1M2XA

Crystal structure of the metallo-beta-lactamase blab of chryseobacterium meningosepticum in complex with the inhibitor d-captopril
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
219
structure length
219
Chain Sequence
b'DVKIEKLKDNLYVYTTYNTFNGTKYAANAVYLVTDKGVVVIDCPWGEDKFKSFTDEIYKKHGKKVIMNIATHSHDDRAGGLEYFGKIGAKTYSTKMTDSILAKENKPRAQYTFDNNKSFKVGKSEFQVYYPGKGHTADNVVVWFPKEKVLVGGCIIKSADSKDLGYIGEAYVNDWTQSVHNIQQKFSGAQYVVAGHDDWKDQRSIQHTLDLINEYQQKQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords class B carbapenemase BlaB-1
publication title The 1.5 A structure of Chryseobacterium meningosepticum Zn-beta-lactamase in complex with the inhibitor, D-captopril
pubmed doi rcsb
source organism Elizabethkingia meningoseptica
molecule tags Hydrolase
total genus 68
structure length 219
sequence length 219
chains with identical sequence B, C, D
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2002-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 1m2xA00
4AWZA 3KNSA 4FSBA 5KIKA 4D1WA 3FCZA 4TZBA 4TZ9A 2BG7A 2HB9A 4C1EA 3BC2A 2OHIA 2BR6A 4JO0A 5ACUA 2FU6A 4YSBA 4D1UA 1M2XA 2QEDA 2ZZIA 2BFZB 2YNTB 4C1CA 1BMCA 2I7VA 4TZEA 1QH5A 1ZNBA 4YSLA 2I7XA 3IEKA 3T9MA 2BFLA 5FQCA 4EYFA 2P4ZA 4UA4A 3T3NA 4V0HA 2P1EA 2BFZA 2YNTA 5LCHA 5HIPA 2NZFA 4HL2A 3I0VA 2CBNA 3WXCA 3R2UA 3Q6VA 5EVKA 4DILA 3MD7A 3IOFA 2I7TA 4J5FA 2DKFA 4C09A 3ADRA 3L6NA 4AD9A 3SD9A 3SBLA 3QH8A 4FR7A 4BP0A 4XWTA 2WRSA 2BMIA 2ZWRA 3DHBA 2R2DA 3G1PA 3IE1A 3SPUA 1A7TA 4Z5YA 2BIBA 4AX0B 1WW1A 5LSCA 2FU7A 4C1FA 4GYQA 2BFKA 5HH4A 4B87A 3ZWFA 3DH8A 2QDSA 3JXPA 2GKLA 5A87A 1L9YA 2FU9A 2ZO4A 5FQBA 1XTOA 5EV8A 4WD6A 2BGAA 4UBQA 1JT1A 4TYFA 2FU8A 2NZEA 4NQ6A 4XUKA 5B3RA 4UWOB 2DOOA 3FAIA 3P2UA 4KEPA 1YCHA 4GYUA 3ESHA 3ZQ4A 5EH9A 4HL1A 1BC2A 4D1VA 1QH3A 4PVTA 2WYMA 5A0VA 5HIOA 5AHOA 3T3OA 4AWYB 1DD6A 1KO3A 5AHRA 3RPCA 5EV6A 4BZ3A 4Z60A 2BG6A 2GCUA 1VMEA 2Q9UA 5ACSA 3PY5A 5LE1A 3IE2A 4TZFA 5AYAA 5ACTA 5KILA 3AJ3A 2FHXB 2WHGA 3SW3A 4C1DA 4D1TA 5A0TA 4C1HA 2M5DA 2BG2A 1DXKA 3SRXA 1WRAA 1ZTCA 4XWWA 2FHXA 4UWRB 5A5ZA 4O98A 5AXOA 1VGNA 4DIKA 4UAMA 5K4MA 2QINA 1A8TA 4UWPB 5HIQA 3TP9A 2NXAA 4C1GA 2VW8A 4ZNBA 3KNRA 2WYMC 3LVZA 5AXRA 4F6ZA 3VPEA 2M5CA 4RAWA 1YCFA 2BTNA 4Z7RA 5K0WA 2P97A 2BC2A 5LM6A 