1ZTCA

Crystal structure of a putative metallo-beta-lactamase (tm0894) from thermotoga maritima at 2.10 a resolution
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
209
structure length
209
Chain Sequence
HHMELKILVTGGNVFVPGRLNAHFSTVVYLEHKDRRIIIDPGNLSSMDELEEKFSELGISPDDITDVLFTHVHLDHIFNSVLFENATFYVHEVYKTKNYLSFGTIVGRIYSKVISSWKNVVLLKGEESLFDEKVKVFHTPWHAREHLSFLLDTENAGRVLITGDITPNRLSYYDIIKGYGSVQVKNFLDRVGRIDLLVFPHDAPLKPEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of hypothetical protein (tm0894) from Thermotoga maritima at 2.10 A resolution
rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
molecule keywords hypothetical protein TM0894
total genus 61
structure length 209
sequence length 209
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 1ztcA00
2CBNA 4LE6A 2OHJA 5HH5A 2Y87A 4C1CA 4C1GA 2R2DA 2P4ZA 2QINA 3KL7A 5EVKA 4C1DA 2GMNA 2A7MA 1KO2A 3ZWFA 4C1HA 3IEMA 5A0VA 4KEPA 1ZTCA 2H6AA 3IE1A 5EH9A 5ACQA 4ZO2A 2Q42A 5HISA 5LMCA 4EXYA 3TP9A 4BZ3A 4B87A 1BMCA 4D1VA 4FEKA 1JJEA 2AZ4A 2M5DA 3T9MA 2YNWA 5ACUA 4Z5YA 5LS3A 5EWAA 2Q0IA 4C09A 2NXAA 2I7TA 3I13A 2YNVB 2BR6A 2ZO4A 1X8GA 3SFPA 3QH8A 2BFZB 4FR7A 3AJ3A 3IE0A 3L6NA 1KO3A 1JT1A 1XM8A 2DOOA 1BC2A 2I7VA 2BFZA 5LCHA 1WUPA 5EV8A 3JXPA 5ACWA 4UBQA 4UWRB 3VQZA 4D1TA 3SRXA 5B15A 1M2XA 3I0VA 2BG8B 3X2ZA 3SD9A 5K4KA 2ZWRA 5B1UA 5K4MA 5LSCA 1L9YA 2XR1A 5LE1A 4UWPB 5B3RA 3MD7A 2FU8A 2QDTA 4ZNBA 4J5HA 2UYXA 2YNUA 4F6HA 1DD6A 2NZFA 3KNRA 2FHXA 4C1FA 5ACRA 1X8IA 5HH6A 4NQ4A 2BFKA 3Q6VA 3RKJA 3SBLA 3PY6A 4EYFA 2GFKA 5LCFA 4GCWA 3DHBA 2GKLA 1A7TA 4NQ6A 3DHCA 4AWYB 2Q0JA 4XWTA 2WYMA 3RKKA 2AIOA 4NQ2A 4TZEA 5AHOA 4O98A 2I7XA 5IQKA 2QEDA 1VJNA 1QH3A 3IOFA 3I11A 2XF4A 4Z7RA 2QDSA 5EW0A 2FU6A 5AYAA 1P9EA 2Y8BA 5EVBA 4AD9A 5K4NA 2WYLA 1HLKA 3PY5A 1E5DA 3SW3A 4Z60A 3WXCA 1WUOA 4D1WA 4DILA 2YCBA 2M5CA 3LVZA 2YZ3A 1K07A 2GFJA 5HIOA 4J5FA 1VMEA 5EVDA 3ZQ4A 3IEKA 2BGAA 3I14A 1DDKA 2Q9UA 1WW1A 2P1EA 4RBSA 4AWZA 4RAMA 5DPXA 3H3EA 2BMIA 4RL0A 3X2YA 1X8HA 2FK6A 1KR3A 4Z5ZA 4KEQA 2NZEA 1MQOA 1SMLA 3X30A 4EY2A 4V0HA 2FU9A 4WD6A 2ZNBA 3A4YA 1BVTA 1Y44A 5A0TA 3ESHA 3P2UA 4U4LA 4ZO3A 3IELA 3BK2A 5FQBA 4TYFA 4YSLA 2YNTA 3RPCA 2WRSA 1WRAA 2OHIA 2BG8A 1ZNBA 3FCZA 5LM6A 5EHTA 5AXOA 3FAIA 4FSBA 