4XWTA

Crystal structure of rnase j complexed with ump
Total Genus 180
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
180
sequence length
543
structure length
543
Chain Sequence
APTLEVIPLGGMGEIGKNITVFRYGDEIVVVDGGLAFPKAHQMGIDLIVPRIDYLLEHQDKIKGWILTHGHEDHIGGLPYIFARLPRVPVYGLPLTLALVREKLSEFGLQDVDLREVTYGDEVRFGQSFVAEFFCMTHSIPDNAGYILKTPVGDVLHTGDFKIDPDVGTGAGIVSDLERVEQAGKDGVLLLISDSTNAERPGHTPSEAEIARNLEEIIKGCRGRVFLTTFASQVYRIQNILDLAHRQGRRVVMEGRSMIKYAQAAQATGHMNPPEPFLTSEEVGELQDQQVLFVCTGSQGQPMAVLGRLAFGTHAKIALRRGDTVILSSNPIPGNEDAVNLIVNRLYEIGVDVVYPPTYRVHASGHASQEELATILNLTRPKFFLPWHGEPRHQINHAKLAQTLPRPPKRTLIAKNGDIVNLGPDEFRVSGTVAAGAVYVDGLGVGDVNDDVLLDRVNLSQEGLLILTAVLHPTPHVEVVARGFARPNRDLELQIRRVALEAVEQGLREKKRLEDVRDDMYGAVRRFTRKATGRNPVLIPMIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DR2417
publication title Structural insights into catalysis and dimerization enhanced exonuclease activity of RNase J
pubmed doi rcsb
source organism Deinococcus radiodurans
molecule tags Rna binding protein
total genus 180
structure length 543
sequence length 543
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
A PF07521 RMMBL Zn-dependent metallo-hydrolase RNA specificity domain
A PF17770 RNase_J_C Ribonuclease J C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.580 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4xwtA03
3.40.50.10710 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Metallo-hydrolase/oxidoreductase 4xwtA02
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 4xwtA01
5EHTA 3I13A 4DIKA 4XWTA 4C1HA 2FHXA 2XF4A 4XUKA 2ZO4A 3T9MA 5HIQA 5ACQA 5FQAA 2GFKA 5HIPA 4Z6XA 1YCHA 4BP0A 4RL0A 2BFZA 3I11A 3IE2A 2Q42A 4RAWA 2YZ3A 4ZO3A 4C1FA 2OHHA 5EVKA 4J5HA 1MQOA 4UWRB 4F6ZA 4UWSB 1ZTCA 2BG8A 2YNVB 4YSBA 3IOGA 5LCFA 2AIOA 2GCUA 2QDSA 5ACRA 2FM6A 5AHOA 5EVDA 4LE6A 2CBNA 2HB9A 3IE1A 1SMLA 2YNUA 5A87A 4EYLA 2P4ZA 2WYMC 1WW1A 