4RL0A 4U4LA 3KL7A 5LCFA 5ACRA 1HLKA 3DHCA 4RBSA 2Y8BA 4UWSB 5LMCA 2QJSA 3IOGA 2P18A 5ACWA 3X30A 2AZ4A 2Y87A 3PY6A 4LE6A 4Z5ZA 3I14A 1JJTA 3ZNBA 4FEKA 1Y44A 3IEMA 3H3EA 3X2ZA 2YNUA 2QDTA 4ZO2A 4RAMA 5EVBA 3VQZA 4Z67A 1E5DA 4ZEJA 4EXYA 4J5HA 5EHTA 4PVOA 2OHHA 4D02A 4EY2A 2Q0JA 5EW0A 1X8IA 2OHJA 2Q0IA 4KEQA 3I11A 4RL2A 3IELA 2YZ3A 3S0ZA 5EWAA 4F6HA 5HH6A 5EVDA 4NQ2A 5ACQA 5ACPA 1WUOA 4H0DA 1X8GA 5K4NA 4NQ5A 5HH5A 1YCGA 4RM5A 2FK6A 2XF4A 4Z6XA 1MQOA 5LLDA 3IDZA 4EYBA 2FM6A 3BK1A 5ACVA 1ZKPA 1KO2A 2GFKA 3F9OA 1VJNA 4AX1B 5HISA 2NYPA 4CHLA 5LS3A 1KR3A 2ZNBA 3X2YA 2E7YA 5LCAA 5AEBA 3I13A 5ACXA 1P9EA 4TYTA 3RKJA 1WUPA 3AF6A 4ZO3A 2GMNA 1DDKA 4GCWA 2BG8B 2H6AA 3X2XA 1BVTA 2Q42A 1SMLA 2WYLA 5K4KA 3AF5A 3A4YA 3BV6A 3IE0A 1JJEA 3ZR9A 1K07A 2YNVB 4HKYA 5IQKA 2BG8A 2UYXA 2GFJA 2A7MA 1X8HA 2AIOA 4NQ4A 5B1UA 3DHAA 3PG4A 1XM8A 2YNVA 2Y8AA 4EYLA 4EXSA 5FQAA 5B15A 3BK2A 2YCBA 3RKKA 2XR1A 4EFZA 4P62A 3SFPA 5DPXA 4YSKA 2YNWA 3I15A
chains in the Genus database with same CATH superfamily
4AWZA 3KNSA 4FSBA 5KIKA 4D1WA 3FCZA 2CG2A 4TZBA 4TZ9A 2BG7A 4AXHA 2HB9A 4C1EA 3BC2A 2OHIA 2BR6A 4JO0A 5ACUA 2FU6A 4YSBA 4D1UA 1M2XA 2QEDA 2ZZIA 2BFZB 2YNTB 4C1CA 1BMCA 2I7VA 4TZEA 1QH5A 1ZNBA 4YSLA 2I7XA 3IEKA 3T9MA 2BFLA 5FQCA 4EYFA 2P4ZA 4UA4A 3T3NA 4V0HA 2P1EA 2BFZA 2YNTA 5LCHA 5HIPA 2NZFA 4HL2A 3I0VA 2CBNA 3WXCA 3R2UA 3Q6VA 5EVKA 4DILA 3MD7A 3IOFA 2I7TA 4J5FA 2DKFA 4C09A 3ADRA 3L6NA 4AD9A 3SD9A 3SBLA 3QH8A 4FR7A 4BP0A 4XWTA 2WRSA 2BMIA 2ZWRA 3DHBA 2R2DA 3G1PA 3IE1A 3SPUA 1A7TA 4Z5YA 2BIBA 4AX0B 1WW1A 5LSCA 2FU7A 4C1FA 4GYQA 2BFKA 5HH4A 4B87A 3ZWFA 3DH8A 2QDSA 3JXPA 2GKLA 5A87A 1L9YA 2FU9A 2ZO4A 5FQBA 1XTOA 5EV8A 4WD6A 2BGAA 4UBQA 1JT1A 4TYFA 2FU8A 2NZEA 4NQ6A 4XUKA 5B3RA 4UWOB 2DOOA 3FAIA 3P2UA 4KEPA 1YCHA 4GYUA 3ESHA 3ZQ4A 5EH9A 4HL1A 1BC2A 4D1VA 1QH3A 4PVTA 2WYMA 5A0VA 5HIOA 5AHOA 3T3OA 4AWYB 1DD6A 1KO3A 5AHRA 3RPCA 5EV6A 4BZ3A 4Z60A 2BG6A 2GCUA 1VMEA 2Q9UA 5ACSA 3PY5A 5LE1A 3IE2A 4TZFA 5AYAA 4AV7A 5ACTA 5KILA 3AJ3A 5AJLA 2FHXB 2WHGA 3SW3A 4C1DA 4D1TA 5A0TA 4C1HA 2M5DA 2BG2A 1DXKA 3SRXA 1WRAA 1ZTCA 4XWWA 2FHXA 4UWRB 5A5ZA 4O98A 5AXOA 1VGNA 5K4MA 4UAMA 4DIKA 2QINA 1A8TA 4UWPB 5HIQA 3TP9A 2NXAA 4C1GA 2VW8A 4ZNBA 3KNRA 2WYMC 3LVZA 5AXRA 4F6ZA 3VPEA 2M5CA 4RAWA 1YCFA 2BTNA 