4XWWA

Crystal structure of rnase j complexed with rna
Total Genus 182
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
182
sequence length
545
structure length
545
Chain Sequence
b'PAPTLEVIPLGGMGEIGKNITVFRYGDEIVVVDGGLAFPKAHQMGIDLIVPRIDYLLEHQDKIKGWILTHGHEDHIGGLPYIFARLPRVPVYGLPLTLALVREKLSEFGLQDVDLREVTYGDEVRFGQSFVAEFFCMTHSIPDNAGYILKTPVGDVLHTGDFKIDPDVGTGAGIVSDLERVEQAGKDGVLLLISDSTNAERPGHTPSEAEIARNLEEIIKGCRGRVFLTTFASQVYRIQNILDLAHRQGRRVVMEGRSMIKYAQAAQATGHMNPPEPFLTSEEVGELQDQQVLFVCTGSQGQPMAVLGRLAFGTHAKIALRRGDTVILSSNPIPGNEDAVNLIVNRLYEIGVDVVYPPTYRVHASGHASQEELATILNLTRPKFFLPWHGEPRHQINHAKLAQTLPRPPKRTLIAKNGDIVNLGPDEFRVSGTVAAGAVYVDGLGVGDVNDDVLLDRVNLSQEGLLILTAVLHPTPHVEVVARGFARPNRDLELQIRRVALEAVEQGLREKKRLEDVRDDMYGAVRRFTRKATGRNPVLIPMIVD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DR2417
publication title Structural insights into catalysis and dimerization enhanced exonuclease activity of RNase J
pubmed doi rcsb
source organism Deinococcus radiodurans
molecule tags Rna binding protein/rna
total genus 182
structure length 545
sequence length 545
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
A PF07521 RMMBL Zn-dependent metallo-hydrolase RNA specificity domain
A PF17770 RNase_J_C Ribonuclease J C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.580 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4xwwA03
3.40.50.10710 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Metallo-hydrolase/oxidoreductase 4xwwA02
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 4xwwA01
2Q42A 4Z60A 1VGNA 5ACVA 2YNTA 3SW3A 4P62A 5AHRA 2BFZA 5FQCA 5K4KA 2P1EA 4PVOA 5LM6A 2HB9A 2ZZIA 1QH5A 3IOFA 4FEKA 5FQBA 5HH6A 2UYXA 5K4NA 2AIOA 2E7YA 4Z6XA 3RPCA 1WUOA 1JT1A 4UWRB 4XWTA 4ZNBA 4EXSA 2QDSA 1A7TA 2P18A 4UWSB 4NQ2A 2H6AA 2BG2A 5LCFA 5ACQA 4EYBA 3VPEA 2P4ZA 1VJNA 4GYUA 2I7TA 2WHGA 5ACRA 3TP9A 3SD9A 2FHXB 1MQOA 3X2YA 4HL2A 4NQ5A 2M5CA 1L9YA 3IE0A 5KIKA 2Q9UA 2Q0JA 2WYMA 4C09A 3SBLA 2BR6A 5A87A 3AJ3A 4AX0B 3RKKA 3PY5A 5EVKA 4NQ6A 3I13A 3IOGA 4D1VA 5EW0A 5IQKA 4RM5A 4D1UA 5A0VA 4Z5YA 2R2DA 3WXCA 5AHOA 2NXAA 2M5DA 3T9MA 5EVDA 3R2UA 1KR3A 3X2ZA 3FAIA 1M2XA 2A7MA 3L6NA 3IDZA 1DDKA 2OHIA 2GCUA 4UWPB 5LSCA 4TZEA 5FQAA 3FCZA 3IELA 5EHTA 2Y8BA 4C1FA 3ESHA 4O98A 3KNRA 1DXKA 4AD9A 1X8HA 2YNTB 4KEQA 2XR1A 4AX1B 2BFZB 4RBSA 2OHJA 5HH5A 3S0ZA 1DD6A 4C1GA 5B3RA 5AXRA 4XUKA 2YNVA 5HH4A 2QEDA 2QINA 1E5DA 1ZKPA 4Z67A 1WRAA 1JJTA 3F9OA 2YNUA 2FU7A 4EY2A 5EVBA 2I7VA 2WRSA 2BMIA 5KILA 3BC2A 1A8TA 3KL7A 1KO3A 3A4YA 4GCWA 4D1WA 4C1HA 2BIBA 3DHAA 4UWOB 4D1TA 4ZEJA 2DOOA 5ACSA 4FR7A 5EH9A 3G1PA 4UAMA 2FU6A 2GFKA 3IEMA 3DH8A 1KO2A 2AZ4A 4F6ZA 3RKJA 4RAMA 4XWWA 2FU9A 5HIQA 3Q6VA 3IE1A 5ACTA 1BC2A 4RL0A 4FSBA 3BK2A 2ZNBA 2BG6A 3IEKA 3ZNBA 5LCAA 3LVZA 5EV8A 1ZNBA 4JO0A 4J5HA 4C1DA 1X8GA 4D02A 4DIKA 5LE1A 3ZQ4A 4AWZA 2Y8AA 4TZ9A 4RAWA 4WD6A 4TYFA 5A5ZA 4EFZA 1YCFA 4TZFA 2GKLA 3I15A 4V0HA 4TZBA 2YZ3A 5HIPA 4B87A 3P2UA 5EV6A 2YNWA 3KNSA 4F6HA 2FK6A 1XTOA 4YSBA 2NZEA 4EYFA 5ACWA 3MD7A 1WW1A 3DHBA 5AYAA 1VMEA 2P97A 3AF6A 4HL1A 4HKYA 5HIOA 3SFPA 3T3NA 4H0DA 2BFLA 1JJEA 2ZWRA 4Z7RA 5A0TA 1XM8A 4YSKA 5ACUA 4EXYA 5ACXA 3H3EA 1X8IA 5LMCA 4CHLA 1BVTA 2YNVB 2BGAA 2WYLA 1Y44A 2GMNA 4J5FA 3PY6A 3BK1A 4UBQA 2GFJA 3I14A 2BTNA 3DHCA 3X30A 5HISA 1YCGA 2Y87A 2FM6A 2BFKA 2I7XA 2ZO4A 4DILA 4C1EA 4TYTA 4KEPA 1K07A 5LCHA 4ZO2A 3SRXA 3T3OA 3I11A 2CBNA 3VQZA 2BG8A 3X2XA 2XF4A 2DKFA 5ACPA 5LLDA 4Z5ZA 2FHXA 5K4MA 2BG8B 5AEBA 4NQ4A 5LS3A 2QJSA 3I0VA 2FU8A 1SMLA 5EWAA 3ADRA 5DPXA 1QH3A 1WUPA 4AWYB 2OHHA 2YCBA 1BMCA 1HLKA 2VW8A 3QH8A 4UA4A 4PVTA 4YSLA 5B15A 3BV6A 2NYPA 4U4LA 5K0WA 5B1UA 2Q0IA 4GYQA 1YCHA 3PG4A 3JXPA 4RL2A 4C1CA 1P9EA 3IE2A 3ZR9A 2WYMC 4EYLA 2QDTA 3AF5A 2BC2A 4BZ3A 2BG7A 4LE6A 4ZO3A 4BP0A 3SPUA 1ZTCA 2NZFA 5AXOA 3ZWFA
chains in the Genus database with same CATH superfamily
3QA8A 4PPYA 2DPGA 4N0MA 2QQ0A 2F1JA 1O6FA 5EY5B 3PTFC 5AIBA 3GJYA 2O57A 2GA8A 3ULKA 3JAWB 3DR5A 2H57A 1SKYB 4QT0A 1N2HA 4ND3A 4KWHA 2OZEA 3QV2A 4ZV7A 5AXAA 3TUIC 3LO8A 1PNVA 1GNUA 4DZZA 2QXTA 3ROMA 2MSCB 2XMCA 1WD7A 4DIUA 1WF6A 3UHAA 3OEHA 3ASUA 3BS4A 1JSCA 2O4UX 4M1ZA 4X91A 2VAVA 3WYGA 2V7UA 4K6KA 5C1IA 2TYSB 4F4JA 4JL8A 2Q9UA 2I4NA 1XJ0A 1NVID 1BQEA 1X1DA 5CBKA 2A9FA 4C6TB 4YDHB 4YJ2B 4HZUA 1KY4A 3DCNA 5CHFA 3B48A 5PNTA 1UOEA 3AFGA 2BFPA 2IXEA 4TN1A 1RYEA 1TYBE 3JQEA 4BVLA 2DUMA 3FTQA 5JAHA 1OBVA 1SCNE 3H1BA 2BEWA 3AEGB 1G3IA 5EVDA 3I9FA 5AXCA 4U0JA 2GZ2A 2QMEA 3WSWA 2A14A 1FTGA 3OIUA 2V5AA 5JFGA 2VOJA 3CWCA 1HA3A 3A9KA 4L7QA 3WIUA 3K73O 5MGBA 4HHEA 1FXUA 4JUCA 3CPHA 4LJSA 1W8IA 3M1IA 3OA2A 3SX4A 1JZQA 1PR0A 3SKYA 3QPAA 2HU8A 4HKTA 2O54A 3QX9A 3B85A 4C21A 2KWDA 4X92A 5AXBA 5LFAA 3WFJA 3N59A 2O3SA 2AH5A 2I2CA 1NATA 4AP4C 3DDCB 1Z8DA 4OW0A 3TLZA 3IBEA 1SVLA 3UCEA 4GCWA 7REQA 3NVDA 2HNKA 1KBQA 1G1MA 4FDVA 1U9JA 5IVIA 2B7LA 5LN1A 2AL7A 5F2KA 4OZCA 2OWDA 4OSPA 1QBKC 1UWMA 1T5HX 2AR0A 1Z7YA 3K70B 4RORA 3PC2A 1UODA 2YUTA 3H11A 5AW2A 3S2SA 1TTQB 3PNSA 2JVCA 4E4TA 1SR8A 4HMQA 3DQVA 3GGDA 4UPDA 1U0LA 1EQ2A 1EESA 5JLAA 1GB4A 4I19A 4X7PA 4L76A 1LCIA 4JLOA 2BSQA 1R00A 3PIIA 4QTZA 5LQKA 3B8EA 3CCFA 5A3RA 5GVSA 2XCOA 1Y37A 4ARCA 3L10B 3E9DA 3W5UA 