4XWWA

Crystal structure of rnase j complexed with rna
Total Genus 182
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
182
sequence length
545
structure length
545
Chain Sequence
PAPTLEVIPLGGMGEIGKNITVFRYGDEIVVVDGGLAFPKAHQMGIDLIVPRIDYLLEHQDKIKGWILTHGHEDHIGGLPYIFARLPRVPVYGLPLTLALVREKLSEFGLQDVDLREVTYGDEVRFGQSFVAEFFCMTHSIPDNAGYILKTPVGDVLHTGDFKIDPDVGTGAGIVSDLERVEQAGKDGVLLLISDSTNAERPGHTPSEAEIARNLEEIIKGCRGRVFLTTFASQVYRIQNILDLAHRQGRRVVMEGRSMIKYAQAAQATGHMNPPEPFLTSEEVGELQDQQVLFVCTGSQGQPMAVLGRLAFGTHAKIALRRGDTVILSSNPIPGNEDAVNLIVNRLYEIGVDVVYPPTYRVHASGHASQEELATILNLTRPKFFLPWHGEPRHQINHAKLAQTLPRPPKRTLIAKNGDIVNLGPDEFRVSGTVAAGAVYVDGLGVGDVNDDVLLDRVNLSQEGLLILTAVLHPTPHVEVVARGFARPNRDLELQIRRVALEAVEQGLREKKRLEDVRDDMYGAVRRFTRKATGRNPVLIPMIVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DR2417
publication title Structural insights into catalysis and dimerization enhanced exonuclease activity of RNase J
pubmed doi rcsb
source organism Deinococcus radiodurans
molecule tags Rna binding protein/rna
total genus 182
structure length 545
sequence length 545
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
A PF07521 RMMBL Zn-dependent metallo-hydrolase RNA specificity domain
A PF17770 RNase_J_C Ribonuclease J C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.580 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4xwwA03
3.40.50.10710 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Metallo-hydrolase/oxidoreductase 4xwwA02
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 4xwwA01
1SMLA 5AHOA 1DDKA 4TYTA 3DHAA 5HH6A 4FR7A 4RAWA 5DPXA 1MQOA 3RKKA 4ZEJA 4ZNBA 2ZZIA 4NQ6A 4Z6XA 2Y8AA 3ZWFA 2ZO4A 3DHCA 3PY5A 4D02A 4TZBA 5EW0A 1YCHA 4EYLA 4UWOB 3SFPA 4TZFA 1QH5A 3PG4A 4YSKA 1XTOA 5K4NA 3PY6A 4DIKA 1XM8A 3G1PA 4C1GA 5AEBA 3IE0A 4UWSB 3H3EA 2OHHA 4C1EA 4RBSA 1VJNA 4UWPB 2WRSA 3AF5A 2ZWRA 2YNVA 5LSCA 3FAIA 5KILA 3IEMA 1P9EA 2YNVB 3ZQ4A 3ZNBA 3I14A 1BVTA 4FSBA 2OHJA 4F6ZA 3X2ZA 4EXSA 3L6NA 5A0VA 5K0WA 4C1DA 2GKLA 3I11A 2UYXA 3I13A 4J5HA 4D1WA 2R2DA 2FM6A 4XWWA 4UAMA 5HISA 2YNWA 4UA4A 4C1CA 3Q6VA 3KNSA 2BG8A 5LE1A 5IQKA 2BG8B 3IE1A 5ACTA 4D1VA 2Y87A 4XWTA 3SRXA 4Z60A 1WRAA 4DILA 4Z7RA 2QDTA 4YSBA 4B87A 2BR6A 5ACWA 3BK2A 3IE2A 1VMEA 1M2XA 5EHTA 4XUKA 4JO0A 5ACVA 2BTNA 2VW8A 4Z5ZA 2P97A 4UBQA 4NQ2A 2BIBA 5ACUA 5AXOA 2BG2A 3FCZA 2Q9UA 2HB9A 4EYFA 5EV8A 4TZEA 4ZO3A 3DHBA 1KR3A 2I7XA 2NYPA 5B3RA 4HKYA 3I0VA 4Z67A 5EV6A 3LVZA 5EVDA 3IELA 3ADRA 4EFZA 5FQBA 5FQCA 3ESHA 2OHIA 5EH9A 4V0HA 1JJTA 2GFJA 2Q42A 4UWRB 3P2UA 2BFLA 4PVTA 2BFZA 3BC2A 5KIKA 4F6HA 2BFZB 4WD6A 4H0DA 2E7YA 4RM5A 4D1TA 2NZEA 4P62A 4AWZA 2FU7A 3T3OA 4BP0A 3ZR9A 2FHXA 2BC2A 2FHXB 4HL1A 2FU9A 1Y44A 5ACXA 1A7TA 5B15A 3VPEA 4AD9A 1X8GA 2QJSA 2WYMC 4C1FA 3SPUA 2AIOA 2Y8BA 2BG7A 3TP9A 3A4YA 2BGAA 5FQAA 3WXCA 1L9YA 2BMIA 3X2XA 3MD7A 5HIQA 1E5DA 2YCBA 1HLKA 3T9MA 2BFKA 2ZNBA 3X30A 2FU6A 2P4ZA 1JT1A 5HH5A 2NZFA 3IDZA 3KNRA 2YNTA 5LM6A 4GYUA 2YNTB 3BV6A 4RAMA 5ACQA 3IOFA 1DD6A 1BMCA 2I7TA 4NQ5A 2WYLA 1VGNA 3F9OA 5EVKA 2CBNA 3R2UA 1WW1A 1QH3A 2Q0IA 1ZTCA 2M5DA 4C1HA 3JXPA 3AJ3A 2XR1A 4ZO2A 5LCHA 3SW3A 5B1UA 2GMNA 3QH8A 2NXAA 5LCAA 4EY2A 2WHGA 5AXRA 4RL2A 1YCGA 5HIPA 3AF6A 5LLDA 1JJEA 3SBLA 1DXKA 2WYMA 5ACSA 3DH8A 2A7MA 5ACPA 5K4KA 5ACRA 4RL0A 4YSLA 5EVBA 2Q0JA 2YNUA 5K4MA 1A8TA 2QDSA 5HH4A 1WUPA 5A87A 3X2YA 2FU8A 4KEQA 5A0TA 4PVOA 3BK1A 5LCFA 1KO2A 2P1EA 1YCFA 2H6AA 4GYQA 3S0ZA 2BG6A 4FEKA 4C09A 2GCUA 4EYBA 1K07A 5HIOA 2M5CA 4O98A 2I7VA 1ZKPA 2DKFA 1X8IA 4NQ4A 4LE6A 5AHRA 5LS3A 2FK6A 2QEDA 2QINA 5AYAA 3RKJA 3IOGA 2AZ4A 1X8HA 1KO3A 3RPCA 4AX0B 2P18A 3I15A 4Z5YA 4GCWA 4J5FA 4AWYB 1BC2A 4HL2A 4U4LA 4TZ9A 3T3NA 2YZ3A 4EXYA 2DOOA 4KEPA 3SD9A 4CHLA 5A5ZA 5LMCA 3IEKA 3VQZA 4BZ3A 2XF4A 5EWAA 3KL7A 1ZNBA 4AX1B 2GFKA 4TYFA 4D1UA 1WUOA
chains in the Genus database with same CATH superfamily
1ZH8A 4RPHA 1ZLXA 3UT5B 1U0TA 3HK0A 5JS7A 3ZHCA 3MBIA 5HWSA 1TUIA 5JNSA 1M0SA 5KSPA 5FBZA 3NW9A 1K8RB 4YYEA 3AKDA 4IFTA 1W581 4ZAWA 3BD8A 3RC2A 3L41A 3R8BA 3BILA 3MFYA 4KSBA 3A4VA 2Q6IA 2QRVA 3BMNA 4BC1A 2A14A 2VHQA 9LDBA 5K8JB 1FFCA 2C58A 4NRDA 4LBVA 5EMHA 1KIAA 1NKSA 3EGDB 4A2QA 4N0MA 3B1VA 4RV9A 1MVLA 3JVIA 2OV2A 2WWHA 3CMCO 1R8JA 1YR6A 3TSCA 3U4EG 2ID9A 4ZYWA 2CGEA 4A9AA 2XDAA 1ZO8A 4YTPB 1YB4A 3MUOA 1MB0A 1R7SA 4RULA 5JLAA 1OAKA 4MGKE 3KR0A 3S1AB 3L7KA 4R9NA 4EJFA 1E66A 2Q6TA 3P9RA 3PNBA 3BIWA 3KKKA 3LKZA 3BTUA 3QUAA 4GBGA 1GTZA 4V3BA 3R7SA 1CXZA 1XTRA 1JDBB 3GBPA 2R8PA 3UXMA 3PVCA 1KJNA 2L18A 4PC3A 1NLYA 3HS3A 4XX5A 3TMAA 1ID1A 4FJYA 4UEWA 1ZVKA 1MU0A 2P1RA 1Y8QA 1JBQA 4EEXA 4B6JA 2CC2A 5BT9A 3CRZA 1OASA 1QH0A 1EVLA 4UE3S 5LCXA 3DOIA 1JRUA 1AKVA 2VJKA 1C8BA 4FGJA 2GRUA 1IM5A 3ZJ4A 1XTTA 5GONF 4B47A 2FG6C 3NHUA 1K5PA 3GG2A 4C0JA 3GEHA 2QMHA 1ZN8A 4MGYR 1B14A 1U2PA 1T4MA 2J33A 1YC2A 4QYTA 3N32A 2A8YA 2NTNA 3QX9A 3TD6A 4WERA 1Y5LA 5TR9A 1JH8A 3WANA 2RPQA 1M1NA 4ND8B 4ZV9A 2JHFA 3P9KA 4E5SA 2YEPB 1M3SA 3PT9A 2DWOA 4Z9BA 4QGBA 1MTOA 4ZARA 1Z0AA 4DSOA 1L5NA 2PUBA 3SZMA 4ZEMA 1M7BA 3AVWA 4KPFC 4J7CA 2WYLA 4I9HA 5BUQA 1RLIA 3RZWC 1M4VA 5LWQA 1ST3A 4C1HA 1Z5GA 1FJ2A 3K8ZA 2NO7A 1ID8A 2QAIA 2XNDA 1QORA 2J7KA 1Z12A 3D4LA 2VP9A 4ME6A 4M87A 1A5BB 