4XWTA

Crystal structure of rnase j complexed with ump
Total Genus 180
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
180
sequence length
543
structure length
543
Chain Sequence
b'APTLEVIPLGGMGEIGKNITVFRYGDEIVVVDGGLAFPKAHQMGIDLIVPRIDYLLEHQDKIKGWILTHGHEDHIGGLPYIFARLPRVPVYGLPLTLALVREKLSEFGLQDVDLREVTYGDEVRFGQSFVAEFFCMTHSIPDNAGYILKTPVGDVLHTGDFKIDPDVGTGAGIVSDLERVEQAGKDGVLLLISDSTNAERPGHTPSEAEIARNLEEIIKGCRGRVFLTTFASQVYRIQNILDLAHRQGRRVVMEGRSMIKYAQAAQATGHMNPPEPFLTSEEVGELQDQQVLFVCTGSQGQPMAVLGRLAFGTHAKIALRRGDTVILSSNPIPGNEDAVNLIVNRLYEIGVDVVYPPTYRVHASGHASQEELATILNLTRPKFFLPWHGEPRHQINHAKLAQTLPRPPKRTLIAKNGDIVNLGPDEFRVSGTVAAGAVYVDGLGVGDVNDDVLLDRVNLSQEGLLILTAVLHPTPHVEVVARGFARPNRDLELQIRRVALEAVEQGLREKKRLEDVRDDMYGAVRRFTRKATGRNPVLIPMIV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DR2417
publication title Structural insights into catalysis and dimerization enhanced exonuclease activity of RNase J
pubmed doi rcsb
source organism Deinococcus radiodurans
molecule tags Rna binding protein
total genus 180
structure length 543
sequence length 543
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
A PF07521 RMMBL Zn-dependent metallo-hydrolase RNA specificity domain
A PF17770 RNase_J_C Ribonuclease J C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.580 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4xwtA03
3.40.50.10710 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Metallo-hydrolase/oxidoreductase 4xwtA02
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 4xwtA01
5B15A 5HIPA 5AXRA 2BFZA 4UBQA 2BMIA 4RBSA 4LE6A 1KO3A 4TZEA 1A8TA 3IEMA 3X30A 2DKFA 1JJTA 1YCHA 3TP9A 5B1UA 2Q42A 3JXPA 1K07A 2FK6A 5HH5A 3I15A 2Y87A 3KL7A 1ZKPA 1ZTCA 3P2UA 4H0DA 5EVKA 5LLDA 4J5FA 4ZNBA 3SRXA 3SBLA 3BK1A 2BG8B 4TZFA 3FCZA 4D1TA 1M2XA 2NZFA 1DXKA 3QH8A 1BMCA 4XWTA 2FHXA 3ZQ4A 4BZ3A 1VJNA 4D1UA 1MQOA 4HL2A 2QDSA 5LM6A 2NYPA 5ACXA 5A0TA 4FR7A 4F6HA 4YSLA 1XTOA 2WHGA 3F9OA 2BFKA 1KR3A 2BG6A 2BC2A 4XUKA 3IDZA 1WRAA 4WD6A 4GCWA 1HLKA 4FEKA 3IE1A 2YCBA 1XM8A 2YNVB 5LS3A 3BV6A 5B3RA 5AYAA 3AF6A 5HH4A 1SMLA 2WYMA 2NZEA 3S0ZA 4UWSB 5EWAA 4C1DA 4DILA 4EXSA 4CHLA 4ZO3A 4KEPA 5LE1A 5EVDA 2H6AA 5HIOA 1E5DA 5ACPA 1KO2A 2GMNA 3IE2A 4HL1A 2CBNA 1VGNA 4TYTA 2BFZB 4NQ4A 3MD7A 3SPUA 2FU8A 1A7TA 3KNRA 4O98A 1X8IA 5KIKA 4Z5YA 5IQKA 3T3NA 2Y8AA 5FQBA 4Z7RA 2YNWA 4Z6XA 1DDKA 5EHTA 4YSKA 3VQZA 3RKJA 5K4NA 3A4YA 3ADRA 4C1GA 3DHCA 5LSCA 5LMCA 1VMEA 1JT1A 2M5CA 2FM6A 2XR1A 2FU7A 2OHIA 3I13A 4EFZA 4TYFA 2YNTA 3DHBA 2BR6A 5ACUA 3IELA 2UYXA 3PY5A 4EYLA 4HKYA 4EY2A 2I7XA 2FHXB 2AZ4A 4ZEJA 4C1EA 3T3OA 1WUOA 4TZ9A 2ZZIA 2Q0IA 4Z67A 4D1VA 4AD9A 5ACQA 3Q6VA 4UWPB 3SD9A 4KEQA 3FAIA 3ZNBA 3VPEA 1L9YA 3AJ3A 3G1PA 3BK2A 2YNUA 3ZR9A 3H3EA 1JJEA 3DHAA 3AF5A 3R2UA 3I14A 5ACTA 4J5HA 5K4MA 4C1HA 4AWZA 4TZBA 2FU9A 5LCFA 2QINA 2NXAA 2I7VA 4NQ2A 4JO0A 4C09A 5LCHA 2OHJA 4P62A 2BG7A 5KILA 2ZWRA 2Y8BA 4AX0B 2P1EA 2R2DA 5DPXA 4B87A 2HB9A 2AIOA 1BVTA 1X8GA 1WUPA 4Z5ZA 5HH6A 2BTNA 3IEKA 4UWRB 3PY6A 4RAWA 2Q9UA 4F6ZA 1Y44A 3RKKA 1QH5A 3ZWFA 4D1WA 3X2XA 2BFLA 2DOOA 2GCUA 2P4ZA 1QH3A 2ZNBA 4UAMA 4PVTA 2P97A 5FQAA 1X8HA 4YSBA 2GFJA 2QEDA 3IOGA 2YNTB 4U4LA 5AHOA 2OHHA 3SFPA 4FSBA 4NQ5A 3PG4A 1BC2A 3BC2A 1ZNBA 1P9EA 3SW3A 2I7TA 3ESHA 4C1FA 2QJSA 4UA4A 5EH9A 4NQ6A 5AXOA 5K0WA 3RPCA 1YCGA 2XF4A 4PVOA 2YZ3A 3X2ZA 5ACWA 5ACVA 4EXYA 5EW0A 2Q0JA 4RAMA 4RM5A 4Z60A 5LCAA 5A87A 2WRSA 3X2YA 4RL0A 5HISA 4AWYB 5AHRA 4V0HA 4D02A 3T9MA 1YCFA 1DD6A 2BG8A 2QDTA 4BP0A 2M5DA 2FU6A 2BIBA 2WYMC 5EV6A 5HIQA 3KNSA 5A0VA 4UWOB 3WXCA 4EYFA 5AEBA 5K4KA 4RL2A 2VW8A 4C1CA 4AX1B 4GYUA 2BGAA 5ACRA 5A5ZA 4EYBA 2GFKA 5EVBA 2A7MA 2GKLA 4ZO2A 3DH8A 3I0VA 3L6NA 3IE0A 3I11A 2WYLA 1WW1A 2YNVA 4DIKA 2ZO4A 3IOFA 5EV8A 2P18A 5FQCA 4GYQA 4XWWA 3LVZA 5ACSA 2E7YA 2BG2A
chains in the Genus database with same CATH superfamily
2PYDA 4QPCA 1P72A 3TQOA 2C0QA 3JXEA 2D3GA 1MVKA 5JD5A 3KFVA 4FSHA 4KGZA 4GXBA 2P2YA 2IPMA 2BKRB 4IM7A 4YLGA 1RQXA 2VYQA 2VPIA 2MYPA 2JH9A 2EMSA 4XM1A 1WXSA 3P0RA 5DH9A 4L7QA 2B1QA 1ZQ9A 1KDYA 5IH7A 2BTEA 5C3JB 2E87A 1CJBA 4EEKA 2KNBA 1THMA 2CFRA 3WAPA 2XMBA 1HFEL 4L9RA 4LJ4A 4NI5A 4WKNA 4YUYA 4A5SA 5C1IA 3MGKA 5AKEA 3VSEA 1X7WA 5DVZA 3LUFA 2IO1B 4BASA 1U2DC 4II2B 2KX7A 2JQRB 3ELUA 2P5SA 3VDXA 1GG9A 2Q6LA 2YYAA 1OZ0A 1QNLA 4KN6A 1TZ1A 4OI4A 1KR5A 1XKLA 3BB1A 4MUXA 1PYOA 5BMVB 2TMKA 3QMWA 2V3PA 2PHZA 1ZJ6A 2JJ8A 2FOLA 3VX3A 4XI9A 2FZVA 1XCMA 1H5NA 4M98A 4MELA 3ZHSA 1RI1A 2RIRA 3DVQX 4HX9A 2C2KA 4DSZA 4O8ZA 4D81A 4KVZA 4AECA 4HUTA 1JIJA 4ZVUA 1H2RS 3VC1A 3KR9A 3R7WB 3BIOA 4M99A 4AN0A 3S1AA 3PUXA 1RYHA 1NKSA 4LRQA 4OVZA 5AXCA 3J7AC 4KQMA 3DWMA 2R97A 3L7CA 2PGNA 4PWYA 1EM7A 4MPPA 3AERB 4C1EA 4N12A 4GMXA 2P5TB 1ZL2A 3H1PA 3R3HA 4DG9A 1T8UA 3FTCA 1V2HE 4OK5A 3I39X 3QKSB 3PGKA 2FSHA 3SYLA 4C0HA 3ZGYA 4KGXA 4CGZA 1E1LA 1Z5NA 2CEAA 2QTBA 4WJOA 5HKKA 5H3LA 2VZ9A 3O9ZA 2XYHA 1VMDA 4RFVA 2H89B 3PRHA 5IKXA 3W2IA 2PPLA 2ZWRA 2FCRA 3T3EA 2CF6A 1MRZA 2HB9A 1ABBA 1WUPA 1OW3B 3RVKA 2M6LA 3M1YA 4LDTB 2XWJI 3DVSX 4HXEB 1BX0A 3FNQA 2R3SA 1EQUA 3TSSA 3WZLA 1I4DD 1X7GA 3ZU5A 3M89A 3VR8B 4TLMB 3LFTA 3I6BA 3JQFC 4IIJF 3TZQA 2MWSB 4FJ0A 1OVGA 1H2AS 4ZC8A 2J4FA 1X1MA 