4XWWA

Crystal structure of rnase j complexed with rna
Total Genus 182
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
182
sequence length
545
structure length
545
Chain Sequence
PAPTLEVIPLGGMGEIGKNITVFRYGDEIVVVDGGLAFPKAHQMGIDLIVPRIDYLLEHQDKIKGWILTHGHEDHIGGLPYIFARLPRVPVYGLPLTLALVREKLSEFGLQDVDLREVTYGDEVRFGQSFVAEFFCMTHSIPDNAGYILKTPVGDVLHTGDFKIDPDVGTGAGIVSDLERVEQAGKDGVLLLISDSTNAERPGHTPSEAEIARNLEEIIKGCRGRVFLTTFASQVYRIQNILDLAHRQGRRVVMEGRSMIKYAQAAQATGHMNPPEPFLTSEEVGELQDQQVLFVCTGSQGQPMAVLGRLAFGTHAKIALRRGDTVILSSNPIPGNEDAVNLIVNRLYEIGVDVVYPPTYRVHASGHASQEELATILNLTRPKFFLPWHGEPRHQINHAKLAQTLPRPPKRTLIAKNGDIVNLGPDEFRVSGTVAAGAVYVDGLGVGDVNDDVLLDRVNLSQEGLLILTAVLHPTPHVEVVARGFARPNRDLELQIRRVALEAVEQGLREKKRLEDVRDDMYGAVRRFTRKATGRNPVLIPMIVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Rna binding protein/rna
molecule keywords DR2417
publication title Structural insights into catalysis and dimerization enhanced exonuclease activity of RNase J
pubmed doi rcsb
source organism Deinococcus radiodurans
total genus 182
structure length 545
sequence length 545
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
A PF07521 RMMBL Zn-dependent metallo-hydrolase RNA specificity domain
A PF17770 RNase_J_C Ribonuclease J C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.580 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4xwwA03
3.40.50.10710 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Metallo-hydrolase/oxidoreductase 4xwwA02
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 4xwwA01
2NXAA 1HLKA 2P1EA 4Z60A 1BMCA 3BK1A 1A7TA 4NQ5A 2BG2A 3BC2A 3PY6A 3KNRA 4P62A 5LCAA 3SW3A 2H6AA 5A0VA 3TP9A 2BFZB 4WD6A 5B1UA 2NZEA 3IOFA 5EW0A 4F6ZA 2I7VA 4UWRB 2Y8BA 4XWWA 3ZQ4A 4FR7A 1WUOA 5ACXA 4TYFA 1DDKA 3SD9A 1KO3A 3I0VA 1YCHA 5ACUA 4GYQA 2BMIA 5EVBA 2DOOA 2AZ4A 2YCBA 2QINA 3BV6A 5HISA 5LS3A 5EV6A 4ZNBA 3QH8A 3KNSA 2QJSA 5LCFA 5HIPA 3I14A 3FCZA 4H0DA 2P4ZA 2GKLA 5EH9A 4XWTA 3IE2A 5EVDA 1JT1A 1BVTA 1X8HA 5FQBA 5A5ZA 1KO2A 4UA4A 2BR6A 5HIQA 3I13A 5A87A 2XF4A 4C1HA 5LLDA 3T3OA 4YSKA 2P18A 1A8TA 3R2UA 5EHTA 2R2DA 4HKYA 2YNVA 4JO0A 2YNWA 3ZR9A 2YNUA 3FAIA 5HH5A 4RAMA 4RAWA 3JXPA 3PY5A 5EWAA 2GCUA 3T3NA 2ZNBA 2DKFA 4TZFA 5ACSA 2OHIA 1P9EA 2CBNA 4HL1A 2E7YA 4DIKA 1VMEA 3MD7A 3P2UA 5HIOA 2P97A 5LCHA 3VQZA 2ZO4A 3LVZA 3I11A 3AF5A 4XUKA 4AD9A 2YZ3A 4RL0A 4UAMA 5EVKA 4J5HA 2BG8B 4RBSA 4C1GA 4D02A 1ZNBA 4EXYA 3DHBA 4AWZA 2BC2A 2WYLA 4BP0A 4DILA 2Y87A 2WYMC 2A7MA 4RM5A 3IE1A 3I15A 1QH3A 4F6HA 2YNTB 4TZ9A 4C1DA 4UWOB 2BFZA 4BZ3A 5IQKA 2GFKA 2HB9A 3SFPA 5KIKA 4GYUA 2BGAA 5ACPA 5ACRA 4AX0B 5EV8A 2Q42A 3ESHA 2AIOA 2FM6A 2XR1A 4FSBA 4CHLA 2BFLA 3AF6A 4UWPB 1X8GA 4YSLA 3PG4A 2GFJA 1MQOA 5B15A 3X2XA 4D1WA 1DD6A 2I7TA 5ACQA 2FU7A 3X2YA 3T9MA 4ZEJA 4KEQA 4EYFA 3RKJA 2YNVB 4AWYB 4Z7RA 2FHXA 5AHOA 5LE1A 4PVTA 3X30A 3BK2A 4C1CA 3IDZA 5AEBA 3SRXA 1Y44A 3G1PA 4HL2A 4KEPA 4U4LA 4RL2A 3ZWFA 4V0HA 4ZO3A 4J5FA 4PVOA 3Q6VA 3RPCA 5ACVA 2ZZIA 4EFZA 4TZBA 5DPXA 4Z5YA 5AYAA 4C09A 1KR3A 3SBLA 4O98A 4ZO2A 2M5CA 4Z6XA 4NQ2A 3IEMA 4UBQA 3IELA 5KILA 2BG6A 3WXCA 5LM6A 4EY2A 4UWSB 1L9YA 4EXSA 3RKKA 3DHCA 2QDSA 2I7XA 1WUPA 1ZTCA 4LE6A 1BC2A 2GMNA 1YCGA 2QEDA 2Q0JA 1JJEA 5FQCA 3AJ3A 3X2ZA 1XM8A 3ADRA 5HH6A 1WRAA 2NYPA 2VW8A 5FQAA 5B3RA 2Q0IA 4FEKA 2WRSA 5ACWA 5HH4A 1VGNA 5K4KA 3IEKA 2BG8A 3DH8A 3IOGA 5LSCA 1JJTA 3A4YA 4TZEA 4Z67A 3F9OA 3SPUA 2BFKA 4D1TA 4D1VA 1X8IA 2Q9UA 3ZNBA 5K0WA 4YSBA 5AHRA 3KL7A 2BIBA 2NZFA 4EYLA 2YNTA 3DHAA 4NQ4A 2QDTA 2UYXA 4NQ6A 4Z5ZA 3S0ZA 2FHXB 2OHJA 4C1EA 2WHGA 2FU8A 1WW1A 2FU9A 4TYTA 2M5DA 1QH5A 2Y8AA 5LMCA 4AX1B 2BTNA 4EYBA 4GCWA 1E5DA 3L6NA 5AXOA 4C1FA 5AXRA 2FK6A 4D1UA 5A0TA 5K4NA 2FU6A 2ZWRA 1YCFA 1K07A 3VPEA 5ACTA 3IE0A 5K4MA 1XTOA 2BG7A 2OHHA 2WYMA 1ZKPA 1M2XA 3H3EA 1SMLA 1DXKA 4B87A 1VJNA
chains in the Genus database with same CATH superfamily
4B8ZA 2AFHB 2ZT5A 5FAKA 2KDIA 2C0CA 4LC0A 2AB0A 3BDVA 3TLKA 3EZLA 1CQJB 2L83A 1TYCA 1W5SA 4K88A 5C8ZA 4F85A 2QMQA 5LXTA 5BRNA 5LA6A 4C30A 2VXYA 4LK3A 4YTNB 4NZZA 5H68A 4FR2A 4L4ZA 4MDEA 5EMLA 2YICA 2VOEA 3EZ2A 2JVIA 4X7BA 1BMLC 2DH5A 2A9RA 5B3LA 1YCHA 1ZRNA 3ORYA 2QMHA 4TL8A 2FTKE 1V8PA 5DM4A 1FQKA 3TBLD 1A5BB 4TSFD 2OV3A 3BV6A 2QYHA 4I5GA 2BBCA 5JAOA 3W8EA 3GZTB 4PCLA 2W6JA 3A6HA 3GC6A 4QASA 3DAOA 4AF6A 2VRCD 2KHZA 5J5VA 1DQZA 4D9HA 2ZRIA 4Z9BA 3HJHA 4YBZA 3THYA 3FA2A 3LQFA 1K0FA 4UHKA 3EPJA 4MR9B 2HA2A 3HUTA 3L8CA 3A1FA 4W5TA 4HZGA 2G71A 3C8YA 3PKJA 4KQ9A 2X8JB 1JQAA 4KWTA 1O97C 4X95A 2P4EA 2IY0B 3O8QB 3IJRA 4CR8A 1CIJA 2UZ4A 4EB3A 3PX2A 3IERA 1EGQA 3EZYA 5T8KC 1EFVA 3MGGA 5AKYA 3K0FB 3PDWA 4KQMA 1CX9B 4Z9XA 1V0JA 2R8XA 4C80A 4GVXA 3M6VA 2Q6KA 1Q3KA 4O0MA 3LQ1A 5AM1A 1RP1A 1RTKA 5F5XA 2O06A 2HW8A 4GNKA 4YROA 3ZLJA 3OZCA 1JAYA 4QPNA 2BBTA 3O9VA 3X43A 1KRWA 4MM3B 4UU8A 1Y6ZA 1QNFA 1S1CA 3FUCA 1JECA 4H0FA 4XI9A 3T1TA 5HIAA 2BBSA 1H6BA 1L4DB 3IIEA 1QAQA 1S8AA 5B6PA 4MEMA 4XPIB 4BWYA 3KWFA 4PQFA 3WWEA 1JMYA 2XNJA 3U1BA 4QBIA 3D6AA 1QE0A 3D6MA 1JEOA 1Q0WB 1M6WA 1N61A 2HK7A 1KFYB 3GFGA 3FZNA 3DEIA 1V39A 3S68A 1PV4A 2XZOA 3EFOB 2X77A 2CLKB 2O2VB 1U0BB 2W98A 4H18A 5BSKA 2OBNA 3L7OA 4YMUA 3RBVA 4ZO2A 4B45A 2NSDA 5K0LA 2IEZA 4KGSA 3FAKA 3LNCA 