4XWWA

Crystal structure of rnase j complexed with rna
Total Genus 182
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
182
sequence length
545
structure length
545
Chain Sequence
PAPTLEVIPLGGMGEIGKNITVFRYGDEIVVVDGGLAFPKAHQMGIDLIVPRIDYLLEHQDKIKGWILTHGHEDHIGGLPYIFARLPRVPVYGLPLTLALVREKLSEFGLQDVDLREVTYGDEVRFGQSFVAEFFCMTHSIPDNAGYILKTPVGDVLHTGDFKIDPDVGTGAGIVSDLERVEQAGKDGVLLLISDSTNAERPGHTPSEAEIARNLEEIIKGCRGRVFLTTFASQVYRIQNILDLAHRQGRRVVMEGRSMIKYAQAAQATGHMNPPEPFLTSEEVGELQDQQVLFVCTGSQGQPMAVLGRLAFGTHAKIALRRGDTVILSSNPIPGNEDAVNLIVNRLYEIGVDVVYPPTYRVHASGHASQEELATILNLTRPKFFLPWHGEPRHQINHAKLAQTLPRPPKRTLIAKNGDIVNLGPDEFRVSGTVAAGAVYVDGLGVGDVNDDVLLDRVNLSQEGLLILTAVLHPTPHVEVVARGFARPNRDLELQIRRVALEAVEQGLREKKRLEDVRDDMYGAVRRFTRKATGRNPVLIPMIVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DR2417
publication title Structural insights into catalysis and dimerization enhanced exonuclease activity of RNase J
pubmed doi rcsb
source organism Deinococcus radiodurans
molecule tags Rna binding protein/rna
total genus 182
structure length 545
sequence length 545
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
A PF07521 RMMBL Zn-dependent metallo-hydrolase RNA specificity domain
A PF17770 RNase_J_C Ribonuclease J C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.580 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4xwwA03
3.40.50.10710 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Metallo-hydrolase/oxidoreductase 4xwwA02
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 4xwwA01
5ACXA 5HISA 2Y8BA 5LCFA 4C1EA 1X8IA 4CHLA 1VGNA 4EYLA 3FAIA 1VMEA 5FQBA 4RAWA 3ADRA 4LE6A 4EFZA 4HKYA 2OHIA 4C09A 5ACWA 4BZ3A 2NXAA 1BC2A 4V0HA 5EVKA 5A87A 3DHCA 5AHOA 2GFJA 4XUKA 4JO0A 2Q42A 3P2UA 2XR1A 2H6AA 4C1HA 2GMNA 1BVTA 4Z7RA 1JJTA 3IDZA 5A0TA 3LVZA 2BC2A 4NQ4A 2FU7A 2CBNA 5EVDA 1M2XA 2M5CA 3VPEA 3X2YA 4AWZA 3I15A 1KO2A 3T9MA 1XTOA 5K4MA 2FU9A 5B3RA 3IOFA 1WUOA 2HB9A 3DHBA 2YNVA 4D1TA 2WYLA 1WRAA 3G1PA 1P9EA 4XWWA 3F9OA 3IEKA 4ZO2A 4PVOA 2GCUA 2I7VA 4H0DA 4F6HA 3SFPA 1XM8A 5IQKA 2P4ZA 5EVBA 4FR7A 4UAMA 4TYFA 3X2ZA 4GCWA 4U4LA 4AX1B 3SD9A 1WW1A 2UYXA 4AWYB 3PY5A 3PY6A 3IE2A 3IEMA 2NYPA 3I14A 5FQAA 2QJSA 3I11A 5K4NA 4D1UA 4EYFA 4WD6A 4ZNBA 5EW0A 2BFLA 3TP9A 2AZ4A 4BP0A 4Z5YA 3IE0A 3VQZA 2OHJA 4D1VA 2BG2A 3IE1A 4AD9A 4RL0A 2QDTA 1A7TA 3ZNBA 2BTNA 2DKFA 4PVTA 2BFZA 4RBSA 1X8HA 4HL1A 2YNTA 2DOOA 4UWOB 2YCBA 3IELA 3JXPA 4AX0B 4TZBA 1KO3A 4ZEJA 4HL2A 4Z67A 5A0VA 2OHHA 5KIKA 3IOGA 3S0ZA 3AF6A 2FHXA 5AYAA 1X8GA 1DD6A 4EXYA 2WYMA 4UBQA 2YNUA 1SMLA 4DILA 5LM6A 5LLDA 2QINA 3ZWFA 2A7MA 5HH4A 4D1WA 4YSLA 2QDSA 2ZO4A 1VJNA 5AEBA 2Q0JA 4UA4A 2XF4A 4KEPA 4ZO3A 2ZWRA 2BG7A 1ZTCA 1E5DA 1JJEA 2I7XA 1L9YA 5ACRA 4J5HA 3L6NA 3PG4A 2WRSA 2R2DA 2Y87A 5K4KA 3X2XA 4C1GA 1DXKA 4FSBA 2QEDA 1YCFA 2BFZB 2WYMC 1A8TA 5LSCA 3ZQ4A 4TZEA 2GKLA 2YNTB 3T3NA 5ACQA 4YSKA 4D02A 3SBLA 4TZFA 4C1FA 1YCGA 3BV6A 4RAMA 5K0WA 2BR6A 2BG8A 5AHRA 1MQOA 2BIBA 2P97A 4DIKA 2Q9UA 2ZZIA 4Z60A 1DDKA 3KNSA 2WHGA 1QH3A 3BK2A 2FU6A 2YNWA 5B1UA 4TYTA 4B87A 3I13A 2BGAA 2NZFA 3QH8A 3FCZA 1BMCA 2P1EA 4J5FA 5EV8A 5HH5A 5AXRA 5ACTA 4EY2A 2E7YA 1ZKPA 5LS3A 5A5ZA 2Q0IA 2YNVB 2FM6A 5LE1A 5LCHA 5DPXA 4GYUA 1HLKA 4C1CA 5HIQA 5LMCA 3WXCA 2I7TA 5EHTA 3A4YA 4GYQA 4Z6XA 4UWRB 1KR3A 5ACUA 3ZR9A 2BFKA 1Y44A 2YZ3A 5KILA 2P18A 4XWTA 4Z5ZA 5EV6A 5HIOA 2BG8B 4O98A 5ACVA 5HH6A 1QH5A 3H3EA 3BC2A 2BMIA 3R2UA 3T3OA 4F6ZA 2ZNBA 1ZNBA 3KNRA 2BG6A 5ACSA 5FQCA 1WUPA 4C1DA 4UWSB 5HIPA 4EYBA 2NZEA 3AF5A 2FU8A 2VW8A 3I0VA 3SRXA 4UWPB 3DH8A 4RL2A 5EWAA 3Q6VA 1YCHA 3MD7A 4NQ2A 5B15A 2FK6A 3SPUA 2GFKA 3ESHA 4KEQA 3SW3A 4RM5A 4TZ9A 3AJ3A 4NQ5A 5LCAA 3RKJA 3RPCA 3DHAA 5AXOA 4P62A 3RKKA 4YSBA 4NQ6A 1JT1A 2FHXB 2Y8AA 1K07A 2AIOA 3KL7A 5EH9A 5ACPA 4EXSA 3X30A 2M5DA 4FEKA 3BK1A
chains in the Genus database with same CATH superfamily
2D1YA 2DBRA 2HGSA 4GOLD 2X2EA 5IXSA 4IRXA 1DC5A 5DVZA 3F5FA 2C4UA 1JHYA 4X41A 5HGXA 2FEOA 3RUIB 4BL5A 4DT1A 4EY6A 5EEGA 5G4KB 1WZCA 1M5UA 4XFJA 3PUVA 1WB4A 3LDZE 3WP1B 2WOJA 4NPNA 4XUEA 4Q9KA 1C0PA 3NPAA 3UK0A 1KTKA 5BW4A 3B7WA 1ZLYA 3C14C 3AH7A 4E30A 3GFRA 4RK1A 3EGDA 3AF4A 2IOYA 4HPLB 3KDAA 4W5NA 2O2HA 1C0LA 4I4TF 2D8AA 3QU9A 5DGDA 3JYUA 1F8YA 3WZMA 2VO1A 1E6KA 5COQA 5SY6A 1R64A 2QQ0A 4Q7KA 4RHXA 4CR8A 2QYSA 2GPYA 1ZNQO 5BMIA 2BW2A 1UQTA 4P84A 3RRFA 4TV3A 2YJ4A 4XJVA 2BKLA 2BSAA 5TV2A 5HGJA 2V54A 4BTVA 2YVKA 4CCSA 4X1IB 5ESWA 4DMCA 2QK4A 4ED9A 3E23A 4QXOA 3A33B 1WW1A 3GFVA 1G42A 1K5GA 1NC3A 2DWQA 4P1BC 4WZAB 3GV0A 1FJ2A 1YWGO 1VHLA 5HTOA 1WX1A 4MQ4A 1ADCA 2OZVA 1FIUA 1PQWA 4GOND 3UHAA 4M00A 4ER6A 4L4SA 4KIFA 4FMCB 4EH1A 3RZWC 3JPYA 2C9DA 3DULA 2LD4A 3UBMA 4JU9A 1PCXA 4ZEJA 4ZHOA 1ZUIA 4A0HA 3LUJA 1Y7PA 3EWSA 3TFWA 2R5NA 5C7YA 4GB9A 4D8WA 5DYGA 1SMLA 4OA8A 2IHBA 2V3CC 1TI7A 1APBA 1JLKA 3ZDCA 4EO7A 1XDBA 3IKMB 1LXDA 4EUFA 1F9JA 5B6PA 3HHEA 5AR1A 4OB6A 1M6HA 1XD8A 1O1YA 2F1JA 1OZ0A 2WS3B 1H1LA 3LOPA 2COKA 2ZUDA 3ICWA 2HPAA 1V25A 1QHXA 1A9XB 1QOAA 1IXYA 3CE6A 3ETGA 4WY8A 4CRWB 2YDXA 1T0UA 5EYPB 1HNWB 2F43A 3UYKA 2QS9A 3TR5A 3PFCA 5MFPA 2YQZA 3WAKA 5E0OA 2WSBA 1M72A 3STWA 4WSOA 4TZFA 3G9UA 3KQVA 2VN8A 4QM6A 4E88A 3LPDA 2JRLA 5A6VA 2CXTA 1RJEA 