3PBKA 4FOSA 4A73A 3W34A 1YJQA 3JQBC 1GHTA 3Q3HA 4P0PB 3MFQA 2YTZA 2J0UB 1JW9B 3MILA 1XTVA 1Z6GA 4LJRA 2IUSA 3CCCA 2AX5A 3LP5A 3I8XA 2VAPA 4US9A 4BNWA 3V55A 5D85A 1ZCFA 4PCUA 1QH1A 1RI5A 3H2YA 1F4PA 2IRWA 5BP7A 3K73O 1THGA 4UWOB 4TQAA 3BWEA 2PKQO 5A23A 1NLUA 1XJ5A 2G63A 4BNVA 4QUHA 3T7CA 3R3VA 1FPYA 4HXFB 3OUTA 4BBNC 2INNE 4MWZA 5JSYA 2HWKA 3RVLA 1XQ1A 4G0PA 5FA5A 3O5AA 2XX3A 3KAPA 4PONA 4B0PA 4CQLB 3DQVA 4RJKA 2XNDD 2Q8PA 4FQ5A 1CDEA 3ACBA 5IUKC 3P9PA 4X92A 4GUDA 1M33A 3KPVA 3ABOB 1NBWB 5HIPA 1QHIA 3FILB 2ICIA 4QU5A 4J90A 4EKGA 2VYNA 4A1FA 1JB9A 3AM4A 3TAUA 1I24A 3COSA 3FH0A 4YXWD 1ONBA 1VTKA 5DM4A 4J1TA 4B84A 3I1IA 3R09A 1N8NA 4L23A 3WLIA 2M1MA 2P1ZA 1SOMA 2B25A 1L5MA 2QGNA 1FZQA 4IW3B 1RRGA 4KAAA 3RABA 1LS6A 1FYEA 2BEJA 4G0YA 1BEZA 1OKKD 3JYUA 4KR7A 4HRAA 1EFVB 4KH1A 4JC0A 1T2CA 3SIPA 3ICWA 2EGHA 1TDJA 4TYWA 4G4SP 2GBRA 3M4XA 4KN9S 3SEBA 1PX2A 4YDQA 1ULSA 2JF5A 4YGXB 1U9CA 1RPZA 4J0HA 2VRRB 3PGVA 3ZV3A 4AXXA 1YAHA 2W0SA 4IEFB 3G5LA 4NMXB 1ZWKA 3H8HA 5EVDA 2O2XA 1BGWA 2NYRA 4CMIB 3WLQA 4HFJA 3M2TA 4YP1A 2I6QA 5AXAA 1V1OA 3WKBA 2W6NA 4R0NA 2O2CA 5JCJD 2VWHA 1U1CA 3AU9A 3DE1X 1VI2A 3WX0A 4X8HA 5DX8A 4Q7EA 1T6ZA 4Q66C 4NAVA 5JADA 2QBYB 3RDPA 1NURA 3TL5A 1VMEA 2GF2A 4QRIA 1PNRA 5EE5B 5L3ZA 4PICA 3USES 3OZTA 5JXGA 3QF4B 5IKEA 2BR6A 4JS0A 1DC5A 5CNKA 5LQKA 4IJMA 3HCAA 1VIAA 1UEIA 2MHJA 2G80A 4DHZE 1XX6A 2WWWA 3AF1A 4UNIA 2CSUA 4HNQA 1BFUA 3DM5A 4LKRA 2GBLC 3R3YA 2PZMA 3D0QA 4FNGA 1I0LA 4R1SA 1AQ6A 3U7RA 1I7SB 5J2TB 1Z8NA 4QYTA 1YJJA 3BK2A 3U49A 2I22A 3M7IA 2Z5VA 3JAMA 1YDMA 4ZDIA 4DR4B 3X1XA 1E0SA 4I1OA 3U7GA 3PRJA 1I4PA 4BGIA 3TQFA 1EA7A 4GIBA 1VE1A 3BEOA 1G6OA 4ZHQA 4UM9D 2HMWA 3DGFC 1I4WA 2UYZB 2CSXA 4BXOA 3ZVMA 2G1JA 3B1XA 4MVJA 1UK7A 1XNHA 4PAWA 4RE5A 4MGYR 1SK9A 3ECAA 2DEUA 5ALZA 3LUDA 3NEJA 4KPUB 4UQPA 3LNCA 3QXXA 5F2OA 2DAJA 3W5VA 3KDAA 2JH8A 3PNSA 3UIEA 2AN3A 1Y5LA 5KYUA 2BSQA 4ARCA 2FBWB 1IP9A 2OKCA 2VDJA 4KBYA 5IVIA 5C37A 2P2DA 1RS0A 1C41A 1C4WA 3MM4A 2P62A 4P1BC 1RWMA 1VLLA 4WJPA 3CX4A 1ID1A 3T7SA 1EM8A 1T8YA 2AC4A 1UOQA 2WE7A 3X2YA 3R0IA 4ZQHA 3AV0B 4HSEA 4TMAB 4HNUA 4JBWA 4JMLA 3ZI4A 1B93A 4DDVA 2VA9A 4KN5A 4E70A 1SM4A 4KXXA 3U5TA 3E7FA 4R69A 1LDGA 2P77A 4LECA 4EGFA 4PS7A 1O6CA 3JARB 2I1QA 5EE0A 5SZKB 1N6NA 3ZWPA 1I0IA 2FUEA 3D8HA 4LF9B 4PR3A 3OC6A 2O8DB 1JLKA 5COQA 2WXNA 4DIOA 4LKOA 3U19A 3VBEA 4JIOU 3U44A 3EGXA 3HJGA 1AF4A 2P75A 3VH1A 4EEXA 4PG4A 4S1VA 2H1SA 1DAGA 1LDYA 2PH3A 1OB2A 2Q6OA 2O6VD 2R8XA 1MH1A 1RBZA 2WWIA 4C14A 2ZYSA 3MT7A 3PXEA 4GO1A 2E5WA 1ZDMA 1KLGD 4QJIA 4J9UE 1J0GA 4Q1DA 1RRPA 4Q9HA 4MI9A 4EABA 1QKJA 3IKMB 4DXFA 2HRBA 4RVSA 4DSUA 1UC5B 4C43A 1S4MA 4OUKX 1ZI6A 3DFZA 1YJ8A 1ZVVA 1JXMA 1AKYA 1U1DA 4D41A 1VBNA 3GL9A 1ZICA 4R2MA 2BGGA 2IHZA 4V38A 4BBZA 4ZMRA 4NU6A 1N2GA 1XLTA 1PR6A 2QL5A 4U8HA 3W4IA 1U0JA 1T9AA 1WEKA 1KEZA 5EQFA 4BNDA 3N9YC 2H52A 3DAPA 3FA2A 4DG8A 2DJIA 1GZ3A 3OWHA 3OC0A 1TAHA 5D3QA 5LQAA 2X2OA 2V58A 3R8XA 1BCSB 4RY2A 3PQEA 1RZRA 5EXDA 2ZJ5A 4XVQA 3I5YA 2F62A 2P9TA 2VJNA 2V0NA 2V55B 1SGHA 1ECBA 2H1LA 1LLDA 3DF9A 4C5CA 1P73A 1Y0BA 1D5MC 2B3TA 3MCVA 2RBEA 4R9VA 1U2ZA 2C5GA 1OAAA 2AG1A 2M19A 2HBYA 2I4OA 4KAXA 1Y6FA 2MJLA 1KMMA 4BB5A 2G8NA 4UULA 1YB2A 4DWVA 4WK4B 1OGYA 1Z0UA 4RZIA 4EYSA 3OCVA 3QPCA 2WHRA 5J47A 2JFWA 4D7AA 2HRZA 2L3ZA 5H92C 4N5DA 3K9NA 1ZD9A 1SUAA 2REOA 3Q7EA 1MFWA 4CEHB 4HKYA 1GGNA 3TTWA 2QUJA 1GRQA 4TZ9A 1QTQA 4BO5A 3VR9B 4RIFA 2FWIA 2IEAA 2AI2A 4IV5A 3JWPA 1KY3A 1SC3A 4KQXA 2JVCA 5JDIC 4WXHA 3RYCB 5TSSA 1IDOA 4IX9A 3L7JA 2ZYUX 3OTGA 3R7DA 2FQQA 3RVSA 3PGA1 4IJKA 3R77A 4YRDA 2ZRJA 1MV8A 2FU9A 2MDTA 2HGZA 3O26A 3A1CA 2HCBA 1QZEA 1NRXA 1F8YA 4B35A 1IUKA 1SWWA 1D3ZA 1JEQA 3P7MA 5GZ3A 3SZLA 1JAYA 1Z5UA 3KJEA 2VDMB 2GRIA 3NM5A 2PLPA 3K32A 2J7QB 2AOXA 2XKKA 4JVOA 1QGED 2C9BA 4C6HA 3KEOA 3OTQA 2XDYA 2FNJB 1R88A 1SUSA 3N3KB 4YI3A 4CM7A 4JJIA 5KNCH 3BQNB 1ZW1A 4QJBA 4UBIA 4HDMB 1RM4A 1QK4A 4ZVKA 4FLFA 2MYNA 1D2AA 1H4SA 2GNAA 2IHKA 1FF9A 2XF4A 1P9DU 4D3XA 4LTUA 1CNEA 1N5DA 2AGVA 1MIHA 4K5QA 1EGHA 4FS3A 1M6VA 1QU3A 4UTRA 1L6VA 1XKXA 1FDUA 4BP0A 4P3PA 5FPTA 5HE9A 1GGMA 3N2LA 3QENA 3VFDA 3J81k 4KOEC 4TLDA 3BHNA 3ZZMA 1TW3A 4NOLA 4HBZA 3RRFA 3C74A 5EMLA 5T8KC 3EFOA 3RIEA 3EF0A 1SOWA 3LLMA 5JZSA 4WACA 4EHAA 2WX1A 4G4SO 3BJRA 1SQ0A 4EUKA 4LDPA 3RS0A 2HW8A 4AD8A 2X4DA 2DH5A 2YY5A 2P18A 5LLTA 3HB7A 2CY0A 2PJDA 1CEXA 3HP4A 1YB1A 1WJGA 3SICE 2D2EA 1J00A 4KQFA 4DTIA 1EDBA 2C98A 3GEPA 4F2GA 1SKYE 4J0QA 3BQMB 3WKCA 1AKWA 4UD2A 1C9JA 2VHTA 2VZEA 1Y7HA 2WTMA 5JASA 2B37A 1P39A 2CYAA 5KQMA 1KSGA 4ZVLA 1SVLA 4DCTA 5L9AA 3PSEB 1J0AA 2ODQA 2GB4A 3MGBA 3WAJA 5JAQA 1VG0B 1PDVA 3OHMA 4AS2A 1FUYB 2WT4A 4AN4A 4E4RA 1I7QB 2K8CA 2QN3A 4EHBA 3DLPX 2OGSA 2VHYA 5FAKA 1BJTA 1KOJA 4UM8B 3SK0A 1S2MA 3S2YA 2N7EA 1ZM9A 5IASA 3P52A 2WY2D 1HDRA 3OO1A 3A70A 1RRCA 4PZ0A 1YQEA 5DTJA 3GLFE 1TF7A 1L5HA 3KALA 4I46A 1G8GA 3JQ7A 3BJMA 3IUSA 3U13A 5BRJA 4ZDWA 1BZYA 3G2MA 2CDCA 2NU8B 3JSXA 2VP0A 1VPWA 1DNPA 4RH1A 1CJMA 1XXHB 2SKDA 2NP6A 5K3FB 1NJFA 5ER6A 5LE1A 2CV1A 4G1UC 1W88B 3ETRA 3ZCUA 2X58A 3GP7A 2VRNA 4JDUA 4JLJA 2HSEA 5IABA 4DBGA 4MICA 1KH1A 3MCZA 2IZOA 4UE3S 4XGIA 2KC1A 4UBLA 5EEGA 5FOUA 4HWTA 1Z4MA 3OQIB 2CV0A 4YUXA 3BRQA 3MAAC 4P9NA 3UEOA 