4XWTA

Crystal structure of rnase j complexed with ump
Total Genus 180
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
180
sequence length
543
structure length
543
Chain Sequence
b'APTLEVIPLGGMGEIGKNITVFRYGDEIVVVDGGLAFPKAHQMGIDLIVPRIDYLLEHQDKIKGWILTHGHEDHIGGLPYIFARLPRVPVYGLPLTLALVREKLSEFGLQDVDLREVTYGDEVRFGQSFVAEFFCMTHSIPDNAGYILKTPVGDVLHTGDFKIDPDVGTGAGIVSDLERVEQAGKDGVLLLISDSTNAERPGHTPSEAEIARNLEEIIKGCRGRVFLTTFASQVYRIQNILDLAHRQGRRVVMEGRSMIKYAQAAQATGHMNPPEPFLTSEEVGELQDQQVLFVCTGSQGQPMAVLGRLAFGTHAKIALRRGDTVILSSNPIPGNEDAVNLIVNRLYEIGVDVVYPPTYRVHASGHASQEELATILNLTRPKFFLPWHGEPRHQINHAKLAQTLPRPPKRTLIAKNGDIVNLGPDEFRVSGTVAAGAVYVDGLGVGDVNDDVLLDRVNLSQEGLLILTAVLHPTPHVEVVARGFARPNRDLELQIRRVALEAVEQGLREKKRLEDVRDDMYGAVRRFTRKATGRNPVLIPMIV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DR2417
publication title Structural insights into catalysis and dimerization enhanced exonuclease activity of RNase J
pubmed doi rcsb
source organism Deinococcus radiodurans
molecule tags Rna binding protein
total genus 180
structure length 543
sequence length 543
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
A PF07521 RMMBL Zn-dependent metallo-hydrolase RNA specificity domain
A PF17770 RNase_J_C Ribonuclease J C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.580 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4xwtA03
3.40.50.10710 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Metallo-hydrolase/oxidoreductase 4xwtA02
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 4xwtA01
4NQ2A 4PVOA 2I7TA 2Y87A 4AWYB 3MD7A 5LMCA 2ZZIA 4C09A 2BFLA 2P4ZA 3BC2A 4YSLA 5LS3A 4UA4A 4TZBA 2BMIA 2BC2A 2OHJA 4Z6XA 4RAMA 2BG6A 2YNVB 5EHTA 3DHBA 2FU9A 2Q9UA 3ADRA 4EY2A 5ACRA 4GCWA 4CHLA 3SW3A 4P62A 1YCHA 4U4LA 5A0TA 2GMNA 5HISA 2UYXA 3S0ZA 1A8TA 4C1GA 5HH5A 1X8GA 2P97A 4D1TA 4C1CA 4C1DA 2WYMC 3FAIA 1ZNBA 3DHCA 4RAWA 4NQ5A 4KEPA 1QH3A 2BIBA 2XF4A 5K4KA 4Z67A 1X8HA 4H0DA 4DIKA 1X8IA 2CBNA 1DD6A 2P1EA 5IQKA 5HIQA 4KEQA 4HL1A 3KL7A 1VJNA 2AZ4A 2VW8A 2WYMA 1A7TA 3X2YA 2YNVA 3H3EA 1E5DA 1HLKA 2R2DA 4YSBA 2QDSA 4RL0A 2DKFA 1YCGA 4DILA 2E7YA 5FQBA 1XM8A 4ZO2A 3T3OA 4RL2A 5EW0A 5HH6A 2NZEA 4UBQA 5ACTA 2OHIA 3BV6A 4EXYA 2AIOA 2BR6A 4AD9A 3DH8A 4Z7RA 3AF6A 3RKJA 3RPCA 4Z5ZA 5LLDA 3ZWFA 4AWZA 4PVTA 4F6HA 5HH4A 4EYLA 1BVTA 3ZNBA 3IE1A 3ZQ4A 4ZEJA 2H6AA 1BMCA 3IEMA 4C1FA 5ACSA 1WUPA 2WHGA 5FQAA 2P18A 2GFJA 3T9MA 4Z5YA 1VGNA 3X2ZA 4D02A 1DDKA 2GKLA 1DXKA 1L9YA 1YCFA 5A87A 3P2UA 2A7MA 3IOFA 1SMLA 3G1PA 2WYLA 5ACVA 5HIOA 3PY5A 3TP9A 4UAMA 4Z60A 2FU7A 3IOGA 5A5ZA 5EWAA 5ACQA 5ACPA 2QJSA 2YCBA 5LM6A 4EYFA 2BG8A 5A0VA 3LVZA 4XUKA 5B3RA 3WXCA 4XWTA 4TZFA 4BZ3A 2YNUA 5EV6A 5LCFA 3X30A 1KO2A 3BK2A 2Q0JA 1P9EA 4AX0B 3X2XA 4J5FA 5ACWA 2I7VA 2ZWRA 3AF5A 5AHRA 4EXSA 3IEKA 2BTNA 4J5HA 3DHAA 5AYAA 2YZ3A 3RKKA 3BK1A 4JO0A 5B15A 5HIPA 3T3NA 4B87A 2NZFA 3SRXA 4RBSA 4C1HA 3ZR9A 4RM5A 2Y8AA 3I11A 4TZ9A 3L6NA 4TZEA 5EV8A 2DOOA 3R2UA 5AHOA 4GYQA 2BG8B 2OHHA 3SD9A 2BFZB 2FU8A 1VMEA 3IE2A 5ACUA 1JJTA 5KIKA 3F9OA 5EVKA 3I15A 2ZO4A 1MQOA 4F6ZA 5AXOA 2ZNBA 2BFKA 3SPUA 4FSBA 4UWPB 5K4NA 5LCAA 3A4YA 5EH9A 5AXRA 2Q0IA 3QH8A 2FK6A 4ZO3A 3VPEA 1JT1A 2NXAA 5LSCA 4HKYA 4YSKA 2I7XA 3PY6A 2HB9A 5LCHA 2YNTB 4XWWA 1XTOA 2YNWA 5K0WA 1KO3A 4TYTA 2BFZA 4BP0A 4O98A 3FCZA 4D1WA 4HL2A 4NQ6A 3SFPA 4FEKA 2FU6A 2FHXB 3PG4A 3IE0A 4AX1B 3I0VA 1ZKPA 1Y44A 4UWOB 2NYPA 1QH5A 3VQZA 4D1VA 4EFZA 4LE6A 2Y8BA 2BG2A 4WD6A 1WRAA 3KNSA 1KR3A 1ZTCA 5EVDA 4D1UA 1BC2A 1JJEA 2QINA 3ESHA 5B1UA 5DPXA 5EVBA 1K07A 4UWSB 2FM6A 1M2XA 2BGAA 4GYUA 2Q42A 2QDTA 2GCUA 3KNRA 5LE1A 3SBLA 4EYBA 3Q6VA 2GFKA 3AJ3A 1WUOA 3IELA 4FR7A 2QEDA 2YNTA 4C1EA 5KILA 3I14A 5FQCA 5ACXA 4NQ4A 3JXPA 2WRSA 4ZNBA 2M5CA 1WW1A 2FHXA 4TYFA 2XR1A 4UWRB 4V0HA 2M5DA 3IDZA 3I13A 5AEBA 2BG7A 5K4MA
chains in the Genus database with same CATH superfamily
5HE8A 4DIEA 3C15C 4C06A 2WXJA 3V00A 2NQTA 3TZBA 1M2OB 2D0IA 1G4AE 4B3DA 4BFLA 4K0RA 4F1SA 5KMGA 4LX8A 1YUBA 5AVOA 4FULA 4A73A 5K0LA 5KSZA 4U9HS 2C9ZA 2YJ6A 3KQOA 2JFOA 1Q91A 2RKWA 4KXLA 4OJTA 4RJKA 2IU3A 2Q5CA 3K0AA 3UGBB 4Z4FA 3DMFA 2MMCA 2QLJA 4JOQA 1NXTA 1J99A 1XL0A 4P1ZA 1QFJA 2H52A 3QARA 4R1NA 4DJ5X 3OHPA 1DD6A 1NWCA 5C8YA 5IQKA 5HIQA 1ECLA 4ZGWA 1MRZA 1MO4A 1EFVB 4IQFA 1DHRA 2Z1DA 1CP2A 2VZLA 2PO5A 3VTKA 1B1ZA 4KR6A 5JSQA 4PHGA 3NYQA 2JEZA 3ZWXA 2UZ1B 2PAAA 4YY3B 2PX3A 4EJ0A 2RGYA 2X0NA 1GPAA 4YRRA 1U04A 4YWGG 3K15A 3B6JA 4KN5A 2PEYA 3E8SA 1ND5A 2X23A 1GLVA 4J03A 2OR3A 1EX6A 1ML3A 4BNYA 3AOEC 4MRPA 3KB6A 3ELWA 1IXRC 4GOKA 4F6HA 1CUBA 4R8MA 4RLQA 3UHPA 3FYHA 5C23A 3NBZC 3DMTA 1E2MA 4CR7A 1PTJC 1WW3A 5SY4A 4II2B 3UFBA 2X8WA 1CRZA 4HNRA 4LXYA 5ARDA 4CF4A 4FR5A 3SFVA 3FUUA 5DBIA 4O4JB 3T0FA 2FCRA 2H11A 2LXNA 2WWZA 1IPGA 1YE3A 2KQUA 3UK0A 1VJGA 3W2IA 5BSFA 4TUYB 2RB4A 4P3YA 3D3JA 4FYWA 4KQGA 1SCNE 1M33A 3VNRA 1TY2A 3BVPA 1HA3A 5J2UF 1C9KA 2GWRA 3HJAA 3ZV6A 1K66A 5DV9A 4WEOA 4GEGA 3COZA 1MFPA 4WJZA 1S2NA 1OI3A 1VL5A 2XDWA 2Z8LA 4EZJA 3Q0TA 4G3XA 3IILA 4QX6A 4UAJA 3WFZA 2QYSA 2QUKA 4WNYA 2AMFA 1BT0A 1ZMXA 4HRVA 4ZT3A 1DSSG 5DLDA 3ZU3A 3ZJUA 2QGNA 4DT1A 1GYRA 4ZC1A 2AR9A 3LUJA 3L0OA 4QOGA 1GYPA 3W3AD 3Q3MC 1KMQA 3UT5A 2O5VA 1J2RA 4OU4A 1DINA 