5K0WA 3IELA 1KO2A 4U4LA 5EVBA 5K4NA 2A7MA 3BV6A 2WHGA 2Y8BA 3AJ3A 4UBQA 1M2XA 1X8HA 3A4YA 2YNWA 5B3RA 5B15A 3VPEA 2M5CA 1KR3A 3WXCA 2BIBA 4RBSA 3X30A 4EYFA 3R2UA 4V0HA 5EV8A 4RM5A 5K4MA 4HL1A 4Z5YA 2P97A 2DKFA 1WUPA 2YNTA 3BK1A 3KL7A 5A0VA 3H3EA 2NZEA 4CHLA 2FU9A 3Q6VA 2GMNA 3ZNBA 3BK2A 1VMEA 5AEBA 3SRXA 3IE0A 5ACPA 4NQ2A 4RAMA 2GKLA 2I7XA 3MD7A 4Z7RA 5LM6A 4ZNBA 3ZR9A 3P2UA 5HH4A 2BTNA 4XWWA 4NQ6A 4HL2A 2QJSA 3IDZA 5AXRA 4P62A 3RKJA 2BG8B 4Z5ZA 2NZFA 2BMIA 1QH5A 3RKKA 4BZ3A 4FSBA 5ACWA 4UAMA 2R2DA 3KNSA 4WD6A 2BG2A 4B87A 5A0TA 4D1TA 2QEDA 3DHCA 3PY5A 3ESHA 1YCFA 4YSKA 3X2XA 1A7TA 1L9YA 5EWAA 2FU6A 4D1WA 1A8TA 3IEMA 4D1UA 4TZEA 2WYMA 4UWOB 4AX1B 5EW0A 3VQZA 3S0ZA 2Y8AA 2AZ4A 2OHJA 5A5ZA 4AD9A 2FU8A 2OHIA 5ACUA 1DDKA 1KO3A 1XM8A 4AWYB 2BG7A 5EH9A 1VJNA 1HLKA 1JJTA 2BFKA 2XR1A 4GCWA 1VGNA 3TP9A 2YNTB 4TZFA 1DD6A 2BR6A 2I7VA 2E7YA 2WRSA 5LMCA 1BMCA 4EXYA 3X2YA 1JJEA 5ACTA 2BGAA 4EFZA 2H6AA 1JT1A 5AXOA 2Q0IA 2DOOA 4FR7A 3BC2A 5ACSA 1QH3A 5LSCA 5AYAA 1BVTA 1ZKPA 4HKYA 2VW8A 3I0VA 3T3OA 3PG4A 2Y87A 2UYXA 5B1UA 5LS3A 4EYBA 5ACVA 3DHBA 1X8GA 4TZBA 3SPUA 2FU7A 4KEPA 4F6HA 3L6NA 1DXKA 2NYPA 4C09A 5FQBA 1BC2A 3PY6A 5LE1A 5LLDA 4D02A 2YCBA 3I15A 3SD9A 4FEKA 4TYFA 4AX0B 4J5FA 1X8IA 4C1CA 2WYLA 4D1VA 4NQ4A 4PVTA 3F9OA 4GYUA 3LVZA 3G1PA 4TYTA 4C1GA 2ZWRA 4UWPB 3ZWFA 1WUOA 5IQKA 2ZZIA 2I7TA 4KEQA 4PVOA 4C1EA 2Q9UA 5AHRA 4ZEJA 1XTOA 2M5DA 4YSLA 3ZQ4A 2GFJA 4EY2A 3JXPA 1ZNBA 2FK6A 5HH5A 4C1DA 5FQCA 3ADRA 4JO0A 4RL2A 3AF5A 3IEKA 2YNVA 4NQ5A 2QINA 5K4KA 1WRAA 4TZ9A 4EXSA 1P9EA 5ACXA 4DILA 4O98A 3DH8A 3I14A 2BFLA 3X2ZA 3T3NA 5KILA 2P1EA 5LCAA 3AF6A 5HH6A 4UA4A 3SBLA 5EV6A 4ZO2A 5LCHA 3KNRA 5HIOA 4GYQA 1E5DA 3FAIA 2ZNBA 1K07A 5DPXA 2NXAA 4Z67A 3RPCA 3SFPA 4H0DA 2BG6A 2QDTA 5HISA 3SW3A 2FHXB 5KIKA 3QH8A 3FCZA 4Z60A 2Q0JA 3DHAA 3IOFA 1YCGA 2BFZB 1Y44A 4AWZA 2BC2A 2P18A
chains in the Genus database with same CATH superfamily
