1M2XA

Crystal structure of the metallo-beta-lactamase blab of chryseobacterium meningosepticum in complex with the inhibitor d-captopril
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
219
structure length
219
Chain Sequence
DVKIEKLKDNLYVYTTYNTFNGTKYAANAVYLVTDKGVVVIDCPWGEDKFKSFTDEIYKKHGKKVIMNIATHSHDDRAGGLEYFGKIGAKTYSTKMTDSILAKENKPRAQYTFDNNKSFKVGKSEFQVYYPGKGHTADNVVVWFPKEKVLVGGCIIKSADSKDLGYIGEAYVNDWTQSVHNIQQKFSGAQYVVAGHDDWKDQRSIQHTLDLINEYQQKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The 1.5 A structure of Chryseobacterium meningosepticum Zn-beta-lactamase in complex with the inhibitor, D-captopril
pubmed doi rcsb
source organism Elizabethkingia meningoseptica
molecule tags Hydrolase
molecule keywords class B carbapenemase BlaB-1
total genus 68
structure length 219
sequence length 219
chains with identical sequence B, C, D
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2002-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 1m2xA00
2FU7A 5AHOA 2NZEA 5ACVA 4LE6A 2GMNA 2BFLA 2GCUA 4UAMA 4EFZA 3IEKA 3ZNBA 5B1UA 2FU8A 4P62A 4J5FA 4UA4A 4C1GA 5ACQA 2FM6A 5HIOA 4J5HA 5LM6A 3PG4A 4EYLA 1WUOA 2QJSA 2I7TA 5ACTA 1A7TA 4AX0B 2YNUA 4Z67A 4BZ3A 2P1EA 3X30A 2Y87A 2ZWRA 4EXYA 5LCHA 5A5ZA 2AIOA 4AWYB 1QH5A 2BG7A 4XWWA 4ZEJA 2QDTA 3T3NA 1K07A 1KR3A 2Q0JA 2ZNBA 4TZ9A 4HL2A 2FK6A 1XM8A 4YSKA 5ACUA 4EXSA 4HKYA 2Q42A 2P18A 3PY6A 4FR7A 3I11A 5AXOA 2P4ZA 1QH3A 3KNRA 2BG8A 1KO3A 1L9YA 3ZR9A 3T9MA 5LSCA 4ZNBA 2P97A 3ESHA 3S0ZA 2OHJA 2BMIA 1P9EA 3F9OA 1VGNA 2BGAA 4Z6XA 1KO2A 3DH8A 2WYLA 5B3RA 2E7YA 1Y44A 3SFPA 4GYUA 5EVKA 3BC2A 4B87A 3SPUA 5EWAA 4O98A 2OHHA 2GFKA 2M5DA 4YSLA 5ACPA 2OHIA 5K4MA 1DDKA 5LS3A 2HB9A 2NYPA 3IDZA 2WRSA 4PVTA 4RL2A 2YNTA 4GCWA 3G1PA 5EVBA 4YSBA 3VQZA 5EV8A 4Z5ZA 2XR1A 2CBNA 1VJNA 3X2XA 2BR6A 2FU9A 1WUPA 4DILA 5LLDA 3FAIA 4C1HA 5KIKA 4AX1B 3BK2A 5ACWA 1X8IA 4AWZA 4ZO3A 5HH5A 2BG8B 2ZO4A 4F6HA 2YZ3A 4BP0A 4F6ZA 3SW3A 3AF5A 3DHAA 3SRXA 2YCBA 1YCHA 2QEDA 5EVDA 2GKLA 3KL7A 1WRAA 3JXPA 3FCZA 5EV6A 4TZFA 5DPXA 2NXAA 5B15A 3QH8A 4C1EA 4NQ6A 4UWRB 5EH9A 5AEBA 2WYMC 5HH6A 3IEMA 3Q6VA 3DHCA 1WW1A 4RBSA 3IE1A 1MQOA 4NQ5A 5A0VA 4XUKA 2GFJA 3P2UA 5EW0A 2A7MA 3BV6A 5A0TA 2XF4A 2R2DA 1YCFA 5LCAA 5LCFA 4RAWA 3BK1A 4DIKA 2I7XA 4TYFA 