2GMIC 4YSKA 1CQZA 3ORQA 2ZCJA 4YVFA 2CJNA 1A7JA 2EX0A 2IV3A 4IIHA 1R00A 2G6TA 1E79A 1OAOA 1GAQA 3E81A 2GEVA 2C7BA 5JPCA 4C03A 2JPHA 2PUBA 3IELA 2NXEA 3GRUA 1SHZA 2C7GA 2RD2A 2M56B 1R6BX 4XJTA 3F4BA 2PXHA 3BN3A 3WAMA 3RF6A 1Z6AA 3VMMA 3ZE0B 3DHYA 4GI7A 2H1VA 4DKXA 2WLTA 3VPHA 5HIKA 3ENZA 4ALIA 4MWCA 4W7IA 1WQ4A 2W2PA 1BVRA 3LH5A 3JU3A 3H87A 3E6AA 1ZMBA 4O4IB 2F1KA 4HQ0A 3H2BA 4KGDA 5LBUA 4HRYA 4RZXA 4ZYZA 5C8VA 1RM0A 2QUZA 1LXDA 3PKZA 3PNLA 2GRUA 2WM3A 3PR1A 4RKFA 2O7VA 3H04A 3ND5A 4BVEA 2BDUA 4P2BA 1A95A 3ZVVA 4PQFA 3DMDA 1V7CA 1M1ZA 3I9NA 4B87A 1DAEA 5JCXA 5FR2A 2MIIA 2H7XA 3KLNA 5C34B 3L0YA 3E82A 1CVRA 3PY6A 3LUGA 4HVBA 2JATA 2WFAA 3F2VA 1WOYA 3LIPA 3MHZA 1RAIA 1SIOA 2NU9B 4DV0B 2EV9A 3TM5A 1F4VA 4LZAA 4XYMA 2CJXA 1NZJA 2W54A 1H66A 1D2MA 1N34B 4ZARA 3U09A 3ND6A 1PP4A 2F00A 1L5SA 1CYEA 1X7ZA 2DR2A 4QEZA 1XYGA 5CH8A 1REQA 4OJNA 4ZJUA 2I6UA 2QMYA 4NJMB 3RASA 4JBNA 2ORED 5P8WA 5ELMA 3X2ZA 2Z0MA 5AT1A 4PS0A 1V5FA 3L7BA 1V7ZA 2R6ZA 3RK0A 1G8FA 2Z5LA 2VNJA 2CNLA 1QRRA 1KVUA 2NXCA 1U11A 2FPGA 2C9CA 1OQYA 3WWEA 1ISSA 1HDIA 3Q0TA 5FD8A 1J2TA 3N8NA 2IO3B 2CXOA 4GD3Q 3KM0A 4U2EA 1OT5A 2A4MA 1JLHA 4IKGA 4PGMA 2JRIB 4HADA 1KTKA 4RLHA 2VDOB 4I4CA 3ST7A 3NJ4A 3HRDD 1K3UB 3Q5DA 2VHJA 4UTXA 7MDHA 2I87A 3Q1LA 7ADHA 3OLQA 4U02A 2L7RA 5FR3A 3N7AA 1LPSA 3HBLA 2XVZA 2Q9CA 4WOBA 4YH1A 5D3KA 3MQ4A 1ZVMA 2GVNA 3NGXA 4XPIA 5CM9C 4CLHA 3UFXA 1YBMA 4NCAA 3IBYA 4G9EA 3H5VA 2AL6A 5FWXB 2J46A 5AOBA 1KO3A 1NF8A 4R31A 4U2BA 4NXMB 3KR1A 2G36A 4KWCA 4MV7A 3FB4A 2CXQA 2LCIA 3LQ1A 3ZIAA 2RAPA 4ZTBA 4W6QA 2IXBA 3UQYS 3GFOA 5LMZA 4TTQA 4CG3A 1UH5A 5CNJA 3MTQA 3C0RB 1E9DA 4G5RA 4EUTA 2XF8A 5AO9A 1RW4A 3CBGA 1WZ2A 2PJRA 2CK3D 2NSYA 4M6WA 2A9VA 4B95A 4HEJA 2XPCA 2KN5A 2XUPA 2Y77A 5J5VA 5JEEA 2XZDA 1OJ7A 1MTOA 4M1MA 3OOWA 3BDAA 3TLYA 1V1RA 4K6HA 3B6MA 2FEWB 1GP2A 1I1QB 4ON9A 2B5WA 2O2YA 2KFKA 5LN1A 2X1HA 3D6FA 4PAOA 1A8PA 4LRTB 4Y1GA 1CP3A 3DFFA 1Z5WA 5AYAA 3PUJA 4KQGA 1OFFA 3U0VA 4GQBA 5HJ2A 1Z7GA 2JGKA 4DMRA 4Z4HA 2XEDA 3HJCA 2NSHA 4MWDA 3MJCA 1EWKA 4IDBA 3NTOA 1EK5A 2VHQA 3MD7A 2L17A 1A7TA 3O84A 5ECDA 3CNNA 2NZXA 5JS7A 2Z59B 4JP8A 2FGJA 2NZ2A 3HH8A 4WGGA 3ORFA 4GPTA 2GEUA 3ND8A 3W6PA 3DAYA 3WYFA 2OSVA 4LVCA 2HTME 4QKQA 3K2IA 2OGWA 4J2OA 3B2FA 2O7QA 2NQ2C 5KC8A 1MNAA 4CG1A 1OMOA 2JI7A 1M5RA 3G13A 3JR3A 3PSAA 4ER7A 3T7TA 3IHLA 3PVSA 5E6NA 2BDTA 3UW1A 2PMBA 1WNTA 3P4YA 4NZOA 4OP2A 3F71A 4IV8A 1DG9A 4GBJA 4KDFA 5FJIA 4PZAA 3ERCA 4ML3A 1C50A 2YJ5A 4PX2A 2H0AA 3B1VA 2QY9A 3FOCA 4QO7A 3VHQA 2MT9A 3WR5A 1YMHE 3H2ZA 1C9YA 3HXMA 4NATA 3MYRA 1V8BA 1UWMA 4I1IA 3V1MA 3AY6A 3CT6A 3PG5A 2BFDA 3SCZA 3IUYA 4RDCA 2IGDA 3V8MA 2UUBB 3OTHA 4E51A 2AA3A 2VL7A 4A10A 3PX2A 3ALBA 2OMEA 1TM1E 1IJFA 4RCYA 1JROA 1RCUA 1ACCA 1YAJA 2EGGA 4E11A 4RE6A 1CY1A 2OEPA 5F52A 1WDLA 3DH0A 3X2FA 4WGFA 3VR3D 2GBJA 4Z8YA 4GLSC 3BXXA 1N4DA 4V1CA 1HQDA 3JQAA 4CM9A 5JNSA 4PNZA 4JEHA 1SG0A 2BSAA 1FMJA 3WLKX 2CZQA 2IPXA 1Q77A 5DBIA 1R12A 3CB4A 3IO3A 3GDHA 5J5CA 1E9RA 1KZ9A 1XQ6A 3HFJA 1OXUA 1KY5A 4DSNA 3PXDA 3VR6A 5KHOA 5JROA 2WMYA 1NU8A 4ZEMA 2NVWA 3ADBA 2W2XA 1Z08A 2HJVA 1QVWA 4EXYA 3QG5A 4WY5A 2QTLA 1QS0B 3JQ9A 1JVNA 3O2JA 3OAAA 5A87A 2MR5A 4IJ6A 3TQSA 4JVNA 3I63C 4D8WA 2OYRA 2C2MA 4MV8A 1SUEA 2IEZA 3LOQA 2B3DA 2J3LA 2O7NA 1UBMS 4N01A 5TEWA 5DK4A 4QBHA 2MCNB 2ODAA 5GV8A 3KXPA 3HWX1 2VJYA 2IIQA 1GL9B 1OXXK 2R6R1 3HJRA 3UHFA 1Y9DA 5GIPE 4QQKA 1J9ZA 5IXJA 3O03A 2VCHA 5EZ5A 1A2QA 4LSGA 3DFIA 4X1KA 5CK4A 1G5TA 1QYWA 1PR2A 4IRUB 1JLLB 4GYQA 1YACA 2CNKA 3V80A 2IHNA 2KYWA 1BXZA 2BMFA 4KPEC 2PD4A 1SXGA 2J3JA 4ZIRB 1P1RA 1R5JA 1QTNA 1V3TA 1G7TA 1GILA 5DHFA 4CCYB 3DTNA 1YHYA 2DH6A 5K8LA 3BA6A 2ZVPX 4P4NA 3X30A 1D1QA 3HFGA 2B2CA 5KYNA 4F91B 2QRZA 2H4YA 3AJDA 1L4EA 3NVMB 4KGVA 1GV0A 2PN1A 5BPHA 2M98A 3VNUA 1LRJA 2PX6A 2JAHA 2CDRA 4MVJE 2F1IA 1DEXA 5DHRA 1NMYA 5LLSA 4KQ6A 4FP9A 1Z6XA 4IXTA 3L0OA 1TJ5A 1T13A 2PE6B 4J0DA 4G0NA 3HXQA 4WAAA 3X2EA 1XJ0A 4X45A 4XD7D 3EODA 3ZWDA 3O73A 3OD1A 5IAAA 2WSLA 2ORVA 3VC3A 2ZW0A 3G2PA 3ZIUA 5BURA 1VPEA 4C2AA 1KBOA 3KSAC 2W0MA 2ZYRA 4N4AA 1ND6A 4LNIA 2RDBC 1EE1A 1TB4A 5CX4A 3H1FA 1HY3A 1TCCA 3FHTA 4BN5A 1GL6A 4ZO9A 1BGXT 3MSCA 1GCGA 5DP2A 1WZ3A 2Q1TA 4Q4HB 4UVGA 1PU2A 3DT8A 4TS9A 2NVUA 3KOOA 4CCSA 1ZKHA 1IY9A 2FP4A 4NZYA 5TPWB 2WXKA 3BVZA 3A1WA 4MW6A 1SKMA 4KO8A 4DXDA 3ER8A 4DR2B 5FT9A 3UXMA 1P29A 5I47A 2X6TA 4HLDA 5JJCA 5KWJA 1JF8A 3OM8A 2FU7A 3HI6A 1IBLB 2XZPA 2BFWA 2G9HD 4P0TA 3AECB 4CQMB 1LPMA 2BW2A 1RXYA 1UL1X 3TRJA 1XPUA 4I5EA 3M82A 4EVRA 1SCDA 4F6CA 1X70A 3CUYA 3QKRA 1VL2A 2V4ZA 2KK8A 1D6MA 4GNRA 3SC2B 3MIZA 4GWLA 3T99A 1C3OB 3K4PA 5B3KA 2C3MA 2XECA 1RJGA 4JU8A 4HB3A 2VKTA 4XYGA 2NO0A 4ANXA 3HDVA 1NBMA 3T1TA 3N0WA 3E5NA 3M34A 4FGZA 3DZBA 4RETA 1TY2A 1FDIA 5AKYA 5LU8A 2DYMA 1ATIA 4L50A 4E5PA 4CRWB 3KZXA 3LUKA 2A0XA 3PWTA 4YB8A 3IC5A 3JYPA 2D00A 2I34A 3PENA 1GNRA 1DB3A 4UTZA 2JIQA 1L5QA 1FU7A 3CW9A 2EFJA 4G81A 3WNZA 3AIIA 2IUTA 1BD3A 5KNDD 3PGEA 3HR8A 3PR3A 3ZWFA 2OFXA 4RTLA 5I3ZA 4XTRA 3VOAA 2Z6QA 2D4HA 4FCTA 1T1GA 3NZ3A 1SNYA 5T6BA 5CLLA 5K6AC 2Q2OA 1UGMA 4OHJA 4OIFA 1CNFA 3IFSA 1CZNA 1VSQA 4KLNA 4WWNA 2Z2KA 4LE2A 1CS0A 3QYAA 4W8HA 3C5HA 1JQ4A 3GCZA 4OP3A 3IFWB 1B43A 1WMFA 3BM5A 1T2FA 3ONDA 4WNAB 4IIEA 