1J8CA 3UXHA 3A05A 2Y3IA 5AJHA 3UF8A 1G8JA 4CL2A 5CRIA 5E6SB 4ZO3A 2IIQA 1SIBE 3DFIA 3P4PB 1V8ZA 3GQVA 2EL9A 1J8QA 3VDNB 4BLTA 3RJTA 4OSOA 3TD2A 2Y9PB 5BUQA 2OHFA 4DQDA 1WEKA 3TZLA 2YINC 4OGWA 4MHSA 3OPQA 5J1TB 2XOKA 5GM1A 1KYXA 3IHKA 3O1HB 2RAVA 1NVVQ 3SZUA 4BBNF 1GLVA 3H42B 4JT8A 3R9WA 4BP3A 2CE7A 3V60A 1L4HA 3A7EA 4IOKA 2PRSA 2ZWIA 2BRUA 3OM0A 1N75A 4KKJA 5LU8A 3EGRA 2O6VD 2KFKB 4CIAA 2GA9A 4K9RA 5IC6A 3PHXB 8OHMA 5J2TF 5LA6F 2ID7A 5BMVF 4X3PA 2B2NA 1P18A 4IZ6A 2QGFA 4JB0A 4DV3B 1VLZA 4HQLA 4X95A 5ALSA 3LRPA 2HPVA 1KSGA 3F47A 1FDOA 2P6UA 5EZYA 1FX0B 1PYDA 1CUUA 4J1NA 3NTRA 2F4NA 1BFKA 1DO0A 2R5WA 1YASA 3RYHA 2EV9A 1KK3A 1JS1X 1YB5A 4EZIA 3N6XA 4GKJB 2E5LB 4D2KA 2NTVA 3I5XA 2AW5A 3WQHA 3WMFA 1X7YB 3JSAA 3HDTA 3P2YA 1Z62A 1N57A 2GILA 4S17A 1O96B 3HFJA 5DE3A 3WC4A 4JJIA 3DEZA 1Y48E 1IPFA 3EF1A 3B6MA 3WGYA 1D3ZA 1W5FA 1E8MA 2VC2B 3ZX5A 1VJNA 3IHWA 1UZAA 2HQRA 5J40A 2R2QA 3H4TA 3KNZA 4Y2VA 1OH8A 2FNJB 2QW0X 1NA5A 2PS3A 2ZPTX 1HYBA 1YZHA 1T4CA 1K8ZB 3GL9A 5BMIA 4MKZA 4AQ7A 1D8AA 2O7VA 3HNOA 1MC1A 4AJPA 1JG3A 2IPNA 4YRBA 1NVBA 1VBFA 3MBKA 2V3CC 3WLHA 3AOEA 1FTQA 1XMVA 4QYIA 2VUIB 2JB9A 2XDQB 1GGJA 3IPLA 1GAXA 4EYBA 4MWDA 3IG3A 3UJ8A 4KHPB 3N8DA 2M0XA 2ONKA 2YXBA 2VZKD 4KX3A 1HUQA 3O1LA 4RABA 1EMDA 4KXXA 1AOXA 3IOEA 3K71B 5IKXA 4WL0A 5EP4A 4Q9JA 3RFFA 3ML9A 2VJCA 2XUOA 1JI0A 1P5ZB 2H7YA 1DBRA 1WXIA 4WURA 2POCA 4G5OA 4D9CA 1YX5B 5JTTA 1FCCC 4KXQA 3OC0A 1XRJA 3BZDB 1G7RA 4NPAA 1XKQA 4MA0A 3NEYA 4R3UC 4ZEJA 5E0OA 3EB9A 1GKLA 4TOIA 3BVMA 3QVSA 3B0AA 5B4VA 5JEDA 3WR5A 1C0PA 5AHKA 9MHTA 2YVKA 3U7DA 3S1SA 3AJAA 2FZLA 2GF2A 2QRVA 2O8FB 1P7VA 4QXOA 3LBAA 3X2ZA 3HRHA 2MYNA 3PUKA 1R8XA 3EOAI 5BT9A 1B3BA 1TS3A 4N41A 1KJ8A 1OBOA 1NM5A 1JHVA 1Z6YA 2PM8A 2VT2A 1C3JA 3H18A 2IH4A 1WOMA 1RRVA 2HJSA 5G2NA 1RMQA 2PV7A 3AEDB 3EDQA 1E7YA 4Z60A 2TMYA 1QLJA 4MLPA 4NOKA 2JGNA 5H59A 1P1HA 4KTTE 2ADMA 4UM8B 4QYSA 1KM7A 2VZEA 1KH3A 1ULTA 1NOJA 