4J1QA 2F2TA 4UE2A 1PYDA 3THOA 3FFAA 3H4VA 3SJZA 5FWDA 5C5EA 3IS3A 1F3LA 1MC4A 5IN4A 1RZRD 4JI3B 4EQ6A 3QHAA 3QPUA 5FHQA 1FQOA 4GXTA 2FPGA 2C0QA 3B8HA 3O8OB 1B9RA 2AOTB 5AKEA 4RF5A 3A26A 1U8UA 4D5EA 4TSKA 1CZOA 4RQTA 3AJEA 1DO0A 5B7GA 3UJBA 3CH6A 1OAAA 3G0BA 3WJAA 5LJIA 4UCXA 4JLMA 1G64A 3TPFA 1NNEA 1A04A 2MHJA 3VH4A 3DHAA 2D5LA 3RRZA 3LUBA 1BEEA 3BWMA 1EVEA 1J2RA 1C50A 1QGOA 1DJQA 1FRFS 2XRFA 3JPYA 3C8DA 1Z2EA 5KNLA 2FR8C 2I7CA 4YQZA 2HB6A 3E2MA 4MGZE 1BMTA 4OCZA 4H16A 1Z5VA 4P2BA 1KXJA 1P18A 2Y4OA 4NC9A 3H5VA 4ISCA 4F2WA 3VPEA 2XMGA 3C4JA 4U02A 4CHTA 4CCAA 1OFTA 2A3RA 1GPDG 3PDUA 4ZHSA 5KMGA 3BPSA 2K6GA 1QU2A 1QDLB 4G84A 3PTAA 1WR6E 3AKCA 2ZLBA 1Y5IA 4B4DA 5ECYA 1IB6A 3OTHA 3RS7A 4M9ZA 2R6ZA 4G11A 3IAUA 3HCDA 1A7TA 4FFBB 5ED4A 2GPJA 2C2KA 3COWA 3CPHA 1H0RA 2QRMA 3UGQA 2BFZB 1Z5SB 3CRRA 3SC4A 5CFLA 3SX4A 3ZQ4A 1OAOA 1ZU5A 5LUBA 1EO6A 1XXHE 2N1WA 1JF8A 4Z7NB 2D5GA 2FDRA 3WQBA 1Q0UA 4TKLA 1JRLA 2FAXA 3PT5A 2PYZA 3N2KB 3HXTA 1RBZA 1M0WA 3ESAA 4Z2AA 4M9UA 5ALQA 3USCS 4LTMA 3MYYA 4XYCA 2I6GA 2Z2JA 1Y8CA 5BWBA 4Q18A 2QR5A 1KI4A 3NUQA 3P5SA 2ACEA 4FFSA 2XT6A 5EVDA 4TLCA 2OFFA 4J6FA 1EFKA 1ATIA 4Q05A 3U61B 4YO8A 5K1ZA 3MERA 2GEJA 3WGVA 4RJTA 1TEXA 1EWYA 3HCCA 1NASA 4TXNA 3FVVA 1KMIY 1Y1RA 4HXGA 3VR3D 2A9FA 3DL2A 1T5BA 2OOKA 2QD5A 3JD4A 1S9HA 1V80A 3U62A 2IXAA 1YDGA 2QIPA 2PCJA 1DV2A 2WQYB 4BYMA 4TYPA 1CLUA 1CP3A 4XZ4A 1SC3A 3MLBA 4AXBA 1MOQA 2YHSA 5DTEA 1HNNA 4UOQA 1S01A 3WNCA 1MJNA 2BEWA 4ZGWA 1E94E 2DCUA 1TQ2A 1W2WB 1JS1X 2TMGA 2VDQB 4DZTA 3PNSA 4LW8A 4LS3A 4DILA 1U63A 1AGNA 4FX2A 4DC1A 3HUUA 2IP2A 4B9KA 3KQ4A 2WEKA 1PGAA 4WZBB 4AKHA 4C1DA 2N9LA 3VI3B 5INTA 4OA8A 3FOFC 2I2WA 4OQQA 3OCYA 1OXXK 5AW6A 2FM6A 2RG1A 3FZEA 4WA8A 1YU6A 1D0VA 2BGGA 1NX9A 2IYXA 4TQ1A 2O20A 1G21A 4AI6A 1USUA 4L3WA 1WU8A 1EFCA 4ISBA 2KN5A 1YTLA 2LGXA 4FYKA 4YPFA 3LP5A 4CMKA 3UYLA 4IOKA 2PT5A 1FDOA 4KVFA 3CE9A 4OU5A 2VYFA 1JR6A 3BJIC 2KSQA 4MUNA 1ODIA 3AFMA 1TMYA 1GA4A 1IHXA 5J4LA 4MI9A 4P0PB 1W44A 1FYWA 2EX0A 3KLPX 4B6JA 5IK2A 4JC4A 1FP1D 4L08A 2AEFA 2ADOA 2EWVA 2FUG1 1P39A 2HM7A 1EK6A 2VYND 1VQ1A 1OY1A 5IWAB 5B1HA 1DKMA 1QYXA 2QLFA 1G6KA 2YQZA 4KXNA 5TE9A 2CXPA 4BZQA 4GGMX 3OOYA 4HAXA 3HNPA 4MV4A 4X62B 2QIEB 3GW8A 4TROA 1T1SA 2ADFA 1M94A 4Y1EA 1DBWA 3WA0A 1QHXA 4NQ6A 1P9NA 4HJGE 4QUIA 4RJLA 1RLJA 4DA0A 4TMXA 1R4NA 3T54A 4GWKA 2AI1A 3T95A 1HSOA 4P5PA 3OQHA 3I04A 2Q8PA 1A9SA 5DZSA 4ZCTA 3O26A 3R3JA 3ADOA 3ENNA 1TS5A 2HFJA 4WNAA 4CMAA 4WZAB 3KQLA 2VQEB 3IE0A 2DBVO 1ACMA 5E6NA 4Y2HA 1FCJA 2J46A 1C9MA 2ZRMA 4U9HS 4ESVA 4RVGA 2B83A 3VC7A 4E1AA 2WMNB 3U4MA 3G6KA 3O1IC 5JS2A 3RU7A 4DL9A 5ICGA 2WFLA 2ZYVX 1AQIA 4C7XA 1F1BA 1YDMA 2FZVA 3PUZA 3R3UA 3DCIA 3MP9A 1PDXA 4OX9Y 4M0UA 1XEEA 2OCBA 1SWWA 2EP8A 3VTVA 4F6ZA 1YMHE 4X61A 3MJ4A 5A0FA 1PR3A 3NWOA 4BGEA 3K0AB 2FPKA 3CUKA 4MCJA 1F8XA 3RS2A 1GM5A 5L53A 1BH2A 4M76B 3PQEA 4AZSA 4YJDA 3UGKA 4K1LA 4CL0A 3HJAA 3C7AA 5BSGA 4WOCA 2GAAA 3KOMA 3V9PA 2GBFA 1AIPA 4RMNA 5KTYA 1TKGA 2NU7B 4YBRA 3JY6A 1CNMA 1SG0A 3GS2A 4LNFA 4XWTA 2YWHA 5ERXA 4YUYA 1VE3A 1G60A 3I5UA 2QXTA 3C87A 3HCEA 2ZIXA 2QEQA 4G26A 2QQ0A 3K6JA 5FD8A 3JXPA 3E03A 2R8YA 2HF9A 1WHTB 1LGRA 3LBFA 3CNOA 2D3BA 3DVAA 3OFVA 3FC4A 1JKJB 2F9FA 3BE4A 1V1MB 4M87A 3KKZA 1GU0A 4AMYA 1P9EA 2J53A 1I3CA 4N3GA 3MILA 2O7SA 3BRCA 1U28C 4FXPA 2QPAA 1Y3CE 5TSDA 1W59A 2MJEA 3TX6A 4CM7A 2PZLA 3ES9A 2J41A 1CY4A 1L7AA 3SXUB 3QKUA 3APDA 5J18A 621PA 1CY2A 3DL7A 4S0ZA 1LW7A 5BV1A 3H17A 4JN6B 4RETA 4GB9A 2YHIA 4ZVKA 4IIJB 2R9VA 3DOUA 3KZ1E 3UATA 3L01A 1O0SA 2JU6X 1TQ4A 4KGVA 4EATA 2WX1A 4J6IA 4IUDS 3MT9A 4CMJA 4AWBA 2IDJA 2ONKA 3WJ2A 1FL9A 3D0KA 1G4AE 1HGXA 5A5EA 4TMVA 1UPFA 3K70D 1L6UA 3K9QO 1ODKA 4I50A 1MIOB 5FOWA 5L3SB 2AJTA 3SFVA 4FEYA 3M3DA 4KPGA 4HNTA 3H84A 3K73O 4V0SA 1E58A 1TQHA 1XBTA 1NXSA 2X9NA 3WIEA 5KOHB 2DKNA 2WJ3A 4X45A 3U2QA 3G59A 4CMIA 3BGIA 2QT9A 5ICMA 1BGVA 1EZZA 1Z0UA 1I7PA 1WEKA 2ZRHA 1I3NA 2QORA 4P1ZA 2UUBB 2RSLA 4JA0A 1D0SA 2ZYTX 3OI7A 4ITVA 5IULC 1QQ5A 3ZWMA 3P2YA 3HR4A 3KQQA 4GFDA 1KO1A 1T0RC 4YJ3A 3SKYA 2XUFA 5AP9A 1F2UB 1NQXA 2QPLA 4IQFA 1DRWA 1YE8A 4A1FA 4Y9TA 2VS1A 2VAMA 2NYPA 2SECE 3RTAA 3TEWA 4NATA 3SS9X 1EUQA 2WG2A 3A1TA 1ZM7A 4LQLA 2VBIA 2CFSA 3KXLA 2H0QA 4LNUB 3AG5A 3NW9A 3L6EA 3WP1B 4GOND 5ES3A 2BEVA 4L5IA 1R7SA 4ZK6A 1LRKA 3SEZA 4XVCA 3OE7A 3KAQA 2GCEA 4EUTA 1B1AA 3GF4A 2H7VA 5EJ4A 3WKEA 3OURA 4MI6A 2R6AA 4BGUA 4GKAA 3L92A 1TYDE 4BAZA 1UBLS 3ER6A 4U63A 3WSVA 2QR3A 1J0AA 3N3AC 1VGQA 2PLRA 4Q15A 4GQAA 4JUAA 4MRMA 4D3DA 1RPAA 2JGEA 2QN6A 5JZEB 4MHTA 4DV5B 1JR3E 4QULA 2X2PA 1D6NA 2QR2A 4Z7QB 3ETJA 3TMAA 1WS6A 1Z5WA 4LXXA 3BCSA 2PE9A 2WJYA 3OWEB 2BI7A 1KC3A 2WR8A 4ON9A 4Y30A 4AJJA 4ED9A 4RPCA 1KVQA 3R0JA 4MVWA 4I4IA 3DHIC 2N7DA 1OGWA 1A9ZA 4GX5A 2WYQA 2ZYIA 5E4FA 4HEA6 3CS3A 3FG9A 4FNOA 2GKOA 3CZAA 4RC9A 4U2KA 4LV6A 3RVJA 4FWIB 1WOMA 1FP6A 2E4UA 4EUFA 5AVKA 5F7XA 1KBOA 1FRDA 1REQA 3C15C 3AL2A 2GK6A 3GT4A 4EG6A 2D1YA 3S7TA 5KHLB 3ZTCA 3ENQA 1HFEL 2YHBA 421PA 2GRUA 2HWXA 1H4RA 3GQBA 2GYUA 4OQLA 3D64A 2BRUA 3ZTTA 3LFHA 4RNCA 3PE3A 5BT8A 1W1IA 2ZANA 5BW4A 5JCJD 2XOXA 3P4PB 5FBZA 1QUEA 3TNDA 4JBWA 3RC7A 4UNRA 3JASA 1G20B 1FLDA 4BAUA 1BIFA 3NVWA 1Y5NA 2KI5A 4O4HF 2G9VA 3BTSA 1SM4A 3MSXA 5BYAA 