1ZTCA

Crystal structure of a putative metallo-beta-lactamase (tm0894) from thermotoga maritima at 2.10 a resolution
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
209
structure length
209
Chain Sequence
HHMELKILVTGGNVFVPGRLNAHFSTVVYLEHKDRRIIIDPGNLSSMDELEEKFSELGISPDDITDVLFTHVHLDHIFNSVLFENATFYVHEVYKTKNYLSFGTIVGRIYSKVISSWKNVVLLKGEESLFDEKVKVFHTPWHAREHLSFLLDTENAGRVLITGDITPNRLSYYDIIKGYGSVQVKNFLDRVGRIDLLVFPHDAPLKPEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein TM0894
publication title Crystal structure of hypothetical protein (tm0894) from Thermotoga maritima at 2.10 A resolution
rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
total genus 61
structure length 209
sequence length 209
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 1ztcA00
3SFPA 5EWAA 3T9MA 3X2XA 5EVKA 5HH6A 2GFKA 2Q0IA 1DXKA 3DH8A 3IE0A 5LLDA 2P18A 4NQ5A 2QINA 4EY2A 5EVBA 2FK6A 4HKYA 1XM8A 5ACTA 3I15A 4C1EA 2ZO4A 3JXPA 3PY6A 4FSBA 5ACXA 5LSCA 5EHTA 2GMNA 3BV6A 5ACSA 4PVOA 4AX0B 4D1TA 1YCHA 3LVZA 4J5FA 4JO0A 2WYMC 1KO3A 2YNWA 2BC2A 2YNUA 2NXAA 1VGNA 1ZTCA 4P62A 2ZWRA 2QDSA 2NZEA 4TYTA 4D1UA 3BK1A 4Z6XA 4C1GA 3KL7A 2BG8B 1DD6A 4TZFA 2OHIA 1SMLA 4EYBA 3Q6VA 3ZQ4A 4DIKA 5K4KA 1VMEA 2WYLA 5HIPA 2HB9A 5FQCA 5ACPA 3IEMA 5B1UA 5HH5A 5AEBA 3SBLA 4FR7A 1WW1A 4AWZA 2NZFA 2FU9A 3AF5A 3SPUA 2BIBA 2BGAA 2P4ZA 4LE6A 4C1CA 2QDTA 3TP9A 3QH8A 3ZNBA 4GYUA 5ACRA 5LCAA 4UWOB 5K4MA 4YSKA 4XWTA 2QEDA 1JJTA 5FQBA 3X2YA 3AJ3A 3X2ZA 3BC2A 4EXSA 2M5CA 4TZBA 5A5ZA 3IOFA 4U4LA 5LS3A 5AHOA 5A0VA 4EFZA 3I11A 2Q42A 2FU7A 4F6HA 3BK2A 3RPCA 2XR1A 4J5HA 1K07A 3DHBA 4RAWA 4UA4A 2DKFA 4UAMA 1MQOA 5EVDA 4B87A 2R2DA 2FHXA 1WRAA 5FQAA 5HIOA 4UWRB 1BVTA 4TZEA 4PVTA 4Z5YA 5HIQA 2P97A 4NQ2A 2Y87A 1YCGA 4DILA 2GKLA 4EYFA 3IE2A 5ACWA 1QH5A 4ZO2A 3A4YA 2BFZB 4BP0A 3DHAA 1XTOA 5K0WA 5LE1A 2WRSA 4WD6A 3S0ZA 5LCHA 1JT1A 5HISA 2AIOA 2YNVB 3F9OA 5KIKA 2Y8AA 4ZO3A 1L9YA 2AZ4A 2XF4A 2E7YA 2WYMA 3VPEA 3MD7A 4GYQA 4FEKA 1QH3A 4D02A 5EV8A 1BMCA 2YNTA 1BC2A 4RAMA 2H6AA 5AHRA 3KNRA 1WUOA 3FCZA 1HLKA 1YCFA 2I7VA 4UBQA 3I13A 3PG4A 3I0VA 4EXYA 2GCUA 5AXOA 2NYPA 3IE1A 2BG6A 2BFKA 2A7MA 4XWWA 4CHLA 4AWYB 5LCFA 1VJNA 4HL2A 1E5DA 3DHCA 2Q0JA 2FU8A 3P2UA 3X30A 2VW8A 3IOGA 3I14A 3IDZA 5IQKA 