3G1WA 4QU8A 2G0AA 2ATCA 1YE8A 1HQCA 2N0SB 5F3RA 1XTSA 4RHUA 4M3NA 2HRRA 1W4ZA 5C51B 4GSKA 2V3VA 4ON9A 5F4BA 3A1NA 1TK2A 3K05A 3Q6IA 4TKMA 1RXVA 2F3UA 1IC6A 3DFMA 3N0VA 1QFMA 2H7XA 4W9NA 5BYJA 4QDOA 4C30A 3P94A 1COZA 4N7MA 3EJ6A 5DO9A 3LOUA 1J7AA 2D4AA 3AI3A 3ZHTA 4ZZIA 5DNVA 2XK5B 1E79A 1QIEA 3PFBA 5JSFA 3DYBA 1CR2A 4KXYA 4E30A 3IE0A 3VH2A 5CP8A 2PSEA 3OE1A 1ZKPA 1QQ7A 1JMKC 4PYMA 2X77A 1X77A 1NF8A 2BWES 1L5QA 4RF0A 4S35A 3CXUA 3L1JA 3TD9A 2WLTA 4L9AA 2XSZA 2JK1A 1VJTA 3H7PB 4MRSA 2Q28A 5CLIA 1M2XA 1W6UA 3T5PA 2CN1A 1DXYA 4F3NA 4TKVA 4G8JA 2MJLA 4EHBA 1E6EA 3D6MA 4M0FA 3AF3A 4M76B 4BGIA 1CUFA 3O7WA 1ORHA 2FFBA 3IDZA 1FP4A 5DX0A 5C3JB 3G9QA 2EKDA 2P35A 4QOEA 5JZSA 2DUWA 4NABA 5NLLA 2ZE8A 4KO8A 4YH1A 5JPIA 5LS3A 5BT8A 2QL7A 4HNHA 2P68A 5IASA 3O1HB 5ELLA 1MC5A 1D4AA 3USZA 3A11A 1GPDG 4HB4A 2Z5VA 1ZLXA 1T6BX 4KQCA 4UEOA 3KZKA 4ANFA 4X6YA 2JUOA 1XUOA 2O06A 3QUCA 3EZXA 2VHQA 3L7CA 1XQ6A 2V7XA 4LYDA 2BEWA 1I4HA 1YR9A 3U2QA 4WNCA 1NSFA 2QY9A 3B89A 3DL4A 3SIXA 1P5FA 4N5LA 1EK2A 3OF5A 1F8FA 2QQFA 2QRQA 3I9OA 1DO0A 4ISCA 1AMUA 2QL5A 3FKQA 1ZNXA 1Z7WA 2V4MA 3DEAA 3GLQA 4RMNA 3OLXA 3IRVA 2REOA 4Q19A 4P1CC 5F73A 9ATCA 3PLNA 2CFRA 1E1KA 1BE0A 1PZHA 3MT9A 2W2QA 1G5IA 4DILA 3I64A 3JSAA 4UNQA 3DC2A 5HNKA 2ZRNA 3IAS1 3PC3A 4JDPA 1H66A 3VYRB 5IJ9B 3P2MA 4YUZA 5C1BA 3D7NA 4B6SA 1TKCA 5FKAC 3R75A 6REQB 3O83A 2EDCA 2BRUC 3ZLZA 4Z5ZA 3CX7A 3AE5B 2NUTB 1W36B 2H6AA 4TWJA 1YQ3B 3K2QA 2UUPA 5LZ9A 1CJCA 3TBKA 1TTQB 2OGTA 3STVA 3SYNA 1CUHA 4Q3KA 1ODKA 4EUSA 2ZI3A 4JB3A 4WIAA 4DA8A 5H5JA 3AINA 1JWMD 4C4OA 2QMQA 3UPDA 2RGBA 4PM4A 4LSMA 1IATA 4RTLA 1EVEA 3WMXA 2B8EA 4MLCA 6PFKA 1RM5A 1XEXB 3OG9A 1S2GA 5AKGA 5BSKA 3ESDA 9ABPA 5FWYA 1ZW1A 3IHLA 3WGQA 1ROEA 5BSMA 3FGNA 2HFJA 5J17A 1KA9H 1TJ3A 2NTSA 1QPGA 3ZWKA 2PZGA 3G0CA 1M7BA 3AIMA 3ZS8A 5I9LA 5HRUA 3WYAA 5THKA 1XZDA 3AJEA 4A36A 1FRRA 4QYIB 1XB2A 1ZIDA 4NP6A 3GYGA 4D4LA 4A8JC 4IIDA 3R2IA 3A26A 1XCOA 5HFNA 2ADMA 4FLEA 4H4EA 5JHAA 2ZCVA 4JO0A 3CF4A 3G2QA 3H8JA 4UUQA 1LKZA 1E2HA 3IS3A 5DLEA 4QATA 3X2EA 3WIBA 1NQUA 2UVQA 2PYDA 1GDHA 2HCFA 3O13A 1LU9A 2CKDA 1FIQA 3NTRA 4IQ4A 3REGA 1XHLA 4ENWA 3RCZA 5L7WA 5JSHA 1U8ZA 5IZCC 3M6AA 2R2QA 1WD7A 2IPOA 2IHJA 3F46A 2GNPA 1P6QA 3VR9B 3F3MA 1IBSA 3KUDA 2VRCD 1R4NI 4ZYNA 4F4HA 2Z98A 5LP6A 1TQHA 2WTNA 3R3ZA 3GJ3A 3STHA 3SE7A 4NZNA 1KKMA 1KEZA 4BNVA 1ZFNA 4XSVA 1NBOA 1B6GA 4KU4A 2UVPA 3ETCA 1KTVA 4R2WA 4ZJPA 5DHSA 3GLTA 3NJ4A 3UAWA 4R51A 5FH9A 4HAOA 3DDOA 2GJSA 4YJKA 2B99A 5GWXA 1SG6A 1N3IA 1UFOA 1UUFA 1NMYA 3WGHA 1PR4A 3FWYA 2P11A 2O1XA 4E03A 4RFSB 4FLHA 1OXXK 4BRSA 5M34A 4WFJA 4MPDA 3AJ3A 1A95A 2WAOA 4D4KA 2P0YA 2PA3A 4TTQA 3AR3A 2SKDA 1O08A 2VPQA 2CF5A 4K8OA 1WE6A 4EDHA 3PD7A 4YDQA 4JBYA 5LQAA 3RAJA 1FFVA 3H2JA 4JT4A 4RTSA 1NVUQ 3AP1A 2G7MC 1T91A 5EXPA 3MD7A 2JPHA 2J0QA 3BBLA 4RJJA 1CJSA 3GFVA 5F4ZA 3S7ZA 4MUGA 3PDIA 3AQIA 4WOPA 3FMOB 2ZJ5A 2XUHA 2W37A 3GGOA 2QC8A 2AI2A 3UENA 3G8DA 3IT3A 3NBQA 4RJ2A 4OQXA 5ECYA 1LPAB 4EB6B 1YQQA 4UTRA 1WZ2A 2EX0A 3ZNGC 2EJCA 2I33A 1QRDA 4PBRA 4QTXA 3U9SA 3NEYA 4GYJA 3DBVO 3KPUA 3LW8A 1UR5A 2XIQA 5FBZA 4DLNA 4I1OA 3FTNA 3G9TA 4WJQA 1DFGA 4N6OA 5AKIA 2AZ4A 1DIOB 5AQ1A 1CZHA 1HE2A 3O2QB 5EJMA 4C1NA 4ITUA 2IEAA 4IXWA 2Q6KA 1PLLA 1P7PA 2GMWA 4QJ3A 4MVWA 1OFUA 1AYFA 4FGZA 1CT9A 4ZO2A 1PWYE 4ARAA 4TVKA 2Q3CA 3E2PA 1QMGA 3B13B 3ABZA 3AI2A 1QPBA 2XY4A 1O96A 3F71A 1Y6JA 2C2OA 4MLDA 2GJ8A 4QASA 5TNXA 2WF5A 4CIDA 3E1SA 1WTCA 3W5DA 4ZQFA 4Q05A 1XJQA 3EA6A 2LHEA 1H1LA 3LC1O 1ST2A 1P2FA 1N6NA 4QUAA 3ZX4A 3PHHA 1EUDB 4YT4A 3N0RA 2ZGVA 2I62A 2ZJ8A 1I2BA 5HBRA 2XQGA 1N6LA 2DX5B 1NNSA 4KIKA 4B6WA 4IDGA 5EJ7A 1Y9EA 1PX0A 3E2IA 4YRGA 4OHKA 5DVZA 1QRUA 3ZH9B 1JH8A 4JBHA 4OI1A 1NG9A 3TXYA 2OUKA 4MR9A 4HEQA 4W7HA 1ZC3A 3IJEB 1TFRA 1Q74A 3C2QA 3U3XA 4JA0A 1XCTL 1N6PA 1RRMA 2QN6A 3P4UA 4MR8A 3M62B 1ZBDA 3V1NA 2Q7XA 1LF0A 3RUCA 1U0HC 1NI2A 4NI5A 4U3JA 5LD2C 1KERA 1MC1A 1H6BA 1V8BA 1YDHA 4RTOA 1JLMA 4DDKA 1EWCA 1U0FA 3DTVB 2HYIC 2P9CA 4PYNA 3I45A 5HI1A 4WOCA 4NPNA 3A33B 2NT3A 3HKDB 5FWAA 4XX5A 4NF2A 4IINA 1PGXA 3RNOA 3KXPA 3B2GA 1QFYA 4K7SA 3A36A 3PQEA 3FZNA 3V97A 1FFEA 3B48A 4S17A 3OCUA 5E6SA 1E0SA 3SC2B 3BWEA 3ZBQA 5JI3E 1MC4A 4P82A 1SBCA 4L8FA 4OKNA 3GNTA 5LPNA 3PNYA 5FI0B 4X41A 2G0TA 4P7JA 1B93A 1PX2A 1DHTA 3BSYA 3EPHA 4HBGA 2V7QA 1VLMA 4B17A 1XYVA 2R0QC 2NBUA 1HF3A 4NY1A 1ABEA 3B8EA 1Z34A 2XVMA 2VJPA 2NSYA 1MFWA 3CX4A 1D2MA 2W2KB 3T7KA 3E3OA 2ES4A 1ESNA 5JD4A 4HK4A 4PFJA 4B3CA 4NZPA 3NHZA 3FMGA 4H9GA 3RHTA 3FNBA 2VF7A 2P5TB 2BCGY 4R2MA 3W7VA 5FWDA 4TRNA 3ZU2A 5EVDA 3CSUA 2YJZA 3AFMA 5I4CA 1RHUA 2I55A 1HLFA 4CPDA 1DELA 4YFYA 5B3KA 2LPMA 2QM0A 3JVVA 2QMYA 5G1OA 3ZCVA 2PBZA 3LVBA 2E5LB 4RK7A 5CBPA 1CTQA 4OG2A 2JCYA 3K9LA 3D3EA 1S1QB 3ADBA 2PVPA 1ZPDA 1YMQA 3MCVA 1YWGO 4Q3LA 1I7SB 1NV8A 2GUWA 1WIWA 2HA4A 1T0IA 3BWXA 4XH9B 1H2BA 1FMJA 4ALLA 3EHEA 3ER6A 3LL7A 2XE8A 1U6KA 4FEYA 4Y2YA 1UMKA 3KL2A 5DXFA 2HBYA 4Y6QA 4Q4JA 8OHMA 4ZCIA 3S2IA 1OYVA 4G4GA 4P7GA 1NR1A 1V4NA 1CRQA 1KTIA 2AYYA 3KJZA 1BW9B 1LK0A 1TM7E 2D3GA 1VJDA 2Q4BA 1VSVA 2PS9A 5EPEA 1LBQA 4CFZA 1C3OA 3JYHA 4MW4A 4MS4A 2EBWA 1F3LA 1ZNBA 2H08A 3Q3NC 3PXCX 4NQ5A 3HKEA 1QT9A 4K87A 4J94A 2Y3AA 4GXBA 1GU1A 1BRMA 2P9JA 4Q5IA 4ZN6A 3H6NA 