4QOJA 1JMYA 5D01A 5DSZA 5B55A 1Z5PA 1S2LA 2K25A 2R1ZA 3OZUA 2NPOA 4PYRA 2HYIC 5LXTA 5JYDA 2Q5WD 1RFGE 1K8XB 4G4SO 3DPSA 2WYIA 2IDZA 2JUOA 5F7JA 5AIJA 3NHRA 5CA1F 5G5HA 1LDEA 3LY9A 2IXGA 1WMBA 5IH7A 4LNNA 5HG2A 4P7JA 2XECA 1Q77A 4XIFA 3CUEF 3C6ZA 4BLWA 3IXSA 4D8UA 3GCDA 4MWOA 1PL7A 2VAXA 2V5UA 3VHQA 3RPFC 3KQHA 1TAGA 2V54A 2FUCA 2A9RA 3KTAB 4B0MA 3UICA 3S2YA 5KNDD 2WYWA 1NG1A 1E9AA 3G1WA 2X0NA 1CULC 3JQGB 4AU1A 1VHDA 3H8WA 3E22B 2WF8A 2M2IA 1M94A 4CUZA 2KANA 4Q9DA 5KQSA 4QM6A 1WO8A 3AL3A 2WFLA 3GZJA 2J6HA 2C9BA 1XCOA 5AHOA 4GOOD 2VN8A 2J5KA 4RNCA 4TQAA 1ZH6A 3D4IA 1IMOA 2C4HA 1I6WA 1X80B 2J7PD 3C24A 5DBIA 5JALA 4X9XA 2KQ7A 2J6BA 1AGPA 1RKQA 3BIID 1TZOA 1H2YA 4WXHA 2AHRA 2PLFA 3GB1A 1T36B 3EVTA 5J5VA 3WC4A 1RZRD 2RGNA 1SZDA 3EFBA 3Q88A 4QOIA 3C2QA 4W5JA 4G4JA 2K5UA 2VWPA 5LQMA 3I4CA 4DIDA 4FLEA 3GGPA 1YR1A 1XTKA 5DX0A 2ID7A 2AZDA 3C3WA 4E2WA 1YN3A 1OWLA 4KIUA 2WRSA 2IL1A 1QGOA 3P2BA 1CIJA 1XVLA 2WHPA 5KSZA 3QVXA 3HO1A 4NPCA 3MUEA 2MHJA 3EZLA 3IDOA 4QOSA 1ZDXA 3GNSA 1ES9A 2ATEA 2X7JA 3N3BC 2VHYA 2CHFA 2Y4NA 3RJ5A 3O03A 3ETJA 5I51A 2WQYB 4I9GA 2WICA 4BECA 2VNJA 1X42A 1CRPA 2YWXA 2ERCA 1X87A 3V4RA 3RNEC 1AG9A 3G8BA 4JLAA 4TKMA 2PX5A 4H1UA 3I6QA 2WU8A 4K3CA 3VU1A 4OQXA 2IPKD 1WX9A 3VRHA 2XRFA 4NNJA 4HFJA 4WOJA 4KPUB 4HP8A 1NXXA 2R4TA 3BGSA 3C1UA 4WLNA 4HDRB 2JH3A 2JGJA 1O94C 4HYTA 1Z36A 5EPEA 4E1BA 4QBTA 5KNDH 1L0XB 1G55A 4OJYA 2Q4RA 2R5WA 4RA6B 1DHRA 1JG1A 2XA9A 1C3EA 4E2YA 1P4RA 3M2TA 3BC1A 1N2CA 3OWHA 1ECGA 3U4HA 1H2FA 1U7XA 4TL6A 1QXSA 2DAPA 5D3MB 3QXSA 1EEHA 2K8CA 4BP0A 5AI9A 4W1PA 2PV7A 1M34A 5BW6B 4HT3B 5JJCA 1WYGA 2WJIA 3PGVA 5E95A 1WX7A 4ZCMA 5CUQA 3RYIA 2NWQA 2ZB4A 1OR8A 1EHYA 2BKLA 2R6ZA 1PYWD 2YWEA 5JVDA 2PUDA 3IAS1 2RCNA 2EQAA 2LTAA 3SF0A 5C7IO 5BN4A 4HGYA 5AK3A 1W2GA 3RVNA 2M6RA 2Q50A 1IPGA 3H2BA 5E9WA 1JT1A 1QRTA 3WFZA 1ML4A 3GNLA 2X58A 1YIWA 2XH8A 2WWYA 3J81A 2BFNA 3QJGA 4IYJA 4BDSA 1PR3A 4BP3A 1PX2A 1UWLA 3IUPA 5TMBA 3QUTA 5K5EA 3CZMA 1MPEA 4MV1A 4BZZA 4JZYA 1WKBA 1P2VA 4NS4A 2PGOA 4KBFA 3CUWA 4ZOLA 1RJFA 4LV6A 2C9WB 4XB2A 3H2SA 1GHTA 3IHTA 4FWBA 4AI6A 3ILYA 3T0IA 2D5IA 1ONBA 3E9MA 2C31A 1DZIA 2E49A 1TGZB 2CLCX 1LUAA 3UAZA 4CFZA 2J0UA 1ET6A 1LRKA 1OWNA 1OXXK 3VI3B 2RDBC 5J2RA 3B1KA 1SBHA 4AJ2A 1KH3A 3DVAB 2CF6A 4NZZA 3RC3A 1JZSA 1VSTA 2R4UA 4I55F 4KFSA 2WJZB 4FC7A 1YF3A 3H97A 4BZXA 2D5AA 4PSKA 2PEAA 5AW3A 1U5AA 3OJ4B 5IBCA 3L40A 3CZ9A 3PJDA 3OQMA 5AYAA 3MC1A 5CHVC 4BP9A 2FSVC 5K4HA 3VR6D 1BA3A 2X2FA 1G6Q1 1JHXA 5TB5A 5I3ZA 2EFYA 4WECA 1R6AA 4F9GA 2E0IA 1IQ0A 2B82A 1EFKA 2P9CA 3THXB 5CB8A 1Y1TA 3ABIA 3SM3A 5IT9A 3U44A 2DCMA 3OOEA 5DN6A 3TGWA 3VSBA 1O4WA 1I4LD 3E5MA 3R7LA 1BXRB 1MNQA 1XRNA 3A3PA 1S8OA 5IKMA 1ILWA 1ICEA 1NBEA 2D5BA 2I8LA 1UGMA 5JJ5A 2YWFA 4BE4A 3RJZA 5C2JB 4ZEJA 1DQSA 3A6FA 3AX6A 2X5XA 3E9RA 2IEYA 2JGIA 3PHXB 1OH7A 4DCGA 4L8VA 4Q4CA 3L0CA 2AD1A 1U80A 2AL7A 4YUAA 3NDRA 3ED5A 3MCWA 3ORFA 2H29A 3QW4B 2AWOA 5FQOA 2VT7A 2E48A 3PL1A 4MB6A 4JB8A 1DWQA 2Q45A 1ZWLA 3COVA 2QVCA 3TO5A 2ZR8A 4PZLA 5IYZB 4NJMA 1N0WA 2R3SA 1ZOSA 3F1KA 2RGYA 3OC6A 2X5NA 2KAJA 1IUEA 2QSDA 1QR2A 4PC2A 3JSVA 4WH0A 3ENKA 4KNWA 1AYFA 3GFTA 1CY1A 1IVSA 2FQYA 3B3FA 5BMHA 4MPTA 3DAFA 4MIYA 4CLRA 3M3PA 2B98A 3KUDB 4H17A 2G5PA 4S17A 5IULC 3OOSA 4MDKE 4DM4A 1CJKC 1G291 5E6NA 2GTPA 2IPLA 3DFKA 1VL8A 1Y5NA 4B7AA 3S44A 5IK2A 1A50B 3K4PA 1J19A 1FMJA 1VL5A 121PA 1G6HA 2FR0A 5A9SB 1FPYA 3GUVA 4XYCA 1K86A 2O1SA 1USUA 4ZVQA 5IT4A 4LGYA 4LQLA 2KVRA 3WLSA 3GLHA 1P9LA 4MDYA 4J0IA 2J9ZB 2X4IA 3I2KA 2BZSA 3P9PA 4K6HA 1YBHA 1O96B 4Z1MA 3UATA 3TGPA 3ZE1B 1V3VA 3RYCB 4IMJB 1RRMA 3ZJVA 4Q0MA 4MXDA 1A4RA 4M7RA 3ZGYA 1LX7A 4OAOA 3E23A 3HTXA 4R1SA 3AEKA 2DETA 1LBSA 2D3CA 2NZEA 1TKRA 2PLRA 1Q1EA 1RTTA 2DEUA 3OQVA 1P4HA 4I36A 4K7JA 2P2NA 5BR4A 1UKVY 4D3SA 3TGLA 4CKBA 4Z9FA 2QQ5A 3G0HA 3L77A 2QTLA 3NS7A 1QZXA 2AG8A 1ISIA 5IZCA 2VF7A 1KOTA 1J0GA 2PMFA 3BEDA 5BSVA 2MR5A 3DDHA 5ALDA 2VDKB 2HHHB 1M66A 3AWDA 4NMHA 1V1RB 2V6JA 2F1OA 3PUVA 4AN1A 4Q16A 2NM0A 4WNAB 4HJXA 4D74A 3O2JA 2ZRGA 3OQOA 2X8JA 3VDMA 4FUQA 3LP8A 3CSUA 2P9FA 5JSYA 4Z9YA 1OTYA 3A6GA 1CUZA 1DHTA 4R5MA 1IVYA 3N8NA 2AR9A 2VPPA 2YCLA 3I30X 3WLFA 2IOFK 4WQMA 4QYMA 5FYQA 4X97A 2F48A 2QZSA 4MUMA 1Y9DA 1KP2A 2B99A 4L6CA 3IEUA 2BGTA 2VO1A 4O63O 2Z5VA 4RSGA 4ZEOA 4EMTA 2A1TS 1RYDA 2DUJA 4KIJA 1YAHA 2AMVA 3F5FA 5IKEA 2ZT6A 1NENB 3U3ZA 3GP5A 4MIKA 2TYSB 3HZHA 3OF2A 4UBMA 4LNAA 2X22A 1T9DA 1VCMA 3NC1C 1KO2A 4BMPB 3ZVVA 4GYQA 4S0RA 2TMGA 1JTVA 4EW1A 1E8MA 2BR4A 1NDDA 1XR3A 2WMYA 5LXTF 2FZEA 3EQZA 3TRKA 1H1LA 2NYVA 2JAXA 1TVMA 3L02A 4NIMA 5AZHA 4UAVA 2HV9A 5D86A 5KJ6A 5FR1A 3Q12A 1HF3A 4PLPA 4ARSA 3PFKA 2P4UA 4QZVA 5IF3A 4BCDA 3ADBA 3AR9A 1KC1A 5TQJA 4EFLA 4A8TA 1FDVA 1VE5A 3RHZA 4FJZA 4AXBA 1P6QA 3DLTA 2XCTB 2DP4E 5KHOC 1W5TA 4DLVA 4TQ0A 4JR1A 2P30A 4U6QA 2PXXA 4G63A 4BO0A 4TPKA 4RMIA 1B41A 3KLOA 4NATA 2ZG6A 1SCKA 2AYZA 1V39A 2EBHX 4I1VA 3UMGA 4A27A 2FSIA 3DHCA 4JR2A 2Y27A 3Q15C 1QRDA 4RNAA 1SCAA 4M2LA 4CI0B 5C5EA 2QLTA 2NVBA 2BGJA 3V7UA 2Q7OE 3QIAA 4LDJA 1WCXA 3UMCA 3NPMA 3OFNA 4MWSA 1PGPA 4UCWA 4I8DA 1P0RA 3RAGA 4YCDA 1Y4SA 4MZXA 3PHHA 1YZUA 1ODFA 3P2MA 4HGPA 4HZUA 3MG9A 3ZU2A 3HH8A 3UHPA 3MJTA 4TWAA 2JAHA 1BU5A 1I30A 3E4CA 1SXIA 