4Z7RA 5K0WA 2P97A 2BC2A 5LM6A 4RL0A 4U4LA 3KL7A 5LCFA 5ACRA 1HLKA 3DHCA 4RBSA 2Y8BA 4UWSB 5LMCA 2QJSA 3IOGA 2P18A 5ACWA 3X30A 4PDXA 2AZ4A 2Y87A 3PY6A 4LE6A 4Z5ZA 2YHEA 3I14A 1JJTA 3ZNBA 4FEKA 1Y44A 3IEMA 3H3EA 3X2ZA 2YNUA 2QDTA 4ZO2A 4RAMA 2CFUA 5EVBA 3VQZA 4Z67A 4NURA 1E5DA 4ZEJA 4EXYA 4J5HA 5EHTA 4PVOA 2OHHA 4D02A 4EY2A 2Q0JA 5EW0A 1X8IA 2OHJA 2Q0IA 4KEQA 3I11A 4RL2A 3IELA 2YZ3A 5A23A 3S0ZA 5EWAA 4F6HA 5HH6A 5EVDA 4NQ2A 5ACQA 5ACPA 1WUOA 4H0DA 1X8GA 5K4NA 4NQ5A 5HH5A 1YCGA 4RM5A 2FK6A 2XF4A 4Z6XA 1MQOA 5LLDA 3IDZA 4EYBA 2FM6A 2CFZA 3BK1A 5ACVA 1ZKPA 1KO2A 2GFKA 3F9OA 1VJNA 4AX1B 5HISA 2NYPA 4CHLA 5LS3A 1KR3A 2ZNBA 2CG3A 3X2YA 2E7YA 5LCAA 5AEBA 3I13A 5ACXA 1P9EA 4TYTA 3RKJA 1WUPA 3AF6A 4ZO3A 2GMNA 1DDKA 4GCWA 2BG8B 2H6AA 3X2XA 1BVTA 2Q42A 1SMLA 2WYLA 5K4KA 3AF5A 3A4YA 3BV6A 3IE0A 1JJEA 3ZR9A 1K07A 2YNVB 4HKYA 5IQKA 2BG8A 2UYXA 2GFJA 2A7MA 1X8HA 2AIOA 4NQ4A 5B1UA 3DHAA 3PG4A 1XM8A 2YNVA 2Y8AA 4EYLA 4EXSA 5FQAA 5B15A 5AIJA 3BK2A 2YCBA 3RKKA 2XR1A 4EFZA 4P62A 3SFPA 5DPXA 4YSKA 2YNWA 3I15A
chains in the Genus database with same CATH topology
4AWZA 3KNSA 4FSBA 5KIKA 4D1WA 3FCZA 4TZBA 4TZ9A 2BG7A 2HB9A 4C1EA 3BC2A 2OHIA 2BR6A 4JO0A 5ACUA 2FU6A 4YSBA 4D1UA 1M2XA 2QEDA 2ZZIA 2BFZB 2YNTB 4C1CA 1BMCA 2I7VA 4TZEA 1QH5A 1ZNBA 4YSLA 2I7XA 3IEKA 3T9MA 2BFLA 5FQCA 4EYFA 2P4ZA 4UA4A 3T3NA 4V0HA 2P1EA 2BFZA 2YNTA 5LCHA 5HIPA 2NZFA 4HL2A 3I0VA 2CBNA 3WXCA 3R2UA 3Q6VA 5EVKA 4DILA 3MD7A 3IOFA 2I7TA 4J5FA 2DKFA 4C09A 3ADRA 3L6NA 4AD9A 3SD9A 3SBLA 3QH8A 4FR7A 4BP0A 4XWTA 2WRSA 2BMIA 2ZWRA 3DHBA 2R2DA 3G1PA 3IE1A 3SPUA 1A7TA 4Z5YA 2BIBA 4AX0B 1WW1A 5LSCA 2FU7A 4C1FA 4GYQA 2BFKA 5HH4A 4B87A 3ZWFA 3DH8A 2QDSA 3JXPA 2GKLA 5A87A 1L9YA 2FU9A 2ZO4A 5FQBA 1XTOA 5EV8A 4WD6A 2BGAA 4UBQA 1JT1A 4TYFA 2FU8A 2NZEA 4NQ6A 4XUKA 5B3RA 4UWOB 2DOOA 3FAIA 3P2UA 4KEPA 1YCHA 4GYUA 3ESHA 3ZQ4A 5EH9A 4HL1A 1BC2A 4D1VA 1QH3A 4PVTA 2WYMA 5A0VA 5HIOA 5AHOA 3T3OA 4AWYB 1DD6A 1KO3A 5AHRA 3RPCA 5EV6A 4BZ3A 4Z60A 2BG6A 2GCUA 1VMEA 2Q9UA 5ACSA 3PY5A 5LE1A 3IE2A 4TZFA 5AYAA 5ACTA 5KILA 3AJ3A 2FHXB 2WHGA 3SW3A 4C1DA 4D1TA 5A0TA 4C1HA 2M5DA 2BG2A 1DXKA 3SRXA 1WRAA 1ZTCA 4XWWA 2FHXA 4UWRB 5A5ZA 4O98A 5AXOA 1VGNA 4DIKA 4UAMA 5K4MA 2QINA 1A8TA 4UWPB 5HIQA 3TP9A 2NXAA 4C1GA 2VW8A 4ZNBA 3KNRA 2WYMC 