4DXHA 3C3CA 1MABB 1XU7A 1G2PA 2Q6KA 1QIEA 2WIAA 4UVIA 4R3WA 2QKYA 4BFRA 2GZ2A 1YQ3B 3NBKA 5DSZA 2B5VA 4LA4A 4UHKA 1MEEA 5H92C 4G0WA 2F1KA 3DWEX 5BMGA 3KE9A 1QGUA 2WXFA 3VH3B 3E48A 3P0RA 3IALA 3DCNA 3NHWA 1XXHB 1FD6A 2IKSA 2JFXA 4WASA 4QA9A 3VUXA 4GBJA 4IOIE 2WV9A 1J2TA 2C7RA 3PNMA 2WSSA 3C5CA 3DS8A 4CV1A 1QFYA 4EMUA 3GK3A 2P9FA 3RDPA 3BX1A 4N0DA 2YV4A 4TT3A 3JVZX 3UMCA 3R75A 3REQB 4C7OB 2WTUA 2ZSFA 3C1UA 3CKMA 2XQIA 5T4FA 3R74A 4HTAA 1Y37A 3O3NB 3C6BA 2WF7A 4FMBB 1KVUA 3RRMA 3NTQA 1EVZA 4YP9A 2HB6A 4GS5A 4ZJZA 2CZQA 1Q5WB 2FETA 3Q3GE 1YQEA 1WQ3A 4GM4A 4ZRQA 3OIWA 5AT1A 3NAMA 3AHEA 3G5TA 2ECQA 2I6GA 3HUUA 3INYA 2KVZA 4XTRA 2JVJA 2X3UA 1D5CA 4XD2A 2C98A 5TT1A 2BMIA 2ZWOA 1RAFA 1L0BA 4HB0A 1L5LA 2B6NA 3N3BC 4CLDA 4IJMA 4OSPA 4GMGA 1E94E 2WYHA 4GNRA 4RCZA 2O7RA 1U5BA 3ZY6A 4DSAA 3FPKA 2NP6A 1XE3A 4U2KA 1UBOS 3TNJA 3B52X 4RWZA 5ENZA 1MHTA 2B0JA 4TKVB 1YVDA 1X9HA 4N3CA 3BGIA 5KPJA 5K8VA 3MJ4A 4DNFA 2Y0BA 4BO3A 1XKLA 3O9MA 2H9YA 1I7PA 3PEUA 3LJ3A 1FNWA 3EMDA 4IIUA 5BYBA 1RMTA 1SHJA 4R6WA 2QG4A 4O4JB 4QQRA 1DZ3A 1R0CA 3AEXA 2Q3MA 4YCDA 4NBTA 3OOYA 5JFGA 5CB0A 1M66A 2WIDA 4K7SA 1NHWA 4KU4A 3COWA 5BSTA 3JD0A 4PRLA 3SLRA 1GPJA 3WWDA 4TYPA 1RJ9B 4IAOA 2Y0EA 3R2JA 3RK0A 2BV3A 4BEJA 4B0EA 1SURA 4ZO8A 1ULUA 3CWZA 4R3DA 4KRYA 1DFIA 4J5FA 4C07A 1WZCA 3KYDB 1CZUA 1QIMA 4KO8A 2JAWA 4GMVA 1UPUA 3E4DA 2NMVA 4EHFA 3G1UA 2FPRA 4WX2B 3NWBA 1VI2A 4D4JA 1ATIA 1RXUA 1HZZA 3NH6A 3KTAA 3THXA 4DSNA 2KO3A 3FCUB 5CLFA 5GOTA 1SVMA 2HD4A 5GTDA 2HA5A 4J90A 1JKJB 3JQBA 4TQUS 3A6DA 3UMSA 4E94A 3N2KB 2ANCA 1ESEA 4XOUA 3V3TA 5IMSA 3WB9A 5JI3E 1VG8A 1N6LA 1YHZA 3C4JA 2K7ZA 2VHUA 2O48X 4K7UA 4FTWA 1PTJC 1VTKA 2CHZA 1GJRA 2AEJA 1G7TA 4B79A 3W3ZB 2ZRGA 1N5XA 4JNKA 4MS1A 1BDBA 4ZPXA 2UZ3A 2LNDA 4QM7A 2GGSA 5TV2A 5AVTA 3DMFA 4JLSA 5BUCA 2H88B 1CQXA 1TAQA 4RNAA 1YIDA 3UXEA 3A8TA 4EUEA 3TIGA 3ND6A 3O75A 3QXHA 2EZ4A 4IIJA 2D1TA 3B89A 3KEMA 2ZYWX 4BE7B 1R6BX 