2LUOA 4ZO9A 1TQDA 4MX8A 4X65B 5LZ8A 1S1MA 5E3JA 1GKYA 4I4IA 1P31A 4I5GA 3LQ2A 2IIBA 3RI3A 3WLKX 2W93A 4B6PA 3ZCXA 2V4UA 2B8WA 3H5TA 3EF1A 3N58A 5EJAA 2BGLA 3PGVA 4ZRKA 1PKEA 4QUGA 4BRUA 3FDZB 1M2KA 3OEED 3U0BA 3DTNA 2LBPA 3GRKA 2ARKA 5D01A 3TKYA 1P7CA 1I7QB 3H1UA 2IZ7A 4K9MA 4RJJA 5KDDA 3SXUA 3SEQA 4QOFA 2Q2WA 2OO7A 2BF7A 2ZDQA 4I1YA 2A1UB 1P18A 2B4YA 3AKEA 3OT4A 3U3RA 1PR6A 3VJMA 3G8AA 3O2NA 4HX2A 2P0EA 2NMQA 1U8TA 5FRDA 2L32A 4PO3X 4M53A 3QW4B 4FDUA 1VG1A 3NHEB 3HM2A 2NTSA 5F2NA 1BFDA 3V4FA 4MB0A 3E9CA 3JQFC 2PRIA 5GAJA 1TC1A 1LZKA 3QUAA 4UUMA 1ENYA 2V4LA 1O6GA 1KIMA 3F3KA 3WGIA 4TMFA 2WHPB 1BFKA 2G5PA 5EEHA 5M7EA 1NQUA 1GU0A 1T8PA 4EELA 3V8QA 2WG2A 1UWKA 1GG9A 2VUTA 2YHBA 1M33A 4XIIA 4GUDA 3OVMA 3L9WA 1UXIA 2ASEA 3Q3MC 2Q29A 3EGRA 5G53C 2HO5A 3R2TA 5CFNA 2PDAA 2YL2A 2QTMA 2NPTA 2AJBA 1SBTA 2PR2A 1V47A 2J7QB 2LD9A 4X93A 2AFIB 1ITZA 4BRSA 3GAAA 4FNOA 3MAJA 4UAVA 1MJGA 1CF4A 1QCCA 3D0RA 1LC0A 1U1DA 4ZCTA 3I52A 3V62A 2EZ4A 3RM3A 3ANMA 1D6EC 1F8FA 3C41J 2GK4A 2DAPA 2IYQA 1DNPA 3RJ5A 2AR9A 5B3AA 4TXNA 5EZYF 1I4XA 4QEKA 4QGGA 5C5IA 3GEBA 1A5SB 5ENDA 4WXRA 4FSHA 1L6RA 1EFVA 2R44A 2OAP1 3HJUA 4F84A 3H1PA 3K1AA 4MV5A 2M2IA 5AI0A 2H4XA 3F5SA 1HEUA 1K9VF 5I9LA 3VH3A 4JLDA 4URXR 2P65A 3NYIA 1HT1E 1YC5A 4XEUA 4MJSB 2RGWA 1E6WA 1H0RA 4IXWA 3WO1A 4I6GA 3IMCA 4Y7DA 2ZSEA 2C4TA 1MB0A 1IZ9A 4LKRA 3QU2A 2X0RA 3ESHA 4KUGA 1R0BA 2JT4B 4B79A 2AA3A 4JKYA 2HBQA 4E70A 1JAHA 5BMHA 3FKJA 2IXFA 2XNCA 4JMLA 4CKCA 4OX9Y 3K8ZA 2Z2JA 3THYA 3NEYA 3O2QB 4I9UA 2NTJA 1THZA 2Q5LA 2DVMA 1DOXA 3UHPA 1JA1A 1RCFA 4RVCA 4X61A 1ZD5A 4Q1AA 1MW9X 2G8NA 5IAKA 4FLEA 2XNAC 4YSYB 2DQYA 3O83A 2FG6C 3P2JA 1DP4A 2KN4A 2FW0A 1UT6A 4JR1A 1K75A 4ESEA 5ALQA 4OKIA 4Q7KA 4NOKA 4EABA 1UAAA 2Y5PA 1K8QA 3IEMA 5DNDA 4RE5A 1T5BA 2GCOA 5TGDA 3O91A 3DV2A 2WFMA 1X2EA 3WGYA 3LLCA 1TM7E 3EFOA 1Y4AE 4HDRA 3VHTC 1IY0A 4I1VA 1ZD4A 3BD7A 4JLWA 4PFSA 1WIAA 4F3NA 2P78A 3LIIA 5F7ZA 4KREA 1Z28A 2LXAA 5ICSA 4EFZA 2CJFA 4BNZA 2WP9B 1G16A 4RNDB 3K2EA 3KVOA 4RHXA 4UDNA 4A73A 3WCQA 1YQDA 4CTMA 4L3WA 3FTPA 5HMLA 2BJHA 4W9LA 1RBMA 2C97A 5CURA 5BV1A 2G9HD 5ALPA 1YBMA 3UGQA 1N1DA 1IHPA 4OMCA 5E6SB 3KJZA 5I8PA 1YD7A 4ON9A 2G9UA 3JZIA 3OCVA 4E6PA 3ZY2A 3TVYA 2AV6A 1NXSA 3AJ8A 2VL7A 1IY8A 4QEDA 4DC9A 2ZUCA 2B4KA 1JHPA 3WX0A 5B4UA 2GARA 4L6AA 3T7CA 3JX9A 1PL8A 3RR2A 2FUG6 3EC1A 1R0RE 2IPXA 1QU2A 3FPBA 5COQA 8ATCA 3T5BA 1B73A 4ZYYA 1JYSA 1US8A 5FPTA 2H6EA 2EBWA 3CKYA 3SMVA 3TZBA 2JD2A 1DCKA 3DMPA 2I38A 3NBKA 1WZ0A 4Q1DA 5G3ZA 3H9UA 2XDQB 2V8BA 1LWOA 3AB3A 2WA1A 3NIBA 3EEYA 1P91A 2QDXA 4OK6A 1ZNXA 1GL3A 3UYLA 3CEJA 4LYYA 4NZMA 3VZDA 4BP0A 1PYOA 4IJKA 3QJ5A 2HY7A 4RSGA 3UINB 4C4RA 1QF7A 3LYUA 3AV3A 5K3FB 1DI0A 1WCIA 1F17A 4PPNA 4WXYB 1W581 4KVFA 1OQAA 3NGMA 2GEJA 3R8XA 4E74A 4UM9B 4OY3A 2HV9A 1QS0B 3BGDA 3PFNA 4WHMA 4GBGA 4MQFA 5MFPA 4HXFB 4ZQIA 1UBRS 1NM5C 1KI6B 3DMYA 4HDOA 4EF5A 1NF2A 1HO3A 4L4RA 1EUDA 4GKVA 2ORWA 4UWRB 5HGJA 2QDSA 3IIIA 2XOEA 5J17A 3EULA 3UFXA 5IUJC 4NQ2A 4MV7A 3RK0A 4NMXB 5ACQA 1L1RA 1JR6A 2X2EA 4BUZA 1OFUA 4Q03A 3U09A 1QHSA 3NVYA 2QLMA 1PGQA 4DQDA 2XY4A 3CBQA 3KHKA 1ENZA 4ZOLB 1SG0A 2Z8XA 3NHUA 2DX7A 1COZA 4R7ZA 3JYPA 2QNBA 1QYWA 1BGWA 1P74A 1FXWA 2FCNA 4I4TB 4WERA 4J49A 5K0LA 3UM9A 1UH5A 2G28A 1ZCFA 3QOFA 3R8CA 2NAPA 4IV0A 5GOZA 2OOSA 1V11A 2RHMA 3MTDA 3KSZO 2BHLA 5LLSA 2W6JA 1YZNA 1U7WA 1MB9A 1RQLA 4K9NA 1PCXA 3E70C 2QPAA 4Y6OA 2OV1A 2BFOA 1XMVA 1ROEA 2PMEA 4AO8A 2IE0A 2XRYA 2PQ2A 3B9BA 4MV1A 3UO8B 2ZYRA 3V9AA 2I71A 2FXVA 4HUJA 3ZLUA 4DHZB 2Q1YA 3CWQA 1YS4A 4D4JA 2WB4A 1F0KA 1RZ3A 2AVDA 3IAEA 4E22A 1ZOYB 4AUQC 4W9CA 1OXUA 1XLUA 4YMIA 5JVDA 3K3PA 3RASA 4DQVA 4WCVA 3AH7A 5B3JA 1NX9A 5BUZA 1UPAA 3V9PA 1IJEA 1GCUA 4JC8A 2IH5A 2XF2A 5K05A 1SIOA 4Q1EA 4HY3A 3VAWA 2YIVX 2D1YA 2NSYA 5C7OO 4CN8A 1EB8A 3HYCA 1FVFA 4X8MA 5KSYA 1FFDA 4LZJA 3S2AA 2NSJA 1MRSA 1B0PA 1B8UA 3ZDRA 4INAA 3N3AC 3Q6VA 2YWFA 1YJQA 3BH6A 1XVLA 1PR5A 3DKVA 4BZZA 1Q0TA 3TQSA 4JOCA 4OBWA 4IIYA 3HKBB 4YYZA 4OQZA 5G1PA 3QNUA 1IVNA 5IBRA 2I6GA 4KN8A 2BZGA 3G13A 3HZOA 3ROZA 4DLZA 4YRFA 2XF8A 4BQPA 3RNEC 4F2GA 3DONA 5J58A 2YTZA 3FJ1A 3ZLVA 4BCBA 3FC4A 3NORA 3NH6A 2COUA 2OYSA 4J0IA 2HUNA 1GPAA 4FEYA 3VAAA 1L8QA 4KUHA 4R8LA 1IONA 1G3UA 4EMUA 2ZWOA 3FJYA 3W7VA 1V71A 3BMNA 4W5JA 5LMCA 4MR9A 1BC5A 4TTJA 3X0DA 2BR3A 2IX9A 4FFBB 3VH4A 4BMDA 2ET6A 5KJ1A 4HK2A 1LK7A 4LQ4A 3KELA 4IIEA 1FMLA 2IU3A 5CM2Z 2CF6A 2PTLA 3RUCA 1GN9A 2I2YA 4FNMA 3GB9A 1CUAA 2D1FA 1ISIA 3EHEA 4IV8A 3CV3A 3JV7A 4K87A 1ZUHA 2X0NA 4R98A 5KSOA 2ZCBA 4KH1A 3RSGA 3KZXA 1MRZA 1E5WA 1Q21A 2OCLA 4JGIA 3I0VA 1EE2A 4DHEA 3RFUA 1QQ7A 4BLRA 5CFQA 2I87A 2VTBB 4U8HA 1DQRA 3BF7A 4GP9A 4OXXA 5JMTA 4LF9B 3VA7A 1KH1A 4YPOA 4FOTA 4KMOA 3MJVA 4Q3OA 1N36B 5KIAA 1SF0A 1T13A 4QTYA 1TTPB 4AK9A 5B1UA 3M62B 1YB7A 1EK6A 3KLPX 5JARA 3A3OA 2O23A 4KMSA 3JXPA 4XR4A 4RGNA 3Q8AA 4YJDA 1E4OA 3RU9A 1HV8A 1RAEA 5B6JA 2HJWA 3DBHB 2NU9A 2I76A 1NLMA 4LWQA 5CXSA 3EX7C 3GLGE 1EEHA 3PJDA 3ONSA 2YRFA 2BL4A 5BUCA 3CNQS 2VAXA 4TTRA 3U9LA 5FTLA 2RHRA 3EPKA 4H1TA 1QE5A 4RZXA 6ABPA 1NJ1A 1XHFA 3AUKA 4UHKA 3DR3A 3NV9A 2CV2A 1CNFA 1WXFA 1EFUA 4KIKA 3D8HA 3QY0A 4XWAA 4GBED 4TL8A 2REXB 2OFWA 2GH1A 3PEEA 4KGTA 2BYVE 5E6PA 5CX1B 2B7BA 1ULAA 4G8JA 