3LVZA 5AXRA 4F6ZA 3VPEA 2M5CA 4RAWA 1YCFA 2BTNA 4Z7RA 5K0WA 2P97A 2BC2A 5LM6A 4RL0A 4U4LA 3KL7A 5LCFA 5ACRA 1HLKA 3DHCA 4RBSA 2Y8BA 4UWSB 5LMCA 2QJSA 3IOGA 2P18A 5ACWA 3X30A 2AZ4A 2Y87A 3PY6A 4LE6A 4Z5ZA 3I14A 1JJTA 3ZNBA 4FEKA 1Y44A 3IEMA 3H3EA 3X2ZA 2YNUA 2QDTA 4ZO2A 4RAMA 5EVBA 3VQZA 4Z67A 1E5DA 4ZEJA 4EXYA 4J5HA 5EHTA 4PVOA 2OHHA 4D02A 4EY2A 2Q0JA 5EW0A 1X8IA 2OHJA 2Q0IA 4KEQA 3I11A 4RL2A 3IELA 2YZ3A 3S0ZA 5EWAA 4F6HA 5HH6A 5EVDA 4NQ2A 5ACQA 5ACPA 1WUOA 4H0DA 1X8GA 5K4NA 4NQ5A 5HH5A 1YCGA 4RM5A 2FK6A 2XF4A 4Z6XA 1MQOA 5LLDA 3IDZA 4EYBA 2FM6A 3BK1A 5ACVA 1ZKPA 1KO2A 2GFKA 3F9OA 1VJNA 4AX1B 5HISA 2NYPA 4CHLA 5LS3A 1KR3A 2ZNBA 3X2YA 2E7YA 5LCAA 5AEBA 3I13A 5ACXA 1P9EA 4TYTA 3RKJA 1WUPA 3AF6A 4ZO3A 2GMNA 1DDKA 4GCWA 2BG8B 2H6AA 3X2XA 1BVTA 2Q42A 1SMLA 2WYLA 5K4KA 3AF5A 3A4YA 3BV6A 3IE0A 1JJEA 3ZR9A 1K07A 2YNVB 4HKYA 5IQKA 2BG8A 2UYXA 2GFJA 2A7MA 1X8HA 2AIOA 4NQ4A 5B1UA 3DHAA 3PG4A 1XM8A 2YNVA 2Y8AA 4EYLA 4EXSA 5FQAA 5B15A 3BK2A 2YCBA 3RKKA 2XR1A 4EFZA 4P62A 3SFPA 5DPXA 4YSKA 2YNWA 3I15A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AWZ A;  3KNS A;  4FSB A;  5KIK A;  4D1W A;  3FCZ A;  4TZB A;  4TZ9 A;  2BG7 A;  2HB9 A;  4C1E A;  3BC2 A;  2OHI A;  2BR6 A;  4JO0 A;  5ACU A;  2FU6 A;  4YSB A;  4D1U A;  1M2X A;  2QED A;  2ZZI A;  2BFZ B;  2YNT B;  4C1C A;  1BMC A;  2I7V A;  4TZE A;  1QH5 A;  1ZNB A;  4YSL A;  2I7X A;  3IEK A;  3T9M A;  2BFL A;  5FQC A;  4EYF A;  2P4Z A;  4UA4 A;  3T3N A;  4V0H A;  2P1E A;  2BFZ A;  2YNT A;  5LCH A;  5HIP A;  2NZF A;  4HL2 A;  3I0V A;  2CBN A;  3WXC A;  3R2U A;  3Q6V A;  5EVK A;  4DIL A;  3MD7 A;  3IOF A;  2I7T A;  4J5F A;  2DKF A;  4C09 A;  3ADR A;  3L6N A;  4AD9 A;  3SD9 A;  3SBL A;  3QH8 A;  4FR7 A;  4BP0 A;  4XWT A;  2WRS A;  2BMI A;  2ZWR A;  3DHB A;  2R2D A;  3G1P A;  3IE1 A;  3SPU A;  1A7T A;  4Z5Y A;  2BIB A;  4AX0 B;  1WW1 A;  5LSC A;  2FU7 A;  4C1F A;  4GYQ A;  2BFK A;  5HH4 A;  4B87 A;  3ZWF A;  3DH8 A;  2QDS A;  3JXP A;  2GKL A;  5A87 A;  1L9Y A;  2FU9 A;  2ZO4 A;  5FQB A;  1XTO A;  5EV8 A;  4WD6 A;  2BGA A;  4UBQ A;  1JT1 A;  4TYF A;  2FU8 A;  2NZE A;  4NQ6 A;  4XUK A;  5B3R A;  4UWO B;  2DOO A;  3FAI A;  3P2U A;  4KEP A;  1YCH A;  4GYU A;  3ESH A;  3ZQ4 A;  5EH9 A;  4HL1 A;  1BC2 A;  4D1V A;  