4C1DA 3KNSA 2DKFA 3X2ZA 2I7VA 2Y8AA 4RL0A 4HL1A 4H0DA 5EHTA 4FSBA 1JJTA 4U4LA 4UBQA 4NQ2A 1VMEA 5HIQA 2FHXB 3DHBA 1ZKPA 4C1FA 1DD6A 4AD9A 1SMLA 2BG2A 4RAMA 4UWOB 4FEKA 2WYMA 5ACSA 3PY5A 4C1CA 2VW8A 2H6AA 2BIBA 3SD9A 5FQCA 4D1TA 5FQBA 2WHGA 1DXKA 4TZBA 4Z5YA 1BMCA 2BC2A 4NQ4A 4D1WA 5ACRA 3RKJA 4WD6A 3R2UA 2BFKA 2UYXA 5AHRA 2BFZB 3IOGA 1X8HA 3LVZA 1ZNBA 5K4NA 1BVTA 2M5CA 5HIPA 4UWSB 3L6NA 4GYQA 2YNVA 2ZZIA 3RPCA 2Q9UA 1BC2A 4KEPA 1JT1A 2QINA 3X2YA 2Y8BA 5K0WA 1E5DA 5A87A 3MD7A 4XWTA 3H3EA 4Z7RA 3RKKA 3ADRA 3VPEA 5LE1A 4TYTA 2YNVB 3ZWFA 5HISA 4JO0A 3I14A 5LMCA 4D02A 3T3OA 4TZEA 5AYAA 4KEQA 4EY2A 2BFZA 2YNTB 4V0HA 5KILA 1X8GA 2YNWA 4ZO2A 5IQKA 2DOOA 2NZFA 3IE2A 4EYFA 5ACXA 4D1UA 5AXRA 3IOFA 3A4YA 5HH4A 1YCGA 5K4KA 3IELA 1JJEA 3SBLA 3AF6A 2Q0IA 3AJ3A 2AZ4A 2BTNA 1M2XA 2FU6A 4RM5A 4PVOA 3ZQ4A 1HLKA 4D1VA 3I13A 3I15A 3IE0A 1XTOA 2QDSA 2FHXA 3TP9A 4UWPB 1A8TA 3WXCA 4Z60A 4CHLA 5FQAA 3I0VA 4C09A 1ZTCA 2BG6A 4EYBA
chains in the Genus database with same CATH superfamily
2FU7A 5AHOA 2NZEA 5ACVA 4LE6A 2GMNA 2BFLA 2GCUA 4UAMA 4EFZA 3IEKA 3ZNBA 5B1UA 2FU8A 4P62A 4J5FA 4UA4A 4C1GA 5ACQA 2FM6A 5HIOA 4J5HA 5LM6A 3PG4A 4EYLA 1WUOA 2QJSA 2I7TA 5ACTA 1A7TA 4AX0B 2YNUA 4Z67A 4BZ3A 2P1EA 3X30A 2Y87A 2ZWRA 4EXYA 5LCHA 5A5ZA 2AIOA 4AWYB 1QH5A 2BG7A 4XWWA 4ZEJA 2QDTA 3T3NA 1K07A 1KR3A 2Q0JA 2ZNBA 4TZ9A 4HL2A 2FK6A 1XM8A 4YSKA 5ACUA 4EXSA 4HKYA 2Q42A 2P18A 3PY6A 4FR7A 3I11A 5AXOA 2P4ZA 1QH3A 3KNRA 2BG8A 1KO3A 1L9YA 3ZR9A 3T9MA 5LSCA 4ZNBA 2P97A 3ESHA 3S0ZA 2OHJA 2BMIA 4PDXA 1P9EA 3F9OA 1VGNA 2YHEA 2BGAA 4Z6XA 1KO2A 3DH8A 2WYLA 5B3RA 2E7YA 1Y44A 3SFPA 4GYUA 4AXHA 5EVKA 3BC2A 4B87A 3SPUA 5EWAA 4O98A 2OHHA 2GFKA 2M5DA 4YSLA 5ACPA 2OHIA 5K4MA 1DDKA 5LS3A 2HB9A 2NYPA 3IDZA 2WRSA 4PVTA 4RL2A 2YNTA 4GCWA 3G1PA 5EVBA 4YSBA 3VQZA 5EV8A 4Z5ZA 2XR1A 5AIJA 2CBNA 1VJNA 3X2XA 2BR6A 2FU9A 1WUPA 4DILA 5LLDA 3FAIA 4C1HA 5KIKA 4AX1B 3BK2A 5ACWA 1X8IA 4AWZA 4ZO3A 5HH5A 2BG8B 2ZO4A 4F6HA 2YZ3A 4BP0A 4F6ZA 3SW3A 3AF5A 3DHAA 3SRXA 2YCBA 1YCHA 2QEDA 5EVDA 2GKLA 3KL7A 1WRAA 3JXPA 3FCZA 5EV6A 4TZFA 5DPXA 2NXAA 5B15A 3QH8A 4C1EA 4NQ6A 4UWRB 5EH9A 5AEBA 2WYMC 4AV7A 5HH6A 3IEMA 2CFZA 3Q6VA 3DHCA 1WW1A 4RBSA 3IE1A 1MQOA 4NQ5A 5A0VA 4XUKA 2GFJA 3P2UA 5EW0A 2A7MA 3BV6A 5A0TA 2XF4A 2R2DA 1YCFA 