4XQCA 4HAXA 2R6JA 3CKLA 4O8CA 3HZZA 2NU7B 3STHA 1K52A 2KLCA 5TLSA 3GPIA 3EIFA 2PGXA 3JQDA 4JJAA 4H27A 1P0FA 1SUIA 3F78A 4UUQA 1IZZA 4FBMA 1JR3D 1GGFA 4IINA 3MFQA 2QD3A 1TM5E 2JGMA 5EIEA 2NNWB 3VTWA 1CUXA 4KR6A 4UW9A 3ZK7A 5FWYA 3HYTA 3M33A 2P3QA 4CV2A 3M2TA 1TYGB 5LCXA 4LF8B 1WM2A 2ZWVA 4QGSA 5IC4A 1Y3FE 3SYTA 3ZJUA 2R2GA 1QWSA 1OBCA 1DE0A 5AZHA 5EWLA 3N0XA 3HWWA 1V80A 1A27A 3T9CA 2WJVA 4X60A 4DBZA 1KZ4A 1Q7GA 2K5UA 3ED1A 4CR7A 4JASB 5JYDA 5CDSA 3C3DA 4XM1A 3DE3X 5SICE 3EQ2A 3OIFA 2ZIZA 2GZAA 2MHCA 2JLQA 2XQFA 2YNTB 3BIJA 4DSOA 1L5VA 5J2UF 4MPPA 3GRAA 1XDGA 1E8DA 4DQ0A 4E2FA 1Z4MA 1XKTA 3KXLA 1R6AA 5IT0A 1L5KA 1W5SA 2ZR9A 3DZHA 2FN9A 2QINA 4PZLA 2ZE5A 3A1DA 4GGPA 4PO9A 4IIVA 1QQBA 1ISGA 4FDTA 5E1DA 3W9SA 5E2IA 4A5SA 1T2AA 3GZNB 1ZGBA 1U2DC 4N3BA 1TPZA 4IX1A 3REQB 3HB5X 5KOYA 2F55A 2E1RA 5LB2A 2IU0A 3OTGA 1UBGA 4V0SA 2HPVA 4ZTUB 4TRNA 1XG5A 4ZRJA 2ZCUA 2OCBA 3IXQA 4CL8A 4EG6A 1XJWA 4Z4GA 4BFVA 5FA8A 2K2QB 1XHEA 4KR3A 3Q88A 1R50A 4NHOA 3NOVA 1UBNA 4WGFA 1TW3A 2ZNBA 2JLVA 1JXQA 2YJ5A 5C52B 2WHIA 2V97A 4B44A 4QYXA 4KMMA 5TS3A 3HPRA 1E7YA 1E7UA 5HHTA 4DLSA 4KIFA 1W85A 4O6VA 3V4OA 5I7SA 5FUMA 4HLCA 1A9XA 1KVQA 2PJZA 1EX6A 4XGNA 3SC4A 4V0HA 2IYNA 2BEVA 4NZYA 3HN7A 4GMXA 3WAMA 1BWSA 4BAXA 1WHSB 4M21A 4V03A 4PLCA 4HJXA 5E1MA 1ZK1A 5LOVB 2KDFB 1N3YA 3BVPA 4Q9NA 3OQHA 5A0TA 2OZVA 4US2R 5JH7F 1NXTA 2VRNA 3AOEA 2JZZA 1U0GA 4DUGA 1YB1A 2J0EA 2YJ4A 3SSNA 2IPMA 4D0GA 3QLUC 2KI5A 1OU0A 5I7AA 2VT7A 4MLCA 1YAJA 4R2JA 3PFFA 1KTVA 2CLCX 4WKPA 5EA2A 4P5PA 3EZLA 2OOKA 1RIIA 1J39A 4U02A 4PZEA 3AK4A 4NV3A 1EDBA 2VT6A 5EYPA 1RD4A 1ORWA 3C3XA 3UMVA 3GRVA 1E2BA 5B53A 4B0PA 3WB9A 4EJSA 4BAUA 3I23A 1X3LA 3NOBA 1ZGHA 2NU6A 2LRUA 4F8YA 2OHFA 4R0VA 3MRVA 5GZ6A 2HJHA 4D96A 4HPLB 5DMXA 1IN7A 4HFMA 4LNFA 4DQLA 4BQFA 1TAHA 2PYDA 1YQXA 1ZHOA 4IMJB 1IUPA 1SQGA 4EBFA 2FZGA 4NPCA 2GN8A 1PNTA 3QOXA 1VE3A 4AKHA 1EM6A 1JFLA 4H0NA 4IXNA 2RG7A 1EUQA 2QUKA 1THTA 4IJ6A 5JQGA 1VGNA 1E1RD 1F9EA 2CLIB 3ZKWB 5H92C 2BFZA 1LO5D 4WNAA 4MA0A 2IPAB 5DGIA 2BR4A 3OKFA 3KDPA 5K6TA 3GGSA 3GAZA 3BE5A 3D64A 2AMJA 1O96B 1Q19A 1MFZA 4XX1A 5K2MA 4ZNBA 1XN1A 1Z34A 3PZ7A 4H2DA 4I1OA 5DK4A 3QLTA 1B8OA 1EPUA 3EXHC 3PCXA 3N0VA 2FN3A 4Y6LA 3QVMA 3OG5A 4B0MA 1O0SA 4DMLA 2QAGC 3I4FA 1PTJA 1G38A 2OZLA 2PZMA 1JQ3A 1X9IA 3PYLA 3NLLA 3OPVA 4B3DA 3RUFA 3QP9A 3RNBC 3DUWA 1SUDA 1TF7A 3LKBA 2DUNA 3LQRA 3K9LA 3NIWA 4XVCA 4RIIA 4F1JA 1RZUA 3O90A 2A78A 2QGZA 4HWIB 3CX8A 3PZBA 3L8ZA 1JLLA 3KAJA 2VXOA 3TFOA 2CFCA 2PBLA 3C1TA 3V6LA 3DNMA 4FP9A 4OXYA 3R6WA 5BSTA 2QSJA 1U0SY 2Y1LA 5AHOA 2Q9CA 1MZVA 2QVCA 3WVNA 3R7WB 3FTCA 2OHXA 3DWGC 3RTCA 1UC5B 4CYMA 3LX8A 2EWWA 1N0HA 1F12A 5DYIA 2V1XA 3ILYA 1DDKA 2G72A 3HM6X 4CUZA 3RD5A 3IELA 1QHGA 1Z0AA 3LD9A 5JPDA 5I4KA 1RU3A 1H2RS 1SWWA 3C3YA 5JI2E 2UVQA 5FPKA 2BM1A 3RABA 5LU9A 5CEFA 1GYRA 3ZWCA 2ZJ4A 1CR2A 1FLAA 1SVKA 2FKNA 3GLSA 1K6XA 1F2RI 3BWVA 4F46A 4AOFA 1ZMOA 4J91A 4LXQA 2C2KA 3IILA 1CZLA 2ZZMA 2V5UA 5BYAA 1VG0B 3OZWA 5GMVA 1XNRB 3DKIA 2O2SA 3IA7A 4JAVC 1SHLA 1QHFA 4IHAA 5F77A 5KKCA 3WNBA 3Q6NA 2VQEB 3WWPA 3PT5A 4N49A 1DBRA 2PZFA 3CX7A 3ZNPA 3RRFA 1PQUA 3E9EA 5HS6A 2QN9A 1QZEA 5IEJA 2C0CA 4A90A 3QHPA 5C37A 5KYYA 3H4MA 2Q3FA 1AIPA 2QUBA 2ADMA 4HZUB 4R05A 2IUUA 1BMDA 4QUDA 4Q9LA 1FS6A 1PU2A 5B2FA 1ZCAA 1X8GA 3PUIA 2DY1A 1ZGUB 3PXUA 5CA0F 3TINA 4LG1A 4DBGA 2BEWB 3LOQA 5ADVA 3ENNA 1WU7A 3L4BA 2XHZA 4EB6A 1KO5A 4BE9A 4A82A 2C4KA 2HLPA 3WGZA 2G6TA 3VNSA 4DDGD 5T7BA 1GAXA 5IARA 4ZGBA 5A7FA 3A9KB 3IAM1 1WSPA 2UXDB 4ALLA 1ARZA 5ARDA 4AVYA 3KFLA 3W1SA 2PL3A 3GBVA 3A28A 4IIBA 1GPWB 1HKHA 1P1FA 3ZE7A 1J21A 2QLBA 1E20A 2IK8A 3UAOA 4HNQA 1M2JA 2OHVA 1VR9A 5ELXA 3PREA 7REQB 5EQFA 5CW2A 4EB8A 3SRXA 3O3CA 3I11A 2AXNA 2FWAA 3G0GA 1E64A 3WB2A 1ZVMA 4PO8A 3OBBA 3TW0A 1HDIA 3NRCA 2K3UA 5IVDA 2A5GA 4NYMR 1R4MA 4LCJA 1RXYA 5EMNA 1OT5A 2RK4A 2P2NA 1MPEA 3H11B 4NDZA 1UPTA 3Q2AC 2GQ0A 3KPYA 1DIOB 5IW8A 2JCYA 4QG7A 2PKWA 1IZ7A 3GLFE 1TZCA 5LUAA 3WADA 1D1TA 1IG3A 1WB6A 3JZMA 2QRVA 3PENA 3ACBA 3C4VA 3FE2A 7MDHA 1FFBA 2TMYA 3HA2A 4K9PA 2AXEA 1K4YA 2KPOA 3PD7A 1QFYA 2PX2A 1E7QA 3M5PA 2H89B 3QMPA 2R68A 5A9SA 2XAAA 3PIDA 3W5UB 3SJBA 4QLAA 1WQ4A 4PSCA 1OWPA 4DLAA 3VC2A 1ZMBA 3HCEA 2CMKA 3E3LA 3P0HA 3EA4A 2XIJA 4UMVA 3A36A 4HAZA 2HLHA 3D2LA 5ADHA 4PFJA 1WLSA 4KGVA 1YR7A 1GZSA 3B7WA 2NUBA 2QA5A 1BJRE 1CNEA 5L3QB 1XIVA 1RWPA 5C32A 4WINA 4F4FA 4EXSA 1I4EB 3UNXA 2VJAA 4Y1FA 1XVUA 3RROA 4AO7A 5K8VA 4RAOA 2NCNA 1WXWA 4Q82A 4ZZIA 4WK6A 4Z0PA 1W5BA 1OJ7A 2AB0A 1C3XA 2JK1A 4B3XA 5JNLA 1SFRA 3C3WA 4FHKA 2QD5A 2YEPF 2OBNA 5KWIA 3P63A 1NVKA 5DFAA 4E2WA 2WYMA 4JKIA 2WDPA 4JJ7A 1J1UA 1VCNA 4K9OA 5ICEA 5DNEA 2ZWPA 2X5JO 1CRQA 2J87A 4QYIA 4RM5A 3DDNA 1XR3A 3EZFA 1L4NA 2WA2A 1X13A 3OIVA 3WSVA 3KBBA 2WM8A 1Y3AA 3RVOA 2C88A 2EL9A 4ZVPA 3CBGA 1M1UA 1IEVA 4IM3A 2V6FA 2P9YA 2TMDA 3A33B 3TBLD 1GEEA 4CL2A 2FLKA 3AFIA 5A7GA 1R64A 1C30A 1LBTA 2CFZA 1ZDVA 1SE4A 5HRUA 4PZ0A 3GYBA 2NPTB 4NQRA 1Z06A 1Y3CE 5D6JB 4W8GA 4MELA 3WY9A 1BFUA 3CZAA 1X8HA 1UFKA 4MJ3A 1P9WA 1XMPA 3EQ8A 1AUOA 1VE7A 5JOQA 2XLBA 5BWBA 3ZDXB 1E0SA 3SLGA 4EFKA 4WZAE 2BZ1A 1CUDA 5IAGA 2QN7A 1SBHA 1XLPA 5ALZA 1ZW6A 1VFNA 1EZ4A 4X6LA 3OP4A 4XVHA 1U8AA 2PUEA 2BGGA 3VNUA 3FLBA 4O4JA 3PNPA 