4XWWA

Crystal structure of rnase j complexed with rna
Total Genus 182
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
182
sequence length
545
structure length
545
Chain Sequence
PAPTLEVIPLGGMGEIGKNITVFRYGDEIVVVDGGLAFPKAHQMGIDLIVPRIDYLLEHQDKIKGWILTHGHEDHIGGLPYIFARLPRVPVYGLPLTLALVREKLSEFGLQDVDLREVTYGDEVRFGQSFVAEFFCMTHSIPDNAGYILKTPVGDVLHTGDFKIDPDVGTGAGIVSDLERVEQAGKDGVLLLISDSTNAERPGHTPSEAEIARNLEEIIKGCRGRVFLTTFASQVYRIQNILDLAHRQGRRVVMEGRSMIKYAQAAQATGHMNPPEPFLTSEEVGELQDQQVLFVCTGSQGQPMAVLGRLAFGTHAKIALRRGDTVILSSNPIPGNEDAVNLIVNRLYEIGVDVVYPPTYRVHASGHASQEELATILNLTRPKFFLPWHGEPRHQINHAKLAQTLPRPPKRTLIAKNGDIVNLGPDEFRVSGTVAAGAVYVDGLGVGDVNDDVLLDRVNLSQEGLLILTAVLHPTPHVEVVARGFARPNRDLELQIRRVALEAVEQGLREKKRLEDVRDDMYGAVRRFTRKATGRNPVLIPMIVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural insights into catalysis and dimerization enhanced exonuclease activity of RNase J
pubmed doi rcsb
source organism Deinococcus radiodurans
molecule tags Rna binding protein/rna
molecule keywords DR2417
total genus 182
structure length 545
sequence length 545
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
A PF07521 RMMBL Zn-dependent metallo-hydrolase RNA specificity domain
A PF17770 RNase_J_C Ribonuclease J C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.580 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4xwwA03
3.40.50.10710 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Metallo-hydrolase/oxidoreductase 4xwwA02
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 4xwwA01
2NXAA 5A0TA 3A4YA 2BC2A 4F6ZA 3SW3A 4JO0A 2FU8A 5AHRA 2BIBA 4UAMA 2VW8A 5HIPA 2Q0JA 3BV6A 4Z60A 1BC2A 3SBLA 2Q0IA 3R2UA 4EXSA 2WYLA 2YNVB 2BG8A 4ZO2A 5K4MA 2AZ4A 5HIQA 5A5ZA 3IDZA 5A87A 4FSBA 2ZZIA 3AF5A 5DPXA 3VPEA 2I7VA 4D1UA 4UWOB 2QJSA 3F9OA 1VJNA 3TP9A 3SD9A 2YCBA 4HL1A 5ACTA 2DKFA 2NYPA 3BC2A 2Y87A 5ACWA 1XTOA 3FCZA 2GFJA 3RKJA 3IOFA 3MD7A 5EH9A 3BK2A 2NZFA 2P18A 4B87A 3IEMA 5KILA 3X2ZA 4FR7A 4EYBA 4RM5A 2BTNA 4GYUA 5K4NA 5EV8A 2YNTA 2WYMA 4C09A 5LLDA 3RPCA 2QINA 4D1WA 4NQ2A 4U4LA 2H6AA 4F6HA 5LE1A 3ZNBA 1YCFA 5ACVA 4HKYA 2GMNA 5ACXA 5ACRA 3X2XA 3S0ZA 2OHJA 4AX0B 3IELA 2YNVA 5ACPA 5EVKA 5K4KA 4J5FA 2FU9A 1QH5A 3ADRA 5K0WA 4C1DA 2XR1A 1SMLA 4RAWA 4UWRB 3KNSA 5HH4A 4TZFA 2BFKA 4EYFA 5FQBA 1JJEA 1WRAA 5EV6A 2HB9A 5B1UA 3IE1A 4C1EA 4EY2A 5LCFA 5LM6A 2I7TA 4Z67A 4RL2A 2OHHA 2FM6A 1ZTCA 2Q9UA 2BGAA 2FHXB 2ZWRA 3IEKA 3SPUA 3T3NA 2DOOA 4C1CA 4WD6A 4BZ3A 2E7YA 2FHXA 1BVTA 5ACSA 2BFZB 2YNUA 1WUPA 4NQ5A 1BMCA 2M5CA 4C1GA 3AJ3A 4FEKA 1QH3A 2R2DA 4AWZA 5KIKA 2OHIA 3QH8A 5FQCA 3P2UA 5AYAA 4O98A 1X8HA 4H0DA 3RKKA 3ZQ4A 1A7TA 3ZWFA 4TZEA 1VMEA 4YSBA 5EW0A 2WHGA 1DDKA 3G1PA 4D1TA 4YSKA 2GCUA 3DH8A 5AEBA 2GKLA 4UA4A 1YCHA 2YNTB 2BG6A 2BG7A 5IQKA 4EXYA 1WUOA 2M5DA 5LSCA 2I7XA 1JJTA 3I14A 4RAMA 2WYMC 4UWSB 2WRSA 1WW1A 1XM8A 3X30A 5EWAA 1X8IA 4UBQA 5AXRA 1ZNBA 5AXOA 2QDTA 4DILA 3I11A 2BG2A 3DHCA 3KL7A 4NQ4A 3X2YA 5LCAA 4D02A 1MQOA 4XWWA 4LE6A 4Z5ZA 3ZR9A 3KNRA 1JT1A 3I13A 4Z5YA 3VQZA 2Y8BA 2FK6A 3IOGA 2FU6A 4TYFA 4GCWA 5A0VA 4AX1B 3H3EA 3L6NA 5AHOA 2BMIA 3T3OA 3SRXA 1KO3A 2YNWA 5LMCA 4C1FA 3T9MA 2BG8B 3ESHA 1Y44A 2AIOA 4Z6XA 3Q6VA 4XWTA 5ACUA 4C1HA 5EVDA 4D1VA 5HIOA 4ZEJA 1L9YA 4V0HA 4CHLA 3SFPA 3FAIA 4ZO3A 1KR3A 1A8TA 5B15A 2QDSA 2BR6A 2NZEA 3I0VA 4EFZA 1DXKA 3DHAA 4DIKA 3PY5A 2BFZA 1DD6A 4KEPA 3PY6A 3PG4A 5FQAA 3DHBA 4RL0A 4PVOA 4TZBA 5HH5A 4ZNBA 1KO2A 1HLKA 4NQ6A 2BFLA 2P97A 5LS3A 2ZO4A 1X8GA 4AD9A 1YCGA 2QEDA 4BP0A 2A7MA 1VGNA 4UWPB 2Y8AA 2CBNA 2Q42A 1ZKPA 1K07A 2GFKA 4EYLA 5HISA 3JXPA 2FU7A 2P4ZA 4Z7RA 4TZ9A 3AF6A 5EHTA 1P9EA 4P62A 4RBSA 2UYXA 4HL2A 3LVZA 4GYQA 2P1EA 4KEQA 4YSLA 5ACQA 3BK1A 1M2XA 4J5HA 3IE0A 4XUKA 1E5DA 3I15A 4TYTA 4PVTA 2ZNBA 5EVBA 4AWYB 2YZ3A 2XF4A 5HH6A 5B3RA 3WXCA 5LCHA 3IE2A
chains in the Genus database with same CATH superfamily
1HFEL 3ORQA 4AKSA 2D54A 4MVJI 4ASUA 2ZJBA 5CM9C 3QHPA 4MRRA 2VYND 2VAMA 4DK5A 1ZK4A 1M75A 2IK8A 2RH8A 2OG2A 2XIQA 1PFWA 4NQKE 3IG3A 3PZDA 3BF7A 2V7PA 4WTOA 2Q41A 3QVSA 2V7EA 4N58A 3B5JA 3HGMA 3LDZE 3C5VA 1TFRA 1UFKA 3E15A 5DGHA 1O58A 3VGPA 4BAZA 1F7VA 4C7BA 1VKRA 2WIDA 4BLUA 1DYQA 4HWSA 2Q0JA 1DOXA 1GCOA 2Y0PA 4IEEA 4DV2B 4AY2A 1W96A 4Q9IA 2G09A 4NULA 1MGOA 4AK9A 5LMZA 3LFTA 5KTRA 7REQB 3V6CB 2VJLA 4NL4H 3MT8A 1O08A 3VNSA 3TRKA 1ZIYA 2FPXA 2IS2A 5KJFA 2YHUA 5EZ5A 8OHMA 1C3OA 3D8TA 3ZZ1A 2Q1UA 1YV9A 4TSFA 5AM4A 5ICSA 2GI9A 4QXAA 2C3OA 5BYJA 4ZJUA 4WACA 4G24A 3SQLA 1VHJA 4K5QA 2QYOA 1N7IA 1UMDA 3BMOA 3F4KA 4KUGA 2VBIA 1C3LA 4WOPA 3RREA 4IQFA 3LG2A 4JODA 3WKEA 4BP9A 3GPCA 3UPTA 1EFCA 2JIMA 3Q7QA 4KLCA 3TWOA 3L6OO 2BFWA 1QHEA 2VJKA 1R2QA 3L0WB 3LC1O 1W44A 3OTQA 1RRFA 4J3FA 1K92A 3UT0A 4FC6A 2PZFA 4MCJA 1NMXA 1OA1A 3P9RA 4OQQA 5I51A 1Z0DA 5JASA 3FTDA 1LK5A 4Z4HA 2G08A 1UEIA 3KBBA 5C7IO 1W0KA 3S8MA 5FUYA 2VJCA 5KYNA 4B3MB 5FOTA 4YUAA 3PUYA 3WLIA 3I0MA 4R3UC 4UPDA 5T4EA 2JFUA 4GBED 1T9ZA 3SIWA 3R4CA 4YRBA 5JSHA 4CEJB 5HVNA 1PYGA 1IM2A 1IUNA 1L4MA 1VSUA 1H2AS 2A14A 1V7ZA 2QGFA 2Y1DA 3R3HA 4NCHA 3U40A 1NJ5A 4U2DA 4TKLA 5DHQA 4B3JA 2HO5A 5HCIA 4OFXA 5EH9A 1TJ3A 4LJ9A 4N0EA 4CM8A 1V8PA 1X74A 4LRWA 1L7BA 3A3OA 4I14A 3AFOA 2X0KA 2D8MA 2I4NA 3O82A 3HUDA 