4FP9A 2W9XA 5A5EA 4BQSA 3BRWA 4ANXA 2XVMA 2PS0A 3IUMA 4D3DA 2VT3A 1ZGGA 3HDQA 5D3MA 3RV4A 1F9EA 3OKPA 4QUIA 2BF4A 2QN2A 2AN1A 4JD5A 1W59A 4RVOA 1UBFA 2ZYSA 2EZ8A 1T1SA 1CUVA 3ROQA 2FN7A 4TQ9A 2Y1KA 4KE9A 3GDOA 4TXHA 1WQ1R 3CUTA 4IZHA 4CG0A 4H15A 1U0GA 2WD7B 4E5PA 4JJGA 4EB6A 4HVCA 1NATA 2GJKA 3QTLA 1GT6A 2ZB3A 5EXSA 5CIYA 5DU2A 1KSFX 2IU4A 4BMYA 2WQ6A 4DDHA 3LT4A 5I5GA 1GP2A 3M6XA 4R68A 4JI1B 2YXEA 4FC6A 2BIBA 1NYLA 4A10A 1NN3A 2CZCA 2VCYA 4GT1A 4NPCA 4IQFA 3ZCRA 3I4FA 3LV8A 1WB4A 3VQTA 1E18A 1YQUA 2V58A 1TIFA 2R7LA 4ANWA 2X0RA 2HWUA 2ZIVB 2ZM6B 2IZ5A 3S2EA 3BB4A 3IV6A 1ZICA 2GMNA 3PQ3A 5F98A 2LEKA 2LVQA 5JSHA 5CCBA 3GEGA 1ABEA 1EKXA 3CVVA 2Q07A 4GNKA 1C0KA 2BDTA 5IXYA 2EAUA 2FPGA 3CUSA 4HPPA 2W98A 1PG2A 1E1NA 2WYOA 5LDGA 5AJXA 3JD1A 5CNJA 2ISQA 1F77A 4JENA 4UAMA 2HEGA 4CCWA 4GOXA 4HJGE 3V6CB 2KI5A 1X86B 3Q6NA 3WSVA 3P63A 1SHZA 3C3WA 5KTYA 2ZRJA 5F33A 5DGXA 4G1VA 1WG8A 2H2GA 4ZMSA 2AX4A 2NUPA 3P26A 3T1HB 1NLMA 2OHXA 4U9HS 1HE8A 4MV4A 3JAWB 3H05A 1ZRMA 4DCMA 3VXWA 4A6DA 4C88A 3TD9A 1IOLA 5JYBA 2X0IA 1WA5A 1AM4D 2QTHA 4JFAA 2WD9A 4LNFA 2Z9CA 1Q5PA 2KC1A 1K5PA 4EARA 2PNFA 4I6NB 2GF9A 4KDIC 2J4DA 4C22A 5DI3A 3OZUA 3CIRB 4RS3A 3DNFA 3RM3A 4RKYA 4PGMA 2O2VA 5HQTA 4NVRA 3PHHA 2C4NA 2PKQP 4FHJA 3OIVA 4BO6A 5L40A 1QXSA 3FMIA 2H2DA 4CDRA 4RMGA 5CFNA 2AA3A 2DR0A 4C4RA 3BA6A 4NK5A 2PO5A 3MTIA 1SF0A 4LJLA 5WRFA 3CXRA 1DBVO 5BR8B 2X8AA 2F67A 4FYKA 3ZJVA 3AONB 1OXTA 4P3NA 1GYRA 3R20A 2FFRA 5FWYA 4EFKA 3O65B 3FTCA 4PN7A 3OTGA 4EEXA 3ABSB 4YFYA 2XHEA 4MCJA 3LE8A 4RNCA 3HL4A 5BV7A 4DGQA 3OFVA 2J0QA 3TE7A 3LFHA 2J9GA 2RMMA 4H1HA 4NYJQ 2JKZA 5IKEA 1ZN9A 2R1UA 4TLCA 1U2EA 1N2HA 3MOIA 4K6MA 2WFAA 1CJUC 2Y1WA 1PDVA 3KOZA 3OZ7A 4MDFA 3E7DA 4V0ME 1JU9A 4QEDA 1E5WA 3JATB 1E63A 3T06B 3JASA 4AJ9A 2ARKA 4QDKA 2D5BA 2WBLC 3F5FA 5BN3A 1YN3A 1CK1A 2O4CA 1QC5A 4LK3A 3VU3A 2ZIXB 3PUHA 5LVAA 1J0AA 2YW9A 3ZD8A 2II6A 2ID4A 1XIVA 1T9CA 1PZFA 3WNCA 