3F4KA 1Q6YA 3PB3A 4G5FA 4U6NA 5EZSA 3UJCA 3PRYA 2CCGA 3ENEA 1QU2A 1I7NA 5EEHA 2QEJC 1CUXA 3RODA 4B32A 3KB6A 3I3SR 2ZIUB 1KMIY 5J1TB 2PGNA 4WI1A 1O95A 5E6RB 2OQIA 4S1TA 5ACWA 4F1SA 4TL9A 3X0DA 1ECPA 1REQB 5DLQC 1P1AA 3BMQB 1E2IA 1RYMA 1TT7A 1R5BA 4NQ2A 3WLPA 4UOEA 1HA5A 1ORRA 4AZWA 2WAYA 1X8XA 3GQVA 2X13A 3LSYA 5KX5A 4P4SA 2QRMA 2I4IA 3P19A 2JGAA 1AS0A 3CX8A 3RAEC 3U7EB 3E61A 4XDYA 1L4MA 3EIOA 3AI7A 3B08A 2GUGA 3SEQA 3RMKC 1BVRA 3H3FA 2ISQA 5D7NA 2XVMA 2BBSA 3EECA 3IAM6 1KRWA 1XMQB 2PUAA 1WZ3A 3OJWA 1T0SC 3FVRA 5LDGA 3HLTA 5D94A 4MKXA 4NBLA 1ODIA 3H6NA 1XD2A 2CNWA 5GIOE 3TXAA 3ESXA 3TJPA 2Q3JA 4IV8A 4QU9A 1BGVA 1M2EA 5KYKA 1YDHA 2WZBA 2F1HA 4BFVA 1J8MF 3PREA 1WPGA 4QXRA 4ICUA 1C81A 2XDWA 1H3NA 3VSCA 1PR0A 4KE6A 5JVDF 3ZJTA 2XXAB 3QVLA 4TL7A 4UNQA 2LFIA 4U2KA 3WKBA 3JQAA 3PGLA 3KZKA 3GOQA 3FTQA 4MICA 4M8NA 1TFRA 2IYPA 5FOSA 1QC5B 4MMYB 3C6KA 3MHZA 1Y42X 3KUKA 4BE7B 1XEXA 3DC2A 5SICE 2JATA 4ZOLF 2WWVD 3SHQA 4PE5B 1QANA 1DXKA 1VRAB 1JTFA 2JLUA 3M6UA 1W1UA 2PH5A 1MMFB 3AY0A 3VPXA 4NVRA 4WZBB 3G7NA 1JU4A 1W36D 5EKXA 2FN9A 2FPGB 2ISCA 3EXIB 3I5XA 4FCCA 2HMWA 2OO3A 4YMSA 1M2HA 1ZK4A 2FSPA 1XQYA 1JEQA 1GLVA 4WH4A 3I1JA 4C5CA 3ANTA 1G8GA 4X8HA 3SI7A 3Q3MC 3G68A 3FMGA 4ZWNA 5IMBA 4EF5A 4DDKA 4D0SA 4Y2QA 4P93A 2EWMA 5JARA 3GJ4A 3RUAA 1MW8X 5KOHA 3HKCA 2GK7A 3IAUA 2VPIA 3C41J 2X86A 3EVNA 1U11A 2BJHA 3X1WA 3O31A 3Q8XB 4FXOA 4GNRA 3G59A 2C8VA 2SECE 2JIRA 2BR3A 1Z8NA 2K22A 1FDRA 4CU5A 3G9ZA 4B74A 4AY5A 2RD0A 3MWJA 3ZZUA 1DV1A 3P63A 3FX2A 4X95A 2LUEA 4JI0B 1U7DA 4NOJA 3TS1A 4F7DA 4ZHPA 4CKZA 1GVNB 4FHFA 2HA3A 1WXHA 2VJBA 2VK1A 1IBLB 1BG6A 4ENTA 4X64B 2G82A 3TOVA 1C9FA 3NGLA 5KMGB 3UQBA 4QEZA 2BWES 4JPSA 1CUFA 4WA8A 3PQ6A 4X8OA 1U4AA 4K46A 2JCYA 3GGCA 5HM6A 2RDMA 1RADA 5ARBA 4J7UA 2J41A 3KYDB 2MOKA 4JEHA 3JQQA 3K9NA 1CF2O 2PQ2A 1WHSB 1KMQA 1XBTA 1YNSA 2QOEA 4WJZA 1OFFA 4BJ3A 2O23A 3SEZA 3LHIA 3DHVA 2ZIVB 1YKFA 2R8RA 3KDSE 1BAPA 4HXFB 3E5NA 3HYCA 3I5JC 3SKXA 2A6PA 2O6VA 4P36A 5DU2A 1ZSYA 3A6EA 5LP6B 1H8HA 3WB0A 2XE4A 1PO7A 3Q8AA 2XY4A 3PFIA 5BQPA 5EE1A 3X1ZA 4RPLA 3TRIA 4P3NA 2DF8A 3UFBA 5ALFA 4C0AC 5DULA 1WUJS 1OFUX 4EZLA 2K5PA 1RQ2A 4FN2A 4LHEA 3GJXC 5C5CA 4EVIA 1P31A 3PC8C 3MFQA 3PD1A 2B7CA 3M5WA 4CCYB 3WLMA 1NMYA 2AFRA 1FSGA 2B30A 4UM5A 3TKLA 4DQVA 2QRPA 1T9HA 2DT5A 3AWIA 4H0DA 1GAWA 2G1UA 2HSJA 1MLDA 5KWSA 4AWZA 4JT4A 2VDOB 4QNNA 5GZ1A 3BB4A 1OXSC 3DCJA 1RWBA 5B15A 1U3DA 3M5PA 3N75A 2FWRA 1D1PA 3QIVA 3DKKA 4AROA 4WFJA 4HEJA 4K3BA 2W2QA 3FM9A 3WXBA 2H9YA 4Z4QA 2WJ3A 5ETJA 4EG0A 1NKTA 3HJFA 4OJQA 2WKRA 2G83A 5EERA 4MO9A 1H4QA 2FUNB 2XZDA 1U3WA 1HWYA 3IVAA 1ETHA 5JJIA 4Q2JA 2XDQB 4FFBA 2YWJA 1ZUNB 3GHHA 1GOZA 3DYVA 5IVKA 2DWPA 5FOVA 2BW0A 5TSSA 2K1FA 2BJVA 3E8SA 4MITA 5BV0A 4LE0A 2FGKA 4QBFA 3CF0A 4MUKA 4ARIA 4MRAA 4MVJG 3RTDA 2WV9A 2EKBA 2ZRIA 3QOFA 3ZUGA 3T38A 1WD5A 1E1LA 4PNZA 4AP6A 1G20A 1VCOA 1Y4AE 2CJXA 1VHTA 3Q3NC 2OZEA 4LJ9A 1DJNA 1OFTA 2ZPUA 2ZYVX 3SMVA 1MG5A 4CPDA 3RSGA 3WBBA 4CKEA 2DBZA 5F2OA 2GHIA 4TSFD 3TSYA 3WV5A 4GOKA 1MGOA 1OX6A 3C39A 3SWWA 2AX4A 4BVHA 5B7GA 3AH8A 3WWOA 2FCAA 4HNAB 4CFYA 2Q8PA 3GQBB 2XA1A 2GM9A 3OCUA 2LGDA 4UDYX 1PDXA 2KMMA 2XODA 3IOGA 1M2WA 2C7PA 3IOMA 1B8PA 4GR5A 2BGFA 1SG6A 2A35A 4NYJR 1JWLA 4DR4B 2P65A 1OI3A 3PLVA 5A5ZA 4RV5A 4KO3S 2GI4A 3VOTA 4RPKA 2NS5A 2P6OA 1QIJA 5IH3A 4A55A 2V4UA 4DR2B 4PSDA 4C43A 4JL6A 4DHEA 4RXMA 2KQUA 4OGLA 1YQWA 3GHYA 2KE5A 4PZDA 3EIUA 4II3B 4GEGA 5H59A 3VUWA 3UJHA 3V46A 1ORWA 4BWFB 5L4NA 3OFVA 1CUVA 3N1YC 1K3UB 1OFUA 3IUYA 4LK2A 1GR1A 2FWBA 1Y6JA 3OZXA 4C2BA 1C29B 3MS7A 4F92B 1JIKA 2C7RA 3EGIA 4PZ0A 2HAEA 1DB3A 1ADFA 4KLZA 4IDCA 5HTKA 2P79A 5IAAC 3EMKA 3W9UA 1JKXA 3GRFA 4JCOA 3M82A 1QFJA 1WE6A 4RTSA 4S05A 1E9BA 1IUKA 1YDMA 4E30A 1NQAO 3TZ6A 3T1TA 4DIBA 1GUAA 5B6IA 5ABPA 1RWSA 4FLFA 4XX0B 3WKCA 1I33A 1W73A 4F6ZA 2WSYB 4V0SA 3B6EA 1IHUA 4FOOA 1U0GA 2PYIA 1YOVB 2JGKA 3FKJA 4TUUA 4PRZA 3GXOA 3H4VA 3DT9A 4YRCA 4L8WB 4D9BA 3GGJA 1SIUA 5IJ9A 5ITZA 2HO4A 4U3JA 4JLNA 3GLKA 4ZVOA 4UU8A 5AVWA 3BSSA 2NVUA 1M1YB 1IG3A 4ENQA 2NZUG 2UYZB 3AOEA 2X6TA 3G88A 5LZ4A 4AZ3A 4L0DA 1DG1G 1SC4A 1NFFA 1J8VA 3JXEA 5F5XA 4J2OA 1QMGA 3FCZA 2AEHA 4HBZA 1LPSA 2HT6A 4OZAA 1V1MA 3GUYA 4BMDA 4ARAA 5IJ0A 5D6OA 5BYJA 4C4PA 1Z4OA 2WYHA 4HDSB 3EUAA 2ZPYA 3AVOA 4GKJB 4IWXA 2BS4B 1LY1A 1MF7A 521PA 1KDOA 4GBMA 1WXVA 5KX5F 4PLYA 3IAM1 4RJJA 1O87A 3JW8A 4U5XA 4OQZA 3KYJB 3WNDA 2BFZB 1XTIA 2C7VA 2ZOSA 5B1EA 1MB9A 1TAUA 1PK8A 1RDFA 3NRJA 3QC8B 1UBQA 5JQGA 1VE7A 4C0QC 3D8NA 5E6UA 5HIAA 3A10A 1O0SA 1U3VA 3AZQA 4AJYB 4O29A 2H1FA 3UIOB 3EK2A 1FVFA 1JR3E 3FVVA 1L9XA 1WXIA 4QTYA 3A32A 3ETGA 5FP0A 3TCNA 5C37A 1ENFA 3SJCA 3SKVA 2R6R1 2VP6A 5BRJA 2JHAA 1V49A 1XEAA 1G2PA 4P58A 5C1DA 4ENUA 4M9XA 2W6CX 5LD2C 4GOND 2HV8A 1FVHA 3EW7A 4NQ5A 1ZPSA 4A1FA 1DOIA 2A5LA 1PGAA 4F60A 3J80A 2GI9A 3VPAA 4W9GA 4O4LA 4JXKA 4WBSA 1HY3A 1X1SA 1TYGB 2NUAB 3QH8A 1M2VB 4R1OA 4P3KA 2X0IA 4IICA 1PGNA 5CH3A 4S1PA 4HKZE 4RK1A 3H8HA 3V60A 3OMWA 2VYND 3C0RB 5F73A 5DGXA 4ZVMA 4Q1AA 4QOEA 3BG5A 3KALA 3QXXA 1NAHA 1MO4A 1HE5A 3PPAA 1RXEA 1M74A 4TRMA 3X2YA 2XSZA 4RZIA 2H31A 4C30A 4IKGA 1M5RA 2CMKA 2WJYA 3MWYW 3VZQA 2QN3A 2B1JA 4ZXPA 1R5JA 1UGJA 3NZUA 2LD9A 3NJ4A 1NG9A 5KC8A 1JJAA 4AZTA 