5HTOA 1YN4A 4MVYA 4RF4A 5HG2A 3EVFA 5G40A 1Y89A 3G1PA 3OSZA 2WM9B 4F5YA 1RPTA 4LYFA 3PEVA 3LJ3A 3PNOA 5EIHA 1EFVB 2R25B 4JK3A 3V1UA 3VKHA 5TV2A 3K1AB 2HGSA 4I9FA 3SFTA 2PFKA 1O5OA 3GH1A 4MM3A 3ZZTA 2BG6A 1JDTA 2QMUA 5CT6A 4BNDA 1GU7A 2LIPA 4XSVA 1J0DA 3VH3B 4UJ5A 4U6QA 3OPQA 1AB6A 4B9KA 5LMUB 3EEBA 3KU1A 5K4GA 1SKQA 5DULA 3AR6A 3FSEA 3EXFA 3JTEA 5IAOA 3AJDA 2BEUA 1WR6E 1EAYA 2YNWA 3AHJA 5K8UA 1MO3A 1P8JA 4ZRNA 2VJCA 4ND4A 2ZRCA 4ND6A 4WD3A 1J2UA 5AKLA 1VPEA 2R1ZA 3UB3A 1V45E 1Q0UA 3CF6E 2WNSA 1J7BA 1FDIA 1AW7A 1BDMA 4PQGA 1VKOA 1UP7A 1OB5A 2I2BA 5IXJA 2WSMA 3THYB 2JIBA 1VDVA 4ER3A 2WDRB 4JGGA 2GHTA 3H1EA 1UZAA 3GIDA 1UWLA 5BSUA 3PE6A 1NQOA 1T1IA 2IHZA 3SJCA 2VVTA 1LBHA 2R8XA 1QWOA 3SFZA 4I3HA 3ZY5A 4WKBA 1KLVA 4RGBA 4OL0A 5DXFA 2VT3A 1CQXA 4M4SA 3REGA 3HBJA 4W9GA 1L7NA 3WAGA 4Z0NA 3UGJA 2D13A 5H9VA 3EFOB 1SAYA 1C7QA 4HDRB 4R71A 3DVQX 5IDQA 1FFAA 4E08A 4PPQA 2NP7A 3F4BA 3MJ4A 3D0QA 1TCUA 3KR1A 2J4CA 1M8KA 4X20A 3V8MA 4ISBA 4JWKA 3KKQA 1OAOC 1HG1A 2WHXA 3WMWA 2E48A 3VO2A 2WVJA 3K9WA 1NJ5A 3D2CA 5AESA 4QLBA 1T1SA 1EUZA 3L7BA 1P2UA 3KEQA 3RC3A 2I8CA 1PT7A 1OXSC 1R9JA 4OYRA 1HLGA 4JUIA 2WDTB 3HYSA 5IJ0A 1W36C 1LJLA 4PDXA 1G9SA 1EFHA 3PE3A 1CR4A 3VC3A 1IBLB 3I64A 5AK6A 3ITDA 4RH3A 3ZVKA 2OXTA 1FYDA 3L6UA 3UOAB 2GM3A 5ALFA 4BCDA 1AHNA 2HF2A 4QXRA 3ADKA 2BI7A 1P73A 3KQMA 2XN9C 3VU3A 3FCOA 1E8NA 4F4UA 3OICA 3CC8A 4RA6A 5TMEA 3ZWAA 4C03A 3RJZA 2ID7A 2DYKA 4YCJA 1BU8A 3L7LA 5IWAB 2QCZA 2D8MA 2N7DA 1GRVA 2NP6A 1EVQA 2KMLA 3CLHA 4GVPA 1XL1A 1NI2A 2IWHA 3RULA 1ZM3A 2ONYA 1US8B 1XFAA 3IIMA 3HCOA 2EJCA 4FE3A 3NAGA 2G04A 5MFZA 3ETDA 3CLTD 1WJ6A 3E1GA 4JBLA 3UUEA 1SSNA 4J0JA 4UUNA 3FWZA 4V0NA 1JSLA 3S2GA 2R2DA 3PHLA 2IL1A 1OZ0A 1ENFA 4DV6B 1BMFD 4P9NA 1C4CA 1WW8A 1PGAA 3IALA 1RMYA 3W7AA 3H9BA 2XBLA 2PGDA 2GCUA 2XUAA 2AJ8A 1NMEA 3OE1A 4FYYA 3PUZA 1WCIB 3G8DA 3GH3A 3ZI4A 1UJBA 4G8BA 4GNRA 4I55F 1SHJA 4MQFB 2JEZA 1I4QA 1FA9A 4I99A 821PA 3DYBA 3PJFA 2YNVA 3WLMA 2FMIA 4GSWA 5TJ9A 2MOKA 4LXGA 1JFSA 4HDOB 2Z0EB 2HA2A 1EUDB 3I34X 2HT6A 1FK8A 2VBFA 1W4CA 3ROQA 2WU3A 3D6VA 2O8CA 3C4QA 3UFXB 4R2XA 4YSZB 3UK6A 3FPHA 3PQCA 2W43A 4RXMA 2P9FA 2BEKA 4RFSA 2ZGVA 4EF4A 3OKPA 4ZMBA 2IP4A 1YR6A 2V96A 4B17A 2I6FA 2C2OA 1I3LA 3W4JA 4FMCF 4BEVA 2F1IA 2YV3A 4P7FA 5C2TB 5DK6A 2FEWB 3NHKA 5JD4A 3K1YA 4IEIA 5LKRA 4ESOA 4H4EA 5CH3A 1YVEI 4NKRA 4W82A 4KGDA 5JFTA 5E7JA 4YJ3F 5ES4B 4RKWA 1ZG3A 4D02A 3MWEA 2NYRA 2Y0CA 1V11B 1Y33E 1T2FA 2B98A 5BO4B 1C9EA 5B3KA 5LA6F 1AH2A 5BWOA 2WIGA 1PN3A 1ZCZA 2E85A 4GX1A 5CYFA 1KNQA 5DNYB 4G0XA 5ACWA 2EL7A 2KT7A 4RDHA 2X86A 3CF2A 4U2KA 2Z8YM 2E89A 2RHJA 5IT5A 1URPA 3V8RA 4AUNA 2C42A 4ZK2A 4BKQA 1PLJA 5JV5A 1MEJA 1VZ8A 5L6MB 3BERA 1YWGO 3GXBA 2FPKA 3NTXA 2VBCA 2PE5A 3RS8A 2QPTA 3DS8A 3H5VA 3NGLA 1BOOA 2CK3A 4XVRA 5HUHA 3ZI7A 3VU0A 4EPYA 4MITA 2VRWA 3T7IA 3T1HB 4PYNA 4FR0A 4BLTA 4YRBA 3Q7IA 3DV0A 3Q3VA 3O4GA 4CIAA 4GFDA 1T5IA 3VKWA 4E2YA 4Q34A 1YL6A 1AGNA 3C1AA 2AE2A 1DO8A 3WRXC 4XCVA 2EGGA 4A6XA 3WKDA 4IW3B 3FTEA 5CTAA 5FTJA 1U90A 1H85A 4DC0A 5JNSA 1WP9A 4YI3A 4KITB 1UINA 4E0BA 2QI9C 4HS4A 3KS9A 4ZO3A 3MQ4A 3TCNA 1EDEA 2H54A 4QFDA 1H1LA 1EP1B 4K7JA 1GV1A 4G8CA 2HK7A 4RPCA 4IH9A 3CB2A 1MDBA 1Y4DE 2WXFA 4RD3A 5IJWA 1QILA 4HG2A 5K4KA 4TL9A 1C7RA 3S6JA 3SHQA 5KDLA 1BKSB 3G2KA 2YZ7A 3ZKJC 3DQPA 2ZUTA 4KQGA 4C7JA 4ZEXA 3BMNB 3KLSX 4RNCA 3G2HA 3UB4A 3R5FA 4MR9B 4BFCA 3K09A 5EINA 4P84A 1PWEA 2QU8A 1WAMA 2CMHA 4J0DA 4YRKA 3WYEA 2RHLA 2D5AA 4LJ8A 1N5XA 3CT6A 4BPRA 4ZZ3A 2C83A 3BIID 2WKWA 4WKOA 2W55A 2W6CX 4X85A 3DLAA 5I9MA 2GGSA 2ZYTX 3HU2A 4FDAA 5E0KB 2WILA 2F1KA 2BPOA 4IFEA 1U0RA 2H0RA 4FI3C 3VO9A 4H77A 4TQ9A 1E4YA 2WFZA 2IIVA 2GILA 1DTSA 4TKVA 5JSFA 2P2DA 2OAGA 1BH6A 4JI7B 4Y18A 4ODIA 1QSGA 3K4HA 5T3YA 1XPJA 3H9CA 1KHTA 1Q7EA 2Y1CA 4BVKA 1PZHA 4UBIA 4RH6A 5IN4A 1THMA 1CQVA 4UHDA 5GIOE 2RD0A 4YRNA 4ZVMA 2NU9B 4CGYA 4WNIA 1KEEA 2D10A 1AN0A 3CKKA 2I8LA 2PVPA 5ERYA 1WE6A 4QO7A 4D8UA 4XRGA 1IOVA 4KLRA 4NAMA 3LP5A 4D4KA 4EQZA 1YN3A 1ZH0A 2C1ZA 5BYRA 1R9GA 1JDUA 4H17A 4JLKA 2OHOA 1HL7A 3IMGA 3D54D 2QYTA 3GRRA 1FDRA 4DSUA 5FNZA 2ZFUA 3MTBA 2WNMA 1YJ5A 4EY2A 3LUPA 5IJ9A 4KIKB 2IQIA 2AE1A 3TQQA 2VHQA 4JQCA 4LDTD 1DIHA 2K6QA 1N6RA 4MI9A 3VAZA 3V48A 4H6XA 3SJUA 3CLRD 4B7CA 4YV2A 4IIFA 2RONA 2B0JA 4DGSA 1UC4B 3LPMA 1JALA 2EEPA 1KKMA 3T4EA 3B52X 5H83A 4LJAA 3BXPA 3W0LB 4WJQA 4TWZA 4WVLA 3BK2A 1Y7HA 4M1EA 1ZD8A 4TWAA 2WQ7A 3BB4A 1W5TA 1IN4A 3KLOA 2H4FA 3BA6A 2FSIA 4YUXA 2QD1A 4PIVA 4EL5A 5EJ8A 3AHEA 2XEXA 1KVRA 1E3TA 3I2HA 4KE7A 5EWLB 3OFJA 2ZCJA 2WSYB 4J4BA 1Q7BA 3TNLA 1YRHA 4C0JA 1WLYA 3DVLA 2P4QA 4QPNA 4IILA 3ZHUA 1EE9A 4TYNA 4K8OA 2TSSA 2ZR7A 4Z7QB 2DYOA 2IGHA 1J8VA 1RFKA 1P8AA 2R86A 1W5FA 3W4KA 2BMAA 2ZCVA 3T34A 2PCLA 3QVVA 4MYRA 3UMGA 1TLFA 3FUVA 4KLZA 4IP0A 3E82A 4RK0A 4RHYA 3U7FB 2INNE 3H84A 4V38A 2SHKA 4ZTBA 4UXIA 1A2KC 2EJBA 4BV8A 3ZNNA 3LQ1A 4NJCA 1B15A 3ID6C 1R6DA 1FLVA 3OQOA 4U4AA 4RV4A 3NHFA 4K26A 1Z6YA 3I4CA 1G0OA 1QKJA 3NQ41 1BX3A 4O1HA 5T3UA 3MFYA 1XCQL 5A3JA 1OQYA 4LS3A 4Q9IA 3WNZA 2ZWMA 3MAAC 5EAIA 2DOKA 5ITZB 1Y4ZA 2QRHA 1UK8A 2EGHA 2L00B 2BEJA 4MGIR 4TL7A 4UE3S 3W6NA 2DKNA 1YA8A 4OOFA 3H86A 1XXLA 1ZFNA 4MQEA 2QKYA 1UJ6A 3MT9A 3MBKA 1XBTA 2EV9A 4ID3A 2CLOB 3V1KA 