5IN4A 1EP9A 1NUTA 4H4DA 3SBXA 5BQ3A 4A3SA 4P4UA 3RT7A 5KINB 4PINA 1OFIA 3L7IA 5JS1A 1W1WA 2PS9A 4V03A 1XTSA 4QPDA 4QXMA 3MWGA 2ODWA 1U5BA 5T57A 5FBVB 1ZCZA 2DBRA 1I9CA 2EAUA 2RHOA 4WY2A 4C0WA 1JKJA 3EMVA 2GKGA 1UWLA 3H75A 1FP4A 2BBCA 4QUBA 3S1SA 3PC6A 2Q62A 4YT0B 4C0AC 4QQNA 1VCNA 3CPEA 2JS7A 4B75A 2JGLA 4OVVA 3MS7A 1XZBA 2XCUA 3BPSA 1K7XB 4KRYA 5DWDA 1VSBA 3E61A 4B48A 1ODSA 1P9OA 1Q7TA 2IU0A 3IEPA 4MV3A 3I2JA 4IICA 4M54A 5TRTA 2F3QA 3UHPA 3ETEA 3D5EA 1TFUA 1WRBA 4LV5B 4UMEA 3TVDA 3AVQA 3EQ2A 1Y6ZA 4HX5A 4LE6A 4US1R 5BXQC 2IOYA 3AMVA 3ICCA 3P9ZA 4AJWA 3BL6A 4IQ8A 3VUXA 3H4VA 1UKVY 4MH0E 5L95C 2VZ0A 3AU5A 3QUCA 5ALXA 4P22A 4LXUA 3ZC3A 1EJBA 1YBAA 2OHVA 1JJFA 4TXJA 4UPEA 2R1VA 4A8JB 5DNWA 3R4CA 1PQWA 5E3IA 5ALEA 3V7NA 5A3RA 4PIMA 1UBNA 5HF6A 3LZDA 5EERA 4BFVA 4MT5A 4P16A 3GRAA 5EE9A 2EKPA 4DQXA 2Y0DA 3BJIC 4DEVA 5G5GA 1TMOA 2OO3A 3TRIA 3V05A 5FKJA 1QOAA 4UZEA 4OFXA 2H48A 1V11B 4C22A 3HP1A 2M8SA 3E9DA 5LC1A 4N5IX 1P80A 3UUEA 3TIXB 2W83A 4M8KA 1V16B 2O3TA 2YNVB 4YJFA 4I3HA 1U2QA 3BCSA 3KEGA 4IJUA 2NM0A 4NCIA 1FM0D 4ZGGA 5LNK1 2RHHA 4YMLA 1QCYA 3DMYA 4YRNA 4HV4A 3FI0A 4NZLB 3D2AA 3PC8A 1OPXA 1XL0A 2ACKA 3MLAA 2PUJA 1IZ9A 4F2WA 3I61A 1C4XA 1NW7A 4YLYA 1M8PA 3FNRA 3SNHA 4MDYA 3WYDA 1OIVA 1IN7A 1RKVA 4YAEA 1S1MA 2R00A 1DAMA 2GOYA 3SSNA 2MMCA 1J21A 3QV2A 2L0XA 4QGSA 3QFFA 2Q07A 4OI2A 1XZKA 1LTHR 1G3UA 4EKYA 1A76A 3DMTA 5JPIA 1ZUD1 3SHWA 3B7GA 1E2QA 4EFZA 1KLUD 1P5HA 1H2WA 3K3PA 4DARA 3BMNB 3VYRB 2DSTA 4PSVA 3A37A 3CT4A 5FWDA 1KJQA 4ZU3A 1GCUA 3MTAA 4HJKA 1SZJG 2GCOA 3KOUA 5JXHA 3TRDA 5K6TA 1V1MB 3CZCA 3L9WA 2RK4A 3L43A 1ZFNA 2CJWB 2VRCD 2ZUUA 3GT0A 2VTBA 3WGHA 2AOUB 3AEQB 3AJ3A 4Y2YA 2OXIA 1GC6A 1JWBB 3MNFA 4E7PA 2NPIA 4JMPA 3WIMA 1RHRA 3BMOA 3QPVA 3A26A 4EI8A 3ZV7A 1GUAA 3D4PA 4LNAA 1COWA 5GTDA 5CLHA 2UUPA 1ZLXA 3HUDA 3R6WA 2J3DA 1LI4A 2WWVD 2P2GA 2YWJA 4UASA 1HNZB 2JYTA 3JX9A 2K87A 1PZXA 1IN6A 4D9KA 3PHBE 1DHRA 2V8BA 4QU0A 4TLBA 3BD6A 1MC5A 3WI7A 5BV8A 5B4VA 2RKWA 4JB8A 5HYVA 3MWFA 2GFJA 3TR5A 4CUJA 4IDDA 1OH6A 2ORYA 2RSLA 2NUPA 2DENB 1IGDA 3TS1A 1BE0A 3SZOA 5TE9A 5JNUA 2O9JA 3QQPA 1U9ZA 1W4CA 1H3NA 3EGCA 1R4AA 2YVAA 4DLUA 2QMEA 3G2KA 1N36B 4XUGB 1DX9A 2OFFA 2QTAA 3NHBA 3JPYA 1DT3A 1RE0A 4DV2B 3QWIA 4G1VA 1CW2B 1E2GA 2IH4A 2BKUA 4Q3LA 1N6OA 3HCCA 1H85A 2FKAA 4BJ3A 2C96A 3RSQA 1L4NA 4GGQA 2ZQYA 3ZHOA 4S0RA 2MINA 3TI9A 1BDIA 1FQWA 1QPBA 1CE8A 1N75A 1ZN2A 4DUGA 3LBNA 4INJA 1Z83A 3LLVA 4NAUA 2DCUA 3EEIA 1WS6A 3F9IA 5K20A 4G5XA 3KUCB 3L6NA 4E2WA 1JYEA 2I3BA 2DKNA 4R71A 3IUEA 1KVTA 2YCLA 3EPPA 2GAJA 1QQ7A 4L0MA 3N86A 5ALFA 2VHZA 1K4MA 3BULA 1WSAA 4O4JF 4R8MA 4E1VA 1RKXA 2QE7D 1DBRA 1RHMA 5GONB 1VI5A 2A0KA 1PQ4A 2BZ0A 3UICA 1DELA 1NJ2A 3BGIA 1MDFA 4CNBA 3BFXA 3FDXA 3QNMA 3UH1A 3USZA 1H6BA 5BN1A 4DA7A 3UT5B 1B1CA 3UOGA 4NV0A 3R0QA 2MSEB 4L76A 5HOEA 5CAEB 4CF4A 1ZGHA 3N32A 1AHPA 4M00A 3C6ZA 1KGSA 1YR6A 1XN1A 3WL4A 3TL3A 3I1FA 2ZI6A 3PWZA 3LF2A 2BUAA 2V7UA 3D6AA 4UCFA 3Q6MA 4TZFA 2Z1DA 5ETJA 5AVZA 3UBMA 4QWMA 3QBDA 4J0CA 3QVJA 1KARA 4TVOA 3I6MA 5FBRB 1XZ8A 1E1RA 1KR2A 4BN4A 3LOPA 3HN2A 2J33A 1I2AA 3LXUX 2VZLA 2BPSA 4TQ0A 2B0JA 4C05A 1X8LA 2G7MC 3DZKA 1WUJS 5TQVA 4RD0A 3WLLA 2Y0BA 5JU6A 2NPTB 1RLOA 5KMGB 4U2GA 3L2OB 1JIVA 5KU1A 2WAYA 4YTPB 1N6RA 1BHJA 3VV3A 2I6SA 5NLLA 3HCOA 1YFLA 4C4XA 2V4MA 2G9QA 4KEPA 1B1AA 3I72A 4TTSA 5HIOA 3MBIA 2KZRA 3R9XB 1RQ7A 4B3TB 3MWKA 3GVPA 2OAP1 4K9MA 3VU1A 6AT1A 4R2JA 3GEBA 2F55A 1OEYA 1DMRA 1OWOA 5KYVA 1Q1OA 2V6JA 4K8RB 3ZCVA 5EHZA 2HJ1A 3FUCA 3REQB 4LGCA 4KX6B 5DOVA 2GLSA 2ORWA 3MXTA 3NH6A 1EXMA 4KZCA 2EL9A 1DWQA 2XBBC 4TXHA 3E22B 4C1GA 5KUTA 1Z4JA 3ZVLA 1JE0A 3ANTA 2C4NA 3IOBA 2YZMA 2DF8A 2Z2IA 4PO3X 1Y98A 1WGGA 1FK8A 4TZ6A 2FYTA 3KUDB 4I36A 2LI5A 3ESCA 3HJUA 3TR0A 4EPYA 4HLUC 1Z2EA 2QTRA 1NW5A 3HB1A 3VO1A 3TFQA 1NN3A 1I8TA 2EIXA 1T5SA 3TVYA 5BSMA 4OTZA 3WA7A 3FUUA 4DDKA 1GRCA 1L4MA 2WHPA 3L0DA 5D8DA 3ZJYA 4PHFA 3DDCA 1V45E 3KV1A 3L93A 2RHRA 4GQIA 2WUGA 3RAJA 4JGHB 3DHAA 2HA4A 4ZVPA 3CW2A 5LBIA 4CIXA 4AWZA 3M95A 2ZSDA 5LCFA 1KYXA 5FI3A 5LCHA 1EBBA 3KFXA 4EG5A 2QLTA 2ZIWB 2YBEA 2GD0A 3KJNA 3RFTA 4Z3OA 1VYUA 3NALA 3KTFA 1TCVA 4KKXB 1D2EA 1ILEA 2JB9A 2WOJA 3LECA 3RRXA 2N1BA 1CUVA 4MRSA 2G09A 2Y1FA 3W3AA 3G8YA 1W75A 4MV1A 4M1EA 3GJ3A 5AUIA 2ZBEA 2QVXX 4ZHSA 1TLFA 1GZHB 4W7SA 2OSBA 4U7FA 2HXYA 3K92A 4KI7A 4ZOCA 2VUIB 4P3YA 2DCMA 4CBVA 1SC4A 4ASUD 3FR7A 4AS3A 2I2FA 3Q41A 4QUJA 2WA1A 2DWUA 5BW5A 2FPOA 4YRLA 1A7KA 4ZCTA 4Z9BA 3DOOA 3SHQA 1P8JA 3JWJA 3UJAA 3VVCA 2HUNA 3HUFA 2WHEA 5IDVA 3ZHBA 4LISA 4WRRA 1DAPA 1GPDG 3B60A 1FDSA 1PT6A 5B55A 5I4IA 5J59A 2HH9A 2C7PA 3VKHA 4UUOA 4PLHA 3ZNNA 1ELOA 3MXOA 3CMMB 1YB5A 5ES4B 2XB9A 3L4KA 2B5VA 4KN8A 1ZGAA 2WTXA 2OHFA 3ISVA 3FGZA 4KXLA 3QCAA 1IB6A 4AJ4A 4BKUA 3N30A 3GDGA 3ZK7A 1WQ1R 3DBRB 3UGBB 3NEPX 2VDWA 4FEAA 2M6RA 2Q3EA 1V4BA 2WVGA 2GJ4A 1UEXC 3K1AA 4FYKA 4G56A 5K6RA 4JGGA 2BJHA 2WXGA 2B7BA 1X8XA 2D11A 4F3TA 4YWHA 1U0TA 5L3QA 4G0UA 3TD2A 1SKUA 5A6SA 5DNVA 4QDTA 4U9IS 1RWBA 1YE5A 3B52X 4AJHA 3GQBA 2AWTA 3TOXA 1FE8A 4JI3B 3LU1A 1JJTA 1QLWA 5E6SA 3P1MA 1N0VC 2YWDA 1IPGA 3WBKA 3KELA 4GPBA 5E6UA 3U1BA 4WK2B 3G0OA 2Y1XA 1KDRA 4W6ZA 5JBNA 1N7JA 4RK6A 3GLHB 3EIXA 1G8AA 2Z83A 4MTLA 2RAUA 4GM1A 2CVOA 