5LCAA 5LCFA 4RAWA 3BK1A 4DIKA 2I7XA 4TYFA 4C1DA 3KNSA 2DKFA 3X2ZA 2I7VA 2Y8AA 4RL0A 4HL1A 2CG3A 4H0DA 5EHTA 5A23A 4FSBA 1JJTA 4U4LA 4UBQA 4NQ2A 1VMEA 5HIQA 2FHXB 3DHBA 1ZKPA 4C1FA 1DD6A 4AD9A 1SMLA 2BG2A 4RAMA 4UWOB 4FEKA 2WYMA 5ACSA 3PY5A 4C1CA 2VW8A 2H6AA 2BIBA 3SD9A 5FQCA 4D1TA 5FQBA 2WHGA 1DXKA 4TZBA 4Z5YA 1BMCA 2BC2A 4NQ4A 4D1WA 5ACRA 3RKJA 4WD6A 3R2UA 2BFKA 2UYXA 5AHRA 2BFZB 3IOGA 1X8HA 3LVZA 1ZNBA 5K4NA 1BVTA 2M5CA 5HIPA 4UWSB 3L6NA 4GYQA 2YNVA 2ZZIA 3RPCA 5AJLA 2Q9UA 1BC2A 4KEPA 1JT1A 2QINA 3X2YA 2Y8BA 5K0WA 1E5DA 5A87A 3MD7A 4XWTA 3H3EA 4Z7RA 3RKKA 3ADRA 3VPEA 5LE1A 4TYTA 2YNVB 3ZWFA 5HISA 4JO0A 3I14A 5LMCA 4D02A 3T3OA 2CG2A 4TZEA 5AYAA 4KEQA 4EY2A 2BFZA 2YNTB 4V0HA 5KILA 1X8GA 4NURA 2YNWA 4ZO2A 5IQKA 2DOOA 2NZFA 3IE2A 4EYFA 5ACXA 4D1UA 5AXRA 3IOFA 3A4YA 5HH4A 1YCGA 5K4KA 3IELA 2CFUA 1JJEA 3SBLA 3AF6A 2Q0IA 3AJ3A 2AZ4A 2BTNA 1M2XA 2FU6A 4RM5A 4PVOA 3ZQ4A 1HLKA 4D1VA 3I13A 3I15A 3IE0A 1XTOA 2QDSA 2FHXA 3TP9A 4UWPB 1A8TA 3WXCA 4Z60A 4CHLA 5FQAA 3I0VA 4C09A 1ZTCA 2BG6A 4EYBA
chains in the Genus database with same CATH topology
2FU7A 5AHOA 2NZEA 5ACVA 4LE6A 2GMNA 2BFLA 2GCUA 4UAMA 4EFZA 3IEKA 3ZNBA 5B1UA 2FU8A 4P62A 4J5FA 4UA4A 4C1GA 5ACQA 2FM6A 5HIOA 4J5HA 5LM6A 3PG4A 4EYLA 1WUOA 2QJSA 2I7TA 5ACTA 1A7TA 4AX0B 2YNUA 4Z67A 4BZ3A 2P1EA 3X30A 2Y87A 2ZWRA 4EXYA 5LCHA 5A5ZA 2AIOA 4AWYB 1QH5A 2BG7A 4XWWA 4ZEJA 2QDTA 3T3NA 1K07A 1KR3A 2Q0JA 2ZNBA 4TZ9A 4HL2A 2FK6A 1XM8A 4YSKA 5ACUA 4EXSA 4HKYA 2Q42A 2P18A 3PY6A 4FR7A 3I11A 5AXOA 2P4ZA 1QH3A 3KNRA 2BG8A 1KO3A 1L9YA 3ZR9A 3T9MA 5LSCA 4ZNBA 2P97A 3ESHA 3S0ZA 2OHJA 2BMIA 1P9EA 3F9OA 1VGNA 2BGAA 4Z6XA 1KO2A 3DH8A 2WYLA 5B3RA 2E7YA 1Y44A 3SFPA 4GYUA 5EVKA 3BC2A 4B87A 3SPUA 5EWAA 4O98A 2OHHA 2GFKA 2M5DA 4YSLA 5ACPA 2OHIA 5K4MA 1DDKA 5LS3A 2HB9A 2NYPA 3IDZA 2WRSA 4PVTA 4RL2A 2YNTA 4GCWA 3G1PA 5EVBA 4YSBA 3VQZA 5EV8A 4Z5ZA 2XR1A 2CBNA 1VJNA 3X2XA 2BR6A 2FU9A 1WUPA 4DILA 5LLDA 3FAIA 4C1HA 5KIKA 4AX1B 3BK2A 5ACWA 1X8IA 4AWZA 4ZO3A 5HH5A 2BG8B 2ZO4A 4F6HA 2YZ3A 4BP0A 4F6ZA 3SW3A 3AF5A 3DHAA 3SRXA 2YCBA 1YCHA 2QEDA 5EVDA 2GKLA 3KL7A 1WRAA 3JXPA 3FCZA 5EV6A 4TZFA 5DPXA 2NXAA 5B15A 3QH8A 4C1EA 4NQ6A 4UWRB 5EH9A 5AEBA 2WYMC 5HH6A 3IEMA 3Q6VA 3DHCA 1WW1A 4RBSA 3IE1A 1MQOA 4NQ5A 5A0VA 4XUKA 2GFJA 3P2UA 5EW0A 