1F4LA 2YYAA 5A1TA 2HOQA 4EI9A 1P73A 1YB6A 4B7XA 1XN4A 1ZGHA 3A1FA 1UCFA 2MJDA 3ZW8A 1H5NA 3GVCA 3VVBA 3GBPA 1XN1A 2FSIA 4M0CA 1H0KA 1XLNA 3L0PA 5JPIA 4D4HA 1KYZA 3JQGA 3ANSA 3GUZA 3FVWA 1NQTA 3FPCA 4DJEC 5JR3A 1GRCA 2WOJA 5FL7D 3DO8A 1ZJ6A 1L2NA 4ZRNA 2EELA 1E9DA 3EIHA 2KWCA 3PQDA 1YZTA 3WB2A 2ID9A 4G8DA 1P9NA 3X1JA 1C0EA 3U62A 1AGXA 1ENPA 1EF5A 4JYMA 1E1YA 5K99A 4CKCA 3QX7A 4OYHA 4EA9A 4Q34A 2J4CA 3HNRA 3MGBA 3TBKA 1TUEA 4YMUA 5JHHB 1IIBA 3ENVA 3OIGA 5SY6A 1VDZA 4L5JA 2DLCX 4C4YA 1GZ3A 5A04A 4CHTA 2PTLA 3TNFA 5K9ZA 3WWOA 4L85A 1B0ZA 5HIIA 1P9LA 2AG6A 2QM0A 4PAQA 3TLJA 3L7MA 2PKOA 3TQRA 3RZWC 1PG0A 4IUDS 2V6FA 3OM1A 4PE5B 5JD6A 3QNWA 5HKHA 1OJ7A 4PC3A 3Q8XB 4QG3A 2IDYA 1KS9A 1YOBA 1I4PA 3GFSA 4DR3B 3GNQA 5FXMA 4TVBA 3OD1A 2Z9DA 3ND7A 2RI0A 2R47A 5EQDA 4KIGA 1VIMA 4PTYA 1ISJA 1JDBC 1OV4A 4XIIA 2BTOA 4IJQA 5NLLA 2OG2A 2BFEB 1YQXA 3KZ1E 4AD9A 3V55A 3GVXA 1ZSYA 3IAXA 4BTLA 3GFFA 1H0RA 1B8NA 4IY1A 3VKVA 1TTHA 4X93A 4GICA 1NBOA 1EFPA 1HLKA 1JA1A 3GFOA 1R0KA 2IIPA 2PVCA 1FPQA 2PX3A 5JEEA 1O3YA 4MCAA 4QXRA 2A84A 3ZIAA 2Z57A 4UTRA 1FU8A 2LTAA 5K3EA 1M2GA 3AN1A 1BMCA 3V4PB 5LP6B 1SVWA 2C8JA 2A5LA 2REOA 1KH0A 5D3IB 2O7NA 1JQAA 4PU0A 2IDMA 2QTWB 3QX3A 4JWSC 4NYIR 1L5OA 1CRZA 4MQEB 4HK4A 1YA4A 3EA6A 4CKEB 4C05A 4LRXA 1ULBA 1UGJA 5BORA 4YT5A 4LRQA 4YK7A 2VW8A 2O0LA 3OA2A 4IEFB 4MRNA 5CW2A 3A1WA 3WLTA 3UK7A 4G36A 3UJCA 3I9OA 2JGJA 4P5PA 5CU7A 1EO6A 4F1WA 3C8HA 4GOND 3LO5A 4LGVA 2H2IA 1NBFC 3PREA 2MJEA 4W6ZA 1V1OA 2WHRA 2KJRA 3DL4A 4ZCRA 1R4MI 3RKUA 2F17A 3G1PA 4W9EA 5JH7B 4JZYA 3ZVMA 2RGDA 1Q19A 3KQVA 1DG3A 5KOJA 4ILKA 1JFSA 2QM7A 4OHRA 4GF5A 1SOMA 1WTCA 5ERGB 5L8VA 1JLLA 1G0OA 4IHQA 1V8OA 2YXNA 3HRDD 3TWOA 4L72A 3C24A 1V45E 5D3QA 3O1IC 3FWKA 2E5WA 2F00A 3I2YX 1Z0SA 1R5BA 2A5GA 3E8SA 2KN4A 4PX3A 3FMFA 2XA1A 3MUNA 2C88A 3M89A 5IT0A 4KSCA 2C3OA 2E1RA 1NXTA 2QT1A 2MQJA 3AF0A 3N8GA 1WPRA 1DBWA 4DMGA 1V11B 4A8JB 4GO1A 4MVJP 