2YVCA 5ILOA 5ALWA 4OD0A 4OHUA 4YXDB 3TZKA 1KKUA 5AXBA 4FNAA 2B2NA 4Q3BA 4P54A 4TMXA 1YTLA 1WQ3A 1YJ1A 5TJ9A 4WGGA 1BDBA 1DU4A 4RTKA 1YZQA 2H89B 1JCKB 2GLXA 2E0IA 3UW1A 5KAPA 3GFTA 5SZHB 4I5FA 4HDNB 1EP2B 4WWNA 4EKGA 4MJ3A 2DHCA 4YT2A 4PSUA 4PY2A 3WL6A 4TRMA 4M6WB 2GCEA 1N9ZA 2P3QA 1M2VB 4FCWA 1JIXA 2J3IA 1WZCA 4DZTA 2YOGA 4X7RA 2G77B 3HR4A 5SZJA 5IVPA 2B3TA 5A3JA 2XYHA 3QY0A 1EX7A 4JUFA 2VOEA 3VMMA 4UHFA 3K71B 1KMHA 1NXOA 2CXOA 2GAIA 2R1TB 2BMWA 4MLZA 4K46A 2FNAA 1O5OA 3UMCA 5BYSA 5JAOA 1L4BA 3AERB 3GB9A 3DO5A 4Z9AA 2IYFA 3V7YA 1DKLA 3SOPA 3GG9A 1DG1G 4N5DA 2IHZA 3U26A 5EKSA 3WG9A 1VI5A 4O2LA 1L5VA 4XIYA 3LDUA 3KEGA 3LPMA 4IDIA 4MUBA 2CV1A 3I62A 1QB7A 1H0KA 5IF9A 2NW6A 3R24A 2JY6A 1V1PB 1Y8QA 4Y2UA 1ZXHA 4QQNA 3C3PA 5IC4A 3KAPA 4HTAA 1VHJA 3I8OA 3JPYA 1JV2B 2I3BA 2CVZA 1BDMA 1OWMA 3GC6A 1UWMA 3ORSA 4HGRA 1QGED 4DREA 1RWXA 1CQIA 1P2VA 4N41A 4JYAB 3C8UA 1KDRA 3H0EA 2ZJ4A 2YVLA 1DLIA 1NVDA 3ZHOA 2GJAA 2TMYA 3N7TA 1Y9ZA 3H3JA 2Q7OE 5GM2A 4CT0A 2OAGA 2A9RA 4B3TB 4JCCA 3OX2A 1OQRA 3NVAA 4J1TA 4WY2A 4WPGA 1EBUA 1VKJA 2R68A 4JMPA 1EVQA 2CVQA 1OLUA 3HXTA 3KWLA 1RKVA 3K0CC 1D0VA 3VI3B 2JYEA 4XUCA 1VZ2A 4IG7B 1Z28A 3I4LA 1R7RA 4XB6B 2FSVA 3L7MA 1V48A 1NG1A 2CVOA 3DFFA 2FHXB 3AR9A 5KTKA 3RQIA 3DD5A 5LN1A 1OOEA 4EFZA 3CLRC 1QRSA 4ESOA 2PUWA 4JT9A 3SZUA 4JB2A 2A5FA 3ESHA 5B1UA 3MG9A 4O08A 1Z5UA 2OMKA 5JYDA 3HVKA 4ALJA 2V0CA 2VA8A 3DBIA 4QO8A 1JP7A 3PJEA 3FUVA 5KHAA 4BFTA 4CLOA 1Y1KE 2H9AA 2Z30A 4QDTA 1CC1S 5EIBD 2K2WA 3ESYA 4LTDA 4Z7JA 3RIEA 3BFKA 1Y5IA 4CQMB 5CDFE 4BRZA 2GD1O 2ONKA 3ICCA 2H4FA 2IS4A 1R50A 3DEIA 1YS6A 3RJTA 2B5VA 3RO7A 3CPSA 4YCSA 4P0TA 2E5FA 4XGQA 2O0KA 3SYTA 4BVFA 2DU8A 1J8QA 1S89A 2AFHA 5CFOA 4QRDA 2WVHA 3ERCA 5TSDA 3FILA 4PBSA 3CT4A 2DWOA 3QW2A 1FVXA 1NFRA 1XNHA 4BNHA 4UUPA 1H5NA 2WYWA 4MQEA 3F8TA 3PUWA 1GTG1 3BGDA 4FPXA 3D8HA 4L8VA 5LSAA 5IK2D 3WRXA 3X2SA 4BEBA 4XLZA 4YRDA 3CRW1 4JLNA 1CR6A 3O3NB 3CCBA 4CHGA 5DYNA 2OPBA 2A5LA 1C4XA 1G6KA 2RHBA 4KI7A 1LRJA 3R23A 5KYVA 1Q14A 4LYYA 1ZH4A 1FFDA 5KQSA 1LUAA 4YBRA 1WMBA 3HDTA 1T24A 3FDXA 3Q3JB 1N6HA 2OLKA 4W9DA 4EGJA 4INPA 3RU3A 5DB4A 2I3DA 1KVTA 5H8YE 3KYBA 2B1RA 4EHAA 2ZJBA 2C8LA 1JIVA 3KTAA 2EELA 3A6PC 1QVRA 5IXYA 3V1MA 3RSZA 3LDHA 3G2MA 3VKHA 1TZ1A 3ET4A 2XA1A 4JC8A 2Q5QA 3RLFA 5DISB 2CUNA 1BVRA 3VKGA 3AU4A 4KO4S 1XQWA 2JAQA 3KQQA 1SB3C 1VIVA 3PUHA 1WL8A 2VF5X 1XD9A 4M9UA 2B6NA 1PR0A 5GIOE 1SD2A 3CB4A 1JTEA 3FNGA 3Q2OA 4QXMA 1H42A 3LVZA 3W2GA 2JIQA 4RDHA 4CV1A 2QGZA 4HH3C 2Z2ZA 2GPTA 5KYGA 3U30A 4OP3A 4BBPA 5F9FA 3JU3A 1X7XA 4ZPXA 3GGCA 3DDNA 4IWXA 3U09A 3SDLC 3GW8A 3HM3A 3PR3A 1XLNA 1OYOA 5HP4A 3ILXA 1ZOIA 4L50A 2Q21A 2J07A 2BUBA 3N1ZC 1R88A 1ZZGA 2YZKA 3JQGB 4NYMQ 3K1AA 1MX3A 4M7OA 4E4TA 4UHDA 4EX7A 2KWCA 4J1NA 5ITWA 3ILVA 1JVSA 3PNPA 2GI9A 3AEKA 1KOFA 4V0QA 4MINA 1B8VA 2FQ1A 3HDJA 1P31A 4URUR 1NW6A 2UVDA 2V6MA 4FFVA 3K70B 4C0KA 1ZKHA 2OGZA 4RA6A 3KLSX 1SBNE 1QCYA 4XLTA 2KDIA 3GGJA 3RVOA 5JARA 4RWZA 2Z2JA 2CHQA 2E1PA 4LK2A 2AZTA 1C79A 1UK8A 4LJ8A 3M4NA 5CDUA 1RFAA 5I3ZA 2ATXA 3FXAA 4EQZA 4DSAA 3E70C 1WHTA 4POOA 6YASA 3L8HA 4Y9TA 2J33A 5IF3A 2O3TA 3AVXA 1MD9A 1JLKA 3KKQA 1PS0A 1SCUB 3OO0A 4LZWA 1JTVA 4R7ZA 2BFBB 2Z5LA 3OMXA 3WALA 3UMRA 2YASA 2ZBGA 1X7DA 3VO9A 5I45A 4BQPA 3W4KA 5ICGA 2KKCA 4XGNA 4I99A 2HD5B 1WOMA 3RRMA 2CWWA 2XB4A 1KY2A 5IDVA 5BRNA 5IKMA 3QSGA 2WYHA 3U31A 4NK5A 4R3UC 1YMUA 3TO5A 4JXKA 2OBFA 4YPFA 4RNDB 4UFNA 2HU7A 5BVGA 3TW6A 5CH3A 4MGZE 3NT5A 4QGGA 1SVIA 3B1JA 1EVYA 2RBGA 2HPZA 2VPZA 4HLUA 2BQQA 2CNNA 1UMCB 4W5NA 3IOMA 4KXQA 5HGJA 3I5UA 4C7MA 2FX3A 3V32A 1TKBA 4K1LA 2CBZA 5D6JB 2VTDA 1RYJA 5ACRA 4OLHA 2QI9F 3MUFA 5JAIA 5BQPA 3IP5A 2XYGA 4DR3B 1L5HB 5CGQB 2IU0A 2DHEA 2FDXA 5CK4A 1FFWA 3U5TA 1BX3A 4IDHA 1TI7A 5KTPA 3H18A 3SWWA 5LCXA 3KQTA 5ALHA 3DBSA 2W83A 3ROGA 5L3SB 2E5WA 4WACA 3QVSA 1H3NA 4BN5A 4XVCA 3T95A 4ZD6A 3A1QA 3W5BA 1IY8A 1A9OA 4H3SA 2QE7D 4OV6B 4Q9IA 3T1HB 3ZLVA 2EBFX 1MNAA 2PT5A 2H4HA 5AM2A 5BV1A 1P1CA 3T8YA 2XPCA 3T3PB 4PZEA 1NMZA 4Y9DA 3UIOB 3JQPA 3E35A 3M1IA 3AY3A 1NVKA 5IHPA 5CG2A 4K6MA 4PDXA 1OMOA 2HQSA 3PGXA 5G2OA 1RMYA 5IJ0B 3HUIA 3JQRA 1M6YA 3VU8A 4HH4A 4M8KA 2HF7A 1N5RA 4OVUA 2K8BA 1PBNA 3ANLA 5JHBA 3E61A 3GP8A 5EMJA 5EJ2A 2ONCA 4OXIA 2ICAA 3U6BA 3T94A 3DBRB 1PHRA 4KGSA 4MW9A 3H2SA 2COKA 3NFYA 2NTYC 3ENWA 4LHWA 2QEQA 1E2JA 5CYGA 3LC2O 1QG4A 5G3ZA 1HRKA 2H4ZA 1J8YF 3WJ2A 1ZN7A 3VR6D 2C5FA 3Q88A 1R5NA 1MDBA 5THQA 3A58B 5C1IA 1NF3A 3GZNA 1GOTA 4GYWA 2C0PA 2VNIA 4D45A 2XOKA 4DV4B 1K8YB 1Y82A 4W5JA 3GLUA 1T36A 3W5CA 1L0BA 3B3JA 2QRHA 1KO4A 2I7VA 4L28A 3CE9A 4ETIA 1XV5A 2YFKA 4DCVA 2VEDA 5F33A 2FLKA 3B60A 3D6JA 1S01A 4ZAZA 3AW9A 5BSEA 1DP4A 1FO4A 1NDHA 1FNBA 2PMVA 5EHQA 4RD0A 1NULA 2AB0A 1SE3A 2OAEA 2VPIA 1MG8A 3CWIA 1G5QA 5JMWA 1Y7HA 4DEYA 3VR3D 4UHCA 1N2OA 1GB1A 1RM3A 4JVNA 3OPYA 3P2BA 1Z5NA 3N05A 5B6IA 3IIKA 2QMHA 1VE1A 3AJ8A 4J49A 3TLEA 1WXSA 3BH7A 3N32A 1RYBA 1B6SA 5JLAA 1USUA 3PB3A 1LS1A 1U80A 1Z22A 4C7OA 1WVGA 4QOIA 2IDYA 2WD9A 4JHXA 2HO4A 1KGSA 2A94A 4KLAA 5D6NA 2GXQA 2G71A 1SZPA 4GSLA 3L54A 3FMVA 5AK4A 3ZUNA 4EKEA 5CW2A 1SEVA 4JGHB 2CL0X 2R00C 1KAOA 1Q7RA 4BMNA 1CR0A 3MBKA 3FCZA 4QAYA 4TLCA 3DVLA 1W7AA 1LGYA 4LE2A 3DLCA 2Z6QA 5DTJA 3VH4A 4PW0A 2C4MA 