3ZR9A 2Y8AA 5ACXA 2YNVA 2YNTB 4YSKA 4F6ZA 4CHLA 4TZFA 2ZZIA 5ACSA 3T3NA 1XTOA 5FQAA 5HIPA 4EXSA 4AX0B 5AHRA 1YCHA 5HH4A 5KILA 1DXKA 2WYMC 4EYLA 3IE2A 2P97A 4GYQA 4DIKA 2E7YA 5A87A 2BG7A 4ZEJA 5AEBA 2BIBA 1ZKPA 4HL2A 4TZ9A 3X2XA 1VGNA 3DHAA 3BV6A 4D02A 4AX1B 4UA4A 1YCFA 4BP0A 1QH5A 2DKFA 3IOGA 5KIKA 4C1EA 3VPEA 5K0WA 3AF5A 3F9OA 2FHXB 3DH8A 4UAMA 2WHGA 4EFZA 2GCUA 5ACVA 2HB9A 4PVOA 3T3OA 3IDZA 3I15A 4RL2A 5AXRA 2BG6A 4D1UA 5LCAA 2VW8A 3AF6A 2BFLA 2FU7A 3ADRA 2FM6A 5A5ZA 5ACTA 1JJTA 4HL1A 3R2UA 5EV6A 5FQCA 5LLDA 4HKYA 4P62A 3ZNBA 4NQ5A 2P18A 4EYBA 4GYUA 2QJSA 4XWWA 4H0DA 3G1PA 1YCGA 3BC2A 2NYPA 4UWSB 1A8TA 2BTNA 4Z6XA 3PG4A 4RAWA 4Z67A 4UWOB 4PVTA 3KNSA 5HIQA 5ACPA 2BG2A 3S0ZA 4JO0A 3BK1A 4XUKA 3SPUA 4RM5A 2BC2A 2OHHA 4TYTA 4YSBA 4TZBA
chains in the Genus database with same CATH superfamily
2CBNA 4LE6A 2OHJA 5HH5A 2Y87A 4C1CA 4C1GA 2R2DA 2P4ZA 2QINA 3KL7A 5EVKA 4C1DA 2GMNA 2A7MA 1KO2A 3ZWFA 4C1HA 3IEMA 5A0VA 4KEPA 1ZTCA 2H6AA 3IE1A 5EH9A 5ACQA 4ZO2A 2Q42A 5HISA 5LMCA 4EXYA 3TP9A 4BZ3A 4B87A 1BMCA 4D1VA 4FEKA 1JJEA 2AZ4A 2M5DA 3T9MA 2YNWA 5ACUA 4Z5YA 5LS3A 5EWAA 2Q0IA 4C09A 2NXAA 2I7TA 3I13A 2YNVB 2BR6A 2ZO4A 1X8GA 3SFPA 3QH8A 2BFZB 4FR7A 3AJ3A 3IE0A 3L6NA 1KO3A 1JT1A 1XM8A 2DOOA 1BC2A 4PDXA 2I7VA 5AIJA 2BFZA 5LCHA 1WUPA 5EV8A 3JXPA 5ACWA 4UBQA 4UWRB 3VQZA 4D1TA 3SRXA 5B15A 1M2XA 3I0VA 2BG8B 3X2ZA 3SD9A 5K4KA 2ZWRA 5B1UA 5K4MA 5LSCA 1L9YA 2XR1A 5LE1A 4UWPB 5B3RA 3MD7A 2FU8A 2QDTA 4ZNBA 4J5HA 2UYXA 2YNUA 4F6HA 1DD6A 2NZFA 3KNRA 2FHXA 4C1FA 5ACRA 1X8IA 5HH6A 4NQ4A 2BFKA 3Q6VA 3RKJA 3SBLA 3PY6A 4EYFA 2GFKA 5LCFA 2CG2A 4GCWA 3DHBA 2GKLA 1A7TA 4NQ6A 4AXHA 3DHCA 4AWYB 2Q0JA 4XWTA 2WYMA 3RKKA 2AIOA 4NQ2A 4TZEA 5AHOA 4O98A 2I7XA 5IQKA 2QEDA 1VJNA 1QH3A 3IOFA 3I11A 2XF4A 4Z7RA 2QDSA 5EW0A 2FU6A 5AYAA 1P9EA 2Y8BA 5EVBA 4AD9A 5K4NA 2WYLA 1HLKA 3PY5A 1E5DA 3SW3A 4Z60A 3WXCA 1WUOA 4D1WA 4DILA 2YCBA 5A23A 2M5CA 3LVZA 2YZ3A 1K07A 2CFZA 2GFJA 5HIOA 4J5FA 1VMEA 5EVDA 2CFUA 3ZQ4A 3IEKA 4NURA 2BGAA 3I14A 1DDKA 2Q9UA 1WW1A 2P1EA 4RBSA 4AWZA 4RAMA 5DPXA 3H3EA 2BMIA 4RL0A 3X2YA 1X8HA 2FK6A 1KR3A 4Z5ZA 4KEQA 2NZEA 1MQOA 1SMLA 3X30A 4EY2A 4V0HA 2FU9A 4WD6A 2ZNBA 3A4YA 1BVTA 1Y44A 5A0TA 3ESHA 3P2UA 4U4LA 4ZO3A 3IELA 3BK2A 5FQBA 4TYFA 4YSLA 