4TYFA 1A7TA 2Q9UA 3G1PA 1JJEA 5B3RA 4RL0A 2OHJA 5HH4A 2OHHA 4AX1B 5A87A 2ZZIA 2QJSA 5AXRA 5ACQA 3T3OA 1DDKA 2BG8A 2M5DA 2FU6A 2FM6A 4XUKA 1X8HA 2ZNBA 2GFJA 4KEPA 5EW0A 4F6ZA 5A0TA 2Y8BA 5KILA 2BMIA 2YCBA 1KO2A 3L6NA 1ZNBA 5EH9A 2I7TA 2DOOA 2BTNA 4RBSA 4RM5A 2CBNA 4EYLA 3ADRA 3PY5A 3ZWFA 4ZNBA 1X8GA 4Z67A 4D1VA 4UWPB 5DPXA 4C1HA 5B15A 1X8IA 4BZ3A 5LMCA 3WXCA 4YSLA 3AF6A 2FHXB 4D1WA 2YZ3A 5ACVA 3IELA 4Z5ZA 5ACUA 5EV6A 4YSBA 2BR6A 4C1FA 4V0HA 1P9EA 4RL2A 3RKKA 2P1EA 4AD9A 4Z7RA 4C09A 1Y44A 4NQ6A 4TZ9A 4H0DA 4UWSB 3FAIA 3R2UA 1M2XA 3KNSA 4HL1A 3VQZA 4C1DA 4GCWA 4KEQA 3RKJA 3SW3A 1A8TA 4ZEJA 3ESHA 5LM6A 2UYXA 4NQ4A 2BFZA 5AYAA 1WUPA 3SRXA 1ZKPA 2BG7A 3ZR9A 5K4NA 3T3NA 1KR3A 4O98A 2BG2A 2YNTB 2WHGA 3IEKA 2BFLA 2YNVA 3H3EA 2I7XA 4Z60A 3SD9A
chains in the Genus database with same CATH superfamily
3SFPA 5EWAA 3T9MA 3X2XA 5EVKA 5HH6A 2GFKA 2Q0IA 1DXKA 3DH8A 3IE0A 5LLDA 2P18A 4NQ5A 2QINA 4EY2A 5EVBA 2FK6A 4HKYA 1XM8A 5ACTA 3I15A 4C1EA 2ZO4A 3JXPA 3PY6A 2YHEA 4FSBA 5ACXA 5LSCA 5EHTA 2GMNA 3BV6A 5ACSA 4PVOA 4AX0B 4D1TA 1YCHA 3LVZA 4J5FA 4JO0A 2WYMC 1KO3A 2YNWA 2BC2A 2YNUA 2NXAA 1VGNA 1ZTCA 4P62A 4PDXA 2ZWRA 2QDSA 2NZEA 4TYTA 4D1UA 3BK1A 4Z6XA 4C1GA 3KL7A 2BG8B 1DD6A 4TZFA 2OHIA 1SMLA 4EYBA 3Q6VA 3ZQ4A 4DIKA 5K4KA 1VMEA 2WYLA 5HIPA 2HB9A 5FQCA 5ACPA 3IEMA 5B1UA 5HH5A 5AEBA 3SBLA 4FR7A 1WW1A 4AWZA 2NZFA 2FU9A 3AF5A 3SPUA 2BIBA 2BGAA 2P4ZA 4LE6A 4C1CA 2QDTA 3TP9A 3QH8A 3ZNBA 4GYUA 5ACRA 4AV7A 5LCAA 4UWOB 5K4MA 4YSKA 4XWTA 2QEDA 1JJTA 5FQBA 3X2YA 3AJ3A 3X2ZA 3BC2A 4EXSA 2M5CA 4TZBA 5A5ZA 3IOFA 4U4LA 5LS3A 5AHOA 5A0VA 4EFZA 3I11A 2Q42A 2FU7A 4F6HA 3BK2A 3RPCA 2XR1A 4J5HA 1K07A 3DHBA 4RAWA 4UA4A 2DKFA 4UAMA 1MQOA 5EVDA 4B87A 2CG2A 2R2DA 2FHXA 1WRAA 5FQAA 5HIOA 4UWRB 1BVTA 4TZEA 4PVTA 4Z5YA 5HIQA 2P97A 4NQ2A 4NURA 2Y87A 1YCGA 4DILA 2GKLA 4EYFA 3IE2A 5ACWA 1QH5A 4ZO2A 4AXHA 2CFZA 3A4YA 2BFZB 4BP0A 3DHAA 1XTOA 5K0WA 5LE1A 2WRSA 4WD6A 3S0ZA 5LCHA 1JT1A 5HISA 2AIOA 2YNVB 3F9OA 5KIKA 2Y8AA 4ZO3A 1L9YA 2AZ4A 2XF4A 2E7YA 2WYMA 3VPEA 3MD7A 4GYQA 2CFUA 4FEKA 1QH3A 4D02A 5EV8A 1BMCA 2YNTA 1BC2A 4RAMA 2H6AA 5AHRA 3KNRA 1WUOA 3FCZA 1HLKA 1YCFA 2I7VA 4UBQA 3I13A 3PG4A 3I0VA 4EXYA 2GCUA 5AXOA 2NYPA 3IE1A 2BG6A 2BFKA 2A7MA 4XWWA 5AIJA 4CHLA 4AWYB 