1IZYA 4EF4A 4E33A 2XGGA 3SR0A 1SXQA 1GC7A 3B52X 5F5XA 1EK0A 4NZLB 2UUCB 1LC3A 2E2WA 1MA3A 3DT6A 1NYRA 1XRRA 2RI6A 1UT6A 4OP1A 2YYSA 4FKZA 5EG5A 4CV3A 3ORFA 2EEPA 3B1VA 4AMBA 2YRWA 3T7RA 3MTJA 3ZDFA 1D5WA 2H7CA 4Q7LA 4LVUA 2JRIB 4KXMA 2JT4B 1ZDVA 2FN8A 2A33A 1DZ3A 1ORRA 4XFKA 3KKMA 2XQJA 1PL8A 4LNOA 3TW8B 4M00A 5EHZA 5I9IA 1WMHB 2X1HA 4BWVA 4C0XA 5IS2A 4QSHA 4Z1MA 4YECA 4YSLA 5D6OA 4R9NA 5TGZA 5LA6F 1CUGA 4IUDS 2NU7A 5EA2A 2RIPA 4A1OA 3NFRA 1KHHA 2OG1A 3FETA 3CUVA 2R6ZA 3PFIA 5FL7D 3ENNA 3U9TA 3E27A 4E1BA 3PDHA 1UWCA 1UXHA 3I5YA 3OOHA 2ZB3A 2WDPA 5EN4A 5KQMA 1QG2A 1N7JA 1ISJA 2GEFA 2FK8A 3JQ8B 1U4AA 2WXRA 3ZGOA 4EP1A 1JEQB 2YN4A 2E18A 3EFHA 1DRJA 3OQ1A 2AEMA 2WU5B 1JDUA 1ILWA 4BX0A 4ZTUB 2XWSA 2OOKA 4JI3B 4D56A 5DULA 4MW2A 3I2FA 4JQYA 1DAPA 3NIGB 3KTFA 5CW1A 3V2GA 4PQYA 1K89A 4TL8A 2WU8A 1V35A 2EFEB 4C29A 1VBMA 2NYVA 3TQRA 4A7PA 2X1MA 4NQRA 4PYKA 4RIEA 5AM0A 3RLIA 3QI7A 5F2OA 1C2YA 3P4YA 2R5WA 1PW7A 3OAWA 3DQZA 2B8NA 2FK7A 3Q5GA 2ORED 3ZWAA 1PYGA 3O8OA 4C1FA 1D09A 2F4NA 2CYAA 2ZP1A 4XYMA 3AUYA 3IPLA 4Z5YA 3QGMA 3PHCA 5HQTA 2O54A 3DKKA 2Q8PA 4ATNA 4FHCA 1VHQA 1TAGA 3W8DA 4MQ6A 2P62A 1AVTA 4CEHA 2IYPA 4FJYA 2VYVD 1OAKA 2D4HA 2A1IA 1I5OA 3WNCA 4BLOA 1SOMA 5AT1A 3ONEA 1M73E 2Y5CA 3CZPA 5ACPA 2FE1A 1RZ3A 5JD5A 2QXUA 4PLGA 4D8WA 4LW8A 3NXKA 4GDLB 5FA5A 5BQXA 1C7JA 2FR8A 3LZ6A 3TAUA 2A9FA 1YJCA 3FFBA 3UHAA 1FW6A 4GOJA 4I2VA 4FJ0A 2BS2B 1TQDA 2ZIUB 4GP7A 3ADOA 4BNWA 2EW8A 1DQSA 2MQJA 4G0UA 4YP6A 4EHIA 2R4UA 1HURA 1NSYA 3H84A 3JQBC 1OKKD 2W4QA 4LSGA 3TH5A 1SHUX 5J5CA 2WDVB 3CU5A 1QQ5A 1VMKA 1X1AA 2G70A 4B84A 1R0RE 4LGYA 4IKPA 2CLMB 1ZUWA 2H6EA 3WBFA 3X0WA 2PVOD 3ZKAA 2G36A 5A04A 1IUNA 3QOFA 1T34A 2AHRA 4ANWA 3IPCA 1MVKA 4D2IA 3I15A 5J5AA 5HG0A 3FSRA 4NFLA 1SQGA 5DBHX 3H65A 5TRTA 5AW6A 2FZ5A 1IN8A 1GG9A 1T0RC 1IYFA 1RAIA 2XTMA 3QH8A 4E7PA 4C80A 1VJ0A 1DQZA 1PJSA 2NZ8A 1Z5PA 2ILVA 5IM4F 3ZDMC 4OBBA 1CLEA 4WKOA 1K7EB 1N78A 2EWWA 5KSPA 3L4JA 3TL2A 1G8PA 1SUSA 2RE8A 4QOSA 1LQ2A 1PZFA 4ZQCB 3ZCQA 2Y5BB 4RMIA 1XZEA 1Z5SB 3NHLA 1JA1A 2NZWA 1F20A 4KN9S 1NE2A 4Q1VA 3KIPA 2KN4A 3FJ1A 4S24A 1JPVA 1JBQA 4KQIA 1RLJA 1WXHA 2YX1A 4IPTA 1G55A 3CT6A 3AFNA 2P41A 2QDTA 2PL5A 4X71A 1PS9A 3AEAB 2NVWA 3GLVA 2QM8A 3L6DA 3RWBA 2PGDA 4JEMA 1CXZA 1VTKA 2CCGA 1CNFA 1X2EA 1RQ2A 4A6DA 2C4WA 2L52A 4H1VA 1GPNA 3IJPA 4QVIA 1JBKA 5FP0A 1G8JA 3TKAA 4KDRA 5DM0A 3SG0A 2V6IA 3PE4A 5AVUA 3CXRA 3KQLA 3LYHA 2E82A 1GGVA 5TGTA 1KTKA 2NU9B 2W6CX 1Z7EA 3WR5A 2KDFB 1ZRMA 2ZTVA 4MQ5A 4E5VA 1HE8B 3JARA 3C6BA 3OBIA 1BXKA 3BXEA 1ADYA 1OD6A 2BKAA 5A9RA 4CHTA 3RIMA 4LN1A 3ETRA 3OT1A 1GAEO 1UMBA 4MVJF 1MRSA 3EGRA 4GF5A 4MLPA 1NRWA 1X7ZB 2C1XA 1AOXA 2W6JA 2VXYA 3UI3A 3LIIA 2W2PA 1RMTA 3L7NA 1QH0A 2O1EA 3MD9A 4GIBA 3DEYX 4EG6A 4QGBA 3GLFB 4AZ3B 2OAQ1 3N8NA 5DYYA 4RU1A 1TVEA 3KOXA 3O5AA 4G63A 3HBFA 4ZRKA 4CKZA 1D6JA 5DOZA 5EJAA 3W1WA 5JAZA 3AESA 2VC2B 1WZIA 3TQFA 2HWWA 2J31A 1XZKA 4DXAB 4GKJB 3K0EA 1KVQA 2V4IB 3RUAA 2QZ4A 1F6WA 1OC4A 4MUKA 4DR6B 4WBNF 4TVSA 4RHYA 1BVUA 3C1TA 1X1RA 4D3SA 1BHQ1 3NHKA 1JG7A 4ZVRA 4EFDA 1J6UA 4F97A 5CLHA 1EMDA 2RKBA 4YQZA 1WY7A 4EEXA 2J9FA 4R6WA 1WEKA 3EDOA 4G56A 1OWLA 3CLSD 2I34A 1TCBA 2YWBA 2WUDA 1F0YA 5KJ6A 3AILA 2FU7A 4D79A 1DBWA 3EC7A 4F3CA 2VHZA 2WFLB 3DMDA 1TQ2A 4BQNA 1YKGA 5CEFA 1FU4A 4I6NB 1IN7A 4NJEA 3VYTB 1Y6GA 4IRXA 3DXZA 2DFVA 2NXWA 1F6BA 2N1WA 2BH9A 4TS3A 4KGRA 3ECIA 2HT6A 3CKYA 4W5WA 2Z4RA 2ZWRA 4MQLA 1ZGUB 1MX5A 3I30X 1MIOB 4UCXA 3C3CA 2GEVA 1E69A 5A4MS 1ULSA 2P4QA 1YQDA 5HFAA 2NU6A 1ISIA 5I9SA 4P7IA 4MTCA 4RM5A 2WTMA 1AD2A 1EBFA 1JU3A 3DULA 2W43A 5EJGA 2P8JA 4ITRC 1VLZA 4CLEA 3WFIA 3DFZA 3DJYA 1JWLA 2I71A 3BCHA 4NU8X 3ZCUA 3TGPA 3OSZA 3ENQA 2P3SA 2D07B 2ZKLA 1R66A 5C3MA 2FN9A 2X15A 1T0YA 2HXGA 4TPKA 4M46A 4UWPB 5D1NA 1WAMA 4F8CB 4IJQA 3HQ4O 5H81A 3K31A 3U4QB 4MHTA 1RJDA 3D43A 3DZHA 4G5RA 3ZZ1A 1XVAA 4IFIA 3G49A 1GNQA 3HVDA 1EFTA 5CT4A 2JVIA 4HATA 3NUHB 4ZYWA 3P45A 4G5FA 4TSSA 1N0IA 2FXVA 2ON6A 1UJ5A 2YKGA 1GZ4A 1E6KA 1XMXA 2FSHA 2HMYB 4XD7A 4ZHPA 2Q46A 2J9RA 2NU8A 1WZ3A 1E1RA 1E9CA 3UCEA 1U6JA 3NHBA 1U2PA 2XB8A 3R0VA 1RPZA 3EA5A 2PT7A 4KPGA 5JXIA 2BKFA 1KAQA 4LY3A 1OXMA 3KNRA 2L19A 3DBLB 5LE1A 2ZVJA 5L51A 2QVBA 2WG2A 2QL9A 3OT4A 1NBIA 4JVOA 2OE2A 3DUFA 5JDIC 2HK8A 3VZSA 4NEQA 4YQFA 5E4JA 1SUBA 1C0IA 3SHFA 4PYJA 4DCTA 3GVIA 4RYDA 4UXHA 1FJGB 3OAAD 3P2IA 3ONNA 3ZDZB 1JDPA 2KFKA 2K6GA 4Y2XA 1TUIA 2JJQA 1C80A 4H4CA 4L7QA 1N9GB 5KTYA 5JAUA 2YNVB 2D5CA 3L4BA 3RRYA 3N20C 3C7TA 1QLJA 5G3YA 3UAVA 5FYDA 2VP4A 3U7QA 1X8GA 4ZGGA 2G17A 3L82B 3W34A 4EITA 2FPMA 2ODTX 1VC2A 1I7HA 4RDIA 1ZM3A 5LDGA 1OGJA 4KEPA 2VTEA 2KTRA 4B3JA 3FTEA 3EIFA 4K5QA 1WW8A 4GZ5A 2WYQA 4QDZA 3MN1A 4LXQA 1WUKS 5E6OA 5CXXA 4YMSA 3QVLA 3F78A 5A1JA 1YR6A 3AWDA 4I7EA 3PHLA 5CFZA 4DRYA 1HH4A 1DDIA 2W8ZA 2XXBA 1YR2A 5BUZA 2DKFA 1GPUA 4TMAB 1A9TA 3MMPA 5GGYA 4GQBA 1U3VA 2FZLA 4A8TA 3PDUA 2FEOA 5HKKA 5KNDA 1IFXA 3COYA 2MBOA 5AM4A 3CY6A 3NC0C 3ND8A 1UDAA 1DNPA 2WIFA 2LCFA 1P0PA 2V4LA 4A3PA 2H8KA 3VPDA 5JVDB 5KHQA 2ET6A 2WTXA 5F7OA 4AWZA 2RDGA 3ZIUA 3H5AA 1EAMA 1R0BA 4X3CA 4MP8A 5DHUA 3DLAA 1WUPA 5EJIA 4RCYA 4A8HA 1HZZC 2YR0A 2Z5FA 3QK0A 1ORDA 3SM9A 2I2CA 1U0NA 2C2HA 4OBWA 3R40A 4R0VA 2IO3B 4U2EA 4Q9KA 2XTZA 