1ZTCA

Crystal structure of a putative metallo-beta-lactamase (tm0894) from thermotoga maritima at 2.10 a resolution
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
209
structure length
209
Chain Sequence
b'HHMELKILVTGGNVFVPGRLNAHFSTVVYLEHKDRRIIIDPGNLSSMDELEEKFSELGISPDDITDVLFTHVHLDHIFNSVLFENATFYVHEVYKTKNYLSFGTIVGRIYSKVISSWKNVVLLKGEESLFDEKVKVFHTPWHAREHLSFLLDTENAGRVLITGDITPNRLSYYDIIKGYGSVQVKNFLDRVGRIDLLVFPHDAPLKPEV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein TM0894
molecule tags Hydrolase
source organism Thermotoga maritima
publication title Crystal structure of hypothetical protein (tm0894) from Thermotoga maritima at 2.10 A resolution
rcsb
total genus 61
structure length 209
sequence length 209
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 1ztcA00
3IE1A 2Q0IA 1WRAA 2P4ZA 4YSKA 3X30A 2FHXA 3FAIA 3IE2A 3H3EA 2BFZB 3F9OA 3SW3A 1BC2A 4RL0A 4CHLA 3IDZA 3SD9A 4ZNBA 3ZNBA 4Z60A 4GCWA 5LMCA 5A0VA 1YCHA 3R2UA 4KEQA 4NQ2A 2QDSA 5HH6A 2BR6A 2BGAA 4NQ6A 4C1GA 5IQKA 2R2DA 4AWYB 1JJEA 5HISA 4RAMA 4V0HA 3RPCA 5ACSA 4RM5A 5K4NA 5AYAA 3RKJA 4D02A 2DKFA 2ZNBA 5HIQA 2YCBA 4Z5YA 3L6NA 2A7MA 2AZ4A 2AIOA 5EHTA 3BC2A 3FCZA 1YCFA 4ZEJA 2Y8AA 2FHXB 2ZO4A 4DIKA 4UWPB 1YCGA 2ZZIA 4WD6A 4UWOB 4FSBA 5ACTA 5A5ZA 4C1EA 5ACRA 3JXPA 3KL7A 4AWZA 4D1UA 2I7TA 4EYLA 5LS3A 5ACVA 3I13A 1VMEA 3RKKA 1ZNBA 4LE6A 4TZFA 2YZ3A 3AF5A 2FU6A 1ZTCA 5AEBA 4Z67A 2WYMC 4EXYA 3T3NA 4XWTA 2GMNA 3PY6A 4D1VA 4TYTA 4RL2A 1QH5A 4PVTA 2NXAA 2P18A 5ACXA 3S0ZA 2P1EA 4ZO3A 5FQCA 2E7YA 3I11A 3Q6VA 2WYLA 5LLDA 1A7TA 4YSBA 5LCHA 4HL1A 2GFKA 5LCAA 5ACQA 3VQZA 4Z5ZA 2CBNA 1WUPA 2QJSA 4C09A 3IOFA 2NYPA 5LE1A 1K07A 2YNVB 5K4MA 3SPUA 3T9MA 5EVDA 4UA4A 5HIOA 2P97A 5KIKA 4HL2A 5EH9A 5AHRA 5A87A 4ZO2A 5A0TA 4U4LA 2OHIA 3PG4A 1VGNA 3IE0A 5LCFA 4D1TA 2OHHA 4HKYA 3I14A 4AX1B 3ADRA 4EYBA 1WW1A 2QDTA 5FQAA 5EW0A 5K0WA 5B3RA 2BFKA 5FQBA 4AX0B 1L9YA 2YNVA 5HIPA 3TP9A 3X2XA 1XTOA 2HB9A 2Y87A 5K4KA 1DD6A 2NZEA 1X8GA 5B15A 3SBLA 4C1CA 5LSCA 3ZR9A 1BMCA 4J5FA 4PVOA 4P62A 2BMIA 3AF6A 3DH8A 1BVTA 3ESHA 2Q9UA 3IOGA 3X2ZA 3PY5A 3WXCA 2XR1A 2FU8A 3ZWFA 3X2YA 4C1FA 1KO3A 1KR3A 3QH8A 2BFZA 4TZBA 3KNRA 4BZ3A 3ZQ4A 5EV6A 3IELA 5EV8A 3BK2A 5AXRA 5ACUA 4O98A 2VW8A 2XF4A 3IEKA 2WYMA 