1ZTCA

Crystal structure of a putative metallo-beta-lactamase (tm0894) from thermotoga maritima at 2.10 a resolution
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
209
structure length
209
Chain Sequence
HHMELKILVTGGNVFVPGRLNAHFSTVVYLEHKDRRIIIDPGNLSSMDELEEKFSELGISPDDITDVLFTHVHLDHIFNSVLFENATFYVHEVYKTKNYLSFGTIVGRIYSKVISSWKNVVLLKGEESLFDEKVKVFHTPWHAREHLSFLLDTENAGRVLITGDITPNRLSYYDIIKGYGSVQVKNFLDRVGRIDLLVFPHDAPLKPEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of hypothetical protein (tm0894) from Thermotoga maritima at 2.10 A resolution
rcsb
source organism Thermotoga maritima
molecule tags Hydrolase
molecule keywords hypothetical protein TM0894
total genus 61
structure length 209
sequence length 209
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 1ztcA00
2CBNA 1VMEA 2YNVB 2GFJA 2BGAA 2BMIA 4F6HA 4RL0A 4C1DA 3RKJA 2P1EA 2FHXA 5ACWA 3I14A 1QH3A 4EYFA 4EXSA 3S0ZA 2ZNBA 2Q0JA 5EV8A 3VQZA 3IE2A 3SD9A 5KILA 4C1FA 3R2UA 5HH5A 3H3EA 5LLDA 1YCGA 4TYTA 4C09A 5EVBA 4FEKA 3BC2A 4ZEJA 5ACXA 3IE0A 4C1GA 2A7MA 4UBQA 3P2UA 4C1EA 1YCFA 1VGNA 4P62A 2AIOA 3ZWFA 3SBLA 3ESHA 2BFKA 2ZO4A 2XF4A 2ZZIA 1K07A 2I7TA 2HB9A 2I7XA 4NQ4A 5K0WA 5ACPA 3SW3A 3LVZA 4EXYA 3KNSA 4UWOB 3X2ZA 2NXAA 2QINA 3JXPA 4EYLA 3ZR9A 5A0TA 2BFLA 3F9OA 3AF6A 5HIPA 4DIKA 1E5DA 4YSKA 3QH8A 1KO2A 3PY6A 1MQOA 3DH8A 5FQBA 5FQAA 1XTOA 1Y44A 2FM6A 4AX1B 3ZNBA 4ZNBA 2BFZA 5B1UA 2R2DA 5LSCA 4O98A 3KNRA 4GYQA 3DHBA 4NQ6A 3G1PA 1A7TA 3SRXA 5ACUA 3AF5A 1X8IA 5K4MA 1DD6A 2FK6A 3RPCA 2WYMA 2YNUA 5HIOA 4Z5ZA 2WYLA 4C1CA 4UWRB 5FQCA 3IE1A 1DXKA 1BMCA 5LS3A 1WUOA 4NQ5A 4D1UA 3PY5A 2NZEA 5AHRA 4C1HA 3ZQ4A 2BG6A 2AZ4A 2Q42A 1WW1A 4YSLA 5K4KA 2BC2A 2OHJA 3FAIA 2DKFA 5LCHA 2FHXB 3WXCA 1KO3A 3IEKA 5A5ZA 3T3NA 2GCUA 3SFPA 4Z7RA 3SPUA 3VPEA 3MD7A 1WRAA 2BIBA 4NQ2A 3BV6A 4FR7A 4AX0B 5HH4A 2GKLA 2BG2A 4D1VA 5ACVA 3KL7A 2YNTA 2BG8B 3DHCA 5LM6A 3BK1A 4PVOA 2QEDA 2BTNA 4XUKA 3IOFA 3IOGA 3Q6VA 2P18A 1ZTCA 4AWZA 3ADRA 4CHLA 2OHIA 3X2XA 3L6NA 4PVTA 1X8HA 2BG8A 4Z6XA 2DOOA 2Q9UA 3PG4A 4GYUA 4ZO2A 3AJ3A 5A0VA 2Y8AA 1VJNA 5K4NA 5KIKA 4LE6A 4EFZA 4HL1A 1JJEA 2M5DA 2YCBA 5B15A 2Q0IA 5LMCA 5DPXA 1QH5A 4RAMA 5EW0A 5ACTA 3FCZA 4D02A 2I7VA 2FU7A 1ZNBA 4UAMA 2XR1A 4KEPA 2BR6A 2NZFA 1SMLA 3X2YA 