4GVLA 2V74B 1SGHA 3ZTWA 5DP2A 1RXYA 1OX4A 4CV2A 4BKOA 1N2CE 4N0DA 3GRFA 1BS1A 1PEDA 1IB0A 3BQNB 5IOIA 4UU8A 4DR5B 3VHXB 2QMUA 1XQWA 5IRCD 3TRKA 1ZDXA 3TCNA 4EABA 2VTBA 3CO0S 4RY8A 2EW2A 3MXTA 3HFRA 5IEBA 1NF9A 2VZ8A 2RAVA 1VLJA 5E7QA 2JIRA 1TQHA 1AKQA 3H1FA 4I9NA 4UOZA 3PI7A 2BV3A 1Z7GA 4ZRIA 1K89A 4D9GA 3AW8A 2V8BA 1BNCA 4RACA 2JFBA 4TMFA 4XWTA 2AW3A 1DC4A 1XCMA 4KO4S 2JGNA 1OXKB 3GLTA 3UW3A 1NW6A 3PQ4A 4XSHA 1CKEA 1ZHHA 2VK8A 1YB2A 1I0LA 2QQFA 4W9RA 4EZBA 2K7ZA 1N5WA 1CJTC 1WUPA 2WGSA 3HUFA 4K7WA 2EJCA 3AIOA 5GIOE 3UINB 4O1HA 1SNYA 3KBBA 2C0PA 4QAJA 4ZHQF 2QSDA 3RW9A 3FWHA 4MEMA 2C4NA 5JZOA 1MJ5A 3FMPB 1PQYA 4BFVA 4JI4B 4U8HA 4L0CA 4QDOA 1W581 3DFKA 1B76A 4TPKA 1LD3A 3U4EG 1UM8A 1JTVA 3PC6A 4YUYA 5C1ZA 3MAJA 3ELYA 3D5EA 1SUFA 3NRCA 1A4IA 1QKZA 2ZSHA 3TTVA 5CDFA 1GDDA 3SVTA 3DVQX 3IAXA 3Q7RA 4CU5A 2JH3A 5KNLA 4ZP1A 3P27A 1E8ZA 5KYVA 4BNWA 2JHFA 5FYDA 2WD8A 3W1YA 2BUBA 4RCZA 1S9DA 2HQSA 1E96A 3WA7A 4FCCA 3CF0A 1VJ0A 3UMCA 4Q03A 1TT7A 3GZNB 2Z83A 2L05A 5IX8A 1ACMA 4Z7JA 3MWGA 1Q44A 3R0IA 3JQRA 3ZXVA 1D8TA 1US8A 3LK6A 3ZLBA 1UAYA 3W5JA 1FDSA 3LDAA 1SB3C 3FWYA 3GZTB 3VOTA 3GLIB 4RE5A 1Y7IA 2MHCA 2ZUSA 3IJ5A 4PN3A 2QR3A 4PR3A 4CM4B 1VZ3A 4XA8A 3MYYA 1DAMA 1UC5B 4TKLA 4F2DA 3QSYA 3OPYB 2W8ZA 2PAAA 1WRAA 1EFDN 1EE2A 4B33A 3HM9A 3OZUA 3AB5A 4FNAA 4IP0A 1NTRA 1GZHB 2FPPB 4FYXA 3WHIA 2NR2A 4Y6SA 3FNFA 3CFYA 1WF6A 2Y99A 1XB2A 5LDDC 3KJIA 1RHRA 1Z6ZA 3F6EX 1TW3A 1ULUA 2GLUA 5LYJB 2Q45A 1VR9A 1J9GA 5MN4A 3DTVD 2R79A 3D2AA 5H3LA 2YVCA 3ZNBA 4JNCA 1RJWA 4C80A 1LSSA 4Z9FA 1RAFA 2GD0A 2WMOB 3VR0A 1K8RB 3TKLA 5KB3A 1XWWA 3JQAB 1V7CA 3EGWA 5DYTA 4HB0A 5JDIC 2XPCA 5H83A 4MA4A 1CB7A 2QNIA 1JDJA 5A0VA 3PEWA 3VNAA 4JP5A 3EDYA 1JH9A 1QQBA 1E1KA 2CUKA 2LGXA 3CKYA 2J52A 3I42A 3QW4B 1XXHB 1I6LA 3UHOA 3W2IA 1OTHA 1VECA 3BVPA 4XGRA 2Q7DA 3A2LA 4ZJYA 4JWSC 4MPJA 4AZTA 1P1AA 1TYZA 4FB4A 3LLUA 4RQAA 2P7HA 3GOQA 2DJIA 5M5BA 1TF7A 3NDIA 3ROMA 4YCNA 1Z28A 2Q5QA 1KQNA 3AE8B 4RH3A 2XF2A 4J0CA 1KTIA 4W9EA 3L7KA 3DBOB 3I1YA 4LY9A 5B53A 4C7VA 3R3MA 1GC7A 3KR0A 1RSZA 2K25A 1U99A 3ZR4B 2CYAA 3H1AA 2QORA 4KXQA 4KUHA 3TMAA 3LTEA 3PT9A 5AXDA 4WAFA 3PA6A 2OYCA 1ZXLA 4GDFA 2PMEA 4AECA 3WGUA 2WJIA 4W9FA 2NADA 1Z75A 1H0KA 4NU8X 3Q15C 4IL5A 4HPPA 4BNDA 4M8MA 2GPAA 3A3NA 4N58A 5FRDA 1LFDA 1ZD5A 2XRFA 4PU0A 3OU6A 5JQGB 3LQFA 1GZ3A 4INOA 1C1HA 3F7MA 1M2NA 3OETA 4LOKA 4CM6A 4YONB 1N2OA 1MPTA 2F17A 2M9MA 4N82A 4PZ9A 2D2XA 5CB0A 1N6HA 1ISIA 4G63A 1VXOA 3E5RA 2UWQA 3PSEB 5EUBA 2YZ3A 5F2OA 4DXDA 5GY7A 4D8TA 5T3UA 1T0RC 1A72A 4CLRB 4OI4A 4JGHB 5IH7A 2W0SA 3CZ9A 2QNBA 1V1RB 4HKQA 4DV2B 1N78A 3LT0A 1J25A 5DK6A 4REZA 5KSZA 4DANA 1ZK0A 3QVGA 3JQ9A 1RM6C 1S3SG 2X86A 2FWRA 3W9YA 3NS8A 2BI7A 3VDMA 4RSRA 3RCBA 3ADOA 4TYYA 3WHKA 3AYZB 2FFJA 4A8HA 4OMDA 5LCAA 1TF2A 3YASA 2JASA 2RHCA 1UBLS 3ZLVA 1CUZA 2RPVA 4KO3S 2AZDA 4PZCA 5ALLA 2ORED 2KT7A 1T1SA 4JX1C 2J67A 3HGMA 4PPFA 1QC5A 3O13A 5GINE 3CLUD 3A9TA 1N61A 2H0QA 3MJ5A 3CLSD 1SBHA 3DDCA 1WSBA 2D1SA 1ZVJA 3MRSA 3WBJA 2XNDD 2DFDA 1ZD2P 1JG1A 4OMFG 1Y34E 2ORWA 3NGMA 2G1EA 3X1WA 1WE2A 2GKSA 2XR1A 2FSSA 3VR3A 2MR6A 2GMNA 4Z7RA 3EXAA 5HM6A 4NR0A 2VPWA 4EPTA 4DMFA 1K7CA 2ECPA 3H7PA 4O3FA 1CMXB 2BFCA 2WA2A 4IGKA 3EWAA 5IXJA 2AD5A 2ZLBA 4LJPB 4Q05A 3GLGA 1EKXA 4OBWA 3TINA 3RYTC 3ZCSA 5J5AA 5C9ZA 5INTA 1PQPA 2NO1A 3AL2A 5BSKA 4AKIA 1WL8A 2HWYA 1CJVC 1LNZA 4YDSA 2AT1A 1XCOA 1V81A 4EHNA 4I6LB 3R7QA 3CMMA 2D5BA 1SK8A 2OZLA 3AR9A 3TSZA 4YPVA 4Z4GA 1G8PA 3V1KA 2ZE8A 3DQZA 1QOBA 1W59A 4D81A 5DLQC 1MIHA 3R3VA 3EW9A 3P2MA 1XJWA 2PE9A 1IQRA 2XGOA 4TTSA 3U49A 3VH3B 5KJ6A 3EXIB 1SXJC 1I7NA 2C04A 3LBFA 1I6KA 3OQIA 2R6CA 4B3RB 3LPAA 4PAOA 1QAQA 5LQJA 3PUWA 4YDRA 1PJTA 2P9CA 2HCJB 3O84A 1WX9A 2YTZA 3B89A 4ANWA 5FR2A 4WXPA 3S8MA 4JX8A 2BGMA 3TEJA 1FFHA 3V4OA 1RJDA 2CXOA 3LI2A 1QFZA 3QWZB 4BV3A 1UDCA 1ZOIA 3V2IA 4JT9A 3W8NA 4LDAA 4KQXA 1M1YA 3RHSA 3AJ8A 4WFJA 2JLCA 4IDFA 3L93A 4GMDA 4GMHA 4M02A 2JA1A 1PZHA 2KPOA 1RRMA 2A7MA 4WD3A 1JQLB 2WWRA 1CZLA 5AEBA 4AXHA 4XFDA 2W82A 2V3VA 4GPEA 2QTGA 2XD9A 4MLPA 4A8JA 3GJQA 2HC9A 3WYNA 3EMKA 5K2OA 1TZ2A 4UBLA 1XA4A 4JFAA 4MA0A 3TW8B 3VFKA 2UKDA 4GVPA 3KQTA 1YJXA 2JA2A 2GBGA 4BGUA 1QFMA 3O8NA 4BTLA 3KEFA 2YYZA 5IW8A 1TE2A 2DQ4A 4RHEA 4IS3A 4DV0B 4IW3B 5CYOA 3DAHA 1TJEA 1QIMA 4YCMA 2QP4A 2PLAA 2JKZA 3W79A 2XGJA 2BMJA 1M8KA 5LXTF 5C2JB 2WVGA 4GMKA 1Z12A 2R1ZA 1JHVA 3PL5A 2YINC 3L4JA 1F7VA 3PZ7A 3TF5A 5CHFA 4XGAB 1VE1A 3SC4A 4FX2A 5DOVA 1Q21A 4EF4A 4PFQA 4HLDA 3RHZA 3PHBE 1Z47A 3A4MA 2QTNA 3AUSA 2OBMA 2XB8A 3THYB 2YUTA 2GYVA 1N0UA 4BNZA 1A7AA 2R47A 1I3NA 1PKXA 3VTVA 4MUIA 5GONA 1WOYA 1Y89A 4F84A 3B60A 3WL4A 4YGYA 3AIMA 3Q10A 1XUOA 2G9QA 4PGGA 5KILA 3PB3A 2FPLA 3TMKA 3GXBA 4HDOA 1WHTA 3L7JA 2I2DA 3IT4B 1GGFA 3IP3A 1YL7A 4UTPA 4EA7A 1V1MA 5TVKA 4XH9B 4CMGA 1U3GA 2IU4A 1BW9B 1J6UA 5JCOC 1XEXA 2RJOA 2XDQB 2YN2A 1U8XX 1V3VA 3V1NA 5C1PA 2L42A 4RHTA 5JMTA 3SC2A 3G0IA 2W9NA 3Q2IA 2IE0A 1M2FA 2I3ZA 3ZXSA 1U8AA 5EJ9A 2QYTA 4AROA 5EEHA 2WQ7A 4Z9BA 3UH1A 2BFEB 3RH0A 1L0XB 3CB4A 2R97A 8AT1A 2P9HA 4FEKA 1OBFO 5KJCA 1W0KD 3A6FA 1SO8A 1T1RA 3OJFA 4HNVA 4O2AB 4JJ7A 1A2BA 3HXPA 1ZRHA 2OO7A 4DA8A 3SS7X 2YHEA 3KCNA 3OQOA 3MHTA 3C6ZA 2XMBA 2PJDA 3E1GA 2DULA 3BK7A 4NNPA 