1WUOA 2WRSA 5AHOA 4Z7RA 4UBQA 2WHGA 2Y8BA 4XUKA 2NZFA 4GYQA 3A4YA 3I0VA 4B87A 4JO0A 2Q0JA 2GCUA 2QEDA 3BK1A 3MD7A 1A8TA 2QINA 3G1PA 5HH5A 2H6AA 1HLKA 2BG2A 2GFJA 2BIBA 4AD9A 1KO2A 2BFLA 2M5CA 4RBSA 2I7VA 4C1HA 2BG6A 1X8IA 4UWSB 2YNUA 4UAMA 2BG8B 4EYFA 4EFZA 4XWWA 3P2UA 1XM8A 1SMLA 3DHBA 3IEMA 1MQOA 1X8HA 3LVZA 1E5DA 4NQ5A 1JT1A 5B1UA 4DILA 4UWRB 5EVKA 3I15A 3T3OA 2BG7A 2FU9A 1VJNA 4BP0A 2Q42A 4FR7A 4J5HA 4TZ9A 4D1WA 5KILA 3DHAA 4EXSA 5DPXA 2M5DA 4EY2A 3SFPA 5EWAA 3VPEA 4F6HA 4RAWA 2ZWRA 4H0DA 5EVBA 2GKLA 2FU7A 4GYUA 2FK6A 4TYFA 4YSLA 3SRXA 2BC2A 2OHJA 2FM6A 5HH4A 1JJTA 5ACPA 2YNWA 1M2XA 4KEPA 3AJ3A 2UYXA 1QH3A 2BTNA 2I7XA 4NQ4A 4C1DA 5AXOA 1ZKPA 4FEKA 2YNTB 4Z6XA 1DDKA 1DXKA 3DHCA 2DOOA 5ACWA 2YNTA 2BG8A 5LM6A 4TZEA 3BV6A 4F6ZA 3KNSA 1Y44A 1P9EA
chains in the Genus database with same CATH superfamily
3IE1A 2Q0IA 1WRAA 2P4ZA 4YSKA 3X30A 2FHXA 3FAIA 3IE2A 3H3EA 2BFZB 3F9OA 3SW3A 1BC2A 4RL0A 4CHLA 3IDZA 3SD9A 4ZNBA 2CG3A 3ZNBA 2YHEA 4Z60A 4GCWA 5LMCA 5A0VA 4NURA 1YCHA 3R2UA 4KEQA 4NQ2A 2QDSA 5HH6A 2BR6A 2BGAA 4NQ6A 4C1GA 5IQKA 2R2DA 4AWYB 1JJEA 5HISA 4RAMA 4V0HA 3RPCA 5ACSA 4RM5A 5K4NA 5AYAA 3RKJA 5AJLA 4D02A 2DKFA 2ZNBA 5HIQA 2YCBA 4Z5YA 3L6NA 2A7MA 2AZ4A 2AIOA 5EHTA 3BC2A 3FCZA 1YCFA 4ZEJA 2Y8AA 2FHXB 2ZO4A 4DIKA 4UWPB 1YCGA 2ZZIA 4WD6A 4UWOB 4FSBA 5ACTA 5A5ZA 4C1EA 5ACRA 3JXPA 3KL7A 4AWZA 4D1UA 2I7TA 4EYLA 5LS3A 5ACVA 3I13A 1VMEA 3RKKA 1ZNBA 4LE6A 4TZFA 2YZ3A 3AF5A 2FU6A 1ZTCA 5AEBA 4Z67A 2WYMC 4EXYA 3T3NA 4XWTA 2GMNA 3PY6A 4D1VA 4TYTA 4RL2A 1QH5A 4PVTA 2NXAA 2P18A 5ACXA 3S0ZA 2P1EA 4ZO3A 5FQCA 2E7YA 3I11A 3Q6VA 2WYLA 5LLDA 1A7TA 4YSBA 4HL1A 5LCAA 2GFKA 5ACQA 5LCHA 3VQZA 4Z5ZA 2CBNA 1WUPA 2QJSA 4C09A 3IOFA 2NYPA 5LE1A 1K07A 2YNVB 5K4MA 3SPUA 3T9MA 5EVDA 4UA4A 5HIOA 2P97A 5KIKA 4HL2A 5EH9A 5AHRA 5A87A 4ZO2A 2CFZA 4PDXA 5A0TA 4U4LA 2OHIA 3PG4A 1VGNA 3IE0A 5LCFA 4D1TA 2OHHA 4HKYA 3I14A 4AX1B 3ADRA 4EYBA 1WW1A 2QDTA 5FQAA 5EW0A 5K0WA 5B3RA 2BFKA 5FQBA 4AX0B 1L9YA 2YNVA 5HIPA 3TP9A 3X2XA 1XTOA 2HB9A 2Y87A 5K4KA 1DD6A 2NZEA 1X8GA 5B15A 3SBLA 4C1CA 5LSCA 3ZR9A 1BMCA 4J5FA 4PVOA 4P62A 2BMIA 3AF6A 3DH8A 1BVTA 3ESHA 2Q9UA 3IOGA 3X2ZA 3PY5A 3WXCA 2XR1A 2FU8A 3ZWFA 3X2YA 4C1FA 1KO3A 1KR3A 3QH8A 2BFZA 4TZBA 3KNRA 4BZ3A 3ZQ4A 