2A7MA 3BV6A 5A0TA 2XF4A 2R2DA 1YCFA 5LCAA 5LCFA 4RAWA 3BK1A 4DIKA 2I7XA 4TYFA 4C1DA 3KNSA 2DKFA 3X2ZA 2I7VA 2Y8AA 4RL0A 4HL1A 4H0DA 5EHTA 4FSBA 1JJTA 4U4LA 4UBQA 4NQ2A 1VMEA 5HIQA 2FHXB 3DHBA 1ZKPA 4C1FA 1DD6A 4AD9A 1SMLA 2BG2A 4RAMA 4UWOB 4FEKA 2WYMA 5ACSA 3PY5A 4C1CA 2VW8A 2H6AA 2BIBA 3SD9A 5FQCA 4D1TA 5FQBA 2WHGA 1DXKA 4TZBA 4Z5YA 1BMCA 2BC2A 4NQ4A 4D1WA 5ACRA 3RKJA 4WD6A 3R2UA 2BFKA 2UYXA 5AHRA 2BFZB 3IOGA 1X8HA 3LVZA 1ZNBA 5K4NA 1BVTA 2M5CA 5HIPA 4UWSB 3L6NA 4GYQA 2YNVA 2ZZIA 3RPCA 2Q9UA 1BC2A 4KEPA 1JT1A 2QINA 3X2YA 2Y8BA 5K0WA 1E5DA 5A87A 3MD7A 4XWTA 3H3EA 4Z7RA 3RKKA 3ADRA 3VPEA 5LE1A 4TYTA 2YNVB 3ZWFA 5HISA 4JO0A 3I14A 5LMCA 4D02A 3T3OA 4TZEA 5AYAA 4KEQA 4EY2A 2BFZA 2YNTB 4V0HA 5KILA 1X8GA 2YNWA 4ZO2A 5IQKA 2DOOA 2NZFA 3IE2A 4EYFA 5ACXA 4D1UA 5AXRA 3IOFA 3A4YA 5HH4A 1YCGA 5K4KA 3IELA 1JJEA 3SBLA 3AF6A 2Q0IA 3AJ3A 2AZ4A 2BTNA 1M2XA 2FU6A 4RM5A 4PVOA 3ZQ4A 1HLKA 4D1VA 3I13A 3I15A 3IE0A 1XTOA 2QDSA 2FHXA 3TP9A 4UWPB 1A8TA 3WXCA 4Z60A 4CHLA 5FQAA 3I0VA 4C09A 1ZTCA 2BG6A 4EYBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FU7 A;  5AHO A;  2NZE A;  5ACV A;  4LE6 A;  2GMN A;  2BFL A;  2GCU A;  4UAM A;  4EFZ A;  3IEK A;  3ZNB A;  5B1U A;  2FU8 A;  4P62 A;  4J5F A;  4UA4 A;  4C1G A;  5ACQ A;  2FM6 A;  5HIO A;  4J5H A;  5LM6 A;  3PG4 A;  4EYL A;  1WUO A;  2QJS A;  2I7T A;  5ACT A;  1A7T A;  4AX0 B;  2YNU A;  4Z67 A;  4BZ3 A;  2P1E A;  3X30 A;  2Y87 A;  2ZWR A;  4EXY A;  5LCH A;  5A5Z A;  2AIO A;  4AWY B;  1QH5 A;  2BG7 A;  4XWW A;  4ZEJ A;  2QDT A;  3T3N A;  1K07 A;  1KR3 A;  2Q0J A;  2ZNB A;  4TZ9 A;  4HL2 A;  2FK6 A;  1XM8 A;  4YSK A;  5ACU A;  4EXS A;  4HKY A;  2Q42 A;  2P18 A;  3PY6 A;  4FR7 A;  3I11 A;  5AXO A;  2P4Z A;  1QH3 A;  3KNR A;  2BG8 A;  1KO3 A;  1L9Y A;  3ZR9 A;  3T9M A;  5LSC A;  4ZNB A;  2P97 A;  3ESH A;  3S0Z A;  2OHJ A;  2BMI A;  1P9E A;  3F9O A;  1VGN A;  2BGA A;  4Z6X A;  1KO2 A;  3DH8 A;  2WYL A;  5B3R A;  2E7Y A;  1Y44 A;  3SFP A;  4GYU A;  5EVK A;  3BC2 A;  4B87 A;  3SPU A;  5EWA A;  4O98 A;  2OHH A;  2GFK A;  2M5D A;  4YSL A;  5ACP A;  2OHI A;  5K4M A;  1DDK A;  5LS3 A;  2HB9 A;  2NYP A;  3IDZ A;  2WRS A;  4PVT A;  4RL2 A;  2YNT A;  4GCW A;  3G1P A;  5EVB A;  4YSB A;  3VQZ A;  5EV8 A;  4Z5Z A;  2XR1 A;  