5LCFA 1VJNA 4HL2A 1E5DA 3DHCA 2Q0JA 2FU8A 3P2UA 3X30A 2VW8A 3IOGA 3I14A 3IDZA 5IQKA 4TYFA 1A7TA 2Q9UA 3G1PA 1JJEA 5B3RA 4RL0A 2OHJA 5HH4A 2OHHA 4AX1B 5A87A 2ZZIA 2QJSA 5AXRA 5ACQA 3T3OA 1DDKA 2BG8A 2M5DA 2FU6A 2FM6A 4XUKA 1X8HA 2ZNBA 2GFJA 4KEPA 5EW0A 4F6ZA 5A0TA 2Y8BA 5KILA 2BMIA 2YCBA 1KO2A 3L6NA 1ZNBA 5EH9A 2I7TA 2DOOA 2BTNA 4RBSA 4RM5A 2CBNA 4EYLA 3ADRA 3PY5A 3ZWFA 4ZNBA 1X8GA 4Z67A 4D1VA 4UWPB 5DPXA 4C1HA 5B15A 1X8IA 4BZ3A 5LMCA 3WXCA 4YSLA 3AF6A 2FHXB 4D1WA 2YZ3A 5ACVA 5A23A 3IELA 2CG3A 4Z5ZA 5ACUA 5EV6A 4YSBA 2BR6A 4C1FA 4V0HA 1P9EA 4RL2A 3RKKA 2P1EA 4AD9A 4Z7RA 4C09A 1Y44A 4NQ6A 4TZ9A 4H0DA 4UWSB 3FAIA 3R2UA 1M2XA 3KNSA 4HL1A 3VQZA 4C1DA 4GCWA 4KEQA 3RKJA 3SW3A 1A8TA 4ZEJA 3ESHA 5LM6A 2UYXA 4NQ4A 2BFZA 5AYAA 1WUPA 3SRXA 1ZKPA 2BG7A 3ZR9A 5K4NA 3T3NA 1KR3A 4O98A 2BG2A 2YNTB 2WHGA 3IEKA 2BFLA 2YNVA 3H3EA 2I7XA 4Z60A 3SD9A 5AJLA
chains in the Genus database with same CATH topology
3SFPA 5EWAA 3T9MA 3X2XA 5EVKA 5HH6A 2GFKA 2Q0IA 1DXKA 3DH8A 3IE0A 5LLDA 2P18A 4NQ5A 2QINA 4EY2A 5EVBA 2FK6A 4HKYA 1XM8A 5ACTA 3I15A 4C1EA 2ZO4A 3JXPA 3PY6A 4FSBA 5ACXA 5LSCA 5EHTA 2GMNA 3BV6A 5ACSA 4PVOA 4AX0B 4D1TA 1YCHA 3LVZA 4J5FA 4JO0A 2WYMC 1KO3A 2YNWA 2BC2A 2YNUA 2NXAA 1VGNA 1ZTCA 4P62A 2ZWRA 2QDSA 2NZEA 4TYTA 4D1UA 3BK1A 4Z6XA 4C1GA 3KL7A 2BG8B 1DD6A 4TZFA 2OHIA 1SMLA 4EYBA 3Q6VA 3ZQ4A 4DIKA 5K4KA 1VMEA 2WYLA 5HIPA 2HB9A 5FQCA 5ACPA 3IEMA 5B1UA 5HH5A 5AEBA 3SBLA 4FR7A 1WW1A 4AWZA 2NZFA 2FU9A 3AF5A 3SPUA 2BIBA 2BGAA 2P4ZA 4LE6A 4C1CA 2QDTA 3TP9A 3QH8A 3ZNBA 4GYUA 5ACRA 5LCAA 4UWOB 5K4MA 4YSKA 4XWTA 2QEDA 1JJTA 5FQBA 3X2YA 3AJ3A 3X2ZA 3BC2A 4EXSA 2M5CA 4TZBA 5A5ZA 3IOFA 4U4LA 5LS3A 5AHOA 5A0VA 4EFZA 3I11A 2Q42A 2FU7A 4F6HA 3BK2A 3RPCA 2XR1A 4J5HA 1K07A 3DHBA 4RAWA 4UA4A 2DKFA 4UAMA 1MQOA 5EVDA 4B87A 2R2DA 2FHXA 1WRAA 5FQAA 5HIOA 4UWRB 1BVTA 4TZEA 4PVTA 4Z5YA 5HIQA 2P97A 4NQ2A 2Y87A 1YCGA 4DILA 2GKLA 4EYFA 3IE2A 5ACWA 1QH5A 4ZO2A 3A4YA 2BFZB 4BP0A 3DHAA 1XTOA 5K0WA 5LE1A 2WRSA 4WD6A 3S0ZA 5LCHA 1JT1A 5HISA 2AIOA 2YNVB 3F9OA 5KIKA 2Y8AA 4ZO3A 1L9YA 2AZ4A 2XF4A 2E7YA 2WYMA 3VPEA 3MD7A 4GYQA 4FEKA 1QH3A 4D02A 5EV8A 1BMCA 2YNTA 1BC2A 4RAMA 2H6AA 5AHRA 3KNRA 1WUOA 3FCZA 1HLKA 1YCFA 2I7VA 4UBQA 3I13A 3PG4A 3I0VA 4EXYA 2GCUA 5AXOA 