2UYXA 4J5FA 4WD6A 3IEMA 4XWWA 2H6AA 4D1WA 4TZEA 4UA4A 3A4YA 5EHTA 3IELA 2FU8A 3TP9A 5EV6A 5AXOA 4RL2A 4BZ3A 3DHAA 2M5CA 4TYFA 3X30A 4J5HA 4GCWA 4RAWA 2GMNA 2VW8A 5HIQA 5HH6A 5B3RA 5ACQA 5AHOA 2FU9A 5ACRA 5A87A 2NYPA 1L9YA 4KEQA 1BC2A 2YNVA 4UWPB 4HKYA 4Z5YA 4U4LA 5EWAA 3BK2A 3I11A 1ZKPA 4TZ9A 2BFZB 3T9MA 4Z60A 4UWSB 5AXRA 1A8TA 1KR3A 2YNTB 2Y8BA 1WUPA 3IDZA 5LCFA 5EVDA 2E7YA 1X8GA 5AEBA 3I13A 2WRSA 2GFKA 4TZFA 4TZBA 2Y87A 4BP0A 2QJSA 5AYAA 3I0VA 2FU6A 2ZWRA 5ACSA 4JO0A 4RM5A 3I15A 5LCAA 4D1TA 4DILA 1BVTA 2YZ3A 1P9EA 4H0DA 1HLKA 4HL2A 2P4ZA 5IQKA 4RBSA 2OHHA 1YCHA 4Z67A 4EY2A 3T3OA 5EH9A 5EVKA 5LE1A 2WHGA 5HISA 4FSBA 1JJTA 4F6ZA 4B87A 2QDSA 4V0HA 1JT1A 2YNWA 4XWTA 4AWYB 4EYBA 2WYMC 1XM8A 4AD9A 2P97A 4ZO3A 1M2XA 2BG7A 1DDKA 4YSBA 2QDTA 3RKKA
chains in the Genus database with same CATH superfamily
2CBNA 1VMEA 2YNVB 2GFJA 2BGAA 2BMIA 4F6HA 4RL0A 4C1DA 3RKJA 2P1EA 2FHXA 5ACWA 3I14A 1QH3A 4EYFA 4EXSA 3S0ZA 2ZNBA 2Q0JA 5EV8A 3VQZA 3IE2A 3SD9A 5KILA 4C1FA 3R2UA 5HH5A 3H3EA 5LLDA 1YCGA 2CG2A 4TYTA 4C09A 5EVBA 4FEKA 3BC2A 4ZEJA 5ACXA 3IE0A 4C1GA 2A7MA 4UBQA 3P2UA 4C1EA 1YCFA 1VGNA 4P62A 2AIOA 3ZWFA 3SBLA 3ESHA 2BFKA 2ZO4A 2XF4A 2ZZIA 1K07A 2I7TA 2HB9A 2I7XA 4NQ4A 5K0WA 5ACPA 3SW3A 3LVZA 4EXYA 3KNSA 4UWOB 3X2ZA 2NXAA 2CFZA 2QINA 3JXPA 4EYLA 3ZR9A 5A0TA 2BFLA 3F9OA 3AF6A 5HIPA 4DIKA 1E5DA 4YSKA 3QH8A 1KO2A 3PY6A 1MQOA 3DH8A 5FQBA 5FQAA 1XTOA 1Y44A 2FM6A 5AIJA 4AX1B 3ZNBA 4ZNBA 2BFZA 5B1UA 2R2DA 5LSCA 4O98A 3KNRA 4GYQA 3DHBA 4NQ6A 3G1PA 1A7TA 3SRXA 5ACUA 3AF5A 1X8IA 5K4MA 1DD6A 2FK6A 3RPCA 2WYMA 2YNUA 5HIOA 4Z5ZA 2WYLA 4C1CA 4UWRB 5FQCA 3IE1A 1DXKA 1BMCA 5LS3A 1WUOA 4NQ5A 4D1UA 3PY5A 2NZEA 5AHRA 4C1HA 3ZQ4A 2BG6A 5A23A 2AZ4A 2Q42A 1WW1A 4YSLA 5K4KA 2BC2A 2OHJA 3FAIA 2DKFA 5LCHA 2FHXB 3WXCA 1KO3A 3IEKA 5A5ZA 3T3NA 2GCUA 2CG3A 3SFPA 4Z7RA 5AJLA 3SPUA 3VPEA 3MD7A 1WRAA 2BIBA 4NQ2A 3BV6A 4FR7A 4AX0B 5HH4A 2GKLA 2BG2A 4D1VA 5ACVA 3KL7A 2YNTA 2BG8B 3DHCA 5LM6A 3BK1A 4PVOA 2QEDA 2BTNA 4XUKA 3IOFA 3IOGA 3Q6VA 2P18A 1ZTCA 4AWZA 3ADRA 4CHLA 2OHIA 3X2XA 3L6NA 4PVTA 1X8HA 2BG8A 4Z6XA 2DOOA 2Q9UA 3PG4A 4GYUA 4ZO2A 3AJ3A 5A0VA 2Y8AA 1VJNA 5K4NA 5KIKA 4LE6A 4EFZA 4HL1A 1JJEA 2M5DA 2YCBA 5B15A 2Q0IA 5LMCA 5DPXA 1QH5A 4RAMA 5EW0A 5ACTA 4AV7A 