1QWOA 3PC3A 4E33A 2CL7X 1JFVA 1Y3FE 1WUYA 1F9JA 4HN4B 5IULC 3ZGLA 2OXIA 2VC2B 4PGFA 2WD7B 4WJKB 3KQTA 5BN3A 1M1UA 3R7RA 5FFNA 1SOVA 3FTNA 3NDIA 4N12A 3FAHA 4D26A 4UUAA 4NPHA 3WFIA 3Q3IA 2JH9A 2X2PA 1VJRA 1BDMA 2M1ZA 3R0VA 1T4CB 4BAGA 4B71A 3BQNB 3C7DB 3JQCA 5G3ZA 1PR5A 4OJNA 4JLKA 2BGRA 5G4KB 3FOEC 2QPLA 4FFPA 1E62A 3D7SA 2GZ1A 3BXFA 4KXVA 3VVMA 2HC9A 1L8AA 2PGXA 4PV7A 4POAA 1XXHE 2QP3A 4AJOA 4BO6A 1IYZA 5CA1F 1K4YA 1KK1A 1W5AA 1YCFA 3AULA 1PT8A 2Y0EA 3B53X 4Y2SA 5ALRA 4ANXA 3PEUA 1UUPA 2AG1A 2CXXA 1XXGA 2B21A 4Q3BA 1QG2A 4RD1A 1FUYB 1PP4A 2BGTA 2G36A 2NU9B 3SHOA 4DDUA 1L7NA 3CLRD 2R1TB 1LF0A 4G85A 2GSDA 2XNJA 5F9FA 2LGYA 2WZBA 4KZCA 2UUOA 2QHOA 1ZH4A 2AJDA 3L7OA 2FNJB 3WDLA 1EXVA 5LUBA 3LBHA 2R68A 1NN3A 2CUNA 3DV0B 2FR1A 3V4SA 2IHVA 1SG0A 2AOWA 2JAXA 3PGVA 4OQPA 4NMXB 4JCCA 5K4KA 1TKRA 1OU0A 2BM0A 5J23A 1GP2A 3D2AA 3ESRA 1BQEA 3OKAA 4II7A 2FY8A 3SXJA 3L84A 2PNFA 3QVGA 2FFQA 4XAQA 4H1UA 4ND8A 4Y98A 2WAMA 2HZ7A 2AQ8A 4HXFB 3VHRA 2FW1A 1JBEA 2CXTA 4IH4A 2ZRJA 3PLVA 1JXQA 1Y8RA 2XXBA 4LJ5A 3U13A 2L05A 3P7MA 4HB4A 1D5ZC 1QLJA 1ORTA 2WHXA 3CCFA 4K40A 2VCHA 3A3KA 4Q7JB 2PPLA 1ZXBA 3TMKA 4F9EA 4CBVA 2GKLA 1Z7WA 3QKSB 3EIXA 1RFGE 2CY0A 2PU5A 2VKQA 1JFSA 3RC1A 4C7MA 2RJ3A 5ALYA 3NTVA 1GG2A 3TNDA 4BVAA 5I7EA 5KOJB 4QRDA 4EKYA 1KXZA 1ZQ1A 4WH0A 1QDEA 2AJCA 2H7XA 3TTXA 3WGKA 1KBZA 3QE9Y 2CJPA 1XEEA 1EVLA 1GPBA 1Q74A 2VR1A 3KELA 4L75A 1ZD5A 3KUXA 3NBZC 1E4EB 4QPCA 3KZVA 3ZHOA 3ZWWA 4POOA 1DX4A 5EHXA 2WSBA 5JALA 3DKVA 3N7AA 2WIAA 2HTME 2Z5GA 3P9IA 5BQXA 3T8MA 3PSAA 5KPDA 1EFRA 3AFHA 1JDSA 1QOAA 2HJRA 3AG5A 3CYFA 3EMBA 1EE1A 3JARB 1T1JA 4LOAA 2AKAB 4TQUS 3VTZA 1D2EA 2FR8C 2EYUA 3P0EA 3VOTA 4C3ZA 4H2AA 3CF4G 2N75A 1X2BA 4IFIA 1GQFA 5LDGA 5F7XA 4RPLA 5JEEA 5LXTA 5MN5A 4XZ4A 2FHXB 3URMA 1H1LB 1XYGA 4EUNA 2XUPA 1PJLA 3EGOA 3HY4A 2WYVA 5LYYA 1IDN1 3DWFA 1G2IA 5J2RA 2WHQA 2WXHA 2ZTLA 1VJ1A 3L0BA 5CRIA 4UTXA 1NVEA 1QHHA 5PNTA 3A1CA 1A69A 2FPWA 2FF5A 3D6TB 4BZ3A 5FWXA 2AL3A 3SF0A 3MWFA 3V6LA 1SAYA 3G5AA 4Q9HA 1U2SA 3LVRE 3NOVA 1P9DU 2DWCA 4OZCA 2FMIA 2VHZA 1G8YA 1QHXA 2BGIA 2VSFA 3INRA 3IQXA 2IHJA 1XLTC 1KS2A 4JLAA 1ZEJA 1JIVA 4AN0A 3QU2A 4L9WA 5E8JA 4PG5A 2QNIA 5IBPA 3UV7A 1HTBA 4QTYA 3ETGA 5KSOA 3RQSA 3SAJA 2MR6A 3V7WA 4OZBA 2R3SA 4X1YB 2C9YA 3ESBA 3QEBZ 2FPGB 4KFCA 5G0VA 5TXGA 3TSAA 2PKRA 1L4FA 1GPDG 2NTTA 4B95A 1P19A 1GZUA 1Z4KA 3KSDO 3OJLA 3OJXA 2QI9C 3RFFA 1AB5A 1ZMBA 1EFTA 1VSBA 2PFKA 2VLBA 3GO4A 4BRSA 2WJIA 1PT7A 2OHIA 2NUPB 3L8EA 2G70A 4UFPA 3P2UA 4Q3DA 3V2UA 4OREX 1T1SA 4AMGA 4PO9A 4E32A 4TYPA 1NW9B 3AHHA 2V5UA 3DBRA 4GI3A 1NVGA 2FJ0A 2YWRA 3DMTA 3L9WA 3OU2A 4UVHA 4B7CA 4ZGGA 5IF9A 3UAXA 3FTFA 1E7QA 1I1HA 3NV9A 4PZEA 2DFVA 1A70A 2RKBA 3NHSA 2GN1A 4C76A 1Z12A 1YQDA 1FB5A 2YWXA 2V3PA 1N6HA 2DTEA 1TYDE 3HG7A 5F1PA 4ODIA 1MX1A 1OYYA 2LGSA 5A71A 5AM2A 3K96A 1TUGA 1OTHA 2HK7A 3AEYA 3HYTA 4RPJA 5E2AA 2PUFA 3GD5A 4MVJF 1NVID 5LWQA 1CEEA 1U0RA 5G5GA 2W3RA 2AX5A 3H2KA 3GPBA 3II6X 1JB9A 4O4JB 3DNMA 5E8RA 3VU9B 4EECA 5BWOA 2PH5A 2Q0QA 3MLAA 3VPBA 1US8A 3HH8A 3KKQA 4GKAA 4TV9F 4RIGA 3PT5A 4MW5A 3UJAA 3VYSB 2P41A 2CFSA 3MBIA 2BG6A 4JP1A 2R1VB 4ZRQA 1DC3A 1MOQA 2XEDA 4IGIA 4TLEA 4NAUA 5DYGA 3W04A 4V1CA 3WLHA 5DMXA 4QXQA 3DQZA 2XYPA 3BQ9A 1I14A 1OI3A 3SQXA 2HRQA 3FNGA 3TINA 3WMRA 2YFYA 4ENWA 4NHEA 2PZGA 2CSXA 4DCGA 2J1LA 2B2CA 1YZGA 3P9NA 5HTOA 3V42A 2CLLB 3VR2A 4C4XA 3TEXA 4RAMA 5CCBA 3EFHA 2NV6A 4JI4B 2XA9A 3GLVA 1Q0WB 3KTAB 2NPTB 1YB1A 4FEAA 3ZU5A 4X9XA 2EBUA 1PZNA 3NJ8A 3SC6A 1CY1A 5CCDA 4O4IA 4LXIA 2UZ0A 4QDXA 4V0OA 4EM6A 1O87A 1WVIA 2ZUUA 1FZQA 1R3DA 3KT6A 4JLCA 2O6LA 2Q9AA 3VR8B 5DXAA 2P3LA 4UJ5A 2FHPA 5HDBB 3MRVA 3MAGA 4J43A 4J3NA 1BFDA 1RADA 1A5ZA 1E2NA 3T9CA 4RS4A 1BCRB 1BN7A 1TC1A 1EJ6A 1FD6A 4HP8A 3DHCA 2VAPA 2CLOB 2O3QA 1L3CA 2BSXA 4G8JA 2XZLA 4NQ5A 3FAKA 4AECA 3HXOA 2DU8A 2FQYA 4MV5A 2CNDA 3P1JA 3K53A 3RVSA 1N77A 2WHIA 3Q8LA 2WFMA 4X41A 1UPXA 1FJXA 2E1RA 4IJ5A 4N47A 2JZ3B 1G2OA 2OKGA 1DRJA 2V3WA 3EIEA 4N01A 4YHHB 3AEGB 4QWWA 1ZKMA 4FZRA 2UUPA 6CHYA 1PJ3A 2XB9A 1JWMD 3WY9A 4EA8A 3MJWA 5GZ3A 4XWWA 1XQXA 5JZOA 1D2MA 4QUHA 1BKDR 3BERA 4YASA 5FKAC 4LZAA 2O06A 2B1JA 4MITA 4JCOA 1U0EA 1FXUA 3NYRA 5FOWA 2XCLA 3GOHA 4OVVA 4A10A 2B7BA 4Y0VA 2Y8BA 3LO5A 2EQBA 3FKYA 2RARA 5JTUA 2W2TA 3Q7SA 1I4WA 3WNZA 3IO3A 1VCHA 1EPUA 1PDWA 4PLVA 4IEFB 4M87A 4U2KA 1XCOA 2C5EA 1T36B 2V7VA 5DW0A 3H5LA 5AFSA 4KQGA 1PUIA 3K6RA 4TKUA 3L6NA 5GVSA 3DAHA 1RE1A 2GK7A 2WJ4A 5DM0A 1UJMA 2Q4RA 1D1PA 3F9RA 4GQIA 3ZYYX 4YONB 1FRVA 4GMVA 4WKOA 1Z83A 3RJTA 2OQIA 1MI0A 1VSQA 1DINA 3P26A 4G07A 4N7BA 2DOKA 5K51A 3KV1A 4A03A 5I48A 1YMQA 2JI8A 3D7KA 1JG4A 1KI6A 2J6CA 3G3EA 2NV0A 3CRMA 3HBFA 1QCYA 3DOWA 1BWPA 4GMFA 1V2YA 3MCWA 1J7CA 4R6WA 4B8ZA 4CV1A 4CXMA 3BD7A 3NVDA 3TR0A 4D3FA 4OOFA 1I4RA 2A4ZA 5D01A 1UXKA 2C2BA 2WJPA 3E9NA 1KO4A 1ZN7A 4LISA 1Y44A 3NCTA 4Z6XA 5FLKA 2CNOA 4IJVA 3PEYA 3SS8A 3ZCRA 1OXMA 3WQSB 2Y1KA 1IIRA 2Z4TA 1BXGB 3S99A 4A8PA 1R3UA 2D2XA 1YX5B 3GCZA 3RK1A 2ISCA 2Q5HA 5JJIA 3DZJA 4PHFA 3L16A 1WQ1R 4IJWA 3DM9B 2LCIA 1NLUA 2VTKA 2XUKA 5ES4B 3K70D 2NO5A 3O8BA 1YOVA 4PAMA 2H4XA 1Q5WB 3ST7A 4OMUA 1GITA 1NW7A 3Q2OA 3ZU2A 5LZ9A 2K2WA 4V0HA 4G0PA 1KQNA 1UJ6A 1Y37A 1RW4A 4P4LA 3C3YA 4YV2A 3UJ6A 4JL9A 