5U9CA 1QP4A 1L0VB 2QVLA 1F14A 2J0QA 4ZYTA 1GFZA 2XJ4A 4RF4A 3VZPA 1T9GR 1Y63A 2FE1A 4K7SA 2BHNA 5E4TA 4W82A 3D7SA 5KTYA 3SF8B 3ZDEA 4MVJI 3WFJA 4EMSA 4ISCA 4KIWA 3IE1A 2Q21A 3I73A 3QJYA 3CS3A 5H4HA 3E8SA 1H8ED 1NDHA 2ZOSA 1YHZA 4PFQA 3DDWA 5LPNA 1BVYF 5HK9A 3OLXA 4EMTA 1RYMA 3K9CA 4KMMA 1VD2A 1GLNA 5DYTA 3QWAA 1R8JA 1ZEMA 4M8MA 2RGAA 3FSJX 2VH2A 4KQHA 2AJ8A 4DIBA 8GPBA 3FIJA 4BV9A 2J09A 2FPUA 1YXMA 2YRXA 3TMYA 3MMSA 2NPFA 4Z0HO 4OA5A 2M9MA 2RI1A 1RQLA 4Q4DA 2AYYA 2ZYAA 1KAEA 1WXIA 2M5CA 3A1VA 1YI8A 2EWMA 5GPBA 5BWMA 5LYJB 3K8QA 3B0AA 3MRTA 3FI9A 1RFGE 2GSWA 4H9GA 1DAFA 1IHDA 3AI5A 1ZVJA 1WGRA 2CCGA 3FBGA 4YSXB 1NU6A 2CVHA 2W2VA 1PVVA 5D3ZA 4LBVA 4YRAA 2FSVA 5AOVA 5DXFA 3CO0S 4HMOA 1BHO1 2RHMA 2RBGA 4B9KA 1WXFA 2LKCA 2Q99A 3STWA 1R9JA 4BZZA 4DF3A 4X1YB 4C1NA 3O7MA 2UXBB 1BFKA 2EJCA 1TYGB 1OE0A 4IYJA 1YQDA 1FX0A 2V54A 4X8MA 4XE0A 2CB9A 2BF8B 2UUCB 4CLOA 3TSWA 1L8OA 1TNDA 5J2UB 1MXHA 1BJKA 4CEIA 3RUIA 2Q5QA 1NF9A 3DQQA 4FB5A 3KYCA 2FLKA 4XX0B 2CV2A 2CU3A 3IDSA 4RZHA 3Q69A 4AY2A 1H2XA 1OQQA 3KIPA 4GOOD 4QG3A 1N1GA 3TZBA 3RJ5A 1Z22A 2ZRKA 4FCVA 4GYKA 1NG1A 3CISA 1VLQA 2ISCA 4C78A 2RMKA 3D59A 2Y71A 3ZY6A 1KJYA 4DCGA 3SQLA 4AMBA 4QOFA 4PX3A 3AHGA 1KH2A 1XQYA 4H35A 1WGKA 3DVGX 4PRLA 2P2CA 3TLJA 5CDUA 1HDXA 4MW5A 2E4XA 1QG6A 4B6OA 6ABPA 5EIFA 1XZMA 4UTVA 5H68A 3IQFA 2FJ0A 1TKCA 2GPAA 4NJEB 1P31A 4AURA 2C59A 1YDHA 3ICQB 4MACA 2HK8A 3AI3A 4ZODA 2NV0A 4UM9B 2O8FA 4RMGA 2X9QA 5JY6A 2GUGA 3UV3A 1T1EA 2E6UX 3HRIA 3EVEA 3RI7C 1J90A 4PQEA 4M1YA 2C95A 4XQGA 3SHOA 4LJSA 4AP5A 2BGUA 4ERNA 1EHCA 3DDNA 1NW6A 5IP5A 1RWOA 3KOMA 3PRMB 2IHBA 5JCPA 4RV4A 5AVYA 2GJAA 4TSRA 2NAPA 4LJ5A 2XK5B 5HF8A 2EBWA 1KO4A 2C4VA 1PEYA 3ZWAA 5EY5B 3H5NA 1LFAA 5DTRA 5M3BA 3AI7A 1K7EB 2VSYA 4NV3A 2WYVA 2X86A 5T3YA 2IZ5A 1CF4A 3ADCA 4KGTA 1T0QC 3GVHA 2FCQA 5ICMA 3QI7A 1ZJWA 1EUCA 5A7FA 1RU3A 2EW8A 1P45A 5LUAA 4B79A 1XZIA 4GPIB 1NBME 4HVCA 2O3QA 4Q7QA 2YBDA 4NONA 1TF5A 5AKHA 3C3JA 2VAVA 2HUPA 1Z34A 3AGPA 4RX1A 5KYKA 2MSKA 1ESDA 5AM2A 3FVWA 3QFHA 1NT2A 5DHPA 1U8TA 1HKHA 3N5CA 4YQFA 3FYUA 1QXSA 4HH1A 1TAGA 4GIVA 3C1UA 1HNNA 2BCGY 1AHNA 4M7PA 5FYQA 4ENPA 4PLTA 1U1GA 3NBKA 2AZMA 5ACXA 3RLIA 4BB9A 4BPRA 5CBPA 3U3RA 4M7WA 3TKYA 2CHVA 3VR5H 3A2NA 5JZ9A 3LI2A 4GOJA 1M1NB 1DG3A 5EOVA 1US8B 2BVNA 5AZGA 4QAQA 3TLEA 1XVUA 5ICEA 2EKEC 4EXSA 3WV5A 2FEOA 2XYVA 2FWPA 5AK0A 2YHIA 1WSBA 1ZGCA 4RVDA 2WQ6A 1STOA 2WXLA 1RLTA 2O6VB 1FUUA 2GMNA 4U2FA 4WW0A 1ORRA 1BH2A 2FU8A 4OB6A 2WIJA 2H2HA 6Q21A 2R7LA 2VK8A 4KXMA 5GOTA 3CZ4A 1YASA 2OB2A 4CKWA 4DDUA 4LE1A 5K4NA 2CEKA 4WLNA 2VBFA 4G89A 1G64A 3CA8A 4MV9A 2LGSA 4CEJB 3C7CB 1XJQA 3G8DA 1WI0A 2XUJA 3PHWB 5K0FA 2XRZA 4BVHA 3HYTA 2SEBD 1QYCA 4BEBA 4ZGBA 1AOXA 3CPJB 3QVXA 4UNSA 2KTFA 4EPXA 2ZWVA 1JDNA 4RVNA 2H4ZA 4D45A 5EHQA 1WE2A 4MKXA 1FP6A 4FMBB 5KOHB 4GZLA 2FX5A 2A9RA 5JYBA 4YCNA 2I6TA 3S8YA 5L8VA 4AMVA 3U7HB 5CFLA 1E2BA 1BGVA 1CF9A 1F17A 3GX1A 2C9MA 1G8SA 3DCGA 3EQ7A 3H8VA 2QRNA 1LLCA 4B31A 1MB3A 4EW6A 5BSTA 2HI0A 3W9CB 2PQ6A 2K3UA 1KC1A 3QPDA 3VPXA 4COKA 4RO0A 2WZBA 5B58T 5BV2P 3GEMA 2D2QA 3G2OA 1B6SA 3I5MA 1RT9A 4LDJA 3RROA 5TQJA 2WU8A 3EXG1 3O4RA 3KWLA 2V59A 4KQEA 2NT3A 1W0JA 1I2ZA 4MMXB 4RF5A 1M3SA 2EBHX 1AU9A 1N63A 1UC9A 4JDPA 4MUIA 4KQIA 5LP6C 1N0IA 4L6IA 1EQAA 3T3GA 4D6XA 4TV9F 2AF3C 3IOYA 4Y2TA 1ZXXA 1JEJA 4KGRA 5WRFA 1PS0A 1K8YB 3IVFA 3UHJA 1Z8DA 2WNHA 4K9QA 3LDFA 4JJFA 4CGYA 2IDMA 4BFYA 1SCUB 3FUWA 1Z39A 4Q1VA 3UJHA 1Z82A 5H80A 3DAGA 5L51A 4X1IB 3NFRA 1KMCA 4OK3A 3MW8A 1IZZA 4DDMA 5B4UA 5BSWA 4ZAXA 1LB1B 5LZ4A 1YQ3B 1SVKA 2G7ZA 4MA5A 2JRCA 3OURA 4N65A 5FUVA 3VYUB 3WE7A 2ZRHA 2BWES 3KZMA 2PE9A 4EG4A 4JEUA 5DLPA 1HT1E 3B85A 3EOAI 4C7OB 3PE3A 4CN9A 4BQIA 4HATA 2DYBA 4KBGA 4Q16A 1P0CA 4WZAA 1OHHD 3JWGA 3VSAA 1KU0A 4MW2A 4ZO2A 2EU8A 1Q6YA 2HGSA 1X8JA 2Y66A 5SY9A 5LNK6 1RHUA 3RAEC 2G5TA 3K8OE 1DJOA 1I1NA 4BKSA 4US0R 4HEHA 2ZSFA 4M02A 1KHHA 1PWHA 5EHXA 1GNSA 4P5PA 1AGRA 4IIJA 3PDJA 1QOBA 5M29A 2GTIA 4K0RA 3GD5A 3ZQUA 3WL3A 2W70A 2CLKB 2EKIA 1XJWA 3H0KA 3U4QB 4CNQA 1VJTA 3TQCA 4M0CA 1NZDA 4KFTA 1FCJA 4R9UC 1YQTA 1TAUA 2VT6A 4ID9A 1UXIA 3TW8B 3G0CA 3FYDA 5DIZA 1H8HD 4GXQA 3OZFA 5C3MA 3QRWA 1SBTA 5C52B 3MEQA 3ENVA 2PS0A 3GRZA 3OJEA 5JNWA 2M4NA 1VPTA 5C4GB 3AHHA 1XELA 1L9KA 5GGYA 5IZ4A 1EWQA 2HE7A 3L8FA 4O0LA 2VT7A 1IJEA 4MQFA 2JA2A 3I9MA 5HR5A 4RLQA 4P3NA 1G20B 2KD0A 4WD6A 3VV2A 2H3EA 5JSFA 2XMGA 4J6IA 2BOVA 3DQPA 3UJBA 4C01A 2PTLA 3G5TA 1TO2E 2MWMA 3GBVA 5TX7A 2XWSA 2AZTA 4QOHA 2SNIE 5E38A 1HL3A 2ZB4A 5EP1A 2CXXA 3ECSA 1YVUA 3TLKA 2PO7A 4IZIA 4ZVMA 2QWXA 2FCAA 2A5UA 3HDHA 3NWOA 3NVZA 1QAMA 1LV7A 5LZ2A 2GEFA 2IIPA 4FFPA 1YS9A 4KYVA 2VPQA 3MRSA 3NVDA 4QASA 3ZLVA 4M1ZA 3F8WA 5CT9A 4R7ZA 4QA9A 4RFLA 2JLQA 3ADRA 2D1RA 2VDRB 1NBHA 4RSGA 3HGQA 3SBDA 3I6QA 1OVMA 4ROSA 1QO7A 3MCWA 5ACUA 5JAZA 3PY5A 4ZREA 2DWOA 2AZ4A 1A4RA 3RVNA 5K0JA 2EFYA 5DCLA 2W71A 3OFKA 1UFKA 1DGJA 1T8RA 3LX5A 1PK7A 1DVRA 2XNCA 3P42A 2C3YA 2CL6X 4UC0A 3IEVA 3FAIA 1EJ0A 2HD5B 3HVKA 1LWNA 1DWOA 3RH0A 1JBQA 4LF8B 2VNIA 3K6SA 1QPGA 5ILQA 1NEKB 2AG0A 4A20A 3E5HA 3C6YA 4L85A 4QBKA 1M7BA 4JC5A 1YJ1A 5HBRA 2FDRA 1T1SA 1UT8A 2W6ZA 1RAHA 1IULA 4LDAA 2PSJA 3VYWA 4BNLA 1L4UA 1K2WA 4O4LF 3PIIA 1NVMB 3WGIA 3GJYA 2I8CA 