1JFFB 3DC7A 1XEWY 3ED1A 3A28A 4FFWA 2X9NA 3JYQA 3HNRA 2GAFA 5ADHA 4GPIB 5CLHA 4GCWA 1EH5A 2BC9A 2HJGA 1R18A 2WDPA 3I53A 2EQ5A 1VL1A 4EB0A 5FV4A 1OBFO 1W47A 3F46A 4DREA 5LMCA 1D5WA 2OQRA 2W8BB 4NPHA 1PNQA 1FFEA 5DBEX 1IZYA 2P4HX 5IG2A 3NP9A 4UREA 2SCUB 3C98A 3HUIA 1MABA 4LZOA 4HX9A 5A62A 3G9XA 1RHRA 4Y0NA 1PYOA 3P71T 3TW4A 1RLUA 2Q0QA 1XZKA 2Q21A 1GZ6A 5ALMA 4NE9A 5CM9C 3F3MA 4P80A 1TMYA 3QK0A 1P3Y1 1XF1A 3VGPA 4I1SA 5E3IA 1GTJ1 2WFZA 3JWGA 3T34A 2O59A 1E6UA 4EAQA 1FYXA 4EKDA 3KKPA 1T5HX 1HGXA 1Z8HA 3U37A 4DMUB 2QXUA 2LR0A 4Q1BA 4C2TA 3TD2A 4P83A 4ZEXA 4LHXA 4EO7A 1XRSB 5DNVA 5TPWA 1ZJYA 3V8QA 4XUCA 1F2DA 1UAYA 2H07A 1YA8A 1IIBA 2JJMA 1U04A 2O50A 2ZK7A 2LZ6A 4D1WA 1VKNA 3OFKA 4RNDB 2V6FA 1ONPA 4C4XA 3PDCA 3UYLA 3C43A 4NJ6A 2FJPA 1PE0A 5F3RA 3AFHA 3I8SA 4FJ2A 2IRWA 5EIOA 2QRNA 3WMEA 2O8FB 3IAS6 3Q8WA 2I55A 3Q6BA 2XD4A 1QX4A 2DFLA 1E8WA 4YCMA 3O8OA 3EDQA 2CNNA 2G0AA 4EZKA 2HQRA 1UJ2A 4P54A 3BREA 4QU5A 3ERCA 1CZPA 5HW0A 2O0KA 3PC2A 1R3UA 4UXJA 2BP7A 2XMSA 1BDMA 1TRHA 1L3BA 4Y6LA 3I9NA 3G2PA 1KYQA 1MC1A 2ATCA 5ISMA 5JBNA 3CONA 1C3OB 2HIGA 4PYLA 4ZRJA 1EIZA 2VZ0A 3PGA1 4B43A 4JL9A 2W00A 4LOLA 4FYIA 5M34A 4TUYA 1MA0A 2AK3A 1M76A 3DDCB 4XKJA 2W0MA 2EX0A 2ZWMA 4D2KA 4C7BA 4G0VA 4I2VA 4GU2A 1T9ZA 2XA2A 4RD6A 1BJRE 1YD8U 4AWJA 2P40A 2OP0A 3AU4A 1VPLA 2MYUA 2M1MA 3ONNA 1VCBA 3EQ7A 1WETA 2H17A 4PYOA 2PUVA 1F2TB 2ZIEA 4XZ3A 4PHHA 3HKBB 3VAZA 2GXAA 4JX8A 2JGMA 5K20A 1WDLA 3QJ5A 2VH1A 3AZPA 1E0KA 5FPPA 1EUQA 4FFOA 1HRKA 1YJ1A 4NXNB 2HJVA 4UPEA 3DNPA 5DCUA 4MGZR 3K73O 1GA4A 4NBWA 3WNQA 3LK7A 5BMVB 2BW2A 2EYQA 1RAAA 1H8EA 5AM5A 5FTKA 2GZ2A 3D6JA 5DPTA 2IWHA 4UEJA 3EISA 3CSTA 4PLCA 1ZUD2 2ZVOA 4QXAA 1NGSA 4OW0A 2QPAA 1QE3A 2UZ0A 3OOYA 3U48A 3GLFA 1KSHA 2QAGB 4IIBA 3ABZA 4RZXA 2FN4A 4L8YA 4QA9A 2V5AA 8LDHA 4P16A 4RHEA 4BB6A 3SR4A 2B2XA 2Y1KA 2DFNA 4TRJA 3TBHA 2WNIA 4IYRA 2VAVA 3HDTA 1TZCA 3FBTA 4OHMA 1LB1B 4JJGA 3BGVA 4EYOA 4FGWA 4GXRA 2D1QA 5BSMA 1XPJA 3V6CB 4FZRA 3ELWA 2CDAA 5BSEA 4DGSA 4W9MC 4EUTA 1WF3A 4AKHA 1XWIA 3PEVA 2REXA 1UMKA 2DECA 1I0IA 1DRJA 4CHGA 3W8NA 3KPUA 3UENA 4GQBA 4Q37A 4JQCA 4WCFC 2BGLA 1R88A 4XSVA 5K3EA 2AXNA 4OBWA 3ZVKA 1JHPA 3V2UA 5C3JB 3A9KA 3TQOA 2BUBA 1YUNA 2NU7A 2NVUI 2BFCB 2EF1A 4B3DA 4B4UA 5HFJA 4BMVA 5LIRA 2NV0A 1JDJA 4RGMA 1C0LA 5HGXA 2ZM6B 3R3MA 1ESNA 3AVXA 5G2NA 4RPGA 1SE3A 4WRRA 4JQSA 2JGLA 3VH4B 1G2OA 2YOHA 2W6IA 2BFEA 3UINB 1OZGA 2AXPA 2WUFA 5MFZA 2C1ZA 1MJFA 1Q1QA 4P4TA 4BKPA 3HWX1 3O95A 3WOVA 1ZVQA 1R2QA 5DHRA 2QRQA 4CKCA 3GGGA 5BSUA 2Q5IA 3KTOA 3WFJA 1FTSA 3P9YA 5SY4A 1MQ9A 3PY5A 1IQPA 4YAOA 5HCNA 4N0QA 1N1MA 2ZVJA 4QPDA 2Q4EA 3F4LA 3IULA 4MJSB 2TSYB 4DSTA 2GEFA 1R0WA 4XDHA 3OE7D 2BHNA 3EH1A 4RE6A 4WCFA 1WXFA 1X3LA 3K15A 1VMKA 1UC5B 4WUVA 2YDYA 1C14A 2O0JA 4BVAA 1SVWA 3QUCA 4DJJA 4X8LA 1SUCA 2Z5GA 1B1AA 3N7TA 2I03A 1YZHA 5SZJA 3SQXA 2NSHA 4KZKA 4D8XA 3CBGA 5ER6A 2FWMX 1GAXA 4LLGM 1FQKA 2BFMA 4G5GA 3WLRA 1XVTA 1QUEA 4QUKA 1AKNA 4RQUA 1NULA 3AJRA 2JASA 3UF0A 3QKIA 2V4IB 3S8EA 4L4RA 1NPYA 4QHYA 5FI1B 2ZJ7A 5CYOA 2X0RA 3SM9A 2HF9A 5K03A 2FWJA 4URWR 2KO3A 1WSBA 4QO7A 1X7HA 3MM4A 1QVWA 1ZC4A 5D3KA 4LKRA 4QXPA 1KZHA 2G07A 4Q4LA 4GP6A 3FSGA 3OJ0A 4EKNB 2EJBA 1YC5A 3IUJA 2HJ8A 4MW9A 4YT4A 3KJHA 5EV8A 4XFKA 1UPAA 3KYCB 4FI3F 1QQ7A 3F6RA 4EZBA 3SXUB 1WF9A 3LL4A 5EV6A 1PAUA 2A9FA 2I6FA 4BGIA 2O07A 1KIMA 4OK5A 4Q66C 3KJEA 2KK8A 4H1WA 3DOUA 3W5VA 2QORA 3SXJA 4KVGB 3A1FA 4KXFB 4IWYA 1NBME 3QARA 1F60A 1EFVB 4DV7B 3T3OA 4F4IA 2ECKA 3UUWA 5E2BA 4G2NA 1EBBA 1FXUA 3HCPA 4WK2B 1LK5A 3W8DA 3W5UB 1U0FA 4K1RB 4DV0B 3QEOA 2ZS7A 4AO6A 2RGNC 2B94A 5JQGF 1BW9A 3OAAD 1OVMA 4HPXB 2M19A 2IZ1A 1NJ1A 1KI9A 4EYEA 2WJHA 1AK9A 3ZHYA 2VUIB 1TNDA 2I7TA 4MHSA 4MOWA 3LZCA 1D4FA 1EWKA 3RJTA 3AHJA 4BBAA 3O94A 1W5FA 4BKMA 1ODJA 3UAGA 3KBBA 4WKOA 5J2TA 2CLIB 2NXNA 5E7IA 4F8YA 1UC8A 4INOA 4JWKA 1XMVA 5BQXA 3ZU3A 2PX2A 4OXXA 3NEPX 3PA8A 1X39A 1LQBA 2ZBRA 4HX2A 4ZYXA 4O4LF 5GJVC 2G63A 4HAVA 3HL4A 4GSLA 3ZUPA 5ACPA 2R6DA 4G9BA 4TKNA 1FTQA 2CLLB 4YR9A 1D04A 4K6MA 4OA5A 1UKBA 4YJGB 4YJ3B 3DEHA 3B9JA 1HR0B 3RWMB 3K9CA 2R1UA 3Q8BA 2O2IA 1A82A 1MIOA 4JDUA 5JS1A 2MIIA 4LDTD 4QBKA 1IAQA 1US8A 5AVYA 3ZIAA 1BCRB 2YUIA 3O4RA 2R8XA 1A1VA 1LXCA 2D0IA 1XPRA 3HYLA 4LMAA 3R7FA 1T6XA 2MR6A 2KWDA 2B25A 1L7MA 2QI9F 1VI6A 2ZTVA 3AF0A 1N5RA 1GKKA 1JAYA 2WABA 4DZTA 3SBOA 3HSSA 3VR3A 2G6BA 1RE1A 5ED4A 1SU7A 3KL7A 3UCEA 4KZPA 3ZWCA 4YAEA 2AZTA 3ZLJA 1VCNA 2HADA 4P7KA 2V3SA 4ZJYA 2OO7A 1AJEA 1VE3A 4A8JB 2EJVA 5DPXA 5JEDA 2DSTA 5CEEA 4LRYA 1W76A 4C80A 1P1RA 3QELA 3NRCA 5KQRA 3FNBA 1DAEA 1DBVO 3V1LA 3TE7A 4F3CA 3NU1A 2ZI9A 2ZIAA 5BWCA 4IWOA 2C00A 3A05A 1YCHA 1DCMA 1BXGA 5LP1A 3L4JA 3LBNA 3P4QB 3WBKA 2GT1A 2N9KA 3JQ6A 3NNDA 2XOEA 3ZWQA 1MOPA 1YKSA 4M46A 4GMHA 2C4NA 1J07A 2PVSA 3IIKA 4MA0A 5DYIA 2ZJ4A 3I73A 1VJNA 8MHTA 2BWFA 4X44A 2W2OA 2N75A 5CITA 2WU2B 5HIKA 2HF8A 4KQFA 3L7YA 2KQ4X 1AF4A 5BQOA 2Z6AA 5F3DA 4EX6A 5CX4A 2YJ5A 4PVDA 2RDGA 3PX2A 4C21A 2AKEA 1NW6A 4C89A 4UE2A 1M0WA 4EQ6B 4C03A 3MAAC 3ZE0B 1JHYA 2DH6A 3MLEA 3LP5A 1M8PA 4G25A 3R5JA 4G67A 2V9CA 3IA7A 2N42A 4FMDF 1HZJA 5J4LA 3PNYA 1N7HA 1T2DA 1W19A 4RF0A 3H2YA 4DY4A 3WL6A 1PWHA 3K0BA 3TLBA 4PGFA 3AILA 3KXPA 3X43A 4GYWA 3QMPA 3SF8A 3NYWA 5I7UA 