1JFRA 1GDDA 3B1YA 3QYFA 5GONA 3RYHB 3STVA 2H31A 3HC7A 3PC6A 4BV8A 5KNDH 1ZI9A 4J0DA 2VNKA 4WAUA 3VNRA 4YSXB 1C9DB 1SC6A 3W5CA 1WCV1 4EMTA 2MCFA 1ZGAA 4YV7A 3Q2AC 3NWJA 1I7DA 5FR1A 2QEQA 4TXMA 1YZHA 3GDOA 2ZDQA 2GPYA 1PZMA 2I80A 2FPGA 1LSJA 1P2GA 3EWAA 1AXRA 3K72B 3IGFA 2WAOA 1Z73A 1MPXA 4NU8X 2CVQA 3IEXA 4Y6OA 3FKSD 1G8FA 3FH0A 2QDKA 4TV8B 3S0JA 3TRJA 4G97A 1DD6A 1XU7A 1GG3A 4CUJA 1U3VA 1UDCA 1TM7E 3DYVA 2FW8A 3AOEC 3DP9A 4A8TA 4K9LA 3AYZB 4LOLA 5FV7A 4RCYA 1OVGA 1VSTA 1W4ZA 2QQ5A 1JIKA 4D74A 3IIIA 1JDZA 3V1LA 5IJ0B 1J0AA 3V3XA 3N5CA 3FZYA 3R40A 4LY6A 3Q8EA 3HZOA 4MPTA 5E1DA 5JADA 1CQWA 1R4AA 3EC2A 3HN6A 4KWCA 1ZN2A 1O9HA 1C2YA 5F5LA 4IMIB 4X20A 1RWKA 3RSQA 4CMCA 4NQ6A 1YDGA 4JB3A 1MH1A 1PNVA 4XEUA 4AJJA 2AC4A 2QV0A 1GZDA 2D5AA 1VR9A 1ZW7A 2IKQA 2XLBA 3OU6A 1N2XA 3MC9A 2FCRA 4JJ4A 4KFTA 4L7QA 3STYA 1C3XA 2O1SA 3DMRA 4TV9A 2BGUA 2F1IA 4GOCA 4DR6B 1XKLA 3GNLA 1X7GA 1JDNA 3G23A 2LVPA 4GOXA 4L1KA 1BD3A 5AZHA 1A8QA 5A5FA 5K0SA 4H59A 2ZPYA 4ARZB 1ODTC 2BCJQ 3KB8A 2W9NA 1FMJA 3F71A 1T6YA 4C88A 4PN7A 4F56A 3CLUC 4ASWC 1I36A 2VHVA 3NDPA 4JL5A 1T4BA 3M0EA 4BVGA 3WIDA 5JCZA 4RBSA 3KOUA 3NUQA 2N9LA 2K8BA 2R5FA 4LECA 1C8LA 4W4TA 4PANA 3LVZA 4BKGA 3K71B 2DAPA 2ZBUA 3IBSA 4L78A 2SAKA 4Z8XA 5K7SA 1TQ2A 2BHSA 1FCCC 3JW0X 3AY3A 1GCUA 3QIJA 3OEHD 1UPUA 2PMBA 1QHNA 3WRXA 5CBKA 4B3SB 2FQ1A 3LT1A 1R4ZA 3RYHA 1IMJA 2IYWA 5J47A 1NLFA 3O95A 4F85A 3GG9A 4HB0A 1AKVA 3L3BA 1U28C 2BGLA 2BHNA 5K99A 1B4DA 1JIJA 2RHCA 2FWRA 3ABRB 3FWNA 1XLPA 2QXYA 3A58B 4WVFA 5LR6A 2NPFA 3TNJA 5LSAA 4YRAA 2IITA 1THGA 3L10B 1DO8A 4Z7NB 1M6HA 5G2NA 4C29A 2NTEA 4KR2A 2PX4A 3GNSA 1UWLA 1B76A 1WMBA 2BT4A 2OG1A 2ONJA 5EP3A 2ZSAA 2W6IA 4C0AC 4DXAB 2HNKA 5IANA 1NP7A 3RZWC 1IQ0A 5JPCA 2IXEA 3ENZA 1TYCA 2H4YA 3AUTA 2INCC 3EZYA 3U62A 3UW3A 1Z4NA 2NXAA 1JFLA 1OZGA 2QQFA 3HI6A 5BPFA 1ZUWA 4XB6B 3NBQA 1XL0A 4HPMB 1WAMA 3ANYB 3IUQA 1UZXB 2H48A 4M0KA 3VU3A 4GYYA 3SW3A 4MARA 5BN5A 2O0MA 1ZN8A 1ZUNB 2FU5C 1EJBA 3MMXA 2AV6A 3OFVA 4X44A 1I4TD 1P72A 4DLUA 3UPDA 2WJGA 2IU3A 3D2BA 3G9QA 3PK0A 1V48A 2YASA 4HQFA 2GLUA 5D6NA 5REQB 1GUDA 1E6CA 1XO1A 5HIPA 3B70A 4CF4A 2RGWA 3RAEC 2GB1A 2GXUA 2OY0A 3O4HA 4L0CA 4IXWA 4F46A 1KTKA 1FSGA 1O6ZA 1H4TA 2D5IA 2FX3A 1DKPA 2ZZKA 1QNLA 1LLFA 1I6MA 3G9ZA 1TEXA 3TF5A 1LPMA 2LV8A 3T4PA 3E81A 3UJHA 3SBDA 6LDHA 1Y81A 3G0OA 1ZOOA 3OJFA 4L08A 1AUVA 1GILA 2F3QA 4O4LA 4B43A 4IH9A 3A6PC 3EOZA 4QZVA 1RYZA 4PLHA 3I9JA 2ZUTA 4FWBA 2PM8A 3H6KA 4FGZA 4IOMA 3KK0A 4W9NC 4ZTUB 1E9RA 4ZO2A 3KTOA 2HDNB 5BOSB 5I9LA 4L2YA 2ZZIA 1Y6JA 3A4NA 4DR5B 4FFBB 1I4PA 4K7WA 1T5IA 3EVNA 4J2OA 2ZNVB 1LY1A 3H5IA 1V86A 4XX5A 1N5JA 4JA2A 4M1ZA 3ENQA 2ECPA 3QARA 1VMKA 4LK3A 3JQ7A 1UODA 2DBRA 2NMQA 1XQYA 2GSWA 2H51A 2JGDB 1ONBA 3TLBA 2IZ1A 3STTA 2OHVA 4MWZA 1AT1A 2UYGA 3SCZA 1WZIA 2ALJA 2AJLI 4IL5A 1KAGA 3C8MA 2NUPA 3IP1A 4LX0A 2QBYA 2A9FA 4H31A 3ZNOA 4F45A 5LVAA 3G5TA 3IUPA 2WY2D 1RPZA 1Z4JA 1N61A 3EC7A 3IKMB 5AOVA 3NY5A 4LBVA 1E2JA 1EM8A 4GVPA 2C2ZA 4YAJA 2JL1A 3ROGA 4WH4A 1AXGA 1XTSA 1R9GA 4RPGA 4X1YA 3F74A 3GLHB 4LFAB 2VPYA 1M0EA 5TGDA 3GIWA 4OMDA 4DIEA 5EMHA 2VYQA 4ERNA 5JU6A 2Q5EA 4AWAA 3KU1A 2B6NA 3J7AC 1Q6ZA 5F1YA 1I4HA 1U31A 4AJYB 1YDMA 1J9ZA 1Y5NA 3A9WA 1SC9A 2E4YA 5HS4A 1FYVA 1I33A 4Y3UA 5K0BA 1OB5A 2Q8PA 3BIXA 3PP8A 1M72A 2WD9A 3ADKA 3EGXA 1QH1A 4RK6A 2CFUA 2GHQA 4KUHA 3VH3A 2P9CA 1T10A 2CB9A 3D6JA 1WUJS 1FSSA 3QEJA 4G8DA 4JLMA 4YCNA 3C3EA 4BHTA 1I9GA 1X7XB 1CG6A 1ZNYA 2V5VA 3F8TA 3LYAA 3SEFA 2RKOA 4O4JF 5EA2A 3ZWPA 4YMUA 4W9FA 2CDAA 3IUMA 3IMKA 1NURA 3C6XA 5L7YA 1PGOA 3FLBA 3KDSE 3NM4A 5BUCA 2JRCA 4G8CA 2WM8A 2J42A 4BQRA 3Q3VA 5DK6A 3OEYA 1ZPSA 1WGGA 2QTAA 3CLRC 1WWKA 2DPXA 2D3TA 2JCSA 3E03A 1ZGCA 2XDQB 3GFRA 3QBJA 3QLVA 4MR7A 4RZHA 4WADA 2GPAA 4Y67A 3V5NA 3ZNBA 3AIMA 4IIGA 4KU4A 1M6YA 1MQ9A 2W22A 3B3GA 1E1DA 1L5OA 2VRCA 5LQCA 1DXHA 1W5EA 2UZ1A 3M1YA 1W35A 1A04A 2VUHB 1L7VC 2HSGA 3K9GA 3PNOA 4YRLA 3U37A 1TBEA 5KOJA 4XRGA 1RYEA 2XDQA 2I2XB 3HVKA 1TJNA 2AXQA 5IC5A 3SU8A 5IOIA 5A4MS 2FPSA 4IO1A 1G20A 1DC5A 4QPDA 5JJKA 1IZ7A 4KYTA 5FO0A 4EVIA 3Q8MA 1KDRA 1PJZA 3UMVA 3L9XA 1PX0A 1V95A 4DQVA 1TL7C 1STOA 2W2PA 1NW4A 1QX3A 3IULA 3LQ1A 3VAYA 3EB9A 4PXYA 4L4RA 2OBFA 1NNLA 2LIVA 1E2DA 1Q83A 2IYZA 4KE6A 5BPHA 2OLKA 4KJZA 4M9CA 2X5KO 4NABA 3EMDA 2YZGA 3ROEA 3L7AA 4DV1B 1AS2A 4PLYA 2G63A 5DYYA 3RZFA 2Q7XA 2KXJA 2ZJ0A 4S0RA 3KSBC 2ZWOA 3RLIA 1AQUA 1LPPA 1OVMA 1D2CA 3KVVA 3UUWA 4CLOA 1UJBA 1RRBA 3WL5A 4ENSA 5IJ9B 5IVHA 3TUZC 1WPRA 4LLGM 3C98A 3UAZA 4K3BA 2GAOA 2JHGA 4IWQA 1EZ1A 4NX2A 4F4IA 1K53A 2ZE7A 5DNUA 4RJLA 4IUMB 3W2EA 4D46A 8ADHA 4OK6A 4B9KA 2FVXA 1R4NI 3D1JA 3IQGX 3AP2A 1WXEA 2CWWA 4HGRA 1EGAA 4R83A 4AS2A 4AKIA 5CEJA 3UVEA 3KNZA 1C1DA 1R16A 4HDOA 2IZZA 4GI1A 4UMVA 5FWDA 3Q7IA 3QPDA 4QEDA 3UYKA 4WOBA 3KE8A 3ZXYA 3WAGA 3B1ZA 1X77A 3ZZ0A 3K5PA 4LV5B 5JAOA 1D5XC 3T1YB 4MUKA 3NBUA 5L6LB 7MHTA 2Z2ZA 4HRXA 1HFKA 1JEQB 2AZTA 4PX2A 1A9SA 3LX8A 2ORED 3OIDA 4MXDA 5JQGF 4GPEA 1EP3B 1H4SA 1PFKA 2HA2A 2MHJA 1ULBA 3EX7C 3T95A 1I7QB 1XLUA 3QVWA 1FX0B 4DQOC 3INYA 3A0UA 3ZVVA 2EX4A 4UNRA 1Q3HA 5KNBH 1AVTA 1BMQA 1PZGA 1Y4UA 2P0YA 1BW9B 2JGDA 3ND8A 3OLQA 3QI7A 5EZSA 5F2OA 5FPQA 1TUBA 2QMUA 3WA6A 1T4CA 1RNLA 1V16A 1H6CA 4LGVA 1OH8A 3QEKA 