3FCZA 4D02A 2I7VA 2FU7A 1ZNBA 4UAMA 2XR1A 4KEPA 2BR6A 2NZFA 1SMLA 3X2YA 2UYXA 4J5FA 4WD6A 3IEMA 4XWWA 2H6AA 4D1WA 4TZEA 4UA4A 3A4YA 5EHTA 3IELA 2FU8A 3TP9A 5EV6A 5AXOA 4RL2A 4BZ3A 3DHAA 2M5CA 4TYFA 3X30A 4J5HA 4GCWA 4RAWA 2GMNA 2VW8A 5HIQA 5HH6A 5B3RA 5ACQA 5AHOA 2FU9A 5ACRA 5A87A 2NYPA 1L9YA 4KEQA 1BC2A 2YNVA 4UWPB 4HKYA 4Z5YA 4U4LA 5EWAA 3BK2A 3I11A 1ZKPA 4TZ9A 2BFZB 3T9MA 4Z60A 4UWSB 5AXRA 1A8TA 1KR3A 2YNTB 4AXHA 2Y8BA 1WUPA 3IDZA 5LCFA 5EVDA 2E7YA 1X8GA 5AEBA 3I13A 2WRSA 2GFKA 4TZFA 4TZBA 2Y87A 4BP0A 2QJSA 2YHEA 5AYAA 3I0VA 2FU6A 2CFUA 2ZWRA 5ACSA 4JO0A 4RM5A 3I15A 5LCAA 4D1TA 4DILA 1BVTA 2YZ3A 1P9EA 4H0DA 1HLKA 4HL2A 2P4ZA 5IQKA 4RBSA 2OHHA 1YCHA 4Z67A 4EY2A 3T3OA 5EH9A 5EVKA 5LE1A 2WHGA 5HISA 4FSBA 1JJTA 4PDXA 4F6ZA 4B87A 2QDSA 4V0HA 1JT1A 2YNWA 4XWTA 4AWYB 4EYBA 2WYMC 1XM8A 4AD9A 2P97A 4NURA 4ZO3A 1M2XA 2BG7A 1DDKA 4YSBA 2QDTA 3RKKA
chains in the Genus database with same CATH topology
2CBNA 1VMEA 2YNVB 2GFJA 2BGAA 2BMIA 4F6HA 4RL0A 4C1DA 3RKJA 2P1EA 2FHXA 5ACWA 3I14A 1QH3A 4EYFA 4EXSA 3S0ZA 2ZNBA 2Q0JA 5EV8A 3VQZA 3IE2A 3SD9A 5KILA 4C1FA 3R2UA 5HH5A 3H3EA 5LLDA 1YCGA 4TYTA 4C09A 5EVBA 4FEKA 3BC2A 4ZEJA 5ACXA 3IE0A 4C1GA 2A7MA 4UBQA 3P2UA 4C1EA 1YCFA 1VGNA 4P62A 2AIOA 3ZWFA 3SBLA 3ESHA 2BFKA 2ZO4A 2XF4A 2ZZIA 1K07A 2I7TA 2HB9A 2I7XA 4NQ4A 5K0WA 5ACPA 3SW3A 3LVZA 4EXYA 3KNSA 4UWOB 3X2ZA 2NXAA 2QINA 3JXPA 4EYLA 3ZR9A 5A0TA 2BFLA 3F9OA 3AF6A 5HIPA 4DIKA 1E5DA 4YSKA 3QH8A 1KO2A 3PY6A 1MQOA 3DH8A 5FQBA 5FQAA 1XTOA 1Y44A 2FM6A 4AX1B 3ZNBA 4ZNBA 2BFZA 5B1UA 2R2DA 5LSCA 4O98A 3KNRA 4GYQA 3DHBA 4NQ6A 3G1PA 1A7TA 3SRXA 5ACUA 3AF5A 1X8IA 5K4MA 1DD6A 2FK6A 3RPCA 2WYMA 2YNUA 5HIOA 4Z5ZA 2WYLA 4C1CA 4UWRB 5FQCA 3IE1A 1DXKA 1BMCA 5LS3A 1WUOA 4NQ5A 4D1UA 3PY5A 2NZEA 5AHRA 4C1HA 3ZQ4A 2BG6A 2AZ4A 2Q42A 1WW1A 4YSLA 5K4KA 2BC2A 2OHJA 3FAIA 2DKFA 5LCHA 2FHXB 3WXCA 1KO3A 3IEKA 5A5ZA 3T3NA 2GCUA 3SFPA 4Z7RA 3SPUA 3VPEA 3MD7A 1WRAA 2BIBA 4NQ2A 3BV6A 4FR7A 4AX0B 5HH4A 2GKLA 2BG2A 4D1VA 5ACVA 3KL7A 2YNTA 2BG8B 3DHCA 5LM6A 3BK1A 4PVOA 2QEDA 2BTNA 4XUKA 3IOFA 3IOGA 3Q6VA 2P18A 1ZTCA 4AWZA 3ADRA 4CHLA 2OHIA 3X2XA 3L6NA 4PVTA 1X8HA 2BG8A 4Z6XA 2DOOA 2Q9UA 3PG4A 4GYUA 4ZO2A 3AJ3A 5A0VA 2Y8AA 1VJNA 5K4NA 5KIKA 4LE6A 4EFZA 4HL1A 1JJEA 