3LCJA 4PLYA 2BMEA 1L5LA 4DBZA 2BEVA 3OKCA 1Q20A 1SIJA 1I2DA 5J58A 2W3SA 2NYUA 2FUKA 4NMHA 1VRWA 2ET6A 1DLIA 4ZRQA 4EJ0A 3NZEA 2QDFA 5DB4A 2GNOA 2P9ZA 2O2DA 1GNTA 1KIMA 3PG4A 1ZNQO 2A0WA 1P2VA 1BC2A 2JIBA 1T6BY 5HWSA 2RR9A 1E98A 3E5MA 2G1UA 4PLZA 1L0XB 5CT5A 3BWDD 2RJ3A 2BHSA 2DUJA 2X4LA 5EEHA 4OVKA 3D3WA 1CFZA 4KWIA 5KNDH 4CMGA 1W2HA 1NKVA 2HPVA 4UU7A 4BNIA 1YVPA 2AC2A 2RB5A 1S9HA 1V5TA 5LXTB 2YLMA 4KCGA 1UBGA 3VC7A 4DPKA 4GHWA 3IP3A 4I4TB 4TSFA 2IA5A 3LPMA 4EKDA 3GJXC 5IC4A 3PUHA 2BT6A 3HCFA 1QIMA 3S2EA 2KPOA 2QUIA 1ZXBA 4LJYA 1SEBD 4ESVA 4R1TA 2V5AA 2JK0A 5C2JB 3DMFA 1GQQA 2XQFA 4RAQA 5GM2A 1CY7A 1P2FA 1TJPB 1DC4A 3OLZA 4N7JA 1CY2A 4BKRA 1J20A 5AXDA 5K7SA 2FWNA 3WB9A 4AMZA 4HWOA 2WP9B 1ZP6A 1Y42X 2DT8A 2C88A 3BZDB 2IYEA 3S8MA 3CTMA 1V96A 3LT4A 1X3LA 4K6CA 4D6PA 3E23A 3R6LA 1L4ZB 4ICIA 1QIEA 1D6SA 3GAAA 3OE7D 4C07A 1H94A 5E1DA 2YWCA 4JVMA 2N9PC 1QYXA 4OMDA 1GL3A 1H3FA 2QAGC 3QZUA 2PKEA 3AEGB 3KL4A 3TD6A 2FK6A 4WXPA 4F92B 5EE3A 3KZ1E 4M9ZA 2AS0A 1ZKPA 2PR7A 1WNFA 3F5DA 3TOVA 2PY6A 4CL3A 4FHKA 5FTLA 1P33A 1YC2A 2DMRA 5DT2A 2IYRA 5FA6A 2FHXA 5FPSA 2P3LA 3KQOA 4OXXA 1B23P 1GDTA 2RD0A 1FMFA 3KUUA 5CX1B 4WIAA 2IODA 1P4JA 1VZ7A 1FDRA 3A9CA 2WM2A 4QDUA 3B6KA 3WLNA 4DJEC 4X6YA 4O02B 3DOFA 3QC8B 4V1CI 4JIMA 5TMDA 1UT5A 2J87A 5K0LA 2Q27A 2I2AA 4WKPA 1XTKA 2BH9A 3RB8A 4TVBA 2C2OA 3S2UA 4HAUA 4QWWA 4LVUA 2I6GA 3RSFA 3WGUA 3V4PB 3O0DA 1UDXA 3GB9A 4NZ9A 2KTRA 4J43A 4MUNA 3KSZO 3THXB 4AWXA 3JYHA 3K0CC 2AHRA 3OZVA 2IX9A 3EXIB 5DI9A 2XKAA 3QVVA 3W1YA 2R4UA 3R7SA 4QYIB 3F8TA 4CU5A 2C2YA 3H9DA 5BSRA 1WIAA 2C1EA 4BVJA 4FSXA 3MT9A 4PC6A 1MMFB 1PSWA 5LCXA 5LA6B 3TXXA 2QX7A 4F7ZA 5JWOA 1KOTA 1UMKA 2QZJA 1U6IA 9ABPA 4JQYA 1YRAA 2BFEB 1ZLYA 1I6LA 2I1KA 3HVIA 5IULC 1CUXA 2OB1A 4HVAA 4HN2A 2G0TA 1C8VB 2OTCA 1L5PA 3RC2A 3FHCB 3QW2A 4LXYA 1E6MA 2RGBA 3BTOA 4GXRA 2TSYB 2AXEA 1T9ZA 4BB0A 1H2ZA 3G85A 1RZUA 2V9ZA 3PNQA 4G0VA 4BNJA 3MPOA 4AF8A 5E4JA 1GZSA 1O9HA 3GBSA 3N0VA 3D8UA 2DQZA 2X0RA 3C3CA 4TZKA 5KOJB 1CK4A 2WHQA 1E9BA 3I5UA 4JT2A 5CTAA 1DFGA 1VZ3A 1LK7A 2RJOA 5F1YA 1SJED 4F71A 3K70C 1FQKA 3D4BA 4WQMA 3W9YA 4FFVA 5BWOA 1G16A 4UTNA 4WLFA 4YMGA 2O50A 1YMQA 1JWMD 1VXOA 1U0LA 4EA9A 2XTMA 3OX3A 2VF7A 1EKXA 2JUOA 3PQ2A 4D2KA 4Q9IA 3UO8B 3UWPA 4BQSA 2J07A 4U2KA 5H59A 3AXCA 1MG8A 5ACWA 1CXZA 2YYSA 4RM5A 3NHJA 2J48A 1R27A 1NP3A 1DQNA 1NIJA 1L4DB 1A4XA 1N9KA 5FO0A 4CE6A 4QRHA 3P4XA 4QPZA 2X23A 2V7GA 5JNTA 3V8BA 3CWIA 5HIQA 1N5MA 1XI2A 5KWSA 1LLFA 2YW9A 10MHA 2YHBA 2F4NA 3L46A 4EYFA 4J16C 2Y1WA 5D51S 1Q83A 1ZK4A 3NBXX 3NHSA 2NVUI 3NP7A 3T06B 2YZGA 2BFAA 4ALLA 2W48A 3SEFA 3SYNA 1MPXA 3C45A 1LLUA 4NS4A 3LIIA 4EUHA 2GPNA 4DLNA 2B36A 5BN5B 3U3DA 1WPRA 2WXOA 2J9ZB 4MEBA 1HZZC 2VJMA 3ZQJA 4JI1B 4C7VA 3OX4A 2WSSD 5DCWA 4GKAA 5C7YA 2DLDA 5G3ZA 4JUDX 1AN9A 3U5ZB 2DOKA 2QNIA 3FNIA 2WJJA 2BR4A 5SV2A 2ZEQA 3MOSA 2CVQA 4ZI2A 5AJLA 2D13A 1Y8CA 4Z9AA 1IWOA 4O6VA 3FCSB 3L9XA 1FZTA 3E35A 3IIKA 5HTOA 4CZ2A 5B7GA 1NA5A 4KR2A 1VA5A 1SUIA 1C30B 2DWCA 3ZUGA 1MAWA 3ENWA 1A8TA 1Q0HA 3X1KA 3S7ZA 3S1LA 1D8AA 5KKAA 5AKLA 3K70D 1D2RA 5GWXA 3LC7O 2PXCA 3PTFC 1G8KA 2QV7A 1O4VA 4GEGA 4Q1CA 5B7PA 3PDUA 2BMAA 3V1LA 1KA9H 4H6PA 5E9WA 4DCSA 4I19A 3X2SA 1VCOA 4NPNA 3HHPA 1RKUA 4ZD6A 5B3AA 2MSCB 2KJQA 4QTZA 4GL2A 4ARZA 5FBZA 1ECCA 1O2DA 4LNUA 4C5BA 1KIFA 3DONA 2VZ8A 3UENA 1C0KA 2XT9A 1KP3A 2NBUA 1K6MA 2BZ1A 1W52X 2Z98A 4IDPA 1MF7A 2GS9A 2P11A 4YROA 3R66C 5AK3A 3EXFA 4MQLA 3NHEB 3FWPA 1OY1A 1ND5A 1DKPA 5FX2A 1RP1A 4OHYA 1ZIXA 2WMOB 4ABTA 1ZRMA 4C7BA 3FSGD 4EDFA 3NAGA 2YNWA 4QM7A 1JFSA 4D46A 4RGVA 3UWKA 1UP7A 1W4RA 4TSSA 4YUZA 1Z45A 1E6KA 2R65A 3UK2A 3H19A 1YX6B 2J9FB 2Q8NA 2X8JB 2EW2A 1Z4LA 4OHKA 2YY6A 4K3VA 3I13A 3ZKWB 2VH1A 2J6CA 5HBGA 2G4DB 2V3VA 2PKXA 1R6TA 2VJKA 1TS3A 2JVKA 3MWJA 4WLVA 4DRXB 3BYTB 5CJPA 3W5UB 2XGGA 1ZZGA 4ZHPA 4KRGA 4CL0A 1HQYE 1U0BB 1E5TA 3HXOA 2IDYA 4EG8A 3X43A 1XD3B 3S4YA 4HJGE 1BMFD 4EF6A 4C4RA 4QYMA 1XO1A 2JDID 1E2DA 4ZAYA 3CG0A 2BD0A 3VPEA 3O91A 3CNEA 2J3QA 4LOLA 1P5RA 2V03A 4LI3X 2DPMA 5FLKA 1KJJA 1S3GA 5HILA 1HEIA 3NIWA 1IXZA 4CM8A 2VJQA 5I3CA 3H0CA 5I8ZA 2CW5A 1NJGA 1YZGA 3EBOA 2OHJA 5LMNB 3T12A 4BAXA 3VJRA 4PLFA 2YINC 5K03A 1Y7LA 2OCPA 3W5BA 4NMLA 4WXYB 1O58A 3WDKA 2GM4A 4EUSA 3BERA 4NFYA 1E8YA 4B4VA 3KQKA 2FDCA 3U4DA 3OY2A 1QH3A 3ZGVA 4WJLA 1LXCA 5DM60 3CGGA 1QVAA 2AQKA 3LE8A 4UHBA 3THYB 1IG0A 4OI1A 3R0VA 3GPBA 2IO2B 1FFBA 3QXSA 5HM8A 2EDCA 2ZXEA 1QKIA 3UJNA 1KP9A 4J4BA 4L4UA 1XD8A 2WJHA 4C2BA 4Q6WA 4BVAA 3ESHA 3KUZA 1SO8A 2HADA 3T4UA 3FFTA 2Q1UA 1RCTE 2XD9A 4XVCA 5AHXA 1FYWA 2WRSA 4DA8A 3WLJA 4DOMA 1I7NA 1HA5A 4RNDB 1ISIA 3K6KA 5L3SB 4EJ2A 1O94A 1QGAA 2WKQA 3E9MA 1GNLA 4B6JA 2GBMA 4DJDC 1XRSB 1RYBA 2PGAA 4D79A 5EJ8A 1JDVA 3BE5A 4ER0A 2GK3A 4M22A 1N78A 4JXJA 3ZV4A 3P4RB 5TQ2A 1KZ4A 3LDUA 4AXBA 4C0XA 2V7WA 3S2AA 3TTVA 2PV7A 3U3XA 1O6ZA 2XA1A 1JSXA 4Z99A 2H4JA 4IDAA 4OYRA 4RNAA 3K0AA 3W6NA 3PEFA 3A4LA 3AUKA 4R16A 4EVIA 5ELLA 3BIXA 2ZAMA 2V9HA 4EB6B 3GGPA 4PSDA 3GWGA 5FLEX 2PEYA 1P0QA 4JLCA 2P35A 2MX2A 1VJDA 3C3AA 5ALDA 4RHTA 3A6KA 3CX7A 2QORA 1C78A 5AJXA 4AZ0B 4TUUA 1U3DA 4JLDA 4RCOA 3QLEA 1WCIB 2ZAIA 1Y3IA 4IMIB 3IP5A 2HEIA 4UOEA 4QXAA 3OT1A 2BZGA 4WAFA 5DHSA 5TT0A 3RFCA 1NOJA 3LJKA 1IEQA 