3NS1A 4KZPA 4DDUA 3GJ0A 4TM7A 5B3AA 4DJFC 1U3GA 2HRZA 4YJ3B 1E8ZA 4RV5A 3U1VA 4WLNA 4W9FA 4OGLA 1ZSYA 4CN8A 2Q5WD 2G40A 4X64B 3IESA 1GXSA 3A4VA 1XRNA 3JZFA 2VS1A 1TIFA 3WAJA 1P5JA 4F4JA 1X94A 1GSIA 4Y1RB 2LJIA 3QFFA 3NT4A 3FVVA 3VV3A 1RRCA 1A7AA 4OQLA 1KRXA 5IULC 4MVCA 3JASB 3I76A 2WU2B 3BKWA 1NJ1A 3CZ4A 3NOBA 1BFUA 5L95A 3PIDA 4WTOA 7REQA 3L6OO 4H77A 3R6DA 3EUAA 4IH1A 4XJVA 2VJMB 2C3YA 2H2WA 4XAQA 4B73A 2XCLA 5H0IA 3NGMA 1CZOA 1FE8A 1JSXA 3KSRA 2BDTA 3MTAA 4XWAA 1I4OA 2MYNA 1L5FA 5EPOA 3VO1A 3ZE6A 2AE2A 2PLRA 4URWR 2F8SA 2W6IA 3BTVA 3O47A 3NM4A 4YWJA 4CMIA 2X1VA 3E5NA 2CVFA 1EH5A 4G8DA 2RI1A 3VFDA 4HROA 1V16A 1WLYA 3NNNA 4UZEA 3GFQA 5D5QA 4KO3S 1TAQA 3INYA 3NZ3A 4EWLA 2KJ6A 3JAWA 4DLXA 4HKYA 1XZLA 3O31A 1KO1A 3DLTA 4ND3A 2PGNA 5FLKA 2FQWA 3ZHQA 3T1TA 4BDTA 4M4SA 3E58A 2IWHA 2E4VA 3PITA 1DZIA 4KKVA 3HL0A 4B8YA 2VJBA 1UXJA 1Z13A 2MMGA 4UBOA 2Q6VA 5HKAA 4F8JA 3LRXA 1O57A 1WO8A 1EESA 4XYBA 4F8YA 4MSQB 3U44B 4KHPB 5A1TA 3GUHA 1RRBA 2EKEC 3HUEA 4KUHA 4DMHA 2VP2A 2KW5A 1IQUA 1Y1TA 5D01A 2TMDA 4EG8A 2YW9A 1UPCA 4YP7A 4BIIA 3KSDO 1A8QA 2O8BA 1DG3A 2HA6A 3V1UA 2JAXA 4CNBA 3A06A 2K25A 3FPGA 2W9NA 3EXFB 2BMAA 3U0BA 2QN2A 1DGQA 4FT4A 2IY7A 1YJQA 4HCJA 2KQ4X 4AURA 1KXZA 3PKIA 4I50B 1S6YA 5I5GA 4TZTA 2Z6UA 1T2NA 4KFRA 1PUIA 2J3LA 4ML3A 2N9LA 3FTPA 4H59A 5DX8A 3OKAA 3TNFA 3UJ3X 2H5LA 4FMCF 4QBIA 4ENQA 2C07A 4BJ1A 1IIRA 5B7PA 2XWJI 2BC2A 3N53A 4DRXA 1Z75A 2ZRCA 5KKCA 1UOEA 3IAXA 1Y1RA 2GAFA 2RR9A 1ZHHA 1A7KA 1QFZA 4HB2A 3H1UA 4GMVA 1I6LA 1G20E 1K4YA 1OQAA 3ZCRA 1G8GA 4QDKA 2PL3A 4CM6A 1ZNQO 3VKVA 4J90A 1U7XA 4EAQA 3EIOA 5KQRA 2KQSA 4BXOB 4RXMA 1A27A 2IYWA 1B14A 4DBZA 2IPAB 2DZIA 1QNFA 5E1BA 1J8DA 3PQ7A 2FSFA 3L77A 2HBRA 4QRIA 2EKZA 3FPLA 3EFOB 1R4NA 3HV2A 4I55F 4KQKA 3P9QA 1W1UA 1YIAA 3M1AA 4FBLA 4AKTA 4DCJA 5FTWA 4FYKA 2WLSA 4YRCA 4PS7A 2XUIA 4IF6A 2I9PA 2HQOA 1VJ5A 4D9JA 1DRVA 3OQNA 1JQBA 2K6QA 3CGGA 3TWOA 3F4BA 5C7OO 1SC4A 4UAUA 3I6MA 2ZW9A 4DAEA 1RRPA 4PYLA 4JC4A 5DBFA 4DV5B 1GPJA 2P6NA 2DPGA 3U2SC 1XD2B 4F12A 3JQAA 4RYLA 3TB6A 5T4FA 2GK7A 1TL7C 1E3DA 3FOWA 2ZUSA 2BYVE 3CONA 4JFRA 4G0QA 2YHAA 4FR2A 4BNTA 2X6QA 4I3FA 1YCFA 4ACAA 1PSDA 3FUCA 1HDXA 4YJHA 1ZBQA 3RZFA 3GA5A 3ESCA 1QZXA 4OOEA 3QEMA 2PUAA 4DQOC 4I46A 4KN6A 2Z8XA 2F1OA 2R47A 5GVRA 3E9CA 4PXYA 4HDOB 3KYDD 4IHKA 5LCFA 4I5EA 3BX1A 3L8FA 4ER3A 2Y1OA 1JSRA 1JJVA 3VHRA 1M6HA 4EYQA 5FTKA 2W2NA 2ZSBA 1SCBA 1AKWA 3PJRA 3T3MB 1E8DA 2FPGB 3C0RB 4Y6RA 3TZCA 1SIBE 3EZ6A 2GBIA 1CY7A 3PA8A 3REFA 4COKA 1F5SA 2ROQA 4MWDA 2EMTA 1AK1A 2IYLD 3CUWA 1YFJA 4ARUA 1SD5A 2KJRA 1YRLA 3QEBZ 5KTNA 1KDVA 4LOAA 3RJZA 2R2AA 3M4ZA 4FTWA 4O4IA 2C1ZA 5JXVA 2CNWD 2XEWA 5I7HA 2H92A 1VCOA 1YL5A 2ZNVC 2C31A 3AQ4A 3CF2A 3AP2A 3VH3B 2J41A 1I1QB 4FSBA 5E1MA 2I1VB 1AN0A 3AUFA 2NQ2C 5CJJA 1A9ZA 2IELA 3WAMA 3OZBA 1XKLA 5F1YA 1PU2A 3HUUA 4MRRA 3QV1A 3PY6A 3UGJA 1IUPA 4CKWB 3QU5A 3GHHA 4U2KA 4LXUA 3WHIA 2PRYA 1YH3A 2E55A 4UBMA 2XN9C 3PZBA 1TXGA 1VCMA 1WJ4A 2L7RA 1AMNA 3ZKJC 1F17A 3ROMA 5F1KA 1U8FO 2ZVOA 3L10B 2C3OA 4MUMA 3IC5A 1ZTCA 4YSYB 1EGAA 3C87A 5FTNA 1ISMA 2RHCA 2IJ0A 2J0VA 4HF7A 4G81A 1LV7A 1VHDA 4UEKA 4IIGA 1RKQA 4KIUA 2DYBA 1E58A 1CS4C 1RZRD 4HNGA 4P93A 3FDFA 2C9DA 2GCUA 3DCYA 4ZDKA 1S8FA 4L0QA 3BL5A 3ZQKA 5JASA 3B9PA 1FIUA 3NWOA 1HLGA 3MF4A 4YRMA 1FMLA 2P0EA 1GG5A 4HNTA 3MT8A 3W5VA 3L0BA 3I13A 5FQNA 1XK7A 5CDFA 2JJ2A 3T5MA 4C9BA 1GL7A 3HVJA 3DVNU 4XDCA 2CJOA 1FNDA 2B9VA 4YQEA 3OZEA 1F8GA 3ZXYA 4HRAA 4BNGA 4BFZA 3OQIB 2PE9A 4R1QA 4FBMA 1UGMA 4FSXA 1V2GA 1M4VA 2P2LA 1ZY2A 4ZI7F 5TQ0A 3U3MA 4P58A 3E1KA 2RHLA 2WD8A 3HO6A 2IYAA 3RTCA 4NCJA 3NDRA 4KQEA 1RC1A 3ZY2A 3RFUA 4BVEA 3W2TA 1T5LA 4XX1A 3BOSA 5K9ZA 1JDZA 5I7RA 3RIXA 2H65A 4EUKA 4JAVC 2B35A 4TTJA 4UNRA 3BSWA 3M1LA 2LGSA 5AIJA 3ZI0A 2B98A 4EPYA 5DZSA 3KL7A 5HJ7A 4ME6A 1NPYA 2AYOB 2PRIA 3OJLA 1C9EA 5JS8A 4TN1A 2ADOA 5AW3A 1VLVA 3ZW3A 3DLBA 2IIQA 3OCVA 4LNKA 3H2ZA 1PUJA 1NUPA 2PZ8A 1J1ZA 3GJ4A 3IHTA 3BTSA 3J81k 3RNAC 3GLKA 2JBWA 4UU1A 3I8XA 1IVYA 4UU8A 3GI1A 4AD9A 2VUHB 1U1FA 2CBGA 5TEVA 4RW0A 4HQ0A 4XI9A 3KG2A 2F9LA 4B5LA 2J8ZA 4Q1CA 1ZL2A 4R1MA 1KSGA 3E8MA 4E2FA 3TIIA 4J6EA 5EIHA 5A06A 1ZJWA 3PHJA 1DC6A 3H5WA 1ENPA 2WJYA 4WFIA 3CRVA 3X2ZA 2XIJA 3IHPC 4G86A 3CLUD 3NYWA 5AW4A 3G0IA 1XCBA 5BVHB 4G8BA 1ZOOA 1SXJB 5I4DA 4RBNA 3DH0A 4I14A 2HSGA 2ZLBA 4MI1A 1OJLA 1XEEA 4P16A 1RJGA 2O2HA 4MH0E 3DOOA 1AZWA 4RPGA 4RJTA 2Q6OA 1K8RB 3NWBA 4HX2A 3CISA 3PXBA 4L4RA 5EVCA 1FLAA 3PTFC 4X1OA 3TMAA 4O4LA 1YFZA 1U3TA 1UBUS 3OTQA 4XWTA 2D8MA 3MVEA 2IP4A 3CB2A 1L6RA 2R87A 4K26A 4B85A 1D2AA 3IP6A 4RSMA 4II3B 5EJEA 1RAHA 3QTTA 1W88B 2P2SA 3SF8B 1E1MA 3ZHSA 2GJKA 4O33A 2FB9A 2ZU6A 1J9GA 3TK1A 5C32A 3ENEA 3UY4A 1MABB 1KOJA 2ZG6A 1RKXA 1CSEE 3WOVA 2XMQA 3GU3A 1OPRA 3IOCA 2F4VB 2XD9A 3QQ5A 4GP9A 1L8XA 2R3SA 4HJKA 1IJFA 4ER5A 1S3SG 5AKZA 4DXHA 1NURA 2QVLA 2GBKA 3M6FA 2VKQA 3F9CA 3H1PA 2R2GA 3F9OA 4C3ZA 1QFSA 3TRKA 3LCVB 2IX9A 4YAKA 1NPDA 2FWPA 4MQUA 4MJXA 5DMHA 3TBFA 5DU2A 3N1YC 3A4YA 1PYOA 3AV8A 1BHJA 3V8VA 4ARBA 1EVZA 4II7A 1Q57A 3SMQA 4QQRA 2JCGA 3QBEA 4MUYA 1C3TA 4ZCPA 5IDWA 4ZT6A 1E9RA 1BGWA 2YHEA 1S2MA 4GAEA 3WJ1A 1Y3CE 4IIEA 2I4OA 4ZKEA 2RGNC 4LSWA 5LYYA 3G59A 5DPRA 1WPRA 2KWUB 3MC8A 3OETA 5C8YF 3KUZA 4AD8A 