5DN9A 2CE2X 1QIDA 3OG9A 2M56B 4AJWA 6ABPA 3RULA 3VHXA 2OYCA 1U5AA 3AJ8A 2QSDA 1RI1A 1GYRA 4I81A 3R8XA 1UGJA 4HATA 3BJZA 1WUTA 3NZEA 4WY5A 4FYWA 1FUUA 1NW3A 2WU5B 2AQ3B 3BMOA 2QRLA 4B73A 2I62A 1I24A 1PV1A 2PGAA 3UGTA 1DXYA 3PWKA 3WL4A 3E82A 2C5EA 3ZBUA 3QIJA 4RBSA 3EUAA 1PZGA 1VHJA 2F8SA 4AWZA 3EE6A 3EEYA 1B8PA 3EFCA 3S27A 4EW6A 2LXAA 3K0BA 1BXTA 4MV5A 3OJ3A 2HEGA 2JZPA 3TX2A 2QTRA 4LWOA 1KJYA 4RA9B 2B35A 1PO7A 3N70A 5C7YA 4G0WA 2L0FA 4G1MB 2L3ZA 5G55A 5C31A 3LKVA 4G1FA 1QYRA 1RQLA 4Q37A 3F4BA 4BNWA 1P8AA 3L0OA 2WWHA 5ALUA 1OYWA 4DUGD 1UDXA 2F59A 4A26A 3IUQA 5HYVA 2QM7A 3HNOA 2ZJBA 3D02A 2QGNA 4J1TA 3Q0EA 3GN2A 3B3JA 3WLEA 5D1NA 2BYTA 5BN4A 4OOEA 4HLUA 4QOEA 4YV1A 1G8JA 3BXFA 1JKMA 3DE6X 4AECA 4J6EA 1AO3A 4CV3A 4NMXB 3TF5A 2CF5A 5HUQA 5CVVA 3SIXA 3DLIA 1MRZA 3V7YA 3A6GA 4K28A 5KNCD 2QTCA 7MDHA 5EQTA 2PZEA 3IUNA 4BKSD 4D9MA 3FSJX 1Z15A 3T9LA 1BQ3A 5K0SA 1W1UA 1U3VA 3LHSA 1ISHA 1RXEA 1SJHD 3DH0A 1EESA 1L4YA 2B6NA 1W5TA 4ZT2A 1IZYA 2R7NA 4L72A 3QFTA 5KOJA 3WL3A 3ZNNA 1GPKA 3QU7A 3PD1A 3SS7X 1L8AA 5DTRA 4TTVA 5A4AA 2PT7A 3K8OE 1RWWA 4MEAA 4Z7JA 4AJLA 4I4TF 4ONEA 3W8NA 2IPMA 3LUJA 4P2GA 3NV9A 4ZRKA 2XA2A 1H05A 2OHJA 2G4SA 4GR5A 4CW7A 2ZSBA 2EHJA 3FILB 4DKXA 2FJUA 1R1DA 5FI5A 3U16A 4FOOA 3LIPA 3GAAA 3JWJA 1H2HA 3FNHA 1E62A 2ABWA 3TLZA 1M83A 2FU6A 4ARVA 1YQ4B 4HDMB 1L1RA 3RFZB 4FBJB 5E1BA 2GFHA 1ZR2A 1NI4B 1CQIA 2JAWA 3DE5X 5LQUA 3USES 1L5KA 3D3WB 1YHZA 2KYWA 2GMWA 2OV6A 3CCCA 3FLEA 5CTAA 3U6KA 1NV8A 4JROA 3L0CA 5L51A 2PLAA 4UM9D 3WBKA 2Q3HA 2J52A 3LT1A 4R71A 1CUXA 1Q95A 2AOVA 3ASZA 1Q1BA 2BG2A 2O1SA 3MMNA 3OY2A 3RAJA 5BWNA 1F06A 3HBLA 5CHWA 3SW3A 2FNAA 4HVBA 2YZKA 5DX1A 1G8GA 4MGYE 3INRA 4O4HB 1L8XA 1L5PA 1ZXLA 4IDOA 4RD6A 4URXR 1U3TA 1G5RA 4AQDA 5FCDA 2X42A 5A02A 2WVHA 4HSEA 3V61A 4Z7OB 2XMBA 1OI3A 4I6LB 3FAZA 3RUIB 3L54A 1XWWA 5G5HA 2BKAA 4LHXA 3DNMA 2C4UA 1E2LA 2ZJDA 1K5GA 1LDMA 1DQYA 3AFHA 2XMZA 1BA2A 4QT4A 3ZYYX 1EWKA 1GKUB 1ZD9A 1EX9A 1GAQA 1N6OA 2H89B 3GJ5A 3KZOA 5IAGA 4LY3A 1S3GA 2KBFA 3E70C 5LOVA 4OFWA 2X22A 2ZSKA 2V6IA 4AJIA 1JPVA 3SDBA 1ZOOA 2ZUFA 3AL0C 2FNJB 4OLAA 2BF4A 5D87A 4R1QA 3L07A 2CCJA 1WDWB 5IOIA 2ZRFA 2ODQA 1EE2A 1TUIA 4EZEA 4KQJA 1DAKA 3LS2A 1A82A 2ZT7A 1HL3A 1NUUA 3PPWA 1TVEA 3G7NA 2Z57A 4QVKA 3UYKA 1P9DU 2FWNA 5BOSA 1PZMA 2BMAA 5JAQA 1CLEA 4NCIA 3WNVA 4QVGA 2BFFA 2P97A 1I4QA 3CVWA 1FFSA 3BL6A 1U5BB 2QUHA 5K3FB 4BQRA 4G6ZA 1I1OA 3T3IA 4ARZA 2LMCA 3FPCA 3PRKE 2V3PA 3KZCA 3DHBA 3N2LA 4NK5A 2YHEA 2F6RA 4NH0A 5TXGA 3DULA 1A2QA 3ELWA 3B6IA 4N40A 1UKBA 1F20A 2DPHA 3NP9A 1B74A 1HZJA 2VDPB 3CE6A 1NBEA 3OWOA 1XLQA 4K9SA 121PA 1JDUA 3VX3A 1D5MC 4B8WA 4GMVA 1T4DA 2X4LA 2W37A 4OD0A 3PGKA 3S2AA 4X6XA 3UH1A 3KQVA 1YNTE 2G25A 4HJXA 3OFND 4GMGA 3C43A 1SC1A 4OQYA 4C3VA 3IQFA 5BQXA 4IVPA 3ZXSA 4U7JA 4HNQA 1H8HD 2BFCB 3R75A 4BLWA 1EM7A 1UBQA 4HWKA 1DAEA 1Q1QA 4XWGA 2ZT8A 2AMFA 5A3JA 5CXXA 4YTEA 2IHTA 4LRQA 2JCVA 2GHIA 4U2GA 3CRW1 3TYXA 2BMVA 4NAWB 1Y5LA 3ANMA 4D96A 2V55B 1XHFA 1GL7A 3ZY3A 1T5XD 3QVXA 4JDPA 4FFOA 1DWOA 1V95A 1QGAA 5C4IA 5F51A 3SE7A 4CI0B 1ECCA 1TJ4A 3COSA 2EYUA 1WYGA 3ANSA 1A27A 4EVRA 3ZC3A 3PHCA 2QVLA 1Z22A 1NOJA 4RDXA 5IXYA 3DLBA 2VDMB 3HZHA 1YI8A 1P9OA 4O4IA 2RPQA 1S8NA 2NUTB 3Q8BA 3ALBA 4EL5A 2YS7A 1QB8A 5L6LB 3T1YB 2W5UA 4TWIA 2UYXA 1XZHA 3RT9A 1PVVA 2AQ1B 3RF7A 4J1NA 3DC2A 2BUAA 5BNIA 1WPGA 2ZYRA 4AKSA 1A88A 1TVKA 3PNOA 4KX3A 3VXKA 1V37A 1DEHA 4HQLA 3LSYA 3H83A 3HGQA 4RAQA 1UXGA 2PIAA 3R09A 2I1WA 3QVKA 1E9VA 2I9KA 2IHZA 1RCUA 1BNCA 4XDDA 2IH5A 1IK6A 4F4JA 2C59A 3O2JA 5M7EA 4RHXA 4X0EA 4X1IA 1XG5A 4AZ0A 4KGXA 1Y3AA 3WGYA 1P5JA 3FOAA 2J7PD 3I37X 3BVZA 4LGVA 3LX8A 3ODPA 2ZCCA 4BFLA 3TSSA 2H1LA 2FMIA 2PX5A 4C4VA 1HQKA 4R1SA 4GP9A 4Y2QA 1N8SA 4KPUA 5GIPE 1OXTA 1MABA 5DBHX 1WBJB 1PK8A 2F1JA 3JX9A 4FBMA 1KR2A 2VO1A 4YJHA 1U04A 2OUKA 1SC9A 3QF4B 5FBLB 3HSSA 5A0VA 4XVUA 2OPHA 4DGQA 2VBGA 3LX4A 2JIOA 4W9EA 3TEYA 4EUNA 2I7VA 4F71A 3H7SA 3ESCA 4XD7D 2K7ZA 3L1VA 2YV3A 3STUA 3DSRA 1VECA 2W90A 3G1UA 2OFPA 3O93A 1VKJA 2HA4A 4NDZA 3OCUA 4IZHA 2NQTA 1AU9A 1XNGA 4IEFB 1R5BA 3BAZA 3IHKA 2L8JA 3MG9A 2Q4BA 3EGEA 2DP4E 2V4LA 2YV5A 2LASA 4MEBA 2KX7A 3UWMA 3C14C 3LT5A 1ENFA 3Q14C 1QK5A 2Y0EA 3H9JA 3Q0IA 3UJPA 3PJGA 1G5FA 1AS3A 1XMQB 1XWIA 3JAWB 4REZA 3BTVA 4Y2SA 2GEFA 3SYKA 4YX9A 4C5AA 2KFKA 3JQEA 3GHYA 2REQA 4KGRA 4NAVA 3T4PA 4LDNA 4ECEA 4P35A 1P2BA 3HU3A 4ROSA 2KS6A 3KJNA 3STYA 5K0ZA 3GDGA 2VJMA 1GG9A 1DELA 1TL7C 2DWUA 1J90A 4NJMA 4BVLA 4YRAA 7ADHA 2Y5BB 4EKIA 3H2KA 1E5XA 2NTJA 2C95A 1RCFA 2CDCA 1W96A 3WNDA 4GGQA 1RWXA 4FJZA 1VYTA 3GRVA 1RPTA 2VDVE 4J5HA 5KDOA 1FUYB 2W70A 3KWLA 3ENVA 3U52E 2DFDA 4X44A 4N7JA 4PSAA 5A9SB 3THWA 1Q0SA 4MUBA 2VT6A 3M7IA 1RWBA 3IAS1 5JS6A 1DIBA 1V8DA 5EFOA 1M2WA 5CM9C 1DKRA 2YFHA 3O9ZA 1R0SA 4AX0B 3NTVA 3FR8A 4W9JA 4WADA 1PKXA 1PWEA 1NN0A 3NOVA 4JGBA 5FEUA 3BZDB 4GDMA 3O4VA 3C3DA 1PJRA 3PPAA 2IPAB 1N9GA 5KYWA 4IRXA 1RC1A 4I1YA 1XLWA 1YACA 4BNDA 2I3GA 1HEUA 5GY7A 4QU8A 5IFLA 1RLUA 4BZWA 2QTGA 2ISSD 2IZZA 1Q5PA 2AMJA 4ZO3A 2Y1EA 2RMMA 1MT3A 5AZFA 1UPBA 2RI6A 4C4AA 4ZDJA 3FTNA 3R3WA 5KHOC 1MFZA 4MVCA 3QHPA 4L5BA 3KKMA 4BDSA 1WXMA 5CM2Z 1THZA 1O3YA 4LLGM 4W6ZA 4C2AA 3GT0A 3Q3FA 1DKOA 3MZ0A 1IWPB 4HDRA 3G9ZA 2QDSA 3M2TA 1C76A 