1QH3 A;  4PVT A;  2WYM A;  5A0V A;  5HIO A;  5AHO A;  3T3O A;  4AWY B;  1DD6 A;  1KO3 A;  5AHR A;  3RPC A;  5EV6 A;  4BZ3 A;  4Z60 A;  2BG6 A;  2GCU A;  1VME A;  2Q9U A;  5ACS A;  3PY5 A;  5LE1 A;  3IE2 A;  4TZF A;  5AYA A;  5ACT A;  5KIL A;  3AJ3 A;  2FHX B;  2WHG A;  3SW3 A;  4C1D A;  4D1T A;  5A0T A;  4C1H A;  2M5D A;  2BG2 A;  1DXK A;  3SRX A;  1WRA A;  1ZTC A;  4XWW A;  2FHX A;  4UWR B;  5A5Z A;  4O98 A;  5AXO A;  1VGN A;  4DIK A;  4UAM A;  5K4M A;  2QIN A;  1A8T A;  4UWP B;  5HIQ A;  3TP9 A;  2NXA A;  4C1G A;  2VW8 A;  4ZNB A;  3KNR A;  2WYM C;  3LVZ A;  5AXR A;  4F6Z A;  3VPE A;  2M5C A;  4RAW A;  1YCF A;  2BTN A;  4Z7R A;  5K0W A;  2P97 A;  2BC2 A;  5LM6 A;  4RL0 A;  4U4L A;  3KL7 A;  5LCF A;  5ACR A;  1HLK A;  3DHC A;  4RBS A;  2Y8B A;  4UWS B;  5LMC A;  2QJS A;  3IOG A;  2P18 A;  5ACW A;  3X30 A;  2AZ4 A;  2Y87 A;  3PY6 A;  4LE6 A;  4Z5Z A;  3I14 A;  1JJT A;  3ZNB A;  4FEK A;  1Y44 A;  3IEM A;  3H3E A;  3X2Z A;  2YNU A;  2QDT A;  4ZO2 A;  4RAM A;  5EVB A;  3VQZ A;  4Z67 A;  1E5D A;  4ZEJ A;  4EXY A;  4J5H A;  5EHT A;  4PVO A;  2OHH A;  4D02 A;  4EY2 A;  2Q0J A;  5EW0 A;  1X8I A;  2OHJ A;  2Q0I A;  4KEQ A;  3I11 A;  4RL2 A;  3IEL A;  2YZ3 A;  3S0Z A;  5EWA A;  4F6H A;  5HH6 A;  5EVD A;  4NQ2 A;  5ACQ A;  5ACP A;  1WUO A;  4H0D A;  1X8G A;  5K4N A;  4NQ5 A;  5HH5 A;  1YCG A;  4RM5 A;  2FK6 A;  2XF4 A;  4Z6X A;  1MQO A;  5LLD A;  3IDZ A;  4EYB A;  2FM6 A;  3BK1 A;  5ACV A;  1ZKP A;  1KO2 A;  2GFK A;  3F9O A;  1VJN A;  4AX1 B;  5HIS A;  2NYP A;  4CHL A;  5LS3 A;  1KR3 A;  2ZNB A;  3X2Y A;  2E7Y A;  5LCA A;  5AEB A;  3I13 A;  5ACX A;  1P9E A;  4TYT A;  3RKJ A;  1WUP A;  3AF6 A;  4ZO3 A;  2GMN A;  1DDK A;  4GCW A;  2BG8 B;  2H6A A;  3X2X A;  1BVT A;  2Q42 A;  1SML A;  2WYL A;  5K4K A;  3AF5 A;  3A4Y A;  3BV6 A;  3IE0 A;  1JJE A;  3ZR9 A;  1K07 A;  2YNV B;  4HKY A;  5IQK A;  2BG8 A;  2UYX A;  2GFJ A;  2A7M A;  1X8H A;  2AIO A;  4NQ4 A;  5B1U A;  3DHA A;  3PG4 A;  1XM8 A;  2YNV A;  2Y8A A;  4EYL A;  4EXS A;  5FQA A;  5B15 A;  3BK2 A;  2YCB A;  3RKK A;  2XR1 A;  4EFZ A;  4P62 A;  3SFP A;  5DPX A;  4YSK A;  2YNW A;  3I15 A; 
#chains in the Genus database with same CATH topology