2YNTA 3RPCA 2WRSA 1WRAA 2OHIA 2BG8A 1ZNBA 3FCZA 5LM6A 5EHTA 5AXOA 2CG3A 3FAIA 4FSBA 3ZR9A 2Y8AA 5ACXA 2YNVA 2YNTB 4YSKA 4F6ZA 4CHLA 4TZFA 2ZZIA 5ACSA 3T3NA 1XTOA 5FQAA 5HIPA 4EXSA 4AX0B 5AHRA 1YCHA 5HH4A 5KILA 1DXKA 2WYMC 4EYLA 3IE2A 2P97A 4GYQA 4DIKA 2E7YA 5A87A 2BG7A 4ZEJA 5AEBA 2BIBA 1ZKPA 4HL2A 4TZ9A 3X2XA 1VGNA 3DHAA 3BV6A 4D02A 4AX1B 4UA4A 1YCFA 4BP0A 1QH5A 2DKFA 3IOGA 5KIKA 4C1EA 3VPEA 5K0WA 3AF5A 3F9OA 2FHXB 3DH8A 4UAMA 2WHGA 4EFZA 2GCUA 5ACVA 2HB9A 4PVOA 3T3OA 3IDZA 3I15A 4RL2A 5AXRA 2BG6A 4D1UA 5LCAA 2VW8A 3AF6A 2BFLA 2FU7A 3ADRA 2FM6A 5A5ZA 5ACTA 1JJTA 4HL1A 3R2UA 5EV6A 5FQCA 5LLDA 4HKYA 4P62A 2YHEA 3ZNBA 4NQ5A 2P18A 4EYBA 4GYUA 2QJSA 4XWWA 4H0DA 3G1PA 1YCGA 3BC2A 2NYPA 4UWSB 1A8TA 2BTNA 4Z6XA 3PG4A 4RAWA 4Z67A 4UWOB 4PVTA 3KNSA 5HIQA 5ACPA 2BG2A 3S0ZA 4JO0A 3BK1A 4XUKA 3SPUA 4RM5A 2BC2A 2OHHA 4TYTA 4AV7A 5AJLA 4YSBA 4TZBA
chains in the Genus database with same CATH topology
2CBNA 4LE6A 2OHJA 5HH5A 2Y87A 4C1CA 4C1GA 2R2DA 2P4ZA 2QINA 3KL7A 5EVKA 4C1DA 2GMNA 2A7MA 1KO2A 3ZWFA 4C1HA 3IEMA 5A0VA 4KEPA 1ZTCA 2H6AA 3IE1A 5EH9A 5ACQA 4ZO2A 2Q42A 5HISA 5LMCA 4EXYA 3TP9A 4BZ3A 4B87A 1BMCA 4D1VA 4FEKA 1JJEA 2AZ4A 2M5DA 3T9MA 2YNWA 5ACUA 4Z5YA 5LS3A 5EWAA 2Q0IA 4C09A 2NXAA 2I7TA 3I13A 2YNVB 2BR6A 2ZO4A 1X8GA 3SFPA 3QH8A 2BFZB 4FR7A 3AJ3A 3IE0A 3L6NA 1KO3A 1JT1A 1XM8A 2DOOA 1BC2A 2I7VA 2BFZA 5LCHA 1WUPA 5EV8A 3JXPA 5ACWA 4UBQA 4UWRB 3VQZA 4D1TA 3SRXA 5B15A 1M2XA 3I0VA 2BG8B 3X2ZA 3SD9A 5K4KA 2ZWRA 5B1UA 5K4MA 5LSCA 1L9YA 2XR1A 5LE1A 4UWPB 5B3RA 3MD7A 2FU8A 2QDTA 4ZNBA 4J5HA 2UYXA 2YNUA 4F6HA 1DD6A 2NZFA 3KNRA 2FHXA 4C1FA 5ACRA 1X8IA 5HH6A 4NQ4A 2BFKA 3Q6VA 3RKJA 3SBLA 3PY6A 4EYFA 2GFKA 5LCFA 4GCWA 3DHBA 2GKLA 1A7TA 4NQ6A 3DHCA 4AWYB 2Q0JA 4XWTA 2WYMA 3RKKA 2AIOA 4NQ2A 4TZEA 5AHOA 4O98A 2I7XA 5IQKA 2QEDA 1VJNA 1QH3A 3IOFA 3I11A 2XF4A 4Z7RA 2QDSA 5EW0A 2FU6A 5AYAA 1P9EA 2Y8BA 5EVBA 4AD9A 5K4NA 2WYLA 1HLKA 3PY5A 1E5DA 3SW3A 4Z60A 3WXCA 1WUOA 4D1WA 4DILA 2YCBA 2M5CA 3LVZA 2YZ3A 1K07A 2GFJA 5HIOA 4J5FA 1VMEA 5EVDA 3ZQ4A 3IEKA 2BGAA 3I14A 1DDKA 2Q9UA 1WW1A 2P1EA 4RBSA 4AWZA 4RAMA 5DPXA 3H3EA 2BMIA 4RL0A 3X2YA 1X8HA 2FK6A 1KR3A 4Z5ZA 4KEQA 2NZEA 1MQOA 1SMLA 3X30A 4EY2A 4V0HA 2FU9A 4WD6A 2ZNBA 3A4YA 1BVTA 1Y44A 5A0TA 