2NYPA 3IE1A 2BG6A 2BFKA 2A7MA 4XWWA 4CHLA 4AWYB 5LCFA 1VJNA 4HL2A 1E5DA 3DHCA 2Q0JA 2FU8A 3P2UA 3X30A 2VW8A 3IOGA 3I14A 3IDZA 5IQKA 4TYFA 1A7TA 2Q9UA 3G1PA 1JJEA 5B3RA 4RL0A 2OHJA 5HH4A 2OHHA 4AX1B 5A87A 2ZZIA 2QJSA 5AXRA 5ACQA 3T3OA 1DDKA 2BG8A 2M5DA 2FU6A 2FM6A 4XUKA 1X8HA 2ZNBA 2GFJA 4KEPA 5EW0A 4F6ZA 5A0TA 2Y8BA 5KILA 2BMIA 2YCBA 1KO2A 3L6NA 1ZNBA 5EH9A 2I7TA 2DOOA 2BTNA 4RBSA 4RM5A 2CBNA 4EYLA 3ADRA 3PY5A 3ZWFA 4ZNBA 1X8GA 4Z67A 4D1VA 4UWPB 5DPXA 4C1HA 5B15A 1X8IA 4BZ3A 5LMCA 3WXCA 4YSLA 3AF6A 2FHXB 4D1WA 2YZ3A 5ACVA 3IELA 4Z5ZA 5ACUA 5EV6A 4YSBA 2BR6A 4C1FA 4V0HA 1P9EA 4RL2A 3RKKA 2P1EA 4AD9A 4Z7RA 4C09A 1Y44A 4NQ6A 4TZ9A 4H0DA 4UWSB 3FAIA 3R2UA 1M2XA 3KNSA 4HL1A 3VQZA 4C1DA 4GCWA 4KEQA 3RKJA 3SW3A 1A8TA 4ZEJA 3ESHA 5LM6A 2UYXA 4NQ4A 2BFZA 5AYAA 1WUPA 3SRXA 1ZKPA 2BG7A 3ZR9A 5K4NA 3T3NA 1KR3A 4O98A 2BG2A 2YNTB 2WHGA 3IEKA 2BFLA 2YNVA 3H3EA 2I7XA 4Z60A 3SD9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SFP A;  5EWA A;  3T9M A;  3X2X A;  5EVK A;  5HH6 A;  2GFK A;  2Q0I A;  1DXK A;  3DH8 A;  3IE0 A;  5LLD A;  2P18 A;  4NQ5 A;  2QIN A;  4EY2 A;  5EVB A;  2FK6 A;  4HKY A;  1XM8 A;  5ACT A;  3I15 A;  4C1E A;  2ZO4 A;  3JXP A;  3PY6 A;  4FSB A;  5ACX A;  5LSC A;  5EHT A;  2GMN A;  3BV6 A;  5ACS A;  4PVO A;  4AX0 B;  4D1T A;  1YCH A;  3LVZ A;  4J5F A;  4JO0 A;  2WYM C;  1KO3 A;  2YNW A;  2BC2 A;  2YNU A;  2NXA A;  1VGN A;  1ZTC A;  4P62 A;  2ZWR A;  2QDS A;  2NZE A;  4TYT A;  4D1U A;  3BK1 A;  4Z6X A;  4C1G A;  3KL7 A;  2BG8 B;  1DD6 A;  4TZF A;  2OHI A;  1SML A;  4EYB A;  3Q6V A;  3ZQ4 A;  4DIK A;  5K4K A;  1VME A;  2WYL A;  5HIP A;  2HB9 A;  5FQC A;  5ACP A;  3IEM A;  5B1U A;  5HH5 A;  5AEB A;  3SBL A;  4FR7 A;  1WW1 A;  4AWZ A;  2NZF A;  2FU9 A;  3AF5 A;  3SPU A;  2BIB A;  2BGA A;  2P4Z A;  4LE6 A;  4C1C A;  2QDT A;  3TP9 A;  3QH8 A;  3ZNB A;  4GYU A;  5ACR A;  5LCA A;  4UWO B;  5K4M A;  4YSK A;  4XWT A;  2QED A;  1JJT A;  5FQB A;  3X2Y A;  3AJ3 A;  3X2Z A;  3BC2 A;  4EXS A;  2M5C A;  4TZB A;  5A5Z A;  3IOF A;  4U4L A;  5LS3 A;  5AHO A;  5A0V A;  4EFZ A;  3I11 A;  2Q42 A;  2FU7 A;  4F6H A;  3BK2 A;  3RPC A;  2XR1 A;  4J5H A;  1K07 A;  3DHB A;  4RAW A;  4UA4 A;  2DKF A;  4UAM A;  1MQO A;  5EVD A;  4B87 A;  