3BZUA 1HDGO 1A77A 4PLWA 5I5GA 4QXAA 2A7XA 5EIOA 4JO0A 1V8DA 4CMIA 2FSHA 1VSQA 3AERB 1SH7A 3DZKA 4D2IA 2J1LA 1BUIC 3EW7A 1QFYA 1N2ZA 4XRGA 2YFKA 1ITZA 3QJGA 3QA3E 1UAAA 1WD7A 3W78A 4JP3A 2F00A 2LVOA 3PGKA 3ZBQA 1AZWA 5J4LA 1GCOA 3TMPB 9GPBA 4JCCA 2ZWPA 1HMPA 2KM1A 1CF2O 1FO4A 2C1ZA 3NOBA 2F8MA 3V7NA 1R74A 1N6ZA 1D0SA 1U5BA 1LTQA 4TGLA 2UZ1B 1E6LA 2X0EA 1X86B 4OEHA 2L76A 1XM8A 4LBWA 1DTEA 1Z26A 2HMWA 4RS3A 1KYYA 1JR3A 3G6WA 2AXQA 1Z4LA 1WZEA 4MW5A 1I80A 3JAKB 2QX6A 4HT3B 4MICA 4U5XA 4BO9A 4N0PA 3ZVVA 5BYRA 1TVKA 4BB6A 2QW1A 1UK8A 4TWRA 5J2RA 3CE9A 1DBPA 2J30A 4BOZB 3PYMA 5HI1A 3KETA 1VCBA 1GGVA 3QVMA 3R2TA 3I05A 1F2RI 2WX1A 5LNK1 4X20B 4O4LB 4MDFA 3JXPA 3R41A 4X1YA 1TM4E 3WAMA 4PVDA 5ADVA 3LT5A 2FIDA 3ZJTA 5F1KA 1F0NA 1QKIA 1ZC3A 4RV5A 1G0OA 2JIBA 2XQGA 3CWIA 2G09A 3EDCA 3CISA 2O52A 1SWWA 1EU4A 2VJLA 4KI7A 4FLFA 1EHIA 2IDKA 1E7MA 721PA 1T4CB 1JFVA 5JS2A 4QTZA 1P7ZA 5DULA 4LA4A 2H2AA 1AZTA 2V5VA 3A2NA 1T8YA 4WOKA 1B16A 1XFDA 3DBLA 3IESA 4CV0A 3DB1A 1QO0D 1M0WA 1TJYA 3A25A 3HCBA 3D43A 3HDTA 2HUPA 4AICA 2WJHA 4RPCA 4Y1RB 2ONJA 4D9FA 1SKBA 2QRZA 4UBIA 3W04A 3OLVA 2Y0BA 4QYWA 1K52A 3PTAA 2DG2A 4AG3A 1ID1A 4IJKA 4L1KA 4RLFA 5JANA 2ISSD 1OGJA 3A6HA 4MVJI 3TEXA 2XSZA 1ZK1A 5AVUA 1WEHA 1KFKB 2I2AA 3IAAA 4O8CA 2F8SA 1KFJB 3QEJA 4EMUA 3C8DA 1D03A 2JVKA 2MBEA 2XVZA 1HT1E 4A0GA 1M2OB 3LQ2A 3A04A 3LXMA 2KVRA 3A1UA 4FVTA 4LGYA 3ESAA 1IC6A 2IF0A 3BG5A 4BNFA 4ZI7A 3EGRA 2GBPA 2G06A 4OD0A 1Y3FE 3WNQA 3HDHA 4YRBA 4DNXA 5K45A 1DXHA 5EWJB 4LF9B 3BRWD 6Q21A 4BQOA 3EY9A 2PU7A 1HUQA 1PN3A 5AW5A 1GPXA 3KU4A 1SVLA 3SR4A 3OFND 3KELA 2O4CA 5BN3A 3BE6A 1NVKA 4WINA 4D98A 4JC0A 1O5OA 1I4WA 1DEOA 3OG5A 2PX0A 1DRVA 2XE4A 3N2KA 4DR4B 3O8QA 2CJWA 4G5OA 3MTAA 3EHEA 2EW1A 2R7AA 3FYDA 5CFPA 1P45A 4WHMA 5CGZA 3LUFA 2OZPA 5C5DA 3WZ2A 5F1OA 3NZSA 2Y5BB 4CKWA 4H31A 4XM0A 1YQQA 4AJ2A 2OUKA 2JFYA 2LTAA 2QVZX 3OQHA 4WE3A 1GFIA 1RI1A 1R0WA 1D6EC 4TL6A 3QKRB 5C8ZA 3DLTA 4UTVA 4I9GA 1R0RE 2Q5CA 2RBGA 1X13A 5EE5B 2XNJA 3AE7B 1JLLA 1T9CA 2FHSA 3FYHA 2MWSB 2XT0A 4CL0A 1G2IA 2LRHA 3VNUA 4HN2A 1XU7A 4HC4A 5GGYA 3SKXA 4EG8A 5B3AA 2IYAA 4BCBA 1P1FA 1LS6A 2QLTA 3UENA 2AOTA 3ROKA 4ITVA 3SSOA 2RK6A 4WWNA 2C1EA 3RI7C 2PXHA 1QQAA 4RV4A 2NT3A 2ZSKA 4M89A 3TZ6A 1D9ZA 4G5RA 3ENQA 3GG9A 3M3HA 1YI0A 4F46A 2ZBRA 1A96A 3USCS 2NU9B 1C81A 3OUTA 1JA1A 5C8YF 4O1NA 3NVAA 3EISA 1QPZA 2AQ3B 1Z5ZA 4CMKA 1R16A 1S01A 1ZJYA 4AF7A 3OCJA 2PGJA 1O96A 5K4AA 2Y0PA 2GBFA 4CFZA 4NPCA 5LLTA 3FF4A 4UU1A 2P4ZA 1D1QA 4BXOA 3OFVA 2G17A 2XLBA 1BVRA 4KACA 4CUZA 5LDHA 4IM2A 3DT9A 2FG5A 4RV9A 3K9BA 2DPLA 5FLYA 2Z04A 4G09A 2OL4A 4ARUA 2BFWA 3ETJA 1JU9A 1RHKA 2PA0A 3ZKAA 1RHMA 2F3QA 1EZ4A 2C7RA 4KIKB 4KB5A 3VR4A 4HDMB 2VQSA 4QQNA 1Y3BE 1IMOA 4RZUA 4QGSA 1TK9A 4TZBA 2FP4B 2G9RA 3ENWA 1IHOA 3NALA 1TEZA 5ALHA 4FN2A 3O3MB 3K6RA 3LQQA 2VXCA 5LLDA 2VUUA 3V80A 1FMLA 4JB2A 2MSDB 3N9IA 2OXRA 5JXWA 2EFYA 4DIBA 2XCOA 4JN6B 4EZIA 4WLVA 4JYCA 3ADCA 3OBBA 3BGVA 2EFCB 1D6MA 2H51A 2RH9B 1DAOA 3TR6A 1WULS 3FF1A 4M60A 1EJ0A 3NDPA 4UOEA 2XK5B 2R6AA 2QROA 4EELA 4J49A 2XWJI 2H2FA 1BDBA 3IDSA 2ILVA 2LCFA 1CR4A 2R85A 2W2MA 3VR4H 1YJ1A 4RTPA 2ODQA 1DBRA 3INYA 4H1HA 2XB9A 2ZR9A 3GCZA 3ICOA 2WSYB 4TV9B 4DHZB 2DZIA 1W25A 1P17A 1RYZA 2X1LA 1QLHA 3ZKJC 4D5GA 3ZHUA 1T8TA 2I6UA 3W5HA 1WGGA 2ZYGA 2XNHA 4RVDA 4O4IA 2P75A 5K3CA 4HYYA 4IHJB 4FE4A 1YHYA 2CFCA 2PYIA 3ZDBA 4F4DA 1HLKA 1RPAA 5HIQA 4UHKA 4FW9A 4FOTA 3C3WA 1KEEA 2Q2QA 2Z2JA 2O1EA 1CJKC 3NJ4A 4J0QA 4GXNA 1WE6A 3LUPA 1SE4A 2YJTD 2BDEA 4BFSA 4YN3A 5LZ2A 3MTNB 1ZI6A 5TPWA 2QQ5A 5UKDA 4AUNA 2OP0A 1ACJA 3RAFC 3UBTA 4PS7A 4A5OA 1BXRB 2JGDB 1M75A 1ORDA 2R8ZA 3Q3GE 2ZPAA 1Q0QA 2LCQA 3AVVA 4KXFB 1M2VB 3IKVA 3CX8A 3U4QA 1V0JA 4TSSA 1U8CB 1LPPA 4DLKA 2WWIA 5AIBA 4ZTUB 4MSQB 3W6NA 2VJMB 1NM5A 1ZE3D 4GSWA 4ZO7A 3THWB 4BTEA 4EAQA 4QG3A 2ZRLA 2F3TA 1L4FA 2ZJBA 1MB2A 3VH4A 3OY7A 3BJZA 4HCJA 1OR8A 1EIZA 3QOFA 2GAIA 3VRAB 2IHUA 3C70A 4HYTA 3TNYA 4RKEA 4FFMA 5JZMA 1CZUA 3NCTA 4X65B 4E07A 1F8FA 3IDQA 1C7JA 4DLNA 3NR2A 3I3TB 1W9HA 5CG1A 3BK1A 3NZUA 1W4AA 2FPMA 4CLOA 1KZGB 3DLBA 2O5EA 2B4QA 1CT9A 1QBGA 1G5QA 4GHWA 1RAAA 2CLHB 3HMQA 2OAP1 3LXRA 5E6RB 2C3MA 3C85A 4CL8A 4WKCA 4Y2HA 3NWOA 5IO9A 3J81A 1Z18A 3I8SA 3K09C 2PZEA 4MLCA 4UJ5A 1AH2A 4OLFA 4ZIRA 1GDTA 3KHSA 2I1VB 4KGXA 4I4NA 5CM9C 1L0YB 5JCJD 4EMBA 1RQXA 4KXXA 4KWCA 2KX7A 2FSUA 4MI3A 2SECE 1XRPA 4X1KA 4WBNA 1JBEA 4E6PA 3C19A 4I3GA 1ZEMA 3X2EA 2EP8A 4TYMA 4P3XA 2F4NA 1HORA 4IDQA 2KJHB 3I3SR 5GJCA 4G2TA 1ML4A 4YA6A 4UAVA 4LNIA 2NUBA 3HY3A 2BPOA 2CFUA 4UHEA 3O3OB 4FNMA 1V5GA 4GZLA 5KX5A 2H6EA 4FFOA 3M4ZA 1XRLA 3M6MD 5JLJA 5ITZA 1HZ6A 2MOKA 4HNQA 4CKZA 4NS1A 3HHPA 4U4LA 1PR9A 3GT4A 4UVIA 4DSTA 3AE5B 1B3BA 3KLOA 4TLCA 2LDXA 5ALGA 3OLXA 1AN8A 2IUFA 3T8YA 1D2MA 1I6MA 5HIJA 1QHIA 1ELOA 4D0LB 4BC0A 2DLDA 1I4EB 4BX2A 1DV1A 2PRJA 2HD4A 2FW6A 3K2QA 5I9SA 2QTAA 2EFGA 4E74A 1OWMA 3UJHA 2WYHA 4XIFA 3ADPA 1ZXBA 2L0TA 4MI6A 3P7MA 2ZQ5A 1FDVA 4FD3A 4RFSB 2NQ8A 4DNFA 3BMQB 2PVCA 2Q62A 3ZIDA 5D3IB 1DKMA 3T5CA 2V1UA 4L8LA 5DNVA 4EQ6B 1EX6A 2BG7A 1ZU4A 3F3KA 3TL6A 4CO7A 3M6FA 2Z8ZA 1P4JA 2P27A 3IO5A 3RC8A 3P1JA 2X9VA 3FDZB 1IQUA 2EJWA 5KNCD 4IR7A 1GA4A 2J08A 5H9VA 2R7MA 1N34B 1CEYA 1ET9A 3N0TA 2DENB 4UCFA 