5EV6A 3IELA 5EV8A 3BK2A 5AXRA 5ACUA 4O98A 2VW8A 2XF4A 3IEKA 2WYMA 1WUOA 2WRSA 5AHOA 4Z7RA 4UBQA 2WHGA 2Y8BA 4XUKA 2NZFA 4GYQA 3A4YA 3I0VA 4B87A 4JO0A 2Q0JA 2GCUA 2QEDA 3BK1A 3MD7A 1A8TA 2QINA 3G1PA 5A23A 5HH5A 2H6AA 1HLKA 2BG2A 2GFJA 2BIBA 4AD9A 1KO2A 2BFLA 2M5CA 4RBSA 2I7VA 4C1HA 2BG6A 4AV7A 1X8IA 4UWSB 2YNUA 4UAMA 2BG8B 4EYFA 5AIJA 4EFZA 4XWWA 3P2UA 1XM8A 1SMLA 3DHBA 3IEMA 1MQOA 1X8HA 3LVZA 1E5DA 4NQ5A 1JT1A 5B1UA 4DILA 4UWRB 5EVKA 3I15A 3T3OA 2BG7A 2FU9A 1VJNA 4BP0A 2Q42A 4FR7A 4J5HA 4TZ9A 4D1WA 5KILA 3DHAA 4EXSA 5DPXA 2CG2A 2M5DA 4EY2A 3SFPA 5EWAA 3VPEA 4F6HA 4RAWA 2CFUA 2ZWRA 4H0DA 5EVBA 2GKLA 2FU7A 4GYUA 4AXHA 2FK6A 4TYFA 4YSLA 3SRXA 2BC2A 2OHJA 2FM6A 5HH4A 1JJTA 5ACPA 2YNWA 1M2XA 4KEPA 3AJ3A 2UYXA 1QH3A 2BTNA 2I7XA 4NQ4A 4C1DA 5AXOA 1ZKPA 4FEKA 2YNTB 4Z6XA 1DDKA 1DXKA 3DHCA 2DOOA 5ACWA 2YNTA 2BG8A 5LM6A 4TZEA 3BV6A 4F6ZA 3KNSA 1Y44A 1P9EA
chains in the Genus database with same CATH topology
3IE1A 2Q0IA 1WRAA 2P4ZA 4YSKA 3X30A 2FHXA 3FAIA 3IE2A 3H3EA 2BFZB 3F9OA 3SW3A 1BC2A 4RL0A 4CHLA 3IDZA 3SD9A 4ZNBA 3ZNBA 4Z60A 4GCWA 5LMCA 5A0VA 1YCHA 3R2UA 4KEQA 4NQ2A 2QDSA 5HH6A 2BR6A 2BGAA 4NQ6A 4C1GA 5IQKA 2R2DA 4AWYB 1JJEA 5HISA 4RAMA 4V0HA 3RPCA 5ACSA 4RM5A 5K4NA 5AYAA 3RKJA 4D02A 2DKFA 2ZNBA 5HIQA 2YCBA 4Z5YA 3L6NA 2A7MA 2AZ4A 2AIOA 5EHTA 3BC2A 3FCZA 1YCFA 4ZEJA 2Y8AA 2FHXB 2ZO4A 4DIKA 4UWPB 1YCGA 2ZZIA 4WD6A 4UWOB 4FSBA 5ACTA 5A5ZA 4C1EA 5ACRA 3JXPA 3KL7A 4AWZA 4D1UA 2I7TA 4EYLA 5LS3A 5ACVA 3I13A 1VMEA 3RKKA 1ZNBA 4LE6A 4TZFA 2YZ3A 3AF5A 2FU6A 1ZTCA 5AEBA 4Z67A 2WYMC 4EXYA 3T3NA 4XWTA 2GMNA 3PY6A 4D1VA 4TYTA 4RL2A 1QH5A 4PVTA 2NXAA 2P18A 5ACXA 3S0ZA 2P1EA 4ZO3A 5FQCA 2E7YA 3I11A 3Q6VA 2WYLA 5LLDA 1A7TA 4YSBA 5LCHA 4HL1A 2GFKA 5LCAA 5ACQA 3VQZA 4Z5ZA 2CBNA 1WUPA 2QJSA 4C09A 3IOFA 2NYPA 5LE1A 1K07A 2YNVB 5K4MA 3SPUA 3T9MA 5EVDA 4UA4A 5HIOA 2P97A 5KIKA 4HL2A 5EH9A 5AHRA 5A87A 4ZO2A 5A0TA 4U4LA 2OHIA 3PG4A 1VGNA 3IE0A 5LCFA 4D1TA 2OHHA 4HKYA 3I14A 4AX1B 3ADRA 4EYBA 1WW1A 2QDTA 5FQAA 5EW0A 5K0WA 5B3RA 2BFKA 5FQBA 4AX0B 1L9YA 2YNVA 5HIPA 3TP9A 3X2XA 1XTOA 2HB9A 2Y87A 5K4KA 1DD6A 2NZEA 1X8GA 5B15A 3SBLA 4C1CA 5LSCA 3ZR9A 1BMCA 4J5FA 4PVOA 4P62A 2BMIA 3AF6A 3DH8A 1BVTA 3ESHA 2Q9UA 3IOGA 3X2ZA 3PY5A 3WXCA 2XR1A 2FU8A 3ZWFA 