4H7FA 2VP6A 2H06A 7YASA 4FGLA 1RI2A 1E3JA 4LX0A 2Q3LA 2EERA 4WA7A 3NPAA 5JNLA 2BG8B 4JCOA 3ABVB 3KWVA 4ZZ1A 4CLDA 1PNOA 4Z1MA 3KCQA 3IGFA 2R5WA 2QPLA 3P19A 2J3KA 4KITB 4CVNA 3MTIA 1EFCA 2WC1A 1TQ2A 1ZUNB 3TLCA 4H15A 3AP2A 1X80A 1T6YA 5CA0F 4LHEA 1OZGA 1WP9A 1IHYA 3BIJA 2VTEA 1P5JA 2W82A 1BE8A 2ETVA 4HPWA 2WG1A 3AN1A 2B4QA 4UWSB 2VSNA 3A8TA 3EWSA 4Q9LA 3H84A 3Q87B 2GOWA 4AUEA 1JWSD 3ANSA 2PLWA 1UINA 3O8DA 4F7WA 4QT4A 3KVVA 4CLEA 4TWAA 1QO0D 4LNFA 4KI0A 3NIDB 3JATA 3RRYA 3VO9A 3PQFA 5JANA 5I4BA 4LF4B 2YUTA 4XD2A 2QQGA 1X0VA 5FQBA 5G02A 4IWOA 4YP5A 5JNVA 3GRFA 3C5VA 1M1YB 5B1IA 3SJUA 3F90A 3T1HB 5ALTA 2K2QB 3HQ4O 1ZIPA 3BX1A 4YBRA 1KPIA 1L4YA 3RWBA 4DNXA 4MDKE 1UM9A 3UHOA 1GYRA 3RZFA 1IPHA 5KYWB 4V0RA 1L4KA 1ENPA 1SHLA 4AJIA 5C5EA 2WHYA 1VL1A 1G1AA 5ARBA 3D6JA 1ZJZA 3ZNBA 4DNPA 3ZLJA 4LJ8A 3H42B 5HXAA 1CIVA 1MBZA 3FVQA 3WTBA 4EI7A 3ED1A 4ZC1A 4TYNA 1BXTA 4RAOA 1X9HA 1PQSA 4OO3A 3PPXA 1VKNA 1P75A 5KILA 4JQOA 1KEEB 2CWWA 1VCIA 4LYGA 5ENZA 1O7JA 2XMPA 1N6ZA 5IUNC 1NXWA 3M33A 2H54A 1MB2A 3VH4B 1EZ1A 1ADFA 3S2GA 5IFKA 4MKGA 2J5RA 2FPMA 3GF4A 5BMVF 1RVV1 4IDQA 3S27A 4C6SA 4L4ZA 3U80A 2BRUA 1CY0A 1EP3B 4QGHA 1C7RA 1NP7A 3BT7A 2NSJA 3SIXA 3KZOA 4UOQA 5IJ0B 3OFNA 2Y3AA 3PQ7A 3ITNA 4U3JB 2MA9B 1JBEA 3T3IA 1AB5A 1FRFS 3IP6A 4DC1A 3E1KA 1K2VN 1UQUA 1TQ4A 1UXGA 2LGDA 4OSEA 1DD6A 1ZGGA 2FU6A 1Z7YA 1WM3A 4N3NA 3ZCXA 3ZOZA 3KP1A 2DERA 1UDRA 3VQIA 1JMKC 3RFZB 4CMEC 1QK3A 3AVWA 4F5ZA 1CTQA 2IHTA 5HPYB 4OIMA 1U9IA 5EZSA 1X7YA 3T9AA 4RTKA 4M4SA 2WB2A 3QVTA 1GD1O 3G0BA 3PDWA 1UMDA 1R74A 3H4TA 3FTPA 3ET4A 2JFOA 2Y0EA 2NV2B 2RH9B 2LGXA 2QUAA 2WAXA 5FTKA 1N5JA 3CJQA 3B6JA 1UBCA 1DKQA 2QG9A 5B3JA 4RHUA 2FSUA 4IGAA 2WZCA 3N76A 5I9NA 2XVXA 2PUVA 1T6BX 4KC0A 3DXFA 3QGMA 3R4VA 1EIZA 3QTLA 5B5SA 3JXPA 2FG5A 3N8KA 3WIVA 2DPXA 1NJ5A 2VPTA 5K3DA 4AZVA 3OQOA 4FCCA 1Z17A 4HB4A 2JBAA 4K2AA 4C7JA 4EWLA 5HA5A 1QGUB 2VPPA 5LLDA 4ZCQA 3K15A 1K86A 3IALA 1WZNA 2GZMA 4G0OA 5MN6A 5JXIA 4JP1A 4AMYA 1J06A 4DA9A 2I6FA 1TQ6A 1LF5A 4MRAA 1YR2A 2YOHA 1SUCA 3JQRA 5C8YB 2FAZA 2I3DA 2PUTA 1ICIA 4JOQA 3CPSA 1WGHA 2HHCA 3OX1A 5GMVA 1A8HA 2OHGA 3CUEF 3IDZA 3L07A 2AFHB 4Z7OB 2KLHA 1C4CA 3IHPC 4LOKA 2VIIA 4RS3A 4J0JA 1ATZA 4R2WA 2O3RA 4JODA 3KQNA 4CIAA 4HDNB 2L42A 1PYGA 3OQBA 4PVCA 2BFMA 1FLNA 3P27A 1WMEA 1I5OA 1Y6QA 2F1HA 1P2DA 4M1SA 4RF2A 1J33A 2PRJA 3CU5A 5JS8A 1MABB 3H7PA 2VDKB 1IATA 5JAMA 3MZ0A 1J8DA 3WB1A 1E3IA 1K51A 4QBIA 1M4VA 5I5GA 1N8SA 2JFZA 4MX8A 5CX3A 5E7QA 2QD3A 3WV4A 4Z9YA 4OYLA 3R75A 1FCLA 4PZCA 4GL4A 5FXMA 2DXIA 1VZ6A 4I3FA 1J2YA 1HO3A 4JUCA 2Q5IA 3DCIA 1U4SA 2QI9C 3E27A 4GU2A 4UDYX 3L7OA 3I9KA 1TT7A 1FTQA 3PPAA 2HRRA 4TKVB 1QYDA 1YZFA 3HJHA 4PZPA 3VO2A 3FWHA 3ZK8A 3BRCA 3FNGA 3H2IA 4Q39A 4GWKA 3PLRA 2ZEJA 3RYHA 4J5HA 3IXSA 1WXXA 2VUHB 1WDMA 1BW9A 4B0EA 5ITZB 2DP4E 4TTAA 3ZNQA 2IOFA 3A33B 5IT9A 4PYZA 5CFNA 5BR8B 3QX7A 3W05A 5CCXA 3DDOA 4GMFA 5G3YA 5GMOA 4EMUA 3EUFA 4EHLA 3GGSA 1N6PA 4REMA 3FDIA 2YKGA 4Z9FA 3TBLD 2X8LA 3ORRA 3OQMA 2P4ZA 1E5XA 1C0EA 4PIVA 4BFUA 4QTUB 4FWBA 2PGLA 1XALA 3EXEB 2FW9A 1KDPA 2GJKA 3PX3A 5HDQA 3R5XA 4ETNA 4B4WA 4WK6A 2WKPA 1O08A 3Q3JA 3NO4A 3UF8A 1FS4A 3QX9A 5HHTA 3W1EA 1R66A 3L7NA 4YWGG 2BEUA 1QIFA 5E2AA 2YZ3A 1EZZA 1DUVG 3CSFA 3L06A 1XG5A 1OCEA 2OORC 4DQDA 3GXOA 3FTNA 2VUUA 3C3YA 3FWKA 4X0EA 3F9CA 4XR9A 3UB2A 4YDHB 1U90A 4PWZA 4R8VA 2BHLA 2FJUA 5IT4A 2QZSA 4XJSA 4AJNA 4E6PA 4LRXA 5JQGB 1Q1ZA 3TLGB 4EW2A 5IOIA 2WAMA 3RVDA 2LEKA 1GA6A 1KO5A 1CYDA 2XGOA 5KSYA 3AKDA 4RY9A 2IVFA 2XSZA 1M66A 2N9EB 3ANYB 2VDPB 1K0UA 1ZC3A 4WNCA 3HKBA 2IGHA 2O54A 4QXOA 1T43A 4NCJA 4B8YA 2C57A 1XZHA 5BSHA 4XFDA 1QIHA 3I01M 4LHYA 5BVGB 3A1QA 1U3CA 1BVHA 3EVCA 2QLNA 2PGJA 3STYA 4YRIA 1EEHA 2YHUA 1QUFA 5A03A 4O1HA 4U6SA 3P9SA 4YCJA 1P61B 4CKBB 5JD6A 4O2RA 3K31A 2VHVA 3RYTC 1Z37A 3IPLA 1SHTX 2LD4A 3VJKA 2QSDA 2WIKA 4ZALA 3WNQA 1HDOA 2EHJA 3EIFA 2R8ZA 3AFNA 1MAVA 1JZQA 1ROEA 1VZ8A 2QQEA 2XMCA 4RTNA 5B1UA 4ZI7B 1NBAA 3GOEA 1HYEA 2X0IA 4XLTA 4Z7JA 5HF9A 3L18A 1K0FA 4RK0A 4I9HA 2E3TA 4KDLB 1UBFA 2EP7A 4P34A 3CRRA 1HZ5A 3WLHA 4YJGB 2CKMA 4IWNA 1SH7A 4L57A 4HDRB 3ZVKA 1MRSA 1N7HA 1LDMA 2HWXA 3L0ZA 5LM6A 3EECA 4BDSA 3VH3A 4OHZA 2VJOA 4J1QA 1NP6A 5A3SA 5KVAA 2F1RA 3AB3A 2GK4A 1Y1SA 1D4BA 1B6TA 4FIZA 2QOEA 3RNGC 1JE1A 3KH0A 2QM3A 4IHQA 3A3YA 1II0A 4X97A 4HNTA 1V81A 2LUMA 4PFJA 4DVJA 2GZRA 3VU8A 1SMLA 3VTAA 2XNAC 3K1ZA 3GNTA 1PJLA 3SQXA 1D1SA 3CH7A 4YI5A 1VLZA 4DL9A 2VHUA 1FJ2A 3T7DA 1IPFA 2G17A 3WG9A 2PJUA 4HP8A 5BW6B 2BUCA 4KHPB 2ZB3A 3FYSA 3IR6A 1EUVB 5IQKA 3ER6A 1POXA 3QPBA 2PX3A 4GXTA 3PDIB 1C7JA 3EIWA 2A5DA 1AHHA 1S7CA 3AI1A 3GA7A 3LY9A 2I4LA 5DNDA 5CDGA 1WBDA 4HK2A 3HSKA 3PVCA 2P9CA 3A9UA 1FTYA 4RU1A 2OC9A 3MLBA 4WZBB 4F11A 4Q7MB 4UUNA 3KPUA 4HMPA 2Y1EA 3E7DA 5E3HA 3ITKA 2QTZA 3O31A 3HBAA 3C16C 1HEUA 3K09A 3TCNA 3DHEA 3WGGA 2AZDA 4UE2A 1DPGA 2BV3A 5HZGA 5DM0A 4L02A 5EESA 3WL7A 4BO9A 4K7WA 2PX2A 3I6YA 3RK1A 1ZONA 2Z0DB 2JGDA 4DZZA 2XNKA 4D56A 4GBED 2UDPA 4G5FA 2BIFA 2XUOA 3ZDZB 1E4EB 5F78A 5GJBA 2GGSA 4RY0A 1EWYA 3JD0A 1XMIA 4I55B 3U9SA 2PYZA 4CIDA 3AR2A 4YLEA 3C8HA 3W5HA 2OZLA 4QBGB 4YBZA 4UMDA 3PQDA 2R2OA 1LEHA 2YH2A 1BYUA 2AIOA 2HZBA 3BKXA 4TMVA 3IEXA 3RQSA 2JF0A 3M3HA 1YT5A 2Y6VA 4KLCA 5IDXA 