3ESHA 3P2UA 4U4LA 4ZO3A 3IELA 3BK2A 5FQBA 4TYFA 4YSLA 2YNTA 3RPCA 2WRSA 1WRAA 2OHIA 2BG8A 1ZNBA 3FCZA 5LM6A 5EHTA 5AXOA 3FAIA 4FSBA 3ZR9A 2Y8AA 5ACXA 2YNVA 2YNTB 4YSKA 4F6ZA 4CHLA 4TZFA 2ZZIA 5ACSA 3T3NA 1XTOA 5FQAA 5HIPA 4EXSA 4AX0B 5AHRA 1YCHA 5HH4A 5KILA 1DXKA 2WYMC 4EYLA 3IE2A 2P97A 4GYQA 4DIKA 2E7YA 5A87A 2BG7A 4ZEJA 5AEBA 2BIBA 1ZKPA 4HL2A 4TZ9A 3X2XA 1VGNA 3DHAA 3BV6A 4D02A 4AX1B 4UA4A 1YCFA 4BP0A 1QH5A 2DKFA 3IOGA 5KIKA 4C1EA 3VPEA 5K0WA 3AF5A 3F9OA 2FHXB 3DH8A 4UAMA 2WHGA 4EFZA 2GCUA 5ACVA 2HB9A 4PVOA 3T3OA 3IDZA 3I15A 4RL2A 5AXRA 2BG6A 4D1UA 5LCAA 2VW8A 3AF6A 2BFLA 2FU7A 3ADRA 2FM6A 5A5ZA 5ACTA 1JJTA 4HL1A 3R2UA 5EV6A 5FQCA 5LLDA 4HKYA 4P62A 3ZNBA 4NQ5A 2P18A 4EYBA 4GYUA 2QJSA 4XWWA 4H0DA 3G1PA 1YCGA 3BC2A 2NYPA 4UWSB 1A8TA 2BTNA 4Z6XA 3PG4A 4RAWA 4Z67A 4UWOB 4PVTA 3KNSA 5HIQA 5ACPA 2BG2A 3S0ZA 4JO0A 3BK1A 4XUKA 3SPUA 4RM5A 2BC2A 2OHHA 4TYTA 4YSBA 4TZBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CBN A;  4LE6 A;  2OHJ A;  5HH5 A;  2Y87 A;  4C1C A;  4C1G A;  2R2D A;  2P4Z A;  2QIN A;  3KL7 A;  5EVK A;  4C1D A;  2GMN A;  2A7M A;  1KO2 A;  3ZWF A;  4C1H A;  3IEM A;  5A0V A;  4KEP A;  1ZTC A;  2H6A A;  3IE1 A;  5EH9 A;  5ACQ A;  4ZO2 A;  2Q42 A;  5HIS A;  5LMC A;  4EXY A;  3TP9 A;  4BZ3 A;  4B87 A;  1BMC A;  4D1V A;  4FEK A;  1JJE A;  2AZ4 A;  2M5D A;  3T9M A;  2YNW A;  5ACU A;  4Z5Y A;  5LS3 A;  5EWA A;  2Q0I A;  4C09 A;  2NXA A;  2I7T A;  3I13 A;  2YNV B;  2BR6 A;  2ZO4 A;  1X8G A;  3SFP A;  3QH8 A;  2BFZ B;  4FR7 A;  3AJ3 A;  3IE0 A;  3L6N A;  1KO3 A;  1JT1 A;  1XM8 A;  2DOO A;  1BC2 A;  2I7V A;  2BFZ A;  5LCH A;  1WUP A;  5EV8 A;  3JXP A;  5ACW A;  4UBQ A;  4UWR B;  3VQZ A;  4D1T A;  3SRX A;  5B15 A;  1M2X A;  3I0V A;  2BG8 B;  3X2Z A;  3SD9 A;  5K4K A;  2ZWR A;  5B1U A;  5K4M A;  5LSC A;  1L9Y A;  2XR1 A;  5LE1 A;  4UWP B;  5B3R A;  3MD7 A;  2FU8 A;  2QDT A;  4ZNB A;  4J5H A;  2UYX A;  2YNU A;  4F6H A;  1DD6 A;  2NZF A;  3KNR A;  2FHX A;  4C1F A;  5ACR A;  1X8I A;  5HH6 A;  4NQ4 A;  2BFK A;  3Q6V A;  3RKJ A;  3SBL A;  3PY6 A;  4EYF A;  2GFK A;  5LCF A;  4GCW A;  3DHB A;  2GKL A;  1A7T A;  4NQ6 A;  3DHC A;  4AWY B;  2Q0J A;  4XWT A;  2WYM A;  3RKK A;  2AIO A;  4NQ2 A;  4TZE A;  5AHO A;  4O98 A;  2I7X