3X2YA 4C1FA 1KO3A 1KR3A 3QH8A 2BFZA 4TZBA 3KNRA 4BZ3A 3ZQ4A 5EV6A 3IELA 5EV8A 3BK2A 5AXRA 5ACUA 4O98A 2VW8A 2XF4A 3IEKA 2WYMA 1WUOA 2WRSA 5AHOA 4Z7RA 4UBQA 2WHGA 2Y8BA 4XUKA 2NZFA 4GYQA 3A4YA 3I0VA 4B87A 4JO0A 2Q0JA 2GCUA 2QEDA 3BK1A 3MD7A 1A8TA 2QINA 3G1PA 5HH5A 2H6AA 1HLKA 2BG2A 2GFJA 2BIBA 4AD9A 1KO2A 2BFLA 2M5CA 4RBSA 2I7VA 4C1HA 2BG6A 1X8IA 4UWSB 2YNUA 4UAMA 2BG8B 4EYFA 4EFZA 4XWWA 3P2UA 1XM8A 1SMLA 3DHBA 3IEMA 1MQOA 1X8HA 3LVZA 1E5DA 4NQ5A 1JT1A 5B1UA 4DILA 4UWRB 5EVKA 3I15A 3T3OA 2BG7A 2FU9A 1VJNA 4BP0A 2Q42A 4FR7A 4J5HA 4TZ9A 4D1WA 5KILA 3DHAA 4EXSA 5DPXA 2M5DA 4EY2A 3SFPA 5EWAA 3VPEA 4F6HA 4RAWA 2ZWRA 4H0DA 5EVBA 2GKLA 2FU7A 4GYUA 2FK6A 4TYFA 4YSLA 3SRXA 2BC2A 2OHJA 2FM6A 5HH4A 1JJTA 5ACPA 2YNWA 1M2XA 4KEPA 3AJ3A 2UYXA 1QH3A 2BTNA 2I7XA 4NQ4A 4C1DA 5AXOA 1ZKPA 4FEKA 2YNTB 4Z6XA 1DDKA 1DXKA 3DHCA 2DOOA 5ACWA 2YNTA 2BG8A 5LM6A 4TZEA 3BV6A 4F6ZA 3KNSA 1Y44A 1P9EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IE1 A;  2Q0I A;  1WRA A;  2P4Z A;  4YSK A;  3X30 A;  2FHX A;  3FAI A;  3IE2 A;  3H3E A;  2BFZ B;  3F9O A;  3SW3 A;  1BC2 A;  4RL0 A;  4CHL A;  3IDZ A;  3SD9 A;  4ZNB A;  3ZNB A;  4Z60 A;  4GCW A;  5LMC A;  5A0V A;  1YCH A;  3R2U A;  4KEQ A;  4NQ2 A;  2QDS A;  5HH6 A;  2BR6 A;  2BGA A;  4NQ6 A;  4C1G A;  5IQK A;  2R2D A;  4AWY B;  1JJE A;  5HIS A;  4RAM A;  4V0H A;  3RPC A;  5ACS A;  4RM5 A;  5K4N A;  5AYA A;  3RKJ A;  4D02 A;  2DKF A;  2ZNB A;  5HIQ A;  2YCB A;  4Z5Y A;  3L6N A;  2A7M A;  2AZ4 A;  2AIO A;  5EHT A;  3BC2 A;  3FCZ A;  1YCF A;  4ZEJ A;  2Y8A A;  2FHX B;  2ZO4 A;  4DIK A;  4UWP B;  1YCG A;  2ZZI A;  4WD6 A;  4UWO B;  4FSB A;  5ACT A;  5A5Z A;  4C1E A;  5ACR A;  3JXP A;  3KL7 A;  4AWZ A;  4D1U A;  2I7T A;  4EYL A;  5LS3 A;  5ACV A;  3I13 A;  1VME A;  3RKK A;  1ZNB A;  4LE6 A;  4TZF A;  2YZ3 A;  3AF5 A;  2FU6 A;  1ZTC A;  5AEB A;  4Z67 A;  2WYM C;  4EXY A;  3T3N A;  4XWT A;  2GMN A;  3PY6 A;  4D1V A;  4TYT A;  4RL2 A;  1QH5 A;  4PVT A;  2NXA A;  2P18 A;  5ACX A;  3S0Z A;  2P1E A;  4ZO3 A;  5FQC A;  2E7Y A;  3I11 A;  3Q6V A;  2WYL A;  5LLD A;  1A7T A;  4YSB A;  5LCH A;  4HL1 A;  2GFK A;  5LCA A;  5ACQ A;  3VQZ A;  4Z5Z A;  2CBN A;  1WUP A;  2QJS A;  4C09 A;  3IOF A;  2NYP A;  5LE1 A;  1K07 