4XWTA

Crystal structure of rnase j complexed with ump
Total Genus 180
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
180
sequence length
543
structure length
543
Chain Sequence
APTLEVIPLGGMGEIGKNITVFRYGDEIVVVDGGLAFPKAHQMGIDLIVPRIDYLLEHQDKIKGWILTHGHEDHIGGLPYIFARLPRVPVYGLPLTLALVREKLSEFGLQDVDLREVTYGDEVRFGQSFVAEFFCMTHSIPDNAGYILKTPVGDVLHTGDFKIDPDVGTGAGIVSDLERVEQAGKDGVLLLISDSTNAERPGHTPSEAEIARNLEEIIKGCRGRVFLTTFASQVYRIQNILDLAHRQGRRVVMEGRSMIKYAQAAQATGHMNPPEPFLTSEEVGELQDQQVLFVCTGSQGQPMAVLGRLAFGTHAKIALRRGDTVILSSNPIPGNEDAVNLIVNRLYEIGVDVVYPPTYRVHASGHASQEELATILNLTRPKFFLPWHGEPRHQINHAKLAQTLPRPPKRTLIAKNGDIVNLGPDEFRVSGTVAAGAVYVDGLGVGDVNDDVLLDRVNLSQEGLLILTAVLHPTPHVEVVARGFARPNRDLELQIRRVALEAVEQGLREKKRLEDVRDDMYGAVRRFTRKATGRNPVLIPMIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural insights into catalysis and dimerization enhanced exonuclease activity of RNase J
pubmed doi rcsb
source organism Deinococcus radiodurans
molecule tags Rna binding protein
molecule keywords DR2417
total genus 180
structure length 543
sequence length 543
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
A PF07521 RMMBL Zn-dependent metallo-hydrolase RNA specificity domain
A PF17770 RNase_J_C Ribonuclease J C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.580 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4xwtA03
3.40.50.10710 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Metallo-hydrolase/oxidoreductase 4xwtA02
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 4xwtA01
3IE0A 2I7TA 2QINA 4EYBA 2E7YA 3FAIA 4DILA 4UWOB 1WW1A 5AXOA 4ZO2A 2WYMC 3P2UA 1DD6A 4YSBA 1SMLA 4TYFA 4C1FA 2AZ4A 2Q0IA 4O98A 4D02A 5HIQA 2NXAA 4LE6A 2BIBA 3SBLA 3ZQ4A 4TZEA 5B3RA 4PVTA 2BG8B 1KR3A 1WUPA 2FU9A 1XM8A 4C09A 1BMCA 2A7MA 1JJTA 1E5DA 4GYQA 3T9MA 5K4NA 2DOOA 3ADRA 2NZEA 4RBSA 4AX1B 2QEDA 5LMCA 4HKYA 4Z5YA 5HH6A 2BFKA 4FSBA 5AHRA 4J5FA 4BZ3A 3PY5A 1KO2A 1X8GA 4ZNBA 5ACSA 1Y44A 1X8HA 4TZ9A 5LM6A 3SPUA 1QH5A 3KNRA 4DIKA 2BFZA 4FR7A 3AF5A 4Z60A 1DDKA 1P9EA 2FU6A 2WRSA 4XWWA 5LCAA 4ZO3A 3IELA 5KILA 2OHJA 2WYLA 3I14A 2GCUA 5EW0A 4UWPB 2P97A 4Z5ZA 2OHIA 1YCGA 5A0VA 5EV6A 2BFZB 5LCFA 4RM5A 5HH5A 2GFJA 3IE2A 5ACUA 5ACWA 2BG6A 4U4LA 2YCBA 4Z7RA 2Y8BA 4PVOA 1KO3A 5EVKA 1ZTCA 1WUOA 4FEKA 5LCHA 2I7VA 4RAMA 5AXRA 2WYMA 5ACRA 5EVBA 2Q9UA 2BTNA 4NQ5A 4RL0A 2ZWRA 2BG8A 4C1CA 2QDSA 2WHGA 3RKKA 4C1DA 3I0VA 3IEKA 3L6NA 4D1WA 2YNTB 2FU7A 4AWZA 2YNUA 3X2YA 3ZR9A 3RPCA 4HL2A 5K4KA 4AD9A 1M2XA 5EHTA 5HIOA 4J5HA 4B87A 3BC2A 4UAMA 3VPEA 2ZO4A 5LLDA 5K4MA 5FQCA 4RL2A 5FQBA 5ACXA 5ACTA 5ACQA 2P18A 3X2XA 2BG7A 1WRAA 3KL7A 2YNWA 5KIKA 2NZFA 2YNTA 2R2DA 3DH8A 4AWYB 2OHHA 1L9YA 2Q42A 4WD6A 5A5ZA 4EY2A 3VQZA 5AHOA 4HL1A 1ZNBA 3X30A 2BG2A 3SRXA 5LSCA 4F6HA 2ZNBA 5A87A 2QJSA 4D1VA 3WXCA 3IOFA 4TYTA 1HLKA 4V0HA 3T3OA 3Q6VA 4EXSA 2XR1A 5B15A 2Q0JA 1MQOA 3SFPA 2YZ3A 3PY6A 3I11A 2P4ZA 4RAWA 3IOGA 2BR6A 2CBNA 2M5CA 4XUKA 3ESHA 1DXKA 2ZZIA 2GKLA 3PG4A 3SD9A 2M5DA 4Z6XA 3F9OA 2AIOA 2XF4A 3BK1A 3SW3A 4P62A 5IQKA 4UWRB 4EYFA 4CHLA 5FQAA 5LE1A 4XWTA 1BVTA 4NQ4A 4ZEJA 2DKFA 1K07A 1ZKPA 5DPXA 2BMIA 4TZFA 4GCWA 3X2ZA 3IE1A 3DHCA 3S0ZA 2GMNA 5EWAA 2YNVB 5EV8A 2NYPA 4D1UA 5EVDA 3BV6A 3I15A 4C1HA 2FM6A 2FU8A 1VGNA 4F6ZA 1QH3A 3TP9A 1XTOA 3RKJA 4EYLA 3T3NA 3MD7A 2FHXA 3I13A 5ACPA 2HB9A 4TZBA 4YSKA 3R2UA 4UWSB 3IEMA 4NQ6A 4EFZA 5ACVA 4C1GA 2FK6A 2BC2A 3ZWFA 3DHAA 2FHXB 4EXYA 1JJEA 3FCZA 2BFLA 4UA4A 2YNVA 3DHBA 3IDZA 4JO0A 1A7TA 5EH9A 2H6AA 4GYUA 5B1UA 3G1PA 3AJ3A 3QH8A 2GFKA 1BC2A 4YSLA 2I7XA 2UYXA 4KEQA 3ZNBA 1YCHA 1YCFA 1A8TA 5K0WA 1VJNA 2QDTA 1VMEA 4H0DA 5HIPA 4BP0A 4C1EA 5HH4A 5HISA 4KEPA 5LS3A 1X8IA 3JXPA 2Y8AA 3AF6A 4AX0B 4NQ2A 4D1TA 3A4YA 4UBQA 3BK2A 2BGAA 1JT1A 5AEBA 5AYAA 3KNSA 2P1EA 3LVZA 2Y87A 3H3EA 4Z67A 5A0TA 2VW8A
chains in the Genus database with same CATH superfamily
3AFGA 3PK0A 4PBSA 4EKEA 2FFHA 1LJ8A 1BVRA 5BOSA 4E5SA 1JECA 1KHTA 2WJIA 4QDJA 4WN9A 1QOQB 4LQLA 4OUKX 2ODAA 3JQ8A 4YXWD 5HKOA 5LQMA 4DQLA 2AHRA 5LYJB 3HXQA 1CY7A 1QH1B 2UUBB 2I2WA 3RC1A 4X7PA 4XC2A 3F8WA 4I3HA 2YVQA 2JIZD 4O8CA 4QUHA 3B1LX 1F51E 3RTEA 2W48A 1PNOA 3SICE 2EQ5A 3NHEB 4ZJPA 4OQMA 2FFRA 1R4NA 3T9AA 3VU0A 1WRDB 5DJ5A 4JN6B 1DHTA 1MC4A 1YR2A 1M8JA 1SC1A 1VJ5A 1GPUA 2JIPA 2O2YA 3R0VA 4M83A 4O4LA 1XB2A 4NCHA 5JMWA 1YE8A 3QP9A 1XXGA 2D1QA 4A8XC 2BUCA 3HCRA 4QOJA 2RBKA 2NAPA 3Q3NC 2ZBUA 5DX0A 2O52A 3ND9A 4HB2A 4LBYA 4RPIA 3IUEA 2QM0A 4N1AA 3CKLA 1G4UR 5HMLA 5IEBA 3EGEA 3H2ZA 3KTAB 3I6QA 4FBGA 5FAXA 4ENSA 4DTIA 5K8TA 4LE6A 4G5RA 3R8FA 3OMLA 5TR9A 4GWKA 3VPSA 1IMJA 3QK7A 5EJFA 2ZBDA 2H7CA 2NZWA 5IUKC 2ZVDA 4G0UA 1P18A 1HZ6A 2YN0A 4TPKA 2HA2A 3D8NA 1Y5NA 2AFIA 2ZTHA 5L7TA 1KLUD 4PVTA 1V3VA 3AG6A 3DD1A 4RWZA 4N8DA 1KP9A 2GYVA 4CM1A 3I5MA 1SIFA 1G5TA 3C14C 2OWEA 3PFNA 3EJWA 3D3WB 1XLUA 5KQRA 4IIJF 1PZGA 9ABPA 2BG8B 3KEOA 1G7RA 4WVFA 5TQVA 4G9EA 4BO1A 4RH0A 2QRMA 3W8FA 4B6GA 1RWBA 1EK6A 1ORHA 5A5EA 3GY0A 1F0PA 2MIIA 1KY2A 1XTBA 1UXHA 4S0RA 2FWBA 3OLMD 3A9VA 2PH1A 4FKZA 4IVPA 3REQB 4XXHA 1FFHA 1BS2A 2VF8A 1BMFA 3TCKA 1CQVA 1KO7A 1YK0A 1JFTA 1N5LA 4PO9A 1NF8A 3GQVA 2GD2A 4KLZA 4P86A 3H4IA 4GOOD 1N9GA 3IR7A 4Z86A 4WRRA 1TY0A 1QYXA 3JASA 1EWRA 1Z16A 