2M5DA 2YCBA 5B15A 2Q0IA 5LMCA 5DPXA 1QH5A 4RAMA 5EW0A 5ACTA 3FCZA 4D02A 2I7VA 2FU7A 1ZNBA 4UAMA 2XR1A 4KEPA 2BR6A 2NZFA 1SMLA 3X2YA 2UYXA 4J5FA 4WD6A 3IEMA 4XWWA 2H6AA 4D1WA 4TZEA 4UA4A 3A4YA 5EHTA 3IELA 2FU8A 3TP9A 5EV6A 5AXOA 4RL2A 4BZ3A 3DHAA 2M5CA 4TYFA 3X30A 4J5HA 4GCWA 4RAWA 2GMNA 2VW8A 5HIQA 5HH6A 5B3RA 5ACQA 5AHOA 2FU9A 5ACRA 5A87A 2NYPA 1L9YA 4KEQA 1BC2A 2YNVA 4UWPB 4HKYA 4Z5YA 4U4LA 5EWAA 3BK2A 3I11A 1ZKPA 4TZ9A 2BFZB 3T9MA 4Z60A 4UWSB 5AXRA 1A8TA 1KR3A 2YNTB 2Y8BA 1WUPA 3IDZA 5LCFA 5EVDA 2E7YA 1X8GA 5AEBA 3I13A 2WRSA 2GFKA 4TZFA 4TZBA 2Y87A 4BP0A 2QJSA 5AYAA 3I0VA 2FU6A 2ZWRA 5ACSA 4JO0A 4RM5A 3I15A 5LCAA 4D1TA 4DILA 1BVTA 2YZ3A 1P9EA 4H0DA 1HLKA 4HL2A 2P4ZA 5IQKA 4RBSA 2OHHA 1YCHA 4Z67A 4EY2A 3T3OA 5EH9A 5EVKA 5LE1A 2WHGA 5HISA 4FSBA 1JJTA 4F6ZA 4B87A 2QDSA 4V0HA 1JT1A 2YNWA 4XWTA 4AWYB 4EYBA 2WYMC 1XM8A 4AD9A 2P97A 4ZO3A 1M2XA 2BG7A 1DDKA 4YSBA 2QDTA 3RKKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CBN A;  1VME A;  2YNV B;  2GFJ A;  2BGA A;  2BMI A;  4F6H A;  4RL0 A;  4C1D A;  3RKJ A;  2P1E A;  2FHX A;  5ACW A;  3I14 A;  1QH3 A;  4EYF A;  4EXS A;  3S0Z A;  2ZNB A;  2Q0J A;  5EV8 A;  3VQZ A;  3IE2 A;  3SD9 A;  5KIL A;  4C1F A;  3R2U A;  5HH5 A;  3H3E A;  5LLD A;  1YCG A;  4TYT A;  4C09 A;  5EVB A;  4FEK A;  3BC2 A;  4ZEJ A;  5ACX A;  3IE0 A;  4C1G A;  2A7M A;  4UBQ A;  3P2U A;  4C1E A;  1YCF A;  1VGN A;  4P62 A;  2AIO A;  3ZWF A;  3SBL A;  3ESH A;  2BFK A;  2ZO4 A;  2XF4 A;  2ZZI A;  1K07 A;  2I7T A;  2HB9 A;  2I7X A;  4NQ4 A;  5K0W A;  5ACP A;  3SW3 A;  3LVZ A;  4EXY A;  3KNS A;  4UWO B;  3X2Z A;  2NXA A;  2QIN A;  3JXP A;  4EYL A;  3ZR9 A;  5A0T A;  2BFL A;  3F9O A;  3AF6 A;  5HIP A;  4DIK A;  1E5D A;  4YSK A;  3QH8 A;  1KO2 A;  3PY6 A;  1MQO A;  3DH8 A;  5FQB A;  5FQA A;  1XTO A;  1Y44 A;  2FM6 A;  4AX1 B;  3ZNB A;  4ZNB A;  2BFZ A;  5B1U A;  2R2D A;  5LSC A;  4O98 A;  3KNR A;  4GYQ A;  3DHB A;  4NQ6 A;  3G1P A;  1A7T A;  3SRX A;  5ACU A;  3AF5 A;  1X8I A;  5K4M A;  1DD6 A;  2FK6 A;  3RPC A;  2WYM A;  2YNU A;  5HIO A;  4Z5Z A;  2WYL A;  4C1C A;  4UWR B;  5FQC A;  3IE1 A;  1DXK A;  1BMC A;  5LS3 A;  1WUO A;  4NQ5 A;  4D1U A;  3PY5 A;  2NZE A;  5AHR A;  4C1H A;  3ZQ4 A;  2BG6 A;  2AZ4 A;  2Q42 