1ZTCA

Crystal structure of a putative metallo-beta-lactamase (tm0894) from thermotoga maritima at 2.10 a resolution
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
209
structure length
209
Chain Sequence
HHMELKILVTGGNVFVPGRLNAHFSTVVYLEHKDRRIIIDPGNLSSMDELEEKFSELGISPDDITDVLFTHVHLDHIFNSVLFENATFYVHEVYKTKNYLSFGTIVGRIYSKVISSWKNVVLLKGEESLFDEKVKVFHTPWHAREHLSFLLDTENAGRVLITGDITPNRLSYYDIIKGYGSVQVKNFLDRVGRIDLLVFPHDAPLKPEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords hypothetical protein TM0894
publication title Crystal structure of hypothetical protein (tm0894) from Thermotoga maritima at 2.10 A resolution
rcsb
source organism Thermotoga maritima
total genus 61
structure length 209
sequence length 209
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 1ztcA00
4YSBA 2FU9A 2BMIA 1SMLA 1K07A 4F6HA 2BG2A 4EFZA 2BFLA 4TYFA 2P18A 3SPUA 5ACXA 4RL2A 5HIPA 1JJEA 1VGNA 4U4LA 2I7VA 1E5DA 2E7YA 1YCFA 2ZZIA 3ADRA 4RAWA 2DOOA 5A0VA 2Q0IA 5AXRA 3TP9A 5LCAA 4HL2A 1ZKPA 5HH5A 4EY2A 2I7TA 4XUKA 2OHHA 3KNRA 5AXOA 4GCWA 3BK2A 2Q42A 4NQ5A 4TZEA 1WRAA 4UAMA 5DPXA 3IEMA 3BK1A 4EYLA 4XWWA 2GCUA 3KNSA 1Y44A 4AD9A 2GFJA 4D1UA 4D1VA 3ZNBA 4BP0A 4EYBA 2BR6A 2NXAA 2AIOA 3IE2A 5FQCA 4BZ3A 2BIBA 2BC2A 3RPCA 1VJNA 5A5ZA 4FR7A 2QDSA 4Z6XA 3RKJA 2QDTA 4D1WA 3H3EA 2ZWRA 1BVTA 3L6NA 4J5HA 2GFKA 3SRXA 4C1HA 1XTOA 4Z5ZA 5KIKA 4O98A 5ACQA 3BC2A 3FAIA 5ACTA 3T3OA 2NZFA 3DHCA 3X2YA 4D02A 3IE1A 2NZEA 4JO0A 5LE1A 5LM6A 3KL7A 4TZ9A 2M5DA 5AHRA 3IOGA 4RL0A 3DHBA 4B87A 4NQ6A 4AX0B 2YCBA 2Q0JA 1P9EA 4FEKA 4YSKA 4AWZA 5KILA 3T3NA 4Z5YA 2YNWA 5ACPA 4Z60A 5EH9A 3IELA 4C1EA 2ZNBA 1WUPA 3DH8A 5IQKA 2OHJA 4YSLA 4ZO2A 2Y8AA 3I0VA 1DXKA 3DHAA 4J5FA 1X8HA 1X8GA 2OHIA 5EW0A 1VMEA 3ZR9A 3AJ3A 2A7MA 5AEBA 1X8IA 2P97A 3BV6A 3I13A 5HH4A 2XF4A 4AX1B 2YNUA 2BG8B 1BMCA 5LCHA 4UBQA 1WUOA 5AYAA 2ZO4A 4P62A 5B1UA 4LE6A 3A4YA 4UWOB 1DDKA 2WYMA 1A8TA 5B15A 5EWAA 4UA4A 2DKFA 4TZFA 3JXPA 3QH8A 5EHTA 3R2UA 1BC2A 3I14A 2CBNA 4ZO3A 4GYUA 3PY6A 5ACUA 5A87A 2BG8A 4V0HA 1KO2A 1MQOA 4D1TA 4EXYA 3X2XA 5FQAA 3X30A 5EV8A 4UWPB 4CHLA 2BFZA 4UWRB 5ACSA 4C1CA 3I11A 3X2ZA 4Z7RA 5LMCA 5A0TA 4GYQA 2NYPA 2HB9A 4C1GA 2WYMC 4RAMA 4KEQA 5FQBA 5EVDA 2FK6A 5HH6A 3Q6VA 4HL1A 5AHOA 3ZWFA 4C1DA 1XM8A 