2CBN A;  1VJN A;  3X2X A;  2BR6 A;  2FU9 A;  1WUP A;  4DIL A;  5LLD A;  3FAI A;  4C1H A;  5KIK A;  4AX1 B;  3BK2 A;  5ACW A;  1X8I A;  4AWZ A;  4ZO3 A;  5HH5 A;  2BG8 B;  2ZO4 A;  4F6H A;  2YZ3 A;  4BP0 A;  4F6Z A;  3SW3 A;  3AF5 A;  3DHA A;  3SRX A;  2YCB A;  1YCH A;  2QED A;  5EVD A;  2GKL A;  3KL7 A;  1WRA A;  3JXP A;  3FCZ A;  5EV6 A;  4TZF A;  5DPX A;  2NXA A;  5B15 A;  3QH8 A;  4C1E A;  4NQ6 A;  4UWR B;  5EH9 A;  5AEB A;  2WYM C;  5HH6 A;  3IEM A;  3Q6V A;  3DHC A;  1WW1 A;  4RBS A;  3IE1 A;  1MQO A;  4NQ5 A;  5A0V A;  4XUK A;  2GFJ A;  3P2U A;  5EW0 A;  2A7M A;  3BV6 A;  5A0T A;  2XF4 A;  2R2D A;  1YCF A;  5LCA A;  5LCF A;  4RAW A;  3BK1 A;  4DIK A;  2I7X A;  4TYF A;  4C1D A;  3KNS A;  2DKF A;  3X2Z A;  2I7V A;  2Y8A A;  4RL0 A;  4HL1 A;  4H0D A;  5EHT A;  4FSB A;  1JJT A;  4U4L A;  4UBQ A;  4NQ2 A;  1VME A;  5HIQ A;  2FHX B;  3DHB A;  1ZKP A;  4C1F A;  1DD6 A;  4AD9 A;  1SML A;  2BG2 A;  4RAM A;  4UWO B;  4FEK A;  2WYM A;  5ACS A;  3PY5 A;  4C1C A;  2VW8 A;  2H6A A;  2BIB A;  3SD9 A;  5FQC A;  4D1T A;  5FQB A;  2WHG A;  1DXK A;  4TZB A;  4Z5Y A;  1BMC A;  2BC2 A;  4NQ4 A;  4D1W A;  5ACR A;  3RKJ A;  4WD6 A;  3R2U A;  2BFK A;  2UYX A;  5AHR A;  2BFZ B;  3IOG A;  1X8H A;  3LVZ A;  1ZNB A;  5K4N A;  1BVT A;  2M5C A;  5HIP A;  4UWS B;  3L6N A;  4GYQ A;  2YNV A;  2ZZI A;  3RPC A;  2Q9U A;  1BC2 A;  4KEP A;  1JT1 A;  2QIN A;  3X2Y A;  2Y8B A;  5K0W A;  1E5D A;  5A87 A;  3MD7 A;  4XWT A;  3H3E A;  4Z7R A;  3RKK A;  3ADR A;  3VPE A;  5LE1 A;  4TYT A;  2YNV B;  3ZWF A;  5HIS A;  4JO0 A;  3I14 A;  5LMC A;  4D02 A;  3T3O A;  4TZE A;  5AYA A;  4KEQ A;  4EY2 A;  2BFZ A;  2YNT B;  4V0H A;  5KIL A;  1X8G A;  2YNW A;  4ZO2 A;  5IQK A;  2DOO A;  2NZF A;  3IE2 A;  4EYF A;  5ACX A;  4D1U A;  5AXR A;  3IOF A;  3A4Y A;  5HH4 A;  1YCG A;  5K4K A;  3IEL A;  1JJE A;  3SBL A;  3AF6 A;  2Q0I A;  3AJ3 A;  2AZ4 A;  2BTN A;  1M2X A;  2FU6 A;  4RM5 A;  4PVO A;  3ZQ4 A;  1HLK A;  4D1V A;  3I13 A;  3I15 A;  3IE0 A;  1XTO A;  2QDS A;  2FHX A;  3TP9 A;  4UWP B;  1A8T A;  3WXC A;  4Z60 A;  4CHL A;  5FQA A;  3I0V A;  4C09 A;  1ZTC A;  2BG6 A;  4EYB A; 
#chains in the Genus database with same CATH topology