2LRWA 5LBUA 4DCNA 3LDHA 1XCGB 5H81A 1P2SA 4KFRA 3KQHA 3BYYB 3ZCXA 4FNGA 2A59A 3A0RB 1W7AA 2O59A 1C14A 1MDFA 3IX7A 3MTDA 4H3VA 3ZR4B 4D8YA 1KHTA 1S3GA 2QVYX 3OJWA 4MQUA 4WCFC 5ARDA 4BLWA 5HS6A 3KR9A 1ESCA 2R7KA 2QN2A 2B25A 3L1UA 4AZ3A 4BGDA 1W25A 3OPMA 4KH1A 1O4VA 1BTOA 3H13A 3A14A 5BV0A 3HQ4O 1Q0HA 3GP3A 4O4LB 3KVOA 1JYEA 4IKOA 1S2OA 1DAGA 3HCFA 2BISA 4IFEA 4Y1GA 4KX6B 3QMVA 2C2HA 1QP8A 2GWRA 3TKAA 2FCNA 1U0OC 1ECCA 1FJHA 1G5RA 1U7HA 2EQAA 2G1KA 3PBKA 1JW9D 4GR4A 4PSUA 1UJ5A 5G1PA 3TPFA 3VH4A 3SS7X 1PR6A 3LXUX 4F6LA 3WGIA 3NMUF 2O8FA 1NASA 3H3XA 4WZZA 3NT2A 3L0DA 4AWZA 1AKUA 5EIHA 5KJ6A 1EEXB 3NBKA 4ZU3A 4S2EA 3SVZA 3L08A 3KOXA 4RAQA 1A88A 1U9ZA 4OJMX 4K6MA 4QD3A 1NU6A 2GJ4A 4MVJE 3A6GA 5U1PA 3SP1A 2AEJA 4ZHSA 1K9VF 4FOPA 3OTOB 5GWXA 3RUEA 1TK9A 3ZN2A 1QR2A 4HN2A 5DSTA 2A8YA 2NVUI 1BA3A 3QM1A 4UDOA 3W8FA 4EYGA 2IZ7A 4E70A 3A1EA 1P73A 1SQGA 1HA3A 3UCXA 5B5SA 1VMEA 4TUYA 2IEAA 4MEMA 4FSDA 5EQDA 5IM4F 1XV5A 5EW0A 5AIAA 2R751 1P4JA 1SUBA 4PLWA 2FQXA 2K6DB 1JR3E 4H4CA 1VE6A 3ZIUA 2L0TA 4ZYZA 4FJ0A 2VHWA 4MI6A 4P1BC 3ER9A 3F7NA 2BOVA 3SJZA 4GMXA 2RBKA 1AGRA 1XA0A 2EZ9A 5ALLA 4RHXA 3QOFA 3VBEA 1J8VA 4MJ3A 1ZVKA 4Q03A 1J8QA 1E3JA 1WCWA 3Q10A 3WGUA 1QHGA 3G1TA 3OE5A 1SOAA 1D1QA 4I4CA 4P2GA 1I3CA 4MR8A 4S3MA 3U9LA 4ADSG 3LNTA 4DMLA 4B83A 5COQA 5KQMA 3LNCA 1UP4A 1AHHA 1MPEA 3M5DA 3O1IC 4XYEA 1X1AA 3E5NA 3PX3A 5EKUA 2M5DA 2C77A 1RABA 3UINB 2X58A 2CHXA 3ETJA 3G8BA 3L1VA 4AG3A 3I14A 3W3ZB 3VQIA 2A5LA 2AJ8A 2WJHA 1VI5A 4OLJA 4DIUA 1FTNA 4G5XA 4Z3DA 4LFCB 3D5EA 1QM5A 2UZ1B 4XDGA 5KTSA 2PGNA 3LTNC 4G6ZA 1FZTA 5A4JA 4BDTA 2DZDA 1E5WA 3SXPA 4OBEA 1GB4A 4WW0A 2AH5A 1XZCA 1YJ1A 1U94A 4HD8A 3NKFA 4LUCA 3K7EA 1X8IA 2VDOB 2X2EA 1NMSA 2C5HA 2CFOA 3MJSA 5L53A 2F1JA 2WABA 4OCZA 4M37A 1IWPB 4FCWA 3VDRA 4B3XA 4F7WA 4YDRA 2PMEA 1SUPA 3R6LA 5IHXA 3B7GA 4JB8A 5LKRA 1JG7A 4Q02A 1YVUA 1L2NA 3N70A 4JGIA 2XE6A 3H3JA 3ZBUA 1NAHA 3B85A 4CMHA 1NVBA 5FLXA 2C7QA 2M8SA 2RH9B 3ZCQA 1TGVA 3EH2A 4L7VA 4RZ2A 4TTRA 3JWIA 4NFSA 3EOBI 1OFVA 2EFYA 3QW4B 1X7YB 1P80A 1Y4SA 2QE7A 5IN4A 4I0WB 4G5GA 3QELA 3RS3A 5F35A 1Q1OA 3ESYA 2YQ4A 5E3JA 3TJRA 5IT5A 4DXFA 3HB1A 5J2UB 5AK3A 3VR6H 4REZA 2JLRA 2J7PD 3AUXA 2HXYA 2X4LA 4YY3B 4FNAA 1ZIOA 4RKQA 3AE6B 2WIBA 2OV8A 4D2IA 3M6VA 7MDHA 4QYMA 3C4VA 1BJTA 1WUIS 2KSQA 2JJQA 3VQZA 4HVBA 1SXTA 2OO5A 2ZJ6A 3HJUA 1KEEB 1SCNE 5P21A 4CTNA 3I0NA 2IYAA 2KE5A 1N8SA 4C05A 2W83A 2ZEJA 4DV7B 5FAKA 2VAXA 2YXNA 4TYMA 5LP6C 1XRNA 3QNWA 2VYNA 4YO8A 3OJ4B 3HVRA 4NTZA 3CU5A 2X8XX 2FSGA 3GRVA 4G0QA 3VYWA 2HXGA 4ALMA 5BMVB 3P4XA 4PLPA 1G64A 3CLUD 1HORA 4F7DA 3QHAA 4XI9A 5GONB 1Y34E 2QM7A 3VUXA 3GJZA 3CF6E 1KPIA 2N47A 1BSVA 3P0RA 4L8VA 2OCIA 2KNBA 4MRAA 4D4JA 2B1QA 1W8IA 1KI3A 1C41A 1X14A 3WLOA 4AOFA 1QZZA 4OX9Y 2H4HA 1O2DA 3MM4A 1M8GA 1IEVA 3BB4A 4K1XA 1EK2A 3DGEC 3FMVA 5HMLA 4B3HA 1WBJB 1XHLA 3DE6X 4LWOA 3DEAA 4U7TB 1KEUA 1S8FA 2HWWA 4D2KA 3MGKA 3AEKA 1YIDA 1JRPA 5CB8A 3RADC 3W6PA 2GAJA 1BXGA 1YZQA 3BWEA 5I7AA 4EF4A 1YTUA 1QG6A 2QMTA 1UJNA 2BM1A 2HB6A 2KB0A 2R6JA 2J5RA 3IIMA 2EV9A 4L0QA 3KUDB 4UHHA 2NVWA 2YFKA 3LWDA 1BKYA 4K2AA 4MJXA 1KZHA 2A3NA 4GP7A 5J3JA 1Z35A 1MOPA 2IIQA 3L0ZA 3L7KA 3MMZA 3T4EA 4B3CA 1B8VA 4CIXA 1OWOA 3AK4A 4EW6A 1PRYA 2GYWA 1C50A 3KTAA 4XARA 2K6GA 4ZARA 4DM7A 3HVZA 2O52A 2RG1A 3LH5A 4YCAA 3KSRA 2M6KA 3TQFA 4BFUA 4C4YA 2HIGA 4KBYA 1E7SA 1PVVA 5FTWA 1DJOA 3CJQA 1V8FA 3NAZA 4CF5A 4JBXA 3ZXRA 1YZNA 3K2BA 1CE8A 4ACAA 3P1MA 1Q57A 3R0JA 3KVFB 1JF8A 1Z5UA 4ZVRA 2PW9A 3NVYA 1NJ2A 3VDMA 1QOGA 4CU5A 3LY8A 1LBEA 4MV0A 4O33A 1JN0A 2UYHA 3DCJA 4B0OA 5KDOA 1V9SA 1W75A 1WB6A 2ADOA 1T24A 2P1DA 2OLEA 2INNE 3A11A 3OCXA 4L3WA 1Q1NA 1E9FA 2OL4A 1E59A 2O2SA 2HJWA 1OXXK 3TJZA 1EH5A 2LXCA 3BHIA 4K9QA 2NVUB 3ZKWB 3LOPA 2JCXA 4Z1MD 3MXTA 3RSHA 5JAQA 1PBNA 3FF1A 3F6RA 4IGFA 1RAHA 2BMEA 3KKEA 4H17A 2ZIAA 5IDVA 2AYOB 4YUXA 3TLKA 3Q2KA 3C1AA 5ERGB 1E4YA 3IQDB 1E0KA 3EXHB 5DTJA 1KDVA 3FC4A 3IDAA 4UBQA 5JMOA 4DDID 1E7RA 3L46A 4RFLA 3PHWB 2FZGA 3SBOA 4KKVA 5ICMA 2VL7A 2VF8A 2WNIA 4ANUA 2BHLA 2KKCA 1XNJA 1RXWA 4PVOA 4XDDA 5CT8A 4EO9A 4FUQA 3TJPA 4ICUA 5BMHA 1OAKA 4NENB 5DYTA 4ARAA 2PXXA 3CBQA 3PIIA 2HDWA 5JSUA 1SHJA 1GEGA 2Z59B 1UBCA 3C3CA 4JR1A 4ICVA 3F7TA 1IEXA 3PRMB 1XDBA 2JLAA 4F92B 3LRTA 3MD0A 1VG9B 1RM0A 1MH9A 2XHZA 1B3RA 3G88A 1ND6A 2R9VA 5JNSA 5DTRA 2PVPA 3F6CA 3I09A 3EJ6A 3K2IA 3OC6A 3TS1A 2IY9A 2ZTUA 3ZX4A 2FB9A 2YICA 2WHPA 3AHCA 3IOCA 3LWBA 4DJDC 3E9MA 1XP8A 3KOOA 1FMFA 2B4KA 3JAWB 3L8YA 1E2IA 4W7SA 4NAHA 1QS0B 3LBIA 5JAMA 1AUXA 1FS5A 4KOAA 3DHBA 2FIFA 5B58C 1FUKA 3P9QA 5CFNA 2HUPA 3WXBA 5BN4A 2D2QA 3BRSA 3BSWA 3R24A 2HMUA 4P8RA 2PUEA 1K52A 2ISSD 2IUSA 2MMCA 4ZCPA 3RI3A 4V39A 1LPNA 4YMSA 2C57A 2R86A 3P9SA 4X84A 3FTCA 1GQRA 3EMVA 1YKFA 3FNQA 4IVPA 2ZRLA 2C4WA 821PA 3IH5A 1CZOA 3JVVA 4WXPA 5HHTA 1NVTA 2FOLA 1RI1A 4JLOA 2ASEA 3B2FA 1U0NA 1ZMXA 1IN6A 2M32A 3P52A 4TYYA 3PKIA 4YRQA 3R7BA 4KGVA 4M83A 1A98A 3BCRA 1U4AA 4RZIA 3ZDRA 1F2RC 1L7QA 2QN3A 1Q0ZA 1XQWA 3PWTA 5IBRA 2ZJDA 1NGSA 2PIDA 5FIUA 4PVTA 3V8VA 1RRMA 5ITSA 5ERYA 2DQKA 4W5OA 5EVBA 1QJCA 2YFHA 2YZ3A 3CZCA 4KKIA 4RIHA 3SZOA 121PA 2PMKA 2QD3A 4D4KA 1HT2E 2OBLA 2ZRFA 2XYVA 2SCUA 3UB2A 2K5UA 1JAHA 3D3QA 4TMXA 5WRFA 2N0SB 2XXAB 2BI8A 