4XWTA 5HISA 4Z67A 2YNVB 2P4ZA 4UWSB 5EVBA 1QH3A 4PVOA 2I7XA 2Q9UA 3LVZA 3SFPA 4TZBA 5B3RA 5K4MA 3S0ZA 2WRSA 3AF6A 4RBSA 2BTNA 4KEPA 2AZ4A 2FU7A 3MD7A 4ZEJA 2YNTA 1ZTCA 2FM6A 2YNVA 1QH5A 4DILA 4RM5A 2XR1A 1HLKA 4AWYB 1KR3A 3RKKA 4ZNBA 2QJSA 2WHGA 1KO3A 2BG6A 3AF5A 4FSBA 5LS3A 5ACWA 3I15A 3IE0A 1M2XA 4C1FA 4F6ZA 3FCZA 5HIOA 2QINA 3ESHA 1DD6A 1ZNBA 2QEDA 3SBLA 4WD6A 2H6AA 1WW1A 2FHXB 5K4NA 3ZQ4A 5LLDA 2BGAA 5ACRA 3PY5A 4TYTA 4NQ4A 4C09A 2GKLA 1YCHA 2VW8A 3F9OA 3WXCA 2WYLA 4DIKA 3IOFA 3SW3A 2BFZB 2YZ3A 1JT1A 2FU6A 2BFKA 3G1PA 3SD9A 2Y8BA 2GMNA 2R2DA 2UYXA 5EVKA 2FHXA 1YCGA 3IDZA 2P1EA 5K4KA 3VQZA 4H0DA 4NQ2A 5LCFA 1JJTA 4EXSA 3PG4A 5K0WA 5HIQA 5ACVA 4PVTA 2Y87A 2BG7A 1A7TA 3VPEA 4EYFA 4HKYA 1L9YA 2YNTB 2M5CA 3P2UA 3T9MA 3IEKA 2FU8A 5LSCA 5EV6A
chains in the Genus database with same CATH superfamily
4YSBA 2FU9A 2BMIA 1SMLA 1K07A 4F6HA 2BG2A 4EFZA 2BFLA 4TYFA 2P18A 3SPUA 5ACXA 4RL2A 5HIPA 1JJEA 1VGNA 4U4LA 2I7VA 1E5DA 2E7YA 1YCFA 2ZZIA 3ADRA 4RAWA 2DOOA 5A0VA 2Q0IA 5AXRA 3TP9A 5LCAA 4HL2A 1ZKPA 5HH5A 4EY2A 2I7TA 4XUKA 2OHHA 3KNRA 5AXOA 4GCWA 3BK2A 5AJLA 2Q42A 4NQ5A 4TZEA 1WRAA 4UAMA 5DPXA 3IEMA 3BK1A 4EYLA 4XWWA 2GCUA 3KNSA 1Y44A 4AD9A 2GFJA 4D1UA 4D1VA 3ZNBA 4BP0A 4EYBA 2BR6A 2NXAA 2AIOA 3IE2A 5FQCA 4BZ3A 2BIBA 2BC2A 3RPCA 1VJNA 5A5ZA 4FR7A 2QDSA 4Z6XA 3RKJA 2QDTA 4D1WA 3H3EA 2ZWRA 1BVTA 3L6NA 4J5HA 2GFKA 3SRXA 4C1HA 1XTOA 4Z5ZA 5KIKA 4O98A 5ACQA 4AV7A 3BC2A 3FAIA 5ACTA 3T3OA 2NZFA 3DHCA 3X2YA 4D02A 3IE1A 2NZEA 4JO0A 5LE1A 5LM6A 4PDXA 3KL7A 4TZ9A 2M5DA 2CG2A 5AHRA 3IOGA 4RL0A 3DHBA 4B87A 4NQ6A 4AX0B 2YCBA 2Q0JA 1P9EA 4FEKA 4YSKA 4AWZA 5KILA 2CFZA 3T3NA 4Z5YA 2YNWA 5ACPA 4Z60A 5EH9A 3IELA 4C1EA 2ZNBA 1WUPA 3DH8A 5IQKA 2OHJA 4YSLA 4ZO2A 2Y8AA 3I0VA 2YHEA 1DXKA 3DHAA 4J5FA 1X8HA 1X8GA 2OHIA 5EW0A 1VMEA 3AJ3A 3ZR9A 2A7MA 5AEBA 1X8IA 2P97A 3BV6A 3I13A 5HH4A 2XF4A 4AX1B 2YNUA 2BG8B 1BMCA 5LCHA 4UBQA 1WUOA 5AYAA 2ZO4A 4P62A 4NURA 4LE6A 5B1UA 3A4YA 4UWOB 1DDKA 2WYMA 1A8TA 5B15A 5EWAA 4UA4A 2DKFA 4TZFA 3JXPA 3QH8A 5EHTA 3R2UA 1BC2A 3I14A 2CBNA 4ZO3A 4GYUA 3PY6A 5ACUA 5A87A 2BG8A 4V0HA 1KO2A 1MQOA 4D1TA 4EXYA 3X2XA 5FQAA 3X30A 5EV8A 4UWPB 5AIJA 4CHLA 2BFZA 4UWRB 5ACSA 4C1CA 3I11A 3X2ZA 4Z7RA 5LMCA 5A0TA 4GYQA 2NYPA 2HB9A 4C1GA 