1A88A 1G3UA 5K6AC 4J1QA 2PXXA 1FFVA 1KO8A 3AWIA 2J9RA 3PXXA 3E4CA 2Y0DA 2FSIA 2QV0A 4GBGA 4I99A 3ZG6A 1DDKA 1U3TA 1KMMA 4H3KB 5A3QA 1Q20A 2Y2VA 4TRRA 5KYWB 2BISA 3B52X 4U0JA 5FJIA 1KDOA 2NBUA 2QI9F 4ENQA 1P2SA 4FN4A 3CRW1 4Y9RA 3HDVA 4B80A 1DB3A 3NQ41 4HCPB 4HTFB 3QPWA 1QIIA 3AFOA 4R1PA 5DYYA 1W5EA 4M3NA 1WVIA 3ZY3A 5H81A 3K5IA 3KV1A 4R0MA 4JAVC 1ZWLA 1EJ2A 1MAAA 2D2VA 4KQ9A 1WXHA 3GJXC 1Y1RA 2XZDA 2ZIVB 1G64A 2E37A 3DM5A 4OI1A 1YCHA 1GPAA 1JPNA 2VQDA 4KLAA 4LVOA 4JYMA 4I50A 1NMSA 3OE7D 4MQLA 9MHTA 4HNTA 3DQQA 2I54A 2YICA 2EKQA 1BCRA 1ZGJA 1C0IA 1C1YA 4XDHA 1QF7A 2DE0X 1WCIB 3MOSA 4IIXA 4UM9B 2ZIXB 2CCJA 5JZ9A 1GAXA 3S55A 3ZVRA 2L2QA 2CK3A 5FKAC 2YV2A 4LQDA 3DE5X 2RCYA 1CV2A 4QOJA 3IC5A 4D74A 5A05A 3DTYA 1IM2A 3QRWA 2GA9A 3H18A 2OXEA 4YMVA 2PEAA 4FEGA 2IY1B 1FUYB 1ZK4A 1C1DA 4E5VA 4ITUA 3KYCA 2E4ZA 4IFTA 4NULA 4DE5A 1F2TA 3RASA 1SBNE 5TQ2A 3ZIAD 1R3DA 3A9VA 4F3CA 3H86A 2AX3A 3G1TA 4GSKA 3O90A 2IYLD 2GN4A 5BOSA 5E9WA 1D07A 1B1ZA 1MPXA 5DM1A 4WXEA 4URKA 1O58A 1P7PA 3KZKA 4XWGA 4MM3A 3HADA 5GGXA 4Y2QA 4HRVA 4WJPA 4M8LA 2P6MA 2JBAB 4O08A 1C1XB 5JC8A 1PG5A 2X0JA 1QH9A 4ND7A 4S0ZA 1U7XA 1WG8A 3SYNA 2QLJA 1UMBA 1WDTA 4MCAA 4MI1A 1SC9A 1DKOA 3AVOA 4P4TA 5AP9A 4KUGA 2QB5A 1GQSA 1SCUA 3H1PA 3NTRA 3MC9A 3PY5A 2HZ7A 5CMLA 4F60A 3DL0A 1RKVA 5TIIA 5JWOA 4CHTA 4ASWC 4GXBA 3TECE 3ZGVA 3FHJA 4BO3A 1R4NB 1GGMA 1ILEA 4QL3A 4I55F 1HR0B 3EBOA 1HC7A 1BDMA 1V5EA 4JYZA 1P91A 3GRAA 4OI0A 3H13A 1JWSD 4MDHA 1LXCA 2YRWA 2V03A 4HKZE 3DUWA 2BGGA 3WKCA 1ULTA 2CDAA 5DFAA 3TO5A 1KOTA 5BSEA 4RLSA 1R6UA 3MPOA 2GUWA 3NASA 1CPYA 4D6PA 3EXFB 3TQOA 3D3WB 2CWWA 1K5HA 3Q72A 1GWNA 3DL7A 1S96A 3GY0A 1QIDA 4KXLA 5EZ5A 1OYWA 1N5IA 5DNYB 4DCSA 4N39A 4M8NE 2VNHA 1PYWD 1YJCA 2EKEC 4TT8A 3OU7A 5H0IA 4F6RA 5FI5A 4JSYA 1Z2NX 2NVUB 1L6RA 4OUKX 4B2IA 4JPSA 3ZNHB 4FXOA 1CTQA 3WIEA 4YMWA 3QU2A 2NNWB 5E6OA 1U0GA 3HKEB 4NI5A 2CZGA 3SBOA 4AYWA 4IJMA 2VRRB 3OCYA 3GB9A 4NV1A 2FMUA 5H7XA 3B3AA 2H4HA 5BMHA 2Q2OA 4RA6A 1N9ZA 4MHSA 1DJLA 4Q7EA 2PMVA 1DRKA 1JXMA 1JAIA 1PR6A 1XU4A 2Z2IA 2P68A 1LF0A 3KSUA 3QOWA 5MFZA 4NH0A 5ERYA 1XVIA 5LLIA 3HCOA 1ZS9A 3K9WA 1V2YA 2J4FA 1E2BA 3IURA 2A0UA 2Q0IA 2HWKA 1PGQA 5JARA 1VRCA 5GMVA 2ZYWX 2OOBB 5FHQA 3P2KA 4WKNA 4NBKA 1E5TA 4EKYA 2WYIA 2Z0MA 4HXFB 3W8EA 1XROA 3UGJA 4FT2A 3JW8A 5B7GA 1WB6A 3LS2A 3G59A 4MJSA 2FCQA 4U02A 5IJ9B 2A78A 2W2KA 2A59A 1GPDG 2GYUA 1TRHA 5KYUA 3OU2A 4YWGG 4MCJA 4B6GA 2P9GA 3E84A 3U4GA 5ECWA 2IJ0A 4NX2A 5CYPA 4ND4A 4H60A 4DGQA 4UWPB 2B34A 1SE3A 4JXKA 2JGMA 3H16A 1WMDA 1KJJA 1D4ZA 1RRGA 4JIGA 3ND6A 3R40A 1ZUD1 4D3YA 5C80A 1XNRB 2NUTB 3APFA 4UCWA 3PR2B 2Z8LA 1WDLA 2IGBA 4LKRA 3PTFC 3GJ5A 2P1RA 3I04M 2BGFA 1G8JA 3ECAA 5JSZB 4L4RA 4P33A 4HPJB 5D84A 2OUIA 3UOAB 3BT7A 1TD9A 2NXWA 2F1OA 1EK1A 3AR2A 2DCMA 3MHSD 4A15A 2FU5C 5AKEA 2JSVX 1NVFA 1BSVA 2E85A 2CU1A 4PHGA 1YQUA 2JLAA 1UPFA 3AHJA 3H05A 2XYVA 1U0BB 1EDZA 4JKOA 2JGFA 5H3HA 4EAAA 1KGSA 1ADBA 3TRHA 4D8XA 5AUQA 2AD1A 3UPTA 3SJ7A 3KXIA 4J29A 4AF8A 2GCOB 1OWNA 1NQTA 2GK4A 3U7FB 3VPFA 5F5XA 1XXLA 1L5WA 4QYTA 1R8SA 4KWHA 3DE3X 5JYEA 1FRQA 1YGPA 2YHIB 4PE5B 2ODTX 1RXIA 2V98A 2GX6A 1H4SA 1UKYA 4BEWA 5ICGA 4AL4A 4PAGA 3ZBUA 1BYUA 2WKWA 1SD2A 3EXHA 1CFJA 2W11A 4U0KA 3NT5A 2P4UA 3EZ2A 1FA9A 4PT5A 5BSMA 4BLTA 1E4OA 4GBED 1IBXA 4R2WA 1S9HA 2VYFA 4CMEA 1PFKA 3H9CA 2AMLA 2QJFA 2R1VB 2G9ZA 4TVKA 4WGFA 5BNTA 2XW6A 2H5LA 3RFCA 3WNBA 1P4GA 1E5VA 2DKNA 5JU6A 1YQ9A 4E31A 5EW0A 1YMUA 4PPGA 4UZFA 2OO3A 3PHIA 2KQ7A 2XOKD 2HF7A 5AW7A 4D1VA 1J8FA 4RKRA 4E5NA 4D7AA 1M8GA 1BD4A 4URUR 1ZUWA 1P62B 3T06B 1PK9A 1YOVB 2M6SA 5D3MB 2MSWA 4DLAA 4UC0A 3T4UA 2RHLA 5KBYA 4MWGA 2VUHB 2I1LA 1E1RD 3WFJA 4BKSD 3NDBB 3ZWAA 4Q1VA 4KNYA 1I30A 3QX9A 1JG4A 3OE4A 4C03A 1RCFA 3DP7A 4ND2A 1FYWA 1U1GA 3JZDA 4WN9A 1LBEA 3CN7A 4PZLA 1PX2A 1TAGA 3PDHA 3AY0A 1NUSA 4RWZA 2D3AA 3HRDD 1G291 2PT5A 4HB2A 4K9OA 3R3JA 2R65A 2PQ0A 1IIBA 1KY4A 4KMSA 2PV0A 1G8MA 4Y0VA 3WZLA 4MV6A 1AA6A 5E6UA 5IABA 1PEYA 2VYCA 4PYNA 4YCCA 3FOBA 2XUFA 4MJ7A 2QEDA 2J5KA 3BVGA 3PQ2A 1I3LA 4U2EA 2X0DA 4EHBA 3QI2A 2AFHB 2EOAA 1JROA 3SFZA 3D6AA 3L41A 3Q87B 4OJMX 1KZHA 5EJ7A 3U13A 3T6KA 4XCVA 3F4BA 1NUPA 2PUEA 3K70B 1V26A 5CIQA 5DV9A 3TNDA 3V6MA 1ECGA 1PT5A 2IW1A 4DREA 1JG6A 5KYKA 3U62A 3DMDA 3MCVA 3FW1A 4GRIA 1QHEA 1JDVA 5JWRA 2QRPA 4W9NA 1HK7A 3RQSA 1M0EA 3WALA 2HADA 4QXMA 4P1CC 2Y9PB 1ZAYA 1Z08A 3JYLA 3L6BA 3KXPA 3IJRA 2NVBA 3DTVA 2INNE 1KJIA 1VHJA 2Q5WD 3EC1A 1CQXA 1AN9A 4OVUA 4N8EA 5FCDA 3QVVA 4Q3BA 3SHTA 1IY0A 2B3AA 4FA6A 3DYIA 5F3RA 2OFPA 2O6HA 1Q2XA 1GZ4A 1DG1G 5CYGA 5G1NA 5SYNA 2D4AA 3RJMA 4FHKA 4YR9A 4XM1A 3TI9A 3R74A 1YBVA 4KEQA 1I35A 2WUGA 4XGNA 1J5EB 5K0LA 1GB4A 2PW9A 1DIBA 1GZSA 3R2IA 4DR6B 4DIUA 2EHJA 3DUFA 4BBNF 3QE0A 4BBZA 2F3PA 4LZWA 4LISA 5JNWA 2IHKA 4WJOA 2ES4A 4MR7B 4P2GA 4K6KA 1SXQA 2GSDA 1ETHA 1YZTA 2PGLA 1L4GA 4ZCTA 2H9AA 2XUPA 1MD9A 4ZVPA 2ANCA 2G6TA 4TXMA 1HV8A 4FNGA 2FEMA 5A5VA 4AKGA 4F2HA 1RAIA 4CTNA 4QC2A 5J2TA 3GCWA 3GAZA 1VSVA 1NY5A 4YWJA 2ASQA 3PHCA 2F43B 3H1GA 5HF6A 4JK3A 1Z4KA 2L3ZA 2GMIC 3BRSA 4TTAA 4MPRA 2JEOA 4RADA 1L7EA 4PR0A 3ZD9A 2PT6A 4J9UE 4FDTA 1XZMA 5A5DA 2VRNA 4HWKA 3WLLA 2P2LA 1HFJA 3BHJA 3NWBA 4UMVA 3JR7A 4OSEA 5FBHA 4A3PA 5CH5A 4GLBA 1KK1A 1OFUX 