A;  1WW1 A;  4YSL A;  5K4K A;  2BC2 A;  2OHJ A;  3FAI A;  2DKF A;  5LCH A;  2FHX B;  3WXC A;  1KO3 A;  3IEK A;  5A5Z A;  3T3N A;  2GCU A;  3SFP A;  4Z7R A;  3SPU A;  3VPE A;  3MD7 A;  1WRA A;  2BIB A;  4NQ2 A;  3BV6 A;  4FR7 A;  4AX0 B;  5HH4 A;  2GKL A;  2BG2 A;  4D1V A;  5ACV A;  3KL7 A;  2YNT A;  2BG8 B;  3DHC A;  5LM6 A;  3BK1 A;  4PVO A;  2QED A;  2BTN A;  4XUK A;  3IOF A;  3IOG A;  3Q6V A;  2P18 A;  1ZTC A;  4AWZ A;  3ADR A;  4CHL A;  2OHI A;  3X2X A;  3L6N A;  4PVT A;  1X8H A;  2BG8 A;  4Z6X A;  2DOO A;  2Q9U A;  3PG4 A;  4GYU A;  4ZO2 A;  3AJ3 A;  5A0V A;  2Y8A A;  1VJN A;  5K4N A;  5KIK A;  4LE6 A;  4EFZ A;  4HL1 A;  1JJE A;  2M5D A;  2YCB A;  5B15 A;  2Q0I A;  5LMC A;  5DPX A;  1QH5 A;  4RAM A;  5EW0 A;  5ACT A;  3FCZ A;  4D02 A;  2I7V A;  2FU7 A;  1ZNB A;  4UAM A;  2XR1 A;  4KEP A;  2BR6 A;  2NZF A;  1SML A;  3X2Y A;  2UYX A;  4J5F A;  4WD6 A;  3IEM A;  4XWW A;  2H6A A;  4D1W A;  4TZE A;  4UA4 A;  3A4Y A;  5EHT A;  3IEL A;  2FU8 A;  3TP9 A;  5EV6 A;  5AXO A;  4RL2 A;  4BZ3 A;  3DHA A;  2M5C A;  4TYF A;  3X30 A;  4J5H A;  4GCW A;  4RAW A;  2GMN A;  2VW8 A;  5HIQ A;  5HH6 A;  5B3R A;  5ACQ A;  5AHO A;  2FU9 A;  5ACR A;  5A87 A;  2NYP A;  1L9Y A;  4KEQ A;  1BC2 A;  2YNV A;  4UWP B;  4HKY A;  4Z5Y A;  4U4L A;  5EWA A;  3BK2 A;  3I11 A;  1ZKP A;  4TZ9 A;  2BFZ B;  3T9M A;  4Z60 A;  4UWS B;  5AXR A;  1A8T A;  1KR3 A;  2YNT B;  2Y8B A;  1WUP A;  3IDZ A;  5LCF A;  5EVD A;  2E7Y A;  1X8G A;  5AEB A;  3I13 A;  2WRS A;  2GFK A;  4TZF A;  4TZB A;  2Y87 A;  4BP0 A;  2QJS A;  5AYA A;  3I0V A;  2FU6 A;  2ZWR A;  5ACS A;  4JO0 A;  4RM5 A;  3I15 A;  5LCA A;  4D1T A;  4DIL A;  1BVT A;  2YZ3 A;  1P9E A;  4H0D A;  1HLK A;  4HL2 A;  2P4Z A;  5IQK A;  4RBS A;  2OHH A;  1YCH A;  4Z67 A;  4EY2 A;  3T3O A;  5EH9 A;  5EVK A;  5LE1 A;  2WHG A;  5HIS A;  4FSB A;  1JJT A;  4F6Z A;  4B87 A;  2QDS A;  4V0H A;  1JT1 A;  2YNW A;  4XWT A;  4AWY B;  4EYB A;  2WYM C;  1XM8 A;  4AD9 A;  2P97 A;  4ZO3 A;  1M2X A;  2BG7 A;  1DDK A;  4YSB A;  2QDT A;  3RKK A; 
#chains in the Genus database with same CATH topology