2WYMC 4RAMA 4KEQA 5FQBA 5EVDA 2FK6A 5HH6A 3Q6VA 4HL1A 5AHOA 3ZWFA 4C1DA 1XM8A 4XWTA 5HISA 4Z67A 2YNVB 2P4ZA 4UWSB 5EVBA 1QH3A 4PVOA 2I7XA 2Q9UA 3LVZA 3SFPA 4TZBA 5B3RA 5K4MA 3S0ZA 2WRSA 3AF6A 4RBSA 2BTNA 4KEPA 2AZ4A 2FU7A 3MD7A 4ZEJA 2YNTA 1ZTCA 2FM6A 2YNVA 1QH5A 4DILA 4RM5A 2XR1A 1HLKA 4AWYB 1KR3A 3RKKA 4ZNBA 2QJSA 2WHGA 1KO3A 2BG6A 3AF5A 4FSBA 5LS3A 5ACWA 3I15A 3IE0A 1M2XA 4C1FA 4F6ZA 3FCZA 5HIOA 2QINA 3ESHA 1DD6A 1ZNBA 2QEDA 3SBLA 4WD6A 2H6AA 1WW1A 2FHXB 5K4NA 3ZQ4A 5LLDA 2BGAA 5ACRA 3PY5A 5A23A 2CFUA 4TYTA 4NQ4A 4C09A 2GKLA 1YCHA 2VW8A 3F9OA 3WXCA 2WYLA 4DIKA 3IOFA 3SW3A 2BFZB 2YZ3A 1JT1A 2FU6A 2BFKA 3G1PA 4AXHA 3SD9A 2Y8BA 2GMNA 2R2DA 2UYXA 5EVKA 2FHXA 1YCGA 3IDZA 2CG3A 2P1EA 5K4KA 3VQZA 4H0DA 4NQ2A 5LCFA 1JJTA 4EXSA 3PG4A 5K0WA 5HIQA 5ACVA 4PVTA 2Y87A 2BG7A 1A7TA 3VPEA 4EYFA 4HKYA 1L9YA 2YNTB 2M5CA 3P2UA 3T9MA 3IEKA 2FU8A 5LSCA 5EV6A
chains in the Genus database with same CATH topology
4YSBA 2FU9A 2BMIA 1SMLA 1K07A 4F6HA 2BG2A 4EFZA 2BFLA 4TYFA 2P18A 3SPUA 5ACXA 4RL2A 5HIPA 1JJEA 1VGNA 4U4LA 2I7VA 1E5DA 2E7YA 1YCFA 2ZZIA 3ADRA 4RAWA 2DOOA 5A0VA 2Q0IA 5AXRA 3TP9A 5LCAA 4HL2A 1ZKPA 5HH5A 4EY2A 2I7TA 4XUKA 2OHHA 3KNRA 5AXOA 4GCWA 3BK2A 2Q42A 4NQ5A 4TZEA 1WRAA 4UAMA 5DPXA 3IEMA 3BK1A 4EYLA 4XWWA 2GCUA 3KNSA 1Y44A 4AD9A 2GFJA 4D1UA 4D1VA 3ZNBA 4BP0A 4EYBA 2BR6A 2NXAA 2AIOA 3IE2A 5FQCA 4BZ3A 2BIBA 2BC2A 3RPCA 1VJNA 5A5ZA 4FR7A 2QDSA 4Z6XA 3RKJA 2QDTA 4D1WA 3H3EA 2ZWRA 1BVTA 3L6NA 4J5HA 2GFKA 3SRXA 4C1HA 1XTOA 4Z5ZA 5KIKA 4O98A 5ACQA 3BC2A 3FAIA 5ACTA 3T3OA 2NZFA 3DHCA 3X2YA 4D02A 3IE1A 2NZEA 4JO0A 5LE1A 5LM6A 3KL7A 4TZ9A 2M5DA 5AHRA 3IOGA 4RL0A 3DHBA 4B87A 4NQ6A 4AX0B 2YCBA 2Q0JA 1P9EA 4FEKA 4YSKA 4AWZA 5KILA 3T3NA 4Z5YA 2YNWA 5ACPA 4Z60A 5EH9A 3IELA 4C1EA 2ZNBA 1WUPA 3DH8A 5IQKA 2OHJA 4YSLA 4ZO2A 2Y8AA 3I0VA 1DXKA 3DHAA 4J5FA 1X8HA 1X8GA 2OHIA 5EW0A 1VMEA 3ZR9A 3AJ3A 2A7MA 5AEBA 1X8IA 2P97A 3BV6A 3I13A 5HH4A 2XF4A 4AX1B 2YNUA 2BG8B 1BMCA 5LCHA 4UBQA 1WUOA 5AYAA 2ZO4A 4P62A 5B1UA 4LE6A 3A4YA 4UWOB 1DDKA 2WYMA 1A8TA 5B15A 5EWAA 4UA4A 2DKFA 4TZFA 3JXPA 3QH8A 5EHTA 3R2UA 1BC2A 3I14A 2CBNA 4ZO3A 4GYUA 3PY6A 5ACUA 5A87A 2BG8A 4V0HA 1KO2A 1MQOA 4D1TA 4EXYA 3X2XA 5FQAA 3X30A 5EV8A 4UWPB 4CHLA 2BFZA 4UWRB 5ACSA 4C1CA 3I11A 