5L6MB 2W5UA 4RMJA 3OQ6A 1GRNA 1DARA 1ADJA 2SNIE 3HKCA 3BMCA 4MKIA 5E2IA 1O6ZA 1U3WA 4XVCA 4EITA 3DOHA 4O2LA 4H0DA 2X40A 2J0VA 4OXIA 4KSLC 2FKNA 4N4AA 1E6WA 1Z4IA 3C87A 4MUHA 3ORQA 2ONCA 2Y9MB 2ZQZA 2HLDD 1L7QA 2C61A 1RPNA 5FLXA 5HHDG 4QQKA 4H7JA 1UFOA 1K51A 4BNGA 2JW5A 4G0QA 4KIWA 2O8EA 1WTCA 2AFIA 3S5JA 5B30A 4FYKA 3VDNB 2R61A 4BP0A 1SM4A 2QVYX 3F8TA 1LDYA 3ZX5A 1G1AA 3X1DA 3FHTA 7MHTA 5JFTA 1E9VA 1NVVQ 5FD8A 4OX9B 1TCBA 1D2HA 4IUCS 3OTOB 3E4DA 3IRVA 4WPGA 1E9RA 1G55A 3HVDA 2B4RO 3BH7A 3RKSA 5AYAA 2GDZA 2XNDA 2Q4RA 3T0GA 4WVFA 1RI3A 4YACA 5KQSA 1KAGA 2BGWA 1RWBA 1XELA 1YTUA 2ZPNA 2GFQA 2ZAMA 4H2AA 2H7CA 2OGTA 1TJ3A 2VPZA 3W5VB 3SJBA 3U5TA 3SLRA 2ATCA 2I6FA 1C9MA 4B3BA 4FIDA 1GQQA 4K6GA 1QJ4A 3RVBA 5LD2B 2BB5A 1ZIXA 3PNOA 4GEKA 2RSLA 3A1TA 3A3KA 3BCHA 2D0PB 4YUVA 4XDGA 1JDNA 1J39A 1JHDA 4J3JA 4ZA2A 5JDCC 2LWPA 1AKYA 1US8B 1PL0A 9LDTA 1WABA 4PX5A 3UYLA 3EECA 3LXFA 5C3JB 3RC3A 3H17A 4LK0M 3D4IA 3OOSA 1EHCA 1GKUB 4DJDC 4HWTA 1K7SN 1ZKPA 4E4RA 4WACA 3EZYA 2OQVA 1E9AA 1PSZA 5LE1A 2O5VA 1PFDA 3Q0TA 4J7AA 1N9GB 5DLDA 2C2XA 5JZEB 4M9XA 1DCTA 5B1EA 1INLA 2FLWA 3AECB 2LRWA 1H8HD 1P6QA 4LV6A 4DLWA 1SCJA 3U3MA 2AL6A 4NECA 3CSFA 2GM5A 5JT1A 5LWQA 1CP3A 5KJ1A 4C76A 3GJ6A 4LFCB 4AY4A 1QP8A 2X8LA 2Q6KA 3QPDA 3RF7A 3JZAA 3VKVA 4C08A 2Z3VA 4R71A 1TU3A 4US0R 5LZ7A 4Z3KA 5BMGA 5CLJA 1YS7A 3TDNA 3WRYC 4XX1A 1FDWA 3H6HA 2HWWA 3SW3A 4C29A 3SQNA 2C00A 2GEVA 5JSFA 2VSQA 2PIDA 1MA0A 3AJ3A 4ICUA 1RQ2A 2H0RA 4S2UA 2ZWIA 1F3LA 3FPLA 3T54A 3BJIC 2XZTA 3TVDA 4JOSA 1SXGA 3EC8A 4ZEOA 1X2BA 3FJOA 5A23A 1ODLA 3TOXA 1AV7A 2QHOA 4JP8A 1TZJA 1I2AA 3UUFA 2IELA 1OA0A 3VZPA 5GPBA 1MN6A 2Y8EA 2JBHA 3HJAA 4X6UA 2XBBC 4UPDA 4DQXA 5D51S 3IDOA 1JYFA 4OO3A 3V32A 4UTRA 2VDLB 3HSYA 4AXBA 2QPLA 4KODA 3I39X 5DM4A 3ETDA 3TOZA 2RGNA 3R5FA 1XSEA 4RMNA 1XC7A 3BX1A 2CLOB 1HXYD 4EFDA 1XMSA 4Z4FA 4OI2A 5JVDB 2BC2A 4NQ4A 4G89A 2M19A 2E4XA 1E8NA 4HV4A 4B32A 2O3SA 2Z98A 4MPPA 1TY0A 2SBTA 1P39A 5C3UA 1A2KC 3KJZA 4YCLA 3UAWA 1XTOA 1KERA 5FR3A 3WTBA 3L02A 4D3SA 1ODJA 3BCRA 3ZHBA 1JVSA 5J2UB 4DMKA 4YY3B 4AY5A 1HSZA 4PX3A 3A3PA 5A7FA 2H2DA 4GX2A 4D9NA 1VA5A 1EP9A 4RF3A 4QYIB 1WVMA 5IM5A 1NR1A 1JF8A 2BRUA 1Q7TA 3I72A 1OFHA 3O8CA 4CG3A 1YRLA 3RC9A 3PDJA 3CEAA 2DZJA 3FFXA 4CYMA 5B64A 2HBQA 5KQRA 3JD1A 5FR1A 2Q3JA 5JC1A 3ML1A 2KLGA 5NULA 5KYNA 3CNBA 4ZVVA 1RWKA 1QO7A 1S02A 5T67A 4L0MA 1IVSA 1D6NA 4ZK6A 3MSXA 2ICAA 5BYSA 1R4AA 1ATIA 3ENVA 1QTIA 2WQZA 1S2NA 4KU4A 4H6WA 2Q3LA 4WNYA 4NBSA 3PIRA 3RUHA 3KTOA 4IWYA 4EP1A 3F7TA 1UGJA 3X43A 1OC4A 4LZNA 2HREA 2WXFA 4AZSA 3IUNA 3I4LA 1UZMA 1LPOA 1W0KA 3FH0A 4DJAA 3EZGA 1LLFA 3M63B 4PCLA 3B8EA 2QVXX 4RKWA 5BWLA 5LB4A 2VUIB 2R6ZA 4GPTA 4V24A 4O1IA 3VYVA 2WJYA 2FFRA 2VNIA 1OILA 4B5LA 5F5LA 4U5QA 1FRZA 3QE2A 1V97A 3P4RB 4KRXA 2UUPA 3GF4A 1S3SA 5C1IA 1C4KA 1QC5B 1TFRA 1GCUA 3L8GA 3FAZA 4HLUC 4F21A 2ZAYA 2PKCA 2I8LA 3A1EA 2X2OA 1H9BA 5AJTA 2QLMA 4UDYX 1B6TA 1J49A 2BGLA 4U6QA 3MJRA 1KRXA 1EGQA 3V05A 2W8BB 3MSCA 4HAYA 4FHEA 1ZD3A 5EFOA 4Y2YA 4TLBA 1E2MA 2A2ZA 3LLSA 1MHTA 2YNWA 3WDMA 3H7PB 2TECE 1EQUA 4TYTA 4L3VA 5HG2A 1SXJE 1H4TA 1Z4QA 4OQYA 1DIHA 4PO3X 4OHYA 1PR4A 2NAFA 1PGXA 4KREA 1BTOA 1VBFA 2ON8A 4QNMA 3N70A 3ORRA 4GI2A 4CFSA 5HA5A 3GLFB 1XL0A 3RFXA 3JAWB 2HHHB 2YOFA 4TYNA 3SD7A 4C1CA 5DZSA 2OVBA 3RPEA 3BMNA 2J85A 1IL0A 3LX5A 3CMMB 5L4SA 5ALYA 5I7UA 5DTJA 4GZ5A 1HA5A 1X8KA 3MTEA 5EUQB 3B1JA 4LVNA 4YXDB 1XTJA 1F12A 2L82A 3BOSA 3RS7A 2QP3A 3KAPA 4LZAA 2Q5JA 3KTDA 4JD5A 1JR4A 4EB3A 3BSSA 3X1KA 5AJWA 1T0PA 2WJJA 4G97A 3KQLA 3ZWQA 1I5OA 2PMFA 1WJ4A 4Y6OA 1CY2A 4R0NA 3QM1A 4GXTA 1JHXA 2XADA 3REQA 2HQOA 4EY5A 1P3JA 3OD1A 2KMAA 4QA9A 4R1OA 4WXHA 5BNIA 2HIAA 1XNHA 4HWIB 5IUKC 3VISA 4QGHA 2ZNVB 4HLEA 3WK9A 1RVDA 3BQ9A 3ROEA 4N6GA 3AG6A 3QXCA 1M1YB 4Q2JA 2CHUA 1I9GA 3G68A 1RU3A 4MYRA 3QLEA 4OBEA 4MIKA 1PTJA 2VHUA 3I73A 3E7PA 3U4CA 1P9LA 4I2VA 5KDOA 1NE2A 2Z59B 3R6TA 3T9EA 4B3CA 4NCKA 1QO0A 3OZGA 1VMEA 4YJ3F 1X7GA 4NYMQ 1QB8A 4FOPA 4F9EA 1CEEA 3RG8A 1POXA 4OVVA 5IVHA 4KQ6A 2FAXA 4C6TB 4ESHA 1XLTC 1Q1QA 3NHJA 1PWHA 3EUAA 3A1DA 2JIMA 1RJFA 2X8JA 2KW5A 2WMYA 2DPXA 5HJ7A 5A0TA 2HT1A 4MGKE 2O7RA 5K5EA 3W34A 3NAMA 7ADHA 3H9QA 4OAOA 5CVVA 4OHZA 3AEXA 2QDXA 4ILEA 1Q7GA 1KTVA 4NE2A 1DAPA 4AMBA 5L3SA 4KAAA 1TD1A 1KYTA 2OAQ1 1WUOA 2VEOA 3ETHA 3RD5A 4K3VA 1FUKA 4DLPA 5JAZA 5I4IA 3EOBI 2XZPA 4R0VA 4KN6A 1W48A 1H2XA 1XRNA 4RSHA 3JVVA 4UNPA 3NOQA 3ZNPA 2GCUA 3BRWA 3T99A 2SICE 3FROA 3WGNA 3WWZA 2FHPA 4NMMA 3PUKA 1E2FA 1SCNE 1MG0A 3M81A 3CWCA 4R54A 1L5PA 3PNYA 4BFUA 5B3JA 3W5DA 4IINA 2E6KA 5DTQA 1CR1A 1W0JD 1I1NA 4M99A 1Q95A 4PHCA 2PMDA 3NBQA 3VQZA 3K1TA 2JS7A 1F0KA 2JFFA 4JOQA 4NARA 4II3A 4RMAA 1LBSA 5THQA 2WKRA 3QUBA 3EPHA 4MVJF 4LYJA 4EYOA 1XXGA 3IA2A 1KDYA 3IH5A 2IYTA 3CXUA 4YALA 3DLAA 3UK7A 2P0EA 4JDUA 1QE3A 1UWCA 4GGPA 2NSDA 4EEKA 4AWXA 3HEBA 3N6XA 5FA5A 4TZTA 1UPBA 2P69A 4L7QA 1F8UA 3IUBA 5ABPA 4UA4A 3PF9A 2Q5EA 3EVCA 5SZIA 4IMIB 4TLMB 1LGYA 5DCYA 1KI4A 1RRKA 1RBZA 2IZ1A 4S1VA 1P0PA 4XJXA 1UXKA 1R2QA 3JATA 2M56B 3AM9A 3NHMA 1Q1GA 5D5HA 4N5MA 3IQFA 3A1WA 3GEEA 5K20A 4X8LA 5KMGA 1RMYA 4JE3B 2ZR8A 5DU2A 1SA0A 3HRIA 4G0OA 4C9BA 2EDAA 3ZV3A 1OXBB 2P2CA 1OBCA 4TTVA 4QODA 1ORWA 2FE4A 1GY8A 4ZU3A 1P44A 1PWYE 