5AM5A 1SUPA 4LBYA 3QYFA 5KQGA 1J4AA 5CYGA 2NYRA 4BIIA 5EE5B 5JW6A 3NBYC 5EUQB 4C21A 1VPLA 1XDBA 1LJUA 3DDZX 4L4XA 4D42A 1E2UA 1X9HA 4W9NC 1QHIA 1NI3A 3HUDA 2O2DA 1WW3A 4HEHA 3CNBA 1TBEA 3TIXB 2BONA 4NYIR 2BUBA 4ZIRA 1LK0A 4QU5A 4MWEA 5REQA 4PTYA 6NULA 4OLJA 2X8LA 3KU1A 3OE1A 1GPH1 1QUFA 1U9CA 4TYTA 1DGQA 1OWMA 4GWLA 1R3DA 4MUJA 2XXAA 4YC7A 4L78A 4EO7A 3K70B 3N8KA 4W1RA 2QG6A 1BOOA 1D5XC 4OHKA 2YR0A 1ZGJA 5EJ5A 1VGRA 2ATIA 4DLWA 1WXSA 4KSKC 4DM7A 1ZPDA 4IJVA 1XUOA 1M7GA 2Y66A 4C0WA 1JBKA 2YMLA 2XECA 3LBYA 1ESFA 4JXZA 2EFCB 1DFGA 1F1JA 2OFOA 4G5QA 1PSZA 5DDIP 4FHEA 5E4YA 2P1EA 1UZLA 4TRRA 3P0HA 4P98A 5CEEA 4RE6A 3ZLTA 2CV1A 2HMAA 3ZXIA 2VWGA 1KGDA 5JZMA 1KXZA 5ALPA 1UZNA 2EFDB 1Q22A 3RVSA 3UFBA 4NU8X 4A0QA 5BSRA 2E4XA 3TNLA 1FP4A 4D4HA 2O2CA 2W6NA 1IHPA 3AR6A 1K86A 4ND8B 3LT2A 1TM7E 4L74A 3EZ7A 4WLFA 4TVBA 1JVSA 3HN7A 1XR3A 1H94A 1NE2A 1XZCA 2QTMA 1ILWA 1WB6A 2V0CA 2UAGA 4R98A 3NC0C 2MR5A 4DABA 3V3XA 3UW1A 4FD2A 4PN3A 4PHFA 2V96A 3N86A 3H3JA 3GR6A 2FBWB 4PNEA 4BNHA 3KCQA 3GGJA 2CBZA 3V2UA 4MKFA 1IGDA 3MD9A 2XH8A 1MEOA 2O8CB 2Z95A 4A6DA 3GLGB 4HJRA 4Y2XA 2CDRA 5CXQA 2GKSA 1OVMA 4C01A 3PRZA 4TTIA 4MP8A 3HCWA 1VYVA 2F8TA 1W36B 1DUSA 3PKZA 2FQQA 2AD5A 3AUXA 1NBAA 4EHBA 2ZSFA 1J0DA 1Y7IA 2HMVA 3IP8A 2Y1OA 1WGGA 4KNVA 1XD8A 4JLVA 1OT3A 4F6RB 3EXFB 5AI9A 1O96A 1MENA 5BN3B 2BD0A 5DFAA 1KKLA 3OF5A 5AK5A 2H1WA 3HHPA 2WM2A 3EA0A 3B82A 3R20A 5AI8A 5F4BA 5ITZA 3U60B 2ERXA 2GPTA 4MS1A 2J9GA 4GOXA 2J3HA 1V8ZA 4A16A 5L4SA 5MFZA 4HTFA 2GARA 4RPLA 3WG9A 2J7KA 2FW0A 1KTKA 1D8TA 3EFBA 3AVTA 4KQXA 5FL7A 5BXYA 1PLJA 4JGHB 1PEYA 2WU8A 3K0EA 5A5DA 1DD6A 3URYA 4N47A 2HRRA 4XUDA 2RJNA 3AKDA 3NUHB 3PX3A 3VAWA 2PRIA 2QOEA 2VP5A 2PSDA 3DQZA 2FEMA 1E7SA 3DHYA 2RH4A 2N0SA 3EDCA 4RS4A 3U49A 5CU7A 4R40A 2QI9F 1P6QA 3E22B 3ASYA 3PJRA 2CJFA 4ZVNA 2Z8YM 4C09A 4K2AA 1UBCA 4A0GA 5KILA 3EHVA 4JI0B 2Y71A 2KFJA 2DBQA 1UJ4A 4G5OA 3YASA 2C77A 5F7ZA 4GICA 3HB5X 4NYIQ 5AKZA 1SUSA 4WNYA 2RH5A 2H07A 1K89A 4US9A 1JDZA 3ZV4A 2FRXA 5LYJB 1DPGA 3INNA 4KN8A 3I5XA 1ECFA 3HBFA 1YFJA 1WW8A 4E2WA 4G0UA 2R7MA 5A5GA 1I4LD 2F1HA 4FFDA 1U2PA 4IJKA 5SICE 4D0LB 4GECA 4Y7CA 1PDWA 2Z1DA 1ST3A 2JIZA 3ZE2B 3QWFA 2VQ3A 4ZU6X 3EQ2A 2EJWA 5F2KA 1CUHA 1M1ZA 1KF6B 1ZRHA 3JRNA 3ZVVA 1L8QA 3BINA 2Z5GA 4UFNA 3EVEA 4L8VA 4YK7A 1E6CA 5AUIA 4JP8A 3UJHA 4TLAA 2W82A 1XTIA 2FWAA 3AF3A 1R0KA 1PJTA 2PWPA 3K0CC 1GB1A 3T7CA 3DV0B 2QBYB 3IOMA 4WQMA 2R8BA 2Y05A 5DBOA 4Y6LA 4P8RA 2WDTB 3SEBA 1RI5A 5C8YF 4ZYXA 5LP6A 2WWYA 3UXEA 1Q6ZA 3I3SR 1P61B 2E0IA 3KVNA 2QLBA 4MW7A 3SR3A 4C78A 4I6NB 3LPDA 3FRIA 2TECE 2VL7A 4CM8A 3QBVA 5DIZA 5HKKD 1HLKA 1UKZA 2HWUA 4RGTA 3W0LB 2A0FA 4L28A 4QX6A 3H13A 3JD0A 3E05A 3TP9A 1RHQA 1NONA 3GEPA 1YUMA 3ELDA 4ZRPA 4RMIA 1K2WA 5E6SB 2F8MA 1H2AS 1PWXA 1KZ7B 1EVJA 3GLIA 1QPBA 1KM7A 5ALXA 5IAAC 1W35A 3NTXA 1KEKA 1FU4A 1A50B 2SKDA 2ZJ1A 2CWWA 1USWA 1VZ7A 4YCDA 2B8JA 2BGTA 4RSHA 3H2BA 1J06A 4KFSA 1N0HA 5D5HA 2ZPYA 3TE6A 2FPUA 4TKVA 4LC1A 1DO2A 4Q7LA 2YJ4A 3L04A 3URMA 1YL5A 4L6AA 1K51A 3T3EA 4V0KA 1KARA 3AUJB 3LUFA 4FDAA 4C5CA 3D5QA 2BJHA 2VTEA 2NBVB 2GRIA 4L3VA 4AF7A 4TYNA 3C19A 1V11B 1B23P 5IHPA 3TDNA 2L00B 3P9IA 5ITVA 3KPJA 1Q16A 2IBMA 3F4KA 3CG4A 3CKKA 1CYEA 2PUTA 3VMFA 3VVWB 4UVIA 3BRWD 1U8FO 3IO5A 1G8KA 3Q3HA 4XB6B 1IXZA 2N4FA 1U8EA 5KNBA 4R41A 4C4SA 4ALMA 3ANLA 3AXCA 4LY6A 3W5JA 4Z86A 2I80A 3FRJA 3H11A 2ZUBA 2WLTA 4XVQA 3PR1A 4IICA 3D8TA 4MV3A 4YAUA 1E3JA 3NM5A 2MINA 4IWOA 1DHTA 2CLMB 3FKSA 1AWDA 5KWSA 3R8BA 1S2GA 3ENZA 1V9SA 4OL0A 1W34A 2FAZA 3TFQA 3R3ZA 2QM8A 5JXIA 2YFKA 1NA5A 3WC4A 3GVHA 1MH1A 4D9BA 4F5WA 5AJWA 1COZA 1OBVA 5D7GA 1EHCA 4PFQA 2EBUA 3HCRA 4J9VA 3U9SA 4DLPA 1UH5A 2HIAA 1YBFA 3IQIX 3R40A 4YUVA 4D0SA 3C6ZA 2XOKD 3D3NA 5KZMB 2VG8A 5CXUA 1YZFA 2NYAA 1H2YA 1Y8ZA 1WMAA 3JSVB 3VR5H 2ZKLA 4FLMA 1RQRA 4YP0A 7REQB 2ZZMA 3S2ZA 2PJZA 4U9IS 3OZVA 2A6PA 1Y44A 2IOFK 1BD4A 4KEAA 4LRYA 3MWDB 4RXUA 4KW7A 3NOBA 2PVGC 4Z9FA 1M76A 2OZKA 1K3TA 4KIGA 1NL3A 2B5WA 2D62A 3BFXA 1R74A 4JODA 2R6HA 4WKGA 3NGMA 4OJQA 3B3QA 1WGYA 1L4HA 2EIHA 4H27A 4IIUA 4UBQA 3V1MA 1CK1A 2VPWA 5DBGA 3KYCB 3ML1A 16PKA 2QRKA 4DHZB 2ZBFA 2BR4A 3EWNA 1H6AA 1KY5A 5CCBA 3GLHA 4ZOHC 4J94A 4BP9A 4YSZB 3A36A 1T0BA 5DXAA 3WYCA 4DJFC 1XK6A 3AQIA 1Y56A 3AEFB 1HFWA 1B3BA 3KAKA 3JQFA 5KQPA 2TYSB 1ACJA 4X9XA 2I3DA 1VMDA 4MKGA 2HQRA 2WMYA 4I9NA 1BMFA 5EIBD 1KJ8A 1R4MB 1LNQA 1OLUB 3F9OA 2NVUB 4BC1A 4C7VA 3S2EA 4RD1A 1RPJA 2C5HA 2FQWA 4RHUA 2CB0A 2CL0X 2ZRQA 3N1YC 4F6LA 5LQNA 4LECA 1XTRA 3G3EA 5GWXA 2PMWB 3PHJA 5BYRA 2IJ0A 2IFTA 2A59A 4DBGA 3NNNA 2ZWIA 2I6XA 3SFDB 4GDLB 3W2HA 3GJQA 1GZVA 2G09A 4U6NA 3EAQA 4O2BA 4WCFC 5E6RB 2W2MA 4INJA 3DVLA 4JOSA 4KFUA 5ED0A 4WJZA 3OT1B 3B1ZA 3GD7A 3HUIA 2WIAA 2C94A 2N1BA 1CJBA 5CVDA 1BN6A 4E70A 1P1KA 3L8HA 1V1OA 5JXVA 4HPLB 2JNWA 4DSZA 1UT5A 3AHJA 3DCYA 3HABA 4AZWA 2C3MA 2XCRB 4FGUA 5DLQC 3IPLA 2F1RA 4RLSA 2IE8A 2WNMA 3PF9A 3KPWA 4L5JA 4GZLA 2BTEA 3BWYA 2Q1TA 1UBFA 1U3UA 2BZGA 3SS8A 1PFKA 4EP1A 2EFJA 1R27A 1OH7A 3PSAA 4YCLA 3G2HA 1XTPA 3BMQB 3Q98A 4N58A 4XB2A 4OFBA 5BSVA 1GPXA 4YWHA 3PC8C 1EFPB 3QKRB 1MG5A 2IXBA 4AIIA 1CUCA 3V4SA 3JPWA 4Q4JA 1L4MA 4IJUA 2JG3A 3EMDA 3TD2A 1SZCA 5B7PA 2G0NA 3AILA 4F4UA 2G5PA 3KPYA 3TEFA 3GNQA 