 4AWZ A;  3KNS A;  4FSB A;  5KIK A;  4D1W A;  3FCZ A;  2CG2 A;  4TZB A;  4TZ9 A;  2BG7 A;  4AXH A;  2HB9 A;  4C1E A;  3BC2 A;  2OHI A;  2BR6 A;  4JO0 A;  5ACU A;  2FU6 A;  4YSB A;  4D1U A;  1M2X A;  2QED A;  2ZZI A;  2BFZ B;  2YNT B;  4C1C A;  1BMC A;  2I7V A;  4TZE A;  1QH5 A;  1ZNB A;  4YSL A;  2I7X A;  3IEK A;  3T9M A;  2BFL A;  5FQC A;  4EYF A;  2P4Z A;  4UA4 A;  3T3N A;  4V0H A;  2P1E A;  2BFZ A;  2YNT A;  5LCH A;  5HIP A;  2NZF A;  4HL2 A;  3I0V A;  2CBN A;  3WXC A;  3R2U A;  3Q6V A;  5EVK A;  4DIL A;  3MD7 A;  3IOF A;  2I7T A;  4J5F A;  2DKF A;  4C09 A;  3ADR A;  3L6N A;  4AD9 A;  3SD9 A;  3SBL A;  3QH8 A;  4FR7 A;  4BP0 A;  4XWT A;  2WRS A;  2BMI A;  2ZWR A;  3DHB A;  2R2D A;  3G1P A;  3IE1 A;  3SPU A;  1A7T A;  4Z5Y A;  2BIB A;  4AX0 B;  1WW1 A;  5LSC A;  2FU7 A;  4C1F A;  4GYQ A;  2BFK A;  5HH4 A;  4B87 A;  3ZWF A;  3DH8 A;  2QDS A;  3JXP A;  2GKL A;  5A87 A;  1L9Y A;  2FU9 A;  2ZO4 A;  5FQB A;  1XTO A;  5EV8 A;  4WD6 A;  2BGA A;  4UBQ A;  1JT1 A;  4TYF A;  2FU8 A;  2NZE A;  4NQ6 A;  4XUK A;  5B3R A;  4UWO B;  2DOO A;  3FAI A;  3P2U A;  4KEP A;  1YCH A;  4GYU A;  3ESH A;  3ZQ4 A;  5EH9 A;  4HL1 A;  1BC2 A;  4D1V A;  1QH3 A;  4PVT A;  2WYM A;  5A0V A;  5HIO A;  5AHO A;  3T3O A;  4AWY B;  1DD6 A;  1KO3 A;  5AHR A;  3RPC A;  5EV6 A;  4BZ3 A;  4Z60 A;  2BG6 A;  2GCU A;  1VME A;  2Q9U A;  5ACS A;  3PY5 A;  5LE1 A;  3IE2 A;  4TZF A;  5AYA A;  4AV7 A;  5ACT A;  5KIL A;  3AJ3 A;  5AJL A;  2FHX B;  2WHG A;  3SW3 A;  4C1D A;  4D1T A;  5A0T A;  4C1H A;  2M5D A;  2BG2 A;  1DXK A;  3SRX A;  1WRA A;  1ZTC A;  4XWW A;  2FHX A;  4UWR B;  5A5Z A;  4O98 A;  5AXO A;  1VGN A;  5K4M A;  4UAM A;  4DIK A;  2QIN A;  1A8T A;  4UWP B;  5HIQ A;  3TP9 A;  2NXA A;  4C1G A;  2VW8 A;  4ZNB A;  3KNR A;  2WYM C;  3LVZ A;  5AXR A;  4F6Z A;  3VPE A;  2M5C A;  4RAW A;  1YCF A;  2BTN A;  4Z7R A;  5K0W A;  2P97 A;  2BC2 A;  5LM6 A;  4RL0 A;  4U4L A;  3KL7 A;  5LCF A;  5ACR A;  1HLK A;  3DHC A;  4RBS A;  2Y8B A;  4UWS B;  5LMC A;  2QJS A;  3IOG A;  2P18 A;  5ACW A;  3X30 A;  4PDX A;  2AZ4 A;  2Y87 A;  3PY6 A;  4LE6 A;  4Z5Z A;  2YHE A;  3I14 A;  1JJT A;  3ZNB A;  4FEK A;  1Y44 A;  3IEM A;  3H3E A;  3X2Z A;  2YNU A;  2QDT A;  4ZO2 A;  4RAM A;  2CFU A;  5EVB A;  3VQZ A;  4Z67 A;  4NUR A;  1E5D A;  4ZEJ A;  4EXY A;  4J5H A;  5EHT