 2CBN A;  1VME A;  2YNV B;  2GFJ A;  2BGA A;  2BMI A;  4F6H A;  4RL0 A;  4C1D A;  3RKJ A;  2P1E A;  2FHX A;  5ACW A;  3I14 A;  1QH3 A;  4EYF A;  4EXS A;  3S0Z A;  2ZNB A;  2Q0J A;  5EV8 A;  3VQZ A;  3IE2 A;  3SD9 A;  5KIL A;  4C1F A;  3R2U A;  5HH5 A;  3H3E A;  5LLD A;  1YCG A;  2CG2 A;  4TYT A;  4C09 A;  5EVB A;  4FEK A;  3BC2 A;  4ZEJ A;  5ACX A;  3IE0 A;  4C1G A;  2A7M A;  4UBQ A;  3P2U A;  4C1E A;  1YCF A;  1VGN A;  4P62 A;  2AIO A;  3ZWF A;  3SBL A;  3ESH A;  2BFK A;  2ZO4 A;  2XF4 A;  2ZZI A;  1K07 A;  2I7T A;  2HB9 A;  2I7X A;  4NQ4 A;  5K0W A;  5ACP A;  3SW3 A;  3LVZ A;  4EXY A;  3KNS A;  4UWO B;  3X2Z A;  2NXA A;  2CFZ A;  2QIN A;  3JXP A;  4EYL A;  3ZR9 A;  5A0T A;  2BFL A;  3F9O A;  3AF6 A;  5HIP A;  4DIK A;  1E5D A;  4YSK A;  3QH8 A;  1KO2 A;  3PY6 A;  1MQO A;  3DH8 A;  5FQB A;  5FQA A;  1XTO A;  1Y44 A;  2FM6 A;  5AIJ A;  4AX1 B;  3ZNB A;  4ZNB A;  2BFZ A;  5B1U A;  2R2D A;  5LSC A;  4O98 A;  3KNR A;  4GYQ A;  3DHB A;  4NQ6 A;  3G1P A;  1A7T A;  3SRX A;  5ACU A;  3AF5 A;  1X8I A;  5K4M A;  1DD6 A;  2FK6 A;  3RPC A;  2WYM A;  2YNU A;  5HIO A;  4Z5Z A;  2WYL A;  4C1C A;  4UWR B;  5FQC A;  3IE1 A;  1DXK A;  1BMC A;  5LS3 A;  1WUO A;  4NQ5 A;  4D1U A;  3PY5 A;  2NZE A;  5AHR A;  4C1H A;  3ZQ4 A;  2BG6 A;  5A23 A;  2AZ4 A;  2Q42 A;  1WW1 A;  4YSL A;  5K4K A;  2BC2 A;  2OHJ A;  3FAI A;  2DKF A;  5LCH A;  2FHX B;  3WXC A;  1KO3 A;  3IEK A;  5A5Z A;  3T3N A;  2GCU A;  2CG3 A;  3SFP A;  4Z7R A;  5AJL A;  3SPU A;  3VPE A;  3MD7 A;  1WRA A;  2BIB A;  4NQ2 A;  3BV6 A;  4FR7 A;  4AX0 B;  5HH4 A;  2GKL A;  2BG2 A;  4D1V A;  5ACV A;  3KL7 A;  2YNT A;  2BG8 B;  3DHC A;  5LM6 A;  3BK1 A;  4PVO A;  2QED A;  2BTN A;  4XUK A;  3IOF A;  3IOG A;  3Q6V A;  2P18 A;  1ZTC A;  4AWZ A;  3ADR A;  4CHL A;  2OHI A;  3X2X A;  3L6N A;  4PVT A;  1X8H A;  2BG8 A;  4Z6X A;  2DOO A;  2Q9U A;  3PG4 A;  4GYU A;  4ZO2 A;  3AJ3 A;  5A0V A;  2Y8A A;  1VJN A;  5K4N A;  5KIK A;  4LE6 A;  4EFZ A;  4HL1 A;  1JJE A;  2M5D A;  2YCB A;  5B15 A;  2Q0I A;  5LMC A;  5DPX A;  1QH5 A;  4RAM A;  5EW0 A;  5ACT A;  4AV7 A;  3FCZ A;  4D02 A;  2I7V A;  2FU7 A;  1ZNB A;  4UAM A;  2XR1 A;  4KEP A;  2BR6 A;  2NZF A;  1SML A;  3X2Y A;  2UYX A;  4J5F A;  4WD6 A;  3IEM A;  4XWW A;  2H6A A;  4D1W A;  4TZE A;  4UA4 A;  3A4Y A;  5EHT A;  3IEL A;  2FU8 A;  3TP9 A;  5EV6 A;  5AXO A;  4RL2 A;  4BZ3 