3ZVLA 2C96A 3CZPA 4WAAA 1RRFA 4WX2B 4BO3A 1N0IA 3FSGA 2QP3A 4FX2A 1W85B 4NMMA 4MVJD 1A9XB 3MT0A 4BKMA 3KEMA 2BEVB 5LP6C 4RIHA 3ML9A 5EHIA 3PNMA 1IGDA 1TUBA 1AZSC 3R0ZA 3UJ6A 1F7VA 4L2YA 4KK4A 3PR1A 1SXHA 3ONEA 5KSZA 1I42A 2KLHA 4R7GA 4MW4A 4GOOD 5ICMA 3MN1A 5E3HA 4GLBA 1Q95A 1LJUA 2BFEA 4C06A 3DBHI 2XCIA 2JASA 3TW4A 1W4AA 3QUCA 5C4MA 3FRHA 4XPIA 1T26A 4MVJP 3AY7A 3RTGA 4R9NA 3FX2A 3KUZA 4S0RA 4G0ZA 2AMYA 1W7AA 4Z4QA 5EYPB 3PPVA 3MGKA 2X8XX 2FAZA 4W9RA 2IKQA 3TLAA 3KAKA 3UKJA 1YMQA 3TMPB 1D07A 4EJSB 2XUOA 2ZI5A 1HMYA 4NEHB 2NU6B 4L8VA 4EZIA 3C5HA 4FJ0A 7YASA 2V3NA 1C0PA 4PX5A 2GPSA 2KM1A 1FMFA 5DSZA 3KOOA 2VP2A 4A8HA 3NRZA 5BR8B 3ROGA 2EZTA 5HM8A 1V1PA 4RZUA 1XTZA 1RQGA 1T0SC 5K7SA 4MA5A 1BGXT 3LKVA 4BO9A 4TZEA 3BINA 1H4RA 4DA4A 2B69A 1C0EA 3T5GA 1L7XA 4PRZA 5JQGB 4M0WA 1KJ9A 1U7XA 4RENA 4P3NA 3LDGA 2BFZB 4WNAB 4KGSA 2YMQA 4WFJA 5AXRA 1V7CA 2Q4TA 2B4AA 1Y9JA 4H9GA 3WXMA 5FOWA 3KK0A 2KDEB 5KEIA 4P7GA 3R5SA 3OIYA 1U1IA 3Q10A 5EVBA 4RULA 4HRYA 3C3MA 1VPTA 3AEYA 2C84A 4OBXA 3T5DA 4C88A 1JAIA 1NXWA 3ICWA 1CYEA 3HYRA 1K8XB 3MTAA 1NRXA 1AKVA 1EXMA 2CUTA 2AHRA 5EH9A 4MRVA 2IDKA 3R8BA 3Q2KA 4N5LA 3WXBA 3HBNA 3ZHZA 4QUHA 3C3KA 4B6GA 3GZNI 1FE8A 1FVOA 3WLRA 3F0TA 3AI2A 1JLLB 2KTFA 4GDKA 4TKNA 3FLMA 4A0FA 2ZETA 1HWYA 1TYZA 3MZ0A 4YUVA 3OLYA 5HJEA 1SXJE 2IU4A 5EFZA 1YCFA 2ANBA 3GVCA 1CD5A 3TEYA 1T91A 4IHJA 2P35A 4OM7A 3QOYA 2JGNA 5J1TB 3LXUX 2Z5LA 5I4CA 4QUIA 2NIPA 2QC8A 3K0AA 1WJGA 3IVFA 3KCQA 5KHAA 2NO9A 4JZKA 4MVWA 1AXRA 2YDYA 1OOEA 3GT4A 2BGAA 3ZNOA 2WYLA 4LZNA 4NICA 5BORA 4EJ2A 3VKFA 3ZI0A 3A3YA 5DM70 5KOIA 1ULBA 2K4MA 2P2SA 5DM2A 3V5NA 3ND9A 3F6EX 1M34E 5HQJA 4OL9A 3K20A 2FN4A 4MPDA 3DPIA 4QRIA 3LH5A 3TQFA 2OQRA 1WRBA 3CY6A 2LTAA 3CNHA 3P0EA 1NVUQ 3VVBA 4AJJA 1ZD2P 3ICOA 1QH3A 1HDGO 3HO8A 1G8AA 4B80A 1GGMA 2DWUA 4WZ6A 4FHCA 2VDKB 4AJ4A 4KWTA 1CR6A 5KYYB 2FSGA 3HFJA 1TLTA 2E87A 1CFJA 3K9OB 1C3OA 4ZHQF 3PCTA 3QUTA 4GIBA 1PV2A 2D0PB 3LXMA 1LZLA 1RS0A 1I6MA 1IUNA 2PMBA 3SICE 1G4UR 1J9ZA 4A2PA 1FPQA 5BSHA 3GEIA 3H75A 2NO0A 3U62A 4D3XA 5A4AA 4B43A 4LZZA 1WMEA 5EHZA 1SNYA 3Q7PA 4BMSA 3FXAA 3HVZA 2GBNA 2I1KA 1E58A 3LPCA 2ZSIA 1XA0A 1BA2A 5L40A 3I1YA 3FDFA 2RFLA 1EI9A 1Q12A 5CB4F 4MI6A 1N4AA 2QRUA 2B99A 2O6LA 1W49A 3TOCA 5COAA 1MFPA 4RA9A 1ODJA 4F6LA 3ZHXA 5H82A 2HJGA 4NIMA 3UZUA 3P9NA 1ESEA 1YH3A 3RV4A 1ESFA 3E58A 1GRNA 1N5WA 3F3YA 1FRFS 3GBSA 4IKEA 3ABQB 3KLNA 4RPJA 1NN1A 2A3NA 5JSYA 3EMVA 3PRJA 3ZGNA 5EC8A 5HVNA 1UJNA 1KO4A 3TZLA 2D11A 3RUIA 5E8JA 1T3SA 3KOUA 3RRBA 1FCCC 5JNVA 3PLUA 3PY5A 2FFJA 1C0IA 2N1BA 3PVLA 2EATA 5JRJA 2W2MA 1GHTA 3AL3A 4ND5A 3BCHA 1ZKMA 3H9DA 1CDOA 4DBLC 3S8EA 3UJAA 2OB2A 4WVFA 1MORA 3I30X 3VR3A 2H4ZA 3K9CA 4N5IX 2X8JA 3PRYA 1TW2A 1CUIA 1KJQA 1Z5UA 3VR6A 1FPMA 5T6MA 1LPSA 5A9SB 4PR3A 1AARA 3QSGA 5LXHA 1S7GA 1CHNA 4NOJA 2ZBDA 4IXMA 4PX9A 3ETRA 2O3UA 4BKTA 4MW2A 4LE0A 1PWXA 4KVZA 3ZXIA 1V4BA 1R9MA 5JTTA 3BEDA 4FNAA 2EFYA 3J7TA 1UOPA 3CSTA 1ZX1A 4Y9UA 1N5KA 2VTKA 1G2OA 2N9LA 3I9NA 3EXAA 1HUQA 4Y98A 5DHAA 2IY7A 3GN2A 2B92A 2B9VA 2OP1A 4OU5A 1S3SA 4I36A 1W0KD 5DMHA 2VUIB 2W2KB 4MDYA 1C7FA 4K88A 2Z30A 4E15A 5JDIA 2FCSA 3O74A 3DWGA 2YOFA 5SZHB 5IC6A 1I4GA 5KTMA 4QYIB 1VPWA 3UJBA 3ZWXA 1X15A 3LYLA 2P9EA 4JC4A 2B21A 4MA4A 2WICA 1MT0A 2OCYC 5AHXA 3W77A 2WGSA 4HLUA 2BW0A 4M37A 3F9IA 1GA4A 3JATA 3W5JA 4LV6A 1C30B 2OV2A 4L4SA 1XXGA 3U60B 3RFVA 3T52A 4AP5A 3A6EA 3QUSA 4HL1A 3TRDA 1NDHA 4I1IA 3U7JA 4YMUA 5CVDA 4N47A 1V9JA 1JLKA 3RI7C 4OM8A 3C16C 3DPSA 4MQMA 4WBNA 5SZJA 3BY4B 2PJHA 3U26A 5CDTA 3PY6A 3O6VA 4JI4B 3QTLA 1HEIA 4DA6A 1NXVA 2PD4A 3QBVA 1MW8X 1MQSA 4UZSA 2QJRA 4LVCA 1KORA 3WL6A 4KDLB 2R6FA 3R0IA 1B8NA 5DP2A 3JWJA 4PSAA 4O4JB 2NUPA 3VQZA 3ANNA 3A6KA 1Z2OX 5C5DA 2AW5A 3AETA 1KZYC 2A88A 4GLFA 1E9RA 3FKSD 3EOBI 3B2QA 2PO7A 5BWNA 1GY8A 2FU8A 1H94A 5CR9A 3ADRA 4MR8A 2WNHA 1B42A 1DFHA 1L4HA 1Q0SA 2OGWA 1V16A 2QE7A 4MWTA 1L7AA 2W54A 2YMLA 4MEMA 1FZTA 4PYOA 3F1KA 4BNDB 4AXHA 4DDKA 2I3GA 1A50B 1TA0A 4ACFA 3AGQA 1JFTA 5BWMA 3D59A 3FOFC 3IDAA 3ZD6A 1LX7A 4QUKA 1EWYA 1ORHA 2CNDA 1OXVA 3JQ9A 3UJPA 2BEUB 3IV6A 2A6PA 1QU3A 3LSTA 1JTFA 5AVTA 5HKOA 1TCVA 4QECA 3LVQE 1ZMRA 3TAHA 1MBZA 4PSKA 4MVJG 1KOLA 2IHTA 3TQRA 3ESRA 3M9WA 3L40A 4FXPA 2V6BA 2AIOA 4AL4A 4PEVA 3UI3A 3W05A 3MJ5A 3P94A 2RH4A 4XQEA 2YINC 7ADHA 4TLCA 2ZSKA 2A4ZA 3GI1A 1R66A 5LZ7A 1CZNA 2OWEA 1NFFA 1QC5A 1GG5A 5KMGA 3DVGX 1GAEO 1PWYE 1G6JA 5KWEA 5I7FA 5FR1A 5BNIA 4ZO8A 1IMOA 3DZBA 4KU4A 3DVRX 3Q7SA 4M9QA 4C3UA 1BE6A 1D7OA 3EIQA 2NO6A 3O4RA 4FHGA 1ZCBA 1WJ4A 4DRXA 1C1XB 1IN1A 1GKIA 4NDAA 2OV3A 4HGOA 5IQKA 2H11A 1QFJA 5AUQA 1BE0A 1IBKB 4DLWA 4J75A 5JPCA 3F8SA 4L8FA 4C0QC 3QMVA 1QLHA 3B6IA 5CHYA 2B1QA 4XJTA 2PMFA 1NKVA 1L0VB 4YAFA 4CGZA 5DDIP 3TLXA 3V6CB 2PX0A 1D1SA 2ZI9A 1RW4A 2XE7A 1JHYA 2P4UA 1LVHA 2B25A 3Q6BA 2WMOB 1W76A 4D26A 3CPSA 4ZDJA 3A6GA 5HQTA 3AUSA 5JCZA 4LK0M 3ZE1B 2IW3A 5IJ0B 2HLNA 4RX1A 1YRAA 1Z5ZA 3LVBA 3R8FA 5AI9A 1Q6ZA 2IHYA 5H59A 1VJRA 1W5AA 5FDFA 5JASA 3IXSA 4MVJE 2GUGA 4PE5B 5CT8A 1MO5A 3DF7A 4GQBA 2C54A 3LBIA 4H08A 2FSVA 2YOGA 2R7LA 5LNK6 1O95C 4RA6B 5AUPB 4BMOB 2ZIVB 4TLBA 5E1OA 1TZKA 3EA6A 2J41A 1Q1AA 5JD5A 4RMGA 3FPAA 2AKYA 1E6KA 3BTSA 3SBDA 2O1SA 3DZ8A 2VJLA 1T15A 5K20A 1Y1PA 