3OOSA 3U40A 4DRXA 3FPSA 4XZ4A 2ICAA 1T36A 3AE6B 2H08A 3E9DA 4OOFA 1GL9B 4QKQA 1O96B 2IKSA 3MGKA 4FHKA 3BTOA 4IIVA 2R00A 4RF4A 4G11A 3T8YA 4C3UA 3BMQB 4BRSA 4ENRA 4LPSA 4X6XA 4DXHA 5L4LA 4DV1B 5JS6A 5IAEA 3PY5A 3QBEA 1SKYB 3WL6A 1R0LA 4PR0A 3C5VA 2WIAA 4IWYA 5EINA 4NRDA 4X61A 2D3WA 4JCOA 1R9MA 1XZGA 1MQAA 3RC8A 1FSGA 3A04A 2V5UA 1C8BA 2PYDA 3M81A 5IKOA 4EVIA 1TOAA 4LZAA 5LM6A 4JI2B 4HGPA 2Y66A 1L7DA 2V1UA 2OK8A 3I0VA 4ALNA 2XB2A 3NEPX 4JQOA 3SFVA 3UGQA 4GHWA 1NQOA 2EKDA 4RLHA 1NOIA 2POCA 3FUWA 1LC0A 3PQ6A 2LEKA 4OKSA 3OICA 5JBIA 3Q8WA 3V3KA 2A5LA 2VHQA 3EXG2 2O07A 3KYCB 4M1TA 5KX5A 4CM6A 3UUEA 1SSNA 5TPZD 4TSKA 5KSOA 1U8TA 3BYYB 2REXA 2FTKE 2W4IA 2X77A 3LNCA 2YV3A 3RSGA 3RU7A 1KKUA 1XR3A 2D59A 4BVGA 3L1UA 4LJYA 4XVCA 2ZI4A 4TTVA 1M7HA 1WVIA 1Q1GA 3CLSD 3G8BA 1WM3A 1UPXA 4XWWA 3IQXA 3WX0A 1NUSA 3JZIA 1JWAB 3OTWA 5AK3A 3VR4A 4S0XA 3IELA 4RACA 3BA1A 1MHTA 1PV2A 1S1MA 4O6VA 3I14A 4HGQA 1OTHA 3HADA 4HPWA 1GGJA 2KWIA 4D8TA 3NRZA 5J2TF 5DIFA 3TFWA 4DIOA 5CFPA 1JAXA 1HL3A 3KOYA 7GPBA 4DLBA 3WQSB 2ST1A 5AKHA 4OO3A 4KUGA 4G0NB 1HO3A 2M0AA 1N8NA 4DY6A 3C1UA 1YB5A 1N77A 4Y6GB 5EV6A 1QOFA 3GOEA 4MH8A 1AGNA 1QTIA 1S8FA 1WXFA 2Z1DA 3NVAA 1NVEA 5B2ZA 3C3CA 1LU9A 1RAAA 4YDRA 3RF7A 1FVFA 3D3JA 5BUSA 2HU2A 2O48X 5KU1A 5KYYB 4C0JA 4F2HA 2N9LA 1B74A 2ZB3A 3K9OB 3BMOB 3FZYA 4GMHA 3GLGB 3VR6H 3GE3C 1QGZA 4J9VA 1P73A 2XKBA 5JE8A 1XFAA 2H3HA 1YQGA 2I4IA 2O6HA 4Q4HA 3OD5A 1Y7IA 2I1QA 1T6BX 4WLFA 2HC9A 3AE4B 3U7DA 3DQVA 1WHSB 2HL6A 3AEZA 3DW1X 1GRCA 3PXAA 4FQ7A 3HVDA 3PFIA 4O08A 3W5CA 2JS7A 2W2QA 4A2CA 4MQEB 1QYWA 3HKCB 5LBIA 1NDQA 1AM4D 4CCWA 4UTRA 2NMVA 1KYWA 4INOA 1B43A 1MU0A 2EFHB 4PZZA 4QYIA 4D44A 4ZU3A 5JZEB 4U7DA 2YINC 3RUAA 2QJLA 4AYWA 4H3HB 2PZEA 1PG5A 3HSSA 4LYEA 3VPAA 1R6XA 2JG3A 3LUDA 2C54A 4JLDA 2KDMA 4XYGA 1WVGA 5EVBA 3FIJA 4OYLA 3MQFA 2INPE 1RAEA 4OVUA 3HCNA 3M3JA 3OEWA 2KT7A 5D3IB 3HR7A 3RNLA 1ODCA 3ICPA 1U0BB 1SHUX 4OMUA 4TSFA 5K4AA 4EHKA 4QPJC 1OCEA 4MH0E 1SULA 2GHRA 2RJ3A 3C39A 3RZFA 4C1CA 2MWSB 1QGED 3FGNA 1KNQA 3MRXA 3IUMA 4W8HA 4ZVRA 1P3Y1 4P34A 3K9QO 4ARUA 2PL3A 2WF7A 2VBIA 1RRMA 1XA4A 2YNTB 2P9CA 3VVBA 2YNUA 2WV7A 3P0HA 4BO5A 2VXBA 3LJ3A 4EO4A 3L4BC 4CF3A 4YQZA 1PL6A 3U13A 1R6TA 3OSUA 4AO7A 4X5OA 2DHDA 2HQ1A 3MOGA 1L0BA 1S2LA 3KUUA 3TW8A 1VIVA 3NTUA 4UAJA 1JDZA 2QSYA 3BIJA 1ECGA 4RQTA 5HG2A 4B71A 3A0UA 4NEGA 3SE0A 4TYWA 4RSMA 4TYQA 5FK9C 3UV6A 6ADHA 1YONA 1ZI9A 2PGIA 3S1SA 4FZ5A 2DQYA 2J3KA 4HD8A 1UP6A 3DTVB 5KJ6A 4WWNA 4FDUA 2IIPA 2JK0A 4TUYF 5J2TA 3WE7A 1QE3A 2QL7A 3FZQA 3GCWA 3EZNA 1QGOA 4FLHA 3C97A 3ISJA 3IVAA 4HLDA 4KAJA 4PY2A 2GUGA 1AN9A 4B3GA 3QKSA 2ZIWB 5C2JB 4QUIA 3DBVO 1H5UA 2O3RA 4FGJA 1DLIA 2R2DA 5HHDG 1RAFA 4EPXA 3DEFA 3LHIA 1IPFA 1XE3A 3EC2A 4WD6A 3GL9A 3PXEA 5GY7A 2Z8YM 5DM70 3C43A 3HCPA 5A5GA 1XPRA 1LFDB 1KEWA 1VZ7A 4O02B 2B25A 4C88A 1L5ZA 1HRKA 3KSBC 3CR7A 4GVXA 4FGSA 3NKLA 1QUFA 5BN1A 2DBVO 1WR6E 3ZCXA 1DXYA 1G5QA 1QHGA 2PKRA 1P9OA 2V9PA 1OGYA 5MN5A 4JKIA 3MTBA 2HUPA 3CF4G 4MA0A 4XGQA 1ZINA 2VT6A 3FCSB 4G07A 1JXOA 5MN6A 3J81k 2NTYC 4RGTA 4DUYB 3T9LA 2C5HA 1KTVA 4IVQA 3BE4A 3Q6VA 1E8DA 4IV5A 3NJTA 2Z57A 1FO4A 1BROA 4UHKA 1LLQA 3PYLA 4Y9RA 4BP1A 4YRZA 4W5QA 2HJWA 2YY5A 1G5RA 3RTBA 5IVDA 2XUQA 4KFTA 1Z0SA 3IERA 3OQ6A 3BXFA 1MA0A 1EBBA 1U2PA 4B3HA 3ZW9A 3GRPA 4CMHA 2RH4A 3RPEA 1CQJA 2IXTA 2CD9A 4PRKA 4ZK2A 3ZHVA 1TVEA 4BTLA 4FDLA 3NBYC 4ZTUB 4PBTA 4F0JA 3G2LA 3IV7A 3LHSA 2KN4A 4AXXA 1T8RA 3AVQA 2BFFB 3FWNA 3T3PB 2PUAA 4QJ4A 5KYVA 4Z6XA 4GOCA 2JI9A 3OPYA 4RF2A 3AHDA 4K0RA 4G85A 4NP6A 4W8OA 2IV7A 3G0IA 3V1MA 4CEIB 1JHXA 1Q0HA 3FFTA 3R3VA 5DASA 1YMVA 2B3TA 2J59A 2WG1A 3D4PA 3MILA 4JPSA 3Q0TA 1JEJA 4UM8B 3PDIA 4WY2A 3PNOA 3AI7A 3KYBA 3L0OA 4I4IA 1QLWA 2RE8A 5GZ3A 4FR0A 4DDID 2JIMA 1T8UA 4D2IA 1MABB 4MS3B 3HVUA 5FJJA 3JWJA 3ZKWA 4IYRA 1BS9A 3RS4A 3WMFA 2OWDA 3X1WA 3TF5A 4HEA1 3W1YA 5HTOA 1BWQA 2ORVA 1BXGB 3VPDA 5DE3A 4EZJA 4OG2A 3AHHA 3CVXA 4YPFA 1AK9A 3K9WA 1TADA 1ZKPA 5B1IA 4HFJA 2CR5A 2X0JA 4REQA 4YK7A 4C4RA 1L5RA 4QUJA 4B0MA 4G8CA 1ZW7A 4MVJF 5HYVA 2KMMA 2EC5A 2GMWA 1YQDA 2G63A 2NZYA 4XTCS 3RKRA 5EE0A 2AXQA 3ERCA 1T1GA 3VFDA 2VUHB 4YCSA 4G1BA 1CQIB 3WADA 1F4VA 2HWXA 4K3UA 1JQ3A 4RNCA 4C5AA 4HPMB 1JJIA 3JYNA 1T35A 1DIBA 4ZOEA 5DM1A 2NYPA 2WXMA 3RS9A 2FU9A 3CIFA 3E3AA 5LVAA 4AP5A 2JHPA 3KG2A 4H6XA 1F8YA 1IN5A 3A1TA 3AESB 4C89A 2Q8QA 3HCEA 1LF5A 3QJ5A 3R66C 3UJ7A 1FBTA 1I24A 1IEWA 3QE4A 1TIFA 4JFAA 3S68A 3X3HA 1KI9A 1LI7A 2QG9A 1L7XA 3P2EA 1M6WA 4X00A 3DHGC 2FCMA 1D1PA 3L84A 4F56A 5FUYA 3Q69A 1OIVA 2B6NA 2EMTA 5KYWB 3NTLA 1XRMA 3IP9A 3UW3A 4E15A 2OCLA 3NAZA 2FHXA 2VEDA 1EHYA 4CKBA 1NG1A 5T5QA 4D6XA 6REQA 3VZRA 3WA6A 3HACA 3W1WA 1QQ7A 3IKTA 3OHSX 1B2RA 3UWKA 3NWJA 1RP1A 4EI2A 4DCTA 3HUFA 3KUXA 4R83A 3DXFA 4Y9DA 1I4WA 3B36A 1O95C 1VLMA 3PQ7A 2LCQA 3ZY6A 3L41A 1QG2A 1XRNA 2WHXA 3HYTA 1I35A 2VJNA 2E21A 5D3QA 3IMKA 5AI5A 2C7RA 4OHMA 3JQ7A 4OXYA 1T3QA 1OUMA 5ALSA 4MR9A 4I4TA 1TB4A 2IHZA 4DC9A 3GP8A 4HCNB 4YECA 3U7FB 2IPXA 3UXEA 3HV2A 3THWA 3W7BA 4ZOLB 4NQ6A 1H2BA 1L4ZB 1V43A 4EY6A 1E3QA 3GT7A 1DUIA 2LRHA 3AEQB 3SZUA 3NANA 3GLIE 5A6VA 3RK0A 1PT9A 4D4JA 2JHGA 4D4MA 4M9UA 4DV2B 1Z63A 2ZCBA 2ZJ0A 4FB4A 4HGRA 2IUUA 4P0QB 4CKBB 3I04M 2TSYB 2ENWA 3SC3A 