A;  3DHA A;  2M5C A;  4TYF A;  3X30 A;  4J5H A;  4GCW A;  4RAW A;  2GMN A;  2VW8 A;  5HIQ A;  5HH6 A;  5B3R A;  5ACQ A;  5AHO A;  2FU9 A;  5ACR A;  5A87 A;  2NYP A;  1L9Y A;  4KEQ A;  1BC2 A;  2YNV A;  4UWP B;  4HKY A;  4Z5Y A;  4U4L A;  5EWA A;  3BK2 A;  3I11 A;  1ZKP A;  4TZ9 A;  2BFZ B;  3T9M A;  4Z60 A;  4UWS B;  5AXR A;  1A8T A;  1KR3 A;  2YNT B;  4AXH A;  2Y8B A;  1WUP A;  3IDZ A;  5LCF A;  5EVD A;  2E7Y A;  1X8G A;  5AEB A;  3I13 A;  2WRS A;  2GFK A;  4TZF A;  4TZB A;  2Y87 A;  4BP0 A;  2QJS A;  2YHE A;  5AYA A;  3I0V A;  2FU6 A;  2CFU A;  2ZWR A;  5ACS A;  4JO0 A;  4RM5 A;  3I15 A;  5LCA A;  4D1T A;  4DIL A;  1BVT A;  2YZ3 A;  1P9E A;  4H0D A;  1HLK A;  4HL2 A;  2P4Z A;  5IQK A;  4RBS A;  2OHH A;  1YCH A;  4Z67 A;  4EY2 A;  3T3O A;  5EH9 A;  5EVK A;  5LE1 A;  2WHG A;  5HIS A;  4FSB A;  1JJT A;  4PDX A;  4F6Z A;  4B87 A;  2QDS A;  4V0H A;  1JT1 A;  2YNW A;  4XWT A;  4AWY B;  4EYB A;  2WYM C;  1XM8 A;  4AD9 A;  2P97 A;  4NUR A;  4ZO3 A;  1M2X A;  2BG7 A;  1DDK A;  4YSB A;  2QDT A;  3RKK A; 
#chains in the Genus database with same CATH homology
 2CBN A;  1VME A;  2YNV B;  2GFJ A;  2BGA A;  2BMI A;  4F6H A;  4RL0 A;  4C1D A;  3RKJ A;  2P1E A;  2FHX A;  5ACW A;  3I14 A;  1QH3 A;  4EYF A;  4EXS A;  3S0Z A;  2ZNB A;  2Q0J A;  5EV8 A;  3VQZ A;  3IE2 A;  3SD9 A;  5KIL A;  4C1F A;  3R2U A;  5HH5 A;  3H3E A;  5LLD A;  1YCG A;  4TYT A;  4C09 A;  5EVB A;  4FEK A;  3BC2 A;  4ZEJ A;  5ACX A;  3IE0 A;  4C1G A;  2A7M A;  4UBQ A;  3P2U A;  4C1E A;  1YCF A;  1VGN A;  4P62 A;  2AIO A;  3ZWF A;  3SBL A;  3ESH A;  2BFK A;  2ZO4 A;  2XF4 A;  2ZZI A;  1K07 A;  2I7T A;  2HB9 A;  2I7X A;  4NQ4 A;  5K0W A;  5ACP A;  3SW3 A;  3LVZ A;  4EXY A;  3KNS A;  4UWO B;  3X2Z A;  2NXA A;  2QIN A;  3JXP A;  4EYL A;  3ZR9 A;  5A0T A;  2BFL A;  3F9O A;  3AF6 A;  5HIP A;  4DIK A;  1E5D A;  4YSK A;  3QH8 A;  1KO2 A;  3PY6 A;  1MQO A;  3DH8 A;  5FQB A;  5FQA A;  1XTO A;  1Y44 A;  2FM6 A;  4AX1 B;  3ZNB A;  4ZNB A;  2BFZ A;  5B1U A;  2R2D A;  5LSC A;  4O98 A;  3KNR A;  4GYQ A;  3DHB A;  4NQ6 A;  3G1P A;  1A7T A;  3SRX A;  5ACU A;  3AF5 A;  1X8I A;  5K4M A;  1DD6 A;  2FK6 A;  3RPC A;  2WYM A;  2YNU A;  5HIO A;  4Z5Z A;  2WYL A;  4C1C A;  4UWR B;  5FQC