3GR6A 4U0JA 5IRCD 3E6AA 4F86A 4I5GA 5JCXA 2WVHA 2CV0A 3SX2A 1YQXA 2CZCA 1KEPA 3RGGA 1ZZGA 5FBZA 1TCUA 4ZVQA 2ZJOA 4X3CA 4BIMA 4M7RA 5IAAA 1DZ3A 2FP4B 1HO3A 3TLYA 1XBTA 1AKEA 4MMZB 5BSRA 5HPYB 2BGGA 1T8YA 3PV1A 3DF7A 1ET9A 4NCXA 1ZGJA 3U4EG 3VO1A 4C0QC 2YBEA 1WIWA 3A2NA 1PWXA 3DTYA 4JXJA 5ILQA 3TLGB 2HQ1A 4NNPA 3ZDXB 5A3JA 3IQZA 1SE2A 3MJEA 1GPLA 3S8EA 1C7FA 4HNGA 4O2BB 1RHJA 4P38A 5SZHB 3Q8FA 1BXTA 1KZGB 3JWJA 1WZCA 4C9BA 1AF4A 3D31A 3QWZB 1WRIA 1OIVA 1Z22A 2H4ZA 5AVQA 2PZKA 2Y5PA 4NOMA 2RG7A 3M81A 5DLYA 2O0LA 2P5YA 4CT4B 1KR5A 4EKIA 3U61B 5CW1A 2FLVA 4CMGA 5CH3A 1XCBA 2Z9BA 1X7WA 3VVCA 4X45A 2DPMA 2IHKA 2Q1YA 1Y1RA 5AVKA 4HMOA 1IBCA 2XWPA 3N6VA 4GEKA 4WMLA 3TW0A 3TG2A 2VSXA 1D2HA 2JFFA 3ZVMA 1WPGA 1L4ZB 4I81A 4DHEA 4ROSA 2BBCA 3FDZB 4FEYA 2K8HA 1C7ZA 2XADA 3HUFA 3KB2A 5FF9A 1WNFA 1VLLA 5IAEA 3V33A 4L07A 3ZLBA 1P5FA 2LVBA 3DOOA 3FHTA 2PX5A 2XBUA 3F97A 3Q7TA 4QJ5A 1NVMB 4RIFA 3DXXA 4EYSA 3PT9A 1DC6A 2Q8QA 2E18A 3AEDB 3GARA 4Z9YA 4KDIC 5K3SA 4YSKA 2JUOA 1RXCA 5E95A 2L83A 2I91A 2JG3A 1AD2A 1NG1A 4G0YA 3QX3A 1O6FA 1PEDA 3OFNA 3BXGA 4AJIA 1V5OA 2FUCA 4EAAA 2FPRA 1ZNQO 2IF2A 3PPVA 1W36B 3W9UA 4RGQA 3GUZA 1R0YA 5JNVA 4GL2A 3CZAA 5ACTA 3CIOA 1IAVA 1LV7A 1QONA 3PKJA 4HDMA 4P81A 1XHEA 4ZVMA 3N75A 1D03A 2HWYA 2QG9A 2OHOA 5AJYA 5FPPA 5ES3A 3VJLA 4A8XC 3I9OA 2ERYA 3WYCA 1ILWA 1LFDA 1YDWA 4B6WA 5DCYA 3RS4A 1U90A 3DKRA 4G0XA 1R4MA 3P4UA 1SVMA 4ZAZA 3VU1A 3IOFA 4GLBA 3HO1A 2AF3C 4KCGA 2EG9A 3ZIMA 4MZDA 4DOMA 2R6HA 5DISB 5L7WA 3NC1C 1CSEE 3FB1A 3BWBA 3UKJA 2HLNA 4DV3B 2FR8A 3CSUA 3ICQB 1IBLB 4HBZA 1YL5A 4BYGA 2Q4BA 2WTNA 3MCVA 5HRCA 4C6RA 1X15A 4B2PA 4KHZA 1Q0QA 3FCUB 3PLUA 4ITVA 1IOLA 1SBZA 1T5SA 4TL9A 3FPKA 3OKFA 2VHXA 4IIJF 2W6OA 1J21A 4O1HA 3IT0A 5JSYA 4ZKEA 2EX0A 2RGYA 3MJCA 4NZ9A 3SS9X 4Y9DA 2IPLA 4NF2A 1QZUA 3BEOA 1P9WA 1PNTA 1NUQA 3M6FA 1V43A 3NGMA 5AKEA 3E1KA 3UMRA 3N6XA 5BVHA 2FPIB 1OEYA 1PYDA 5EMJA 4USAA 3LCMA 2CNNA 3P2IA 2IHZA 4QJBA 4HCPB 1YMVA 2XQGA 3EUEA 2HSWA 5I7WA 1J25A 2WMDA 1WDWB 5EXTA 1EIWA 4GSWA 1L4EA 1P31A 1EFKA 4DL9A 4Z51A 4LJRA 4KPFC 3C45A 1CUUA 1UP7A 1D07A 1F2VA 2R6CA 4YCDA 3MF4A 1QHFA 2BJHA 1YIWA 2H06A 1SQ6A 2O2DA 3GT7A 5FLYA 1K86A 3KLOA 2BTOA 5I9BA 2UU9B 2P91A 4PTLA 2HJ8A 1MB3A 1KDZA 1NX9A 1RXEA 2PRJA 3UF0A 2IH2A 2FFHA 3A9JB 3CNHA 2JIPA 2QB5A 4OVZA 2ET6A 2Q1WA 1TKCA 4DEYA 2ID9A 1QOBA 4V2UA 2UUBB 1QCCA 2Y1OA 2YZMA 5KINB 4GWKA 4JMPA 2QF7A 4NEGA 3VVLA 4DA0A 5FBKA 1B2RA 1L7AA 2ASVA 2JFQA 3C5EA 3RSLA 3X0DA 1K7EB 5IWAB 2QVXX 1F20A 5SZIA 2R1VA 1NJ1A 1G42A 1Z37A 2Z4SA 3LUKA 4R2LA 4RVDA 3RM3A 3T7AA 1EVJA 1Z2PX 4IIEA 4X6XA 4FJVB 4DG5A 2ACEA 1UEXC 1WVMA 2BW2A 4YSYB 1P91A 2JJ1D 4OAPA 4Z6KA 4ZYYA 1CRQA 4UC0A 3UV3A 3PFHA 2DHRA 1NQXA 3AETB 1OZAA 1Y3DE 4XIIA 3RUPA 4BNIA 3F47A 2WB4A 1TD1A 4PICA 3M2TA 4EBBA 2NMVA 1F2TB 4AJ4A 1AHNA 5CB4F 3ZUNA 2HK6A 2B4AA 3FI9A 3VZBA 1OZ0A 3E5MA 4MP8A 2CL0X 3DD1A 1LGYA 2YQ5A 3PQFA 3ND9A 4GQAA 2VTBA 2FPPB 1S3SG 3KKOA 1RP1A 2CXOA 5F23A 2C9MA 4FT2A 4X54A 4YRJA 2CFZA 2QMOA 1KTVA 4PF1A 3APFA 3ZOKA 4EG6A 4YMGA 4I6GA 1PNQA 3LC0A 4P4GA 1FM0D 4ANWA 4L15A 1EQ2A 2ZFUA 3C0KA 3A1UA 3UGQA 5CVTA 2GBJA 2HTHA 2ZVNA 2HA4A 4KR7A 2UYQA 5DHTA 4A55A 1KNXA 3QZUA 3SBEA 1NBEA 4REOA 4XPZA 3WK9A 3RI7C 4DA7A 1C3EA 1SXQA 3KL4A 5DHPA 4UE6A 5EWLB 1E1RA 2Z2JA 5AOAA 2ORWA 4EMUA 3UAYA 1SJHD 4J0EA 4DCMA 4R1NA 3D8UA 3L93A 2YY5A 3OQ6A 1NUTA 2AXPA 4R71A 2BF8B 1Z4MA 3PFFA 4ESHA 2X77A 2BGJA 1U8XX 5ERXA 1KQGA 3E2MA 4GVLA 2P6NA 3BYZA 2X5XA 4GPD1 1FW8A 4D8TA 1LLDA 3KLMX 3R7DA 4D57A 4S04A 2OPHA 3B9JA 1EINA 4GMKA 4HVCA 4BQIA 5EJEA 5JAUA 3CPJB 3GVCA 4KE7A 2YJGA 1OASA 3JQ8A 2ZJAA 1QHYA 4WERA 4BASA 4XR9A 4NJEA 1K66A 5CB4A 1L5PA 4GFDA 4O2AA 1EZ4A 1XRSB 1C4CA 3UO8B 2JGMA 1E5XA 2NT4A 4NZZA 2ANCA 1YA4A 2Q3HA 1YDFA 5DT9A 1GNQA 1AC5A 5CX3A 1GFWA 2QM3A 3N30A 3BN3A 3OZDA 5DE3A 5IKOA 2HMWA 4EJ6A 4ZI7F 3A6HA 1KF6B 2FUG6 1AA9A 1DFGA 3W5UB 1UBSB 3HCAA 4HYEA 1G20B 5BW4A 2Q8NA 3M3JA 2KDFB 5I8WA 4XQEA 3T3MB 3EQ2A 3QV2A 1QB7A 4P7GA 4FDAA 1LXCA 2FPPA 3KAPA 1JNXX 1E1MA 2QRGA 3E7PA 1PHRA 2M6RA 3AR5A 1G6KA 1X8HA 5L4SA 3N07A 5SY4A 3ADOA 5JIBA 4J9UE 2QTBA 3RTGA 1NW3A 2I1LA 3U3MA 4NCBA 5AM1A 5E9AA 2O7VA 4WVLA 2Z2YA 3B1LX 1YAHA 3GRPA 2R85A 4EHFA 4Z1MA 4C6TB 2FVYA 3FILB 1QYRA 3CH4B 3TW4A 2WU5B 2WAXA 1FRDA 2VT3A 1DQRA 2ZOSA 3DE7X 3O8NA 4OFWA 2J0JA 3LYUA 4AG5A 2AZDA 4IO0A 2P5TB 1HOXA 4LCEA 3NUHB 1QC5B 5G4LA 1DDKA 3THWB 3P2KA 3UENA 4ANFA 2DLNA 4LI0A 4XGIA 4I3FA 4E1AA 5KPJA 2GFHA 2Y3IA 3Q69A 1SVUA 4R9NA 3I5MA 5AVXA 3W2DA 1JR3D 5ALOA 2FFRA 4QG3A 2K22A 2JJMA 1W88B 2ZVQX 3M4JA 4CMAA 1L5QA 1C1XB 4CM5A 1YONA 4P98A 5JAPA 3U56A 3FG9A 3DDOA 4ATNA 2L0XA 2WXMA 1KYXA 1I4GA 1I2MA 1KAQA 2G88A 2G28A 3IP7A 5E6UA 1P3JA 4YJHA 3GE3C 5LSCA 3QSYA 5BSVA 3ETNA 4Z4QA 1WJNA 1FP4B 3Q0TA 3BE6A 1LK7A 4ZRIA 1QHHB 3FRHA 3VPXA 4Q05A 2I22A 5IK2A 4DM4A 3RS0A 5EP1A 4PYMA 3TVDA 2ZR9A 4UXJA 2FG6C 7ADHA 5BSTA 5JZ9A 5IM4A 3IT3A 1ZVMA 1XTUA 3FI0A 2V1UA 1TTQB 2CLIB 2ZEQA 1NBIA 5C31A 1P2VA 3HVDA 4D3DA 1PR0A 4HGNA 5LD2B 2VQ6A 1TEHA 2RGBA 3I3TB 3IPAA 3UQBA 1AZWA 2B20A 2FRXA 3IRUA 3QXJA 3PV0A 4EY5A 5EWAA 3AXCA 1R0WA 4FLFA 1GPKA 5AXRA 2CEKA 4BO0A 4NEQA 1ENYA 1G5FA 3KHSA 4UHEA 5TMDA 1SCKA 1F06A 1SULA 3ZHVA 4KX3A 1KJIA 1R0CA 1TPZA 2QE7D 3O1JC 