4BNJA 2DWCA 4EMUA 4UHFA 5E8JA 4K8RB 5REQB 2ZPNA 1NL3A 2IHUA 2B36A 5FFMA 5G02A 4BZXA 1G5PA 1KI8A 4PZPA 1CX9B 2CL7X 2PYIA 1SKAA 1T8TA 3E5MA 2PGNA 3H4VA 1X1QA 2WXKA 3NHBA 4YRDA 4KN9S 3SR0A 1RD4A 4AECA 4JV5B 2WILA 1DIOB 2Y92A 1NUAA 1QP0A 2GCGA 1FNDA 1U4SA 4GGPA 4M7OA 1TAGA 1IBSA 1L3BA 1PK9A 4RVNA 4V39A 3ZLVA 1IZ7A 2A3RA 3GJRA 4Q24A 4P4TA 3TE7A 1OV6A 5CLJA 3AOEC 2L3ZA 4Q39A 1R00A 4LTDA 5M29A 3TEZA 4XWKA 3SXJA 1EWYC 4F12A 3RT3B 3DBRA 1U2SA 3QXXA 4BMPB 7AT1A 2P2GA 1IK4A 3EGWA 1NNEA 3P9YA 4QFCA 4XH9B 3W9SA 5A9SA 2I38A 1E1KA 2VHYA 1M34E 4WOPA 2DUJA 2OMKA 2IVFA 4Q05A 3O31A 2ZT5A 4ZA2A 4RHCA 2GFKA 4M7WA 4QM6A 5JO9A 4PZDA 4WXPA 1PJ3A 2BFMA 1QIKA 2PMFA 3D31A 4RL4A 2PVOD 3SD7A 4QBFA 2LGJA 2XUIA 3SU8X 3UQZA 2H4YA 2PFKA 3NNNA 3AEGB 2QI9F 4QUBA 3S81A 1STOA 4JI5B 1PJ8A 4EHJA 3RSCA 2J7QB 1A04A 1KE1A 3BC1A 4O1HA 3SJBA 3DBLI 1K50A 2H31A 2M2IA 4ZVOA 1X87A 4CEIA 1DRWA 4C6HA 4U7HA 1B0AA 5DTJA 2AT1A 2C5AA 2A30A 2QA5A 3L7BA 3KVNA 4R3WA 5K0WA 4BNLA 4WJPA 1NVGA 2VO1A 3VUFA 4QSMA 2P67A 4EEWA 1ICEA 1MRNA 5FO0A 4CUJA 3TG8A 2DR2A 3NRJA 5ICFA 1Z6TA 2Q50A 4EG1A 1EVZA 2AYOB 3KSRA 3O4RA 4JVOA 1RYEA 3ZE0B 3N9YC 4ZRNA 4MVYA 4C1EA 3D8UA 1N1MA 3RI7C 1Y8RA 4B84A 3A1CA 2DYMA 1GG5A 4G89A 3FOZA 2XCSB 5C8ZA 4Y2HA 4JMPA 3M6MD 4KAFA 2W82A 5KHAA 4C4XA 4XDDA 1KARA 2V7EA 4UNRA 2BGAA 3T5CA 1UZXB 1CUXA 2O1SA 2WVHA 4MIKA 3O3MB 2GPWA 2HY7A 4OSOA 1WD5A 4UUMA 3N28A 5CXXA 6Q21A 1GNVA 2WMYA 4TT8A 3DEKA 2IXDA 1P33A 3RN9C 1E1QA 2WYHA 4DLAA 1RACA 3OCVA 5JD5A 3EZ6A 3FZNA 3MT0A 2O2IA 3L4EA 4NZYA 5C8XA 1CIPA 2Q8PA 4PYKA 3EVTA 3A25A 4OGWA 5G2NA 1OQYA 1RFLA 4YMVA 4RM3A 4DIFA 2VP9A 3V4OA 1DTWA 3L6RA 3AP1A 4NCIA 5EN4A 1JL3A 2I99A 1U2TA 1VRCA 2FZLA 1RVV1 2ENUA 3GWZA 1RJFA 3ZHTA 4BLSA 3QC8B 2VJDA 5H92C 1EYZA 3ONNA 4RKEA 4IF6A 5TPZA 4YMUA 1GILA 3H9CA 4F1JA 1KI6A 5DX1A 4F3YA 3MC8A 1HGXA 1M7GA 3O4GA 1SJ9A 4ZT6A 1WULS 2G6BA 1BWSA 4LLGM 2OORA 3SYRA 4LHXA 3AWIA 1V2YA 1GRRA 1FP6A 2Y0CA 2GERA 1T6XA 1P80A 2JK1A 3PKIA 4GGMX 4DILA 2DCMA 1G18A 4C4TA 3QK0A 1J2EA 3LXMA 5JD4A 5KWIA 4JI0B 3KQYA 2FJ0A 2P35A 1WF9A 2RHDA 2UUAB 4IXNA 1R8JA 4PF1A 4CTMA 2IBIB 1U2ZA 2BEWB 4M2LA 2IYEA 5F4BA 5F76A 3TJZA 5SY4A 4WURA 4Z9AA 4TVOA 3JQRA 3W2FA 3DEAA 4ZICA 1OAAA 4B3MB 1KBZA 3P4RB 2TRSB 2G70A 2YV1A 1ZCFA 2BF8B 2HTME 1V3QE 2CCGA 2KI5A 1PQPA 1RWOA 2VDLB 3OURA 4G63A 2AA3A 3MJSA 4YN3A 1SXJE 2LWPA 5JAQA 3ZCQA 3CRQA 3P0FA 3QPUA 2AXPA 1H9BA 5SZKB 1MNAA 1OBFO 3DP9A 2C2HA 2JA1A 2ZKIA 3ESYA 3FDXA 4I1IA 1N0UA 1ZVQA 4IIXA 3JQCA 1YJQA 2NV6A 1T43A 4TYMA 3KK0A 1XIVA 4L9RA 3CLVA 2JCGA 2VBGA 5IFKA 2YHIB 2XRMA 2QRVB 1X7HA 3VQIA 4IEFB 4YJ2A 3EDRA 4ANVA 3GFTA 3NWPA 3UF8A 3BICA 5K2MA 1NLZA 2V45A 3D7MA 1ULAA 1G66A 3F96A 4N82A 2IHYA 2QIEB 1FE8A 1K86A 3EWIA 6PFKA 3PX7A 3ZWBA 4C09A 1RWNA 1WUKS 4FOOA 3UPTA 2CMFA 1I2MA 4JWUC 1OX5A 4L28A 3R7WB 3ESXA 1G21E 2ATEA 1PDXA 2EFDB 1DFIA 3AV0B 3K8QA 4HDMA 1Q57A 3EFOA 2OFPA 2XUKA 2AJBA 1QNLA 1TA9A 3FKSA 3IT0A 4FHEA 2JAXA 3UWOA 4DM3A 5JH7F 4EZLA 2CL0X 1G21B 2BUAA 3K30A 1NW7A 3Q3JB 5JT1A 2PZLA 4V0OA 2H0RA 2G25A 5ERXA 2B7BA 1NMYA 2J9ZB 4KFUA 1PFDA 3BBLA 3ESDA 2KS6A 3IP6A 3DTNA 1SVUA 1XGKA 1WJ4A 4IG4A 2ZJ3A 5G53C 3A1QB 3SEBA 2VDRB 3GLIB 3WJ1A 2Q0QA 2E4XA 1LJUA 4DUPA 4YUVA 1OYYA 2GNOA 2LV8A 2PZAA 1JDPA 2Y4NA 5JXGA 1ZXLA 5TEWA 1MZVA 1GT91 4ARCA 3AMZA 3AX6A 1NTOA 3C5WP 3NBMA 5JEDA 1YB6A 3O8NA 1LRKA 4NYJQ 1G20E 1C4XA 1CWUA 3UHOA 5KYYA 3D6HA 3CRVA 1GEEA 2DH6A 2FRXA 4MGIE 3CRRA 3SPUA 1F52A 1GTZA 1OAOC 3TUZC 4URXR 3KNRA 2OO7A 3MS4A 3N8IA 2QHOA 4A0QA 2CHZA 3CN7A 3T7KA 1B14A 1NY6A 2AW5A 2WSMA 3ZXXA 4BZZA 2VBFA 3O8CA 2ABWA 3S1AB 4A6DA 3MAGA 3EPHA 3DMGA 4DLYA 2X3FA 2J5RA 4M9CA 3O5AA 1MG5A 4BP8A 4PHCA 2PSJA 4GUDA 1JG1A 1RAIA 1N2JA 3D3QA 3R3HA 4GLOA 5NLLA 4ZVQA 3DJFA 4N8EA 3C87A 4GIVA 3NETA 1W0JD 2GD0A 4IDOA 3RYHB 3VOTA 1M6NA 5A4IS 2V4UA 2J32A 1T9KA 4BMCA 3T1YB 1RQ7A 2BVCA 2VJPA 4OXIA 2YYSA 4YC7A 3UKOA 4JJAA 3QKRA 1EFVB 3RVNA 2VCYA 3E7XA 1POXA 1DG3A 1WCV1 3O6VA 3V8QA 2YCLA 4HAZA 1F8FA 2IXEA 1XPJA 4XJVA 1ZJWA 5EW0A 3ZJTA 1G38A 2BFWA 3E8MA 1RKUA 4BS9A 2PLPA 4W1QA 3L7AA 4BNMA 5KX5B 3CCCA 2NZXA 1U8AA 3ZW3A 5CH3A 2INDC 3PSHA 4N01A 3UAWA 3H5LA 5CDSA 1RXIA 3UMYA 2IH5A 5LP6F 4MS4B 5E7QA 5A0VA 1Y8AA 1PYDA 1LSSA 5J17A 1XMPA 1DKQA 1FP4A 2E2WA 1PW7A 4EJSA 5LCFA 1SG9A 1GUFA 2J6IA 4G65A 1ZNZA 2ZYDA 1SUFA 1WY5A 1X7YA 4PCAA 5ES4B 2AV6A 4NJMB 3N32A 4G24A 3V7UA 4MP6A 1AZLA 5AJTA 4DXAB 4JDPA 5F21A 2LR0A 5I4DA 2X1HA 3O13A 3CW2A 4MB0A 4LHYA 5FUVA 1EA5A 3GJ8A 1NRJB 4IKEA 3EMKA 5SZHB 1YE5A 3COJA 2WSIA 1U0OC 2ORWA 4IDDA 1QKZA 2O7SA 5AJUA 4D1TA 5AKXA 1JQBA 1QYIA 3W1EA 4K9RA 5CIWA 3PHGA 1WUOA 5ER9A 1NXXA 3EVCA 1MH9A 2VSYA 5I3ZA 5E4TA 1Y80A 2M98A 1GZDA 4XTRA 3MWLA 4EYGA 1U90A 2IX9A 2IJGX 1PGQA 2WWXA 2ZIVB 3HK2A 4CQNA 1ZVKA 2EL7A 4MYUA 4BWVA 4RAMA 3MAJA 1EUDA 1RCUA 3EASA 1VL1A 3NONA 2QTNA 1NP3A 3D81A 1NDDA 4C4VB 4NTZA 3VYWA 4B6FA 3EXEA 3WQHA 2FE1A 3GG9A 4RJLA 2AZTA 1OV4A 2QMOA 5EIAA 4RNDB 4CMCA 2NIPA 1E7QA 1T4MA 1Z2DA 1KSJA 4AY3A 4MKIA 2I1WA 4EECA 4RAOA 3AL2A 1OMOA 2FZWA 5A71A 3SBOA 4J49A 4O4IB 3PC6A 5KHLB 4FEGA 5LR6A 1L5MA 4WL0A 2R5NA 1X7ZA 3UFXA 1DJQA 3DXYA 5D3KA 3TJRA 1GL7A 4E5PA 3JSVB 1D4FA 3GS2A 3QU5A 4KSBA 3P4QB 5I7WA 3H5WA 1TJ3A 1X1TA 3HMKA 2K2QB 1KI3A 4WVLA 3FOEC 2XVMA 