3IUYA 3D8UA 3EFEA 3MJTA 2CVZA 2O3UA 3U4QA 2FPMA 3PZBA 4WW0A 5KYXA 5T4BA 2NO5A 2PMCA 4G09A 4JFAA 1L4UA 2XXJA 2VJYA 4BMOB 1HYEA 3H8JA 1FMFA 2NAPA 4Z51A 2ZWMA 2IU6A 3WGIA 4AULA 2FPRA 2RGYA 1O6FA 4FJYA 4MQEB 1X7XB 2J85A 3NHRA 1JMKC 3OZRA 1V97A 3Q7TA 2WVGA 3WGZA 4CQMA 3T7TA 1QDEA 3MHSD 2EKZA 3QZUA 4RKEA 3BRSA 1WM3A 1JYEA 2JUOA 5JNVA 4F4HA 3TM5A 2H1SA 3HKBB 4HJKA 1E1QA 5KJ1A 5FA8A 4YR9A 1I5OA 1QGED 4CKXA 1FNDA 4OGFA 4G37A 3ZCRA 2GFQA 3E6AA 2QVZX 5EAIA 4NCXA 3RCZA 2F8LA 1JNYA 3H65A 2EMSA 5KYUA 3PNKA 4G3XB 3EIWA 3HVIA 4D4JA 4EVSA 1N33B 5HCUA 3ZVRA 3OX2A 5JMOA 3MCZA 4H77A 2VPTA 3S7ZA 1HR0B 4LYJA 1PEKE 1VHWA 1SXJA 2JH3A 2CXRA 3R3HA 4Y0VA 1ARZA 2OYSA 1MQOA 3UKDA 1JSZA 1Y4UA 4UEJA 4QG7A 2HFKA 3FPEA 3MJEA 4HNRA 4P4TA 1MA3A 1E1CA 4MOWA 1NVVR 2J0VA 2VZ0A 1P1CA 2WJ6A 2Y4NA 1L5SA 2O2SA 4TX1A 1GTSA 3RSQA 2XWJI 4Q93A 2QTBA 1LD3A 1JFFA 3T7SA 4BAGA 4D74A 5JQGA 4BQFA 4IM3A 3BQ9A 4WOBA 3NTUA 3I23A 3RUEA 4JITA 1TJ3A 1DC5A 3FCUB 3N0TA 4GE0A 1XFAA 3PGXA 4EFDA 4L9AA 2PGNA 5F64A 3OJWA 2QRQA 1N7IA 4HDQB 3K9FC 4UTPA 1JQDA 4HWGA 4XWAA 3B20A 4DV0B 4JI7B 1I2BA 3O8BA 1RM6C 3ZW8A 1NPDA 2OPBA 4C29A 2B7CA 3VV2A 3WE7A 2ZR0A 4UBJA 2EGGA 4PYLA 5HXAA 4FQ5A 3NONA 2DOKA 1WCIB 3CCBA 3UN1A 3FYTA 4NMHA 4BJ5A 4INPA 1Y8QA 3SF0A 4I5FA 2ZSAA 5EPEA 2Q0IA 4XA8A 3L84A 3A1NA 1CQVA 3K70C 3RRMA 2BKFA 4G5SA 3WIBA 3I73A 1W8DA 2J6BA 2ZZPB 5KTMA 2GS9A 2H9AA 1I2ZA 4FVTA 2PMFA 5J2TA 3MJFA 3DDCA 4XDHA 3CM0A 3CX7A 2NZFA 2ZBDA 4FU0A 5TPZA 4FKMA 3BOSA 1YFZA 1E7PB 2FFHA 4DWOA 1Z73A 3FGOA 1X1MA 2ODWA 1A8PA 2DPLA 2FUEA 5LMCA 2Z8ZA 3KZKA 1XZGA 1XVAA 4LISA 1Q1AA 3BMNB 3NZSA 3BMCA 1KO8A 1GA6A 4KRFA 1S3IA 4C6HA 4PPYA 4NS4A 2I3AA 2WGSA 5IKOA 3STHA 2Q1YA 4DWVA 1ET6A 3AUTA 4ALNA 2FSPA 3RHSA 1ZKHA 5AJXA 1M72A 4S04A 2PGOA 3B52X 3AEKA 3QV1A 2IO1B 2RDHA 4W1QA 1L7MA 2WZQA 1VZ8A 5FUVA 3AF4A 3HCPA 4CKEA 1MIHA 1KJNA 3ESZA 1DDIA 1CV2A 2PD6A 5SYNA 4YFYA 1D7OA 4U1RA 4TLEA 4YAIA 3SD7A 2C2BA 4EYSA 5EWJA 1KYWA 4QJ5A 3M3PA 2ODBA 4PYZA 3H2IA 1I8TA 1T5LA 2Z4TA 4LWQA 2BFDA 4QM6A 2CEAA 1G0NA 1W36C 3CUTA 4LNHA 3FPJA 4BTEA 5HPYB 3KKNA 1Q92A 2ZYAA 3NDIA 4EUHA 4URYR 1JEDA 3H0KA 4G5YA 1ZH8A 5JG7A 2BFWA 1EWVA 1K8RA 5ALWA 1LW6E 3K94A 2HMTA 4OGLA 2XKBA 1ADCA 2E4AA 2AG6A 1T2EA 3AI1A 1MC8A 4JL9A 3C24A 1Z4MA 4I4LA 2X19A 4WJLA 5CNIA 4O4LA 4OYLA 2KX0A 3CVXA 4MYTA 4DVJA 3AOEC 1B15A 3T3NA 3WRYA 3A6FA 3T5BA 4DDWA 1GQFA 3WGLA 5EUBA 1T3ZA 4QQNA 3E61A 1TTHA 5KNDD 2IO2B 1AJEA 5LB4A 3DEFA 1WJUA 4EY6A 3JAMA 3MELA 1F12A 3K6SB 4DW8A 2MP2A 2DFVA 3OZDA 2IBSA 3L4KA 2V7VA 1N36B 2OILA 5FI1B 3HY3A 4KAAA 2C7PA 5D84A 2XODA 3JZDA 5TQVA 1NVVQ 2ZE7A 1KHTA 3NLLA 1N34B 4IJMA 4BNYA 1ZVVA 1HLGA 3HEBA 2WT8A 4BLPA 2DCMA 4QUAA 3LDUA 2AX5A 3VR2A 5CAEB 2VJDA 1T9GS 1UEIA 3WI7A 1N6LA 1QNLA 5B58C 2EF1A 3DMRA 3CW8X 3PP8A 4S12A 4D1WA 3TSOA 4A23A 4IKEA 2X1MA 4F8JA 1L0VB 4I3HA 3B7GA 3AM9A 5D3DA 2PQ0A 2IEBA 2FSVA 4RZ3A 1DBIA 2WYUA 1U0HC 3KETA 5EL0A 1HBJA 2Q5HA 1COWA 2FSUA 4K7JA 3SJBA 2IS1A 4OG2A 4DV1B 1LRLA 3DBLB 3FTQA 1MDFA 4K6MA 1DYQA 1F5NA 5ALJA 3WRWA 1WXQA 2ZBQA 2ODEA 2QRJA 2DTEA 5ACVA 3PGLA 4RULA 1C0IA 1SU6A 4XTCS 2A88A 4BKMA 4P6VF 2CNLA 2BEUA 4DMMA 3M70A 2BEKA 3NJRA 3H4MA 1KA9H 3IRUA 1AGXA 2VYVD 2PDAA 3B9BA 2LVOA 4I8XA 2C5GA 3WAOA 2H52A 1PTJC 5BWOA 3Q8EA 1EHIA 3V1TC 1SHJA 3PC6A 4O1HA 4H7IA 1C9YA 5E7QA 3JAKA 4CM6A 5JHGB 3V6LA 2F3SA 3F90A 1SD1A 4MP6A 3VR4D 1E1KA 3DNFA 2C2MA 4TV9A 2ZXEA 5ALNA 5IF9A 1WIWA 4KIKB 1PJZA 3R44A 5DLYA 1NU8A 5CITA 1KAEA 2A35A 3E4DA 3EGDB 2ZYWX 3DVQX 4Y6GB 3R4CA 3MGKA 1HE5A 4DA7A 3QE2A 3PFBA 3EEFA 3P2JA 3VNVA 2QMZA 2R751 4BMVA 1HNWB 2ZBPA 2GCIA 3GIWA 3M1AA 2X0DA 1ZOYB 5K09A 4HNVA 3WLHA 5ALSA 3AFGA 4FQ8A 4PXAA 3WGOA 4FFLA 1R5NA 1EYZA 2HV8A 3A11A 3T35A 4WT7A 3DKIA 1JSLA 2HD5B 2WU0A 4H3KB 2EEPA 2GF0A 1ZM3A 5AW4A 3I58A 4R2MA 1X8XA 1CDZA 3QUAA 2DT8A 4IJ5A 1YR1A 2WHEA 4WTOA 1MJGM 3C6BA 1AURA 4ES6A 2WIJA 2K6DB 2BHNA 4E2ZA 4CF6A 3DCGA 4UHDA 1NEKB 2AUNA 2OBXA 3R3YA 1SK9A 5A2GA 2VJPA 5C1BA 5AD1A 1GJZA 2IEDA 3K1TA 5EYPB 1NW7A 1PT6A 4L07A 1LBHA 5CDGA 1DTWB 2FPIA 3EGXA 4TSRA 4K3BA 2F67A 3SK0A 3KQHA 3LPCA 4NE9A 3UY4A 1L3CA 4P5DA 3HBNA 5EHXA 1Q0LA 2G9ZA 2MBEA 3NASA 4K9OA 3AVPA 3NVZA 1ZSVA 1Q7EA 3OAAD 3EQ7A 3AIMA 4C56C 2D8AA 4TMWA 3LT0A 1D1SA 4BP3A 4DT1A 4UHHA 1HYQA 4CPDA 2E4WA 5I7SA 1ECBA 5T8KA 1M7HA 4URUR 3FNEA 3KNSA 2I1KA 5H59A 4TV8F 5KKCA 4K7SA 1AD2A 1G38A 4JIOU 4JUDX 2AK2A 3V32A 2ZUEA 4YT2A 4GLOA 1XTZA 1F77A 1FYFA 4Y2UA 4H6WA 4F56A 1OFIA 3PREA 4KQ2A 1UWCA 5FK9C 1DWUA 1QLWA 1EHYA 4HF7A 5B7NA 3PNYA 4V1CB 4FYPA 4HCNB 3RE1A 1IJKA 5D7BA 1R6UA 2BOVA 4QIHA 3ZD8A 2CHXA 4L4SA 5LCHA 2RD2A 3ZD6A 1V5IA 3IPCA 5FKJA 4X6UA 4DLNA 1NENB 5I9LA 1PGPA 1WMBA 3WL7A 1NVDA 4NG4A 1JAXA 1SOUA 3TTYA 1YL7A 3WAKA 5A6VA 3OIUA 3T7RA 1WP9A 4EEZA 1AQ6A 4JT2A 2E7ZA 2Q4DA 3ZDXB 1XDDA 3N07A 4CIXA 4BMXA 3DLHA 4QOHA 5ACPA 4NFHA 2H3EA 1UM9B 5ALHA 1SRRA 1KEEA 2KC1A 2BS4B 5L7YA 2FW1A 3TINA 1Z16A 4HRVA 2W8BA 2XDQA 4IG7B 2FZ5A 3BX1A 2Z2YA 4X7PA 4HGNA 1QP7A 4JXXA 4FC7A 4FLFA 4X20A 2E37A 5M29A 3T7IA 5H3HA 2EMTA 4WV3A 2LFIA 1NBMA 5JVDF 3QH4A 2WJAA 5B1EA 3ZKAA 1OQQA 4C1CA 2BBOA 4AY3A 2BFMA 2DAJA 3QE0A 4Q3LA 4MIYA 1XMJA 3HV2A 4OQXA 3RPCA 1CIVA 3HDYA 2BGIA 2I4NA 2VNJA 1N2ZA 1VJGA 3DVNV 2IPKD 2IDMA 3CBQA 3TB6A 1ZW1A 3VPXA 