2R2D A;  2FHX A;  1WRA A;  5FQA A;  5HIO A;  4UWR B;  1BVT A;  4TZE A;  4PVT A;  4Z5Y A;  5HIQ A;  2P97 A;  4NQ2 A;  2Y87 A;  1YCG A;  4DIL A;  2GKL A;  4EYF A;  3IE2 A;  5ACW A;  1QH5 A;  4ZO2 A;  3A4Y A;  2BFZ B;  4BP0 A;  3DHA A;  1XTO A;  5K0W A;  5LE1 A;  2WRS A;  4WD6 A;  3S0Z A;  5LCH A;  1JT1 A;  5HIS A;  2AIO A;  2YNV B;  3F9O A;  5KIK A;  2Y8A A;  4ZO3 A;  1L9Y A;  2AZ4 A;  2XF4 A;  2E7Y A;  2WYM A;  3VPE A;  3MD7 A;  4GYQ A;  4FEK A;  1QH3 A;  4D02 A;  5EV8 A;  1BMC A;  2YNT A;  1BC2 A;  4RAM A;  2H6A A;  5AHR A;  3KNR A;  1WUO A;  3FCZ A;  1HLK A;  1YCF A;  2I7V A;  4UBQ A;  3I13 A;  3PG4 A;  3I0V A;  4EXY A;  2GCU A;  5AXO A;  2NYP A;  3IE1 A;  2BG6 A;  2BFK A;  2A7M A;  4XWW A;  4CHL A;  4AWY B;  5LCF A;  1VJN A;  4HL2 A;  1E5D A;  3DHC A;  2Q0J A;  2FU8 A;  3P2U A;  3X30 A;  2VW8 A;  3IOG A;  3I14 A;  3IDZ A;  5IQK A;  4TYF A;  1A7T A;  2Q9U A;  3G1P A;  1JJE A;  5B3R A;  4RL0 A;  2OHJ A;  5HH4 A;  2OHH A;  4AX1 B;  5A87 A;  2ZZI A;  2QJS A;  5AXR A;  5ACQ A;  3T3O A;  1DDK A;  2BG8 A;  2M5D A;  2FU6 A;  2FM6 A;  4XUK A;  1X8H A;  2ZNB A;  2GFJ A;  4KEP A;  5EW0 A;  4F6Z A;  5A0T A;  2Y8B A;  5KIL A;  2BMI A;  2YCB A;  1KO2 A;  3L6N A;  1ZNB A;  5EH9 A;  2I7T A;  2DOO A;  2BTN A;  4RBS A;  4RM5 A;  2CBN A;  4EYL A;  3ADR A;  3PY5 A;  3ZWF A;  4ZNB A;  1X8G A;  4Z67 A;  4D1V A;  4UWP B;  5DPX A;  4C1H A;  5B15 A;  1X8I A;  4BZ3 A;  5LMC A;  3WXC A;  4YSL A;  3AF6 A;  2FHX B;  4D1W A;  2YZ3 A;  5ACV A;  3IEL A;  4Z5Z A;  5ACU A;  5EV6 A;  4YSB A;  2BR6 A;  4C1F A;  4V0H A;  1P9E A;  4RL2 A;  3RKK A;  2P1E A;  4AD9 A;  4Z7R A;  4C09 A;  1Y44 A;  4NQ6 A;  4TZ9 A;  4H0D A;  4UWS B;  3FAI A;  3R2U A;  1M2X A;  3KNS A;  4HL1 A;  3VQZ A;  4C1D A;  4GCW A;  4KEQ A;  3RKJ A;  3SW3 A;  1A8T A;  4ZEJ A;  3ESH A;  5LM6 A;  2UYX A;  4NQ4 A;  2BFZ A;  5AYA A;  1WUP A;  3SRX A;  1ZKP A;  2BG7 A;  3ZR9 A;  5K4N A;  3T3N A;  1KR3 A;  4O98 A;  2BG2 A;  2YNT B;  2WHG A;  3IEK A;  2BFL A;  2YNV A;  3H3E A;  2I7X A;  4Z60 A;  3SD9 A; 
#chains in the Genus database with same CATH topology