4HDSB 3QKTA 3N70A 4TL9A 4KZ0A 2KBFA 1KFKB 1Z36A 2GK3A 3VSBA 3HZZA 4WSOA 1Z6PA 2IU0A 4AWBA 3QNUA 4PN7A 1ESDA 1MJ5A 1R0KA 2XZPA 3PLVA 2YVCA 1JQLB 3P9XA 4MKRA 3WSWA 2GI4A 2XEWA 1Z5VA 2J9FB 4XX5A 3ABRB 3LF1A 2K6QA 1JAIA 3Q9NA 4D0RA 1WZ0A 1C9JA 5JPIA 4MGIR 2AJLI 3DV2A 3KZCA 2L19A 4R9SA 5EPEA 5IBCA 1Q77A 4ARZA 3FB1A 2VQSA 4LVOA 2G1PA 1J9EA 5BSWA 3CCFA 3PNYA 3VX3A 1E79A 1WMSA 4DXFA 4Q15A 3ZLBA 1E4EB 3PRPB 1RXCA 2ZRPA 3VZSA 3X30A 4D26A 1WXEA 4HUQA 3TXXA 5HXAA 4A4DA 4F5YA 3H7PA 1L1EA 1E5WA 4ITRC 2YHUA 1BE8A 2QHXA 1B41A 3SR3A 3BD7A 2JW5A 2Q6LA 1EM6A 4RD3A 3ZCUA 3HLYA 1FFAA 2HCFA 1BGXT 2G28A 4QA9A 5J4VA 2XCQA 4AUEA 1TECE 3TM4A 1RMQA 4M36A 3A2LA 1H2FA 1M2VA 1GP2A 1TUBB 1IM2A 2HBZA 1RLTA 2ZBGA 1R64A 1P44A 2GZMA 5B1SA 1QQ5A 8ABPA 2R8EA 1U31A 2JLAA 4G23A 3Q7QA 4ZD6A 1OWNA 3VPBA 3GLFE 3A4LA 1IGDA 4X1IB 5I7VA 2VF7A 5JU6A 1LPPA 3S2FA 3IT2A 4PGAA 4XD7A 3QVKA 3KYDA 2N47A 2OUIA 3I4LA 4JR0A 4B76A 3HWRA 4UEWA 1GAJA 1FLDA 4XI9A 2GX6A 4DQXA 4GE3A 4QUDA 1P2UA 3PHIA 2YFQA 3I3SR 3ICCA 1ZD9A 3EQZA 3QBDA 4K9OA 1CIJA 3T4EA 2R6R1 5DNCA 1PVOA 3F5QA 1ONNA 1ZK0A 2QTVB 4QLAA 1J6UA 4RF5A 1JU4A 2GWRA 4YJHB 5H1YA 1HLFA 3V4VB 3HCBA 1D6SA 1FLVA 1QTNA 3GUCA 5JNRA 4I50A 4MGZE 1D6NA 2W0MA 3PRHA 4N48A 4LJ7A 5KUTA 1P19A 3ZWWA 5K01A 2X13A 3KOUA 4RVDA 2PZFA 2V6FA 2NT4A 3TL3A 3DVGX 2OV1A 2XQFA 3WL3A 4RAWA 3K6SA 3V8MA 3OZEA 4HKTA 1F2RC 3LXFA 3ORFA 1TMYA 1T9HA 5U1PA 1BD4A 2CU3A 3Q85A 3AH7A 4J29A 5IANA 1SCUB 2E82A 4TXJA 2H1OA 2FMFA 3MQ2A 4G5GA 2YMPA 2E87A 4RMAA 5GV8A 1N6ZA 3DHIC 1LTHR 2IY8A 3H11A 3K2IA 4C03A 5I47A 3OP1A 4FKBA 4CT5A 5JASA 5AESA 5KYTA 3PNVA 2H7YA 4D6PA 4DK5A 2BFBA 2C2GA 4JP3A 4CLHA 4EPRA 1DBSA 4BE9A 5CD1A 4AT1A 4BLPA 4QXRA 4UFNA 1M2EA 1BH6A 2E48A 1Y7PA 3FPEA 3KELA 2LJIA 1DU4A 3P2MA 3P4YA 4O3FA 4D41A 3DHHC 3FOFC 1ZNXA 2JL1A 4UCXA 3UTDA 1RXWA 3QLUC 5E2AA 4OHKA 2YXDA 1PWHA 4P93A 4JYAB 1LPSA 1DV2A 1OIXA 5BOVA 1CUFA 4KNVA 4AUNA 1T9GS 4OHUA 4E7OA 3KZNA 3U52E 3FUXA 3BOSA 4FYIA 3V8NA 4RFLA 1X8KA 1AA9A 2VATA 4PW0A 3ENZA 3P2JA 1WXVA 3C3XA 3TSOA 5FPSA 4UM5A 2WEKA 3OUTA 2JLYA 1E77A 1OFGA 5G3YA 1PZMA 3ZYYX 2IHJA 4FE4A 3WK8A 1XTTA 4LMBA 1ESNA 4GECA 4L6CA 1X1BA 1X9IA 3M82A 3WGIA 1N36B 1L8AA 5KZMB 1ZLXA 4BNZA 5KMGA 2WG2A 3AKCA 1J8DA 1VBNA 2HHLA 5CJPA 2ZRCA 4B81A 2YNVB 2IPMA 3U37A 4K2AA 4QWWA 4YJFB 3EQ7A 4ML3A 3BV6A 1CKEA 3OU2A 3OE5A 4WBNB 1AWDA 4A6XA 1P60A 1DSSG 3LLMA 2GB4A 2VXCA 1ZSNA 3NLLA 2FPGA 1VGNA 3CWIA 3QUTA 1KP2A 1PBNA 3C74A 2OVBA 3IDOA 3LPMA 4FLEA 4E46A 2OILA 1Q16A 2BY4A 1RPJA 3K1YA 1TYAE 1QH3A 3R5JA 1MO3A 1P4JA 5LP1A 1U1IA 3CH5A 3E7FA 2HV9A 5G1NA 3RHSA 4AZ0B 5IT5A 3AM4A 4PTYA 2KLHA 3IPLA 5KAMA 4HWSA 1K5PA 2CDBA 3EZXA 3I6BA 4D8VA 3NG0A 1ZA2A 5I7AA 4C20A 2JWUA 1C0LA 4QE3A 3HVZA 4KB5A 4P38A 2QDXA 1KRWA 2CWWA 4FJYA 3LUBA 4N12A 2JH9A 4B45A 4G4GA 4YUAA 2AN9A 3IT1A 2JGAA 1BA3A 4X94A 4TZBA 1D1TA 1TIPA 2XDYA 4YSKA 2ZW0A 1XTVA 3L0PA 4PYMA 2XB9A 2Q4TA 3FVWA 3MT7A 3G49A 4CO7A 3M89A 1MF7A 3HKBA 4JXKA 5C7YA 3KSAC 3KKPA 3L4PA 1A95A 2H4FA 3GLHB 4X8MA 2PAAA 4Y2UA 4B09A 3U16A 4TQ9A 1C9MA 3F7MA 3SFDB 2KK8A 4K7UA 4BOSC 2FOIA 4IKOA 1K9VF 4CI0B 1L1QA 2O23A 5I7SA 3PFBA 1LPAB 3HXOA 1RWSA 2A0XA 1YIWA 2MU1A 3LPDA 4EEKA 1TU3A 3I52A 3JU3A 4XIYA 4CDGA 2XE8A 1KEZA 4KTVE 2HMYB 1JTVA 4QU0A 5CDFA 3IQZA 1RHUA 4ARVA 3ANLA 4MPDA 4EO9A 1W0CA 2NU8B 4YACA 4LYDA 1JHYA 5J2UF 2ZROA 2I1JA 3FA2A 1YVUA 3LTEA 1UOEA 1EX1A 4JLPA 4LOHA 1YIDA 5DTMA 3H75A 3ZY4A 4RZQA 2NYVA 1N3BA 3UMGA 2DM6A 4B3TB 4LOIA 5T4BA 3M3PA 3WHIA 4DR2B 1P7ZA 1EHCA 4H7IA 3HJCA 5HRCA 5BR8B 4UDNA 1E4YA 2H1FA 1YJ5A 1NI2A 4R6XA 2R6AA 4MKZA 1WUYA 4YWJA 1I1HA 1TGVA 1CV2A 2GKOA 2HCJB 2HNAA 2OAGA 1C2TA 3H17A 3DAYA 4ER3A 4DLUA 4F9GA 4OAOA 1ORRA 1KJWA 2PT6A 5FFNA 2CLIB 3FHCB 1Y1LA 2JIOA 4QJIA 1UINA 3DNFA 4CE6A 1XCBA 2RH9B 1A7UA 1AUPA 3JPYA 1SC9A 4H0FA 2GN1A 5A3QA 1I4LD 4GSYA 2WHPA 3JQQA 3MJRA 4KRYA 1KP3A 4JR2A 2G9QA 5B1UA 4GAEA 4F8JA 1EUZA 4Q7JB 1G2QA 4UXHA 1B00A 2Q5LA 4BMVA 4FJ1A 5TMEA 3T41A 4EYQA 2D0OB 3OOYA 1P1KA 1XLVA 1B6SA 1WBBA 2R3SA 2VWPA 1KMNA 1WCYA 3BFKA 5FEMA 3NY5A 2PVGC 3IKVA 1K92A 4YXWA 3LQ1A 3UV7A 1UT5A 4PS1A 4R1QA 2Y05A 1SCNE 2P8SA 3ZDQA 4AF6A 4G01B 4NAWB 3P4XA 5HZKA 5A5FA 5LZ7A 4BGDA 2B1RA 1KQGA 5L3QB 4HMOA 1RKXA 1B1AA 4R9NA 2IOHA 4V0RA 2A9JA 1AUQA 4R8LA 4BV3A 4MTLA 3RK1A 2BE7A 3AWDA 1DI0A 3PT5A 3KNZA 2CLKB 3RNEC 1EVQA 5E2BA 4R71A 5BN4B 4GOJA 4LF9B 3RIMA 3ENWA 1KQPA 2QBYA 1JT2A 2YN4A 2PX6A 4DV5B 2GWHA 3FYSA 2E3TA 3NHSA 3E9YA 4HY3A 2IY9A 4NVRA 4IL5A 4RQBA 4E6EA 3SQWA 3JXEA 4DLNA 3L49A 4PQRA 1DGQA 1Y9AA 2GN9A 4RVHA 3LDUA 1X1RA 2B76B 4ZDWA 1LA2A 4TYNA 2F8LA 4HNTA 1FS5A 1DAGA 2W2KA 1Y48E 3EA4A 3DNMA 3DO6A 4C22A 1TD1A 1QP8A 4JI7B 1LTQA 3TLGB 1YZTA 2NV0A 3O1IC 1FRQA 1ZXHA 3E58A 3OO0A 4Y2YA 5DGHA 2NZ2A 3CBQA 5AKYA 2J3EA 3IUQA 3VXKA 7REQA 1KVRA 1VZ6A 2NPTB 2RKWA 2X1MA 4CDMA 5JRJA 4CCYB 1XELA 3GLFA 1P4SA 3TVDA 1HFJA 2QP4A 5CT6A 2RG1A 3VMFA 2XZOA 4E3WA 4DIMA 3DZCA 1D1QA 3CF0A 3FY4A 4MCHA 1XEWY 5L3QA 2LFIA 1J2RA 1FX1A 4NAWA 1RWKA 1G8MA 3ITKA 3OBBA 3GT3A 5G0VA 5CCXA 2C42A 3LQFA 1XEWX 5DWDA 4P80A 1ZD1A 5T3UA 2Y87A 2RPQA 3GOQA 4FOSA 3HI6A 4TLMB 2K3UA 1RBZA 1TLFA 3HLKA 5TV2A 1FM0D 1U7OA 3QA3E 3CFYA 3P1JA 4GMFA 3K71B 4A5SA 2PPHA 1SVWA 3QY9A 3U1TA 5BVGA 1HR0B 4R68A 1X3SA 