4MKZA 3GDHA 2CYAA 4ZEOA 3TKLA 4CFZA 4N8SA 3TD2A 3IVXA 2O8FA 1I80A 4JELA 4AIRA 3EFCA 2J53A 3RUDA 1K66A 3NHAA 3KQWA 1XTSA 2IHBA 5HMMA 5B58C 2X5XA 4WD6A 4ZPJA 1WV0A 5FPSA 2O2JA 3UY4A 3NOOA 2JAOA 3CH7A 5KWJA 1ZKDA 3G82C 4GT1A 1XD8A 3NANA 3WZ2A 3DO5A 4JNCA 4IJ5A 5CYOA 3TS1A 3K0CA 3UJ3X 3H97A 1X8IA 2M56B 5IKMA 2YNVB 3PU6A 1TO2E 2RIRA 3V1LA 4IQ8A 3O4FA 1BG6A 1OMOA 4QDJA 2NAFA 2RGCA 1JEOA 4UCQA 3FPEA 3O4VA 3OOJA 3AXSA 1UBJS 4A2QA 5TF0A 3HU1A 5IFKA 1PX2A 1DLIA 2HXYA 1MTZA 1CVIA 1QO0A 5FXMA 2WUWE 2JHAA 4KSCA 1JWAD 4UDYX 1ONOA 5JISA 4WFKA 3HHPA 4RFSB 3WL5A 1SBCA 1JJVA 2HI0A 4C89A 1XF9A 2QX4A 3ODPA 3B36A 2Z9CA 3A3PA 3OJWA 2AGVA 4R3UC 5EIWA 4RYLA 1N62A 1IHYA 4YSLA 4XASA 3IUYA 4JIOU 4DJAA 5EE1A 2NYPA 4WAUA 4KXYA 3REOA 4KKXB 4C6RA 2HZBA 1BXRA 1UT5A 4UJ3A 1QOZA 1FNCA 3HY3A 3JYOA 3DL4A 4IJVA 2JLWA 3FYUC 4FU0A 4GB9A 1KKUA 1L7MA 3WTCA 1SVWA 2C1XA 2OGZA 3T61A 2WWXA 3R7DA 3EIUA 3R7FA 4BVFA 3GGCA 3O8RA 5C46F 2XIQA 3HPQA 1G55A 1J2RA 2Z6VA 4DLLA 3LF2A 3ZNZB 1MUUA 4D45A 2OM2A 3MIIA 4QPDA 1I14A 1VHDA 4J6FA 3C3BA 3C74A 1TM2A 5GIPE 5HH6A 2W2NA 5EI5A 4C4TA 3NO4A 4Z4FA 1A0OA 2AEJA 1FNDA 4LY9A 4EMBA 4CLXA 3KKMA 2O5VA 1LQTA 1ST3A 2VDNB 3KJIA 4ALKA 2FLWA 5G5HA 1Z68A 2BKAA 4HYTA 4PCLA 4G1EB 2MP2A 2PMVA 1SJED 3HCBA 2JA2A 5AVVA 1X1TA 1Z29A 2RK3A 3UMMA 1TGZB 2JJYA 3B7GA 1QOBA 3QE4A 5H9WA 2XE6A 1EGMB 3DV0B 5I7OA 2VDOB 3TNJA 1H2HA 1KEKA 3T54A 3DW1X 2R62A 2ZRNA 1I4OA 5JMOA 4MARA 4F4CA 1V2GA 3ONWA 4CT0A 1Z6AA 1JMLA 2HL6A 3UKDA 3EDCA 4TMYA 4ZIRA 3OLMD 4P80A 3N1UA 2FOIA 5BRJA 1H2AS 4YAUA 1MHTA 4N6EB 2A8YA 8LDHA 2F9MA 1ZIPA 2EBHX 1H1LB 3E6AA 4KX3A 4RKYA 3UGKA 5C7IO 1COWD 1U3WA 2Y8BA 4KTTE 4LSZA 3FI0A 3KR2A 4C1GA 1EBFA 5CVCA 1PSZA 1MIHA 1WMBA 2VDUE 4LOLA 2IGDA 3SDLC 1DBWA 3FOWA 4YUWA 1GC7A 3VNRA 4P38A 5BWLA 1TK9A 1NR5A 3AE9B 4YWGG 3C1UA 1TVEA 3H5WA 3O31A 2F43A 1OYWA 1M1YA 5KI6A 4Q66C 2XZTA 1LY1A 1LBEA 4ZDKA 4PR0A 4DJJA 3ZXRA 4XX0A 3U9TA 2PZJA 2CXUA 1MC4A 2ZSHA 3CO5A 3ZWMA 2IYZA 1R3DA 5FORA 2IV2X 5CFOA 1PHRA 3PC3A 3T1OA 3OMLA 4BNUA 2I6UA 4PHGA 4RHCA 1V8BA 3VNAA 4QQKA 1H9CA 1HE8A 4RL4A 1MB2A 1WR1A 2K22A 3L3BA 2J5KA 4RIGA 2R7AA 2VF5X 3Q40A 2BDEA 2JK0A 1QFZA 1KEEB 2K8BA 4D9MA 3U3JA 2O3JA 2CE7A 1XZDA 3COWA 3SIRA 1BU5A 3ZNQA 1VE5A 2VFAA 1JHQA 3P0RA 1QGOA 3DCYA 1DAHA 1H2BA 5KINB 2X9VA 2O6VD 5TPWA 2J3KA 4JJZA 1JKFA 3AG5A 3DOIA 2Y87A 5IJ9B 2WWYA 1HYHA 3SXUB 4QARA 3NYQA 4ZI3A 3R20A 3HK2A 2NSHA 2OECA 1NMYA 1QAMA 3D8TA 4TT8A 4O5OA 5FHRA 4QU5A 4CV1A 2QLJA 3AFHA 5D8DA 3BGWA 5H3CA 2FZCA 2ZJBA 3UAZA 3GGJA 3HN6A 2AOWA 5IKEA 1W96A 2RMKA 5LQJA 2F9FA 4I81A 4H60A 2IYYA 1S4MA 3I39X 4YLYA 1SUFA 5AT1A 2JRHA 5DGXA 5HBGA 3SYMA 4XYCA 4IIJF 4JI8B 5DPWA 4U4LA 1A9ZA 3MMXA 3LCJA 1QANA 3VKUA 4PIPA 2WYQA 4XE5A 1WX8A 4PS1A 4E1BA 5CLQA 1X7HA 1WE2A 1N6NA 4ZI5A 1J2TA 5JYCA 1YRWA 5AOBA 4XYBA 2VDWA 1VIMA 3IAS1 1I4LD 4TV3A 5KTPA 4P86A 2YLMA 1G2QA 3I04M 5ALWA 3EWAA 3MXOA 2XCTB 4IWOA 1FDWA 3BCRA 1WWKA 4HPPA 2Q41A 3AY6A 1AV7A 3OFSA 1T3ZA 4EKGA 2FQYA 2UYXA 2NG1A 3T1NA 1UBOS 2CL6X 2R3SA 4E4RA 1SJHD 5JI3E 2IEIA 3EFHA 3OOYA 2MDTA 1SQ0A 2B9EA 4WXMA 4KQ1A 1PX0A 2V9PA 1PJAA 1VIDA 4MSMB 2IOQA 1USGA 5H3LA 5DH9A 1QGUA 3PVZA 1VJNA 3HR7A 2IO2B 4CMCA 2QU7A 5LQDA 3ER6A 3OQPA 1I35A 2H1OA 1XK6A 3R5HA 1DCFA 1FF9A 4PONA 4D9HA 3D3EA 3Q3GE 1CDDA 5KPJA 2R8OA 2H1RA 3BWBA 4CFSA 1ESMA 3S7ZA 4MP6A 2IPKD 4DDWA 2FV8A 3N39C 2Q21A 5GV7A 3QF7A 4FW9A 4MQEB 4MV3A 4G8DA 4QQFA 3JQ8A 4M7WA 1ZESA 2DFTA 2VP6A 3V2IA 4XQGA 3HVHA 2KMAA 3WFZA 1AQ6A 3DH0A 5EMKA 2VUUA 3FYCA 4I1RA 1GLVA 5K0GA 1N7HA 4G2NA 2H9YA 4US0R 2C3UA 2LD4A 2ZB8A 3SOPA 5K4HA 1Z0DA 3U7RA 4D57A 5TE9A 1JR3E 3B6JA 4UFPA 1VCMA 5LZ2A 1BW9A 2IZ5A 2CC2A 1TUBB 5ARBA 3DMDA 3VR6H 2PJUA 4GEKA 5SYAA 2PRYA 1E2KA 3NIGB 3TNDA 3F5QA 4HNSA 4B7AA 2PLAA 5DLQC 3TQOA 2P9TA 1SURA 4ZU6X 3B5IA 4MEBA 4CKCB 3WTBA 4ASUA 4RMHA 2F67A 4XPIB 2CDAA 4GMGA 4ZCSA 1C78A 3LY8A 4ZDVA 1Z4OA 4MRMA 2BY4A 1FSSA 2BIBA 4TSKA 2I4LA 2IS6A 1BHQ1 3RS0A 1P1RA 5DT2A 3K70D 3WK9A 4FBLA 1KOGA 5JAPA 2F6RA 1C7JA 2EFEB 1XO3A 2ZTMA 2VNAA 3OLQA 2VF8A 2V7QA 3MTIA 2CDRA 1GTVA 9LDTA 3TN7A 3KHSA 4GMKA 4PZPA 1VMAA 2YNMC 4KKJA 1O89A 2GCOB 3SMQA 5AM4A 3W1EA 3N1ZC 3RO7A 2EFHB 621PA 4EHIA 5BV8A 3OQMA 3WDSA 1W25A 2IGTA 3MINA 3TEFA 3D1VA 4EX7A 4OHKA 1U9YA 2PG3A 1TJEA 4Y0VA 1V1PB 4Q9KA 1RWBA 4JUAA 3PRKE 1C76A 1UFQA 3CZ4A 3M6WA 4YT2A 2WDZA 1D6MA 1P1CA 1O0CA 4MDHA 4FQ7A 1QYVA 3AF6A 4M0WB 4D82A 2J59A 1QV6A 3FBGA 1PUJA 2CF5A 4O8ZA 1I6LA 4BMVA 2I6TA 3NUGA 1H2WA 2Y27A 5KQGA 1FRQA 1JLHA 1XGKA 4DY6A 2FEPA 2Q3MA 4OAOA 3FNFA 4Q7EA 2Q3EA 4HGZA 3VQTA 3CH4B 3TXXA 5GJVC 3L8CA 1Z5VA 2XWPA 2QL9A 1WZNA 2IPNA 3EEFA 3JQFA 4CBVA 5AI5A 2WKRA 2ZEQA 3GPLA 5JNRA 1G20A 5FBQB 1P2GA 4Z5ZA 2ZRPA 2IYFA 3GYGA 3MD9A 5B30A 3KT8A 1Q15A 1JT2A 1DRKA 1D4FA 1FU8A 1GR0A 2AJDA 3HMKA 4LWOA 4UEQA 3IPCA 4R5MA 4I4NA 3L6BA 3OPMA 3BIFA 3U61B 2VHZA 2QJLA 3PC8C 4GI5A 4HL6A 4NYJR 2AN4A 3MGAA 1C8VB 4GYQA 4GDKB 4GGMX 3FOCA 5D3ZA 4RMAA 1U02A 2QT1A 2WJHA 2FX2A 1S8OA 3BL6A 3EZGA 4CEHA 1ACLA 3USCS 1U3TA 1CUBA 1FC0A 1Q74A 4LCDE 3CEPB 4IHJB 4HLNA 2VSYA 2HQRA 1CP2A 5JZBA 2WXNA 2FZKA 1UXOA 3B1YA 3MC0B 4LYEA 1KJIA 3K0AB 5KC8A 2WG0A 2M98A 4JI1B 1OCEA 1ZJYA 4KO8A 1J56A 3LZDA 1P6UA 2H52A 1UPXA 5AKXA 2G1EA 4J0QA 3UH0A 4XWTA 3IP1A 5HUJA 