4BB5A 2L76A 5HNKA 1WHTB 3PK0A 3H1AA 4F8CB 3M2PA 4PSUA 5BOSB 3QGMA 1OYWA 1ESCA 1TS4A 2B1GA 1OKKD 1Z37A 3O2SB 16PKA 3HBAA 1PLJA 4D3YA 2Y1LA 1DRUA 1JKJA 2R11A 3PKZA 3W2DA 1WUTA 5EUMA 4EZJA 5JCJD 2Y1OA 3DAPA 4TUYF 1SZCA 5B4VA 2JZZA 3U81A 2D8MA 2V55B 4JS0A 2Q5LA 2W58A 5CPBA 5K09A 1IPHA 1DO2A 3OURA 1AGRA 5GJWC 4RS3A 2AOXA 1V8ZA 3R1IA 3RSSA 2YMLA 2Z4SA 2VP2A 3NOVA 3R3JA 1RT9A 2Q9AA 4RETA 2PGIA 2ZNBA 2CUKA 4FYKA 5EZ6B 4Q24A 5GMVA 5B2FA 4K05A 1BQ3A 1WWKA 1N6HA 3FPLA 2H0AA 1YVDA 5J3JA 1ZVMA 1RM6C 2BEUA 5AYVA 4QELA 2K6QA 4YJHA 2WWIA 1QGUA 4X85A 2X1MA 3R66C 3WLQA 1T3GA 1I2MA 4W6ZA 4PBSA 2D4AA 5FBKA 4KJZA 2NV2B 1Y1RA 3LW7A 4CEHA 3IHWA 4QVGA 3QSYA 2XHEA 4EY2A 3DS8A 1J99A 4GX0A 4UCXA 1XDDA 1COWD 5H02A 3SBLA 4IOIE 1VCHA 1YE5A 4EI8A 4R51A 4EVQA 3EGCA 4E11A 3M34A 4BASA 4BCBA 2EFHB 1WS6A 3FFWA 3SE0A 1T4CA 2JFPA 3F6BX 3DMHA 1GEEA 1BEEA 1DJMA 2B3TA 2EFEB 3CSFA 2QTCA 1LLFA 1RAHA 4ZC8A 3IXQA 3JZFA 2AD5A 4DT1A 3FCXA 2YXPX 1FYWA 5TVKA 2PWYA 3T7EA 3PQ2A 2VDUE 5IWAB 3IVGA 2WJWA 1C7EA 3PNVA 5FLEX 2JWUA 4PIVA 6REQB 2NUPB 4Z9XA 1L7PA 3THWB 3ZCVA 1XXHB 3BGWA 3ZD7A 4EB8A 2XWPA 1X2EA 4HYEA 2IOQA 2JRLA 3CRQA 4WXMA 2WHRA 2XTNA 2BMFA 4OB7A 3F2IA 1TZMA 1E6WA 4L8GA 5H70A 4ESOA 1DAPA 2JL1A 1BD4A 2YFKA 1U2GC 1GGJA 5IZCC 3CZQA 4D1UA 1SMLA 3G8YA 1NJ8A 4LZAA 3JWEA 3LSTA 1X6VA 4DRXB 1QVZA 3LC1O 3TLXA 4TOIA 1VGVA 2PS0A 3AFOA 1QHSA 1KI8A 1FUEA 3ZNOA 1WMSA 2ZO4A 4E09A 4D02A 4OB8A 4Q3AA 3OHSX 3V6EB 4ZVRA 2JJ1D 1SRQA 3R0QA 3N5CA 1B26A 1TZKA 4MCJA 2PRKA 4Q21A 5J47A 4QYXA 4YXWD 4XQGA 2CUZA 3W1EA 4GG1A 3DFIA 1WDKA 2YFQA 1ZEMA 4Q01A 4KLAA 1TFUA 4H7JA 1KNXA 2CXOA 3MGGA 4RKRA 3ELDA 3OCCA 4BVLA 3GU3A 2WM9B 1P9EA 1ZRMA 4P1CC 3ZD8A 3V8NA 1M1YE 4R0MA 3HA5A 4AQDA 2PUTA 1VB5A 1E2EA 1E62A 1U2GA 2IH5A 4G07A 3BA6A 3FWZA 5C52B 4BO6A 1EBUA 2G5GX 2WAMA 4XYMA 1MJGA 1E0DA 3DW3X 5ACTA 3MHPA 2O48X 1DFHA 2Q5CA 4UVEA 4CLHA 1VZ3A 1B0PA 1LA2A 1YFZA 3MXOA 2I2YA 4FE7A 3VVBA 3WLAA 1OY1A 5AKXA 1MW9X 3WDMA 4OHUA 2NPTA 3RNOA 1HNNA 4HDNA 4L57A 3ZS8A 2XK5B 3F8WA 1C7RA 1MRZA 3JD2A 2HBQA 2YIVX 3SZ3A 1KL7A 4MCHA 4PO9A 1Z2PX 2PA0A 3I83A 1DE0A 5TMEA 2M4NA 4NQKE 3CFYA 1CDEA 1VLZA 5FD8A 4MZDA 3KAPA 3TXXA 4IIGA 2GB4A 5FHQA 2EIXA 2KSQA 4W8GA 1V1OA 2LWIA 4OSPA 3EW9A 3MTDA 1NRWA 1QYIA 1BNCA 3S81A 4HVTA 3R9WA 2BC2A 4GDMA 4ZQFA 1G4HA 1E3JA 4ZMRA 4K1LA 5FBHA 5JLJA 2ZPTX 2H2AA 2CXNA 2BBTA 4Y7CA 2N0SA 2ADOA 1LBEA 3PP8A 2BG7A 1HE4A 4P0QB 4LBYA 2PX3A 3X2XA 4F8JA 4AP5A 4FKMA 4PS0A 4AMGA 1BIFA 2VLIA 4UQLA 1D9XA 1V6EA 2Z30A 4PLWA 4RKEA 5E3JA 4BOZB 1R8QA 4AJNA 3NDBB 3WRYC 4M0FA 1Z47A 4W9RA 3N30A 4H77A 4HLDA 2HUPA 5EWLA 3SZRA 5F33A 1DV2A 3KHSA 1IHPA 2Q3HA 3LY8A 1LPOA 3SX2A 4ZV7A 3O65B 3Q3GE 2D2EA 1EDEA 2Q0HA 2YWGA 3BRCA 4MWTA 2QXYA 5LN1A 5K0FA 1E58A 2IYXA 1Z5OA 1ZBQA 4WN9A 1YT5A 4GDKA 2HDNB 3X1JA 2PUEA 3IQEA 1NUPA 1W4BA 3PU6A 5J2TF 1O95C 2BCGY 2LV8A 3DG9A 5EWMB 1F6BA 5COBA 5DSXA 3PFNA 4K9MA 3UMVA 1JPJA 1QNLA 4MRMB 4UTZA 4XDCA 3IIMA 1UNSA 3U3JA 3W05A 5M29A 4WDQA 3ZK8A 2IO3B 1IONA 1V6SA 3WRYA 1ZKHA 1QHGA 4QREA 1NR1A 3B0AA 5CFQA 3X1XA 2GKOA 4K3UA 2O7SA 5AJXA 2XMGA 2BGGA 3FYCA 2UYGA 5CH8A 3V4OA 3RV4A 1PZEA 3EAQA 4MJ3A 5HKBA 1KO3A 4MW2A 1UBGA 2YASA 1Y7LA 5E9JA 3HE3A 2GYUA 1FCLA 2XPCA 2PS3A 2CBGA 3UEOA 1WULS 4ZT4A 3RUEA 4PR0A 1GPNA 4J0QA 5SZKB 1QRUA 3CNHA 3ESDA 3ZHBA 3K31A 4JVLA 1JWAD 1G18A 3QVTA 3KXIA 4HNSA 3GOEA 2D3TA 2B4QA 4X60A 2HMSA 1VPTA 3IFSA 3GLSA 4WIAA 2H8GA 3CTMA 3S55A 4ZI5A 1X3SA 3CN9A 2HQSA 1T5TA 2V8OA 1N34B 4X20A 2O8EB 4BV2A 1ESFA 1O89A 3AXCA 1ULHA 4P3YA 5FWYB 4UWOB 1QK5A 3BIOA 3UMMA 1HL3A 1YULA 2YQZA 3AEDB 4RESA 2IPAB 4AMVA 3MPOA 4F9TA 1N5JA 4L75A 4KZ0A 3UK0A 3C7CB 3K94A 1XC7A 1SA0A 3DZGA 4OVVA 3RVLA 5EHIA 3L7BA 2X6QA 2R6AA 4V1CI 1GG5A 4MS1A 1UXKA 4FBGA 1W85A 1U9IA 1G9TA 1EDOA 4PYNA 3H75A 1J70A 1P2GA 1UANA 3MCUA 1PQYA 5TLSA 5CGQB 1J2EA 4E74A 4D96A 2KTFA 4N49A 3L8EA 2YXLA 5CT6A 2PVPA 5HKHA 3KZNA 2KB0A 1Z74A 1KJJA 3NAGA 3QEMA 5JPDA 2P2CA 4X91A 4LY0A 4B2IA 2H1LA 5KVSA 4KGVA 2BIBA 2ORYA 1LW6E 3L9WA 4HPJB 3WKDA 5FI5A 3AF2A 2H1VA 1H6BA 4P33A 2QS9A 5DTRA 1KVRA 3ZCPA 2GBIA 3D7MA 2JCVA 4P82A 4ENVA 5ICMA 1KI6B 4ACAA 4PG6A 4YP1A 2NMVA 3CF4A 1LPBB 2CBXA 3EGXB 3C5WP 3ZNGC 4IDDA 1U1FA 2CK3A 3GVCA 4Z8XA 2VDWB 2DZMA 3I2GA 2JIZD 4F1KA 3IR6A 2PV0A 2P4EA 1XYGA 1G21B 2YICA 2Q6LA 1NV8A 4UZSA 4LFBB 3HJGA 3PSEB 4NQZA 3K35A 2HSWA 4HXYA 7REQA 3KEQA 1E60A 4UOZA 4OG2A 4DLWA 1XTZA 2WX1A 3TJMA 5DISB 2R8OA 5EP2A 2MWSB 3O8NA 2E4XA 1F4PA 1PK9A 2BYEA 4WADA 4C7ZA 2ZTHA 3HK2A 5AT1A 2JBWA 1SU4A 1RPAA 1GKUB 4YUXA 4IHJB 3DXFA 2BM1A 4Y2TA 4N5LA 1V3QE 2G9RA 4CF5A 3SDSA 3V1KA 4TLCA 1PZXA 1XVAA 3ENVA 4WJPA 1YS9A 3HU2A 4S0ZA 2JD0A 3FMIA 4URXR 5IP4D 2PEYA 1JJBA 2NBUA 1A9ZA 2LCQA 4JJKA 2WKWA 2GOWA 4BFUA 5KO2A 2QP3A 2O8BA 5JYBA 5JY6A 1OMOA 4EP1A 3ZDZB 1AWDA 4AV7A 3D8BA 3C7TA 1TS2A 4WWPA 2P27A 9GPBA 4HDOB 4NYJQ 1D5ZC 1YZNA 4J0GA 1FNNA 1EB8A 5ELMA 3ND9A 1LPAB 3CCBA 3ZN2A 2GJAA 4CHKA 1WZ0A 4L9RA 2VJOA 5IA7A 1ISSA 1EFRD 2QMEA 2ZE7A 4ALMA 1IWBB 4V39A 1PL8A 2JCBA 3UQZA 3O8BA 1PD1A 1E92A 5FK9C 1TAHA 5A1JA 3ZYCA 1POWA 2QL6A 4GIBA 2EZTA 3R41A 3IKVA 1O3YA 5FLXA 2KI5A 3M6WA 2IIPA 3FWKA 1H3EA 2J42A 3RSFA 2K4MA 1D2GA 1E4VA 4FGSA 1GITA 4C04A 5LZ8A 3RKRA 2XUDA 1S3SA 3U1TA 4H6WA 4B31A 2RFLA 3K8QA 3ZTTA 