5DI9A 1CRWG 3AULA 3FPHA 3H1FA 1ELOA 2AYZA 2H3EA 4IJ5A 5B6PA 4KAJA 1AKYA 3QXSA 3RDPA 1M6NA 2FDCA 4ZOCA 1AM4D 1S2OA 4LMPA 1F0ZA 4CM8A 2PFSA 3VSDA 4NENA 3BCRA 4XVHA 4X1YB 4BX9A 4OGGA 3G8CA 2J9GA 2YYAA 3C6YA 4RKQA 3EQ9A 3VVBA 4C1EA 1FQJA 4E13A 1H22A 3MMSA 2RK3A 4AYWA 3RC8A 4LFBB 3RAFC 4NARA 2QN8A 5LXTA 4XPIB 4CKXA 2RAPA 3N30A 1TK9A 1QU3A 1WM1A 5MPOA 5AVZA 5FBQB 1YXMA 4KDIC 1F77A 1T3HA 4CQMD 3FD8A 1U28C 4C6TA 4N82A 2M0XA 3GWGA 3OX1A 4ZC8A 1C2TA 4LYFA 4R7TA 3NVZA 1XSEA 1D3AA 3EISA 3LP8A 4MIYA 4N18A 4PFKA 1HE4A 1OTYA 5T3UA 3PPWA 1XTRA 3GJTA 1SU6A 1U1DA 1KZ7B 3W9SA 4EMSA 5A9TA 1XX6A 1E3JA 3EMDA 3GP7A 3L7IA 5JWHA 4UTPA 3GUUA 1KVUA 1VLHA 1Z36A 1P81A 3TF5A 1XF9A 2ZQYA 3Q8AA 4L8LA 2Y71A 4X00A 3G1TA 5AK0A 1O95C 1KJ9A 3GRVA 3PUVA 3TPFA 4P33A 1UINA 5CXQA 1YJIA 4MGIR 4NE7A 1PWEA 1FVOA 3B6IA 1L7OA 2GTPA 4EHNA 4I3HA 1WXXA 5F7XA 1BMFA 1FZTA 4LI0A 5JZVA 4KSKC 3HB1A 3IOYA 4URYR 2WWTA 3NGXA 2JZPA 1BH2A 3KAJA 1ULAA 1E6WA 3AEXA 4D0NA 1NYQA 4E94A 4HTFA 1WDMA 4W6QA 3IULA 2BH2A 1JKXA 2GN2A 3GDFA 3W06A 3JATA 2Q1YA 4DOMA 4MS1A 3LXXA 5BR4A 1NLYA 4FHZA 5L4LA 3D2BA 5DN6D 3B3AA 3ZEAA 1TYAE 4DN6A 3TZ6A 3WK7A 2XD4A 3MTDA 4DYDA 4YDSA 1I14A 1XRLA 2JB9A 1JZSA 2ZIVB 4ICUA 4P35A 3TJZA 3I1FA 5KJFA 1WSPA 1C4OA 4JASB 4XUKA 4EATA 3DLHA 2CU3A 4MUAA 3ZOZA 1SGWA 3I3TB 1CJKC 2RAVA 2MCFA 5JSZB 5K3FB 3WXMA 1O97D 2QPTA 1X9IA 3FNIA 5JZOA 1MAVA 3PA6A 2CJWA 3MAJA 4CGZA 3E2MA 3I5MA 1IBRA 4C78A 3WGUA 5D84A 1DJLA 4R3DA 3TRJA 5DSTA 4TLDA 3M5WA 1SEPA 1FFCA 3UT6A 2HMTA 4BVAA 2XMSA 4QQ8A 4IFBA 4C6SA 2HLNA 4IH9A 3MLBA 2M4NA 1RD4A 3U17A 1R6UA 1VXOA 5KNBD 5BV0A 1KBQA 4NBSA 5HHDG 3I05A 1E3LA 1I6MA 1UDXA 4YX9A 2PT6A 4Y6LA 2LGXA 4OGKA 1YSCA 3KKZA 5ERXA 5LCAA 2K6DB 1SD1A 3EMKA 4ZCTA 3OF2A 3MINB 4JSYA 4CO7A 2ZBFA 3FZQA 4DHEA 5HEKA 1KPGA 4Q3DA 2AD5A 1WV0A 3A10A 3WL7A 1EO6A 4FHJA 1XO1A 1BDJA 1PT6A 1I9GA 3CA8A 5K0SA 2DR3A 4D4JA 5DCUA 2JW5A 4JY7A 2SHKA 2V5VA 1EG2A 1G59A 4HRSA 1EDBA 4UASA 1K51A 2CBXA 1JDBB 2JBAA 5BSTA 3DS8A 4BNUA 4BV9A 1MHXA 2OYCA 5GOTA 4QVGA 3A2MA 1Y33E 3L6RA 1AQUA 1CUJA 1EZ4A 1M2JA 4XXHA 4TWRA 3HNOA 2H1CA 1YL6A 1HT2E 5ALTA 3DHWC 4HB0A 4GN1A 2XNHA 3LQRA 3HUTA 2A78A 2YNTA 1CFZA 1G21B 3RYFA 1AS0A 4AN1A 4ZVVA 2QMZA 1TOAA 3WY9A 2PPLA 4YRZA 1YJXA 1Z6XA 4Z7OB 4R68A 4JZYA 2K9XA 3AUTA 3NAMA 2WM9B 1U5CA 1PYWD 4DLZA 1KYWA 3QOXA 2J1LA 5JD6A 4W1PA 4DC1A 1JWBB 1GILA 4PVOA 2Y87A 1QSGA 4NS1A 3OPQA 4EA8A 2VH5R 4UCFA 1KJZA 2ZBVA 3BT7A 4WWMA 5HMLA 2AFIE 4ZA2A 4U4LA 2GMNA 1S4QA 4B82A 2ETVA 2YEPF 3G68A 1PNRA 1FYDA 5E3IA 3AUAA 2VHJA 3JWIA 3FR8A 2I9KA 3K0HA 1XMQB 3DO6A 1T6XA 1P9DU 4YRNA 3DHCA 2IGTA 3CLVA 1GKKA 3LK6A 1C3EA 3O2NA 2IX3A 2IK8A 1ZKDA 1Z3IX 1LD3A 2YL2A 1XTTA 3IB6A 1H9CA 5HCIA 3ZNOA 4OP2A 3L8EA 1ONOA 2LGYA 2AMYA 3TBLD 5IAJA 2D5GA 3IVAA 4D25A 1ULHA 1GCAA 1EU3A 1PCXA 5CM2Z 5KOHA 5EPUA 1XXLA 3W78A 1HK7A 2QT0A 1XNRB 1G1MA 3A1UA 2QG6A 5AK6A 5MN5A 5FTJA 1OLOA 3H1EA 2OZPA 3EZ9A 1KMCA 4MEJA 3G5LA 2XDQA 4GMKA 3GX1A 3G9ZA 4ZEJA 3B6MA 5LP6F 2G9QA 1U0GA 4A20A 4KSLC 3K8OE 5DLQC 4NQKE 3AHDA 1F4LA 4YV2A 3G2IA 1WE2A 1AW7A 1WH3A 3D8BA 1A1VA 3ZI4A 4JP2A 1L8QA 4MEAA 4DXGA 1P1KA 3FHJA 2MW5A 3WGZA 1ZL0A 1NJSA 2YVQA 3VPGA 1A50B 4ROTA 1N2ZA 5KYUB 2WP8J 1FYEA 3V8BA 1R10A 2LUEA 2PTHA 1RE1A 1NLMA 2IEIA 4XEHA 1JLLB 3ZIDA 5EZ6B 4D92A 1P0CA 3FIJA 1EFRD 4NWIA 3AETB 4WZ6A 3WWPA 1A9XA 2BFWA 4LCBA 4XX0B 5AHRA 2KX3A 5CYPA 1MJ5A 1EK6A 2BEVA 3HVHA 2DF8A 2EOAA 2IC5A 4MJ7A 3L7OA 3P9KA 3AY6A 2JFYA 3RD2A 1Q1ZA 3QA8A 1AGYA 3H2GA 5IM5A 4I6JA 3PF9A 3FGZA 1PFVA 3LPNA 3NORA 1WSAA 3V4SA 1GAQA 2RPVA 3SYMA 1YZKA 2BW2A 2Q1SA 3LDZE 4FOTA 1W4BA 1I4XA 1NF2A 2R6JA 3ECAA 2D6FA 2WE8A 3OJXA 1EWYC 5GTDA 1MXFA 2VCYA 1A8IA 4BYMA 4D3ZA 1U4NA 4BTVA 3RHSA 3UMYA 1NBEA 4YO8A 2VUIB 4L3VA 5CCEA 4M49A 4W8OA 3EF0A 1YQ4B 2PUDA 3TVYA 2XUPA 5LCHA 3SS8A 2MDTA 4BFYA 1WP4A 1N7IA 4IDDA 2ZCUA 4RF2A 3LMKA 4NNJA 1T4CB 1UKZA 1EHCA 2A0YA 2XE7A 3ETHA 4AUQC 2C60A 4GXRA 3MGGA 4UWOB 1RI3A 3AJRA 1IRIA 3PUXA 4XRRA 3QVGA 4NBTA 5IJWA 2Y8BA 4J76A 4J4TA 4DTCA 1EA5A 1NBAA 4Z54A 4BKPA 2Z95A 4KYUA 3Q7TA 1US8A 4B6RA 1TM4E 3X2FA 4OKSA 2IIVA 1F2RI 3A31A 3DC7A 3DZKA 5EFZA 2C2YA 2Y8EA 2M8SA 4YI5A 3W5IA 3AKYA 1ATZA 4JEHA 2O8NA 1LNSA 2OV3A 1WV1A 4FKMA 1YQ9A 2QT1A 3OEHD 1BRTA 1KJIA 4YJ2A 5BWBA 1JG3A 5BYRA 1MTOA 4Y30A 1EUYA 1AN9A 2P9ZA 5E6UB 4IMJB 1WNTA 4PTLA 1KFJB 4OMCA 3GHYA 5EWLB 4LRYA 1GL3A 3LH5A 1CZLA 1Y4UA 2HAEA 3OQVA 3T3GA 3LDGA 1J49A 1UBQA 2FJ0A 3SZOA 1E5TA 3FMPB 3GH3A 4PGAA 4U8HA 4ZVMA 1JHRA 3ZWMA 3L02A 4J3FA 2H2DA 3HGQA 1JEYB 1BGVA 3ZHRA 3HEAA 1IOLA 1G42A 1V3TA 3V5NA 1RXWA 2VPWA 3WMFA 3H2BA 4B46A 2G45B 4V2UA 3RHZA 1YI0A 1MGOA 1O94C 1ML4A 1NI4A 2AOTB 4ALKA 3T4UA 2P1EA 1AUVA 2OXEA 1CBUA 4RKYA 4V24A 1POXA 4HRYA 4EYEA 1XTIA 3PXUA 1R8YA 4TLAA 5TJHA 2IGHA 2KWIA 3GFBA 4RANA 2QQ5A 4MMYB 5EMNA 4CZ2A 5H16A 3MCZA 3CZRA 3WIEA 3SZGA 5FUVA 1DWQA 3UBTA 2V3SA 1GZDA 1CE8A 1VMIA 2FNJB 5JRJA 4Z4HA 4RD1A 4EY8A 4QT0A 2PMBA 2JC3A 4E1VA 4PO9A 5TT1A 3KHSA 4PN3A 1AURA 3EWAA 2FGKA 1ZEJA 4KE6A 3NETA 1J7KA 3A4LA 1QYWA 1OJ7A 2WQYB 2OZEA 3IBCA 4OH1A 4EY5A 2C5LA 3JYNA 4UPDA 2XMCA 3UVEA 2DBQA 3IAM1 1J33A 3JD1A 3LX5A 2W8BA 2VJKA 4TTIA 3LHSA 4HDQA 2NPTA 2J4FA 5HTOA 3WOHA 1NJGA 1KFBB 2QM3A 5JWRA 2H4WA 3D0RA 1JXQA 3KQHA 4PO3X 4CM1A 2ORYA 