4J2TA 1AKEA 3VYSB 2OXIA 3CLUD 2E9SA 1ORRA 1AXEA 1W0KA 4NK4A 5BNFA 2HDOA 3I9KA 4AV7A 2BPSA 4K3CA 5FJJA 3GVIA 1XQWA 4BKOA 4D8YA 1D03A 2VYQA 1WE6A 2G17A 3QFHA 2JGRA 5K8JB 3L7LA 5DRYA 1WB9A 4RCVA 2D07B 4TTSA 2MDTA 5K3BA 3EODA 2QXYA 4TS4A 3I2KA 3N0XA 2W43A 2NPTA 5K3CA 4G1BA 5LSCA 5E95A 4IFBA 4ZKDA 4AB1A 3DWGC 1C77A 3OQ1A 5T57A 1XP8A 3RTBA 3AN1A 1V43A 3L6RA 2W6QA 3RNEC 1KIFA 4LYGA 1E7YA 1TX4B 2Y93A 3VTUA 3J9CA 1OFUX 3HQ4O 2JANA 2ODNA 2PD4A 4MZXA 4YYEA 2CHWA 4QYMA 1UKVY 1QB7A 3C3BA 2F62A 2RHBA 4DG5A 4M6WA 3O84A 3HJFA 1C3XA 3BGVA 1BXGA 5GJCA 3AEUB 4PYMA 4KDEA 4BE9A 2KD0A 3LBNA 4MP3A 2XSZA 1E3IA 5CCDA 2P11A 2W22A 1F9EA 5E0KB 2MYTA 2ZVQX 3DEYX 3I9JA 2BG7A 3JD3A 2AEJA 4J7UA 1U2QA 3KYDD 4JJKA 4N5LA 2E5FA 1QHEA 2NMVA 3AEDB 3WK9A 4JJEA 1P60A 3MN1A 1QPZA 3URKA 3UWSA 5CBPB 2ZUSA 3L7BA 5B1SA 4DEXA 5IJZA 2GEUA 1BDBA 4TV8B 3E1GA 2A5DA 3W9CB 4DJTA 1JROA 4J29A 4ITRC 2ERCA 4WWHA 3O94A 1SGWA 1MB0A 2FH5B 3KQYA 2Y5CA 2C2WA 2CJYA 1QHYA 4WVFA 1ORVA 3KCNA 3LY9A 4D9JA 3M9WA 1JHPA 4HLNA 1L5FA 5EWLA 5CURA 2CGEA 1PL7A 3QXGA 3KDSE 1YH3A 3ZNOA 3UJ7A 1KO3A 5ACUA 3LCVB 4HAOA 1PYOA 4A20A 1HOTA 3MEQA 3T7DA 2OORC 1M0TA 4IM0A 2YCBA 2P9BA 3CX3A 3R0QA 2M9MA 5KQSA 2ZVJA 1T0QC 1C5KA 2V3CC 1CEXA 1E2NA 4XVHA 3F71A 3G68A 3K2EA 4FDTA 2IF0A 3CH5A 4GD3Q 2BH9A 3N5CA 4HPXB 4G1UC 1FYEA 2P2YA 5AXAA 3ZHSA 4DJEC 4LWZA 2J3LA 3F3MA 3KBOA 1XPOA 1GZSA 3D4PA 2B6HA 2L32A 1TA4A 1RRMA 3QY0A 4GGPA 4Y0NA 5IABA 5DT9A 4JE3B 4AY5A 2I71A 3CURA 2H1RA 1CR2A 1K3UB 1OX4B 4I4TB 1JXOA 4RKQA 2N9XA 1YRQA 3WRXC 3SY8A 4KAFA 1ZLYA 2CE7A 1KH0A 3TFWA 2CHUA 3UF0A 5JVDB 5CH8A 5D85A 3ROGA 2C7BA 5DHTA 4R3WA 3UAVA 1I3MA 2BGLA 4C7ZA 3F67A 1Q10A 2FPWA 2X86A 2X23A 4DXAA 3UAWA 1N2GA 4NBTA 5E6JA 4X54A 3EPLA 1IEXA 5LYYA 3GJTA 5DI3A 3SFPA 2B94A 1NULA 1UBRS 4XYGA 1WB5A 1DBRA 2GSDA 1C1HA 5DLEA 1XCGB 4X57B 2WLBA 2F7SA 3A0RB 1MQSA 2IX3A 3BCUA 1Y6RA 2DF8A 4UAJA 4LQDA 2YJ6A 5IAEA 1OC4A 4KLNA 3BKXA 2W9NA 2GBLA 1XCTL 4F8CB 1WM1A 2RGGA 1I32A 2ZJFA 1Q7RA 4XD2A 1R00A 4HZIA 1ZW7A 1XQVA 3UJ3X 1D4BA 1IM2A 2OCYC 3ZWVA 3WLQA 1JKIA 1XMPA 3AB8A 4E21A 3ZIUA 2Z5FA 5BSTA 1XTTA 3K15A 2C1XA 3J81k 1TM4E 4DN6A 3AT1A 5F9FA 1DWPA 4AMBA 3WLLA 2F3TA 4X6LA 1VXRA 4IVNA 1ZWLA 3HACA 4YRNA 3E5MA 4YAGA 2VLBA 3DCNA 3SC2A 2NPFA 1Y89A 1TYEB 5C4GB 2WD9A 1TA0A 1G4HA 3UAOA 1ZMTA 4P0TA 2P5TB 3ZE0B 4W9CA 1GR0A 1ADYA 4NIMA 3PITA 2DKOA 3N7AA 2VZLA 3PCRB 3SEAA 3F3KA 5C7OO 4PSVA 1DB3A 2BP7A 4AZTA 5CPBA 1OXSC 3T5AA 2VRWA 4RM2A 4QREA 4WNCA 1J7BA 1V16A 3ZLZA 3S1AB 2FQYA 5AVYA 4JJAA 3VDNB 2FU9A 1RAFA 4L2YA 1RHKA 1W2HA 3SHOA 3LDFA 4KZ0A 1AUVA 1SQGA 1WDKA 4Q4AA 2O0LA 1DT3A 3MTGA 1A9XB 3TQHA 5AKLA 2IOFA 4CIBA 5D3ZA 1ZI6A 3PR2B 3R0XA 1RM3A 3NOOA 3ZOZA 2LJ5A 1W48A 2JASA 4M7OA 1PF7E 1Z4IA 1RAIA 3R5FA 4O8ZA 1EJ0A 3NIWA 1ORDA 4BN0A 4FIZA 3W34A 1WXXA 5FJIA 1J8VA 1QO9A 4F1WA 6AT1A 3DAYA 5DGDA 3REQA 4AX8A 1E4EB 2O19A 3GJ8A 3KJQA 2K0PA 3DDSA 4CUZA 3PPXA 3WQSB 1T3QA 1TKEA 1EB9A 4WIAA 3VR1A 2YVAA 4LNKA 1M1YA 3GJZA 4XFJA 2Y2VA 3WIVA 3OQBA 1L5HA 3S81A 3GB9A 4WEQA 1WUOA 1GGNA 3H9BA 3O13A 4TKUA 4BBPA 2QRVB 3AESA 2II6A 5LR6A 2X5NA 3WAJA 5GV7A 1QRTA 4QDOA 3QPDA 4QEZA 2V6BA 1FLAA 3ZLUA 3ZWOA 4IMPA 5A3QA 1T8PA 1E9CA 3VVLA 4LRUA 4H0DA 4ARBA 4OSEA 3JYUA 4NBNA 2AFIB 1ZNYA 5KS2A 3SOPA 5I5EA 4FR5A 3JZAA 1G2PA 3VU0A 2OZLB 3A28A 3AGPA 5HOEA 2M8SA 4F06A 1ABFA 1UXKA 4DIOA 1I4RA 4JLOA 2K5PA 5D3KA 3VGPA 4R8RA 1G3MA 2BHSA 1YAJA 3HFGA 1B0AA 3CWCA 1VG9B 3KOZA 3GFVA 1Z3IX 3FYDA 3QYJA 4QWMA 4TLDA 4E4RA 2HJWA 3BGOS 2AEMA 2TMKA 2QDKA 1XPRA 3F9CA 3Q40A 3MTQA 3OG5A 4XDZA 1YDWA 3B5IA 2QJTA 4IINA 1PJ8A 4H3VA 4V0NA 5FFNA 1ACCA 3SC3A 4Q4DA 1FZTA 2R00C 1YZNA 2AC2A 2J5QA 3NBXX 1T6NA 3ANYB 1W5EA 4ZVTA 5SYMA 1EFRA 2PZ8A 2QMUA 1C78A 5GM2A 1ZMOA 1HZZC 1XLUA 3R76A 3PFWO 4YDSA 2ZSDA 5B15A 4TMKA 3FPLA 1C0LA 2PWAA 1WSBA 1I7LA 3QNWA 3AP2A 4WH4A 2E5WA 2BS2B 3IGFA 3LUCA 3LOPA 1ONBA 1TFUA 2O6HA 2FWBA 2YIMA 1RHJA 2CEKA 3OE5A 3T4EA 5AW3A 4RD2A 5KSOA 2GTIA 4RFVA 1O95C 2F17A 4MWSA 4Q6WA 1GWNA 1MO6A 4CL8A 2XEXA 1FOEB 2Y0BA 3VC1A 3I5MA 2QZ4A 3PFHA 3HXQA 4KKJA 4ARCA 2ET6A 3Q6VA 3QAQA 3KW5B 4F60A 3RS3A 4W9IA 4FYJA 1TD1A 3RFFA 3QBEA 3EF1A 3QXHA 5HBRA 3COJA 3NVKI 4HROA 2O14A 1OAKA 3GFPA 4LRTB 1NSFA 3RDPA 2WQZA 1H2EA 1RYMA 1WULS 1PWYE 3GYBA 4DSNA 1YNOA 2GN2A 5K0TA 4YGYA 1AB6A 5EZYA 1RXIA 2D13A 4Z1MA 2DWQA 2CLIB 3GI1A 4AY2A 1UBJS 2DYOA 1NJ2A 1D4OA 1NJSA 3PHLA 4JLNA 3OU7A 1P0PA 2FUCA 5AZGA 2DB3A 5C37A 4FDUA 1JDNA 2GM9A 4D1TA 3QXJA 1XMIA 3RSHA 4H60A 1ZZEA 1QC5A 4L51A 1GQOA 2XE4A 1Y42X 1WP4A 2INDC 1KY2A 2Q1WA 4XM2A 3A9JB 3IUMA 4JJFA 3ZW7A 2MBOA 3RFCA 3UK2A 1YI0A 3VDXA 4HRXA 1QMGA 5HKAA 4US0R 3I8SA 3IKMB 1XCJA 3IT2A 1PYWD 1RADA 4QOIA 4C4PA 2GESA 2XIJA 2CXOA 1KQFA 3OMXA 2PUFA 3N5KA 2C84A 2AGVA 5BURA 2AXPA 5BW6B 1KI6B 3I8OA 4QUKA 2BTQA 4PVDA 1YNSA 3H1PA 1RWKA 1A8QA 2X8JA 3BFKA 4HHEA 1JIKA 2AW3A 3FBTA 4WEOA 2XK5B 2FG6C 1U94A 2ZTLA 3JQCA 5K0FA 3PXDA 4D43A 3FW1A 1ELOA 4ENUA 3BJMA 4I08A 3FI0A 3K0FA 1TK9A 5A06A 4Z4CA 3CZMA 3WMGA 3AHCA 4KYVA 4HQNA 2F3UA 2NVOA 1YDFA 4PT5A 4HSGA 3EA5A 4M8NE 3G17A 4R2IA 4IZOA 1Z2OX 3SZUA 4B0PA 1JWUD 3AUKA 3GMIA 1H2RS 4DDTA 2OUIA 5CMLA 3EISA 2D1FA 5KHAA 2W6OA 2RBEA 1PN3A 1NBOA 1L6IA 4GSWA 2Q3JA 2WE8A 2ZB3A 2XB2A 1J2TA 3GV0A 4NNJB 1JEYB 2K25A 