4UUOA 1J0BA 4B6JA 3ITNA 2O48X 1XVTA 3KWMA 3ZNPA 3QJYA 2WVGA 3L7LA 4M54A 3DBLB 3CXUA 3W90A 1PEKE 5CJJA 3G17A 3W1EA 2XRZA 4HXYA 1XA3A 4O29A 2XTNA 4DYDA 3X2YA 3FMOB 4RVHA 2RBGA 5LCAA 4YPVA 1E77A 1JL3A 2NU8A 4BUJA 3NIDB 4AKEA 4OK5A 2AN4A 1G8AA 2P69A 1NYRA 1KO7A 2J3DA 2V5AA 1XEAA 2BKVA 3DONA 2WUVA 3JD0A 4CM6A 3A9RA 1V4BA 3HDTA 3R9KA 1QLHA 4UD2A 5FO1A 2WF9A 3BRWD 1TXGA 2HRCA 3H2ZA 2F9MA 1NWCA 1PAUA 2HI0A 1W5TA 5EHGA 4AF8A 4BJ1A 3UBTA 5JNUA 2GGSA 1F38A 3EUFA 4FN4A 2BE7A 3ISTA 5DF1A 3IEVA 4RJTA 1MD9A 4TYFA 2BI4A 1SBQA 1AQYA 3OFKA 4BCCA 2AK3A 3PL5A 4G1VA 1L3BA 4QX6A 5EJIA 4FGSA 1GCAA 1UFRA 2F48A 2PDAA 4M9XA 3FVWA 2BR4A 3A36A 4GG1A 4C3OB 2OFWA 4HH4A 3VC3A 3I3OA 3OBIA 2QYSA 3C0RB 1LU9A 4BZWA 4CE6A 4F9GA 4MQFB 3AMZA 1WJ6A 1E3QA 5SICE 5L3QA 2TMYA 4RK1A 3CLSC 3H0CA 1Z6AA 1YZKA 1GVNB 1Z5VA 4FYVA 3CM0A 3I57A 4Q9AA 2GNOA 4FADA 2JSVX 3RFTA 2WIGA 2G5GX 2OC9A 4RV5A 2H59A 1C4XA 4H7HA 2QM0A 3CIFA 4WJLA 2ZB2A 3EE6A 2ZP1A 3DZCA 1J70A 2DG2A 1WI0A 4JIMA 2M0XA 4UM7A 4ZT4A 4ESOA 4CL2A 2Y67A 1XROA 3F9IA 1DQNA 2JCBA 2P67A 1FQKA 1WY7A 3GB9A 4OBBA 3NASA 4ZYLA 1PR1A 2OV4A 3DJYA 4GICA 2PO7A 1CF4A 3CFYA 3THWA 3AEUB 4LWQA 4G1UC 3PREA 4WCFB 3QX1A 5ALNA 1KE1A 3RU3A 3R66C 1UFVA 3BK7A 3ORSA 3TQSA 2FI1A 1QCZA 3FUUA 4W8GA 4ZEJA 4HN9A 2RGNC 3SQOA 1OF1A 3P9PA 4BGIA 3U1BA 2W5UA 3CGGA 2AHOA 5EGNA 5JFTA 2ZUFA 4G50A 2I1VB 3ZX5A 1E79A 4DIFA 4IKGA 5AP9A 1G21A 3VSEA 2L1AA 1I0ZA 1K1EA 1QLBB 4LZPA 4PZCA 5TF0A 3I61A 2GVZC 3UK0A 4HNSA 2AW3A 5CJ2A 4PS0A 3ZY3A 5FK9C 2Z8YM 2QVLA 4X63A 3GBVA 1MHXA 2DHDA 2AG8A 4NMWA 4GC9A 5BMVF 3PC8A 1UINA 3LWZA 4COOA 2RGRA 4DZRA 1XXHA 3I0VA 3FUXA 1EGQA 3IR6A 3NFYA 4NC9A 3MSCA 3RABA 2O54A 3IFWB 2LI5A 2XTJA 3U6KA 3BE5A 4OD0A 1GPWB 1XN4A 2PWYA 2GOWA 4XCQA 4WK4B 4Q4HA 2IPMA 1K4KA 1QTQA 4XXHA 5DBEX 4IOKA 2I29A 4I1OA 4LE1A 2CNBA 5FPHA 1MO5A 2AMLA 3GT3A 4AW9A 3PY6A 2EW2A 1HE3A 1VDZA 2A86A 2Z5FA 4NY1A 2ZW1A 1QHIA 1S9DA 4FXPA 3RCBA 1MXFA 2ZVJA 4FMCB 5FADA 1WF3A 3TCAA 2YMMA 3EF0A 2DCMA 4OATA 3VH3B 3TBFA 2J53A 3VSCA 2D11A 5JTTA 4D6XA 1F48A 2OK7A 5EJAA 1WW2A 3L0CA 3U7RA 3FCXA 2WXPA 4BMZA 4DBVO 1I2DA 5LP1A 1QRAA 2CMHA 1QP7A 2ICIA 1LI5A 3ZDEA 4IX9A 1AKQA 1KXJA 2CF5A 4AYXA 3IEPA 1XPJA 1QYWA 2Y1XA 4NZMA 1GPJA 4LPKA 3RVLA 4EJSC 4KP7A 4HG2A 4PQYA 3T1NA 3EFBA 2XWJI 2FCQA 1WU7A 2M2IA 2VP4A 2O8VA 1TA0A 3HSYA 5AQ1A 2WSYB 2RHHA 4NDNE 2BRUA 3O91A 3K9OB 3F2IA 4OHXA 5LZ8A 1ESDA 5JVDA 2I1WA 2Q7DA 2AUTA 2IXDA 1XTZA 2PBZA 5ESXA 3L8ZA 4ZAVA 3G2HA 3V97A 4BB6A 2GZ3A 3WAMA 2EWWA 4PG7A 4IINA 1K3TA 5AHKA 1N5WA 1IONA 1Q0RA 4DANA 3AF6A 4P62A 2DAJA 1WEKA 4FLHA 1FNNA 2J5BA 4WXYB 3U4QB 3IESA 2L69A 1H85A 1UPCA 1Q21A 4EPYA 3S2ZA 4MCIA 3A1TA 4DABA 3M3HA 3OCZA 4OP1A 4NBTA 5TQ2B 5DNCA 1RBYA 4WLUA 2A33A 3R1IA 2BFDA 3FNEA 3WHIA 4JJKA 3VZDA 4RPKA 2CB0A 2G0AA 2YYSA 3G82C 2LPMA 1JMLA 1FMLA 2FMHA 2PKEA 2ROQA 3AVYA 3LI2A 4P7JA 1IRIA 1L1RA 1RCTE 5IP4D 1M0SA 2EF1A 2HMSA 3B3QA 3EXHA 3D5QA 2PJHA 2ZE8A 4FFDA 4CTMA 2FE8A 1RJDA 4ENRA 3CNBA 3QX8A 2BM9A 1DMRA 4ZEOA 3UMBA 4CKZA 1D8AA 2WV7A 1BE6A 3VR9B 1Z0UA 2LRUA 2AN5A 4BZAA 1BU5A 2QSDA 1FYDA 2VSOA 4NWIA 3EYAA 1MHHE 1OA0A 1ZJ6A 1EHYA 3THYB 2HAEA 4AN4A 2WJZB 2WXJA 1PGBA 4A90A 2H1RA 1DEKA 1E1CA 1H93A 1BH2A 3EIUA 3MHPA 4GZ6A 4UCFA 3WO1A 1CJEA 2LVOA 5AMXA 1QGUA 1R0KA 5BT8A 2H2HA 1HNXB 1NYQA 1YSCA 4I3HA 1LQTA 1RQRA 4DDKA 1HTOA 4RCOA 5K5EA 2J6IA 1YRHA 4IF6A 1H1DA 3TXXA 5JSQA 1E1CB 3OJOA 5K4GA 2E4WA 2OXEA 2VH5R 1FXWF 1HT0A 1XRPA 3IXQA 3TLAA 4HPWA 1QUFA 2EW8A 4MULA 4AMYA 2ZBVA 4B4OA 5F78A 1P62B 2WSLA 2EFDB 4JR2A 1LGRA 3V4FA 4A0HA 3ZTTA 2ZQYA 1SHUX 4UBJA 4LDNA 5JI2E 1Z5NA 4CI9A 4KR6A 1NF9A 3WZLA 2ZRNA 1SVKA 3RUAA 2XK5B 3L49A 1VGVA 4QQ8A 2RGXA 3QQ8B 2DR0A 2Z58A 3F96A 1Z6PA 3HSKA 1DMSA 3IURA 4GNRA 3TEWA 3H7PA 4L2IA 4ZEWA 3REQB 3RVOA 4ECEA 2C8LA 3I76A 2I4RA 3SXUA 1N3LA 2BG8A 2HPAA 3LDFA 4QQKA 1NEKB 2O0JA 4AY6A 2MSED 1C0IA 2F9FA 5K4MA 4II3B 4HDRA 3W1YA 2R97A 4UBLA 4ZREA 2BFFB 3WK6A 3AF5A 1KHHA 1RT9A 4K9MA 1SVNA 1W2HA 4JEMA 3PHCA 3RYIB 4P4TA 3M63B 3OZXA 4RC9A 4RK5A 4WXEA 5A5GA 3PEWA 3PUVA 1FFYA 3TOZA 5LOVA 1E3MA 2GNAA 1ML4A 3PXXA 5KTOA 5DGTA 5HK8A 1ZJYA 3ZWOA 4V3BA 2PKXA 2C59A 2XQFA 4P2BA 5JLAA 4N3GA 3M3DA 2WJJA 5FH9A 1UBFA 2JFBA 3MOSA 5COBA 4CCYA 2WF8A 1YUMA 1EAMA 2Z6AA 2V3VA 4PIMA 4FS8A 4B7AA 5K3OA 3TQRA 2WFAA 4FXOA 4E14A 3UB3A 1D7AA 2YWDA 4IUDS 2GASA 4Q9DA 4YQYA 2WXOA 1NNI1 2Q6KA 4WLVA 2NPTA 3ER8A 4IXTA 4M7WA 3D6FA 2W37A 1YQ4B 1WM1A 1RXIA 1Z7EA 2J46A 3O73A 3PQ3A 4G5SA 3HYLA 4OSPA 3T0FA 1VSVA 4EATA 2L0FA 1WNTA 2WNSA 4FOSA 3RTAA 4G63A 4JYMA 1J7BA 4MTCA 3SYNA 5A6VA 2DZKA 1JI3A 4Y7CA 1PTJC 3ZHQA 4QLOA 3N2KA 4MW9A 2PJZA 2VHQA 2KMMA 1R15A 1Z17A 3JD1A 3J81k 4FR7A 2QTLA 1SUDA 2V03A 2A88A 3C1TA 5A7FA 3CLTD 4HH3C 1ZLXA 3CKYA 1MFZA 1YAJA 4JB2A 2O2JA 4WBXC 1RCFA 2BPOA 1NI4B 1C29B 2FFAA 4BE7B 5B12A 1XUOA 4HK4A 4P4UA 4NZPA 2XBLA 2QTVA 4RMGA 3VAWA 1OI2A 2WYMA 4JBLA 2FYTA 4C4VA 3WL3A 2IXGA 1L7RA 1W76A 2Z5LA 3GHHA 3PC8C 1CYEA 1YHNA 4OHCA 3D6NB 3T5MA 4A8JB 2RHJA 3D64A 1CUIA 4KVGB 3USZA 5ECDA 3BL6A 3LPDA 3VR6A 3WWEA 5C5EA 1AG9A 4D56A 2C07A 4WPGA 3RBAA 3W5AA 1TQ8A 3PZBA 1P81A 4FGJA 3T06B 3MTJA 1UOPA 1MJFA 1QE0A 5U4XA 1UKYA 1V6SA 2XA2A 1DGQA 4RF5A 2G72A 3DAOA 4X1KA 5HIIA 3TM4A 4I8DA 4DNOA 4B2IA 1N9GB 1IJEA 