A;  5IQK A;  2QED A;  1VJN A;  1QH3 A;  3IOF A;  3I11 A;  2XF4 A;  4Z7R A;  2QDS A;  5EW0 A;  2FU6 A;  5AYA A;  1P9E A;  2Y8B A;  5EVB A;  4AD9 A;  5K4N A;  2WYL A;  1HLK A;  3PY5 A;  1E5D A;  3SW3 A;  4Z60 A;  3WXC A;  1WUO A;  4D1W A;  4DIL A;  2YCB A;  2M5C A;  3LVZ A;  2YZ3 A;  1K07 A;  2GFJ A;  5HIO A;  4J5F A;  1VME A;  5EVD A;  3ZQ4 A;  3IEK A;  2BGA A;  3I14 A;  1DDK A;  2Q9U A;  1WW1 A;  2P1E A;  4RBS A;  4AWZ A;  4RAM A;  5DPX A;  3H3E A;  2BMI A;  4RL0 A;  3X2Y A;  1X8H A;  2FK6 A;  1KR3 A;  4Z5Z A;  4KEQ A;  2NZE A;  1MQO A;  1SML A;  3X30 A;  4EY2 A;  4V0H A;  2FU9 A;  4WD6 A;  2ZNB A;  3A4Y A;  1BVT A;  1Y44 A;  5A0T A;  3ESH A;  3P2U A;  4U4L A;  4ZO3 A;  3IEL A;  3BK2 A;  5FQB A;  4TYF A;  4YSL A;  2YNT A;  3RPC A;  2WRS A;  1WRA A;  2OHI A;  2BG8 A;  1ZNB A;  3FCZ A;  5LM6 A;  5EHT A;  5AXO A;  3FAI A;  4FSB A;  3ZR9 A;  2Y8A A;  5ACX A;  2YNV A;  2YNT B;  4YSK A;  4F6Z A;  4CHL A;  4TZF A;  2ZZI A;  5ACS A;  3T3N A;  1XTO A;  5FQA A;  5HIP A;  4EXS A;  4AX0 B;  5AHR A;  1YCH A;  5HH4 A;  5KIL A;  1DXK A;  2WYM C;  4EYL A;  3IE2 A;  2P97 A;  4GYQ A;  4DIK A;  2E7Y A;  5A87 A;  2BG7 A;  4ZEJ A;  5AEB A;  2BIB A;  1ZKP A;  4HL2 A;  4TZ9 A;  3X2X A;  1VGN A;  3DHA A;  3BV6 A;  4D02 A;  4AX1 B;  4UA4 A;  1YCF A;  4BP0 A;  1QH5 A;  2DKF A;  3IOG A;  5KIK A;  4C1E A;  3VPE A;  5K0W A;  3AF5 A;  3F9O A;  2FHX B;  3DH8 A;  4UAM A;  2WHG A;  4EFZ A;  2GCU A;  5ACV A;  2HB9 A;  4PVO A;  3T3O A;  3IDZ A;  3I15 A;  4RL2 A;  5AXR A;  2BG6 A;  4D1U A;  5LCA A;  2VW8 A;  3AF6 A;  2BFL A;  2FU7 A;  3ADR A;  2FM6 A;  5A5Z A;  5ACT A;  1JJT A;  4HL1 A;  3R2U A;  5EV6 A;  5FQC A;  5LLD A;  4HKY A;  4P62 A;  3ZNB A;  4NQ5 A;  2P18 A;  4EYB A;  4GYU A;  2QJS A;  4XWW A;  4H0D A;  3G1P A;  1YCG A;  3BC2 A;  2NYP A;  4UWS B;  1A8T A;  2BTN A;  4Z6X A;  3PG4 A;  4RAW A;  4Z67 A;  4UWO B;  4PVT A;  3KNS A;  5HIQ A;  5ACP A;  2BG2 A;  3S0Z A;  4JO0 A;  3BK1 A;  4XUK A;  3SPU A;  4RM5 A;  2BC2 A;  2OHH A;  4TYT A;  4YSB A;  4TZB A; 
#chains in the Genus database with same CATH topology
