IDZ A;  3ESH A;  2YZ3 A;  2YNU A;  1BC2 A;  5FQB A;  1L9Y A;  2FM6 A;  2AZ4 A;  5B3R A;  4EXS A;  1KR3 A;  2QJS A;  4H0D A;  4KEQ A;  2I7V A;  4B87 A;  3PY5 A;  4LE6 A;  5ACX A;  2NXA A;  3AF5 A;  5EVB A;  2YNT B;  2WYM C;  2A7M A;  2BFZ B;  2Q0J A;  1QH3 A;  4AX0 B;  4NQ5 A;  5FQA A;  2H6A A;  2AIO A;  1WRA A;  4TYT A;  1JJT A;  3AF6 A;  5LSC A;  4YSK A;  5HH6 A;  3VQZ A;  3QH8 A;  4ZO2 A;  4UWS B;  2Y8B A;  3FAI A;  3R2U A;  2FK6 A;  3KNR A;  5ACP A;  5HH4 A;  3F9O A;  3PG4 A;  2BR6 A;  2ZNB A;  5HIP A;  3RKK A;  4RAM A;  4PVO A;  4DIL A;  2BG6 A;  4AD9 A;  2XR1 A;  2XF4 A;  3Q6V A;  1DXK A;  4P62 A;  4UA4 A;  4F6H A;  4Z67 A;  3IE1 A;  2YNV B;  5EW0 A;  2DOO A;  4Z7R A;  4NQ2 A;  1KO2 A;  4XUK A;  4FEK A;  1A8T A;  3IE0 A;  4RBS A;  5A0T A;  3IEK A;  5EH9 A;  3DHC A;  3IEM A;  4GCW A;  3S0Z A;  3ADR A;  3SBL A;  5LS3 A;  2YCB A;  1K07 A;  2VW8 A;  4EYF A;  2FHX B;  5AXR A;  4KEP A;  3WXC A;  3I13 A;  3IE2 A;  2I7T A;  5IQK A;  3X2X A;  4TZB A;  1ZTC A;  1X8G A;  3RKJ A;  2YNT A;  1ZKP A;  2BFZ A;  2NYP A;  2UYX A;  3VPE A;  2BG2 A;  2GMN A;  5HH5 A;  3ZNB A;  4EYL A;  3BK1 A;  4UWP B;  2GFJ A;  2QED A;  2YNW A;  5AYA A;  5ACR A;  4O98 A;  4Z6X A;  5EVD A;  5ACU A;  5AHR A;  2Q0I A;  2BG8 B;  2NZF A;  3L6N A;  5AHO A;  1DDK A;  1YCH A;  3IOG A;  2R2D A;  5LMC A;  5HIQ A;  1BMC A;  2BIB A;  1X8H A;  2ZZI A;  3ZQ4 A;  3IOF A;  1X8I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...