2IZZA 1CF4A 1V8CA 4CTOA 3MUEA 2B8WA 2RAUA 3PTZA 4EG6A 3FMIA 3OEED 4XB6B 4XWOA 1B74A 3C3AA 4IIJF 4MR8A 4D3DA 3WWPA 2G70A 3AYXB 2KANA 2JAQA 2DYKA 2ZJFA 1OY1A 2BR4A 2PJHA 3KZNA 1GSIA 4RFLA 5HIMA 3LY7A 5EE3A 3ABOB 4UUBA 3CZRA 4ETNA 4TV8A 3SC3A 4BNLA 3ZZ0A 3ZW7A 1REQB 3U3XA 5ENVA 2WF8A 4II2B 4EX7A 2HBYA 1E0AA 2PUTA 5ALFA 3CBQA 3X1YA 3FXAA 1IZ8A 3VZCA 1T0IA 1BWRA 3TQCA 3AEZA 3OEHD 3RWMB 5CHYA 2XE7A 4Q34A 1LDNA 3ZE1B 2J0SA 2BMFA 4K9QA 2HW8A 4XEHA 2C5LC 3OZTA 3GLHA 4FSDA 3I5AA 4ID3A 3GJTA 1I7DA 1HE3A 5BMVF 4YO8A 1AGYA 1UMCB 3DHAA 1K06A 2VSOA 5A0FA 1WU7A 2QTWB 1DO2A 5IA7A 1JQAA 1XE3A 1O94C 2ATEA 2W83A 4C88A 2B4YA 4OYRA 4DA9A 1RXSA 2JCVA 4ZDIA 1DCMA 4U4AA 3ZIMA 5EJ4A 1XYVA 3VPBA 2EEPA 1OT3A 3WL6A 1TMYA 3RC7A 1WNTA 3PGJA 2ZWOA 2V4ZA 2PUDA 5FEUA 3ESXA 5U4QA 1PWXA 2JZPA 1BHQ1 1QKKA 3WB9A 4C09A 5JS8A 3AK4A 5DCLA 2VPPA 4W9JA 5LDGA 1VJRA 4PS3A 1E2KA 4LCDE 2Q6TA 2JFXA 4L74A 5AW4A 4ZQHA 1ZG3A 3NJTA 4XKJA 3L9WA 2F1HA 1GPMA 2X1VA 1SUIA 1NOIA 5F12A 1K9SA 5KYXA 3LVZA 2VNSA 4L76A 2FZLA 3G0HA 2LCIA 3DHEA 4ZARA 2ZZPB 2BBWA 2FB9A 3W9SA 1K6JA 4RL6A 2FFBA 3QFSA 3OSZA 1AKRA 1DKQA 5BVGA 3RRJA 3R6DA 4C6HA 5D8DA 1ZRSA 2ZRHA 2DWCA 1M3SA 4MIEA 3SE7A 4LXIA 1Z33A 3D6HA 5DYNA 4AY2A 1A27A 3MINB 1P9EA 4ZJPA 2MSLA 4G26A 4ZVLA 4XDYA 3M82A 2IP2A 5CAEA 4JR2A 1B2LA 5BYKA 1V4NA 2EKPA 3TIVA 5DHUA 2HGZA 3M34A 5AI0A 3UHFA 2H1FA 4F6LA 3PHLA 1EMDA 3T5BA 2FE8A 1L2NA 1QOQB 2VZLA 2M6LA 1Z5VA 3HU1A 3TE7A 1E3WA 1DI0A 3FTFA 5EJ2A 3AR6A 3ZHYA 5BWNA 4TUYA 2I4TA 4PV7A 2RGEA 2VH2A 1SF0A 1WDKA 5BN4B 4F5WA 2I1JA 4EF6A 5BW5A 1P9DU 3K9NA 4BCDA 4IQ8A 5BN3B 5AZFA 1V8PA 3Q3OC 3W5CA 4F5ZA 4WDRA 1QVAA 5J18A 5L3RA 1SULA 1QR2A 4CI0B 2G45B 3O8QB 3V8BA 1UMKA 1EP1B 1JEAA 1DDOA 3RU7A 2WWWA 2AL7A 3LP8A 2ZO4A 1BX3A 4HEHA 3JU3A 1GM5A 1JQBA 1PR5A 3O6VA 4LX8A 4DIFA 3DFIA 2MYTA 1AK2A 2IYZA 4TTPA 3L6NA 4B6FA 1L7OA 3U3DA 5LXIB 4BNNA 2G8LA 5K4KA 5FB3A 3FSRA 3DAOA 1ODTC 1W36D 3U7QA 2L52A 2NTNA 3PNMA 3RYCA 2R4UA 2QVCA 1RIIA 1DXOA 3EOZA 1RM0A 3KLMX 1JILA 1RNLA 2WM8A 1XLWA 4AK9A 1XKXA 3DOIA 2AOTB 2G77B 3RHFA 1BYIA 2FTKE 3GU3A 5J4HA 4R1MA 4HAUA 4QBHA 1PP4A 1R7SA 2LHDA 3IQHX 2XVYA 3H2KA 1H2ZA 4UBJA 2VHCA 3KS9A 1JHRA 3D3KA 5IVKA 3I6QA 2LMCA 4HXEB 1AUPA 4AI6A 4Y2JA 4C2BA 1KI3A 2FQQA 1P81A 5D86A 4ANVA 1GUZA 1EFTA 4LZLA 4KQHA 1QPBA 3P42A 3HWRA 4PF1A 3R3XA 1ZJJA 1PR1A 3B78A 2YL2A 4EKIA 1GSAA 2XN9C 3EZFA 2VC2B 1KXJA 2EBWA 3EHDA 1J0EA 1IZ0A 2ZDGA 3RS2A 1YFJA 1FYDA 1NUAA 4DG9A 2NZWA 3G17A 2ZW1A 1MZVA 3GT7A 1R6XA 2EYQA 2AG0A 5FQCA 1BWPA 2CJFA 4D42A 3Q3JA 5EWAA 2LXCA 3ANTA 4H6XA 4G4IA 1EK5A 3L7DA 1NT2A 3RUCA 1GZ7A 2N7JA 1E7UA 1L4DB 1Z2CA 1BAPA 3AZPA 1M2KA 2ZSEA 4WJLA 2CR5A 1KQFA 3Q7SA 3B7PA 3WLQA 1P98A 2IODA 3KYIB 2QNRA 2BIFA 5G0WA 5KNCA 2YDYA 5JPIA 3Q7EA 1J56A 1DDIA 3OOHA 5LQRA 2H07A 1V7PC 3NXKA 2Y8BA 3I92A 2C2YA 1UC4B 1WJGA 5AHXA 4ZO8A 3ABIA 2FE1A 4CHKA 4CL2A 3OHMA 1V47A 4R05A 3FPCA 5J59A 1O6BA 4EG5A 1VOTA 3H99A 5CT4A 2O0LA 2VR1A 4QGAA 2YLMA 3DHCA 5DBHX 4LKOA 4TSFD 1J0DA 1NVXQ 3ALBA 1TT5B 1GUAB 1OGWA 3C6MA 1CCWA 3KT3A 1NDDA 2J32A 3USES 1GNVA 4MRNA 3PFBA 3Q0EA 3LHDA 3IAM6 3TN7A 4MMYB 3WNVA 1ZNYA 5TMDA 3W6PA 4L9WA 4PHHA 1YU9A 1RIFA 4Z3DA 3FI0A 4BS9A 1L1QA 3UEOA 4IUYA 2W2XA 1ZN9A 4YTMB 2BLLA 1CQJB 2UXDB 1DL5A 3STYA 3OLCX 5KNCH 2M98A 1NU8A 4O4IB 4CBVA 1A82A 1X74A 5JD4A 4C4VA 4B0EA 1M1NA 5KKCA 4EHJA 2GS9A 1ONBA 1GZ6A 3SZGA 5JRDS 2CL0X 1ZXIA 4H6VA 3CLRC 1Z74A 4HG2A 4WCFB 2LP4Y 4HDKA 2RG1A 5C37A 3ZHTA 4P9NA 3I76A 4K1LA 3Q8AA 3ZYCA 1I2BA 3H1TA 3OE7A 2W6MA 5K8JB 1BOOA 2XXAB 5TPWB 5JMOA 1EUDB 3ESDA 3CNHA 4DIDA 2VJNA 3WIDA 1Y3DE 4AZVA 1JHQA 5FPHA 5HQ3B 3MAAC 2JH9A 3GROA 4B75A 5JASA 4RBSA 3UAYA 3WIVA 1K5DA 5ESRA 2QRMA 4QT0A 4GXRA 1HTWA 2NT4A 1O95C 2JH8A 3TLCA 3D6VA 4GM1A 3TBFA 1KYWA 1M76A 3N9YC 4GSYA 1P6UA 4GX5A 4TM7A 3ESCA 3K15A 4GGQA 1C7RA 1T29A 5A2GA 1Q0UA 4I9FA 3CC8A 1K1EA 4ND6A 1NBAA 1QFJA 1EJBA 1A98A 3O4RA 1C0EA 3O94A 1J24A 1ISRA 2Y1OA 3V4SA 3ZIAA 3VSDA 4YMTA 1G3QA 2OHGA 3ROFA 1U3CA 4D9JA 2GZDA 3R5SA 4OFBA 4FWTA 4GECA 4Z51A 3CGWA 2CB0A 1OV6A 2K22A 3TWOA 1CJCA 4YMIA 4YI3A 1DXKA 4EHLA 4MRSA 1V6SA 1YS6A 4YX9A 1IUKA 2V9ZA 4DR1B 3V8VA 2QYOA 2RFLA 2YVQA 3JX9A 3CSDA 2YMLA 3O74A 3RRBA 4X1KB 4ZVRA 1QH3A 1KOGA 1HL3A 1EZ1A 2KQUA 3VR8B 5DI3A 3RUEA 3DXYA 3KTAA 4U9IS 3S27A 1GN9A 1XP8A 4COKA 3T7EA 4NXMB 5KTTA 4AJJA 1R5JA 3E7DA 3FVVA 4CMHA 5L7WA 5JAUA 4LMAA 4QOGA 4WLUA 3A6DA 4FIZA 5KINB 1XZ8A 1RQPA 1IBKB 4W1RA 1XYGA 4AB1A 2MYUA 1GRVA 1W73A 5J17A 3MWFA 2AGVA 1SXPA 3MTDA 3IKTA 2I71A 3DMHA 4Q18A 1X7DA 4JGBA 4HNSA 2QMOA 4QOSA 4DAOA 4UAUA 2I8AA 3O4IA 1EEHA 2R7NA 4YP0A 5CM8B 1ZNWA 5H82A 3C3DA 4IY1A 3L16A 3GIDA 4J2HA 2Q8NA 1CDZA 2BG8B 2QTVB 2C96A 3F5QA 1GD1O 3MS4A 4A3SA 1A2QA 3OWHA 1C77A 1VJ1A 4R8SA 1RAGA 3L4BA 5IAAA 2IO0B 2Z9BA 1JIXA 4HNAB 3HPQA 2WWGA 4JI0B 4NAVA 2J7PA 1GUBA 4RDIA 4OBBA 4XOIA 2HWUA 1T5SA 3W6OA 3KQ4A 2DVMA 1LLDA 1EWYA 1ADYA 1Z68A 2ZVOA 4L0QA 4JI6B 3QVLA 1XF5L 2F59A 4GKVA 2GBNA 2QRVA 4DABA 1TMOA 3SIPA 2P79A 1D3AA 1MXHA 3JQ7A 3P0EA 1UF0A 5IN5A 2TSYB 4HMQA 2EC5A 3A58B 1GGHA 1HQRD 2ZI4A 2GTPA 5L3VA 3MOGA 3Q8BA 1PVDA 1VRAB 1NY6A 1PD0A 3JZMA 4KE6A 5JS1A 5BSTA 4FGKA 2GEFA 1LK5A 1Q3TA 2IUTA 4KGTA 1Y8RA 2GB1A 1BCSB 3PQEA 1MX9A 3T8MA 4L1BA 1Y6FA 4RORA 3O8OA 4LE2A 