 3SFP A;  5EWA A;  3T9M A;  3X2X A;  5EVK A;  5HH6 A;  2GFK A;  2Q0I A;  1DXK A;  3DH8 A;  3IE0 A;  5LLD A;  2P18 A;  4NQ5 A;  2QIN A;  4EY2 A;  5EVB A;  2FK6 A;  4HKY A;  1XM8 A;  5ACT A;  3I15 A;  4C1E A;  2ZO4 A;  3JXP A;  3PY6 A;  2YHE A;  4FSB A;  5ACX A;  5LSC A;  5EHT A;  2GMN A;  3BV6 A;  5ACS A;  4PVO A;  4AX0 B;  4D1T A;  1YCH A;  3LVZ A;  4J5F A;  4JO0 A;  2WYM C;  1KO3 A;  2YNW A;  2BC2 A;  2YNU A;  2NXA A;  1VGN A;  1ZTC A;  4P62 A;  4PDX A;  2ZWR A;  2QDS A;  2NZE A;  4TYT A;  4D1U A;  3BK1 A;  4Z6X A;  4C1G A;  3KL7 A;  2BG8 B;  1DD6 A;  4TZF A;  2OHI A;  1SML A;  4EYB A;  3Q6V A;  3ZQ4 A;  4DIK A;  5K4K A;  1VME A;  2WYL A;  5HIP A;  2HB9 A;  5FQC A;  5ACP A;  3IEM A;  5B1U A;  5HH5 A;  5AEB A;  3SBL A;  4FR7 A;  1WW1 A;  4AWZ A;  2NZF A;  2FU9 A;  3AF5 A;  3SPU A;  2BIB A;  2BGA A;  2P4Z A;  4LE6 A;  4C1C A;  2QDT A;  3TP9 A;  3QH8 A;  3ZNB A;  4GYU A;  5ACR A;  4AV7 A;  5LCA A;  4UWO B;  5K4M A;  4YSK A;  4XWT A;  2QED A;  1JJT A;  5FQB A;  3X2Y A;  3AJ3 A;  3X2Z A;  3BC2 A;  4EXS A;  2M5C A;  4TZB A;  5A5Z A;  3IOF A;  4U4L A;  5LS3 A;  5AHO A;  5A0V A;  4EFZ A;  3I11 A;  2Q42 A;  2FU7 A;  4F6H A;  3BK2 A;  3RPC A;  2XR1 A;  4J5H A;  1K07 A;  3DHB A;  4RAW A;  4UA4 A;  2DKF A;  4UAM A;  1MQO A;  5EVD A;  4B87 A;  2CG2 A;  2R2D A;  2FHX A;  1WRA A;  5FQA A;  5HIO A;  4UWR B;  1BVT A;  4TZE A;  4PVT A;  4Z5Y A;  5HIQ A;  2P97 A;  4NQ2 A;  4NUR A;  2Y87 A;  1YCG A;  4DIL A;  2GKL A;  4EYF A;  3IE2 A;  5ACW A;  1QH5 A;  4ZO2 A;  4AXH A;  2CFZ A;  3A4Y A;  2BFZ B;  4BP0 A;  3DHA A;  1XTO A;  5K0W A;  5LE1 A;  2WRS A;  4WD6 A;  3S0Z A;  5LCH A;  1JT1 A;  5HIS A;  2AIO A;  2YNV B;  3F9O A;  5KIK A;  2Y8A A;  4ZO3 A;  1L9Y A;  2AZ4 A;  2XF4 A;  2E7Y A;  2WYM A;  3VPE A;  3MD7 A;  4GYQ A;  2CFU A;  4FEK A;  1QH3 A;  4D02 A;  5EV8 A;  1BMC A;  2YNT A;  1BC2 A;  4RAM A;  2H6A A;  5AHR A;  3KNR A;  1WUO A;  3FCZ A;  1HLK A;  1YCF A;  2I7V A;  4UBQ A;  3I13 A;  3PG4 A;  3I0V A;  4EXY A;  2GCU A;  5AXO A;  2NYP A;  3IE1 A;  2BG6 A;  2BFK A;  2A7M A;  4XWW A;  5AIJ A;  4CHL A;  4AWY B;  5LCF A;  1VJN A;  4HL2 A;  1E5D A;  3DHC A;  2Q0J A;  2FU8 A;  3P2U A;  3X30 A;  2VW8 A;  3IOG A;  3I14 A;  3IDZ A;  5IQK A;  4TYF A;  1A7T A;  2Q9U A;  3G1P A;  1JJE A;  5B3R A;  4RL0 A;  2OHJ A;  5HH4 A;  2OHH A;  4AX1 B;  5A87 A;  2ZZI A;  2QJS A;  5AXR A;  