3X2ZA 4Z7RA 5LMCA 5A0TA 4GYQA 2NYPA 2HB9A 4C1GA 2WYMC 4RAMA 4KEQA 5FQBA 5EVDA 2FK6A 5HH6A 3Q6VA 4HL1A 5AHOA 3ZWFA 4C1DA 1XM8A 4XWTA 5HISA 4Z67A 2YNVB 2P4ZA 4UWSB 5EVBA 1QH3A 4PVOA 2I7XA 2Q9UA 3LVZA 3SFPA 4TZBA 5B3RA 5K4MA 3S0ZA 2WRSA 3AF6A 4RBSA 2BTNA 4KEPA 2AZ4A 2FU7A 3MD7A 4ZEJA 2YNTA 1ZTCA 2FM6A 2YNVA 1QH5A 4DILA 4RM5A 2XR1A 1HLKA 4AWYB 1KR3A 3RKKA 4ZNBA 2QJSA 2WHGA 1KO3A 2BG6A 3AF5A 4FSBA 5LS3A 5ACWA 3I15A 3IE0A 1M2XA 4C1FA 4F6ZA 3FCZA 5HIOA 2QINA 3ESHA 1DD6A 1ZNBA 2QEDA 3SBLA 4WD6A 2H6AA 1WW1A 2FHXB 5K4NA 3ZQ4A 5LLDA 2BGAA 5ACRA 3PY5A 4TYTA 4NQ4A 4C09A 2GKLA 1YCHA 2VW8A 3F9OA 3WXCA 2WYLA 4DIKA 3IOFA 3SW3A 2BFZB 2YZ3A 1JT1A 2FU6A 2BFKA 3G1PA 3SD9A 2Y8BA 2GMNA 2R2DA 2UYXA 5EVKA 2FHXA 1YCGA 3IDZA 2P1EA 5K4KA 3VQZA 4H0DA 4NQ2A 5LCFA 1JJTA 4EXSA 3PG4A 5K0WA 5HIQA 5ACVA 4PVTA 2Y87A 2BG7A 1A7TA 3VPEA 4EYFA 4HKYA 1L9YA 2YNTB 2M5CA 3P2UA 3T9MA 3IEKA 2FU8A 5LSCA 5EV6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YSB A;  2FU9 A;  2BMI A;  1SML A;  1K07 A;  4F6H A;  2BG2 A;  4EFZ A;  2BFL A;  4TYF A;  2P18 A;  3SPU A;  5ACX A;  4RL2 A;  5HIP A;  1JJE A;  1VGN A;  4U4L A;  2I7V A;  1E5D A;  2E7Y A;  1YCF A;  2ZZI A;  3ADR A;  4RAW A;  2DOO A;  5A0V A;  2Q0I A;  5AXR A;  3TP9 A;  5LCA A;  4HL2 A;  1ZKP A;  5HH5 A;  4EY2 A;  2I7T A;  4XUK A;  2OHH A;  3KNR A;  5AXO A;  4GCW A;  3BK2 A;  2Q42 A;  4NQ5 A;  4TZE A;  1WRA A;  4UAM A;  5DPX A;  3IEM A;  3BK1 A;  4EYL A;  4XWW A;  2GCU A;  3KNS A;  1Y44 A;  4AD9 A;  2GFJ A;  4D1U A;  4D1V A;  3ZNB A;  4BP0 A;  4EYB A;  2BR6 A;  2NXA A;  2AIO A;  3IE2 A;  5FQC A;  4BZ3 A;  2BIB A;  2BC2 A;  3RPC A;  1VJN A;  5A5Z A;  4FR7 A;  2QDS A;  4Z6X A;  3RKJ A;  2QDT A;  4D1W A;  3H3E A;  2ZWR A;  1BVT A;  3L6N A;  4J5H A;  2GFK A;  3SRX A;  4C1H A;  1XTO A;  4Z5Z A;  5KIK A;  4O98 A;  5ACQ A;  3BC2 A;  3FAI A;  5ACT A;  3T3O A;  2NZF A;  3DHC A;  3X2Y A;  4D02 A;  3IE1 A;  2NZE A;  4JO0 A;  5LE1 A;  5LM6 A;  3KL7 A;  4TZ9 A;  2M5D A;  5AHR A;  3IOG A;  4RL0 A;  3DHB A;  4B87 A;  4NQ6 A;  4AX0 B;  2YCB A;  2Q0J A;  1P9E A;  4FEK A;  4YSK A;  4AWZ A;  5KIL A;  3T3N A;  4Z5Y A;  2YNW A;  5ACP A;  4Z60 A;  5EH9 A;  3IEL A;  4C1E A;  2ZNB A;  1WUP A;  3DH8 A;  5IQK A;  2OHJ A;  4YSL A;  