2X0FA 3SJ7A 1I1QB 4RPLA 4FYHA 1JWSD 4N48A 5KC9A 1SU8A 2H0AA 3E1SA 1O8BA 4BKRA 2R5NA 2ZYIA 3Q5DA 4MHOA 5JCJD 3T5CA 3TTWA 4BB0A 5IT4A 5DWDA 4CU2A 4GPIB 1M2FA 4RHEA 3ZD7A 1A8UA 5IMBA 3DZJA 4ZREA 4BB5A 1CEXA 3FAKA 3S2IA 4XYLA 4AX0B 5CEJA 1ZWLA 5AI4A 4D1VA 4W9FA 1TB4A 1EWCA 4UQPA 3BB3A 4NVRA 3PCRB 2Q3JA 3P52A 1C3OB 1VRCA 1CRLA 3L8YA 3V8BA 2I3BA 2AC4A 3KSMA 3EUAA 3HJGA 1WKCA 3F7MA 1GNVA 3FPKA 1Z15A 4QA9A 4Y6RA 4WLEA 4JVSB 1BXGA 4ETIA 3K1TA 2HMVA 5CLLA 4YT0B 1XDUA 3ZXSA 3E7XA 3WLOA 3O8DA 4OB7A 3ELUA 2DBRA 1IU9A 2HADA 1AE1A 3OJ4B 5U1PA 5CNIA 3I05A 1BJTA 3L16A 2GBIA 2HR1A 3G59A 5JAIA 3JVIA 1ZK0A 2BB6A 2NWQA 5DCNA 3ETGA 4OQDA 4RQBA 5SY4A 4QG3A 1YQUA 1GG2A 3VPFA 2G83A 5JVDB 4RA9B 1T2UA 2EWMA 4BQOA 2HA4A 4RDXA 3S68A 3AIMA 2E37A 1U80A 2KSQA 4HCNB 3X1JA 3OTHA 3WI7A 3JSAA 3EAFA 1B16A 1RWQA 3DVNU 4QASA 2W83A 1XWIA 1ZR4A 1VRVA 3PR3A 3RUIB 1STEA 4HJKA 2PXAA 2H2IA 3CURA 1J8FA 2A57A 3CMMA 1N8TA 3C8HA 2CLLB 3HKCA 4V0LA 4X71A 1W87A 5M2QA 3SU8X 2H4YA 3AINA 5AZGA 4IWPA 2CKHB 3NY5A 2QM8A 1Y3HA 4MKGA 1JRUA 2OP0A 2KC2A 1X42A 2X8JB 3SXPA 3TMAA 5KYKA 3RZWC 1TCCA 2EZUA 4EUKA 3BORA 1CV2A 1EVYA 1KAEA 3R3VA 1VL6A 4CYEA 1UQRA 2P9GA 3M6UA 4D3FA 3E2IA 3UV3A 2FPRA 1ODTC 5LLIA 3UGBB 1XB2A 4P4TA 2ZTLA 2X77A 1C7EA 2XXAA 1IHUA 3W3AA 1MJHA 4G0OA 2RGDA 1OYOA 4UVEA 3CJRA 4P34A 2IVFA 3VH4B 4ND8A 1DXOA 4EB3A 4EY4A 3CNEA 4YLGA 2D2XA 2R60A 4DCJA 4BKSD 4L4YA 3NEAA 2KDBA 1YZFA 5IKPA 1MOPA 1ACJA 1KSHA 4OKSA 2AN5A 3O1JC 2Y77A 2K9XA 2UUPA 1D5XC 4KR7A 4ND1A 3R7BA 4F7DA 1SBNE 5EMMA 4MQLA 3PQ3A 5IH7A 4QO8A 3X1WA 1HE3A 5BQXA 2Q6VA 4S1OA 4QBGB 5T64A 1YMUA 2HK9A 3SR3A 1C4PA 1GIAA 1YVRA 2PVGC 4ACBA 4G26A 2FMFA 2ZXUA 1XMSA 3MRXA 4JVLA 2FVYA 2SKCA 4BY9E 1O2DA 1CRZA 1TUGA 2OEDA 2O8NA 2Z6QA 1BUIC 4K46A 4KQIA 1T9BA 1B6SA 3LV8A 1KEPA 2HD4A 4RZ3A 3BICA 4WY8A 4UM9D 1B6RA 3JATB 1NM5A 3OX2A 1XX6A 1II8A 5AVQA 4IJQA 1L6UA 1BROA 3LIPA 3BE8A 3WOHA 3WV5A 3RC9A 1UPCA 4PVOA 1AMUA 3LBYA 4TZ0A 4RM2A 3G7NA 1T4BA 2ZZNA 4W9JA 5A4JA 4BBAA 3RANA 4WBNB 4Y1EA 2L69A 2GBKA 1DEXA 4NC9A 1Z88A 4H7PA 2X3UA 3KEGA 5JRZA 3ZZMA 3LS2A 3VFDA 1Q5WB 5CU7A 3WKEA 3MRSA 1E6UA 4LOHA 4ZGGA 1N2ZA 2NUPB 1B6TA 3LHSA 3L2OB 1A76A 4J2TA 4J3FA 3TP9A 5EE0A 3QVOA 4JSYA 4RTNA 1D1QA 4GH5A 4DV3B 1ICEA 1KY3A 1G66A 4LFAB 3DOJA 3SKXA 3U4IA 5DO9A 2ID4A 4MR8B 4Z4EA 3ADOA 3OD5A 1E2LA 3CRRA 3PD1A 1JG2A 5H8YE 4MMZB 4JJGA 3VDQA 2HHHB 1V16B 2P91A 4CTOA 4NARA 3H2GA 2ZRIA 3O4IA 3QWFA 3FIUA 1HF3A 2CVOA 5ALYA 1J00A 5FWYB 3HDHA 4ZC8A 3RHZA 3SQDA 2Z3VA 1HL3A 3DHNA 5FIUA 1KO8A 3LHDA 5L45A 3P20A 1R4MI 4NE2A 3KXIA 3U8ZA 4TQGA 2QVBA 1E62A 4MDEA 2NS5A 4MWDA 5TEWA 3L4PA 1NPDA 2HCJB 4BKOA 3V00A 4OYLA 4JA0A 2JAXA 3ZDYB 1IY9A 2XQJA 3CR8A 3WRYC 4JLMA 4X8LA 1J5EB 3HDYA 3RF7A 3FKYA 3HE3A 1DADA 2MINA 4M22A 1A5RA 2YYYA 2J32A 2NO7A 2WXLA 4QOIA 2ZSBA 4E5PA 1HSZA 2IYLD 1TFRA 3FVWA 1QC5B 2NMVA 2HWUA 3OP1A 5KO2A 3FPFA 4ZK6A 4TRRA 1GAJA 3KKOA 1EFRA 2I29A 1YVDA 2EYUA 4O4LF 5DHUA 4UQLA 1T2CA 2KBFA 3GOEA 4FA6A 3KKZA 4DLXA 4P4LA 4C0WA 2X9QA 3Q7QA 3V46A 3EG9A 2VT2A 3AKYA 5FUVA 3V32A 4Z3KA 4DRXB 3UV7A 2V3SA 1ZBQA 4AJ1A 3ZWYA 2AYOB 5TPZD 3Q2IA 1KJWA 3BULA 2F1RA 4OU4A 3F97A 1HY3A 4O3MA 3EHVA 4HO1X 1AT1A 3CH5A 3WKCA 3OU2A 3DVSX 3MCVA 1SJ9A 4CKWA 2YZ3A 2EF1A 1NQTA 2B78A 1XU4A 3E4DA 1ZGAA 5CFZA 2F1OA 2C3YA 2ZIAA 1U28C 2ERCA 1KLGD 1WM3A 4C1NA 3NI2A 1MN6A 3VM6A 3OM8A 1RM5A 4LXTA 1UH6A 3RJMA 5JFOA 3LBHA 3PHWB 1R4NA 3AONB 3EXEA 4MEJA 2FAXA 2XTAA 1JPNA 2BD0A 5HX7A 2Q07A 5IG2A 5AHKA 3RYFA 4AWXA 4Q5IA 1SZPA 4MKRA 2FKAA 2ZU0C 1A8IA 1ZXXA 3THWA 4Z7OB 2D06A 3CVXA 4LZPA 1HE2A 4M8LA 4RVFA 1C14A 1N63A 3ZHTA 5K3OA 1TM3E 4W8OA 4QPCA 3RS9A 1P19A 3BAFA 3H1FA 1TADA 1DUIA 3RT9A 3EH2A 1SBIA 5H16A 4OZBA 5DVZA 2GB4A 4MSUA 1M1XB 2WMDA 3QHQA 1M2VA 4FVTA 3PX7A 3KB1A 1FM0D 2A30A 5JBIA 2SAKA 3U2SC 2CGEA 2JVJA 4MO2A 3RLFA 2BKUA 4N0EA 2AN9A 2O8FB 5H80A 5JATA 2YQ4A 2GMWA 1WNFA 3W5HA 1AHPA 3IGFA 3IUPA 3INRA 5DOZA 4LC9A 2FNAA 2JFFA 2IJGX 4TUUA 1Q7CA 1F2DA 1ML4A 3IBSA 3T35A 4LDNA 1VL0A 4ER6A 4JI5B 1NW8A 2FE8A 4O2BF 2PU7A 1RAAA 2GBJA 2C9CA 3OY7A 3RKUA 2BFAA 4LJYA 1X8LA 1EM7A 1HTTA 4HV4A 4R9RA 2FEMA 2FMUA 1XLNA 5D6NA 2D74A 5IANA 4U3JA 1MPXA 3HH8A 5E3IA 1K2VN 2KWVB 1JU4A 3AJAA 5JSHA 3TRIA 4EG4A 5BUQA 5CD1A 3HRDD 3IVGA 4RNAA 4DZRA 3AHCA 1A97A 2A58A 4P3YA 4FCTA 1ZBDA 3SQNA 2WHGA 1GUAA 3MCUA 3LWDA 1L7PA 5ANRB 2WJWA 3P9QA 3H4IA 3EMDA 2OZLB 5JWHA 5K4AA 3GE3C 1E8ZA 4C4PA 4OJQA 1N78A 1IVYA 3R24A 2CXPA 2WJAA 2FMXA 1IAVA 3LMKA 3IQHX 3TQHA 1FUEA 5FNVF 1H2YA 1N6LA 3V1NA 2OBBA 4UBNA 1BXRB 2G1UA 1WMDA 1LRKA 1N5RA 4E94A 1QOQB 1YRBA 4J4HA 3EGOA 4A6DA 4GOXA 2OV4A 4CUJA 5BN5A 2VNKA 3UUWA 1UANA 4GOMD 2C9DA 4FS8A 3SI7A 2VO1A 3MC9A 3OKCA 1PJ2A 4KXUA 2K2WA 4OZAA 3FCZA 4BN4A 1G8PA 4TKLA 3QNWA 2C2BA 3GT0A 2WFAA 2W9NA 2GN4A 2H48A 2CWDA 2WD8A 4P3KA 3RODA 1U2DA 3WGUA 3ZNHB 1XMQB 1TUIA 4I6JA 5FBVB 1QG2A 3HGQA 1B0UA 1QJ4A 3AJRA 1GB1A 2AFIE 1JH9A 2YN0A 3A4YA 4FYKA 5HSGA 1I30A 4FQ8A 2DHCA 2MP2B 5D5PA 1ULUA 3OLXA 2H5LA 4S1WA 2RGGA 3KFXA 2WPDD 4QXQA 3KXKA 3FI9A 3BN3A 4J0HA 1ZW7A 4ZANA 4PN7A 3E5HA 3PPAA 2YUIA 2BS3B 4FW8A 1OLOA 3ST7A 1Z4QA 2B2NA 4PAWA 5LC1A 1FPYA 4AUKA 4WCDA 3KUCA 3ZNBA 2PV0A 1E2DA 3P9PA 3WLLA 4DVGA 5BSKA 4D9CA 1PV4A 1L8LA 3IQGX 4ZIRB 2GKOA 2JFWA 3GG9A 1M6WA 