5ACQ A;  3T3O A;  1DDK A;  2BG8 A;  2M5D A;  2FU6 A;  2FM6 A;  4XUK A;  1X8H A;  2ZNB A;  2GFJ A;  4KEP A;  5EW0 A;  4F6Z A;  5A0T A;  2Y8B A;  5KIL A;  2BMI A;  2YCB A;  1KO2 A;  3L6N A;  1ZNB A;  5EH9 A;  2I7T A;  2DOO A;  2BTN A;  4RBS A;  4RM5 A;  2CBN A;  4EYL A;  3ADR A;  3PY5 A;  3ZWF A;  4ZNB A;  1X8G A;  4Z67 A;  4D1V A;  4UWP B;  5DPX A;  4C1H A;  5B15 A;  1X8I A;  4BZ3 A;  5LMC A;  3WXC A;  4YSL A;  3AF6 A;  2FHX B;  4D1W A;  2YZ3 A;  5ACV A;  5A23 A;  3IEL A;  2CG3 A;  4Z5Z A;  5ACU A;  5EV6 A;  4YSB A;  2BR6 A;  4C1F A;  4V0H A;  1P9E A;  4RL2 A;  3RKK A;  2P1E A;  4AD9 A;  4Z7R A;  4C09 A;  1Y44 A;  4NQ6 A;  4TZ9 A;  4H0D A;  4UWS B;  3FAI A;  3R2U A;  1M2X A;  3KNS A;  4HL1 A;  3VQZ A;  4C1D A;  4GCW A;  4KEQ A;  3RKJ A;  3SW3 A;  1A8T A;  4ZEJ A;  3ESH A;  5LM6 A;  2UYX A;  4NQ4 A;  2BFZ A;  5AYA A;  1WUP A;  3SRX A;  1ZKP A;  2BG7 A;  3ZR9 A;  5K4N A;  3T3N A;  1KR3 A;  4O98 A;  2BG2 A;  2YNT B;  2WHG A;  3IEK A;  2BFL A;  2YNV A;  3H3E A;  2I7X A;  4Z60 A;  3SD9 A;  5AJL A; 
#chains in the Genus database with same CATH homology
 3SFP A;  5EWA A;  3T9M A;  3X2X A;  5EVK A;  5HH6 A;  2GFK A;  2Q0I A;  1DXK A;  3DH8 A;  3IE0 A;  5LLD A;  2P18 A;  4NQ5 A;  2QIN A;  4EY2 A;  5EVB A;  2FK6 A;  4HKY A;  1XM8 A;  5ACT A;  3I15 A;  4C1E A;  2ZO4 A;  3JXP A;  3PY6 A;  4FSB A;  5ACX A;  5LSC A;  5EHT A;  2GMN A;  3BV6 A;  5ACS A;  4PVO A;  4AX0 B;  4D1T A;  1YCH A;  3LVZ A;  4J5F A;  4JO0 A;  2WYM C;  1KO3 A;  2YNW A;  2BC2 A;  2YNU A;  2NXA A;  1VGN A;  1ZTC A;  4P62 A;  2ZWR A;  2QDS A;  2NZE A;  4TYT A;  4D1U A;  3BK1 A;  4Z6X A;  4C1G A;  3KL7 A;  2BG8 B;  1DD6 A;  4TZF A;  2OHI A;  1SML A;  4EYB A;  3Q6V A;  3ZQ4 A;  4DIK A;  5K4K A;  1VME A;  2WYL A;  5HIP A;  2HB9 A;  5FQC A;  5ACP A;  3IEM A;  5B1U A;  5HH5 A;  5AEB A;  3SBL A;  4FR7 A;  1WW1 A;  4AWZ A;  2NZF A;  2FU9 A;  3AF5 A;  3SPU A;  2BIB A;  2BGA A;  2P4Z A;  4LE6 A;  4C1C A;  2QDT A;  3TP9 A;  3QH8 A;  3ZNB A;  4GYU A;  5ACR A;  5LCA A;  4UWO B;  5K4M A;  4YSK A;  4XWT A;  2QED A;  1JJT A;  5FQB A;  3X2Y A;  3AJ3 A;  3X2Z A;  3BC2 A;  4EXS A;  2M5C A;  4TZB A;  5A5Z A;  3IOF A;  4U4L A;  5LS3 A;  5AHO A;  5A0V A;  4EFZ A;  3I11 A;  2Q42 