4DLYA 5AUOB 2WTUA 3HLKA 4TSFD 1JH9A 2CG3A 2X1MA 4IC7B 2FQQA 3H11B 3AHJA 2HA7A 1I2BA 4L50A 4R8RA 4V0KA 4O5OA 4WUVA 1SOUA 5YASA 4RK4A 5ACRA 2OOSA 1SHTX 4FWTA 3S0ZA 3OEHA 1U0GA 4FU0A 2VYVA 4BQFA 4AX0B 1S2DA 5B7QA 1QH8B 1WRBA 1GR0A 1A2QA 1KAMA 3K32A 4IVRA 5JCOA 3E4CA 5TT0A 3GLHE 1R9NA 4QFMA 5B57C 3WRVA 1JA9A 2H5LA 4M00A 3KOYA 3H4MA 4HV4A 3BCUA 3DPSA 2VDWB 3EH1A 3KCNA 1JG2A 3CWQA 4Q3EA 3OZBA 4WJNA 1WB5A 5DTQA 5GADl 3L4EA 4B3FX 2ZUSA 3W5IA 3T3GA 2CWDA 3G13A 4AMBA 3HJNA 2A5YB 3K73O 1S2LA 3IBGA 3HWSA 1P39A 1QZXA 1GA1A 4KREA 1FEZA 1WQ4A 1XZNA 1Y6RA 2W6ID 4DN6A 4XUCA 4Z1OA 1H5UA 3U4IA 2IQIA 3B1VA 4KSBA 4GKJB 5L3QB 1PVDA 2JGRA 4XASA 3BGSA 1U3FA 3SNKA 3U80A 4WWMA 1Y8QB 3FR8A 2CU1A 1A27A 2NLOA 1CX9B 2XWSA 1K6EA 2J7PA 4TMVA 3OSZA 1TF7A 4V0ME 4C1EA 4Y6LA 2JGKA 2R7AA 1YZUA 2JK0A 5FWYA 5CTJA 3H9QA 2VH1A 2DR2A 1I3KA 3MELA 4X93A 1LO5D 1BYIA 1KVTA 2VUSA 3PPAA 3OWXA 4FMDF 4AMUA 1DBPA 2Q50A 1QOZA 4JBYA 5G4KA 2I7TA 3MUEA 5AW3A 4JC0A 5EXEA 4F12A 1PIWA 3ESDA 1O0BA 2OHHA 3BMCA 1UWMA 1Q3KA 2Y05A 3GJ3A 4E7OA 3ZZTA 5BNFA 2XH8A 3TIVA 1GSOA 2MQJA 3N2EA 2QQ0A 3FYUA 4J0HA 4LNHA 5FDFA 3I23A 3QYAA 2O20A 4A3SA 4URUR 4HDQA 1E8ZA 1ODCA 1SGWA 1OV6A 1NDDA 1V7QA 2A5GA 2FW7A 3CONA 3G59A 3GZNB 4JP5A 4QFBA 4A26A 2IO2B 4P34A 3N05A 4F96A 4QREA 2AQHA 2WTBA 2C94A 1LDGA 2VZ8A 4BLRA 4ZI2A 5B36A 2J7KA 4FYIA 3KZKA 2PL9A 5FFFA 1PR2A 4ZZ0A 4DLVA 5CFMA 3OCYA 4I55F 4HVTA 1JAIA 3N6RA 4PQEA 4EA6A 2PZLA 1ZL2A 1J39A 4EKEA 3SX4A 5ABPA 5HW0A 1G18A 2YEPF 1RU3A 4HB3A 2D8AA 3IAM6 4I99A 3EEQA 3GW8A 4BLOA 4BNJA 4DCPA 2JVIA 2GJSA 3LO8A 2VAWA 3FM9A 3MFYA 4HXDA 2JAHA 1M1XB 3JAKA 3LHDA 3QVGB 3SZUA 1H2YA 2WRZA 3ORRA 1SVLA 4G0OA 3O31A 3AR8A 2ZSHA 1IM5A 5JMTA 4F5DA 3HB0A 5F9MA 2O2ZA 4WZBA 1XKQA 2W70A 3RE1A 3NANA 5B4TA 2WNMA 3UXYA 3WMFA 1JHVA 4WY8A 3ZGOA 4DJFC 4P7KA 1GRCA 3UGTA 4FEKA 2DX5B 2A9JA 3LIIA 1J7JA 2D2IA 1N6OA 2IY7A 3TAUA 3TTYA 4YC7A 4AP5A 3Q72A 5C8YA 4K46A 2P90A 4KRGA 3JATB 4L4XA 3VKUA 1GZ6A 4IZ6A 1O5TA 3AOEA 3QXCA 2WXQA 4RAWA 2MR5A 1TTTA 4OIMA 4J3OD 3BWCA 4ROTA 3RIYA 2KTRA 2E4ZA 2WJAA 3FYCA 2WJ6A 3GV0A 1LWNA 5LBIA 5L95A 4G8BA 3KQQA 3MRTA 3K0SA 4AJPA 4E71A 4ZJZA 2PYZA 1TRKA 2JBWA 2Y8EA 5KSZA 3DFFA 1K0FA 3DMNA 1GTRA 3AHEA 4K3UA 4OSOA 5CLGA 3MCAA 2C9WB 5D7BA 5DM1A 4Q48A 4NCIA 4GDLB 3AV0B 4WXRA 1N63A 1J8FA 2G83A 3UGKA 3FFAA 1KDTA 1WMHA 3E8MA 3JQ6A 3OJCA 4QAJA 4AICA 3MCUA 1WXSA 1OI4A 2PSSA 5AVRA 3UFXB 4M98A 2QRPA 4DLKA 3C8UA 4KPGA 4EFMA 1NXWA 2RR9A 3VFKA 4NBKA 3CRZA 2PX8A 3RIEA 2ZRPA 5IVKA 3O75A 2F3TA 4YCSA 4G56A 2JGIA 4ER0A 4FFOA 2XBMA 1ETUA 4S35A 1KMQA 3G2KA 4S2UA 3CV3A 4TS4A 4D9MA 4DUPA 1M67A 1TT5B 2BP7B 3EEIA 3FRJA 2YWJA 5JZMA 1SXJD 2ZUEA 3ME5A 5KVAA 2NG1A 2X1VA 4AXBA 2BGWA 3ESAA 2QU7A 4Z54A 1JJTA 2QYHA 4JNKA 4WDQA 3NKVA 3PDIB 2DUJA 3GCDA 3V00A 2PBRA 3HCDA 1U4SA 4WASA 3QA8A 3SR6A 4YLGA 5C8VA 1OWLA 1DXOA 2BH2A 3DW3X 4JGGA 1N5MA 4YRGA 3JW8A 4S1PA 3LBFA 1Y9JA 3KXIA 4QPPA 4DT1A 4A8HA 3SJUA 4LF5B 4K9PA 3E84A 5D3DA 1RQGA 5D7NA 4CCAA 1CIJA 1J8MF 4M0DA 1MR3F 3JQ9C 4MIYA 4EPRA 4KLZA 3UMGA 3Q1KA 5LNK1 1ATZA 3PNMA 4YAGA 5ECYA 1EESA 2PT6A 4GEGA 4O2AB 1FFVA 1C4OA 3RN9C 1L3IA 3P9CA 4O59O 1YGYA 4HOYA 4QUAA 1RWNA 3PJRA 4I1SA 1JU3A 4HDCA 5TR9A 4C00A 2AOUB 2KDMA 4P5PA 4TMTA 3WL4A 3Q8CA 2PK3A 4D6YA 2RJOA 4CF7A 1WGYA 2O8CB 2HJSA 3KL7A 1E8MA 4PONA 1KL7A 2X8LA 3G7NA 4NQ4A 1P5ZB 2A1IA 3R2IA 4UU8A 3ABOB 1SU7A 1BOOA 4PZZA 4E31A 4MGKR 2E0IA 3HRDD 2VSNA 1REQB 3HDGA 4DDVA 4EGFA 5JARA 5I01A 4KYUA 1UZLA 3NVWA 4WBSA 1CEQA 2Q0HA 4ZCRA 2E7ZA 2FEKA 4M0LA 4CTJA 2OBYA 3B7WA 3HKCB 4CF3A 5C1DA 3CVWA 1DRWA 4MWBA 4UNIA 4WQMA 3EGCA 3PXGA 1YRBA 3Q88A 2XT6A 1ESFA 4Q4DA 2QTWB 3JARA 3HTXA 5TRTA 4IDIA 1H2WA 1N2GA 4YB8A 3ETRA 2AOTB 1I4LD 2FDXA 4ZC8A 4DSTA 1FPYA 1M2JA 3HXPA 2WC1A 1EUVB 2EKPA 4FZJA 3D7LA 4V0MA 1F3OA 3A6KA 5FUWA 3VFDA 1JVNA 2BJWA 3AQIA 4ZOCA 2R84A 1BN6A 3EG9B 5BMGA 4D4GA 1FDRA 1E9VA 2WVAA 3CUEF 2ZZPB 3RJ5A 3TDNA 3UAGA 3ZY2A 1VD2A 1MIOB 1UDXA 5A1JA 3Q5GA 4MGYE 2G25A 2PR7A 4G2TA 3OD1A 4I46A 4CNBA 5SY6A 3MTEA 3LK7A 4JC4A 3EFOA 3GY0A 1F0PA 1OQRA 1OROA 3GFOA 1C0KA 3QV1A 3QBEA 4FC7A 4LX8A 3V4PB 3UMMA 4OXRA 2C1EA 4IRUB 4B5LA 2CF6A 1L6RA 2QJOA 1YU9A 4HFNA 3VI3B 2V1XA 1IY0A 3L8MA 4Z7OB 1GAWA 1SQ5A 4PIPA 2CL5A 5BW8A 2VDUE 5I4KA 1WBBA 1ADBA 4F2PA 3R5TA 2JZNA 4LQ4A 1EX7A 3U4HA 4FYHA 4JOSA 2DUWA 3C3JA 3N0XA 3G89A 1EFDN 3SF8A 3N8NA 1L8XA 3F6EX 5K9ZA 1NBFC 3KT3A 5CNJA 3WGMA 2JANA 3ZLJA 4BO7A 3UT5A 4C7OA 1U9CA 3KXPA 2HRBA 4G9GA 3GLRA 1RQXA 3VUYA 4COKA 3AECB 2YMQA 3WTBA 4HNHA 5KYUB 3PLAE 4BZXA 2BGMA 4Y6RA 2QTHA 1HDRA 4FHKA 2B69A 2IYEA 3DBVO 3ZNZB 1P1KA 2NU9A 2KMAA 4ZD6A 2HX1A 5J5AA 3DLTA 2XB6A 3FVVA 3WA0A 3ICWA 3HK0A 2KWIA 4KIWA 2C3UA 5HQJA 4LXYA 4AKTA 1B1CA 2XJ4A 3E56A 5ALKA 1J06A 4MAAA 4KX5A 2ZDHA 4R9VA 4FD3A 1GU0A 2DZIA 3DS8A 1QV9A 4M22A 3I83A 3AUKA 4L0MA 1QPZA 1NVAA 2AJTA 3ER6A 5IT9A 1B1ZA 4KGZA 5L4LA 4DIKA 2GM4A 1RXUA 1A4IA 2B82A 2ENUA 2IVFA 3F5QA 1S1QB 1V41E 4GE0A 3C6ZA 1M73E 3PG4A 3EUB2 3HXQA 1WZ2A 3WLFA 4KRFA 1OYOA 2PL5A 3KQYA 3W34A 4QQFA 4X62B 2NPOA 3EXG1 3OAAA 4OJKA 1Q44A 1TM4E 3QE2A 2OA0A 1PZFA 1SY7A 4DC9A 1GOZA 2I7DA 3PCRB 4RWZA 1H66A 1OWNA 1WO8A 2FEOA 3GA7A 4ZHQB 2YW9A 2JH3A 2MSNA 3NHAA 1C3JA 4ILKA 3PFIA 4R8VA 5LB4A 1BIFA 2PKCA 1J8CA 2CFIA 4GF5A 