4ZO2 A;  2Y8A A;  3I0V A;  1DXK A;  3DHA A;  4J5F A;  1X8H A;  1X8G A;  2OHI A;  5EW0 A;  1VME A;  3ZR9 A;  3AJ3 A;  2A7M A;  5AEB A;  1X8I A;  2P97 A;  3BV6 A;  3I13 A;  5HH4 A;  2XF4 A;  4AX1 B;  2YNU A;  2BG8 B;  1BMC A;  5LCH A;  4UBQ A;  1WUO A;  5AYA A;  2ZO4 A;  4P62 A;  5B1U A;  4LE6 A;  3A4Y A;  4UWO B;  1DDK A;  2WYM A;  1A8T A;  5B15 A;  5EWA A;  4UA4 A;  2DKF A;  4TZF A;  3JXP A;  3QH8 A;  5EHT A;  3R2U A;  1BC2 A;  3I14 A;  2CBN A;  4ZO3 A;  4GYU A;  3PY6 A;  5ACU A;  5A87 A;  2BG8 A;  4V0H A;  1KO2 A;  1MQO A;  4D1T A;  4EXY A;  3X2X A;  5FQA A;  3X30 A;  5EV8 A;  4UWP B;  4CHL A;  2BFZ A;  4UWR B;  5ACS A;  4C1C A;  3I11 A;  3X2Z A;  4Z7R A;  5LMC A;  5A0T A;  4GYQ A;  2NYP A;  2HB9 A;  4C1G A;  2WYM C;  4RAM A;  4KEQ A;  5FQB A;  5EVD A;  2FK6 A;  5HH6 A;  3Q6V A;  4HL1 A;  5AHO A;  3ZWF A;  4C1D A;  1XM8 A;  4XWT A;  5HIS A;  4Z67 A;  2YNV B;  2P4Z A;  4UWS B;  5EVB A;  1QH3 A;  4PVO A;  2I7X A;  2Q9U A;  3LVZ A;  3SFP A;  4TZB A;  5B3R A;  5K4M A;  3S0Z A;  2WRS A;  3AF6 A;  4RBS A;  2BTN A;  4KEP A;  2AZ4 A;  2FU7 A;  3MD7 A;  4ZEJ A;  2YNT A;  1ZTC A;  2FM6 A;  2YNV A;  1QH5 A;  4DIL A;  4RM5 A;  2XR1 A;  1HLK A;  4AWY B;  1KR3 A;  3RKK A;  4ZNB A;  2QJS A;  2WHG A;  1KO3 A;  2BG6 A;  3AF5 A;  4FSB A;  5LS3 A;  5ACW A;  3I15 A;  3IE0 A;  1M2X A;  4C1F A;  4F6Z A;  3FCZ A;  5HIO A;  2QIN A;  3ESH A;  1DD6 A;  1ZNB A;  2QED A;  3SBL A;  4WD6 A;  2H6A A;  1WW1 A;  2FHX B;  5K4N A;  3ZQ4 A;  5LLD A;  2BGA A;  5ACR A;  3PY5 A;  4TYT A;  4NQ4 A;  4C09 A;  2GKL A;  1YCH A;  2VW8 A;  3F9O A;  3WXC A;  2WYL A;  4DIK A;  3IOF A;  3SW3 A;  2BFZ B;  2YZ3 A;  1JT1 A;  2FU6 A;  2BFK A;  3G1P A;  3SD9 A;  2Y8B A;  2GMN A;  2R2D A;  2UYX A;  5EVK A;  2FHX A;  1YCG A;  3IDZ A;  2P1E A;  5K4K A;  3VQZ A;  4H0D A;  4NQ2 A;  5LCF A;  1JJT A;  4EXS A;  3PG4 A;  5K0W A;  5HIQ A;  5ACV A;  4PVT A;  2Y87 A;  2BG7 A;  1A7T A;  3VPE A;  4EYF A;  4HKY A;  1L9Y A;  2YNT B;  2M5C A;  3P2U A;  3T9M A;  3IEK A;  2FU8 A;  5LSC A;  5EV6 A; 
#chains in the Genus database with same CATH topology