A;  2FU7 A;  4F6H A;  3BK2 A;  3RPC A;  2XR1 A;  4J5H A;  1K07 A;  3DHB A;  4RAW A;  4UA4 A;  2DKF A;  4UAM A;  1MQO A;  5EVD A;  4B87 A;  2R2D A;  2FHX A;  1WRA A;  5FQA A;  5HIO A;  4UWR B;  1BVT A;  4TZE A;  4PVT A;  4Z5Y A;  5HIQ A;  2P97 A;  4NQ2 A;  2Y87 A;  1YCG A;  4DIL A;  2GKL A;  4EYF A;  3IE2 A;  5ACW A;  1QH5 A;  4ZO2 A;  3A4Y A;  2BFZ B;  4BP0 A;  3DHA A;  1XTO A;  5K0W A;  5LE1 A;  2WRS A;  4WD6 A;  3S0Z A;  5LCH A;  1JT1 A;  5HIS A;  2AIO A;  2YNV B;  3F9O A;  5KIK A;  2Y8A A;  4ZO3 A;  1L9Y A;  2AZ4 A;  2XF4 A;  2E7Y A;  2WYM A;  3VPE A;  3MD7 A;  4GYQ A;  4FEK A;  1QH3 A;  4D02 A;  5EV8 A;  1BMC A;  2YNT A;  1BC2 A;  4RAM A;  2H6A A;  5AHR A;  3KNR A;  1WUO A;  3FCZ A;  1HLK A;  1YCF A;  2I7V A;  4UBQ A;  3I13 A;  3PG4 A;  3I0V A;  4EXY A;  2GCU A;  5AXO A;  2NYP A;  3IE1 A;  2BG6 A;  2BFK A;  2A7M A;  4XWW A;  4CHL A;  4AWY B;  5LCF A;  1VJN A;  4HL2 A;  1E5D A;  3DHC A;  2Q0J A;  2FU8 A;  3P2U A;  3X30 A;  2VW8 A;  3IOG A;  3I14 A;  3IDZ A;  5IQK A;  4TYF A;  1A7T A;  2Q9U A;  3G1P A;  1JJE A;  5B3R A;  4RL0 A;  2OHJ A;  5HH4 A;  2OHH A;  4AX1 B;  5A87 A;  2ZZI A;  2QJS A;  5AXR A;  5ACQ A;  3T3O A;  1DDK A;  2BG8 A;  2M5D A;  2FU6 A;  2FM6 A;  4XUK A;  1X8H A;  2ZNB A;  2GFJ A;  4KEP A;  5EW0 A;  4F6Z A;  5A0T A;  2Y8B A;  5KIL A;  2BMI A;  2YCB A;  1KO2 A;  3L6N A;  1ZNB A;  5EH9 A;  2I7T A;  2DOO A;  2BTN A;  4RBS A;  4RM5 A;  2CBN A;  4EYL A;  3ADR A;  3PY5 A;  3ZWF A;  4ZNB A;  1X8G A;  4Z67 A;  4D1V A;  4UWP B;  5DPX A;  4C1H A;  5B15 A;  1X8I A;  4BZ3 A;  5LMC A;  3WXC A;  4YSL A;  3AF6 A;  2FHX B;  4D1W A;  2YZ3 A;  5ACV A;  3IEL A;  4Z5Z A;  5ACU A;  5EV6 A;  4YSB A;  2BR6 A;  4C1F A;  4V0H A;  1P9E A;  4RL2 A;  3RKK A;  2P1E A;  4AD9 A;  4Z7R A;  4C09 A;  1Y44 A;  4NQ6 A;  4TZ9 A;  4H0D A;  4UWS B;  3FAI A;  3R2U A;  1M2X A;  3KNS A;  4HL1 A;  3VQZ A;  4C1D A;  4GCW A;  4KEQ A;  3RKJ A;  3SW3 A;  1A8T A;  4ZEJ A;  3ESH A;  5LM6 A;  2UYX A;  4NQ4 A;  2BFZ A;  5AYA A;  1WUP A;  3SRX A;  1ZKP A;  2BG7 A;  3ZR9 A;  5K4N A;  3T3N A;  1KR3 A;  4O98 A;  2BG2 A;  2YNT B;  2WHG A;  3IEK A;  2BFL A;  2YNV A;  3H3E A;  2I7X A;  4Z60 A;  3SD9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...