2Q2NA 4YRJA 1R16A 1DRUA 1ZN2A 3M6XA 3PC7A 4FUQA 2I7TA 4O8ZA 3JWPA 4YCLA 1UXJA 2QSJA 3KQTA 4TSFD 1TYCA 5GP1A 2OGZA 1AX9A 1T10A 3MWGA 3NP7A 2IY0B 3S2SA 2WJHA 3AR9A 1E7SA 2QD2A 1AHNA 2PE6B 3ZDMC 2HEGA 3CRMA 3KOOA 1ZOLA 4KQJA 4TX1A 5I4IA 5CNIA 1FFBA 2X7HA 1WW1A 4C87A 4Y2SA 1HOXA 1GTSA 2KVZA 3OCUA 4LV8B 4C7MA 4JQSA 4IEIA 5H5JA 3JATA 4I5FA 4RO0A 2EELA 2E5WA 2Y9MB 3HUUA 3I53A 4GI3A 5EJ8A 2ACZB 3SU8A 4O4JB 1GNTA 2C8KA 4BFLA 1QPBA 4FHDA 2DMRA 4GXTA 1Q7BA 2OO5A 3PR2B 3ELWA 1B93A 1GLGA 3B9PA 2LJ5A 1Y8CA 2B0JA 3C85A 2HDNB 4KO1S 4WOBA 3EH1A 4K6OA 3V4LA 2AZ4A 3H2YA 1L5WA 2KLBA 4D92A 4Q1VA 2R79A 2JIDA 1G7CA 3ACCA 4LE0A 4D02A 5AVZA 4I1PA 5E9QA 3WAKA 3ZDRA 2NU8A 4EUHA 1P9WA 4IM7A 1N6LA 4TUYA 2A1TR 3FJ1A 3A9KA 2CUKA 1U3DA 1WQ3A 5A6SB 3REFA 4A26A 4RTJA 1TK3A 1LDMA 2ZJ6A 5JYEA 3SCZA 1NVBA 3U30A 4OI1A 4REOA 4B9AA 1RYBA 4MZDA 1SXGA 2G1KA 3MEQA 2DWPA 3EQ2A 1TS3A 4O0LA 4D97A 1L4GA 3JQFA 3UJCA 3HTXA 1FZTA 3K4HA 4ANXA 1ZHFA 2WKPA 3CLTD 4FS3A 4GI7A 5HW0A 1UMKA 2RJNA 1CDEA 3OPMA 3FLEA 3FRHA 3IILA 2AXNA 4I46A 4QOFA 4NV3A 4CIDA 2QENA 3KT8A 3E5HA 2IYRA 1EIWA 5JVDB 4EHNA 2BGFA 4EJ2A 3KR1A 1KEEA 1WW3A 1Z0FA 3OT1A 2AKEA 4ZHSA 1XXHB 1TJPB 3VU9A 5CVVA 2PV0A 3CHYA 2BJWA 2IYZA 3LC7O 4CFZA 4BGVA 2O8VA 4ZZ3A 4KQMA 1TX4B 3G2QA 4QG7A 1KWKA 2JCSA 5ALPA 4C4PA 1MVKA 2P62A 2IHNA 1H8ED 5EXEA 4EG5A 2OD9A 1U28A 1NZJA 1N0VC 3C3KA 4D9JA 1U28C 1LXCA 2VNAA 4K2HA 5AJXA 2Y1GA 5E0OA 4YP5A 2INCC 2BZSA 5AK4A 4JL5A 1UBNA 4DKJA 1ECBA 1XXLA 3VRBB 1CZKA 1RFGE 1U0SY 1Z17A 2JFGA 2MCFA 3C8ZA 1CRWG 4CBVA 4LOLA 1UNSA 1W0KD 2J07A 4MVJG 2PD3A 1NJ2A 2RGEA 3DDZX 2DAJA 4WEOA 3DH0A 2VIIA 1V7CA 3C3EA 2DPLA 2FPIA 1T5IA 2UVQA 3E70C 2DULA 3FM9A 4KVGA 4RTLA 3II6X 3IAM1 2WKSA 3OZWA 5HNKA 4GBED 2IH4A 2G9UA 1GQSA 2PM8A 2JD1A 4J75A 4RYDA 1SWVA 3SFZA 1O5TA 1MVLA 2B4TO 3IT6B 2CSUA 3AYXB 4GPAA 4Q1AA 4AURA 4JBIA 3GRVA 4L2IB 4A73A 3M63B 2E89A 1L0XB 3EY9A 1E5TA 4FX5A 3HC7A 2ESRA 1TZBA 1WQ4A 2A9OA 3AJEA 4QDTA 4MMXB 5JWRA 2R96A 2PWBA 3A27A 1R88A 4X91A 2VUSA 4M1SA 1NRIA 1JGTA 2WNHA 2DECA 1UFVA 3RODA 3TQCA 3E8XA 4PS0A 2YFHA 3KPWA 1JDBB 4MJLA 2ISCA 2WT8A 2NR2A 4Y9TA 2HO4A 1VP9A 1CRLA 2L42A 3OG5A 2JFHA 1DX6A 2ZAMA 4RTQA 4FLFA 4LX0A 3ABVB 4A1FA 5AM1A 1EQ2A 3A2NA 5FNZA 4KWHA 4K6MA 5F3RA 3WAGA 3I2FA 2PKWA 4CKCB 4AJPA 6NULA 1YC5A 4S1VA 2C8VA 2VJMA 1R0YA 4HPXB 1J7CA 1RPTA 5BORA 1WUHS 4PX5A 3PQ4A 3V60A 1E9VA 2AFRA 4TT3A 5G55A 5LQRA 1SCUA 2QZJA 4LZJA 4H16A 5EUBA 3R77A 1WXQA 2QJOA 3OG9A 5D86A 3SZGA 4AO6A 1YZ3A 2ZEQA 1EVLA 4DB4A 5GJWC 3NGLA 3JALB 2XXBA 3APDA 4HP8A 5C8YF 2XTAA 4QTUB 1R3DA 3G13A 3KWLA 4ND3A 3DGEC 5I5GA 1NBME 3UFBA 1F5SA 3QVOA 4B0PA 5C1PA 1QRSA 4TN5A 2ASQA 2HJRA 3OWHA 1G0OA 1NVTA 5J2RA 4Y2XA 5AK0A 2C92A 4YAUA 2IIQA 4DMHA 2QTVA 4ZYTA 1XCMA 5EVKA 4RK6A 3CH7A 1NV9A 1QFZA 5GV7A 4ERXA 2QN6A 1HQCA 4W99A 3DTTA 4IFBA 3UOWA 4XYCA 2QLNA 3EHDA 5D87A 5B2EA 1Z2MA 1SOVA 1K7YA 3TZHA 4IJUA 3H5IA 2O8EB 4FBJB 1QZ3A 3WGHA 2MH7A 4ZYUA 1CUYA 4UNPA 4E5YA 2PGOA 3MC0B 3KEFA 4PG4A 2TSSA 3KB6A 2CBGA 4BJHB 1XZLA 1I7LA 2JDIA 2O6VB 1KYYA 3ZUNA 1E6WA 1IEXA 3Q72A 3DBSA 1HF3A 1RM3A 1LC3A 4NXNB 3NM4A 4LF8B 2FR0A 3IS3A 1SEPA 3FNGA 4HLNA 4B4WA 1W36C 2IEDA 1F17A 3B08A 1PX0A 2ECFA 3I9OA 3KJGA 4FOTA 3GLIA 2F2TA 1DS6A 4LTUA 3K9FC 5IF9A 3IAFA 4U3JA 3BS4A 2OBYA 2VWHA 3WRYA 5FTLA 4E30A 2GM5A 4M0WA 2C9YA 1J0BA 4OV6B 4MAFA 1HZ5A 1PYWD 1WM2A 2BTQB 1XDGA 3CE9A 5HA5A 4RPHA 2M4NA 4JBWA 3GZTB 3X2YA 1WBDA 4DWOA 3GGSA 2H0QA 4PR3A 5FBKA 5CDUA 1XP5A 4HBZA 1XVTA 3PS9A 1J0AA 2L7RA 1KMHB 2CXUA 4RGQA 4KN8A 1T4GA 1I01A 3ONWA 4LNHA 1E59A 3ABIA 3FX2A 1FTQA 2QD3A 4MDEA 3RUIB 3JQFC 2P2DA 1R10A 4MJSB 4G0ZA 4OJYA 2NXJA 1ADCA 1RM5A 2YFYA 4DWWA 2LASA 2BEKA 3E7PA 5EPUA 5K4MA 2WKWA 1PNVA 5CG2A 2WJPA 3TRHA 3O84A 1AQIA 2ASVA 2W7TA 1H42A 4GPZA 1SZJG 2BEUB 2QZSA 3ZWXA 4W63A 3CUKA 4YO7A 4AJJA 5JECA 1UPCA 1YMUA 2NYUA 5T67A 3M6LA 2GPJA 2ZS8A 2L83A 3AI5A 3UJNA 2MP2A 1YA4A 2BEVB 1L7QA 3QV2A 8GPBA 2HQRA 1ZOIA 2ZB4A 4MM3B 1E3SA 1CUWA 1YJBA 2OB2A 3K4QA 4G1EB 2AXEA 3KB8A 1N5WA 5FWXA 2C58A 3DH8A 2BF7A 3ZU4A 3L17A 1D8AA 4JELA 5AI0A 2CB9A 2ACVA 2DBQA 3BZDB 1HX7A 3MM4A 2Z30A 3L8MA 3Q0IA 4XQCA 4CL2A 4GKKB 1WY7A 2WP0A 4YGYA 2IW3A 5EYPA 5A5ZA 4E2XA 1NI4B 3EA5A 2P6RA 3EXEB 1ZRNA 1E1YA 2OXCA 4KXUA 4PIVA 4ZQFA 5E3JA 2ZWOA 4HLCA 4O4JF 3SRXA 3C19A 1HZJA 1M0TA 4HROA 2V54A 5LSCA 3TPCA 1ET6A 3HYLA 1C4KA 3GJSA 1IYZA 2NT3A 3PXXA 2CE2X 4Q3AA 1NX6A 2FE8A 1TTPB 4F5ZA 4LHZA 4LRSB 4BX0A 2BZ1A 4L8GA 4D57A 2FP4A 3T8MA 1YS7A 3GV0A 4ZVKA 1U5AA 1MTOA 2G4SA 1W29A 2FUEA 2WXFA 1OWLA 1PDVA 1KU0A 4IVNA 3N53A 1KYTA 2NQTA 2VQFB 1Z0ZA 1T5SA 4RCZA 2FZ5A 1KQNA 4CMJA 4UMFA 4DJAA 4JMLA 5JEEA 4GC9A 1L5SA 1Y1QA 2GESA 4QBHA 3Q3CA 4KWCA 2IZZA 1QIMA 3V1TC 4YLYA 2HYIC 2O3SA 5F52A 5J63A 3OJEA 2DRIA 4FDMA 2JLUA 2PS0A 4WH0A 2GBKA 2ZQ5A 3A9CA 2M5CA 1FP4B 5ESXA 4BVAA 3UENA 4Q4CA 2E6XA 3UMVA 3AP2A 1Q1ZA 1BD3A 2PQMA 4KL8S 1YVPA 1GRNA 1TM3E 4LE2A 2IBTA 3SDZA 2PSDA 3UIOB 4BN5A 5KWSA 3CF2A 1RLUA 3WFJA 2FBWB 1RXYA 3B82A 4BO2A 4C4YA 1ZR2A 2WIGA 4DV6B 2LXCA 4KZKA 5AVXA 1A88A 4E1VA 4AP4C 2XA1A 2XE7A 1ZXXA 4CHLA 2QE6A 4FGLA 1V5FA 3ECSA 2WM3A 4YY3B 4Z3OA 1MW8X 1BH2A 4G25A 5AVJA 4FFWA 3VUXA 2OT3B 4W1RA 1DQPA 3KBBA 4O4HB 1DHRA 1XU9A 2JFWA 4YONB 4MW5A 3RJ9A 4Z1OA 3QBVA 2WSYB 