A;  2YNV B;  5K4M A;  3SPU A;  3T9M A;  5EVD A;  4UA4 A;  5HIO A;  2P97 A;  5KIK A;  4HL2 A;  5EH9 A;  5AHR A;  5A87 A;  4ZO2 A;  5A0T A;  4U4L A;  2OHI A;  3PG4 A;  1VGN A;  3IE0 A;  5LCF A;  4D1T A;  2OHH A;  4HKY A;  3I14 A;  4AX1 B;  3ADR A;  4EYB A;  1WW1 A;  2QDT A;  5FQA A;  5EW0 A;  5K0W A;  5B3R A;  2BFK A;  5FQB A;  4AX0 B;  1L9Y A;  2YNV A;  5HIP A;  3TP9 A;  3X2X A;  1XTO A;  2HB9 A;  2Y87 A;  5K4K A;  1DD6 A;  2NZE A;  1X8G A;  5B15 A;  3SBL A;  4C1C A;  5LSC A;  3ZR9 A;  1BMC A;  4J5F A;  4PVO A;  4P62 A;  2BMI A;  3AF6 A;  3DH8 A;  1BVT A;  3ESH A;  2Q9U A;  3IOG A;  3X2Z A;  3PY5 A;  3WXC A;  2XR1 A;  2FU8 A;  3ZWF A;  3X2Y A;  4C1F A;  1KO3 A;  1KR3 A;  3QH8 A;  2BFZ A;  4TZB A;  3KNR A;  4BZ3 A;  3ZQ4 A;  5EV6 A;  3IEL A;  5EV8 A;  3BK2 A;  5AXR A;  5ACU A;  4O98 A;  2VW8 A;  2XF4 A;  3IEK A;  2WYM A;  1WUO A;  2WRS A;  5AHO A;  4Z7R A;  4UBQ A;  2WHG A;  2Y8B A;  4XUK A;  2NZF A;  4GYQ A;  3A4Y A;  3I0V A;  4B87 A;  4JO0 A;  2Q0J A;  2GCU A;  2QED A;  3BK1 A;  3MD7 A;  1A8T A;  2QIN A;  3G1P A;  5HH5 A;  2H6A A;  1HLK A;  2BG2 A;  2GFJ A;  2BIB A;  4AD9 A;  1KO2 A;  2BFL A;  2M5C A;  4RBS A;  2I7V A;  4C1H A;  2BG6 A;  1X8I A;  4UWS B;  2YNU A;  4UAM A;  2BG8 B;  4EYF A;  4EFZ A;  4XWW A;  3P2U A;  1XM8 A;  1SML A;  3DHB A;  3IEM A;  1MQO A;  1X8H A;  3LVZ A;  1E5D A;  4NQ5 A;  1JT1 A;  5B1U A;  4DIL A;  4UWR B;  5EVK A;  3I15 A;  3T3O A;  2BG7 A;  2FU9 A;  1VJN A;  4BP0 A;  2Q42 A;  4FR7 A;  4J5H A;  4TZ9 A;  4D1W A;  5KIL A;  3DHA A;  4EXS A;  5DPX A;  2M5D A;  4EY2 A;  3SFP A;  5EWA A;  3VPE A;  4F6H A;  4RAW A;  2ZWR A;  4H0D A;  5EVB A;  2GKL A;  2FU7 A;  4GYU A;  2FK6 A;  4TYF A;  4YSL A;  3SRX A;  2BC2 A;  2OHJ A;  2FM6 A;  5HH4 A;  1JJT A;  5ACP A;  2YNW A;  1M2X A;  4KEP A;  3AJ3 A;  2UYX A;  1QH3 A;  2BTN A;  2I7X A;  4NQ4 A;  4C1D A;  5AXO A;  1ZKP A;  4FEK A;  2YNT B;  4Z6X A;  1DDK A;  1DXK A;  3DHC A;  2DOO A;  5ACW A;  2YNT A;  2BG8 A;  5LM6 A;  4TZE A;  3BV6 A;  4F6Z A;  3KNS A;  1Y44 A;  1P9E A; 
#chains in the Genus database with same CATH topology