2C0PA 3OE7A 4F7ZA 4XTRA 3I01A 3O13A 3SFVA 1U2TA 4MVJA 2O8NA 4JOBA 3L41A 3DBHB 1YI8A 3OT5A 2JYEA 1LTQA 1SC4A 2YVLA 4XCXA 1K9SA 1CUGA 1ULSA 1NU8A 2DJIA 3KSMA 3EVEA 1FP2A 1TZOA 3DL0A 1U99A 1VCOA 3B2GA 1IJBA 2H5JA 3G2MA 3RKUA 4DNFA 1X1QA 1S8OA 4ZOBA 5EIBD 2IS1A 1HLGA 4OQXA 3ZV4A 3O1LA 3P5BA 3DUWA 1WXHA 2XVZA 5BWLA 1Y4DE 2Q2VA 3AXSA 1K07A 2GFKA 4HEA6 4CI0B 5DFAA 3O8QB 4U6NA 3M82A 3D1LA 3H5OA 5FEUA 1Z8DA 1K7XB 1K98A 1IXZA 2O6HA 1ZCJA 4IZOA 3KAKA 3TIXB 4HGQA 4JVSB 4DLPA 5FUXA 3IAS1 5K6AA 3AEXA 2IX3A 2GPSA 3JSAA 4LKRA 4CKWA 2HHCA 3GD7A 1OV4A 1I35A 2MJDA 2FUNB 4LNOA 1K63A 2HGZA 2OCAA 2P40A 4X60A 1W0KD 4BPRA 1AS3A 2VP0A 4PGGA 2YIJA 1V6CA 3ZWYA 4AZ0B 1M34B 3SSOA 2EIXA 4Z9BA 1I32A 2QX8A 1J8YF 2QJTA 1O77A 3RRYA 3E4DA 2N9PC 1DBVO 4KITB 4F5ZA 4ZHQF 4A23A 1CZHA 4HX5A 1E1NA 2AQIA 3OO1A 1KU6A 1UMCA 2QTTA 5BUSA 3HM9A 2EHJA 4TQAA 2HN9A 3T9BA 2HF8A 2L42A 2DYOA 16PKA 1C1YB 2XQKA 3CGWA 3NRJA 3VHQA 1DDIA 4NKRA 1J9GA 3Q6NA 4KC0A 4ZALA 2QRLA 2SHKA 3TECE 1W85A 4GR9A 1NUAA 5LU9A 1Y63A 3ZTWA 2DYBA 3DOIA 2LR0A 4KV7A 3KUCA 5JH7A 3CX4A 1WWTA 1P17A 1LEHA 1MA0A 3A4YA 4K9OA 2G0TA 2WWTA 1T29A 4J1QA 5H82A 2H54A 3RT3B 2XRMA 3DVSX 3GFQA 2LCQA 4GD3Q 5L9AA 4UNSA 3ODPA 2BIBA 3NRBA 4WINA 4IJMA 2K25A 3KUCB 5JH7B 4EF5A 4MQEA 4BQNA 1GPUA 4M1TA 5BWCA 2DAFA 2JFNA 1CQJA 2CYCA 4PYOA 3GNTA 4L74A 3CJRA 3RC7A 5KS2A 3RVPA 2WMYA 1GXSB 4EXSA 1YR6A 2IA5A 2ID4A 1OXTA 1T1GA 2XUZA 6Q21A 3OURA 1QILA 1JFTA 2CV1A 1F1JA 1YIOA 2XUJA 2ZUBA 1CNEA 1NKVA 4HDSA 3DVAA 1CQPA 5EKXA 5MFZA 4RL4A 3SE0A 3FSJX 4RHEA 2YNUA 4MHTA 2LZ0A 1RYMA 4LXUA 4NS1A 1XVIA 4CMIB 4U6SA 1EFLA 3M6AA 3MD9A 1F2RI 5CFLA 1Q0TA 1JJEA 3W8RA 1XDDA 3HKDA 5FTKA 4H4EA 3OCUA 1UK7A 2PUJA 1JDPA 4HTAA 2Z8ZA 1N2OA 3Q4GA 5DPXA 1ZZEA 4OHYA 4J4BA 1G66A 4IW0A 4G89A 5LC1A 2QRJA 4EFDA 4JP8A 1G2PA 4C0SA 2AWTA 1BCSA 1NI4A 1ODFA 3FOCA 2B2NA 5C1ZA 4G1CA 5EJMA 2G9NA 1FQOA 2B1GA 1NWHA 1GU1A 1XZHA 3DDCB 2KQ7A 4M76B 3F3MA 5ALTA 3GLQA 2OBNA 3PITA 2QAIA 5HE9A 1QYDA 3B1WA 3WIOA 5DNAA 5GOTA 3AH8A 1GO2A 4RZUA 1ZRHA 5CPFA 4JYAB 1RWMA 5TJ9A 2JLWA 1KYWA 2HGSA 4KW7A 4JLJA 2Q4OA 1CNMA 4IXMA 4UEOA 2DKFA 1PLJA 4A0SA 4O4HA 4A0QA 2P7HA 2NYPA 2FG7C 3IXSA 3IP6A 5E7IA 1CUAA 1JKMA 4FYMA 1RZVA 4HAXA 4M3NA 3O26A 1NMEA 2QV7A 2GPNA 2X4DA 4RJJA 4ZEMA 1KZ6A 5H02A 1VZ8A 2E89A 4JI5B 3MJTA 3JV7A 4HF7A 3BIID 2HFKA 1SR8A 3RKJA 1HYHA 2GMWA 2JAQA 2R8ZA 3DSRA 2XF8A 4LWPA 5EJ6A 1N6NA 1B0ZA 1CY7A 3DC2A 3LAWA 1UPBA 1AKNA 4W1RA 5AKKA 2GCEA 2A35A 1CLEA 5A2GA 4YP0A 1QE5A 1WE7A 1SVIA 3DCIA 3DGFC 4HGYA 5JHBA 1SFRA 2Q3DA 4P5DA 1XPOA 3K09A 1R5OA 2X5NA 1OE0A 3GGDA 5K8VA 1M2OA 4WN9A 2HCFA 4DMGA 5DNVA 3WMEA 1X2EA 3LC7O 4WE3A 3ZXXA 5EHZA 1O0CA 1AKWA 3R9IA 2V0CA 2GMIC 3HABA 3K0BA 3GH1A 2AFIE 2GRIA 4U2EA 3V1NA 5J5CA 4ER7A 2EFEB 3ZOZA 5L3SB 1AKYA 1XNQB 1O8BA 3QMPA 3TTVA 2RDGA 4I6PA 1K3FA 1SUCA 3TIIA 4F6CA 4TVSA 7AT1A 1AKMA 3TZBA 2MWSB 4KV9A 4R2MA 3O8OA 3OX1A 4TRMA 3T6KA 4LF6B 1D5MC 5JZEB 2I0FA 1KRXA 1AQIA 3BXXA 2IGBA 3RYCA 2R7MA 4JLDA 4RF4A 2H6AA 3W3AH 2Q5IA 1FXSA 2PE6B 4OJQA 1H2ZA 1KIAA 2OD2A 2RK3A 3NDBB 5DX8A 4UUMA 1YS7A 2NGRA 2XQVA 4QT4A 4MUGA 3CIRB 3RNFC 2HD4A 2OTCA 1S0UA 1ENZA 2Q3LA 4KVZA 3OHPA 2QJLA 1Q2UA 1K0UA 5KOIA 4HHEA 4WEOA 1JDTA 1SKQA 3SYRA 4BKQA 1NV9A 4LZJA 5EWMB 1CR4A 2XX3A 4DHJD 3GMIA 3I6ZA 3NT4A 3OA2A 4JQSA 3IOBA 5AI9A 2Q5OA 3WV5A 1JECA 1TY2A 2X41A 2Y1WA 4H15A 1E98A 2BZGA 4ZYTA 5AW6A 1G8SA 3DDZX 1SBBB 1TX4B 3AB8A 2DWQA 4RCZA 3ROZA 1RXYA 2PKYX 1SVOA 5HDQA 1Q7TA 2WTMA 4PPNA 1WUTA 1BEZA 4KQIA 3T9EA 1KDPA 4JVNA 2ZBPA 5JJLA 1HDGO 4REQA 2QW8A 3QTTA 5IARA 2COUA 2KLBA 4DGQA 3UTDA 4YLYA 3IOYA 1APBA 2PX6A 4U7WA 1ATIA 2ZE6A 2X9NA 4N6EB 3K35A 2WWIA 4EG3A 2IYOA 1OX5A 4Y6SA 3DBSA 3NONA 3C3BA 1DOYA 4PPQA 4J76A 2ZIWB 3HXMA 2I38A 3UB4A 4GKBA 1WTAA 3C16C 5CG2A 1TVKA 4WOKA 1IJFA 4R8MA 1OZFA 2HA5A 1UL1X 4RJIA 4KDRA 1MFWA 1KAOA 3IP8A 1SK9A 2XGJA 3U30A 2F90A 2X2FA 3A2MA 3I2KA 3EW9A 2XUGA 5DWVA 5IAJA 5T8IA 4HLUC 2MBEA 5FYQA 3GRZA 1GZSA 3IUJA 4U5XA 2Q9BA 2FE1A 1TF2A 3KYCA 1O9BA 4W5WA 4WZAB 5DPRA 4WDRA 2GFQA 4TKMA 3QJZA 3L17A 1S02A 3KPVA 4FT4A 2ZRAA 3K2EA 4REMA 2ERCA 3NVMB 5EPEA 3S27A 5M04A 3T4UA 3GZ4A 4TYNA 1BUIC 1PW7A 4IS2A 4UHCA 2WNHA 5BQ5A 4BFVA 4RD2A 4OYLA 4B4WA 3LDAA 3O03A 3JVZX 3LX4A 1N0UA 4PC3A 4PS8A 1UXOA 3O4FA 1KERA 1USKA 4JI0B 1VE9A 2BMJA 3I5YA 2H65A 3AP1A 1YJBA 2GZ2A 2JI6A 3K8ZA 2DECA 4XQ0A 4YAOA 3VAAA 4IDBA 3EY4A 5IH7A 4ZU6X 3U4GA 4FX5A 1NBHA 1X80B 4W5JA 4J8PA 3WBJA 1JDJA 4CTKA 3PE3A 4CIBA 1FSZA 1A1VA 1XZKA 4DIBA 1DUSA 4YV1A 2FHXA 1USIA 1KGDA 5D3KA 5KDLA 1LZLA 1NAIA 2ZUVA 1AK9A 3OMWA 3ZXUB 4C1BA 3DXFA 1OXBB 1EBUA 1E3WB 2R8PA 3DTNA 1ZSVA 2K5PA 3EZ9A 5CK5A 4DJAA 1FDWA 1GGHA 4GBGA 4DUGA 4US9A 3HWWA 4EZEA 2WT8A 2I6SA 3Q7PA 1DTWB 3NUZA 4BE9A 1EDBA 2ZTHA 3CZPA 3QEOA 2BSQA 1EIZA 2PSEA 2NSDA 1MAUA 1JXMA 1H8HD 3AU4A 5EAIA 3W06A 3G49A 3OKCA 4RTQA 4J7XA 5JAHA 3AUAA 2H1IA 2HBYA 4YDSA 5AW5A 3KH0A 4C5CA 1O97D 1E9AA 3NIBA 4XWGA 4S05A 1MOSA 3AWIA 4RXUA 2VF5X 5AJZA 4DTIA 5DPMA 1FJ2A 3UW1A 1V35A 5ILGA 3WL7A 3QG5A 4B3TB 3HCCA 1W73A 1DT3A 3MILA 4RSMA 4NAVA 2FPOA 4RHCA 1YB7A 1PZXA 1Y8RB 2O7NA 2ACWA 4F38A 2J45A 3KWLA 3MJ5A 4C0WA 1A7TA 3NYIA 4IF4A 4MP3A 5EIAA 3AG6A 3LP5A 4IFTA 4ZN6A 3U48A 2JW5A 4K3CA 4AQDA 5M2QA 4W9IA 1P8AA 3HBMA 2WXKA