A;  3IE1 A;  1DXK A;  1BMC A;  5LS3 A;  1WUO A;  4NQ5 A;  4D1U A;  3PY5 A;  2NZE A;  5AHR A;  4C1H A;  3ZQ4 A;  2BG6 A;  2AZ4 A;  2Q42 A;  1WW1 A;  4YSL A;  5K4K A;  2BC2 A;  2OHJ A;  3FAI A;  2DKF A;  5LCH A;  2FHX B;  3WXC A;  1KO3 A;  3IEK A;  5A5Z A;  3T3N A;  2GCU A;  3SFP A;  4Z7R A;  3SPU A;  3VPE A;  3MD7 A;  1WRA A;  2BIB A;  4NQ2 A;  3BV6 A;  4FR7 A;  4AX0 B;  5HH4 A;  2GKL A;  2BG2 A;  4D1V A;  5ACV A;  3KL7 A;  2YNT A;  2BG8 B;  3DHC A;  5LM6 A;  3BK1 A;  4PVO A;  2QED A;  2BTN A;  4XUK A;  3IOF A;  3IOG A;  3Q6V A;  2P18 A;  1ZTC A;  4AWZ A;  3ADR A;  4CHL A;  2OHI A;  3X2X A;  3L6N A;  4PVT A;  1X8H A;  2BG8 A;  4Z6X A;  2DOO A;  2Q9U A;  3PG4 A;  4GYU A;  4ZO2 A;  3AJ3 A;  5A0V A;  2Y8A A;  1VJN A;  5K4N A;  5KIK A;  4LE6 A;  4EFZ A;  4HL1 A;  1JJE A;  2M5D A;  2YCB A;  5B15 A;  2Q0I A;  5LMC A;  5DPX A;  1QH5 A;  4RAM A;  5EW0 A;  5ACT A;  3FCZ A;  4D02 A;  2I7V A;  2FU7 A;  1ZNB A;  4UAM A;  2XR1 A;  4KEP A;  2BR6 A;  2NZF A;  1SML A;  3X2Y A;  2UYX A;  4J5F A;  4WD6 A;  3IEM A;  4XWW A;  2H6A A;  4D1W A;  4TZE A;  4UA4 A;  3A4Y A;  5EHT A;  3IEL A;  2FU8 A;  3TP9 A;  5EV6 A;  5AXO A;  4RL2 A;  4BZ3 A;  3DHA A;  2M5C A;  4TYF A;  3X30 A;  4J5H A;  4GCW A;  4RAW A;  2GMN A;  2VW8 A;  5HIQ A;  5HH6 A;  5B3R A;  5ACQ A;  5AHO A;  2FU9 A;  5ACR A;  5A87 A;  2NYP A;  1L9Y A;  4KEQ A;  1BC2 A;  2YNV A;  4UWP B;  4HKY A;  4Z5Y A;  4U4L A;  5EWA A;  3BK2 A;  3I11 A;  1ZKP A;  4TZ9 A;  2BFZ B;  3T9M A;  4Z60 A;  4UWS B;  5AXR A;  1A8T A;  1KR3 A;  2YNT B;  2Y8B A;  1WUP A;  3IDZ A;  5LCF A;  5EVD A;  2E7Y A;  1X8G A;  5AEB A;  3I13 A;  2WRS A;  2GFK A;  4TZF A;  4TZB A;  2Y87 A;  4BP0 A;  2QJS A;  5AYA A;  3I0V A;  2FU6 A;  2ZWR A;  5ACS A;  4JO0 A;  4RM5 A;  3I15 A;  5LCA A;  4D1T A;  4DIL A;  1BVT A;  2YZ3 A;  1P9E A;  4H0D A;  1HLK A;  4HL2 A;  2P4Z A;  5IQK A;  4RBS A;  2OHH A;  1YCH A;  4Z67 A;  4EY2 A;  3T3O A;  5EH9 A;  5EVK A;  5LE1 A;  2WHG A;  5HIS A;  4FSB A;  1JJT A;  4F6Z A;  4B87 A;  2QDS A;  4V0H A;  1JT1 A;  2YNW A;  4XWT A;  4AWY B;  4EYB A;  2WYM C;  1XM8 A;  4AD9 A;  2P97 A;  4ZO3 A;  1M2X A;  2BG7 A;  1DDK A;  4YSB A;  2QDT A;  3RKK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...