 2CBN A;  4LE6 A;  2OHJ A;  5HH5 A;  2Y87 A;  4C1C A;  4C1G A;  2R2D A;  2P4Z A;  2QIN A;  3KL7 A;  5EVK A;  4C1D A;  2GMN A;  2A7M A;  1KO2 A;  3ZWF A;  4C1H A;  3IEM A;  5A0V A;  4KEP A;  1ZTC A;  2H6A A;  3IE1 A;  5EH9 A;  5ACQ A;  4ZO2 A;  2Q42 A;  5HIS A;  5LMC A;  4EXY A;  3TP9 A;  4BZ3 A;  4B87 A;  1BMC A;  4D1V A;  4FEK A;  1JJE A;  2AZ4 A;  2M5D A;  3T9M A;  2YNW A;  5ACU A;  4Z5Y A;  5LS3 A;  5EWA A;  2Q0I A;  4C09 A;  2NXA A;  2I7T A;  3I13 A;  2YNV B;  2BR6 A;  2ZO4 A;  1X8G A;  3SFP A;  3QH8 A;  2BFZ B;  4FR7 A;  3AJ3 A;  3IE0 A;  3L6N A;  1KO3 A;  1JT1 A;  1XM8 A;  2DOO A;  1BC2 A;  4PDX A;  2I7V A;  5AIJ A;  2BFZ A;  5LCH A;  1WUP A;  5EV8 A;  3JXP A;  5ACW A;  4UBQ A;  4UWR B;  3VQZ A;  4D1T A;  3SRX A;  5B15 A;  1M2X A;  3I0V A;  2BG8 B;  3X2Z A;  3SD9 A;  5K4K A;  2ZWR A;  5B1U A;  5K4M A;  5LSC A;  1L9Y A;  2XR1 A;  5LE1 A;  4UWP B;  5B3R A;  3MD7 A;  2FU8 A;  2QDT A;  4ZNB A;  4J5H A;  2UYX A;  2YNU A;  4F6H A;  1DD6 A;  2NZF A;  3KNR A;  2FHX A;  4C1F A;  5ACR A;  1X8I A;  5HH6 A;  4NQ4 A;  2BFK A;  3Q6V A;  3RKJ A;  3SBL A;  3PY6 A;  4EYF A;  2GFK A;  5LCF A;  2CG2 A;  4GCW A;  3DHB A;  2GKL A;  1A7T A;  4NQ6 A;  4AXH A;  3DHC A;  4AWY B;  2Q0J A;  4XWT A;  2WYM A;  3RKK A;  2AIO A;  4NQ2 A;  4TZE A;  5AHO A;  4O98 A;  2I7X A;  5IQK A;  2QED A;  1VJN A;  1QH3 A;  3IOF A;  3I11 A;  2XF4 A;  4Z7R A;  2QDS A;  5EW0 A;  2FU6 A;  5AYA A;  1P9E A;  2Y8B A;  5EVB A;  4AD9 A;  5K4N A;  2WYL A;  1HLK A;  3PY5 A;  1E5D A;  3SW3 A;  4Z60 A;  3WXC A;  1WUO A;  4D1W A;  4DIL A;  2YCB A;  5A23 A;  2M5C A;  3LVZ A;  2YZ3 A;  1K07 A;  2CFZ A;  2GFJ A;  5HIO A;  4J5F A;  1VME A;  5EVD A;  2CFU A;  3ZQ4 A;  3IEK A;  4NUR A;  2BGA A;  3I14 A;  1DDK A;  2Q9U A;  1WW1 A;  2P1E A;  4RBS A;  4AWZ A;  4RAM A;  5DPX A;  3H3E A;  2BMI A;  4RL0 A;  3X2Y A;  1X8H A;  2FK6 A;  1KR3 A;  4Z5Z A;  4KEQ A;  2NZE A;  1MQO A;  1SML A;  3X30 A;  4EY2 A;  4V0H A;  2FU9 A;  4WD6 A;  2ZNB A;  3A4Y A;  1BVT A;  1Y44 A;  5A0T A;  3ESH A;  3P2U A;  4U4L A;  4ZO3 A;  3IEL A;  3BK2 A;  5FQB A;  4TYF A;  4YSL A;  2YNT A;  3RPC A;  2WRS A;  1WRA A;  2OHI A;  2BG8 A;  1ZNB A;  3FCZ A;  5LM6 A;  5EHT A;  5AXO A;  2CG3 A;  3FAI A;  4FSB A;  3ZR9 A;  2Y8A A;  5ACX A;  2YNV A;  2YNT B;  4YSK A;  4F6Z A;  4CHL A;  4TZF A;  2ZZI A;  5ACS A;  3T3N A;  1XTO A;  5FQA A;  5HIP A;  