2LDBA 3KJFA 5JCOC 4Q18A 1QH1A 2DFLA 1GYQA 1Z38A 1VG9B 1YQEA 2JAOA 1MAWA 1GAXA 4Y9SA 4ECEA 4FX5A 3K4QA 1XEAA 2UXBB 1U1GA 4RKWA 1WTAA 4H31A 1B00A 4XQ9A 1QRAA 4C7XA 4XWOA 1DUSA 4RLFA 3F98A 5KIAA 3B7WA 4NFSA 5FOTA 2EJVA 3OFJA 2GZAA 1OZHA 3D5QA 2JGMA 3ZDQA 4ZAVA 1R6AA 3RVLA 3IEVA 4K3UA 4JJ4A 1CZUA 3A9CA 1YVEI 5FNZA 721PA 4RGNA 3ZVRA 1SQSA 4OHMA 3HY4A 1XF1A 1NBWB 3GPCA 4BDSA 2G3YA 1HQRD 5LB4A 1FD6A 1JQEA 1BO6A 3CMCO 1Z17A 4IL5A 2R8ZA 3NXSA 3UOGA 4YUWA 2HWYA 3L3BA 3BMNB 1DC5A 4JB8A 2R9VA 1Q2XA 3CO0S 2ZUUA 1O6FA 2EBUA 4J3NA 5JFTA 4I19A 3FFWA 4RZSA 4AZ0B 2O5EA 3TYXA 1WDTA 2WJGA 1NQXA 5CH5A 3PWSA 1HLDA 3SYKA 3DAOA 1DLJA 3M5CA 2G88A 3NOXA 4TV3A 3IHWA 1KEWA 4GVLA 5AKKA 1A9SA 1NXXA 3HCNA 1QP0A 3QA3E 4C2AA 2YNMD 3A7DA 5DASA 1NVVR 4EK9A 3E22A 2AZXA 5JI2E 1QKJA 3L1IA 3L0WB 2FY8A 2AZDA 3KD2A 5LQCA 4NYIQ 3RRNA 2HUNA 1N8NA 2OCDA 5GP1A 4MT5A 3DVGY 4B4UA 4B3IA 2W2LD 4G9GA 1KP2A 2DULA 4ZU1X 2AEHA 3U3RA 4U7JA 3IVFA 4TSFD 4MP3A 3PXGA 1G8KA 3O91A 1C1XA 2FAXA 2J85A 3V05A 3PRMB 2VHUA 2XMBA 3AZOA 3L1UA 3H5OA 3IOBA 3E84A 4TTVA 2O2SA 4CR6A 5U9CA 3HWX1 1ZK2A 5L3QB 2QTFA 3KEMA 2O2YA 2OBLA 2ZRLA 2ZYGA 3MMNA 4LNUB 3PGEA 1RPNA 1NVWQ 4L7VA 5EVJA 5EZYB 3TEYA 4IJ6A 2BG6A 4EY2A 3FJYA 2AXEA 1B43A 4JBGA 1W35A 5A0TA 4UREA 2UYXA 4LJAA 2A9QA 5EIFA 2Z04A 1TYBE 1YVDA 3IAAA 1CUUA 5K0TA 4WESA 4QLAA 5E6JA 3O92A 1OAOA 4PF1A 1RT9A 1IM5A 1DG9A 1B2LA 1KFCB 1CS0B 1EGMB 1JZTA 4DWWA 2YV1A 1QAOA 1OI4A 3AB8A 1C1YA 3LC0A 5COAA 4BAUA 4RCVA 3GGSA 4R2JA 4NV0A 4CL0A 3BGIA 4X7BA 4CUJA 3PUYA 4NULA 4ZCSA 3AFOA 3BYZA 4OQMA 2OXFA 2TMKA 1KU6A 4G09A 3EGEA 1EJ0A 3C3BA 1FS5A 7ADHA 2XUOA 1KE2A 1Q3TA 4DCNA 3RJ9A 5AUQA 3RIYA 1LDMA 2BFEA 5CNJA 5HKBA 1JG1A 4Q48A 1NUAA 3SICE 4WCFB 3W8EA 3TSOA 2D06A 4YDHB 3OWEB 4C03A 2XCRB 1PZMA 2D0PB 1F48A 1SC9A 3MEQA 3BINA 5ACTA 3OJ3A 1A4RA 1CUXA 3SBXA 3HZRA 5KTMA 2AX3A 2UYYA 2QD3A 1Y1SA 1MDFA 4PG7A 3ZD7A 2WT9A 2J0SA 2M98A 4IV0A 3N74A 2A35A 5ADWA 2ZW0A 3I4CA 3QSYA 1DOAA 2AA3A 4BNXA 5A4IS 2OBMA 4KVGB 4OHYA 3GMDA 1VCHA 1AN8A 3PXAA 4MV9A 5AJWA 4CQJA 4MPTA 3HBMA 3JQFC 2JHCA 1NM5C 1M1XB 2JIZA 3UWPA 2V55B 4V0LA 1SCIA 3WLIA 1JIKA 5FEMA 1M2KA 1OEYJ 3FDZA 2BGUA 2IZ5A 4RHEA 1T9AA 3Q8FA 3OO1A 3NO4A 1YRAA 2IEGA 2I0FA 4X92A 4JJ8A 4MQBA 4KQWA 2IDZA 2ACWA 3D5TA 3FKSD 5FD8A 4IOLA 2JLYA 3W6OA 4DWFA 3OH8A 1NDDA 4AP6A 3P4XA 2WIKA 2WHEA 3VO8A 3AEQA 5I9NA 4TTRA 2WB2A 5DX1A 2YDYA 3ZE0B 1ECJA 2IXEA 5BSUA 2ZYSA 3OLCX 3ZR9A 4WN3A 4LJ5A 1EIZA 4JSRA 1WF9A 2GO1A 1TMOA 3CH5A 2BGTA 2WXGA 3H97A 1Y7PA 4D7AA 1ACCA 4HKQA 4ZREA 3IPAA 2Z57A 2AJTA 1D07A 1EF1A 2IZ7A 4HZUA 2ZEQA 4MRMA 5F76A 4LE0A 1NSTA 1VE7A 5E3HA 2YIMA 5IDYA 1FSPA 4M8NE 4XB2A 2XUQA 4E2YA 1A2BA 4A5SA 1PV2A 4EO7A 2O48X 4XUEA 3PR2B 2RGAA 3CVVA 4MV6A 3ZIAD 5B37A 3K9OB 2WF6A 3FHLA 1DL5A 2BMVA 2QLFA 4RM2A 2UXCB 3E0XA 5B1YA 1VR9A 2X19A 1VIDA 5LXHA 2HIGA 1EBBA 2OWDA 2BFZA 2BKVA 2FLVA 1L7XA 3RK0A 5CD1A 2I65A 2CFIA 1R3DA 3OKCA 2G3QB 1QS0B 5F9HA 5M29A 3HDHA 4FONA 1UD7A 2E85A 4I1VA 1T9HA 1J0DA 4LE6A 4G1CA 1UZNA 2JXXA 1YU6A 5H3HA 3WNZA 3D4PA 3H99A 2C00A 3ESQA 1USIA 5IO9A 1Z8NA 2DPHA 1L6VA 4HWGA 1E2FA 4M9RA 3AEFB 3NBXX 3ZCTA 2CZGA 2UYQA 1ENZA 1I3OA 2YHBA 3HYLA 4IZ6A 4EJSC 3BMCA 1Q17A 2WOOA 4Q34A 4D4MA 3E56A 1T8PA 1KZ9A 4P3NA 1U0LA 2O7RA 4AUNA 1G7TA 1WW2A 1XDBA 2TSYB 4IDNA 1X1TA 2ODBA 3TMKA 4KYVA 2ZREA 1RCFA 2Y6VA 3NG0A 4P3KA 5AVXA 2FPSA 5G0SA 3M2TA 2I7TA 4CLRB 3ZWDA 4M7WA 3TQTA 5CA0A 1PEAA 3T1YB 3QQ8B 1F2VA 4XM0A 2HPHA 3HG7A 1W36D 2XZLA 5FPYA 3WO1A 2OHXA 4KX5A 1A3CA 4M9XA 3EXHA 5FOUA 5GY7A 3C41J 3UJ9A 5GONA 2WXQA 4ITVA 5BQ3A 1X2BA 4NU5A 3H5NA 1G20A 1RE0A 3EWSA 3OZXA 3EFBA 5HQ3A 4I6PA 5K4KA 3UF8A 4FMPA 3VVMA 4C4ZA 4HUJA 4C4SA 2FP4A 1OXSC 3BE6A 5CUQA 2ZT6A 4REOA 3BK7A 5JQGF 2AT1A 1N5JA 4Y2PA 1EKXA 4LZAA 3LBFA 3L9WA 1NXQA 3VM6A 5F35A 1WXDA 4OQQA 1BQ4A 4ABTA 4FYVA 2J59A 1BTOA 1YI8A 3T3OA 1IU9A 4EGAA 4BOZB 1F8YA 4I4CA 1OX6A 4XE0A 5ALFA 1BU8A 3H11A 3IQFA 2L69A 4OIMA 3CTMA 2KFJA 3R3VA 4JL5A 3WTBA 3RPCA 2JJ1D 2LGIA 4MH8A 3JD4A 4GM0A 3I42A 1ZH6A 1KI6A 4IJKA 1ZITA 1E98A 2NZXA 3S6JA 3BILA 3ZR4B 3ZWCA 4CL8A 1RHMA 1Z6YA 1WXIA 4H18A 5E7QA 2MLBA 3C7DB 2HLHA 2FIDA 3UA4A 3DWGC 1HUQA 2WKPA 3W05A 3DMNA 4V0KA 1FTNA 2ZROA 3ZWVA 3GOQA 1OQYA 5KYKA 4KIWA 1M67A 1JKIA 1ZKMA 4PHFA 3QLUA 5TQ2B 4N58A 1P4HA 9MHTA 2FFQA 4GKKB 1AUXA 4GX5A 3M6UA 3FROA 1XYYA 4PZYA 2A7QA 3BIJA 3NOVA 4AMVA 1XG5A 3PGJA 2OXCA 5K0JA 2Q0JA 3N9IA 1KK2A 4B0MA 1WJGA 4ENPA 3FZEA 2OV1A 3VSEA 3KUCA 2DFDA 1WXAA 2PMWB 4IHAA 3K3PA 3A8TA 2E9SA 2MJDA 4L78A 1FFGA 1QNLA 4D5GA 1XLTC 2FIFA 4HPMB 1TUEA 1JKJA 1XTBA 2DLNA 3GJYA 3SVTA 5J18A 5A05A 4JOSA 3GD7A 1GPKA 4KKXB 2QG4A 1CIPA 5EVKA 4FYHA 3K73O 2XUZA 4GNKA 2RPQA 5PNTA 4LXGA 1R4MB 3TQIA 1TB4A 4KZKA 2GT1A 1RSZA 1S9DA 2F67A 4R16A 4NX2A 3ENZA 3WIOA 3BGWA 3T4EA 2V1UA 3Q0IA 4IVQA 3ABSB 2ZUCA 4EVRA 4L4UA 5IH7A 1UIRA 2GKSA 3TD2A 2XB6A 1A4UA 4KFSA 4KDEA 3PXEA 4P7FA 3IL2A 4H6WA 4BAZA 3R5FA 1L6IA 2C99A 3D7KA 3MLEA 3ZE2B 4YACA 2AHOA 2SNIE 4LRTB 4FZRA 3AU5A 2C03A 1E1CB 2E6UX 2P91A 1PLKA 4KXNA 2K0PA 4LAFA 4D1VA 5GJVC 4QECA 3TQOA 3ZQUA 3L1HA 3EXEA 4F85A 5E1OA 3BA1A 3H9BA 1KJJA 4D81A 4N0DA 2PIDA 2WJZB 2WHXA 4N4AA 3RG2A 3ACCA 2VNJA 1A5BB 1U0SY 3WGOA 3AUXA 2FW1A 1A97A 1GZVA 1SQFA 2NG1A 4LRWA 3UG7A 4CMEA 2VO1A 