A;  4PVO A;  2OHH A;  4D02 A;  4EY2 A;  2Q0J A;  5EW0 A;  1X8I A;  2OHJ A;  2Q0I A;  4KEQ A;  3I11 A;  4RL2 A;  3IEL A;  2YZ3 A;  5A23 A;  3S0Z A;  5EWA A;  4F6H A;  5HH6 A;  5EVD A;  4NQ2 A;  5ACQ A;  5ACP A;  1WUO A;  4H0D A;  1X8G A;  5K4N A;  4NQ5 A;  5HH5 A;  1YCG A;  4RM5 A;  2FK6 A;  2XF4 A;  4Z6X A;  1MQO A;  5LLD A;  3IDZ A;  4EYB A;  2FM6 A;  2CFZ A;  3BK1 A;  5ACV A;  1ZKP A;  1KO2 A;  2GFK A;  3F9O A;  1VJN A;  4AX1 B;  5HIS A;  2NYP A;  4CHL A;  5LS3 A;  1KR3 A;  2ZNB A;  2CG3 A;  3X2Y A;  2E7Y A;  5LCA A;  5AEB A;  3I13 A;  5ACX A;  1P9E A;  4TYT A;  3RKJ A;  1WUP A;  3AF6 A;  4ZO3 A;  2GMN A;  1DDK A;  4GCW A;  2BG8 B;  2H6A A;  3X2X A;  1BVT A;  2Q42 A;  1SML A;  2WYL A;  5K4K A;  3AF5 A;  3A4Y A;  3BV6 A;  3IE0 A;  1JJE A;  3ZR9 A;  1K07 A;  2YNV B;  4HKY A;  5IQK A;  2BG8 A;  2UYX A;  2GFJ A;  2A7M A;  1X8H A;  2AIO A;  4NQ4 A;  5B1U A;  3DHA A;  3PG4 A;  1XM8 A;  2YNV A;  2Y8A A;  4EYL A;  4EXS A;  5FQA A;  5B15 A;  5AIJ A;  3BK2 A;  2YCB A;  3RKK A;  2XR1 A;  4EFZ A;  4P62 A;  3SFP A;  5DPX A;  4YSK A;  2YNW A;  3I15 A; 
#chains in the Genus database with same CATH homology
 4AWZ A;  3KNS A;  4FSB A;  5KIK A;  4D1W A;  3FCZ A;  4TZB A;  4TZ9 A;  2BG7 A;  2HB9 A;  4C1E A;  3BC2 A;  2OHI A;  2BR6 A;  4JO0 A;  5ACU A;  2FU6 A;  4YSB A;  4D1U A;  1M2X A;  2QED A;  2ZZI A;  2BFZ B;  2YNT B;  4C1C A;  1BMC A;  2I7V A;  4TZE A;  1QH5 A;  1ZNB A;  4YSL A;  2I7X A;  3IEK A;  3T9M A;  2BFL A;  5FQC A;  4EYF A;  2P4Z A;  4UA4 A;  3T3N A;  4V0H A;  2P1E A;  2BFZ A;  2YNT A;  5LCH A;  5HIP A;  2NZF A;  4HL2 A;  3I0V A;  2CBN A;  3WXC A;  3R2U A;  3Q6V A;  5EVK A;  4DIL A;  3MD7 A;  3IOF A;  2I7T A;  4J5F A;  2DKF A;  4C09 A;  3ADR A;  3L6N A;  4AD9 A;  3SD9 A;  3SBL A;  3QH8 A;  4FR7 A;  4BP0 A;  4XWT A;  2WRS A;  2BMI A;  2ZWR A;  3DHB A;  2R2D A;  3G1P A;  3IE1 A;  3SPU A;  1A7T A;  4Z5Y A;  2BIB A;  4AX0 B;  1WW1 A;  5LSC A;  2FU7 A;  4C1F A;  4GYQ A;  2BFK A;  5HH4 A;  4B87 A;  3ZWF A;  3DH8 A;  2QDS A;  3JXP A;  2GKL A;  5A87 A;  1L9Y A;  2FU9 A;  2ZO4 A;  5FQB A;  1XTO A;  5EV8 A;  4WD6 A;  2BGA A;  4UBQ A;  1JT1 A;  4TYF A;  2FU8 A;  2NZE A;  4NQ6 A;  4XUK A;  5B3R A;  4UWO B;  2DOO A;  3FAI A;  3P2U A;  4KEP A;  1YCH A;  