 2FU7 A;  5AHO A;  2NZE A;  5ACV A;  4LE6 A;  2GMN A;  2BFL A;  2GCU A;  4UAM A;  4EFZ A;  3IEK A;  3ZNB A;  5B1U A;  2FU8 A;  4P62 A;  4J5F A;  4UA4 A;  4C1G A;  5ACQ A;  2FM6 A;  5HIO A;  4J5H A;  5LM6 A;  3PG4 A;  4EYL A;  1WUO A;  2QJS A;  2I7T A;  5ACT A;  1A7T A;  4AX0 B;  2YNU A;  4Z67 A;  4BZ3 A;  2P1E A;  3X30 A;  2Y87 A;  2ZWR A;  4EXY A;  5LCH A;  5A5Z A;  2AIO A;  4AWY B;  1QH5 A;  2BG7 A;  4XWW A;  4ZEJ A;  2QDT A;  3T3N A;  1K07 A;  1KR3 A;  2Q0J A;  2ZNB A;  4TZ9 A;  4HL2 A;  2FK6 A;  1XM8 A;  4YSK A;  5ACU A;  4EXS A;  4HKY A;  2Q42 A;  2P18 A;  3PY6 A;  4FR7 A;  3I11 A;  5AXO A;  2P4Z A;  1QH3 A;  3KNR A;  2BG8 A;  1KO3 A;  1L9Y A;  3ZR9 A;  3T9M A;  5LSC A;  4ZNB A;  2P97 A;  3ESH A;  3S0Z A;  2OHJ A;  2BMI A;  4PDX A;  1P9E A;  3F9O A;  1VGN A;  2YHE A;  2BGA A;  4Z6X A;  1KO2 A;  3DH8 A;  2WYL A;  5B3R A;  2E7Y A;  1Y44 A;  3SFP A;  4GYU A;  4AXH A;  5EVK A;  3BC2 A;  4B87 A;  3SPU A;  5EWA A;  4O98 A;  2OHH A;  2GFK A;  2M5D A;  4YSL A;  5ACP A;  2OHI A;  5K4M A;  1DDK A;  5LS3 A;  2HB9 A;  2NYP A;  3IDZ A;  2WRS A;  4PVT A;  4RL2 A;  2YNT A;  4GCW A;  3G1P A;  5EVB A;  4YSB A;  3VQZ A;  5EV8 A;  4Z5Z A;  2XR1 A;  5AIJ A;  2CBN A;  1VJN A;  3X2X A;  2BR6 A;  2FU9 A;  1WUP A;  4DIL A;  5LLD A;  3FAI A;  4C1H A;  5KIK A;  4AX1 B;  3BK2 A;  5ACW A;  1X8I A;  4AWZ A;  4ZO3 A;  5HH5 A;  2BG8 B;  2ZO4 A;  4F6H A;  2YZ3 A;  4BP0 A;  4F6Z A;  3SW3 A;  3AF5 A;  3DHA A;  3SRX A;  2YCB A;  1YCH A;  2QED A;  5EVD A;  2GKL A;  3KL7 A;  1WRA A;  3JXP A;  3FCZ A;  5EV6 A;  4TZF A;  5DPX A;  2NXA A;  5B15 A;  3QH8 A;  4C1E A;  4NQ6 A;  4UWR B;  5EH9 A;  5AEB A;  2WYM C;  4AV7 A;  5HH6 A;  3IEM A;  2CFZ A;  3Q6V A;  3DHC A;  1WW1 A;  4RBS A;  3IE1 A;  1MQO A;  4NQ5 A;  5A0V A;  4XUK A;  2GFJ A;  3P2U A;  5EW0 A;  2A7M A;  3BV6 A;  5A0T A;  2XF4 A;  2R2D A;  1YCF A;  5LCA A;  5LCF A;  4RAW A;  3BK1 A;  4DIK A;  2I7X A;  4TYF A;  4C1D A;  3KNS A;  2DKF A;  3X2Z A;  2I7V A;  2Y8A A;  4RL0 A;  4HL1 A;  2CG3 A;  4H0D A;  5EHT A;  5A23 A;  4FSB A;  1JJT A;  4U4L A;  4UBQ A;  4NQ2 A;  1VME A;  5HIQ A;  2FHX B;  3DHB A;  1ZKP A;  4C1F A;  1DD6 A;  4AD9 A;  1SML A;  2BG2 A;  4RAM A;  4UWO B;  4FEK A;  2WYM A;  5ACS A;  3PY5 A;  4C1C A;  2VW8 A;  2H6A A;  2BIB A;  3SD9 A;  5FQC A;  4D1T A;  5FQB A;  2WHG