 4YSB A;  2FU9 A;  2BMI A;  1SML A;  1K07 A;  4F6H A;  2BG2 A;  4EFZ A;  2BFL A;  4TYF A;  2P18 A;  3SPU A;  5ACX A;  4RL2 A;  5HIP A;  1JJE A;  1VGN A;  4U4L A;  2I7V A;  1E5D A;  2E7Y A;  1YCF A;  2ZZI A;  3ADR A;  4RAW A;  2DOO A;  5A0V A;  2Q0I A;  5AXR A;  3TP9 A;  5LCA A;  4HL2 A;  1ZKP A;  5HH5 A;  4EY2 A;  2I7T A;  4XUK A;  2OHH A;  3KNR A;  5AXO A;  4GCW A;  3BK2 A;  5AJL A;  2Q42 A;  4NQ5 A;  4TZE A;  1WRA A;  4UAM A;  5DPX A;  3IEM A;  3BK1 A;  4EYL A;  4XWW A;  2GCU A;  3KNS A;  1Y44 A;  4AD9 A;  2GFJ A;  4D1U A;  4D1V A;  3ZNB A;  4BP0 A;  4EYB A;  2BR6 A;  2NXA A;  2AIO A;  3IE2 A;  5FQC A;  4BZ3 A;  2BIB A;  2BC2 A;  3RPC A;  1VJN A;  5A5Z A;  4FR7 A;  2QDS A;  4Z6X A;  3RKJ A;  2QDT A;  4D1W A;  3H3E A;  2ZWR A;  1BVT A;  3L6N A;  4J5H A;  2GFK A;  3SRX A;  4C1H A;  1XTO A;  4Z5Z A;  5KIK A;  4O98 A;  5ACQ A;  4AV7 A;  3BC2 A;  3FAI A;  5ACT A;  3T3O A;  2NZF A;  3DHC A;  3X2Y A;  4D02 A;  3IE1 A;  2NZE A;  4JO0 A;  5LE1 A;  5LM6 A;  4PDX A;  3KL7 A;  4TZ9 A;  2M5D A;  2CG2 A;  5AHR A;  3IOG A;  4RL0 A;  3DHB A;  4B87 A;  4NQ6 A;  4AX0 B;  2YCB A;  2Q0J A;  1P9E A;  4FEK A;  4YSK A;  4AWZ A;  5KIL A;  2CFZ A;  3T3N A;  4Z5Y A;  2YNW A;  5ACP A;  4Z60 A;  5EH9 A;  3IEL A;  4C1E A;  2ZNB A;  1WUP A;  3DH8 A;  5IQK A;  2OHJ A;  4YSL A;  4ZO2 A;  2Y8A A;  3I0V A;  2YHE A;  1DXK A;  3DHA A;  4J5F A;  1X8H A;  1X8G A;  2OHI A;  5EW0 A;  1VME A;  3AJ3 A;  3ZR9 A;  2A7M A;  5AEB A;  1X8I A;  2P97 A;  3BV6 A;  3I13 A;  5HH4 A;  2XF4 A;  4AX1 B;  2YNU A;  2BG8 B;  1BMC A;  5LCH A;  4UBQ A;  1WUO A;  5AYA A;  2ZO4 A;  4P62 A;  4NUR A;  4LE6 A;  5B1U A;  3A4Y A;  4UWO B;  1DDK A;  2WYM A;  1A8T A;  5B15 A;  5EWA A;  4UA4 A;  2DKF A;  4TZF A;  3JXP A;  3QH8 A;  5EHT A;  3R2U A;  1BC2 A;  3I14 A;  2CBN A;  4ZO3 A;  4GYU A;  3PY6 A;  5ACU A;  5A87 A;  2BG8 A;  4V0H A;  1KO2 A;  1MQO A;  4D1T A;  4EXY A;  3X2X A;  5FQA A;  3X30 A;  5EV8 A;  4UWP B;  5AIJ A;  4CHL A;  2BFZ A;  4UWR B;  5ACS A;  4C1C A;  3I11 A;  3X2Z A;  4Z7R A;  5LMC A;  5A0T A;  4GYQ A;  2NYP A;  2HB9 A;  4C1G A;  2WYM C;  4RAM A;  4KEQ A;  5FQB A;  5EVD A;  2FK6 A;  5HH6 A;  3Q6V A;  4HL1 A;  5AHO A;  3ZWF A;  4C1D A;  1XM8 A;  4XWT A;  5HIS A;  4Z67 A;  2YNV B;  2P4Z A;  4UWS B;  5EVB A;  1QH3 A;  4PVO A;  2I7X A;  2Q9U A;  3LVZ A;  3SFP A;  4TZB A;  5B3R A;  5K4M A;  3S0Z