2FQXA 3I9JA 1XRPA 5B58T 1E1CA 1RRPA 1LPNA 1ZK1A 3FRIA 4QT0A 1XXHE 1OLXB 2P1DA 4KDLB 1S01A 1NMSA 3FMIA 5JC1A 3EW9A 3MWEB 1QFMA 5KPDA 4Q6BA 3SC2B 5LXHA 2GRAA 1G7SA 1ZONA 1KL7A 3GFRA 3ANTA 3E9RA 4WKGA 2GCNA 3QLEA 2WINI 4LOKA 2NO7A 1KDTA 3AKDA 2HN9A 2Q62A 4FOLA 1E9BA 2AF4C 2YJZA 1RHRA 3RKSA 2WHIA 1O9GA 2CMGA 3BK7A 2AK2A 2WTMA 4UZSA 1CY0A 1BYIA 3PC2A 3I15A 5AJHA 1CJEA 3A36A 2K25A 4ZI5A 2XHEA 3SI7A 1S1QB 3EXHC 2FU8A 4TKUB 3C7TA 4TLCA 1PWEA 3C0RB 3LXXA 1HDIA 3H13A 2Y1KA 2OCPA 3QLUA 2G82A 2JLBA 5AOAA 3WG9A 1MO2A 3CW8X 5CT8A 2UZ1B 1O89A 3GLSA 3GP7A 3QXCA 1QRDA 3U8ZA 1U9IC 4LK2A 4UMVA 4DT1A 3IHKA 1ULZA 2OYRA 3RABA 3UGTA 2V3CC 3Q3JA 1A76A 2EW1A 2A94A 5DBGA 2K6DB 1EZ1A 4UU1A 3KR2A 5B4TA 1JH9A 1M75A 2XBLA 4UATA 3WLMA 4KX6B 4QRHA 3M5WA 1ZGAA 1PNTA 5BNIA 1GXSB 3BULA 1D03A 1GHTA 2CXTA 1Y0BA 3AHCA 1USVA 3O9MA 1NRWA 5DBFA 5AW2A 3H84A 3AXSA 3PFKA 5DF1A 3DL0A 3NZEA 4X44A 1KZ4A 1G4HA 1U0RA 4HTFB 2RSUA 3TRDA 2W3RA 2JGKA 4WE3A 1E0AA 1P17A 3QY0A 5EUCA 3ILHA 1O5IA 4N18A 2JH3A 1CT9A 1NNUA 1XZAA 3I6YA 3OTHA 5AIBA 2BC2A 1V86A 1E8XA 1MENA 4FE3A 1U7UA 1UIRA 2ODTX 3LUHA 4PQEA 3BWUD 3HCFA 3DE1X 4HK4A 3X2SA 1FFYA 1TJYA 4BLUA 1JILA 4I1OA 5A4FS 3TQQA 5ISMA 2UVPA 4RMGA 1FJGB 3PLUA 3KXDA 5DB4A 2BGRA 5FX2A 5DW0A 1MDFA 3H5RA 2X8XX 2PMDA 2AUNA 4EJFA 2FW0A 4HQNA 5EQTA 1C4PA 4DDGD 4YRKA 4II7A 4IOJA 2B3DA 2CT8A 4MKXA 1CK4A 2O2VA 1M34A 3CVVA 2PL1A 4MKHA 1ZCBA 5HKLA 3H6HA 1Z9BA 1SOMA 4F92B 1DP4A 5B6JA 2Q1XA 2PH5A 2XNJA 4AP9A 4V1CA 2HQBA 2CJNA 3GB9A 4EATA 1A70A 2CKMA 4DGSA 2KOXA 4W4TA 5TGDA 3RNGC 2MCNB 2CNWA 3OM0A 4AVYA 5H81A 2TYSB 2K0PA 1APBA 3IAAA 1OOEA 5KTYA 3JWGA 4LG1A 5E1OA 2ZTMA 5EE5B 1CJCA 3CWQA 3ROPA 3BVPA 3IVMA 4OLJA 2R6JA 2W2PA 1RWVA 2WP8J 4GX1A 4IQGA 1J2JA 3U3RA 4PZ0A 4UEJA 4J1TC 3UJ3X 3VYUB 1GRVA 3EZ9A 3OMWA 4XAQA 1OLSA 4UDOA 4XVHA 2HADA 2PRYA 1NG9A 2I2YA 4N0QA 2GD1O 1NDUA 3ADPA 3NC1C 3AT1A 1IIRA 3TLMA 2GILA 2DTDA 2J0JA 4GRIA 5DOVA 4BATA 1SCJA 3FNIA 1SE3A 3P2BA 1FFDA 4JBXA 3K09A 5DO9A 2CYCA 4YMGA 3R40A 5EI5A 4NJCA 3KKKA 4V0NA 5I9BA 4ZYXA 5JFTA 1SC6A 5KTNA 2XYRA 4DG9A 1SAYA 1UQUA 4NFLA 4LXTA 2H85A 4DOMA 1QT9A 4XGKA 3KPVA 3UB4A 4QTYA 2QMYA 5J47A 5JSHA 2PGJA 2PMVA 2NTVA 4DQUA 2QTLA 4MW6A 2QXUA 3MERA 3TL6A 4BUCA 3PA8A 2RJOA 5ILGA 4Q3LA 3UKJA 4AIRA 3FYHA 4MGKR 4FP9A 2DVMA 1YOVB 3IQFA 2J3QA 2RDHA 3AVYA 1WY8A 4QZVA 1N5KA 2GYYA 3Q7EA 4P7BA 2OBFA 1IIBA 4GZ5A 4Q9JA 1BFUA 4KEPA 3UM9A 4YRLA 4D45A 2DEUA 4MRMB 1XYGA 4CXMA 4YCBA 4OCZA 2HDEA 1D09A 2D07B 1P7PA 2NN3C 3PHCA 1N61A 2O2SA 4YT4A 1EJBA 1RYDA 2AN3A 3KOWA 4MVJP 5IJ0B 1UDRA 3N75A 4WA8A 1HL7A 1QFSA 1UBEA 3K72B 4LTNA 5CLGA 1X3LA 3IQIX 4NCAA 1MB0A 1MG4A 4OGGA 1XAHA 3EFBA 1YD8U 1HOTA 1PHPA 4OXRA 1J0CA 1ZCAA 1QF9A 5K0BA 4Q01A 2GBFA 4XYMA 2Y5BB 2PNFA 4UHDA 4DS3A 4F38A 2PMEA 4C0AC 4BKGA 3ZO5B 2OQ2A 3E23A 2JGIA 3EXIA 3K9BA 4GICA 2ZUCA 4U6QA 5B30A 4AYXA 2EEPA 5ECYA 3T61A 2WWIA 3FSGA 2WMDA 3HKDB 2VS1A 1T34A 1OI7A 1O6CA 2G0AA 1VE7A 2HF9A 3H2HA 2TMYA 5FD8A 5A62A 1FVOA 1OLSB 1YL5A 1KZ6A 3NO4A 1DFGA 2RGRA 1V6CA 2CFIA 3O9VA 1SIWA 5E0KB 3VZPA 4ABTA 5L3ZA 3RV4A 1L4NA 2ZBEA 4GGOA 4EY8A 3LX8A 2XB8A 5IJ9B 4N76A 3GUVA 3PIRA 1L5GB 4BMSA 2RHJA 2RGXA 2QCZA 3B1KA 3K6KA 2XCTB 2J0MA 3H8WA 2E7YA 1TS5A 2N1MA 4D9HA 1O95D 3DKPA 3ZWKA 5BR7A 2ZR8A 1YL6A 1ZDMA 2HMAA 4MEBA 4BB6A 4L50A 1AC5A 3BGOS 3RG2A 3OEHA 5LL6P 1D2RA 4PIPA 5AQ1A 4ZIRA 3CH4B 4JYZA 2GBNA 3L4BA 1BHSA 4NDZA 3QARA 2Q2QA 1R27A 3H8VA 4IYJA 1VOTA 2BS4B 3ASZA 2ISQA 1E2QA 3LBFA 4KH1A 2O2VB 1M34B 1GKKA 1Q0UA 5DYNA 5FXMA 4P35A 5KYXB 1P7EA 3Q8AA 2V7GA 3V42A 4TYFA 4C1FA 1EZZA 2X5XA 4HN9A 5TS3A 3KDAA 1X1AA 2HA6A 2QLJA 3C2QA 4M0EA 1F3OA 4WZAB 2BHSA 5J59A 2UVPB 4GM4A 1C3VA 2CNKA 3ORYA 5REQA 2IDJA 4RY2A 3SBLA 2GAJA 3HQ4O 5JXWA 2YZNA 4D9NA 3I5XA 3WMGA 3W2HA 5C53B 221PA 4LFAB 2Z0DB 4NU8X 1VRVA 4BVKA 4TL8A 4XJSA 3PHLA 2VBCA 4LF5B 2CFCA 1UWLA 2JQRB 3RRBA 3L9XA 4OBBA 1ADJA 2APJA 3JZAA 4C2UA 3O1JC 1ULHA 3AE2B 4MR9B 3KB2A 3IR6A 1DPGA 1YNOA 3JQAB 3LZDA 4M9SA 3OIVA 4TRMA 3AETA 3KQKA 1OZAA 1QFJA 3ADRA 1LVUA 2G1UA 2BB5A 4HQKA 1Z7BA 2Y5PA 2WJ6A 4ZK6A 5IBPA 4MP8A 1C4CA 1DC6A 3NOOA 3W3AA 4K5QA 4HVBA 5KYUB 1UBIA 1R8YA 4MI9A 2NUTB 1AXEA 2OZPA 4DT1B 2F1KA 3PWSA 2DLCX 3FGZA 4HKYA 1KS2A 4X8OA 1Z82A 2C57A 3S0JA 4RJJA 2UZ1A 1E2LA 3AU5A 2P0EA 5HH6A 3UOGA 3ITNA 2C04A 5G1OA 4B1FA 3OCJA 2WT4A 1COWD 3AN1A 3H1GA 3QOXA 5IBQA 1PLKA 1F20A 1IHYA 3HN2A 1L5NA 3ZS9A 5TR5A 2GSWA 2VYQA 2NVWA 1HDOA 4BCBA 3LFTA 4ANUA 4W5HA 3W9UA 3EXHB 4TKZA 2PJDA 3T6KA 4OFWA 3SQMA 2VYCA 2DJIA 4MYCA 1NQAO 1UMCA 2N7EA 4GDKA 3GJ5A 4KV2A 1UPAA 3BEDA 2W54A 1OT3A 1W5AA 3CLUC 3IAM6 3EC7A 5EIWA 4K0KB 3OZRA 4WK4B 5J58A 3OX1A 2BI7A 1CQIA 1H9CA 4NATA 2PDAA 3FLMA 1EFLA 3A6ZA 1RJ9A 2C95A 1XDWA 3FCCA 1PJCA 4J4TA 5B3JA 1CY2A 3U4IA 5LPNA 1GKYA 1W1IA 2P9FA 3AHGA 3ETLA 4UVDA 3SC2A 5K5EA 3W4KA 4Z60A 1I6LA 1RPNA 2A4KA 1NNLA 1Y8ZA 4BMZA 2KM1A 4IFIA 2M9MA 3AINA 2P69A 3HH8A 2EEZA 1VMKA 5J1SB 5AW9A 1AMNA 3IYLW 5CLQA 1EDEA 2R7MA 3KVOA 2IQ5A 1GNLA 1F2UA 4MROA 4R1MA 4ZZIA 5F1OA 3UKDA 3VI4B 1YRWA 2AG0A 2QKYA 1OJLA 1P2FA 2DFVA 2WDPA 4AX8A 4DBGA 1VFNA 2QRQA 5KWEA 5HBRA 4HDNB 4JB0A 4B43A 1XJQA 3S1LA 2XTJA 3N0WA 4HK2A 2B8JA 4Z99A 1MFPA 1QS0B 4U0JA 4AXBA 2CFUA 1CE8B 2Y93A 1FQJA 2P97A 2X22A 3P9QA 4OQ4A 3FOAA 2V3SA 5J2UB 1VD2A 2JAQA 2PRJA 3IQHX 3N5KA 1DEXA 3PLRA 3T5MA 4YTNB 2RHOA 2SCUA 1PGJA 4AC9A 1YZNA 3KXPA 3J7AC 2ICIA 1OXVA 5KHOC 4OB7A 3SYMA 1JMLA 3KLSX 1FX0B 1S6YA 2IXBA 3SZLA 1BQ4A 1DNPA 1YH3A 3SEAA 5D6JB 3NOBA 2CHGA 4KDIC 2WABA 3P26A 5F4ZA 4CLEA 1UAGA 2PRIA 1C4OA 2TS1A 4PYRA 3NR2A 1SEVA 4GQAA 4TTSA 1A5TA 1MH1A 1P2BA 2B4AA 3J80A 1I4PA 3HXMA 4L15A 4HYYA 2BG6A 2X3YA 2GF0A 3F4LA 4Y2JA 2A92A 2V59A 2HCTA 2P11A 5ENDA 5IWCA 1F6WA 1I3NA 1I7NA 4Q93A 3W5AA 3PENA 1NONA 2XJ9A 3I83A 2Y8BA 4EHLA 2AC4A 1RXEA 1R0BA 3E22A 3IUJA 4DAEA 2MYNA 4CMGA 5JRZA 3VHRA 3DOOA 2WWFA 2HREA 1G8KA 1GGFA 1VZ3A 2CJPA 2FKNA 2GDZA 2H5EA 3AK4A 3KFVA 4GKVA 3E56A 4L76A 1YQXA 4TWJA 4B7XA 5BRJA 1PJ2A 3OC6A 4GX2A 3GD7A 4M1WA 3WWZA 2CW5A 2JFQA 3B2GA 2VH5R 3C70A 4QT4A 4HXFB 3G8CA 4UOZA 5EVCA 2XMRA 5AUPB 2WYMA 3G9UA 4JX8A 2FNAA 2Q1UA 5LD2C 4NY0A 3E3MA 3HJRA 4EYEA 3ZNHB 5JQWA 2ZVNA 1W9HA 2I2AA 4DA4A 2W6CX 2CB0A 2GK7A 1FJ2A 5EYPB 2ATIA 3VVLA 4HZGA 2KTRA 2BTNA 3PUWA 1GCOA 3YASA 2O59A 2C5BA 2W6JD 3EUEA 5HE9A 4AAYA 2YFKA 1U99A 3GMTA 3MWDB 4R4JA 4JX9A 2WHGA 3D1JA 5EQFA 4ZT3A 2UWQA 2YX1A 1NW6A 2FHPA 4EQ6B 2ZRGA 1LEHA 1RC1A 3K1ZA 5C4IA 2KMCA 5D2MB 1DAKA 1PR0A 2X5KO 2Y0EA 3HB5X 2KWCA 3QKSB 5IJZA 1PGNA 4JQZA 4F8EA 1KJNA 4ZHQF 4D8XA 5K6AA 4F8CB 2KAJA 2R6ZA 4MMYB 3ZR9A 2BOVA 4HL2A 1MORA 2HK7A 3A10A 2VPQA 1L7BA 1WX7A 4IGAA 5ITZB 1LV7A 4B3JA 4I9FA 4BNVA 5C8YA 5E4FA 3ZIUA 5K0FA 2C8JA 4CUKA 1WSPA 3DKVA 4PPNA 1TTHA 4F85A 3WL8A 1TS4A 2B0CA 4MJSA 1IXZA 2GH1A 3N6VA 5EE9A 4EHIA 5HIJA 2P2YA 1F1JA 4HQ0A 3UH0A 1FB5A 4RK7A 3HIZA 5IAKA 2FCAA 4MX8A 1R9GA 1WXMA 1L6RA 4KGTA 5CX1B 2IT1A 2P5SA 3R7FA 1PWYE 3DPSA 4GOLD 2P78A 3LT4A 3GJ4A 4YTPB 2RHRA 4LQ4A 4LXHA 3VYTB 2QW0X 7ABPA 2PGAA 5AJZA 2Z5GA 3V97A 4GN1A 2DAPA 1YDFA 2JGDA 3C3PA 3R24A 5DEIA 4LQCA 4KYUA 2VWQA 3LYLA 3E05A 4AZ3B 3WDSA 1RMYA 1YRLA 2XITA 2ZR9A 2DZMA 3GEGA 4H4EA 4LMAA 4BEVA 4YV2A 3EG9A 4CM3A 4RZUA 3LKBA 3FKYA 1P75A 2MINA 4ASUA 2Q42A 5JFGA 1O4VA 3A28A 3ZK9A 5HFYA 1L5FA 3CT6A 3OFNA 4NULA 4AY5A 3GFOA 3TJPA 1SG0A 4PLGA 5K3FB 3RHFA 4Q1DA 2RGYA 4OXQA 4C4SA 1G8FA 3NH9A 1F9EA 3FDZA 1Z45A 2CEAA 2QPTA 4GOND 2P65A 4OY3A 1BMDA 1WXDA 2UV8A 4GVLA 4OM7A 3OLXA 4FDAA 4WNYA 2BG2A 2K8CA 1M8KA 2DZJA 1V5OA 1GCAA 3CMMA 4UOQA 2FMUA 3FYUB 1BJKA 1Z4JA 2WYOA 3FYTA 1CF2O 3CJQA 2Y4OA 3IPYA 3NCHA 3OQBA 4XB6B 5LLSA 3RO7A 3AEEB 3S5UA 2WAOA 1AF4A 1KZ9A 3HP7A 1M1XB 1YR6A 1W25A 1FW8A 2YXPX 2IW1A 1Y3BE 3WGQA 3K70C 1PGXA 1HDEA 2YJNA 4FZVA 4QDOA 3KL4A 3B5JA 1KIMA 3L6BA 2G5TA 1WHSA 2BI4A 4I99A 4RENA 1GKIA 1KIAA 2QLFA 3ZNID 1J23A 2HTHA 1K6MA 1SWWA 2A4MA 2DX7A 2XZDA 3OCWA 4FYVA 4FEYA 4GP6A 1W96A 2W8BA 3H1PA 1XQVA 3AULA 1POWA 4UJ5A 4ZQGA 4LYJA 3ROMA 1JQEA 2B78A 3ZOKA 4R8MA 1L7PA 4HNSA 1DCTA 1A4UA 1SGHA 2M56B 1SHZA 2DPGA 4MV7A 4D9EA 4F96A 2OECA 4X24A 5DPMA 2W37A 3CLRC 3OU7A 4CM4A 2IH2A 3Q6MA 1Z75A 1NC1A 1DE0A 1GAEO 2H48A 2IYAA 3HFJA 3UG6A 2XUFA 1H69A 1NIPA 1NUTA 4A23A 2HRRA 5GADl 2ZZIA 5D5QA 2E7ZA 3L93A 3W2GA 2TECE 1GPLA 1MAVA 1W5SA 3DAPA 4JFRA 2VJMB 1CQWA 2M32A 2VF4X 2VPYA 1I0LA 2OD2A 3VHQA 2OLEA 1FRRA 1A9PA 3D2LA 3VQTA 2W42A 3PL5A 3H8HA 4Z7RA 2XYHA 1B1ZA 1MEJA 3BWVA 3Q0EA 3E0QA 4PSUA 5EHGA 3BG5A 5I48A 4DCVA 1FW6A 1EEXB 1TE2A 3QHPA 5EXPA 1NQWA 1HE2A 4XWTA 1HQRD 4H7KA 1O77A 4Y7CA 3L8YA 1ESMA 2XX3A 4HNAB 4FW8A 4LWOA 4QPCA 2WU4A 1D6JA 2GYWA 4KXLA 4WFJA 2FSPA 2BGLA 1J09A 4RCYA 3WLPA 1YZLA 2Z9DA 2AFHB 4B2LA 2C61A 3ADCA 2WYIA 3DL2A 1HEYA 3Q14C 1KKLA 2HMSA 1V1PA 3P0EA 6GPBA 2IV2X 2C99A 4JUDX 4P4NA 1UPTA 1MO6A 4W9FA 1Z18A 2PKYX 3WGJA 3IAUA 3WNVA 4GCWA 4MVJI 2LZ6A 1BMTA 2ODWA 3P2OA 1P61B 4LSWA 4OQNA 3RJZA 1MB3A 4Q66C 3OLQA 1C0KA 3HCOA 3IQEA 5I4KA 2CNOA 1TQ8A 2ADOA 3U6BA 1QO0A 1UBCA 2LRWA 1N2ZA 3H1BA 3CF6R 2A9FA 5AUKA 2IUFA 1FVXA 4C0LA 2H07A 2VZ9A 4CN9A 5BPFA 2O8CB 3ZZMA 1KIFA 3RANA 1TGZB 4XDGA 5EVDA 4JWSC 5C46F 2I4RA 2WFAA 4IHJB 2C2WA 3E5NA 4NI5A 1UBFA 2YY6A 3HM2A 4DEXA 1OXMA 3ZCVA 1QE0A 1PJRA 3AKEA 3H86A 4JOBA 4UMEA 5DBIA 3SXPA 1BQEA 3K35A 5LUAA 2F8TA 1M2FA 1IZ8A 4UW9A 5EZQA 3B70A 3R3WA 3LTNC 3BAFA 4IKGA 3WQRA 1UELA 1QHNA 3A1WA 4B2YA 3BWDD 1QV7A 2I22A 4DC0A 2FWIA 3R7RA 3JVIA 5EHIA 2WXJA 2KQ7A 1KPHA 4Q7EA 8ATCA 1AG9A 3AF4A 2GPNA 3DMTC 3GOHA 1CR1A 1N9GB 1CQZA 2SNIE 5ACPA 3U80A 3ZI7A 4JU9A 3ND5A 3E1GA 4KE7A 1FF9A 1ML3A 3BGSA 3DVGY 4M0UA 4JIGA 2NU9B 3WBFA 1ODSA 4URFA 3PU6A 3ASUA 2B99A 3HB0A 5GZ6A 4UNSA 3EFHA 3R3XA 5TS2A 2A9KA 5ES3A 3BQMB 2R2GA 2XNKA 2L82A 3EE6A 1ZVMA 1O7JA 3L0YA 4MVCA 5EJ6A 5LWQA 3VXWA 2ZJ7A 1TZMA 4G2TA 4P53A 2K8BA 4KSKC 3DFZA 2HHCA 4B74A 3BQNB 1G8SA 2QX6A 3FCYA 3GA5A 4RPKA 3W9CB 4HDKA 4JEIA 5LYYA 3R74A 4QXQA 1Q7GA 5FPTA 1SBNE 1YCDA 2XSZD 3RS3A 2VT3A 4V0QA 4L0MA 4C56C 3BPSA 4RY9A 2JZZA 3DCGA 4KVFA 3T3IA 4HXDA 1OYVA 1KFYB 4GG1A 4K1XA 5JPDA 2EX0A 4CGYA 4LHEA 2YWCA 3O21A 3LS2A 3KXIA 3MVEA 1UMDA 1C7IA 3ELDA 4H2DA 4IHJA 3TTXA 1H3NA 4FZJA 2YXLA 3ZQ6A 5FI1B 4O4JA 3KCQA 3ZJYA 3V8BA 5L6MB 4W9NA 3LPAA 1QRUA 3OQIB 1R4NB 3RNAC 4TKNA 1WSAA 3WMRA 3ZZ1A 4C6TA 4EXSA 4RPLA 1IHXA 3AONB 5G41A 2FW8A 2D0PB 3DQZA 2R4TA 5K0SA 2J48A 2Q21A 1J7JA 3AHJA 1HTWA 3H05A 5EWJA 2KQUA 3U48A 4DW8A 1SU4A 4GYUA 4UUOA 1P1AA 1PSDA 4EUSA 5TQ2B 1K53A 4UUBA 5K0JA 3VZBA 3TSCA 3IAEA 5AP9A 1C1DA 4IFEA 3B48A 4ZVUA 5AVVA 2IXFA 2C5GA 3LKDA 