4EXS A;  4AX0 B;  5AHR A;  1YCH A;  5HH4 A;  5KIL A;  1DXK A;  2WYM C;  4EYL A;  3IE2 A;  2P97 A;  4GYQ A;  4DIK A;  2E7Y A;  5A87 A;  2BG7 A;  4ZEJ A;  5AEB A;  2BIB A;  1ZKP A;  4HL2 A;  4TZ9 A;  3X2X A;  1VGN A;  3DHA A;  3BV6 A;  4D02 A;  4AX1 B;  4UA4 A;  1YCF A;  4BP0 A;  1QH5 A;  2DKF A;  3IOG A;  5KIK A;  4C1E A;  3VPE A;  5K0W A;  3AF5 A;  3F9O A;  2FHX B;  3DH8 A;  4UAM A;  2WHG A;  4EFZ A;  2GCU A;  5ACV A;  2HB9 A;  4PVO A;  3T3O A;  3IDZ A;  3I15 A;  4RL2 A;  5AXR A;  2BG6 A;  4D1U A;  5LCA A;  2VW8 A;  3AF6 A;  2BFL A;  2FU7 A;  3ADR A;  2FM6 A;  5A5Z A;  5ACT A;  1JJT A;  4HL1 A;  3R2U A;  5EV6 A;  5FQC A;  5LLD A;  4HKY A;  4P62 A;  2YHE A;  3ZNB A;  4NQ5 A;  2P18 A;  4EYB A;  4GYU A;  2QJS A;  4XWW A;  4H0D A;  3G1P A;  1YCG A;  3BC2 A;  2NYP A;  4UWS B;  1A8T A;  2BTN A;  4Z6X A;  3PG4 A;  4RAW A;  4Z67 A;  4UWO B;  4PVT A;  3KNS A;  5HIQ A;  5ACP A;  2BG2 A;  3S0Z A;  4JO0 A;  3BK1 A;  4XUK A;  3SPU A;  4RM5 A;  2BC2 A;  2OHH A;  4TYT A;  4AV7 A;  5AJL A;  4YSB A;  4TZB A; 
#chains in the Genus database with same CATH homology
 2CBN A;  4LE6 A;  2OHJ A;  5HH5 A;  2Y87 A;  4C1C A;  4C1G A;  2R2D A;  2P4Z A;  2QIN A;  3KL7 A;  5EVK A;  4C1D A;  2GMN A;  2A7M A;  1KO2 A;  3ZWF A;  4C1H A;  3IEM A;  5A0V A;  4KEP A;  1ZTC A;  2H6A A;  3IE1 A;  5EH9 A;  5ACQ A;  4ZO2 A;  2Q42 A;  5HIS A;  5LMC A;  4EXY A;  3TP9 A;  4BZ3 A;  4B87 A;  1BMC A;  4D1V A;  4FEK A;  1JJE A;  2AZ4 A;  2M5D A;  3T9M A;  2YNW A;  5ACU A;  4Z5Y A;  5LS3 A;  5EWA A;  2Q0I A;  4C09 A;  2NXA A;  2I7T A;  3I13 A;  2YNV B;  2BR6 A;  2ZO4 A;  1X8G A;  3SFP A;  3QH8 A;  2BFZ B;  4FR7 A;  3AJ3 A;  3IE0 A;  3L6N A;  1KO3 A;  1JT1 A;  1XM8 A;  2DOO A;  1BC2 A;  2I7V A;  2BFZ A;  5LCH A;  1WUP A;  5EV8 A;  3JXP A;  5ACW A;  4UBQ A;  4UWR B;  3VQZ A;  4D1T A;  3SRX A;  5B15 A;  1M2X A;  3I0V A;  2BG8 B;  3X2Z A;  3SD9 A;  5K4K A;  2ZWR A;  5B1U A;  5K4M A;  5LSC A;  1L9Y A;  2XR1 A;  5LE1 A;  4UWP B;  5B3R A;  3MD7 A;  2FU8 A;  2QDT A;  4ZNB A;  4J5H A;  2UYX A;  2YNU A;  4F6H A;  1DD6 A;  2NZF A;  3KNR A;  2FHX A;  4C1F A;  5ACR A;  1X8I A;  5HH6 A;  4NQ4 A;  2BFK A;  3Q6V A;  3RKJ A;  3SBL A;  3PY6 A;  4EYF A;  2GFK A;  5LCF A;  4GCW