4D3FA 1T9HA 4NABA 4B3XA 2NUPB 4LTMA 1JHAA 5GWXA 2CDRA 2INCC 3LCVB 3A1QB 3KT0A 2QRLA 1KKLA 1WP9A 3P9RA 2XYQA 4NY1A 5G4LA 1H85A 4DXFA 4F8JA 1KZ6A 4BZQA 1FU7A 2H1VA 2P40A 2PE5A 1N2CA 4LY3A 2YJ3A 1XU9A 4HDRA 2BGNA 2FY8A 1JEOA 1RLMA 2GVNA 1QV7A 2Q27A 4KVZA 2VT6A 2ZIEA 4NVRA 3NM6B 5FTLA 5B2EA 2IYXA 2FN4A 4X6YA 1Z2AA 3DZJA 1G4HA 1KK2A 1I7HA 4G50A 4D3ZA 3NTQA 1MQ8B 5EUCA 4LF4B 2Q50A 2QIPA 4TXHA 4EJ0A 2WU2B 2DUWA 4IQFA 5AJXA 2ADMA 1NQVA 2JLXA 2B4TO 2PH7A 5L4NA 2BVNA 2ZRDA 4WXMA 1X1SA 4G4SP 1NBMD 2AZ4A 4JH0A 2FDCA 4ZCPA 1ORHA 1DVRA 2BN4A 4MJ3A 3CB2A 4E1AA 4ZVTA 2A4ZA 2WYVA 5JH7B 3LLCA 3U0BA 4J2OA 2WHPA 3FAKA 1M1XB 4BNKA 1HDRA 2LFIA 3A32A 3E9NA 4R3DA 4X84A 4O1MA 5LZ5A 1X7WB 4CGYA 3QELB 2XE6A 5F51A 4MKZA 5K3OA 5B1HA 1YKFA 4WZZA 4B6RA 3E0XA 2QAGA 1XJCA 2OCLA 2QQEA 2QUBA 2HF8A 4ZZ1A 3FZEA 5CR9A 1FMCA 1K8QA 4NEHB 3KQQA 5JJ5A 5KWVA 5FADA 2JGRA 5KEIA 2CF6A 1QRUA 4QNRA 1J8VA 2BGUA 3K1AA 2R1TB 3HCAA 1C1DB 3OKPA 3WAJA 3V1LA 1NNUA 1UBCA 2J4XA 1WWKA 3QEMA 1QYDA 4DQKA 2VT7A 2YZ2A 2QRJA 1TF5A 4Q3OA 4XLZA 1ZCAA 2KLBA 4JX9A 2AN3A 4BVHA 2CNNA 1EK6A 1QK3A 4NOMA 3I8XA 1N2EA 4DVGA 1UIMA 5TEWA 1ECBA 5FBZA 3KAKA 4K88A 2YW9A 2DFNA 5EGSA 3HJHA 4Z4QA 1X80A 4H3SA 3HJGA 4QNNA 2TYSB 2OK7A 2VDWB 3L17A 1PZMA 2C8LA 3T3DA 3DBVO 1I13A 4DJEC 2GEBA 1OF1A 3N1YC 1HPLA 5IJ0A 3BREA 2PX6A 1UMBB 2H0AA 1JE0A 2O57A 3NBXX 2Q5HA 3RVDA 3ZC3A 3KD3A 3ED5A 4AJ1A 1SCUB 1VYUA 3NUGA 2EU8A 4IM3A 4I6PA 4BCCA 4O98A 3FOFC 3BIID 2DUNA 5JLAA 3ZHQA 1ZPSA 3ZY6A 3LKVA 1XDZA 2XMDA 2YRXA 1C8KA 2B2NA 4BKSA 3FYTA 4NOKA 4H1VA 4JHXA 3EFOA 2QPTA 5KZMB 3LW8A 1KIAA 3KKQA 4HAWA 4K7UA 4Q12A 1IBRA 1RLJA 4R2HA 1T0BA 1JLRA 3OY2A 2P67A 3TZCA 1DZIA 3G7SA 3N0RA 3PBKA 2ZU0C 1Y33E 1NBME 3DBHA 1M8PA 1LLUA 1HE4A 2J42A 1JPUA 1R12A 3KB8A 4L5IA 2D62A 4IMRA 1NNLA 4KEAA 3AR5A 3X44A 2UVPB 4JBNA 5EWMB 2OZEA 4HADA 4NYJQ 1CUFA 2YBEA 3CF4G 4JL6A 4YT0B 1E5WA 1FXWA 3VU9A 3OT4A 1YVDA 1OWPA 4ZHPA 4EVSA 1IHYA 4BKMA 3IKLA 3ZWDA 6YASA 4F6RB 1EWRA 1KHTA 4V2IA 1Z8HA 4FZ3A 3ZWYA 3ZOZA 3NTVA 1PWEA 2C20A 4FUQA 4F3KA 2O6LA 1YMVA 2YQ5A 3LWZA 4LDJA 3UTCA 2IXDA 1XN4A 3ABRB 1BZYA 1XZGA 1Z3IX 1YAHA 3AXCA 2J3LA 1EU3A 1F1BA 1X1EA 2HMVA 2MINA 1A5AB 2PT9A 3SICE 2GXQA 4MGKR 3KEOA 3NH6A 4B4WA 1U1CA 5C5CA 1TYAE 5EKTA 2XWPA 4DJTA 3EA5A 5JR3A 3U60B 4Y2UA 3G13A 1VGVA 2Y4NA 1GPWB 3GEIA 2O6VD 5CLHA 5TQ0A 3Q6IA 4O4HF 3E7WA 3H6KA 5DHQA 1A97A 5LZ8A 4M7OA 4UPVA 3LQRA 4EMSA 2JY6A 3DBIA 2QI9C 4XVUA 3NRBA 4DT1B 5DHSA 1NE7A 1FFAA 5JWHA 2Z4RA 1LLCA 4GI7A 2JD0A 2CJPA 3CRMA 1R9JA 3B08A 1G63A 5DPRA 1VIDA 2Y1LA 2ANBA 3KW5B 2HE7A 1NMXA 4D43A 2EYUA 1PWZA 3VH2A 3I6YA 5AKHA 3EGDB 5C7OO 1K86A 3ENEA 4CIBA 1WF3A 2WP0A 1CXZA 4DLZA 4MQFA 4HYEA 2UV8A 5DPMA 4LS3A 1YDMA 3DV0A 1H66A 3I5YA 3JRWA 4H2DA 4YT5A 3WDSA 4ZRKA 4QLOA 4URXR 1P3Y1 3CZMA 5DPSA 5EZYF 3OWOA 4Z2AA 1L7VC 4F7DA 1GVHA 2B7LA 4YLGA 4YXWD 2C2BA 1PEAA 4YAOA 2PD6A 4HBGA 4HO1X 4PLZA 1YHNA 3EEBA 4BN5A 2HEGA 3WMWA 1GNSA 1XDUA 3N30A 3Q8LA 1MQAA 4AOFA 1C29B 1R6DA 4IDBA 4WJNA 4O4JF 2O7VA 3N28A 2FK8A 4Z9YA 2RHOA 1KARA 1ZM4A 3SVLA 1IEQA 2ZJ7A 4BJ6A 4NE7A 5KNDD 1WW2A 4JWUC 1Y3AA 3AI3A 3FUCA 5JDIA 2I6TA 2F9LA 3K5PA 1WKCA 1XTQA 1V96A 2ZE6A 1EFAA 4N5LA 4RJKA 5CUQA 1XL1A 4G4SO 4JKYA 1B6GA 5D3ZA 1L4BA 3NTXA 5IHPA 2D1FA 1QYIA 2ISQA 1P2BA 2WJ3A 3GNTA 3ADBA 3VBEA 2HLDA 2ZXEA 1H2HA 1H1LB 1GN8A 3FPGA 4CETA 3NOXA 4P2BA 5LN1A 4DZZA 1KOFA 2GBLC 4DC1A 1T0QC 2HTEA 5CDUA 1T5OA 3UWMA 2OBBA 4R51A 2VHXA 5LP6F 4C7MA 2J09A 3TGPA 5ACVA 4RZ2A 2N4FA 3LQYA 1NMZA 3U19A 1Q17A 5FWNA 1OX4B 1KEPA 3LVFO 4R6XA 1W49A 3OA2A 4UUAA 1RWWA 2G4DB 1KS2A 1MG4A 2WT4A 5LA6F 2VTBB 1NWHA 4V1CA 1QV6A 1IEVA 3F2VA 5I7VA 1QH0A 3CF4A 1IPFA 3FX2A 1Y9EA 5B55A 3W5AA 2KX0A 3JQCA 4ZAGA 5ICEA 1N4DA 4C5CA 4PYMA 2D3GA 3LBHA 2P3QA 3G9TA 1BDIA 2F4VB 2OV4A 1AMOA 4F5DA 4WN9B 2GZAA 4BJ1A 4C1EA 4IDCA 3KLBA 4IWXA 3QKTA 1WGKA 2RB4A 3GPDG 4BQSA 3ICEA 3GAMA 2V6JA 4PLVA 1EUZA 4IOKA 1KAHA 4KFTA 3WAPA 1FLDA 2IPMA 2OAGA 5E6UB 3R3UA 4A82A 2Q46A 4C7OA 2YKGA 1Z13A 2VRBA 4TSKA 1GTMA 1SBTA 3KQWA 2QWXA 2GEKA 4XVHA 3GRUA 3BXPA 4RIEA 4PNZA 1MOQA 1I4QA 3LOQA 2X8BA 4DLXA 3KP1A 2DEUA 2QZ4A 2VUTA 1FYXA 1T35A 3HP1A 3KX2A 3LLMA 4W5OA 1XRRA 5AVTA 2VHEA 1BIFA 5CFOA 7ABPA 3RO7A 4TWIA 1YA6A 2ZRIA 1ZJZA 1T0HB 3BDIA 1IN6A 4XPIA 1G21E 4EPXA 2VYND 5EERA 3IOEA 4GOMD 1UBJS 1H8HA 1K50A 1Z3CA 5JS7A 4TTJA 1QYCA 1NR7A 4DV5B 3JCZA 5EJAA 1SCKA 1EXWA 2PEYA 2I7VA 4L3OA 2Z8XA 4ZOBA 8OHMA 1P7YA 3HVKA 4FJ1A 3L0SA 4JKIA 1N5LA 2HCRA 5I4CA 2C9ZA 4UPEA 2AYZA 3GGPA 3M49A 4LIPD 3DMRA 5BWCA 3OX1A 1A7UA 2BCEA 3RYTA 2Y5PA 1JIVA 3DE2X 2AQIA 1YVUA 3FZQA 3RNEC 2W6QA 3TD9A 5A04A 1KU0A 1PJRA 3MP9A 4EB6A 2C2GA 2AQ2B 4C56C 2UYYA 5D2MB 4GEGA 1RVV1 2IEZA 2R62A 1WV1A 4FCVA 3IPYA 2DHDA 3GA5A 1SUWA 5K2MA 4IOIE 1YOBA 2OD2A 2XUZA 1MJFA 4A2QA 3JQQA 3PSAA 4B45A 3ORYA 1M6VA 2H4FA 3QYPA 1IJKA 2WICA 4URFA 1HMYA 1OHHD 3LIPA 4B3SB 1FZQA 3HCFA 1VE9A 2YEPB 5CLFA 2XKAA 5LSCA 2YBDA 1J7CA 5B7PA 1CUGA 2MBHA 5DNAA 2GO7A 2HRRA 2REBA 1IIRA 1LJ8A 1PJZA 1G17A 2RIRA 3EIUA 3DNPA 3GGOA 3RF6A 1PQSA 2XCUA 4PS8A 3L7MA 4YAFA 1RWSA 2WVAA 4IIYA 3ESYA 3F7NA 3X1JA 3S0JA 2MQJA 1Y8ZA 2I99A 3QP9A 4JVNA 2WXLA 3EVZA 4JP2A 3OZSA 4QPCA 4B0MA 4G3XA 3ZW9A 3QY9A 1D4OA 4XEUA 5A4JA 1FBTA 4G36A 1DC7A 5AM4A 1XRSB 3T4EA 