3A37A 4DBLC 2V3CC 3R8BA 1E62A 3UMBA 1X38A 4B4OA 4ZHQA 5CB4B 2GHTA 4IEIA 4IMPA 1GPBA 2AQIA 2QP9X 5FV4A 1HE3A 2D3TA 1DKQA 5LNK1 4KPUA 1BROA 3MFGA 1DWPA 4CM3A 2EZ4A 4GKBA 1ZW7A 4MV5A 3TN7A 4LVOA 1YMHE 4B32A 1UQRA 1OKKA 3DT8A 3NI2A 3QX3A 1QOBA 5FXMA 2ZKIA 1PJ3A 2YJ3A 2DH5A 4IDQA 5K0BA 5PGMA 1NAIA 1JHAA 4DC9A 3K5IA 3VTFA 3MWLA 3E7WA 3K2IA 3LQKA 3ML8A 3UYLA 1NNLA 4S1NA 5GJCA 4UMFA 2XH8A 2JZ3B 4AF7A 1M1ZA 2FE8A 1EDOA 4FGLA 4Q12A 3PZ7A 4FOSA 3ZXRA 2G63A 1E10A 3ELUA 4ZYZA 5FFFA 3CURA 1AQLA 2N7DA 1OIVA 2G08A 1J70A 4PNHA 3A1EA 1WX9A 2E89A 2VRRB 2W71A 1LTKA 3MFQA 3FYDA 3M83A 1RJWA 3NNSA 3X3HA 4PXAA 3KZ1E 2WYMA 3RHFA 1FCJA 5KHLB 3FBGA 1NV9A 2CG2A 1V1OA 4JJIA 1KPHA 1RADA 4ZP1A 1YJ8A 4HLNA 5TV2A 2XUAA 3RCBA 1YE5A 3OICA 3OT5A 3RVDA 1AO0A 2KO3A 4JI5B 4N76A 2WMDA 4KYTA 3TSAA 1JU4A 4HUQA 1YS2X 4PC2A 2H2GA 2GN8A 3GEGA 2NYUA 4GE3A 121PA 3RAEC 2F8LA 4R1PA 3DTVD 1NX9A 3RWOA 2FLWA 5AYVA 2ZWVA 1T3GA 2KYRA 4QG7A 1ADBA 1L5LA 2QI9C 4CEIA 1GKLA 3G8BA 4PWZA 1AHHA 3AGPA 1QCZA 5E9QA 1MU0A 3G1PA 1CR1A 1AQIA 2AE1A 4PIMA 2Z09A 3S2SA 3KZOA 4RJIA 3WE7A 2ECPA 2O0JA 2ZS9A 1Q7GA 4WBSA 3VDQA 2AXPA 4AF8A 3W5AA 1EUCA 2GZHA 5EHXA 1W34A 1YAHA 2VK8A 1N2BA 1EDZA 3OKPA 3RMKC 3HSSA 1E9BA 1JG4A 1LWNA 3IXMA 3E9QA 3WA0A 4HYQA 2IUSA 4J7UA 1PNTA 2JGEA 2CB0A 2FMIA 3K16A 2C98A 1N61A 1RHQA 3ILHA 3F6EX 3PVCA 4YP5A 3K9NA 4HCNB 2C1EA 1XVIA 1CFJA 3Q6MA 3UATA 1GDDA 3HLYA 3NASA 3ZWNA 3MTNB 5EJFA 1KO7A 3I61A 3A9KA 3JVEA 2P2NA 1XRMA 5CVTA 4IWNA 1Z4QA 5A3QA 4J0HA 4X5OA 4C88A 2DT5A 4TWIA 1CUDA 1A76A 4HYEA 2DT8A 4KCGA 2FU8A 3UJ7A 1T9DA 3DDCB 3MJSA 1HDGO 2PGLA 3RKSA 2CKMA 2ZNBA 4JIOU 3J9CA 3W3AA 1HDEA 5A62A 3EG5A 2ZRJA 5FPQA 3KU4A 5CDSA 2MT9A 3W9UA 1ONPA 5A5DA 1Z63A 1S3IA 2AOWA 4RGBA 4AFNA 1OXUA 3TCAA 1YZGA 4DCCA 3T4XA 4WEQA 4TKUA 2D2VA 1EM8B 2R97A 5FUBA 4TMZA 2CK3D 3OQBA 1TIPA 2IFTA 4A9AA 4ZIRB 3WA7A 2PKCA 4FWBA 4CM9D 4OYRA 2QTLA 3IPYA 3M3HA 1J2JA 4IVRA 3FF4A 3FVTA 2ZSUA 4WAAA 1Q7TA 4RQAA 1IOVA 4MTLA 5IVDA 3RNLA 3DUWA 5B1EA 4KLRA 1ZJ5A 4PU0A 4NG5A 5JS6A 2FVYA 5JS2A 3B5EA 4BBNF 4WWHA 4X45A 2FZWA 1W48A 3IELA 2WJJA 3P32A 2Y2UA 2WWVD 2Q5LA 3WAOA 3V7FA 2J46A 4BP8A 3HEBA 5KJEA 2XGJA 1PAUA 4H7EA 1WSDA 1GDTA 1HTQA 1NXPA 2KDMA 1ZICA 5DHAA 2DOKA 4YP1A 1ZMRA 5JG7A 5FKJA 2FPIB 3EQ8A 1DX9A 1SEBD 3CTPA 4QOJA 3WP1B 2HBZA 3L01A 3AI1A 4O1MA 5MFPA 4BGDA 5D00A 3AMZA 1D2RA 2BUAA 5M5BA 3BQ9A 2B1IA 5REQB 3VHXB 2G09A 5KU7A 4JVLA 1D7AA 3WYBA 2P97A 7GPBA 4BO3A 2CLOB 4M88A 2P78A 2QQGA 4BQEA 3G85A 3KALA 1LW7A 5DCLA 1RM6C 4ND8A 3FAHA 5B7QA 2XNAC 4QWMA 1EUQA 3DAHA 4DR2B 3R0QA 4Z3DA 3QYPA 5L3ZA 1SSNA 3H8SA 1FDIA 2C7NB 1I42A 1IIBA 1VZ3A 1Q16A 4BLRA 2XYVA 1EFKA 1WM2A 2PWBA 3ORQA 4RK6A 4JLDA 2PD4A 1W87A 3TOVA 3GROA 1TD1A 3ECSA 2PNFA 3DPDA 5AOAA 2YFHA 4MI6A 2EKBA 3WJAA 3BB1A 1XOIA 1OVMA 5IFKA 3CG4A 1FF9A 1XA3A 2GTIA 3MCUA 5K3BA 1PFUA 4R2IA 1KMNA 4EJ2A 3A1SA 2B37A 3I6ZA 3Q3IA 2GEKA 5JRZA 3A6LA 3KR0A 2J5RA 1DTWA 3FC4A 3SQMA 1W5FA 2H31A 2AJBA 3HB9A 3ZNBA 1EZZA 1NW4A 2QX6A 2BCJQ 4E2XA 1LI7A 5JCJD 3TRHA 3L16A 2ZE7A 2BM1A 4GQIA 4I4TB 4UJ3A 4K1XA 5A87A 3WIUA 3K9PB 1V9JA 4F5EA 4FE7A 4XDZA 2J9XB 4ZRDA 3JWEA 4XARA 3M1YA 2AMJA 5IAEA 5IT0A 3ITEA 2RFLA 3MT0A 3DFUA 1ICEA 4U5QA 3G8AA 1ACLA 5MHTA 5DK4A 4DQXA 3QJYA 5KOJA 1JHUA 4JLUA 4PX3A 2OECA 4IDFA 4IZHA 1NVXQ 3BMXA 3DTYA 3LQ4A 4A23A 3GV0A 4IDAA 4C08A 3IUBA 5E0OA 1NW5A 4GKVA 4HMOA 2PANA 1N3LA 5DGXA 3IAFA 3PZDA 1P2UA 4GFDA 1JA9A 5SYAA 4JR2A 1DOZA 4ZALA 4COOA 1KI9A 2RGCA 1YDWA 1L9KA 1TIKA 3KDPA 1QV7A 2FPPB 4M0CA 3AE8B 1IN1A 4RIHA 5L3RA 4F6RB 1W4RA 3M9WA 1ZWLA 3DCNA 4MQMA 2VP6A 5K01A 4Q4HA 1Y3BE 4PZUA 1AF7A 2RK6A 3SD9A 3WLMA 3KKKA 3UAOA 2QILA 1MT0A 1OFIA 3UINB 1CG6A 4PO8A 3WIDA 1IBMB 3EFEA 3PNLA 4F96A 2WYIA 1J5PA 3T5CA 1P9NA 3VSCA 3KJXA 3OECA 3LV8A 1EI9A 4AN4A 3BSSA 3AVTA 5DKFA 4NXNB 2E48A 4OQNA 1DIBA 2PNJA 3L0DA 1K6MA 2HGSA 2G28A 4KK4A 1UXIA 4TKZA 5D5HA 3WLNA 5IJAA 1XZPA 1TRKA 3SR3A 3UKOA 2HHHB 4J0DA 4ZVSA 1XD3B 2H5IA 2VRCA 5DGDA 1D8TA 4JN6B 3FYUB 4QAJA 4CE6A 3D6FA 3BCUA 3PS9A 3KM0A 5CIYA 3MJHA 5BMVB 1GUAB 1A4XA 1FRQA 4DDMA 2M2IA 3RNGC 1SA0B 2ZPUA 4RD4A 2CLCX 2NIPA 4KSYA 3QKTA 4URKA 4WHMA 3ULKA 1MH9A 2QLBA 3HRKA 4F84A 3O84A 1XRSB 3T9LA 1D0SA 2GOYA 2AEFA 2HMUA 13PKA 1W5TA 1NYLA 3EY4A 4IIUA 1Q1AA 2GFKA 3IBTA 5DW0A 5K6AC 4ZYLA 3CX8A 2L0XA 3WNDA 1QK4A 3NS7A 2WV7A 2QNRA 1X39A 1WW1A 2O6LA 3BE5A 3T7AA 2M19A 2O2XA 4UBJA 3IT0A 3UGQA 2H7YA 3SIPA 1J56A 2DHRA 3WLJA 5K2OA 1U9YA 4W9CA 3VAAA 2GNOA 1P7FA 4DCGA 4IR7A 2WT8A 3PF8A 3PI6A 2CNLA 3B78A 3UXYA 3Q6NA 3LPLA 4IW0A 5CYFA 1PK8A 3ZN2A 4DJJA 2IXTA 4Y2GA 5CEEA 2AFIA 3U9LA 1QV9A 1WKCA 3IT4B 1KIMA 2QUZA 2Z9CA 1RWPA 2JG3A 1JX6A 1V86A 4CF3A 4B7ZA 4B75A 1GR1A 3K5WA 2F59A 3D6UA 1O6CA 4WZZA 2QT9A 1LQBA 5IDQA 4JELA 1SG9A 4JU9A 1QR6A 4YHHB 2PU7A 3D32A 1QC5B 4D3FA 1C0PA 1IAQA 2JKZA 4NMWA 1E4VA 4JE3B 4OSEA 1ZOPA 2R25B 2CL5A 5BSHA 5HIMA 5BYBA 3TEMA 2M0AA 5IYZA 5TPWA 1SKYB 5KWJA 3EGWA 4HWTA 5LL6P 3W1VA 4B80A 1RAFA 4KLCA 2L3ZA 2MSDB 4N0QA 3Q11A 2LCQA 4DMLA 4IDCA 3EB9A 1DRUA 2ONYA 2B6HA 4HRXA 4Z6KA 2FZ4A 1AXGA 4N8SA 4FFSA 2I6FA 4G5QA 4NDNE 3E05A 5JXJA 5G02A 4KLNA 1GLNA 2OA0A 2IT1A 2WNHA 4U7GA 1NFFA 1UM9B 1NATA 1II8A 1FXSA 3PNSA 3V48A 1KK0A 1Z2OX 4OPMA 4ZZ0A 1T6NA 3OC0A 1H2AS 3HJCA 3O8DA 5HPYB