A;  1DXK A;  4TZB A;  4Z5Y A;  1BMC A;  2BC2 A;  4NQ4 A;  4D1W A;  5ACR A;  3RKJ A;  4WD6 A;  3R2U A;  2BFK A;  2UYX A;  5AHR A;  2BFZ B;  3IOG A;  1X8H A;  3LVZ A;  1ZNB A;  5K4N A;  1BVT A;  2M5C A;  5HIP A;  4UWS B;  3L6N A;  4GYQ A;  2YNV A;  2ZZI A;  3RPC A;  5AJL A;  2Q9U A;  1BC2 A;  4KEP A;  1JT1 A;  2QIN A;  3X2Y A;  2Y8B A;  5K0W A;  1E5D A;  5A87 A;  3MD7 A;  4XWT A;  3H3E A;  4Z7R A;  3RKK A;  3ADR A;  3VPE A;  5LE1 A;  4TYT A;  2YNV B;  3ZWF A;  5HIS A;  4JO0 A;  3I14 A;  5LMC A;  4D02 A;  3T3O A;  2CG2 A;  4TZE A;  5AYA A;  4KEQ A;  4EY2 A;  2BFZ A;  2YNT B;  4V0H A;  5KIL A;  1X8G A;  4NUR A;  2YNW A;  4ZO2 A;  5IQK A;  2DOO A;  2NZF A;  3IE2 A;  4EYF A;  5ACX A;  4D1U A;  5AXR A;  3IOF A;  3A4Y A;  5HH4 A;  1YCG A;  5K4K A;  3IEL A;  2CFU A;  1JJE A;  3SBL A;  3AF6 A;  2Q0I A;  3AJ3 A;  2AZ4 A;  2BTN A;  1M2X A;  2FU6 A;  4RM5 A;  4PVO A;  3ZQ4 A;  1HLK A;  4D1V A;  3I13 A;  3I15 A;  3IE0 A;  1XTO A;  2QDS A;  2FHX A;  3TP9 A;  4UWP B;  1A8T A;  3WXC A;  4Z60 A;  4CHL A;  5FQA A;  3I0V A;  4C09 A;  1ZTC A;  2BG6 A;  4EYB A; 
#chains in the Genus database with same CATH homology
 2FU7 A;  5AHO A;  2NZE A;  5ACV A;  4LE6 A;  2GMN A;  2BFL A;  2GCU A;  4UAM A;  4EFZ A;  3IEK A;  3ZNB A;  5B1U A;  2FU8 A;  4P62 A;  4J5F A;  4UA4 A;  4C1G A;  5ACQ A;  2FM6 A;  5HIO A;  4J5H A;  5LM6 A;  3PG4 A;  4EYL A;  1WUO A;  2QJS A;  2I7T A;  5ACT A;  1A7T A;  4AX0 B;  2YNU A;  4Z67 A;  4BZ3 A;  2P1E A;  3X30 A;  2Y87 A;  2ZWR A;  4EXY A;  5LCH A;  5A5Z A;  2AIO A;  4AWY B;  1QH5 A;  2BG7 A;  4XWW A;  4ZEJ A;  2QDT A;  3T3N A;  1K07 A;  1KR3 A;  2Q0J A;  2ZNB A;  4TZ9 A;  4HL2 A;  2FK6 A;  1XM8 A;  4YSK A;  5ACU A;  4EXS A;  4HKY A;  2Q42 A;  2P18 A;  3PY6 A;  4FR7 A;  3I11 A;  5AXO A;  2P4Z A;  1QH3 A;  3KNR A;  2BG8 A;  1KO3 A;  1L9Y A;  3ZR9 A;  3T9M A;  5LSC A;  4ZNB A;  2P97 A;  3ESH A;  3S0Z A;  2OHJ A;  2BMI A;  1P9E A;  3F9O A;  1VGN A;  2BGA A;  4Z6X A;  1KO2 A;  3DH8 A;  2WYL A;  5B3R A;  2E7Y A;  1Y44 A;  3SFP A;  4GYU A;  5EVK A;  3BC2 A;  4B87 A;  3SPU A;  5EWA A;  4O98 A;  2OHH A;  2GFK A;  2M5D A;  4YSL A;  5ACP A;  2OHI A;  5K4M A;  1DDK A;  5LS3 A;  2HB9 A;  2NYP A;  3IDZ A;  2WRS A;  4PVT A;  4RL2 A;  2YNT A;  4GCW A;  