3LCJA 1O6GA 2BBOA 5A3RA 1MW8X 3GZNI 2XDYA 3A4YA 4LSZA 3ZO5B 5EMNA 1IATA 5KIAA 1JAHA 1QGDA 1SXJD 1Y1LA 1R5OA 3VKGA 1KO4A 1K7YA 1J19A 3BXEA 2ZJDA 1LCIA 3PUZA 3WLRA 3A4VA 1EB8A 1EO6A 4QGBA 2XCQA 3H5AA 1G9TA 2V7BA 3LSTA 2AFIB 3DONA 4H15A 3GCGA 1A69A 1GNTA 5HQJA 2V4UA 3IVFA 3G2HA 4BNDB 4YTPB 4BNTA 3OPYI 5LQDA 5M04A 4K03A 3K8OE 5IS2A 1LFDB 1GIAA 2X76A 1SKAA 3D1VA 3H8VA 3L0IB 2VEDA 1LRJA 4OSPA 2B78A 1HEIA 2Q28A 4Q3EA 4ZCRA 3D8UA 3L6UA 1E2LA 3TEMA 4YGXB 1YIOA 1SN7A 5ALIA 3AEUA 4E3WA 3SX4A 3VSEA 4OHBA 3AB3A 3PXBA 2EV9A 1VXRA 2OJWA 4X45A 1H5NA 5H59A 2GKGA 3WGYA 3DF7A 3V2GA 2QEJC 3FKJA 4MYSA 4CLEA 4NZPA 5DK4A 1M66A 1XZIA 1IUPA 1C4WA 3JASA 1GTRA 2MSED 1MKYA 1JDBC 4WXRA 1WR6E 3ZK8A 5DT9A 3V9PA 2NMVA 3PQ8A 1AQNA 1A5RA 3ABZA 3QVGB 4FMDB 4RHCA 4TN1A 4MHOA 4YBRA 1UANA 5LMNB 3R8CA 3ANYB 2LUMA 1TA4A 1YACA 2IQIA 3ILSA 4ZVUA 5ESDA 4Y9DA 4A91A 3GD7A 1YS2X 2JI9A 1JHZA 1YIAA 1ZX1A 3R75A 1NYQA 4IQ4A 2X5XA 1VM6A 3I15A 4KYUA 3KZ1E 2R6HA 3BGOS 4FADA 5IMBA 1Y56A 4CMAA 3G8CA 3ODGA 5DRTA 3IIKA 3V8RA 3H8WA 4R6WA 3U48A 4PGFA 3RB8A 3UM9A 3JRNA 3DDCB 2CGEA 1U81A 1E1LA 1PR2A 4JT2A 1XLNA 1C9YA 1RFAA 1OZHA 1XMIA 3GFTA 1T0SC 1TKEA 4MUBA 2L0XA 4MLDA 4FZJA 4UFOA 3G2MA 1NFRA 4EI7A 1MVOA 2IUUA 4GCWA 3I61A 4RTLA 3A7EA 3HBNA 2VHZA 1T2NA 3SXPA 4R3NA 3TIFA 2BD0A 3JQDA 1J8YF 1KH3A 3FPJA 3D4LA 4JJEA 3HVJA 2BFCB 3SZUA 5T7BA 3BWBA 4TRMA 1SJHD 1H05A 2PSJA 4K1RB 1NRIA 3GLGB 4KQMA 1TQDA 5D3DA 2E5LB 1DTWA 3PRJA 3SF0A 2FWNA 4S1WA 4ZCIA 1K5PA 4EKEA 4M53A 4YMSA 2OZLB 3URYA 3SK0A 2CLFB 5JTTA 5CJPA 4GPBA 3ZDQA 4X8HA 4BBNC 2RHGB 1CR2A 1I3CA 1UC8A 2OXIA 4UREA 1QANA 4MQ5A 5C2TB 3B9BA 4NESA 3D5QA 3BILA 3FPHA 1K3FA 1KVUA 5HG0A 3OQIB 4Y7DA 2WU3A 2YS7A 2O0MA 2XV1A 3VMMA 3T4XA 1PFGA 4LF5B 3ANXA 3FGNA 5JXIA 2CYBA 1FOEB 1QTNA 3UWOA 1I0IA 3MYRA 4LOAA 2BR5A 4CKBA 2AHOA 2EKZA 2CLIB 4MMXB 3D59A 1GAEO 2GEUA 4ZAZA 2WDZA 2YV4A 4UD2A 2KKCA 2WJZB 4OJNA 3L46A 2YNMC 1TLTA 2DAJA 2OHXA 2AE2A 3CH6A 4CIAA 5FPSA 5CA0F 4IJQA 3HI6A 1WSDA 2EATA 4A8JB 4KBFA 4UTOA 5LCHA 4MO2A 2QZZA 2FOIA 1G5IA 2K5PA 2OORC 5DHTA 1HM5A 2Q0QA 1E3LA 3F1KA 5L51A 1U2GC 3NHSA 5BV7A 5JCZA 5JD5A 4HY3A 3PCTA 1S0UA 2Q6LA 2XT9A 4Y9SA 5IKMA 2UU7A 1RYNA 5KOYA 3I83A 1JYEA 2DQSA 1KAEA 1V5OA 1ULBA 3CTPA 4F7WA 4QRHA 1OI7A 4PCAA 1JE1A 4EVIA 3QTTA 1GNUA 3R6WA 1WRIA 1MABA 4KQWA 2OKGA 5I5EA 1K6EA 1E94E 3UCFA 1KMQA 3WGTA 2R7LA 4C21A 2CDBA 3GPCA 5LP1A 2ZZMA 3SR0A 2NN3C 4BQQA 5GONB 5CLIA 1ZWKA 3T9BA 2P9FA 2RHDA 3ZXUB 3OFNA 4EXSA 4ZMRA 1E5QA 4M54A 3OAWA 2JJ2D 2FRVA 4HDOB 2SCUA 3WKDA 5AOCA 1WHTB 1J5XA 5LOVA 2KFJA 1XTKA 4OP3A 3G0OA 1QPGA 4N9QA 1ZN8A 3CJRA 3UXEA 4X8MA 1V1MB 1LM8B 4BX0A 5K8IA 3BSWA 4OTZA 4ZMBA 4MGEA 3T5GA 1XEXB 4RTNA 2AC4A 2CKHB 1D7OA 3DLIA 3OEEA 4HNGA 1GPBA 2QR2A 1U9JA 3SC2B 5DGIA 3PV1A 4F8CB 1CR0A 1L0VB 3R3YA 3AVUA 3DO5A 3NEAA 4YPOA 4MUYA 3O38A 1Z8NA 4UDOA 3R5XA 5HXAA 2OLEA 3DS8A 3ELDA 2FZVA 4Y1EA 4A4DA 3PGVA 1USUA 3MIZA 5J63A 3FCUB 4AZ0A 2GARA 1F0YA 4GPZA 1TM7E 2XWQA 3AJRA 4K7SA 2YNVA 2NV2B 4H9GA 2DQZA 4I5GA 1CETA 5KAMA 3Q1KA 5FNZA 2Q5OA 1R8YA 2K87A 4W1SA 1R5BA 4G1CA 4HJGE 3L7AA 3OEHA 4G1BA 4P81A 4CMIB 4TKVA 3VI3B 3SXUA 1WZ2A 3MZ0A 4AWYB 4Z7QB 3QIJA 2RHTA 3WL8A 3IE2A 3UAOA 3UMVA 1R7RA 1WXVA 4A8TA 1DJNA 1GV1A 2I2XB 4DQVA 1UFQA 1A9QA 3HYCA 1BVYF 3ZDZB 4AC9A 3EVTA 2XMRA 3L3BA 4OAPA 4BFRA 5I8PA 4IDNA 4II7A 3AB7A 4PYKA 3KUUA 1AWDA 5I4DA 4RZQA 4B5KA 2P3LA 3QPBA 4YMLA 2RD0A 2IK8A 1U5BB 2CFTA 4LDQA 4B6SA 3KYDD 1M0TA 4ETIA 3KVNA 2UYHA 4MWEA 3S6JA 4FFBA 2ZCBA 1X1TA 3U3KA 4NBUA 3RSLA 4O5OA 3LCMA 3SN6A 5EL0A 5AK4A 3UQZA 5K4HA 1KZYC 2ZI5A 4M1KA 3PLVA 4YI5A 4LDTB 2GA8A 2NXCA 5JPCA 1EX1A 1TVKB 4C89A 3P71T 2BJVA 3D2BA 3ANNA 3S70A 3NHBA 3BHIA 2JHCA 1PLJA 3W2TA 3FFTA 3H5NA 4FOSA 2WIBA 1QMPA 1VPDA 4FCWA 4QE3A 3HPRA 4EKDA 1E3SA 2QTCA 4D4JA 2B61A 3W06A 3NBUA 2JZCA 4AJ9A 1MR3F 5ACQA 2ZANA 3TXYA 3GEDA 4EHIA 4A9AA 4X1YB 2BGJA 4E1BA 4BDSA 5JSHA 2IYFA 3TW4A 2UXCB 5TQJA 4BVAA 1E4VA 3O82A 4HJKA 3QVJA 3UT6A 2KB0A 2A9QA 4GP7A 4D6XA 4REQA 2RH5A 5FOWA 2N1BA 1Z45A 4BKPA 4FR0A 4C4TA 4AP9A 1W5BA 5DEIA 5EHGA 1Z82A 2AA3A 4CM7A 1KE1A 3ULKA 4LC9A 1WPXA 3DT8A 1N3YA 4US1R 4HP8A 2W6ZA 3QV2A 4OGLA 5K3DA 3ZNNA 4WBXC 4IX9A 2NZVG 2VTVA 2IZ0A 3DBLB 3KJFA 3FB1A 2YZKA 5DLEA 2H48A 3PUHA 1EUCA 3D8HA 2EBFX 1PGBA 1VHTA 5ALVA 5IF9A 4MRRA 2VP6A 2GFIA 4ECAA 5J4KA 2PUHA 4C1DA 4MULA 2AL3A 2DXIA 1VG0B 1KBQA 2IYPA 1Q1BA 1T34A 2CD9A 1N2SA 1UODA 3B6EA 3WQRA 3WC4A 3NBMA 2FN8A 5AVXA 2SHKA 1RRFA 1I4GA 2J7QB 2ZE7A 3CRVA 4ATNA 4IUBS 2PL1A 3TNFA 2WTXA 4ZVOA 2L1AA 1P7EA 3LUCA 3MMNA 1VMIA 3FY4A 3IS3A 3H5OA 2QD2A 1K07A 4G25A 1V5TA 1UDXA 4ZI7B 1UWXA 4AO8A 1JNYA 1T8PA 4MOWA 1BX0A 3EFUA 5BXQC 4HDQA 5CB8A 2ZI9A 4RGBA 4HWOA 1LW7A 4KLCA 2D5LA 4FILA 2ZPYA 2I5PO 1E2JA 1PGJA 3PYXA 1EIWA 3LFHA 3FPKA 3RVLA 2Q8QA 4MEAA 5A87A 4PNEA 1DQNA 3CEJA 3HB4X 2KWIA 2RDHA 4AT1A 3V8MA 1SA0B 1HETA 1YX5B 4A73A 3HBAA 1THZA 3QBVA 1Z62A 3U30A 3N2KB 3QMWA 4JB3A 4GRAA 4KJZA 2CJWB 1NHWA 4M0PA 2EQBA 1RPJA 2R8PA 3CH5A 1MO3A 4YREA 3ABSB 4N0MA 2PV7A 1FY2A 2X6QA 4A5SA 4CKWB 3SJZA 1MENA 4ME6A 1NLYA 1SXTA 2RGYA 2OCYC 5LSAA 1AQYA 3QBTA 4MR8B 5FOXA 3Q40A 4P80A 5JCJA 2D3BA 1NURA 3NC0C 1WUHS 2GMWA 3QLVC 3O7WA 3KUZA 3PFNA 5TXGA 3LPMA 2AJCA 3EMVA 4H7PA 3K09A 3KOXA 4XRRA 3ZWVA