3Q8AA 2EYUA 3FFBA 1E9CA 1SCQA 4QUEA 3ZXIA 2G9UA 2J7PD 4BZAA 4P92A 2JLCA 5JHBA 3FNBA 4LS3A 4ZAFA 5A4FS 4LXIA 4WLOA 1CUHA 4RD2A 2QMUA 5CLIA 2O2JA 5BRAA 4UUPA 1CUJA 3K0EA 3HKCB 3SKYA 1TT5B 1W0KA 3TW4A 1NVVR 3H2JA 3LA6A 3VHLB 5KC9A 1R4NA 1YR7A 4V0MA 4ZVRA 2W58A 1HL7A 1DTWA 4DYVA 2NMQA 3PLAE 3D54D 5DU2A 4WVLA 2LKDA 4Q9AA 1IBXA 4A0HA 5FPQA 3T3DA 3D8TA 3VTVA 1X1DA 4DIUA 1YOBA 2FG6C 4MSQB 1QE0A 1I42A 2E4ZA 2OG2A 4LGYA 1D5WA 4LQDA 4EP1A 1BWSA 1RYJA 5H3HA 3C6MA 4QREA 2R48A 1NW8A 1X1EA 4E6EA 4Q01A 4R3DA 1VL8A 3ZR4B 2IU3A 2BFCA 3A9KA 2B94A 4MH8A 5EQJB 2QLLA 5THXA 5ADHA 3EZ2A 1KVSA 2EW1A 4TQGA 4RDXA 3AUYA 1A9TA 3I8SA 4YAJA 4GMDA 4E5DA 3D6UA 4ZRIA 3U4GA 2IYPA 4DLAA 4QNRA 5CURA 1JVBA 5BN4B 1XL1A 3ROTA 4F5WA 3ZKAA 1NMZA 3M5DA 1ZHOA 2CLCX 3BFVA 2XAAA 3DE0X 3QK0A 1LW7A 3BCRA 4OJMX 2YV4A 2ZWPA 5FBKA 2KJHB 1V25A 1QMGA 3HEBA 3F6SA 3HU3A 4IW0A 3U37A 3TN7A 2QMOA 3B36A 3E4CA 3L7YA 3P0IA 4BVKA 4HYTA 3LK7A 4MUGA 4B17A 4EHFA 1IM2A 2R2GA 2XWQA 4Y7CA 4F97A 3O13A 5BOSB 1BMCA 2L83A 3RO7A 2F8SA 2ZT8A 1ET6A 3W8DA 3AKEA 3ZX5A 2ZK7A 3FTQA 2J30A 3DPUA 4QE3A 4YSLA 2HX1A 1JNYA 4EBFA 3O3MB 4P83A 2IYSA 3SM9A 3R0ZA 4P8RA 2CVPA 1V71A 1J0DA 5PNTA 3DT9A 4CR8A 5G0TA 3NGMA 2RHJA 2B21A 2CBXA 1UJ2A 3Q9NA 4DILA 1SOAA 1Z56C 5J4VA 5LMUB 3BAFA 5AI8A 4OLAA 1RAFA 4O4JA 3PEUA 1B3RA 4AG3A 2ZBQA 3D32A 4RMAA 3LQKA 2A7XA 4XLLA 4K81B 4OUDB 1DIOB 2OM6A 1F12A 1I94B 2H11A 1SBCA 1EFKA 4WIPA 2W4IA 5FJJA 2H2IA 5KNLA 2XE7A 1QVRA 5FTMA 3MWYW 1A9RA 2TMYA 3O1HB 4ACFA 3G02A 2J0EA 1PFWA 2O8BA 3G5UA 1DAHA 3NWJA 2C92A 5ALKA 3TPZA 4PBRA 4DLBA 4QG7A 1EB9A 2H1RA 4F06A 5L4LA 1YB6A 4LF6B 2O2GA 4RTMA 1XP8A 5ALHA 2G76A 3WRXC 2ASVA 2XUHA 3L8EA 4MPRA 4KMRA 2K1FA 2O4UX 1UC4B 3QA3E 4Z2YA 1J24A 3R0JA 3BAZA 4PV7A 5EUMA 3QE0A 3FKQA 3TRKA 1SVSA 1K8ZB 5DDIP 3SE7A 3D81A 3AYZB 1FY2A 1E64A 1NSFA 1AQLA 1EM6A 5CFZA 4KDRA 3GGJA 2GM5A 2KDEB 1GTMA 4P62A 4LV6A 2W2OA 2BG7A 3P4SB 4LWZA 2BEWB 3C1TA 4MGKR 3HG7A 2GDZA 1PFYA 2I62A 2P2NA 3H5TA 3SZ3A 2J53A 4GN1A 3EULA 1RQPA 4IUBS 5BYAA 3R7BA 5IHPA 2CMHA 1DOHA 5JTUA 4JB2A 4IQ0A 3IQEA 4Z51A 1P60A 1HQRD 1RBQA 2QTWB 2GCUA 3QLVA 5FBWB 4AKGA 4FC6A 2NIPA 4URHA 4GLLA 1F4LA 4ZXFA 1KYZA 2QQFA 4YP6A 3NMUF 3NTXA 1RNLA 1T29A 2Z4TA 3IUJA 1ZMTA 4FADA 2LMCA 1WEHA 3FKJA 2BE7A 1L0YB 2ENWA 5EFOA 4CKEA 1D6JA 1YN5A 3W6OA 1Y6JA 1SU7A 5HHDG 3SQOA 2ZDGA 1HSZA 3BVMA 3H1EA 4MEJA 3KB8A 4JJ4A 3E3MA 1XCJA 5CITA 2ZZKA 1FUKA 1RIIA 3RJTA 2RDGA 3HJAA 2FCNA 4G4JA 3AEKA 4Y6GB 2X7HA 4DHEA 1HTQA 3OQ6A 3OF2A 4X00A 1K89A 2FLWA 4MZXA 4PC2A 4JXZA 3WP0A 1V6CA 5L40A 1B9RA 1MN6A 4ARIA 1K5DA 2QTTA 4MYHA 4WD3A 1GUZA 1D07A 2QAJA 1V1JA 3ILYA 3IMFA 1W48A 1AMOA 5M7EA 1FB5A 3A58B 1EFRA 2QW0X 3T1VA 2BTQA 1PV1A 2CHUA 1Y4AE 3QLUA 4LXHA 2XOEA 3KVFB 4MWBA 1A5RA 1RJEA 2J8ZA 4RW0A 4BYMA 4PZUA 1MX1A 1MP0A 2YV2A 4BWGA 3ZLBA 4D43A 3ZJUA 3EZGA 5FUQA 4DT1B 5K3EA 2ONJA 3RVOA 3A7EA 1N8KA 4Y2HA 3A36A 1X9IA 4QECA 4IGEA 1EFLA 1PZNA 1E3DA 3GRKA 1G3MA 3TGWA 3PRPB 4HF7A 3C24A 4MIKA 5BO4B 4ARBA 4Q18A 4X7PA 2BY4A 4XJVA 2D5CA 3PVZA 1NOIA 1NN1A 3NWEA 1T4CB 2J9GA 3SPXA 3HVJA 3ZQKA 2ZBGA 1PZEA 1ADBA 4NBTA 1QR2A 3WK8A 2NU7B 3PF8A 3KQPA 4ITKA 1U02A 1H5UA 2OO5A 3EPHA 2PR2A 1AGYA 3PPWA 3HHMA 3FRHA 4F4CA 2NYAA 3NM4A 1NN5A 3ESZA 3M6VA 4BMVA 1F1HA 2AKYA 2BGKA 521PA 1NXQA 4J0GA 3QMVA 3JASA 1WP4A 4LAFA 1UMBA 1UAYA 1NY6A 1A88A 3QH4A 3O65B 2D07B 2W6QA 1TA4A 2MBHA 2I4TA 3KHSA 2NBVB 2OILA 4WEOA 4QIHA 2E49A 1OFTA 3Q40A 2Z09A 1KORA 3E3NA 5J4LA 4F3KA 3CF6E 1SB9A 1HG0A 3TZHA 2Q5FA 1IXKA 3G59A 1Q16A 1DC7A 1B8PA 4AG5A 1KOGA 2Y0CA 2BC9A 3JYLA 3PQ8A 4TXLA 5KREA 1NDQA 4XQCA 3FMVA 2OV2A 3DDZX 1SBQA 1WHTA 1XTTA 5H02A 4M0LA 3CF2A 3JAWB 5EFZA 1R6UA 2Q0QA 2VJAA 5FNVF 4XGRA 3EQ9A 1ST3A 1FSSA 3ZJVA 4MUBA 5DGTA 1GCOA 2MJEA 4AY5A 4II7A 3KU1A 3P8ZA 1H23A 4M0MA 3VDQA 4EYLA 4QYWA 4LK2A 2I2YA 3HABA 1QGZA 4JP5A 4I81A 3A32A 1C3XA 1ZK2A 3FTFA 1QOZA 3KTOA 3SD9A 4BVBA 3JQGB 3GLIB 2W2TA 4WX2B 1GSOA 4A8XC 1E9VA 5JNRA 2Q49A 3OJ3A 2PQ0A 5C5IA 1PFQA 4INOA 1E77A 1SN7A 1QH9A 1UMCB 4QFDA 4C6TB 4NY1A 5KSWB 5DW0A 2WJPA 1JNXX 1I4GA 2VYCA 3KJIA 3ZIDA 5FWYA 2FPSA 1ZM7A 4AX0B 2ZUDA 3DO5A 1JT2A 3N2EA 2OBMA 3AI2A 2J0KA 1U7UA 1PR3A 3I05A 1WAMA 1P9LA 2FZLA 3EFEA 3T9DA 1K5PA 4Q4CA 2PUFA 4IZOA 3CJTA 2ZSUA 1JHVA 2G5GX 4F4HA 1XTIA 1X1TA 4YWJA 2QSJA 2GK6A 3K5IA 1ECPA 1XCTL 1KI6A 2EKBA 1QCDA 1TUBA 3OD5A 4UDUC 4EA6A 3WO1A 2PA0A 1F2UB 3TCXB 4LYJA 2CL5A 2L8JA 4YAOA 2FSFA 5MGNA 2EIHA 5HFNA 1CUBA 4BVUC 1G2QA 3VUWA 2JA1A 5KYXA 3B3AA 2VDNB 1MHTA 4I6EA 5K0ZA 2WTUA 5DT9A 3C97A 2EJVA 1BCRA 3C5WP 4JLAA 1F5SA 4X1OA 3PQCA 2CBZA 4TN5A 1KO1A 1G7CA 1YIDA 2R1TB 3UWDA 4RJLA 1MIOB 3ZHZA 1V35A 3DP7A 4YO7A 3WLTA 4RJ2A 2DY1A 5TQ0A 2AYXA 3ZE1B 4DPMA 1Y4SA 3TMAA 5REQB 4PK1A 3U7JA 3RS3A 5AESA 2KE5A 1ZNZA 4WUTA 4BHTA 1PHRA 2VS1A 4BOYA 3DAOA 1Y6RA 4F1KA 4BLSA 3BQ9A 1U0SY 1TEVA 3SFDB 5IP4D 1KPGA 3P20A 2HV8A 2QE6A 3ZLZA 1MXFA 1E66A 1XHEA 2PWAA 3NHFA 2CHEA 1GKIA 4MYTA 5CVCA 4CI0B 2P6NA 5A9SA 2QVCA 3AM1A 3URMA 5KYYA 2QD5A 3P2MA 4MAMA 1RRMA 7GPBA 2Z0EB 1DG1G 1SG9A 1G8PA 1UBJS 1UBTS 3MCUA 1I4XA 1AMNA 1EFPB 3RJMA 4HK4A 5FTJA 3ZLUA 4MWGA 2N1VA 4A0GA 4N9QA 1HM5A 5K51A 3SQNA 2Q4DA 5HUHA 4J9VA 3P26A 5CYOA 4N1AA 4J1SA 3MWDB 4N18A 1NMQA 5A2GA 1U2TA 2FOXA 1OILA 4S3MA 4XSGA 5JSKA