 3IE1 A;  2Q0I A;  1WRA A;  2P4Z A;  4YSK A;  3X30 A;  2FHX A;  3FAI A;  3IE2 A;  3H3E A;  2BFZ B;  3F9O A;  3SW3 A;  1BC2 A;  4RL0 A;  4CHL A;  3IDZ A;  3SD9 A;  4ZNB A;  2CG3 A;  3ZNB A;  2YHE A;  4Z60 A;  4GCW A;  5LMC A;  5A0V A;  4NUR A;  1YCH A;  3R2U A;  4KEQ A;  4NQ2 A;  2QDS A;  5HH6 A;  2BR6 A;  2BGA A;  4NQ6 A;  4C1G A;  5IQK A;  2R2D A;  4AWY B;  1JJE A;  5HIS A;  4RAM A;  4V0H A;  3RPC A;  5ACS A;  4RM5 A;  5K4N A;  5AYA A;  3RKJ A;  5AJL A;  4D02 A;  2DKF A;  2ZNB A;  5HIQ A;  2YCB A;  4Z5Y A;  3L6N A;  2A7M A;  2AZ4 A;  2AIO A;  5EHT A;  3BC2 A;  3FCZ A;  1YCF A;  4ZEJ A;  2Y8A A;  2FHX B;  2ZO4 A;  4DIK A;  4UWP B;  1YCG A;  2ZZI A;  4WD6 A;  4UWO B;  4FSB A;  5ACT A;  5A5Z A;  4C1E A;  5ACR A;  3JXP A;  3KL7 A;  4AWZ A;  4D1U A;  2I7T A;  4EYL A;  5LS3 A;  5ACV A;  3I13 A;  1VME A;  3RKK A;  1ZNB A;  4LE6 A;  4TZF A;  2YZ3 A;  3AF5 A;  2FU6 A;  1ZTC A;  5AEB A;  4Z67 A;  2WYM C;  4EXY A;  3T3N A;  4XWT A;  2GMN A;  3PY6 A;  4D1V A;  4TYT A;  4RL2 A;  1QH5 A;  4PVT A;  2NXA A;  2P18 A;  5ACX A;  3S0Z A;  2P1E A;  4ZO3 A;  5FQC A;  2E7Y A;  3I11 A;  3Q6V A;  2WYL A;  5LLD A;  1A7T A;  4YSB A;  4HL1 A;  5LCA A;  2GFK A;  5ACQ A;  5LCH A;  3VQZ A;  4Z5Z A;  2CBN A;  1WUP A;  2QJS A;  4C09 A;  3IOF A;  2NYP A;  5LE1 A;  1K07 A;  2YNV B;  5K4M A;  3SPU A;  3T9M A;  5EVD A;  4UA4 A;  5HIO A;  2P97 A;  5KIK A;  4HL2 A;  5EH9 A;  5AHR A;  5A87 A;  4ZO2 A;  2CFZ A;  4PDX A;  5A0T A;  4U4L A;  2OHI A;  3PG4 A;  1VGN A;  3IE0 A;  5LCF A;  4D1T A;  2OHH A;  4HKY A;  3I14 A;  4AX1 B;  3ADR A;  4EYB A;  1WW1 A;  2QDT A;  5FQA A;  5EW0 A;  5K0W A;  5B3R A;  2BFK A;  5FQB A;  4AX0 B;  1L9Y A;  2YNV A;  5HIP A;  3TP9 A;  3X2X A;  1XTO A;  2HB9 A;  2Y87 A;  5K4K A;  1DD6 A;  2NZE A;  1X8G A;  5B15 A;  3SBL A;  4C1C A;  5LSC A;  3ZR9 A;  1BMC A;  4J5F A;  4PVO A;  4P62 A;  2BMI A;  3AF6 A;  3DH8 A;  1BVT A;  3ESH A;  2Q9U A;  3IOG A;  3X2Z A;  3PY5 A;  3WXC A;  2XR1 A;  2FU8 A;  3ZWF A;  3X2Y A;  4C1F A;  1KO3 A;  1KR3 A;  3QH8 A;  2BFZ A;  4TZB A;  3KNR A;  4BZ3 A;  3ZQ4 A;  5EV6 A;  3IEL A;  5EV8 A;  3BK2 A;  5AXR A;  5ACU A;  4O98 A;  2VW8 A;  2XF4 A;  3IEK A;  2WYM A;  1WUO A;  2WRS A;  5AHO A;  4Z7R A;  4UBQ A;  2WHG A;  2Y8B A;  4XUK A;  2NZF A;  4GYQ A;  3A4Y A;  3I0V A;  4B87 A;  4JO0 A;  2Q0J A;  2GCU A;  2QED A;  3BK1 A;  3MD7 A;  1A8T