1PL6A 1RQ7A 5GV7A 2JHGA 3GJZA 3K2EA 1PZMA 2ZSFA 1HYBA 3IP5A 4CM7A 2WD7A 4JYAB 1ZD5A 4JT8A 3QRWA 1T35A 1CF9A 3VZCA 1EK6A 4ZHQA 2N9XA 4BFWA 2V7VA 1BHSA 3C7KA 2WJPA 1UWMA 2QL7A 4HTFB 3TLYA 5DHTA 4ZAZA 4HWGA 2O6LA 3C74A 4U8GA 1U2QA 4OIFA 1JLRA 3GELA 5CX3A 2O3JA 1J22A 3R4CA 2HMAA 3MQFA 3LL7A 3B9RA 5HJ7A 3IEVA 4YRNA 5CD1A 5CJJA 4LQDA 4PZ9A 4RTKA 5TF4A 4G3XA 2GXQA 2XCUA 1XE3A 3LCRA 1BCSB 1NW8A 3LPNA 3QWHA 1T24A 3QPVA 3E3OA 3V42A 4YB8A 1YSCA 4OF4A 2CVPA 4MAAA 1TKGA 5DM0A 4J4BA 2ES4A 2VOJA 2XKAA 3S4YA 4IBOA 4NU0A 1ZCZA 4HJKA 4LXTA 1EX6A 2GF0A 3GEBA 1Y6QA 4RHUA 2E5LB 4CEJB 3OX1A 2C5SA 5AFSA 2LNDA 4IFEA 3VPFA 2JFOA 2ZSUA 3UCFA 4YQYA 1WP4A 3O9MA 2R61A 2Q1WA 2DBYA 4LBZA 1Z4PX 1VTKA 4HPWA 1OPRA 1KE1A 5A5EA 3IMGA 2MINA 2F7SA 1OV6A 3C3EA 3DUFB 4WE3A 4ZCQA 4CW7A 3ZKWA 3RS3A 4AWXA 3R2IA 1W9MA 2CMGA 1GZ7A 3H9BA 3EUFA 1E18A 1AN0A 1FFAA 3STXA 2AZMA 3OSUA 2P78A 2NIPA 2HIHA 1V97A 1BKYA 3EIFA 3ONFA 3ZS9A 1VA5A 2I2FA 3W06A 4NHEA 1I1HA 4UWRB 2IX3A 1RKVA 3UW3A 4WZAB 2QPLA 1A9QA 3T99A 1KETA 2BELA 1C7IA 3GUZA 2VHTA 1NJFA 1T4BA 1KEEB 2Q8QA 3KNZA 4KBYA 1KMHA 3OM8A 5DK6A 1EVQA 5C1IA 4OMCA 2VTEA 1UBMS 3GDHA 4LYHA 3C14C 1TJPB 4Y6PA 1CQWA 3FTCA 3ESAA 2FPKA 4JEIA 2BFOA 3R5KA 3L8FA 4H3KB 2OMEA 1K6IA 4JLCA 4HMQA 2D3WA 4BBNF 2Q4TA 3PCXA 2B6HA 1KAHA 4PLFA 5D85A 3T0FA 5EJ4A 3DTVD 3KCQA 3U6BA 2QT1A 1AK2A 2OC4A 4NDNE 3F8SA 3B1FA 2CE7A 1PFWA 5L40A 3GIDA 2PKRA 4I6GA 5AICA 3SC2A 1IY1A 4PS7A 4Q00A 2JJ2A 1Z13A 5F9HA 4QPPA 1YQ4B 2ST1A 4DUPA 4M88A 3GBVA 2XUFA 4HUJA 2AX3A 4GKKB 1Z0KA 5EINA 1RYHA 4X1KA 1JLSA 3RD2A 3IT6B 2H2FA 2IKSA 1J9ZA 1DX4A 1FMAD 4FXPA 5CP8A 3L04A 3K1JA 3AMVA 1FDSA 1GFIA 1TZ2A 3AOEC 1PTKA 1C1DA 3GUUA 2RG7A 4FI3C 1WXAA 4G65A 2QF7A 3FYDA 1MG0A 3TSSA 3IYLW 2FPRA 2HHAA 1LLDA 5GJBA 2AUMA 2FG7C 3RNBC 2OBLA 4X45A 3FPAA 3NT4A 4GXBA 1QLBB 1TZJA 5GWXA 2C4KA 5KDDA 1RFLA 1O9HA 5EJ5A 3KOWA 3ZVMA 2ADFA 3DBVO 4D57A 3GAZA 1BD3A 3KQTA 4U7FA 1VD2A 3AVVA 1JAHA 2GSDA 2WPDA 2XGOA 4MHOA 2ZYAA 4P08A 4IRUB 4CN8A 4S12A 4OQYA 4DR3B 1HZ5A 3QPAA 3V6MA 1E94E 1RQGA 1CJMA 1W4ZA 3AXSA 1JHDA 3T9BA 1QG0A 1MX5A 4IFBA 3Q85A 4EPWA 1K08A 4ENPA 4J7AA 2V6IA 1J33A 4M1QA 1Q1OA 2I80A 2BONA 3A1UA 5REQA 4IZHA 1IEVA 3MMXA 1FL9A 1GPH1 5AVJA 1R0ZA 1USIA 2Y0CA 3DP9A 1L5HA 4Y9UA 4DANA 3LU1A 2YV2A 1JRLA 3SK0A 2UZAA 1A9OA 1T1RA 2QX8A 3FILA 2BFBB 1YI8A 1NN5A 4OXYA 3QEJA 3AFGA 2XZOA 3KFXA 1CZLA 4X6UA 4Y1EA 1WU7A 2GN2A 4N59A 2ZRQA 3ETCA 4MV7A 3B12A 4D8VA 2VT3A 1Q17A 3ZDTA 4PZZA 1AHNA 4EUSA 3OT1B 1RMTA 2AOUA 3WWPA 3CGGA 2E4UA 5AR1A 4YT8A 5L95C 2R60A 1GYPA 3PUZA 1C4XA 5AHWA 3GFPA 5CNJA 2MSWA 5KYXA 1QP7A 5D00A 3AEFB 5BV2P 3SC6A 4C14A 2C4VA 3Q7RA 4G0YA 3I9V6 5AJVB 4TGLA 1PJBA 4IQ0A 1KAOA 4MH8A 5HILA 3BWDD 2GN0A 4DEVA 4ENWA 4H0CA 5F35A 2GGSA 1L7BA 3CEPB 1EWYC 1SOAA 3N6VA 3KELA 2VFAA 1GD1O 1QHIA 3MJHA 4XIIA 2QDXA 5K9ZA 3OTGA 1T3LA 4QU0A 4R1NA 2FP4B 2PE6B 3ITDA 4CMHA 1XELA 1T3QA 3QBVA 3EG5A 1SB3C 1EXMA 3PNPA 3RUPA 421PA 1QZEA 1X19A 4Q4JA 1RYBA 4Y2SA 4NG5A 3DV0A 4YC7A 3X1MA 3LM8A 1LU9A 4WBXC 1QK4A 3VPGA 2DGDA 2L69A 2QI9C 2MBOA 1G4UR 3FCCA 1NVMB 4O4JB 2R62A 1EZ4A 4GI7A 4ZTZB 4HEA1 5L95A 5ECYA 5JNRA 4B84A 4R3NA 1BE6A 3UM9A 1N7GA 1PQPA 3JATA 1Q0QA 4OSEA 2K0PA 1NXPA 3OECA 1BUIC 2HHJA 3A06A 5B3KA 1PYGA 2WXOA 4YV1A 3DBLB 2GCOA 1IXSB 4DWFA 3UAWA 4C6TA 1EWYA 3FCUB 4NPNA 3HDHA 5C81A 5G55A 4PV7A 4X1IB 3K0AB 1X15A 3FGZA 2OXFA 3AOGA 2JD1A 2CG3A 5J2UF 3UB4A 2R48A 4OHZA 4MUXA 1JR6A 3ORYA 4MQMA 4Y6SA 3VJLA 3CS3A 3GLIB 1P8AA 5D3ZA 1COZA 2XVYA 3BGDA 4M1MA 2QR3A 4GNKA 4ZO9A 4MUJA 1WB9A 2XVZA 2KLCA 5JXJA 1EWTA 4DLZA 1BKDR 1UJ6A 4BGEA 1OX4B 5DGTA 1IPEA 1H65A 4FFPA 1FVOA 1TKYA 3WZLA 2DWUA 4MGHA 1NBMD 1R5NA 2HRRA 4ZO6A 2OO5A 3KEOA 5MFPA 4Y1GA 1EGHA 4BKSD 3EYWA 3TBKA 2VDMB 4DDUA 1IUNA 2GA9A 2WDRB 1X13A 3L16A 3D0OA 3JXPA 1GSOA 1VM6A 4CL2A 4D5GA 4EKUA 1WSAA 2D3BA 2IUYA 1EU3A 3HA3A 1S1MA 1YB1A 1RRPA 2YOGA 2P5YA 4ECAA 3NVYA 3VR4H 1AX9A 3VBEA 3KB1A 3MWEA 2AEEA 4Q4AB 3LCUA 4X63A 4FFVA 5LMUB 3PUKA 3N2GB 3VU0A 3A27A 4W63A 3KOZA 4Y6GB 1A8TA 5HRAA 1EGMB 5K6AA 5HTOA 3OG5A 4RPCA 3I01A 3NEYA 2ZJZA 2RHJA 1UUFA 2NU6A 5CYGA 3ZO5B 4JN6B 1LNQA 2C4TA 4REZA 4PLHA 3Q87B 3TDMA 3RG8A 4J0HA 1FP4A 1PX0A 5FH9A 1KAMA 4I9NA 3SLRA 3KWJA 2VHZA 2JLQA 2GN1A 1QP4A 1RI2A 3WWEA 1N6NA 1I3LA 4CCWA 2YQ4A 3H6KA 3HM6X 1M6YA 5CLLA 5HZMA 1UWXA 2G7ZA 2FKAA 3G5AA 1DXHA 3G49A 2Y05A 2QLMA 4TWBA 1P4JA 2CNDA 2WF9A 1IHOA 3QPCA 1Z2CA 5EWAA 3EFUA 2WMDA 3ETLA 4CG3A 3JR3A 3SVZA 3V05A 1FBTA 1C76A 3E4DA 4X1OA 2BE9A 4AJHA 3MWDA 4ISCA 1HXHA 3IUBA 4ZHQF 3HUEA 4EBBA 3VSAA 3U7DA 1G9SA 3IALA 4NZMA 5JY1A 1PNRA 4IJ5A 1B7GO 3AHFA 3NKFA 1N25A 1GAQA 2V74B 1OBHA 3RM3A 2D2IA 3EGOA 4YSKA 5KJEA 2B83A 3LJKA 1IQRA 5J40A 2ZZMA 3CT4A 4TROA 5SYNA 4JELA 4NCJA 3BF8A 1P7EA 5PGMA 4FYXA 5AP9A 4C0KA 4NAHA 4HH4A 2MJLA 1IU9A 1D03A 1ZIYA 4HWPA 2JBHA 1K3FA 1J39A 3N70A 3L7LA 4AWAA 1UKYA 1SQ6A 4OBXA 4NBRA 4AX8A 3PL5A 3FJOA 3NPAA 3D7SA 1V8OA 1L0YB 3TB6A 1P2SA 3QVOA 4KQKA 4LYDA 5J63A 4AKEA 3L3BA 1ZMRA 1H66A 3N2ZB 1J5XA 4FX2A 5J58A 5JD4A 2Q07A 3W3AH 1YZFA 3U62A 2A94A 3FAZA 4HNQA 5DW0A 1CNMA 1O5TA 3IP7A 3ZGZA 5GM1A 4XUKA 1I36A 5CDUA 1E96A 1ICIA 4RHYA 4OKNA 3B51X 4XPIB 3OPQA 5ALXA 2HLPA 1FC0A 1LBHA 1PKEA 4A36A 2VPWA 1GIAA 3DR3A 1EF5A 5DI3B 2CEAA 3N5KA 