3STVA 2Q46A 3IL2A 5ALDA 3Q0EA 4UUOA 4EB6B 4DCOA 4L1KA 5DX8A 2J0KA 1GSIA 3IX7A 5G02A 1O94D 4PYJA 1WE7A 3QLUA 4XYEA 4EY8A 1NE7A 5HTKA 3OFKA 1O95A 2AQ3B 3M3JA 1F7UA 3VPDA 4PYZA 1BOFA 2CB9A 1LD3A 4OIMA 3PPWA 2A9RA 5AKYA 3V1YA 1LV7A 1OTXA 1NRJB 1YNSA 1CX9B 2CL0X 3E53A 3ZTWA 4NY0A 1JG1A 4ICIA 1XTTA 2GYUA 1WZ2A 3W6PA 4MB6A 3L0SA 5EMHA 4E09A 3CUSA 3GJ4A 3ZNID 1I3NA 1NJSA 2PUGA 1WSAA 4ZA2A 2F43B 4Q4HA 4PZAA 1M1YB 5JZVA 3P9ZA 1GQYA 5L4SA 3F5DA 4XX0B 3DE0X 4BFWA 3WMXA 1QHEA 3ZLJA 4PHFA 3OE7A 4PSDA 1J70A 4IDNA 1R4MB 2CSXA 1IYFA 5AJHA 1E66A 4IDAA 4IVQA 1YJBA 1L7OA 4FOOA 1XNGA 3JZAA 4PYIA 1I7HA 1H2FA 4MKFA 3AUYA 2B4QA 3QXGA 1NVVR 2DPYA 4MPTA 2QRVB 1UJ5A 1HE8B 2ZANA 1UM8A 4X1IA 2HD5B 1E5VA 5DBIA 3BMOA 1AKMA 4BX9A 3HKEA 1L5OA 4QDKA 1M5UA 5BO5A 1PNQA 1QTIA 3G3EA 4F6RA 3E84A 5AHRA 2QJWA 3PP8A 4PQFA 4CMJA 5LMZA 3EXHA 2QT0A 4F5WA 3FUWA 3UATA 3IKTA 4LNAA 3PGMA 5BMOA 2QAGA 3GLIE 2ZRJA 1ZVQA 1AA9A 2V7EA 1MV5A 2JFYA 4C2BA 5TPWB 1OB2A 1X1CA 4YAWA 1BQ3A 1PZFA 1CZUA 2WXJA 2AG6A 3CRMA 3BVGA 4KO1S 4OATA 3QTBA 1IEWA 5KB3A 4PTZA 4IG9A 3QF4A 4L3OA 3STYA 2ZE8A 2VXBA 2CNOA 4BO0A 5E9QA 2ECKA 4TV9A 4B74A 3OAAD 1AK1A 2KWCA 2HU7A 2PYIA 2CFUA 2DFVA 5ED0A 2W2PA 3EC7A 3OOHA 5FWDA 2BI4A 2BMJA 4D0LB 5KUTA 2W0SA 2J4FA 1A82A 2DB3A 5K3BA 5BOVA 4WUTA 1E1QA 1NMQA 1X2BA 1PGOA 4RS3A 1V1RA 2V74B 2XYRA 4KXFB 3LUDA 1WZEA 4WBXC 3BG5A 5DV9A 3FAIA 1T4DA 5AVWA 1TEZA 5GTDA 3U31A 3JQ6A 2W0MA 4B40A 2VDWB 1HK7A 3LECA 1PUTA 4XE0A 2IGBA 2C2XA 5JG7A 4BNJA 2ONKA 3G2LA 2PZLA 3WNCA 4EHHA 5GJBA 1K4KA 3SEBA 4K6CA 1Y1SA 4ZAXA 3DO8A 2LFIA 2C7VA 2BSAA 3LLVA 2POQX 4GE3A 3GU3A 4YP7A 2QEDA 1E2PA 4XAQA 5KVSA 1GA6A 3OO1A 3FB1A 4A0HA 2UDPA 2OBXA 2P5TB 3ITKA 4ZOEA 5HFNA 3OEHD 3HM3A 2YASA 2A7XA 5CCBA 2F3TA 4BFYA 4BNWA 2VWQA 5CJPA 1IUOA 4LSMA 1LDGA 2DMRA 3QEAZ 2ONQA 3PO0A 3FNHA 2CJOA 2RH8A 2C00A 4OVZA 4KYIB 1WGRA 2PIDA 2V0GA 2MYTA 3SVTA 2QUAA 1ULZA 3JVZX 4MM3B 2II6A 2GCPA 2IOHA 4B4WA 3ZH2A 1RJWA 3JQ8B 4DW8A 3FOEC 4R2IA 3UCXA 4BPBA 4B6SA 3ZU4A 3TG8A 2Y8AA 2G07A 1G98A 3G1UA 4BZPA 1VZ2A 4C6SA 3CW8X 3IPYA 3AERA 1OLUA 3R5KA 3SLRA 3O9ZA 2JGRA 4XWGA 4J4TA 1UZUA 1ZO8A 5H70A 3VI3B 1DC6A 4IYRA 1WDTA 3EXFB 3MELA 1YB2A 2R00C 4YRCA 3I0ZA 4YAJA 1BW9B 1VMEA 4JHLA 3QE2A 4MUEA 3VO8A 3SFPA 3VTKA 3PKZA 1CJMA 1N25A 1GYPA 1XQXA 2F4VB 3A1FA 5SV2A 2JD0A 4NAUA 4JLVA 5I47A 1UDBA 5D86A 4LJOB 2PWZA 3JS5A 2ZVOA 3QG1A 2OD7A 3PFKA 3F1LA 3W3AH 3P4YA 4HNAA 3BWCA 1HLFA 4DHZE 4JX9A 2JGJA 2GBGA 5KNCA 4MRMB 2QY6A 3GHHA 5GONF 5A4KA 4GBJA 1O03A 2VPQA 4FINA 2GVNA 3CUVA 3BK7A 3PBKA 4F3TA 1IJFA 3CT4A 3LZ6A 1S3FA 5CGQB 3NNNA 4Y0AA 4BJ5A 2NV6A 2J0MA 4RKFA 3ASVA 2WVGA 3A6JA 4BFRA 1GEGA 1XO1A 1L5PA 3LA8A 2WWFA 1LDBA 1NAIA 1CZRA 2FW8A 1V3VA 1ZH8A 5DYTA 3C4JA 3DOUA 2Q28A 5AI8A 5BSGA 4HYEA 4WZBA 1Z0KA 4C1CA 1JG3A 1WMFA 3MINB 4H59A 5IZCC 1NBFC 2VHVA 1NWHA 1X1SA 1S2NA 4GI2A 3BBLA 3MLAA 4GU5A 4DJEC 3R5TA 4X20B 4C2TA 2HDOA 3TOSA 2ZQYA 1QZZA 4NCIA 4DA7A 1LRJA 4F4DA 2HHJA 3TIFA 2B82A 1R8XA 2Q6TA 3R0VA 1U3GA 3RUAA 4XB2A 5CFLA 1OEYA 4WCFC 5I5EA 1G291 1YMHE 1E3DA 1PK9A 3B51X 2DWPA 2ZSJA 1YDGA 1O1YA 4LHZA 5ECWA 3R66C 2NYVA 3BDVA 1L5FA 1DDGA 3P1JA 1SK9A 1T3GA 4QLOA 2G45B 3ERCA 3DLIA 3CW2A 1M7HA 3PEYA 3U7QA 3DJYA 1WF9A 1Z9BA 1R0LA 3RSHA 4RTSA 3LPAA 1E7MA 3JALA 5B3LA 3E7DA 5ALHA 4AY6A 1E6MA 2Z2KA 1R7SA 1I94B 3G5TA 1G20B 2ZYAA 3OJLA 1L5YA 1F38A 1Y5RA 4KG7A 3CN7A 1GVHA 3HR4A 1W1UA 2BTOA 4CIYA 1Y8RC 5A87A 2PZAA 3F49S 2Q6LA 3G2QA 4V24A 1PJSA 3NM5A 3AKZA 1KPGA 4H7EA 4Z5YA 3H2SA 2XTNA 2P7IA 4AV7A 5B7GA 2GRJA 4GPEA 3U7ZA 1MGOA 4IOJA 4DEVA 2D5GA 2WXRA 1L4GA 5G1OA 3M1YA 3DL0A 3MTQA 1H66A 5JAMA 3P7MA 3PDHA 3HFRA 2RSUA 1EK5A 1YS2X 3HSYA 2Z57A 4L6IA 3KNRA 4ZZ1A 2ZYUX 4AD9A 3G9XA 2IITA 4CMEC 4M9XA 3DBSA 4K6HA 1PZXA 2CT8A 2LRWA 1ISFA 2FIFA 2QUJA 3BGSA 3I45A 3AV8A 2AQHA 4UTXA 3ZIAA 2WYUA 4AROA 1WJNA 3EWSA 3URYA 4YCAA 3EUEA 221PA 2HA5A 2G7MC 1EJBA 2C4HA 4L9WA 1B1ZA 2VDMB 5L9AA 2LVOA 2NTVA 4P1BC 3TJZA 4X1YA 1CB7A 2CXSA 2O8CB 1E2MA 5LD2C 3E9QA 2ATVA 1LXDA 2Q5WD 3RYIA 3H2YA 1E32A 1POWA 1KAGA 3VZPA 3PHJA 2L18A 2V3VA 3COVA 1RP7A 1Z0IA 4MLZA 1G6Q1 1QVRA 5AICA 5ITSA 3GLHA 5HE9A 1MF7A 1ZXBA 4DLKA 2OILA 4J5HA 5F7OA 1J6UA 3PGKA 4CDGA 3BRWA 4Z7JA 4B8ZA 5GJCA 3M70A 2P40A 3USZA 3ET5A 3MWEB 4OI0A 1Q84A 3AYZB 1K5DA 4DA0A 4G65A 4CG2A 4UE2A 3QEKA 3LBNA 3PV1A 2Q3HA 5FBRB 4O4IF 5ILOA 1RLJA 1BXGB 2VZKB 2OUKA 3ILXA 2X8AA 2G9QA 4EG0A 2BKLA 2WTAA 2F8TA 1BEZA 4U6SA 2O2VA 2F00A 2ZRKA 3O7MA 5H5JA 4IMRA 3OQJA 4UU0A 2SBTA 3AO0B 1OFUX 3RU2A 5A6VA 2FUCA 2KHZA 2HU2A 3TZKA 3O03A 4DHJB 1IJKA 1YZVA 5H1YA 4PRKA 4X24A 1ZC4A 1FEHA 4YHHB 4D8TA 3QUBA 4RD4A 3TBHA 1PZEA 2IKSA 2J0VA 1UC9A 1F8YA 2FR8C 4MYCA 4K9RA 2Y05A 2ZIWB 2OPBA 1JCKB 2PKCA 3KTFA 1HYBA 4FLHA 2JVIA 1OAOA 2A5DA 1RLTA 3CMMB 1T9ZA 2M0XA 5CHVC 5AYVA 1S3IA 4EI8A 4MRNA 2OYCA 3NNSA 1I0ZA 4D4MA 1N2BA 3IE2A 4ZT6A 1RWOA 3SCZA 2BC2A 1QH9A 2IELA 1VKNA 1TF2A 1O4VA 3HXQA 3OPNA 1W94A 2FX5A 3HK0A 1I2MA 5TRTA 4B2IA 3T7EA 2LVBA 3EW7A 4HX5A 4OGKA 2R4TA 2Q2VA 1SE9A 5A06A 4YO8A 2OLKA 2ZIGA 1AU9A 3E0QA 2K0PA 2INGX 4K9QA 4I8IA 1HRDA 5BUSA 2HOQA 2BHNA 4ZPXA 1YV9A 2XXAB 3NRBA 4XKJA 4IRXA 3KH0A 4HGRA 4Y6QA 1AYFA 3GGPA 3V8PA 1GWNA 4ZAWA 3CXUA 4ND8B 1DUVG 4BLUA 1S5PA 3JQQA 3L5OA 4JQYA 4OPMA 3QHAA 4B9EA