A;  3DHB A;  2GKL A;  1A7T A;  4NQ6 A;  3DHC A;  4AWY B;  2Q0J A;  4XWT A;  2WYM A;  3RKK A;  2AIO A;  4NQ2 A;  4TZE A;  5AHO A;  4O98 A;  2I7X A;  5IQK A;  2QED A;  1VJN A;  1QH3 A;  3IOF A;  3I11 A;  2XF4 A;  4Z7R A;  2QDS A;  5EW0 A;  2FU6 A;  5AYA A;  1P9E A;  2Y8B A;  5EVB A;  4AD9 A;  5K4N A;  2WYL A;  1HLK A;  3PY5 A;  1E5D A;  3SW3 A;  4Z60 A;  3WXC A;  1WUO A;  4D1W A;  4DIL A;  2YCB A;  2M5C A;  3LVZ A;  2YZ3 A;  1K07 A;  2GFJ A;  5HIO A;  4J5F A;  1VME A;  5EVD A;  3ZQ4 A;  3IEK A;  2BGA A;  3I14 A;  1DDK A;  2Q9U A;  1WW1 A;  2P1E A;  4RBS A;  4AWZ A;  4RAM A;  5DPX A;  3H3E A;  2BMI A;  4RL0 A;  3X2Y A;  1X8H A;  2FK6 A;  1KR3 A;  4Z5Z A;  4KEQ A;  2NZE A;  1MQO A;  1SML A;  3X30 A;  4EY2 A;  4V0H A;  2FU9 A;  4WD6 A;  2ZNB A;  3A4Y A;  1BVT A;  1Y44 A;  5A0T A;  3ESH A;  3P2U A;  4U4L A;  4ZO3 A;  3IEL A;  3BK2 A;  5FQB A;  4TYF A;  4YSL A;  2YNT A;  3RPC A;  2WRS A;  1WRA A;  2OHI A;  2BG8 A;  1ZNB A;  3FCZ A;  5LM6 A;  5EHT A;  5AXO A;  3FAI A;  4FSB A;  3ZR9 A;  2Y8A A;  5ACX A;  2YNV A;  2YNT B;  4YSK A;  4F6Z A;  4CHL A;  4TZF A;  2ZZI A;  5ACS A;  3T3N A;  1XTO A;  5FQA A;  5HIP A;  4EXS A;  4AX0 B;  5AHR A;  1YCH A;  5HH4 A;  5KIL A;  1DXK A;  2WYM C;  4EYL A;  3IE2 A;  2P97 A;  4GYQ A;  4DIK A;  2E7Y A;  5A87 A;  2BG7 A;  4ZEJ A;  5AEB A;  2BIB A;  1ZKP A;  4HL2 A;  4TZ9 A;  3X2X A;  1VGN A;  3DHA A;  3BV6 A;  4D02 A;  4AX1 B;  4UA4 A;  1YCF A;  4BP0 A;  1QH5 A;  2DKF A;  3IOG A;  5KIK A;  4C1E A;  3VPE A;  5K0W A;  3AF5 A;  3F9O A;  2FHX B;  3DH8 A;  4UAM A;  2WHG A;  4EFZ A;  2GCU A;  5ACV A;  2HB9 A;  4PVO A;  3T3O A;  3IDZ A;  3I15 A;  4RL2 A;  5AXR A;  2BG6 A;  4D1U A;  5LCA A;  2VW8 A;  3AF6 A;  2BFL A;  2FU7 A;  3ADR A;  2FM6 A;  5A5Z A;  5ACT A;  1JJT A;  4HL1 A;  3R2U A;  5EV6 A;  5FQC A;  5LLD A;  4HKY A;  4P62 A;  3ZNB A;  4NQ5 A;  2P18 A;  4EYB A;  4GYU A;  2QJS A;  4XWW A;  4H0D A;  3G1P A;  1YCG A;  3BC2 A;  2NYP A;  4UWS B;  1A8T A;  2BTN A;  4Z6X A;  3PG4 A;  4RAW A;  4Z67 A;  4UWO B;  4PVT A;  3KNS A;  5HIQ A;  5ACP A;  2BG2 A;  3S0Z A;  4JO0 A;  3BK1 A;  4XUK A;  3SPU A;  4RM5 A;  2BC2 A;  2OHH A;  4TYT A;  4YSB A;  4TZB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...