3AKCA 3TMKA 2WWTA 4ITKA 2ZWAA 3VOBA 2RH9B 2PKEA 2JFBA 4W9JA 4WVFA 1PVOA 1M2GA 1LSJA 3HUFA 3IRUA 4TTTS 5CVTA 1QOQB 5A5FA 5BMOA 3UF8A 3G89A 4ZYNA 1D9ZA 2BB6A 4REOA 2VQ6A 2PYZA 3FY4A 1V71A 3IAAA 4LZPA 5D6NA 4TZ0A 4ZYVA 2UUBB 2QTMA 4XDGA 1PJ2A 4ARZB 4XJSA 4B3HA 3KHKA 3RK4A 1LGYA 2LRWA 3QU4A 5EUBA 4UXHA 2P9ZA 5BR1A 2OT3B 3ZE8A 4LNHA 1U3TA 2ZZNA 4F5DA 1P44A 3OOJA 5A6SB 1EP1B 4PAGA 3RUDA 4LTNA 3H84A 5J4HA 2I54A 3FR7A 3JVEA 3FF1A 1IN1A 2PGXA 3W6NA 2O8CB 3K0SA 2C54A 3C48A 1L8QA 2D74A 4QBGB 2YJTD 2IYTA 3VHXA 3EODA 2I9KA 4RCOA 3OJ3A 4HNUA 4RYDA 1JROA 3GEDA 3LWBA 3AJ3A 5C80A 3Q8MA 4L4UA 3GJRA 2H52A 1Q0HA 3B78A 2G80A 4UTVA 1UZAA 3NT5A 4MRVA 2DLNA 2HKIA 1TW3A 1UBTS 1XXLA 3CX3A 2YHEA 2FCMA 1Z7GA 3RLFA 1GRNA 2J5RA 4D9CA 1Q84A 3HJNA 3GC6A 1EFUA 3LX8A 2BD0A 2CXRA 3AE1B 4FUTA 4KLNA 3QTTA 3HMQA 3T3PB 3U3MA 1KYVA 3MRVA 3HCFA 3PNQA 1Y1QA 5KYUB 3KLSX 4A3OA 2C4WA 3UC5A 1OAAA 2DKOA 4A16A 3LUAA 1HTBA 1JHZA 2HYDA 4CG1A 3N39C 3QPUA 5HGJA 4IJ6A 3K5HA 1OROA 1SHKA 3PZ8A 1DCTA 1SBCA 1MO5A 4LYFA 4TZ9A 5EIWA 3T5BA 1V6AA 1U0BB 1S01A 2OLKA 3VQZA 3E7DA 3V8BA 1NLUA 2XUKA 2Z4TA 2OCBA 1R9MA 3ENWA 4IH9A 4G4IA 3FPHA 1OTHA 5KNBA 2IW3A 4HAXA 1JAIA 1BQ4A 1NDUA 4NQ6A 4Z4IA 1SURA 3WMXA 2NO6A 5DPWA 4ZAXA 4Q7KA 4Z4HA 1XL0A 1M2NA 2P9HA 3B52X 1PN3A 3JQ8B 3LQQA 3THRA 3VAYA 1Q2XA 3NH6A 1OU4A 4MIOA 3ZHZA 1X70A 4ZRIA 4DY6A 3I9V1 2FW8A 2EELA 3BIXA 3KEGA 3NMUF 1P7VA 3LNTA 5IN4A 2ZUDA 4GX5A 2R6FA 1Z18A 3E6AA 3EGWA 4DPLA 3SD5A 4LCEA 2G04A 3PITA 1M1ZA 3ZLTA 2QX9A 3C8UA 3FFXA 2Y1XA 1RYNA 4D1YA 3TFWA 2O05A 1QP0A 2R2DA 2W71A 5CB6A 1A95A 5A3SA 4LW8A 5JAOA 5L3SB 5DXJA 3BXFA 4BYMA 4N8SA 4H08A 3K0EA 1NVXQ 3I3OA 1MHTA 1T13A 4UM9B 5CFOA 2VXOA 3R7WA 2ZGVA 1R4MA 2UYCA 3ZI4A 2C2YA 3HM9A 3RIGA 2QNIA 4X7RA 5JH5C 3EVEA 4RTQA 4RPIA 1UC9A 2ZSKA 2CNBA 3LPLA 3RO7A 3CN7A 3FTEA 4WZBE 4C56C 1W35A 3I04M 2ICIA 3L1UA 1QIIA 2VF5X 3WVNA 2LVQA 5EHGA 2HWUA 4BATA 3MJRA 1E79D 4AURA 4KO8A 4NL4H 5IRCD 4BZAA 4PEVA 2PZEA 5KTPA 3INTA 3F3SA 5T8IA 1KFYB 4OEHA 4G5YA 1G8SA 4AXHA 3H9UA 1C4KA 3ZCQA 4R3UC 3BB1A 3HXPA 5H7XA 1SCUB 2ZREA 2OWDA 2YZNA 3N0WA 2NMQA 3QHAA 4M6WB 4PSVA 3KYIB 3DMTA 3HHMA 3NM6B 1Q50A 2MQJA 3COWA 5AI0A 4C3OB 1EUVB 2HNAA 2QJSA 4J3FA 1GAJA 4OHXA 1OAOA 3OZAA 4D0NA 3EPHA 2F55A 2WTXA 2ZUSA 4K9PA 5FQAA 4W5OA 3MRTA 3AHDA 3CVYA 4B6PA 4F91B 3MSCA 5L3VA 5I4KA 3EIHA 3HBLA 2ONYA 3ECSA 4PZUA 3DVNV 5B1SA 3VZRA 1XEEA 3GARA 1W46A 4ZYYA 3B2FA 2ID4A 3WB9A 4KQ6A 4MVJM 3TTXA 5F1OA 4G89A 5AKKA 1NMZA 2NP7A 3O73A 4QUHA 1DBWA 3D7NA 1N2EA 5CBPB 4HQKA 1SJ9A 4RZQA 1GCIA 5E7MA 1FY2A 1ISJA 1CUCA 3DF9A 4J76A 1V7ZA 2IHJA 1W2WB 2W9XA 2GD2A 2AXEA 4FJ0A 3TH5A 4JV5B 4B4KA 1W75A 2OCGA 4FW8A 4MKRA 2WVHA 3OWOA 2JF0A 3CW9A 1STEA 2EAUA 1M6VB 4CETA 1WGRA 5KB3A 3IUQA 4ARVA 5GQSA 3WQHA 3BL8A 4X6XA 3G5LA 4BKQA 2H0RA 3D8RA 1L7QA 2PY6A 4ANXA 1K7CA 3LT4A 4ZALA 3WGLA 4EYBA 1MA3A 1KH2A 4BFXA 2IBIB 1C8KA 2V8BA 1MI0A 3I2HA 1OXVA 4PZAA 3IJPA 4CIDA 4GUAA 2O8DB 3OUTA 5BV8A 5IO9A 4O4HA 1D6SA 3AIKA 1NYQA 2Q8NA 4JI1B 4Y0VA 3P4RB 1IY8A 4P92A 3QQ8B 3T5PA 4U4LA 3G79A 3FPCA 3E9EA 3EVFA 3SD9A 2AF3C 1WVIA 2EJUA 4ITRC 1XRQA 5KTRA 3QE2A 1JHUA 1CRLA 4YAFA 4LNOA 3G5UA 5FPQA 1O0CA 1P1HA 1NVKA 5B36A 3C5VA 2X3UA 1P1FA 2PRZA 2CKMA 2GARA 1JU3A 1BN6A 4KACA 4W9DA 3UOGA 1FJHA 3WIDA 2ZRBA 3BCUA 1W6UA 3PVSA 3M89A 1VLMA 2I8AA 3AG6A 3I34X 2CZGA 4OQDA 4HPPA 1WGHA 1I01A 3CYFA 3RS9A 1FS5A 5CH5A 3LLSA 3NHMA 3B3QA 4M1EA 2NSYA 3KWLA 1Z0IA 4ZQHA 2PX0A 3LRTA 3ZDEA 1J0XO 1I7HA 3MINB 2XJ9A 3V32A 4MVXA 3NO4A 3VU8A 1O1YA 3S2UA 4JUCA 1IL0A 5IPFA 2LCIA 3R3XA 1Z45A 3GFVA 3BSYA 1H1TA 1XZFA 3B8HA 3OZRA 2VQ3A 1BVTA 4AD8A 3NRZA 1JNYA 3T35A 3HO8A 4S3MA 1EMDA 2RI0A 4QNMA 1BX3A 2UYXA 4JOQA 4Q3KA 1J8YF 3CUTA 3OESA 4V1CA 4J8PA 1ETUA 1A7UA 1KDYA 3FDZB 1VKOA 5AVRA 2Y1WA 1D8TA 3F2VA 2IIBA 1N6PA 2QGFA 3W1YA 1ORDA 4KAJA 4HNTA 3B6MA 2KHWB 4EI2A 4YRZA 4I9UA 2VZ8A 1SM4A 3WWZA 1CY8A 2DY1A 4WGGA 2WSIA 2OFPA 3DHNA 4WZAE 3OA0A 1QVRA 1I5EA 4G8DA 4IF4A 1KR3A 3EYAA 2WOJA 3WRVA 3TG8A 1TYDE 1EK1A 4DA9A 5GONB 4MVJE 3A3OA 1LLCA 5KSYA 1TI7A 4PPGA 5A03A 1EE9A 3KK0A 5EKSA 5IZ4A 1YJBA 4YBZA 4DQXA 4NQLB 1JN0A 1I3OA 3IHKA 4Y1FA 2P1ZA 2M8SA 4QKQA 1DEHA 1DBQA 1E3MA 2FK7A 3B53X 1L4NA 4BLSA 2XD9A 2WTUA 1R0LA 4MAFA 3MHTA 5AOBA 5BSRA 3M81A 2ZUFA 4KLRA 1CR1A 1P9WA 3VTWA 1IDN1 4R16A 5IABA 4LXIA 1C9KA 4Q5IA 1F14A 2HQOA 3PJFA 2XWQA 4C06A 4BLRA 4HNVA 3ND7A 4GXTA 2KFKB 4BO4A 3T94A 3KSMA 1ATZA 1PVVA 1O03A 1PS0A 1DEOA 3CY6A 4R1MA 4WKBA 1SE2A 1LLUA 3VX4A 4KQ9A 1BMCA 5DMHA 4C7OB 3EWAA 2CHWA 1W4RA 2HE7A 4GDLA 2VDVE 1YI0A 1TIPA 1TTTA 1HFWA 3SW3A 3LOPA 3OQ6A 3BTSA 1YJIA 1CMXB 3OZCA 1QK3A 1OLXB 1GOTA 1HNWB 5A3JA 4Q3OA 3HL0A 2QD2A 2WWRA 3T4EA 2XGMA 3FCEA 4UD2A 1IBRA 4L4SA 1V2HE 3QXHA 4KJXA 4MRSA 2GDJA 2H9IA 3LECA 5CA1B 3PGEA 1X7WB 3DM5A 2GJSA 1O2DA 3H5OA 4K8RB 3IOBA 1RWWA 1Z29A 3RABA 3V3XA 4F56A 2C7HA 4RPJA 1Q6ZA 3NI2A 2ZRNA 1YE8A 2P6MA 4M0KA 5TC4A 1JAXA 3EGRA 1HRDA 5HZGA 3ILXA 4C20A 4G0ZA 2HU2A 1SUIA 3U3OA 1R4MI 4KCGA 4OYRA 3GVHA 1ZHHA 4RDXA 1V5IA 3KJGA 3SCZA 4HX5A 1XQ1A 2RR9A 1KI2A 3C7AA 2N1WA 2G09A 2HPAA 4TVBA 4E94A 2OB2A 5AJLA 4DARA 3LC0A 4Z4FA 1XP5A 4BBNC 3L0PA 3ZWYA 3WK7A 2JLXA 2L2QA 4DZRA 3VUEA 3PXEA 1JUDA 2GN8A 1L0VB 1UJ5A 2AC2A 1X8KA 3K6KA 1GQFA 2HB6A 3LVFO 3OU2A 