A;  2WRS A;  3AF6 A;  4RBS A;  2BTN A;  4KEP A;  2AZ4 A;  2FU7 A;  3MD7 A;  4ZEJ A;  2YNT A;  1ZTC A;  2FM6 A;  2YNV A;  1QH5 A;  4DIL A;  4RM5 A;  2XR1 A;  1HLK A;  4AWY B;  1KR3 A;  3RKK A;  4ZNB A;  2QJS A;  2WHG A;  1KO3 A;  2BG6 A;  3AF5 A;  4FSB A;  5LS3 A;  5ACW A;  3I15 A;  3IE0 A;  1M2X A;  4C1F A;  4F6Z A;  3FCZ A;  5HIO A;  2QIN A;  3ESH A;  1DD6 A;  1ZNB A;  2QED A;  3SBL A;  4WD6 A;  2H6A A;  1WW1 A;  2FHX B;  5K4N A;  3ZQ4 A;  5LLD A;  2BGA A;  5ACR A;  3PY5 A;  5A23 A;  2CFU A;  4TYT A;  4NQ4 A;  4C09 A;  2GKL A;  1YCH A;  2VW8 A;  3F9O A;  3WXC A;  2WYL A;  4DIK A;  3IOF A;  3SW3 A;  2BFZ B;  2YZ3 A;  1JT1 A;  2FU6 A;  2BFK A;  3G1P A;  4AXH A;  3SD9 A;  2Y8B A;  2GMN A;  2R2D A;  2UYX A;  5EVK A;  2FHX A;  1YCG A;  3IDZ A;  2CG3 A;  2P1E A;  5K4K A;  3VQZ A;  4H0D A;  4NQ2 A;  5LCF A;  1JJT A;  4EXS A;  3PG4 A;  5K0W A;  5HIQ A;  5ACV A;  4PVT A;  2Y87 A;  2BG7 A;  1A7T A;  3VPE A;  4EYF A;  4HKY A;  1L9Y A;  2YNT B;  2M5C A;  3P2U A;  3T9M A;  3IEK A;  2FU8 A;  5LSC A;  5EV6 A; 
#chains in the Genus database with same CATH homology
 4YSB A;  2FU9 A;  2BMI A;  1SML A;  1K07 A;  4F6H A;  2BG2 A;  4EFZ A;  2BFL A;  4TYF A;  2P18 A;  3SPU A;  5ACX A;  4RL2 A;  5HIP A;  1JJE A;  1VGN A;  4U4L A;  2I7V A;  1E5D A;  2E7Y A;  1YCF A;  2ZZI A;  3ADR A;  4RAW A;  2DOO A;  5A0V A;  2Q0I A;  5AXR A;  3TP9 A;  5LCA A;  4HL2 A;  1ZKP A;  5HH5 A;  4EY2 A;  2I7T A;  4XUK A;  2OHH A;  3KNR A;  5AXO A;  4GCW A;  3BK2 A;  2Q42 A;  4NQ5 A;  4TZE A;  1WRA A;  4UAM A;  5DPX A;  3IEM A;  3BK1 A;  4EYL A;  4XWW A;  2GCU A;  3KNS A;  1Y44 A;  4AD9 A;  2GFJ A;  4D1U A;  4D1V A;  3ZNB A;  4BP0 A;  4EYB A;  2BR6 A;  2NXA A;  2AIO A;  3IE2 A;  5FQC A;  4BZ3 A;  2BIB A;  2BC2 A;  3RPC A;  1VJN A;  5A5Z A;  4FR7 A;  2QDS A;  4Z6X A;  3RKJ A;  2QDT A;  4D1W A;  3H3E A;  2ZWR A;  1BVT A;  3L6N A;  4J5H A;  2GFK A;  3SRX A;  4C1H A;  1XTO A;  4Z5Z A;  5KIK A;  4O98 A;  5ACQ A;  3BC2 A;  3FAI A;  5ACT A;  3T3O A;  2NZF A;  3DHC A;  3X2Y A;  4D02 A;  3IE1 A;  2NZE A;  4JO0 A;  5LE1 A;  5LM6 A;  3KL7 A;  4TZ9 A;  2M5D A;  5AHR A;  3IOG A;  4RL0 A;  3DHB A;  4B87 A;  4NQ6 A;  4AX0 B;  2YCB A;  2Q0J A;  1P9E A;  4FEK A;  4YSK A;  4AWZ A;  5KIL A;  3T3N A;  4Z5Y A;  2YNW A;  5ACP A;  4Z60 A;  5EH9 A;  3IEL A;  4C1E A;  2ZNB A;  1WUP A;  3DH8 A;  5IQK A;  2OHJ A;  4YSL A;  4ZO2 A;  2Y8A A;  3I0V A;  1DXK A;  3DHA A;  4J5F A;  1X8H A;  1X8G A;  2OHI A;  5EW0 A;  1VME A;  3ZR9 A;  3AJ3 A;  2A7M A;  5AEB A;  1X8I A;  2P97 A;  3BV6 A;  3I13 A;  5HH4 A;  2XF4 A;  4AX1 B;  2YNU A;  2BG8 B;  1BMC A;  5LCH A;  4UBQ A;  1WUO A;  5AYA A;  2ZO4 A;  4P62 A;  5B1U A;  4LE6 A;  3A4Y A;  4UWO B;  1DDK A;  2WYM A;  1A8T A;  5B15 A;  5EWA A;  4UA4 A;  2DKF A;  4TZF A;  3JXP A;  3QH8 A;  5EHT A;  3R2U A;  1BC2 A;  3I14 A;  2CBN A;  4ZO3 A;  4GYU A;  3PY6 A;  5ACU A;  5A87 A;  2BG8 A;  4V0H A;  1KO2 A;  1MQO A;  4D1T A;  4EXY A;  3X2X A;  5FQA A;  3X30 A;  5EV8 A;  4UWP B;  4CHL A;  2BFZ A;  4UWR B;  5ACS A;  4C1C A;  3I11 A;  3X2Z A;  4Z7R A;  5LMC A;  5A0T A;  4GYQ A;  2NYP A;  2HB9 A;  4C1G A;  2WYM C;  4RAM A;  4KEQ A;  5FQB A;  5EVD A;  2FK6 A;  5HH6 A;  3Q6V A;  4HL1 A;  5AHO A;  3ZWF A;  4C1D A;  1XM8 A;  4XWT A;  5HIS A;  4Z67 A;  2YNV B;  2P4Z A;  4UWS B;  5EVB A;  1QH3 A;  4PVO A;  2I7X A;  2Q9U A;  3LVZ A;  3SFP A;  4TZB A;  5B3R A;  5K4M A;  3S0Z A;  2WRS A;  3AF6 A;  4RBS A;  2BTN A;  4KEP A;  2AZ4 A;  2FU7 A;  3MD7 A;  4ZEJ A;  2YNT A;  1ZTC A;  2FM6 A;  2YNV A;  1QH5 A;  4DIL A;  4RM5 A;  2XR1 A;  1HLK A;  4AWY B;  1KR3 A;  3RKK A;  4ZNB A;  2QJS A;  2WHG A;  1KO3 A;  2BG6 A;  3AF5 A;  4FSB A;  5LS3 A;  5ACW A;  3I15 A;  3IE0 A;  1M2X A;  4C1F A;  4F6Z A;  3FCZ A;  5HIO A;  2QIN A;  3ESH A;  1DD6 A;  1ZNB A;  2QED A;  3SBL A;  4WD6 A;  2H6A A;  1WW1 A;  2FHX B;  5K4N A;  3ZQ4 A;  5LLD A;  2BGA A;  5ACR A;  3PY5 A;  4TYT A;  4NQ4 A;  4C09 A;  2GKL A;  1YCH A;  2VW8 A;  3F9O A;  3WXC A;  2WYL A;  4DIK A;  3IOF A;  3SW3 A;  2BFZ B;  2YZ3 A;  1JT1 A;  2FU6 A;  2BFK A;  3G1P A;  3SD9 A;  2Y8B A;  2GMN A;  2R2D A;  2UYX A;  5EVK A;  2FHX A;  1YCG A;  3IDZ A;  2P1E A;  5K4K A;  3VQZ A;  4H0D A;  4NQ2 A;  5LCF A;  1JJT A;  4EXS A;  3PG4 A;  5K0W A;  5HIQ A;  5ACV A;  4PVT A;  2Y87 A;  2BG7 A;  1A7T A;  3VPE A;  4EYF A;  4HKY A;  1L9Y A;  2YNT B;  2M5C A;  3P2U A;  3T9M A;  3IEK A;  2FU8 A;  5LSC A;  5EV6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...