A;  2QIN A;  3G1P A;  5A23 A;  5HH5 A;  2H6A A;  1HLK A;  2BG2 A;  2GFJ A;  2BIB A;  4AD9 A;  1KO2 A;  2BFL A;  2M5C A;  4RBS A;  2I7V A;  4C1H A;  2BG6 A;  4AV7 A;  1X8I A;  4UWS B;  2YNU A;  4UAM A;  2BG8 B;  4EYF A;  5AIJ A;  4EFZ A;  4XWW A;  3P2U A;  1XM8 A;  1SML A;  3DHB A;  3IEM A;  1MQO A;  1X8H A;  3LVZ A;  1E5D A;  4NQ5 A;  1JT1 A;  5B1U A;  4DIL A;  4UWR B;  5EVK A;  3I15 A;  3T3O A;  2BG7 A;  2FU9 A;  1VJN A;  4BP0 A;  2Q42 A;  4FR7 A;  4J5H A;  4TZ9 A;  4D1W A;  5KIL A;  3DHA A;  4EXS A;  5DPX A;  2CG2 A;  2M5D A;  4EY2 A;  3SFP A;  5EWA A;  3VPE A;  4F6H A;  4RAW A;  2CFU A;  2ZWR A;  4H0D A;  5EVB A;  2GKL A;  2FU7 A;  4GYU A;  4AXH A;  2FK6 A;  4TYF A;  4YSL A;  3SRX A;  2BC2 A;  2OHJ A;  2FM6 A;  5HH4 A;  1JJT A;  5ACP A;  2YNW A;  1M2X A;  4KEP A;  3AJ3 A;  2UYX A;  1QH3 A;  2BTN A;  2I7X A;  4NQ4 A;  4C1D A;  5AXO A;  1ZKP A;  4FEK A;  2YNT B;  4Z6X A;  1DDK A;  1DXK A;  3DHC A;  2DOO A;  5ACW A;  2YNT A;  2BG8 A;  5LM6 A;  4TZE A;  3BV6 A;  4F6Z A;  3KNS A;  1Y44 A;  1P9E A; 
#chains in the Genus database with same CATH homology
 3IE1 A;  2Q0I A;  1WRA A;  2P4Z A;  4YSK A;  3X30 A;  2FHX A;  3FAI A;  3IE2 A;  3H3E A;  2BFZ B;  3F9O A;  3SW3 A;  1BC2 A;  4RL0 A;  4CHL A;  3IDZ A;  3SD9 A;  4ZNB A;  3ZNB A;  4Z60 A;  4GCW A;  5LMC A;  5A0V A;  1YCH A;  3R2U A;  4KEQ A;  4NQ2 A;  2QDS A;  5HH6 A;  2BR6 A;  2BGA A;  4NQ6 A;  4C1G A;  5IQK A;  2R2D A;  4AWY B;  1JJE A;  5HIS A;  4RAM A;  4V0H A;  3RPC A;  5ACS A;  4RM5 A;  5K4N A;  5AYA A;  3RKJ A;  4D02 A;  2DKF A;  2ZNB A;  5HIQ A;  2YCB A;  4Z5Y A;  3L6N A;  2A7M A;  2AZ4 A;  2AIO A;  5EHT A;  3BC2 A;  3FCZ A;  1YCF A;  4ZEJ A;  2Y8A A;  2FHX B;  2ZO4 A;  4DIK A;  4UWP B;  1YCG A;  2ZZI A;  4WD6 A;  4UWO B;  4FSB A;  5ACT A;  5A5Z A;  4C1E A;  5ACR A;  3JXP A;  3KL7 A;  4AWZ A;  4D1U A;  2I7T A;  4EYL A;  5LS3 A;  5ACV A;  3I13 A;  1VME A;  3RKK A;  1ZNB A;  4LE6 A;  4TZF A;  2YZ3 A;  3AF5 A;  2FU6 A;  1ZTC A;  5AEB A;  4Z67 A;  2WYM C;  4EXY A;  3T3N A;  4XWT A;  2GMN A;  3PY6 A;  4D1V A;  4TYT A;  4RL2 A;  1QH5 A;  4PVT A;  2NXA A;  2P18 A;  5ACX A;  3S0Z A;  2P1E A;  4ZO3 A;  5FQC A;  2E7Y A;  3I11 A;  3Q6V A;  2WYL A;  5LLD A;  1A7T A;  4YSB