4P16A 2FEPA 1FM0D 1KAOA 3LBIA 4CR7A 3VZPA 4QGFA 2FX3A 1II8A 3Q9UA 4KLCA 4JVOA 2BSXA 3L0BA 4JI4B 1ZOPA 2OLKA 3P27A 2BPOA 3KBBA 5F2OA 1JJIA 4K81A 2EW8A 5CX1B 2D5IA 5FOQA 4ICUA 4ZV4A 2JC3A 1RW4A 1XLPA 2NN3C 2AC4A 1IJEA 1V8OA 1C3OA 2NQ8A 3F74A 1X80A 4XB1A 3OKFA 3ETLA 3O91A 1EF1A 3OQIA 3QUQA 4WCVA 4JENA 3MWYW 3IH5A 4D9CA 2QTWB 4XGRA 3OHPA 4C3OB 3QVWA 1RXYA 4JHXA 4BBZA 1Z9BA 2LIVA 3NWEA 2HN9A 1T0SC 1VPTA 4AS1A 2AOXA 3UIEA 1TM2A 3NTOA 2O50A 4UUMA 1G8YA 4DXGA 3RKUA 5FR2A 5JD3A 2CSUA 2BG8B 5CVCA 2FCNA 3JZMA 1UWMA 4PICA 1FYVA 1N2HA 4MACA 2NV0A 3WIDA 4ZHQF 4MH0E 4KC0A 2K87A 3O8OA 4QRHA 3ZWCA 3KVYA 5BQ3A 4YXFA 4HDSB 2QL5A 2WA1A 1ZCZA 4JLJA 1FJ2A 1SVMA 3V62A 5FORA 2Y3IA 3W9BA 3IURA 1CUVA 4PX3A 1Z0IA 3MMZA 4CV2A 1IHYA 4I8IA 2R4UA 3QFCA 3W5IA 4EHFA 4J7AA 3U7QA 4GMKA 5JEDA 4LFBB 1RWVA 2B4QA 2OECA 5JFOA 2QAGB 4LDRA 1SD5A 4TKZA 3IBCA 1LZKA 1RPZA 4MB6A 3NS7A 1C9KA 1AH2A 2EDAA 2HF8A 1G9TA 3BWVA 3EJWA 4PHHA 1U0OC 8LDHA 4GOCA 2F3RA 5K3EA 1H2WA 2DU8A 4Z5YA 4TZTA 3TXAA 1ADFA 1EX7A 2M1XA 3GN1A 2C9YA 3M3JA 2QRUA 1O08A 4GR9A 1Y8RA 4DCNA 1TTQB 3FAHA 2HNKA 1I30A 3GT7A 4D9KA 5FO1A 2R86A 2AXQA 1L5GB 4QGGA 4Y1RA 3CX6A 2IGDA 1WXEA 4WLEA 2N47A 2Y0DA 1F9JA 4YAJA 2YWXA 4P7IA 3W5VB 3LNTA 4PZLA 3RJMA 3DM5A 2EVWX 1VCOA 1Z33A 2V4MA 1VL1A 5CX4A 1M2GA 1DLIA 3O5AA 3ZZ0A 2A0UA 1MEJA 2JD0A 4ZJZA 1TKRA 4YACA 2VLIA 3ZZNA 3N0RA 4B79A 1M6EX 2HJGA 3E48A 3CSTA 2GEDA 3L10B 4KODA 3UJAA 1W0CA 3KKEA 1QWSA 2Y8AA 4F4CA 3ZLVA 5G1OA 1FTGA 3DZCA 2GAIA 4KXFB 4ZEVA 1ESMA 5AXBA 3GD5A 3AJ9A 1UBHS 4XVRA 4E3CA 1STEA 1JHXA 3A3KA 4WKBA 1CJUC 2NO4A 3VJLA 3KYJB 4YPOA 4MUXA 2Z8XA 3LZCA 3SYNA 3IXMA 1V6EA 5TQ2B 3PYLA 5FOSA 2DLNA 1O8BA 3PEUA 4B2LA 1QFJA 4LJRA 2FG7C 4R69A 1TS4A 3W3ZB 1X9GA 3RC2A 3VZRA 5E8RA 2V54A 4R3UC 2DSTA 1HT3A 1R6TA 2Q7DA 1T29A 4B80A 4CM1A 4UM9B 1C4OA 4U9UA 1XL0A 2GRJA 4ALJA 2HU7A 2D7CA 4ZCSA 1SXGA 1UCFA 3KEGA 1FMAD 3KFXA 2GO1A 3U7EB 4JJ6A 5ACXA 4B0EA 1JBEA 5I8ZA 2R84A 2FFAA 4H08A 2VZEA 5KWIA 3I34X 5ARBA 1U1DA 2IZ1A 1YN3A 3Q3VA 2ERYA 2HSZA 5AKIA 1TYZA 3MC9A 3H16A 3MWGA 5DASA 4GNRA 3GEBA 4JQWC 4ZPJA 2AW5A 3ZQJA 3DMTA 4ESHA 1SBNE 3B6ZA 4LAFA 2BQQA 1LPSA 3ST7A 2C5FA 1PR4A 5A6SB 4KIFA 4BLQA 4QDXA 3HXPA 2UZ1B 1Z45A 2Q6IA 3MBOA 3VHRA 2J0QA 5FEMA 1A8TA 1CHDA 1V7QA 3AM4A 2YNWA 3M6LA 4RDIA 3JALA 4IKPA 2GK7A 4JWKA 5F21A 2WWXA 4F96A 4EM6A 4CQLA 1P1AA 1LJ8A 4LRXA 1JA9A 3OZAA 3FHJA 2KXJA 3PXCX 1EJBA 1T6BX 5K6RA 3ZI4A 1PEDA 4DRZA 2ZPNA 2EAUA 2B69A 2GT1A 4L5YA 4QPZA 4PYOA 2XHZA 3TW8A 4HDNA 3L18A 1AHHA 3SJCA 1IK4A 2L19A 1DBSA 1E98A 3W2DA 5EWMB 4YJ2A 3DBRI 2DUMA 4DIMA 1R5JA 1ZHHA 3DPIA 4QPPA 1J42A 4ZVRA 1A72A 3K35A 5FUYA 3DZIA 4MW5A 1W85B 2IGBA 4R9RA 4L9SA 1OV4A 3MQ2A 2A7MA 2XTJA 4P80A 3MRXA 3LAWA 3O7WA 5CLQA 3QEBZ 3IHWA 4RH1A 3OLVA 4FYYA 5C8YB 2J6HA 1JH8A 3PRHA 1WZ2A 2QTNA 3PJFA 4CIAA 8ADHA 2HI0A 3ZNQA 3C3PA 4LRWA 4RABA 1U99A 3RTGA 5ARCA 4G0YA 1UUPA 4CKWA 1GL9B 1AXGA 3N8NA 4QTYA 3LCCA 4F4IA 3I45A 5M2QA 1NSYA 1CVIA 3O75A 1IAVA 3NDBB 1DRVA 2WD8A 3V2HA 3OZXA 5JD4A 2MJDA 4GEGA 1AS2A 5D3IB 1GNPA 5A5VA 3ESQA 1FS6A 3RSSA 4MW0A 1N9ZA 3GJSA 1EK0A 4F92B 3RNFC 3E1SA 2ZI4A 2IH4A 2ZS8A 4PR0A 2QJWA 3VOTA 1L5QA 4OJYA 3LQ4A 3PFNA 3G0DA 4H1TA 3QE3A 2H06A 1N63A 1UPTA 2RGNC 3CR8A 3ORQA 4HFMA 1P5RA 1YQ9A 2MQJA 3ZUGA 3AE6B 4DCPA 3C6QA 1F6WA 5EJIA 3N2ZB 1Y9DA 2YXDA 1BXRA 5BVGA 5H9WA 4ICIA 1M2EA 1T10A 4JSRA 6CHYA 5HW0A 2Z3VA 5AQEA 4F5YA 3FOCA 1MORA 1JA1A 3R1IA 4E5VA 2WDVB 4YCSA 2HBRA 4GX0A 3GPIA 5K0WA 1XF5L 1Z2NX 3UVEA 3BBLA 2YIJA 2QSZA 4C0JA 4J8PA 3QELB 4RU1A 4C6SA 2PGLA 3Q41A 5AUQA 1NJ1A 5IEJA 4UATA 3WBFA 4PPNA 2X0KA 4EA7A 2BKEA 5EDSA 3SZMA 4NMWA 4H15A 4G8JA 2GEBA 2QXUA 4N39A 2GK3A 1FYXA 2H65A 1H2ZA 4A90A 4PPFA 4YHHB 4BEJA 1RWOA 2X8XX 5HZMA 2AZMA 3ECAA 5DYYA 3UQZA 4D26A 1DKUA 4DB2A 1AZLA 5CB4F 5JYEA 1RE1A 4M4SA 4DEVA 4IM2A 2NSYA 1CF9A 3QE4A 2NXAA 1GLVA 3NFRA 4R2JA 2J0UB 1FDSA 3O9MA 1E3WB 3FBGA 1EUYA 1I80A 5LQMA 3EIOA 4QTUB 3HA5A 4BU0A 2OCPA 4II7A 2Q5FA 2IW1A 3OP4A 5KVSA 1M5TA 4DV3B 1CZUA 3CLRD 1TA9A 5AW2A 1LFDB 3DS8A 2C00A 1R9GA 4OZCA 2P5YA 4JLBA 3F8SA 3SBXA 3QWBA 1IEWA 1EUZA 3CZRA 2HJ8A 3PU6A 3WMWA 2QE7A 2H7CA 2DVMA 1KMHB 3GLSA 4IIJA 2C8JA 3WLRA 1XCMA 3QEKA 4GRDA 4BFRA 1CDDA 3DF7A 1Z18A 2DWCA 4IHQA 2YFYA 1WRIA 1KO2A 4OAPA 2R6DA 5AOBA 1RNLA 2C5SA 1XJ0A 4HH3C 1MIOA 3RFTA 1U02A 1YKGA 4RPJA 4J2OA 4ZDWA 2A9JA 1KEZA 5C8DA 4V38A 5DCLA 2O6LA 1JA0A 4MS3A 2Q1SA 3I3OA 1QILA 1QRDA 1ICIA 5JAIA 1PGXA 1FRQA 2PL3A 4K6GA 3LPNA 3NNDA 4WKCA 1SKAA 4DPKA 1H1LA 1ZAKA 3P9NA 3TW6A 2JRIB 3A4LA 1RKXA 5ELLA 4TQAA 1W30A 1HXHA 5IBQA 1ZAYA 2AHRA 5IMBA 3P5BA 5G0VA 2X76A 1B26A 2WF7A 1UQTA 3QFFA 4MVJA 4IXTA 4C1GA 5IANA 4Q9LA 1CQWA 4OYRA 3O8LA 3PV0A 2FZ4A 3RYTC 2YVQA 1FYDA 2ZBRA 1F2UA 2QILA 1Z47A 2AR0A 1KE1A 3CCFA 3CJRA 4GKBA 4CZ2A 3QKWA 5HBGA 1V7CA 5KHOA 5ALKA 3I62A 1K75A 2CK3A 4QSHA 1RYHA 3D1LA 1HZ6A 2JS7A 3SVTA 2FIFA 3RMKC 1A8HA 4YWGG 2I7TA 3LYHA 1QF6A 3QEAZ 3GJ4A 1DT5A 4DWFA 3DO6A 3MC1A 2SHKA 5JZOA 4ZEJA 3HI4A 3Q7PA 4U4AA 3WGGA 3R3XA 4Z7RA 3P9ZA 4PR3A 1U1EA 2PXXA 1OU0A 3A2MA 2HIMA 3CTPA 1IBXA 1IEVA 4LF4B 2FHPA 4FXOA 1QQAA 1CJVC 1GCGA 4X97A 4W5OA 5JH5C 4ZVSA 2C9DA 4RGVA 1EXWA 4RK0A 1TRKA 1E1LA 5L6MB 1H85A 1UFRA 4LXIA 2Q2VA 3CEHA 4MWCA 3A6KA 3LCJA 4QUHA 3GZNI 1R6VA 