3RC7A 4HLQB 5KYWB 3RC1A 3ZXVA 4NBTA 1ACJA 3HHPA 3GVIA 4IRMA 2VXBA 1BHJA 2ZJBA 3DZFA 4GXQA 4KYVA 2VDJA 5LZ2A 1LPMA 5HA5A 3V8RA 2OYCA 2OR3A 4QYWA 2YDXA 3O84A 2FK8A 2IOHA 3HB9A 1FMTA 4I5GA 1ZJWA 1T0JB 3N05A 2H6EA 3WL8A 1M9NA 5LD2B 3GLQA 1SRRA 3DE6X 4G4SP 2JCGA 4K0RA 4ZZ3A 2H9AA 4M21A 1U1EA 3IP6A 5EVJA 2GKLA 4HMOA 3I5UA 1UDCA 2J48A 2IYUA 2PLNA 1YN5A 1QDEA 1HE8A 4DABA 5B7QA 5ALVA 2X14A 1KEVA 3B6KA 2G40A 5C4GB 3Q6IA 2KXJA 3B5JA 2XCOA 1WRAA 1NQXA 5CDTA 4BNGA 1CDOA 2VC2B 1PJ3A 3H7PA 1XVIA 3YASA 3DQZA 2PPVA 4II2A 3U30A 3WBFA 2JEZA 5GP1A 5K3OA 1R4NB 1VGQA 3RIMA 3G5TA 3BMXA 4U2DA 2ZRKA 3AE2B 3RC8A 3RBXA 3TW6A 1Q3KA 3PQEA 3PEEA 2WNHA 3CUUA 1SWWA 1NDQA 5MN5A 3WKAA 2FW7A 3TN7A 5THQA 4MGIE 2KN4A 3E9NA 1ACCA 1U0NA 3KZ1E 4D9KA 1RKXA 1E2BA 2G1AA 3IBGA 2GTIA 3IEIA 4KH1A 3RULA 5ALWA 1CUEA 3WYFA 1QLWA 3ZR9A 1HLPA 1IN8A 1Z4QA 4FDAA 2EFCB 2VYVD 1R16A 2PBZA 4GL4A 1V5TA 2MP2A 2J59A 2DZJA 1P0MA 2FX3A 3CZ4A 4B9EA 1V1JA 4RM2A 3B1ZA 3UTDA 5DYWA 3RIXA 3WCQA 1C3LA 5HCIA 4UQOA 5JASA 1W0KA 4PRKA 4HATA 2EZ8A 4AC9A 3KQOA 4FHZA 2FUKA 2Z1MA 4Q7JB 2CHQA 4LDPA 2HR1A 2DULA 3VU3A 3L4SO 4FDTA 2CD9A 4E5PA 1G17A 3QU9A 4IDIA 5ULLA 4B0PA 1S3GA 4YP7A 1AXRA 1Y6RA 1U9IC 1KE2A 1NXWA 3EPJA 2L32A 3ONEA 3R5TA 3NFYA 4EA6A 5CFMA 1XV5A 1OHHD 3H1BA 4CTKA 2G4VA 3L84A 3H9CA 3DNMA 3E48A 1VXRA 1MP0A 4B35A 3HXLA 2GZ1A 1ZK3A 3SHVA 3TBLD 1A27A 3RCBA 3UVEA 4B9KA 1SH7A 3EC8A 4I55B 1NNLA 3VO1A 5I5GA 2YN4A 1E9MA 5K4AA 2R9VA 1T8TA 2N47A 2VAMA 3PUWA 1NVBA 3J7TA 2P2SA 4RELA 3D3WA 1NVUQ 5KZMB 1DZ3A 2J07A 3IP3A 2I4RA 1QQ6A 4DDVA 5FWNA 3CISA 4P1ZA 2C82A 3URMA 2QEDA 3DH0A 4GPAA 1UFRA 4PVCA 4R1PA 4BFZA 4OATA 5T64A 3RYTA 3GJQA 3Q11A 4HGRA 3N6XA 2VBCA 3VPHA 1GARA 5LXHA 3CLKA 3U40A 2D0PB 4GOCA 4MX8A 2PWBA 3G5MA 3T3NA 1G8JA 1VMIA 5BWNA 4D3FA 2QP9X 3T54A 2QJLA 2GBRA 4KQCA 4XR4A 3UK2A 4XLLA 4O4HF 4ANFA 3COPA 1QF6A 3TRHA 5HE9A 3UOAB 4IHQA 5EXXA 4JJ4A 1LKZA 2XNSA 3IIEA 1Z7YA 2JZOA 4XVCA 2HMYB 2QUKA 4FNGA 3K6SA 3PNLA 1E6LA 5BV7A 3TX6A 4UU1A 1QOBA 2DZDA 2VLBA 3UJPA 4B5LA 2JPDA 3L7CA 4K26A 2Y76A 4HEA6 4OM7A 3AFNA 3OU7A 4W1SA 1NUTA 1I4HA 1E1NA 4I3GA 3KWVA 2JT4B 2VSXA 2PGDA 1WL8A 2QUZA 3NC0C 4C9BA 4BX3A 2V7QA 1J8FA 3H5LA 4JNCA 5J2UA 3PNSA 3RHFA 2J1LA 2G4CA 2QRVB 3BMNB 3OKPA 3NUHB 3UG7A 2IT1A 2Q3BA 4C3VA 4O3FA 4ZCSA 3SFZA 3I37X 5DM70 4XDDA 4DLSA 1QGED 3OE5A 4XWKA 4G5HA 3EN0A 5AKHA 4LRQA 1Z2OX 3I13A 3GY0A 2X7XA 3VPDA 1IBKB 3WNBA 3JARA 1DC3A 4Z60A 1K88A 4GKAA 4NOKA 1TEHA 3BK2A 2ESRA 4H59A 4HQFA 3P20A 4X1YA 2DAJA 3LY7A 5DEOA 2YZKA 1YJ5A 2FPIA 1I4WA 2PZFA 4IKPA 3HI4A 1VMDA 2JARA 3ZZTA 5DHAA 3JU3A 3OZFA 3HADA 1PDWA 4YT5A 3LF2A 1U4SA 1Y8QB 2C9DA 1LM8B 4C7MA 4MQEA 3O3MB 1JR3D 1JDPA 2FSGA 3TLJA 5BNZA 1IC6A 4Q12A 1CUBA 2MSDB 1FJGB 2IGTA 3NS1A 3DDNA 3MRXA 4RE5A 4XAQA 4D1TA 2PL1A 4DCSA 3RS2A 1P2TA 2ZYDA 2KLHA 1NOIA 4RD2A 4MV0A 4J43A 3DE3X 4EW2A 1A0OA 1LDMA 2JJ8A 1XPUA 3LXXA 1W29A 3TG2A 1AQ6A 3AL0C 1YRAA 4CL0A 1XP8A 1S96A 2DX7A 2GAOA 1XLNA 4MV9A 2NO9A 1DADA 1HM5A 1V0JA 1ZGZA 3WAGA 1M1NB 1GY8A 2E4WA 2BMIA 3RPEA 3U7ZA 3ZNPA 4ER6A 4Y7DA 4HSGA 3CCCA 1VJCA 4BP8A 4ROSA 1E6EA 1PWYE 3KSRA 4OQEA 3R5SA 1Q57A 2VBIA 5FUMA 3HG7A 1GNSA 1YV9A 5EHNA 4F5WA 3CVJA 1G8HA 3ZC3A 4RAMA 1WY8A 3LF1A 1NBWB 3CLRC 3PZRA 5IXJA 3L1IA 1JIUA 5BN3A 1PG0A 1R4AA 3R3YA 4QU8A 4EFNA 5LC1A 1F3OA 3ZD6A 4OHKA 4BLUA 4N12A 2X8XX 4BXOA 1YR3A 1IRXA 4WCDA 2DYOA 1GILA 5T67A 4UJ3A 3VO2A 5ALJA 2ZW0A 1EUCA 2H11A 4F04A 1YCGA 4OHCA 2I38A 7AT1A 2EHDA 5LNK6 3W04A 4ANWA 2F9LA 4NLLA 4L08A 4JSRA 4YGYA 1Y4ZA 1T1SA 1WR1A 5E2AA 3G1TA 5IDYA 2OZLA 2JZCA 2B8WA 4P31A 1XZ8A 1YA6A 1YFJA 4LOKA 5SY9A 4KTVE 3TIGA 1NW5A 1ZC3A 4DG9A 5LXTB 1EX7A 2OOKA 2WV7A 4MACA 3UJ3X 2JFYA 1SC9A 1TS5A 3H83A 3DOOA 5LZ5A 4G5OA 2NYAA 1ZA2A 3LDAA 3HJAA 3S5UA 3Q72A 4LPKA 3CE9A 1L2NA 2ZNVC 4LOIA 5BQ5A 1VHLA 4H3SA 1QQBA 1FEHA 1GADO 4AUNA 5B58C 3EQ2A 2GAIA 1QFMA 2QYTA 4XCXA 4QPNA 3LUBA 2MHCA 1RXSA 2OV1A 4EXYA 3IB3A 1NUQA 4JROA 3AEBB 3CWCA 1HDEA 1K98A 1KJIA 3ZX5A 2F17A 3ZK9A 4MV6A 3R0JA 1EVYA 3DOHA 3LLUA 4R83A 4GXNA 3GRAA 3SSNA 3B5IA 3Q7TA 1E3SA 2FSUA 1O9BA 2WFLB 2K3UA 2QV7A 4FZJA 1HSOA 1YB7A 3BUSA 1RJGA 3VR2A 3ORHA 3EZYA 2O2DA 5I7OA 4NY1A 1PR9A 5CK5A 4EHAA 3ZOZA 4ZNBA 1E5QA 1NF2A 5LU9A 4V0NA 3Q98A 2N7EA 2GZMA 4EW3A 2FEXA 2QB5A 4A82A 2WIDA 4OMFG 3SBDA 4RGTA 3R76A 1BRMA 4XQ9A 4JFRA 3S28A 2DLCX 2PMVA 2IZZA 1RZVA 2GK3A 2HGSA 1XF5L 1W5AA 1CJCA 4PQFA 1JA1A 3O4IA 1NVVR 4MW5A 3IEPA 1UBSB 5FL7A 2JJYA 4OQPA 3ZTYA 1BFUA 1YK0A 4NZNA 2O2VA 4JT9A 1SVSA 2WHPB 3SNHA 1ENYA 2IYRA 1S8FA 5CLFA 1TJEA 1Z5SB 4ZK2A 4AJJA 2R8ZA 2YHUA 1EM8A 2VNHA 1W34A 3SY8A 4NSNA 2W2XA 2QVXX 5K0BA 3L9XA 3LWNA 1V48A 1T34A 1M1XB 2CU3A 5EHTA 1XQ9A 1WXXA 1XTPA 4I14A 5ACVA 4BOSC 2Y2UA 2Z2YA 1V5WA 3HCDA 1MV8A 1S2MA 4E5DA 5JTUA 4W9KA 3C8DA 2G6TA 3BZDB 2GHRA 3IT1A 4NNJB 1F5NA 5DM60 3U61B 5H83A 4DTCA 4EBFA 4U7HA 1YZQA 4WKCA 1YQBA 3I23A 3BMCA 2I1WA 1SC1A 5B7NA 1NXSA 2BM0A 1V6CA 4OX9Y 1I2AA 1SIOA 3NZSA 1GGEA 2FJUA 1AQJA 2YC2C 1RD4A 1N2CB 1JP7A 1WJGA 6YASA 3STYA 2BH9A 2PLPA 3AQIA 4FSXA 4WWOA 2A9KA 1EA5A 2BVNA 1VZ6A 1M34B 2GERA 3BCSA 4KIKA 3A0RB 2DRIA 4RL4A 4QL3A 3N58A 3D8HA 2H85A 4P2BA 3RYIB 4TV9A 5JVDB 1H6CA 2NU9A 3HR7A 5BN4B 3L1HA 2ATXA 3LLCA 1M2JA 1SFRA 4U0JA 2P4ZA 3ER9A 5BN5A 2ONCA 3M6AA