2Q3EA 4FEAA 2HH9A 2NTJA 1QIHA 3JYLA 3N05A 4FILA 1TRKA 4HNAA 4KWTA 4RZSA 5BWLA 1XZ8A 1UJNA 3VTUA 1DAFA 2FMKA 4ZQHA 2YL2A 3QTTA 1GSIA 5H3HA 4MT5A 1NULA 1ZVJA 2JGLA 4N5DA 3QFRA 4RCVA 4C3ZA 1QQ6A 1US8A 5FR6A 2C3MA 4I1YA 4JJIA 3BRSA 2CFRA 3IVFA 1CR2A 4IDHA 3IQGX 2YJ5A 1GR0A 1WWKA 4JBNA 5B1YA 2JC3A 3GVHA 1K0FA 3LT1A 2JRCA 1IQUA 1S2IA 3HY4A 1GFWA 3PJRA 4PO8A 2XA2A 3NW9A 1HV8A 2GETA 1MX5A 5CUQA 2JU6X 3NV7A 1VMEA 3RUEA 2Z08A 3WVNA 2EZ4A 2XUDA 4R1OA 2AIRA 5BPHA 3TLGA 1UBLS 2O57A 4OHPA 2OBLA 4AJLA 2HLDD 1O4WA 1SZDA 1K8YB 1XMQB 3U3DA 2NUAA 4RH1A 3SE7A 3RLIA 2VN8A 2HSWA 4ZVTA 2Y2UA 5AKKA 1N2CE 1D04A 3PCRB 5LS3A 1DX9A 1GQ2A 3HDTA 4YMWA 4O2AF 3SF8A 1ZOSA 3HZHA 3DBHA 3ZJ4A 5IP5A 3T95A 4QARA 3H1FA 1N2CB 4RGYA 1BE0A 3PUHA 1GAQB 4RQUA 5COAA 3REOA 1L8XA 1VJGA 3JQ9C 3S4YA 1X94A 4NAHA 3X1KA 4TYTA 1U7XA 4LI0A 2GJ4A 3KQWA 2ZO4A 4GYJA 5CVUA 4PC2A 2ZWIA 5EP4A 1XX6A 2A0UA 3GVCA 3GUZA 3I2HA 4BVHA 4FN5A 1ZSVA 4WCFB 3D6TB 2YUTA 5EJ4A 5LXTA 1KOLA 1GTJ1 2AE1A 3ZDCA 3CN9A 1AUOA 1R0XA 3VDZA 1TTQB 1F48A 2JFYA 4LDTD 8ADHA 3GMDA 3K0KA 3FDZB 2CJFA 5SY9A 2VHWA 3RI3A 1BX0A 4KXMA 4D80A 1PR2A 5FTWA 3IJPA 3KQSA 4BKQA 1OXSC 2PO7A 5AW8A 3MTEA 1WUTA 4JASB 4C1BA 4OMCA 5C3JB 4ZWNA 3UAGA 5IN5A 2P9ZA 4HLUC 4JC8A 4PINA 4URWR 1D5WA 1MO5A 2PUVA 5K0ZA 2B61A 3T7DA 3PC8A 1B3BA 1E3JA 1SCBA 2WIBA 3GRFA 3ICVA 1ZIDA 4HXYA 5DXAA 2JGDB 2WHPB 4UTXA 5LB4A 4D74A 3EZFA 2KC1A 1T6ZA 3FVTA 3ZKJC 1WPQA 4UWOB 1MJGA 1JLLA 3K0BA 3L07A 1VSUA 2DT8A 2Q5JA 4L4UA 4QGAA 5I01A 2HRCA 1MW9X 5CX1A 1DBIA 3E6AA 4JI8B 2FSVC 5EJEA 3SX0A 4BFUA 3PXGA 4HUTA 3TI9A 5BSKA 2D11A 5HX7A 4U5XA 2C2OA 4MQLA 3OJ4B 1X74A 3ONVA 5EHQA 3VBEA 1FYVA 4DRZA 4PN3A 3LKVA 2XNDD 4MWBA 4ERNA 4LNKA 1E64A 4R2XA 1V39A 2PUWA 4TLBA 2EGUA 2NXAA 3GCZA 3LT2A 2G71A 3QOWA 3QFHA 1XRLA 2XY4A 3EVGA 4G67A 4HNHA 4PYIA 1JMVA 5F2OA 3ZQ4A 2EWMA 2P6NA 4YMHA 4QOSA 1D7AA 2VZLA 4DL9A 4KV7A 1K51A 1ISFA 2X4IA 4RH6A 2Z09A 3HEAA 5E1BA 4MPRA 3DO5A 2G9VA 3A7EA 3AP3A 4AK9A 5JATA 1OSNA 4EARA 2IYWA 1E2DA 4IXTA 3CA8A 1SCQA 3L0BA 1TW3A 2KC2A 3LB8C 3ZTDA 2QRKA 2KTRB 2YOFA 3GLHA 3GN1A 4DMUB 1AXRA 4XWOA 3BJZA 4NE7A 4GR9A 2A7MA 1Y5RA 2EERA 1W59A 4A0SA 2W2XA 4G0PA 3DLAA 2EJCA 1RRGA 1B4DA 4NCBA 3WAMA 3GAZA 1XZQA 3W5VA 1CXZA 3PJEA 2EATA 4N3NA 1J33A 5INTA 3MCWA 4E2YA 2CUTA 2J87A 1Y1TA 4IGIA 3KJHA 3N2GA 1ZVVA 4EM6A 3A6HA 3R5HA 5CBKA 3FROA 4WAAA 2E18A 4J0KA 5AFSA 3E22B 3T3DA 2C78A 4I3FA 2FKAA 1JZQA 3IMFA 3HUTA 3LY5A 3LX4A 4KUEA 1JDUA 1I36A 1ZEJA 2Q9CA 3A3KA 1KO4A 3GMSA 4NBVA 3UZUA 5HSGA 1X8GA 4OVKA 1B8UA 1K8RA 4F1SA 4RHFA 4YSYB 1IOZA 1LLUA 1Z62A 1GC6A 1E0ZA 3I4CA 4PZAA 2BONA 1Q7CA 4MQMA 4Z9BA 4AL4A 4E4TA 5KTSA 5BRNA 3TQHA 5TMBA 621PA 3AOGA 1DJPA 3REGA 1TAHA 5JS2A 3A7DA 3FFAA 4DV7B 3N0VA 4EYOA 4E5NA 1WZUA 2N42A 4HWGA 2NO6A 3C6QA 1AQ6A 3NT2A 4GI1A 4YQEA 3T4PA 3W1SC 3VOSA 3WB2A 3QLJA 4Q3DA 4B85A 2NBWB 5A03A 2Y77A 3ZBQA 1TKRA 4A3PA 3G2OA 3O90A 3WB9A 3ZC3A 2GEFA 5KTTA 4FX2A 1E2MA 1L7YA 2BR3A 3HWSA 4D9MA 1QS0A 2Q9AA 1U2EA 1XLTC 2DUMA 4ZYSA 1V25A 4XJXA 4WK0B 1Q50A 2V58A 1AHIA 2FN9A 2ONCA 3FTDA 3G5LA 1E9RA 1GG9A 1DJLA 2C00A 2B4QA 3VH4B 3FVRA 4NZZA 5D3MA 4XARA 5FH9A 5K09A 4D9IA 3RRJA 3NPAA 4EF4A 3TZ6A 4EDHA 5AVSA 4B34A 1CPYA 4DEYA 4D8YA 1CF4A 5JS7A 1SPBS 2BDEA 3V1LA 4ARIA 1PT8A 2NO1A 2P0AA 2V55B 4HGYA 2C9OA 1NFRA 3WLFA 5KOIA 2HZBA 1ZHOA 3PQ5A 4NQKE 1TMOA 1A27A 3AR7A 3EFUA 2E4WA 1QRAA 2BD0A 3H8SA 3IIKA 4JGHB 1DO0A 4FFPA 1OFTA 5CURA 1NQXA 1QCDA 1V1RB 5FI3A 2FE4A 1P5FA 3MS2A 1KTIA 1MQSA 1EXDA 4IWXA 1Q74A 2F17A 1EZ4A 4KRGA 4Y18A 5M2QA 1UF0A 1H8HA 1UH5A 1S8NA 4LZLA 4N65A 3UAOA 4FYPA 4RM5A 2XZLA 2Y5CA 1BIFA 2UVDA 1JEQB 1IVNA 1ZO8A 1UKYA 1E2HA 3RU9A 2CLOB 2P4HX 1E7MA 2JHAA 2YOGA 3A6GA 2EYUA 4OAPA 4EY5A 4RJTA 1UK6A 4I50B 1HMYA 5CNKA 1X8JA 3WY9A 1HRDA 5JCJD 1C5KA 1OC4A 4L3WA 1HNWB 3VUWA 1T8YA 3KPYA 4LCDE 4HEHA 3VYRB 2XRZA 2EIHA 2NGRA 3D6AA 3M70A 3QPDA 4TTPA 4A1OA 4BV8A 2O0MA 3VNVA 2W43A 1J0EA 1DBVO 3CX6A 2F4NA 2XE6A 3DMTA 3EXG1 5BYBA 4MGYE 2F8SA 4JHLA 3HR4A 3SQXA 2NUTA 3CJRA 2Y27A 2O19A 3BT7A 4MWSA 1E2JA 3I64A 3KZVA 2J85A 1N75A 2C5LA 1LXDA 2GN6A 3IVGA 4H7PA 2OZKA 3HCCA 2FIDA 4Y30A 1UC9A 2R7LA 2ATCA 1P91A 4LXGA 5I9NA 1IN7A 1W76A 4Z4EA 1P2SA 2JGRA 3GIDA 3P52A 2BDUA 2FZVA 4G3XA 3IMCA 1XQYA 1GYRA 4CQJA 4RMHA 2BBOA 3UJ6A 4IMPA 2IGBA 4ICIA 1L5YA 3AR2A 3WISA 3TFOA 2B7LA 3ZV3A 3BFJA 5FI0B 3KEMA 2AOVA 3UA4A 2JFXA 1M6HA 4NMLA 4AOFA 1BDJA 2GUWA 3K9LA 5DSZA 5FR1A 1I3MA 4BO0A 4C1DA 4BRWA 4D1WA 3EIHA 4ND4A 2H7XA 1CRPA 2PSFA 3RREA 4AWZA 2GZ3A 3C6ZA 2VKTA 4RETA 1UWVA 2OEPA 2GF2A 3VAZA 4DADA 3RPCA 5JAZA 3PHWB 4OREX 1QG6A 4AD9A 1M2XA 4UQOA 5HCIA 4PO3X 3ZLZA 2WAXA 1VMDA 4MVJE 4JC4A 2H2GA 4OX9B 4DIDA 1GGEA 1JTEA 3RFFA 4PONA 5KYXA 3VRAB 1TKBA 1D1SA 4L0CA 1KA9H 2JBWA 1NXPA 4KOEC 1QWOA 2BV3A 1QMPA 4LOJA 1FXUA 4HJGE 1R50A 1UEJA 2XDWA 5FHRA 5ACXA 1XBTA 4WBNF 3PPAA 2FRDA 1JR3A 4EKNB 4HDSA 5JW6A 5AUIA 2QVGA 4BNXA 2XMQA 2AX4A 2CG2A 2JCVA 4OEHA 1B26A 1X9HA 4U02A 3WGVA 2OHFA 1N2GA 5AKIA 1WRAA 4LY6A 1FCJA 3JRWA 2ZPAA 1JIIA 4YRTA 3E9SA 2BSXA 3H1AA 1CDDA 3K1TA 2ZXFA 3LL7A 5ALTA 2DFNA 4YP1A 3RS7A 1GUDA 1BCRB 3IFSA 4BQQA 1OH6A 1N5IA 3GD5A 2B7CA 4D4GA 2R5FA 3QXSA 2GO1A 3EDQA 4IIUA 1P5HA 2JFBA 1W30A 2AG8A 2JHCA 1ZIXA 3KUDB 1R4ZA 2KWUB 1T3LA 3KC2A 3LW7A