A;  5LCH A;  4HL1 A;  2GFK A;  5LCA A;  5ACQ A;  3VQZ A;  4Z5Z A;  2CBN A;  1WUP A;  2QJS A;  4C09 A;  3IOF A;  2NYP A;  5LE1 A;  1K07 A;  2YNV B;  5K4M A;  3SPU A;  3T9M A;  5EVD A;  4UA4 A;  5HIO A;  2P97 A;  5KIK A;  4HL2 A;  5EH9 A;  5AHR A;  5A87 A;  4ZO2 A;  5A0T A;  4U4L A;  2OHI A;  3PG4 A;  1VGN A;  3IE0 A;  5LCF A;  4D1T A;  2OHH A;  4HKY A;  3I14 A;  4AX1 B;  3ADR A;  4EYB A;  1WW1 A;  2QDT A;  5FQA A;  5EW0 A;  5K0W A;  5B3R A;  2BFK A;  5FQB A;  4AX0 B;  1L9Y A;  2YNV A;  5HIP A;  3TP9 A;  3X2X A;  1XTO A;  2HB9 A;  2Y87 A;  5K4K A;  1DD6 A;  2NZE A;  1X8G A;  5B15 A;  3SBL A;  4C1C A;  5LSC A;  3ZR9 A;  1BMC A;  4J5F A;  4PVO A;  4P62 A;  2BMI A;  3AF6 A;  3DH8 A;  1BVT A;  3ESH A;  2Q9U A;  3IOG A;  3X2Z A;  3PY5 A;  3WXC A;  2XR1 A;  2FU8 A;  3ZWF A;  3X2Y A;  4C1F A;  1KO3 A;  1KR3 A;  3QH8 A;  2BFZ A;  4TZB A;  3KNR A;  4BZ3 A;  3ZQ4 A;  5EV6 A;  3IEL A;  5EV8 A;  3BK2 A;  5AXR A;  5ACU A;  4O98 A;  2VW8 A;  2XF4 A;  3IEK A;  2WYM A;  1WUO A;  2WRS A;  5AHO A;  4Z7R A;  4UBQ A;  2WHG A;  2Y8B A;  4XUK A;  2NZF A;  4GYQ A;  3A4Y A;  3I0V A;  4B87 A;  4JO0 A;  2Q0J A;  2GCU A;  2QED A;  3BK1 A;  3MD7 A;  1A8T A;  2QIN A;  3G1P A;  5HH5 A;  2H6A A;  1HLK A;  2BG2 A;  2GFJ A;  2BIB A;  4AD9 A;  1KO2 A;  2BFL A;  2M5C A;  4RBS A;  2I7V A;  4C1H A;  2BG6 A;  1X8I A;  4UWS B;  2YNU A;  4UAM A;  2BG8 B;  4EYF A;  4EFZ A;  4XWW A;  3P2U A;  1XM8 A;  1SML A;  3DHB A;  3IEM A;  1MQO A;  1X8H A;  3LVZ A;  1E5D A;  4NQ5 A;  1JT1 A;  5B1U A;  4DIL A;  4UWR B;  5EVK A;  3I15 A;  3T3O A;  2BG7 A;  2FU9 A;  1VJN A;  4BP0 A;  2Q42 A;  4FR7 A;  4J5H A;  4TZ9 A;  4D1W A;  5KIL A;  3DHA A;  4EXS A;  5DPX A;  2M5D A;  4EY2 A;  3SFP A;  5EWA A;  3VPE A;  4F6H A;  4RAW A;  2ZWR A;  4H0D A;  5EVB A;  2GKL A;  2FU7 A;  4GYU A;  2FK6 A;  4TYF A;  4YSL A;  3SRX A;  2BC2 A;  2OHJ A;  2FM6 A;  5HH4 A;  1JJT A;  5ACP A;  2YNW A;  1M2X A;  4KEP A;  3AJ3 A;  2UYX A;  1QH3 A;  2BTN A;  2I7X A;  4NQ4 A;  4C1D A;  5AXO A;  1ZKP A;  4FEK A;  2YNT B;  4Z6X A;  1DDK A;  1DXK A;  3DHC A;  2DOO A;  5ACW A;  2YNT A;  2BG8 A;  5LM6 A;  4TZE A;  3BV6 A;  4F6Z A;  3KNS A;  1Y44 A;  1P9E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...