3G1P A;  5EVB A;  4YSB A;  3VQZ A;  5EV8 A;  4Z5Z A;  2XR1 A;  2CBN A;  1VJN A;  3X2X A;  2BR6 A;  2FU9 A;  1WUP A;  4DIL A;  5LLD A;  3FAI A;  4C1H A;  5KIK A;  4AX1 B;  3BK2 A;  5ACW A;  1X8I A;  4AWZ A;  4ZO3 A;  5HH5 A;  2BG8 B;  2ZO4 A;  4F6H A;  2YZ3 A;  4BP0 A;  4F6Z A;  3SW3 A;  3AF5 A;  3DHA A;  3SRX A;  2YCB A;  1YCH A;  2QED A;  5EVD A;  2GKL A;  3KL7 A;  1WRA A;  3JXP A;  3FCZ A;  5EV6 A;  4TZF A;  5DPX A;  2NXA A;  5B15 A;  3QH8 A;  4C1E A;  4NQ6 A;  4UWR B;  5EH9 A;  5AEB A;  2WYM C;  5HH6 A;  3IEM A;  3Q6V A;  3DHC A;  1WW1 A;  4RBS A;  3IE1 A;  1MQO A;  4NQ5 A;  5A0V A;  4XUK A;  2GFJ A;  3P2U A;  5EW0 A;  2A7M A;  3BV6 A;  5A0T A;  2XF4 A;  2R2D A;  1YCF A;  5LCA A;  5LCF A;  4RAW A;  3BK1 A;  4DIK A;  2I7X A;  4TYF A;  4C1D A;  3KNS A;  2DKF A;  3X2Z A;  2I7V A;  2Y8A A;  4RL0 A;  4HL1 A;  4H0D A;  5EHT A;  4FSB A;  1JJT A;  4U4L A;  4UBQ A;  4NQ2 A;  1VME A;  5HIQ A;  2FHX B;  3DHB A;  1ZKP A;  4C1F A;  1DD6 A;  4AD9 A;  1SML A;  2BG2 A;  4RAM A;  4UWO B;  4FEK A;  2WYM A;  5ACS A;  3PY5 A;  4C1C A;  2VW8 A;  2H6A A;  2BIB A;  3SD9 A;  5FQC A;  4D1T A;  5FQB A;  2WHG A;  1DXK A;  4TZB A;  4Z5Y A;  1BMC A;  2BC2 A;  4NQ4 A;  4D1W A;  5ACR A;  3RKJ A;  4WD6 A;  3R2U A;  2BFK A;  2UYX A;  5AHR A;  2BFZ B;  3IOG A;  1X8H A;  3LVZ A;  1ZNB A;  5K4N A;  1BVT A;  2M5C A;  5HIP A;  4UWS B;  3L6N A;  4GYQ A;  2YNV A;  2ZZI A;  3RPC A;  2Q9U A;  1BC2 A;  4KEP A;  1JT1 A;  2QIN A;  3X2Y A;  2Y8B A;  5K0W A;  1E5D A;  5A87 A;  3MD7 A;  4XWT A;  3H3E A;  4Z7R A;  3RKK A;  3ADR A;  3VPE A;  5LE1 A;  4TYT A;  2YNV B;  3ZWF A;  5HIS A;  4JO0 A;  3I14 A;  5LMC A;  4D02 A;  3T3O A;  4TZE A;  5AYA A;  4KEQ A;  4EY2 A;  2BFZ A;  2YNT B;  4V0H A;  5KIL A;  1X8G A;  2YNW A;  4ZO2 A;  5IQK A;  2DOO A;  2NZF A;  3IE2 A;  4EYF A;  5ACX A;  4D1U A;  5AXR A;  3IOF A;  3A4Y A;  5HH4 A;  1YCG A;  5K4K A;  3IEL A;  1JJE A;  3SBL A;  3AF6 A;  2Q0I A;  3AJ3 A;  2AZ4 A;  2BTN A;  1M2X A;  2FU6 A;  4RM5 A;  4PVO A;  3ZQ4 A;  1HLK A;  4D1V A;  3I13 A;  3I15 A;  3IE0 A;  1XTO A;  2QDS A;  2FHX A;  3TP9 A;  4UWP B;  1A8T A;  3WXC A;  4Z60 A;  4CHL A;  5FQA A;  3I0V A;  4C09 A;  1ZTC A;  2BG6 A;  4EYB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...