2I8CA 4EFOA 3H7IA 3U3XA 3EC8A 1XK7A 2LXCA 4P34A 1AN9A 1Z0KA 4EJ2A 2V8OA 5EIHA 1V5EA 3SYTA 3P0FA 4F46A 2QTAA 1ZE3D 2D2FA 4C06A 2W2OA 3U39A 5LLSA 1HZ5A 1CS0B 2J48A 3HMQA 4NV1A 1WY8A 1G18A 1BS2A 2H1VA 3M95A 1WUJS 4AO7A 2BFKA 5AIAA 3Q6MA 2LVBA 5UKDA 4Z0PA 1C7ZA 2CCKA 4ZOAA 1IB0A 4MZDA 4JKIA 4EYLA 1PLLA 3FFBA 1DOIA 3A4VA 4ZC8A 3TPCA 3TI9A 1XKQA 1KK0A 3IO3A 1UQRA 5C7LO 2BYEA 2UKDA 2CV0A 1Z83A 2HRZA 4LE2A 1KBQA 3O8NA 5K4GA 2ZTSA 4FN4A 1RLOA 3ZUNA 2H1FA 4C1FA 2Q7XA 4REOA 4RBNA 5BWCA 3F5FA 4U7PB 3N20C 1WWTA 1RAGA 1MP0A 4K7UA 5JFGA 1G20A 4ZVMA 1KEWA 1QE3A 4QTZA 5BSUA 1IAQA 4N82A 3CXUA 1DQNA 1IY1A 3ZHZA 4I5DA 4XR9A 2B98A 3V4PB 3ONEA 3OY7A 4NTZA 1I0IA 3JVZX 3DBSA 1WMHA 1FK8A 1A97A 3LWBA 3MINB 5JC1A 4PC7A 4X71A 4D41A 4UM7A 4EW1A 1JJFA 3ACBA 3KSMA 2VH1A 1KMMA 2H18A 3ZWYA 2GBNA 4WBNA 1T91A 4U3JA 4O4JF 3ZE9A 5H1YA 3F6RA 2NO9A 4UWRB 1GSOA 4XWWA 3B36A 3VR5D 1A5RA 3IFSA 2PBLA 5JLAA 3L4BA 1KORA 1XJ5A 2XB4A 4C07A 2INGX 4Y98A 3ELBA 3ZD9A 1BHO1 2KANA 1OD6A 5ICEA 3W05A 4GQIA 4MYCA 5DNAA 2CXHA 1ZK3A 1EH5A 2DZJA 4R2HA 4QBKA 2VK8A 3ETEA 2XVAA 3S1LA 3R7NA 2GLXA 2CMGA 3LQKA 4N5IX 2ZRCA 5C23A 2JJ2A 3CT6A 1J0EA 4ZCRA 4ZC1A 3TMKA 1CDEA 1N1MA 3PDIA 5BO4B 3HWX1 1ECGA 2YN4A 2W6ID 2IC5A 3VR9B 5SV2A 2IOQA 4GZ5A 3FTPA 2MTBA 4XYEA 4M0FA 1WXAA 3O4FA 1PNRA 2VDUE 3RKRA 3CRVA 4PO9A 4GQBA 3CXRA 1ENOA 1PW5A 3V5NA 4RX1A 2JSVX 1O57A 1EFLA 4YMVA 2B20A 3HCBA 3NBQA 3EXEA 4JK3A 3VR6A 1JR2A 1MG0A 4HAIA 1DKPA 1I5RA 3T9EA 4MUKA 4HDCA 2OHVA 3QU9A 4CYEA 2QAGC 1VE9A 2YEPF 2O57A 3U4IA 1GKYA 4QJ3A 3HVDA 2Q45A 4R1OA 2BMJA 5EKDA 5HG2A 1ISJA 4G65A 1L7QA 3MJSA 3FPKA 3RARA 4TSSA 1RYBA 1ZL0A 5LBTA 4BQNA 5AXDA 3W9YA 3GLFB 4B3HA 1PNQA 4IIFA 2VSFA 4UCWA 1JQKA 1CUDA 2H6EA 3V33A 3LDHA 4JEHA 1PJCA 2QUJA 1MC1A 1B43A 4A0FA 2D6FA 1W4CA 3TB4A 1KVUA 3FILA 4A10A 3AWIA 3UB3A 3TLJA 1XROA 3V6CB 2Z5LA 1UIMA 5CDFE 5HCIA 3IBYA 1ZVQA 3DTVD 1CWUA 3W5BA 4KQHA 3IUPA 4EY7A 3UM9A 5J23A 5FPQA 3DEZA 3QBDA 5BR8B 5DBEX 5C1IA 1MPEA 2DZMA 1NI5A 5DO9A 3MWEB 4TL9A 4GR4A 1I7NA 3L0IB 3P2EA 3S99A 4YV0A 4UPDA 1J70A 1HPLA 1JAZA 2J3EA 4E5UA 1NDHA 2ONYA 2JVCA 2IJGX 4GRIA 5FQCA 3DE2X 3F98A 3ZQUA 4R01A 3PRYA 5AVUA 5HH6A 2HXYA 1BOFA 4FP9A 1B00A 4ZVUA 4UQOA 3SPUA 5KVVA 3ZNBA 1YRLA 4IUYA 4ZEOA 2CVFA 5IAJA 3OD5A 4ME6A 4HEA1 5TS3A 4KE9A 3NY5A 5EERA 2W6PA 3L0DA 5KTRA 5AW9A 5G1PA 3JTMA 1NN1A 1Q20A 3IIKA 3HWRA 3KP1A 3Q3OC 2IXTA 1SOVA 2FJPA 1HE8B 3CYFA 1JHQA 1R8SA 2LW7A 1NYRA 4NEGA 1KFJB 1MKYA 3LDGA 1BAPA 3A27A 4XFKA 2QVCA 1K5PA 3EVGA 4WIPA 1RZUA 3OLCX 5IAAA 4DQ0A 3O4HA 1VGVA 2I8AA 5KAPA 5AKGA 3HFJA 3X0WA 4S1PA 1ZKPA 2QI9C 3ZS8A 4YCJA 3HBAA 5MN5A 4GZ6A 2I8LA 4M1YA 1BX1A 3T7EA 1G6HA 2CLSA 3L7NA 3FF4A 5L8VA 2E49A 1QTIA 4DHEA 2EG5A 3QPCA 4LCEA 3JQ7B 1BRTA 1Z74A 3HO8A 2Q5CA 4J7XA 5JNLA 1JR3D 2R1UA 5K3FA 4FW9A 1SVUA 1X7DA 1YTUA 1TZ1A 2JLBA 2ZW9A 4V2UA 4DAOA 3SCZA 4BQQA 3BSFA 2ZYHA 5U9CA 1URPA 5T8IA 4FWTA 4QYIB 1BN7A 3FWKA 4O2AA 3E27A 5JS1A 5EVBA 1AK9A 3VPDA 3KC2A 3AV8A 3BUSA 4TTJA 2WUVA 1D6MA 1DXOA 3Q2OA 4ARSA 1U0RA 1TU4A 1FXAA 3H9GA 2ACKA 3RW9A 3W4KA 3KZVA 4OLFA 5COQA 2QG9A 5T64A 4W5RA 1GHTA 5JAUA 1ET9A 4Y9RA 1X8HA 2ZR8A 1IOWA 1PJ3A 1ZG3A 5JH7F 1HO3A 2YEPB 4AK9A 3W04A 1T0UA 2IU3A 3G2PA 4TXMA 2VUSA 1GARA 4MMZB 2PZKA 2WM8A 2G9HD 3PQ5A 2IYDB 1X7HA 2P9GA 1JGTA 5CFNA 3LRPA 3RROA 1PJAA 3OLXA 3UAYA 3LI2A 2IKQA 3VSBA 2CFOA 3Q72A 1DAOA 4B5KA 2C9MA 3H04A 1C7QA 3RUCA 1O03A 3LCUA 3KTDA 3V2IA 3W7BA 3M1IA 3AO0B 3LQRA 4F3RA 5K0CA 4CIYA 2JGMA 1G98A 4EF5A 3BIXA 3HB0A 3HVJA 1UAGA 2KE5A 2ZB2A 4EZIA 4YRMA 2CU3A 4ZYZA 4LJOB 1YOBA 2I87A 5ABPA 2FR8A 4H1WA 4IDHA 2I22A 1OB5A 3RYIB 2O8DB 4OL9A 2Y87A 1E2EA 2D2IA 3GELA 1WUHS 3O1HB 4A55A 4J0CA 3G0OA 4U7FA 5L4LA 4RD3A 4R8KA 4EG0A 3VRBB 2QA5A 1X7YB 1SVKA 3VC3A 5D3MB 1IPEA 1XQXA 2Z3ZA 5ILOA 1CS4C 1DLJA 4UE3S 4UQPA 2Q5QA 4P36A 2V4IB 1T3GA 2FRVA 3UA3A 5ALZA 3B89A 2IPNA 1Y9EA 2ZJOA 1J20A 5GJVC 5LSAA 4R8VA 5L95C 3BH7A 1BWQA 3LYAA 1XD2A 2HHAA 5AHKA 4EFMA 3KQUA 1DV1A 4ZQHA 3DVGY 2XYVA 1M34A 1YB2A 4WPGA 1VPDA 2VYCA 2Z83A 4ATNA 8OHMA 4EFZA 1FTNA 5JAPA 4KO4S 3UV7A 5KJCA 1UBGA 1ZEMA 2VJNA 4DG8A 4LGMA 3SDLC 1MUUA 1YK0A 5HZHA 2APJA 1ZN9A 3ADDA 2Y1FA 2QV0A 1K4KA 4CT4B 1SE2A 3PFCA 1MNQA 2IUUA 3V60A 3RSOA 1UINA 2P67A 4GYKA 2Z9DA 4MI3A 4DIBA 1UANA 1I7QB 1ODSA 3EG9A 3KM0A 1DJPA 4IBOA 2N7JA 3OHMA 4X3OA 2JKYA 4BNKA 4EYQA 4WK0B 2MYPA 1J9ZA 4WCFA 3F5DA 3N0WA 1FS5A 4G24A 2GPAA 1DINA 4GPD1 4TZEA 2QJRA 1NLMA 1QH8B 4CKBB 1C7IA 3L4JA 1CZHA 1NVWQ 3UI3A 4A6QA 4J4TA 3GLQA 3GZJA 5CLIA 4FI3F 5K8LA 1TF2A 2DLCX 3LHKA 1Z0AA 4YRKA 2FHXB 4NJEA 3L8DA 1P9WA 3KTAB 4KDFA 1E7QA 1JQ5A 2DZKA 3Q2IA 2Q28A 3C3MA 1JG7A 4ENQA 4ND6A 3U0VA 2HLDA 2P6NA 2WP8J 4BLSA 1YJ5A 5JAHA 4L1BA 3CH4B 1M7BA 4M0PA 3ACDA 2O3SA 4JELA 2YZ7A 3DOOA 2VT3A 3PC8A 1L4BA 3KXIA 3TTXA 1QFSA 3AM1A 1I4TD 2RK4A 2Q6OA 1YS9A 5LKRA 3RT3B 4IX9A 3IEVA 4H7DA 3U3OA 5ENVA 2EWMA 1D1QA 1NQVA 4ZCMA 5CHVC 3F6YA 3UFXB 2JHPA 1C0PA 1WKVA 1X13A 4EO4A 4AX4A 2F3PA 3BK1A 5AT1A 1JPUA 4IMRA 3B60A 3KNRA 1SR8A 3V4RA 2G88A 2J0KA 1MLDA 2ZCUA 1J25A 4YIHA 3GDOA 5JH7B 3BFPA 4LMAA 2ECKA 3MC8A 2XBBC 1BEUB 4BN4A 4F5ZA 5K8VA 3VYWA 1VZ2A 4CTOA 4WN9A 1NLZA 4ZVVA 1YR9A 1U11A 5IT9A 3VO2A 2JGKA 4XE5A 2K8BA 1VI5A 1P0CA 3M6XA 4Q9KA 3H1TA 1H8EA 1IWOA 2HCJB 2ZDGA