4GYU A;  3ESH A;  3ZQ4 A;  5EH9 A;  4HL1 A;  1BC2 A;  4D1V A;  1QH3 A;  4PVT A;  2WYM A;  5A0V A;  5HIO A;  5AHO A;  3T3O A;  4AWY B;  1DD6 A;  1KO3 A;  5AHR A;  3RPC A;  5EV6 A;  4BZ3 A;  4Z60 A;  2BG6 A;  2GCU A;  1VME A;  2Q9U A;  5ACS A;  3PY5 A;  5LE1 A;  3IE2 A;  4TZF A;  5AYA A;  5ACT A;  5KIL A;  3AJ3 A;  2FHX B;  2WHG A;  3SW3 A;  4C1D A;  4D1T A;  5A0T A;  4C1H A;  2M5D A;  2BG2 A;  1DXK A;  3SRX A;  1WRA A;  1ZTC A;  4XWW A;  2FHX A;  4UWR B;  5A5Z A;  4O98 A;  5AXO A;  1VGN A;  4DIK A;  4UAM A;  5K4M A;  2QIN A;  1A8T A;  4UWP B;  5HIQ A;  3TP9 A;  2NXA A;  4C1G A;  2VW8 A;  4ZNB A;  3KNR A;  2WYM C;  3LVZ A;  5AXR A;  4F6Z A;  3VPE A;  2M5C A;  4RAW A;  1YCF A;  2BTN A;  4Z7R A;  5K0W A;  2P97 A;  2BC2 A;  5LM6 A;  4RL0 A;  4U4L A;  3KL7 A;  5LCF A;  5ACR A;  1HLK A;  3DHC A;  4RBS A;  2Y8B A;  4UWS B;  5LMC A;  2QJS A;  3IOG A;  2P18 A;  5ACW A;  3X30 A;  2AZ4 A;  2Y87 A;  3PY6 A;  4LE6 A;  4Z5Z A;  3I14 A;  1JJT A;  3ZNB A;  4FEK A;  1Y44 A;  3IEM A;  3H3E A;  3X2Z A;  2YNU A;  2QDT A;  4ZO2 A;  4RAM A;  5EVB A;  3VQZ A;  4Z67 A;  1E5D A;  4ZEJ A;  4EXY A;  4J5H A;  5EHT A;  4PVO A;  2OHH A;  4D02 A;  4EY2 A;  2Q0J A;  5EW0 A;  1X8I A;  2OHJ A;  2Q0I A;  4KEQ A;  3I11 A;  4RL2 A;  3IEL A;  2YZ3 A;  3S0Z A;  5EWA A;  4F6H A;  5HH6 A;  5EVD A;  4NQ2 A;  5ACQ A;  5ACP A;  1WUO A;  4H0D A;  1X8G A;  5K4N A;  4NQ5 A;  5HH5 A;  1YCG A;  4RM5 A;  2FK6 A;  2XF4 A;  4Z6X A;  1MQO A;  5LLD A;  3IDZ A;  4EYB A;  2FM6 A;  3BK1 A;  5ACV A;  1ZKP A;  1KO2 A;  2GFK A;  3F9O A;  1VJN A;  4AX1 B;  5HIS A;  2NYP A;  4CHL A;  5LS3 A;  1KR3 A;  2ZNB A;  3X2Y A;  2E7Y A;  5LCA A;  5AEB A;  3I13 A;  5ACX A;  1P9E A;  4TYT A;  3RKJ A;  1WUP A;  3AF6 A;  4ZO3 A;  2GMN A;  1DDK A;  4GCW A;  2BG8 B;  2H6A A;  3X2X A;  1BVT A;  2Q42 A;  1SML A;  2WYL A;  5K4K A;  3AF5 A;  3A4Y A;  3BV6 A;  3IE0 A;  1JJE A;  3ZR9 A;  1K07 A;  2YNV B;  4HKY A;  5IQK A;  2BG8 A;  2UYX A;  2GFJ A;  2A7M A;  1X8H A;  2AIO A;  4NQ4 A;  5B1U A;  3DHA A;  3PG4 A;  1XM8 A;  2YNV A;  2Y8A A;  4EYL A;  4EXS A;  5FQA A;  5B15 A;  3BK2 A;  2YCB A;  3RKK A;  2XR1 A;  4EFZ A;  4P62 A;  3SFP A;  5DPX A;  4YSK A;  2YNW A;  3I15 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...