3W8DA 3AEUA 1JMYA 4HQRA 4BNWA 2CLFB 2KDMA 3UG7A 3AFOA 1Q91A 4WERA 4ZO2A 3G2JA 2RSUA 4EX6A 2VWHA 1F0YA 2PZAA 4Q4HB 3EEOA 2QN6A 4V02A 3RV3A 3NYRA 3DH0A 4JX1C 4YRJA 4C3UA 2I66A 3FGZA 4FNOA 5KVVA 4HNGA 2ZJ7A 3MVEA 3R5TA 4MITA 1ZWLA 3E82A 1FFCA 4QDZA 3H9QA 5EERA 1GU0A 1OXSC 2BPOA 5C23A 3QJGA 3WLAA 5J43A 3KVRA 3EGOA 3I6IA 3DUFB 2YFHA 3EIQA 3Q6MA 1XO1A 4Q7QA 3DPUA 4ACAA 2QV7A 3T7EA 3AR3A 1XELA 2N9LA 2VUUA 2Z3VA 1XQWA 4IOMA 3FTQA 4J6EA 6REQA 721PA 5ACRA 5BN5A 2QL6A 3EGIA 4CIWA 4M4SA 3MTQA 1DVRA 4AQDA 1FK8A 4PPNA 4Z86A 3PKJA 5FYQA 1F3OA 4B3JA 2WYMC 4P8RA 2XEXA 2WHXA 1OWLA 3ON5A 4DRXA 3AXCA 5H4GA 3C7DB 2IDKA 2EKLA 4GX1A 2PZLA 4YJ3B 3D2BA 4MLDA 3B6EA 3H4IA 3CRMA 3W6ZA 4G50A 2XK5A 1EFTA 4BAGA 4RTNA 3WDMA 2MBQA 4NZYA 5AQ1A 2X3YA 4C6HA 1TCUA 5ESDA 1I30A 4M87A 3Q8FA 4MPDA 4BNZA 2O3TA 7ABPA 2ZIWB 1JWSD 3K73O 4MW0A 1POWA 4DCJA 5MN4A 4ONEA 1XROA 4UPDA 2LGDA 1EUQA 4KYUA 3CUYA 1JXAA 4ECEA 4B80A 2BFCB 2ZYTX 3RNBC 2B5WA 3DR3A 2ECPA 3HFRA 1LRJA 2YHIB 3P2KA 3FVTA 4QOFA 4KN9S 2V0NA 1VL1A 3GCWA 4TQ1A 3PTFC 2IS4A 1K50A 1ZD2P 1SC3A 2QDXA 1Z6ZA 5C37A 2ECKA 2HK9A 4RTRA 3DCYA 4NICA 3ZWQA 1V71A 4CTNA 1J00A 2VDJA 4LKRA 4YCMA 2AN4A 1XLPA 3HWRA 1NG1A 3CNQS 2Y77A 1L9YA 4J1QA 3TFOA 3QAQA 4KCGA 2C7OA 1R6TA 3H7AA 4JK3A 1I13A 4I5FA 1Z07A 5BURA 1VYTA 3ABVB 3L07A 3QC8B 1J0EA 3G5MA 1MOQA 2ZE5A 4AWYB 4NYMQ 3VUFA 2JFWA 1W0JA 2QXYA 5EKSA 1FXAA 5C8ZA 1W36C 4Y1GA 4C08A 5EEHA 4JS0A 1UFOA 2QRPA 3OF2A 2E7YA 5AK4A 4DCGA 4EPXA 1SRRA 3AUXA 1G64A 4E1AA 4NULA 2YJ6A 3TEFA 1WX1A 2GRJA 4BLUA 1K7CA 1QH3A 3CS3A 5KTSA 5DLPA 1J7JA 2CT8A 4BRZA 3OJOA 3PFKA 1GQRA 1KYTA 1SZPA 3ENKA 4LV8B 5IUNC 1A5TA 4BFXA 4OAPA 4P7GA 4YRZA 1IXYA 1N1EA 2ZTHA 2FEPA 2FWJA 3PDIA 2B34A 3GLKA 1OXBB 2IH2A 1G20E 4M0LA 4MO2A 1SUIA 2DY1A 2WAMA 5IM4A 3ISJA 1COWA 4L57A 3QLJA 3FSGA 1TZMA 4ZP1A 3A9JA 4E33A 4UVDA 5CLIA 1ET6A 3R76A 3P2JA 2B8WA 5CMLA 121PA 4Q4AB 1L5MA 3OF3A 4NAUA 2ZAMA 3CLTC 2WKQA 3VPAA 3OKCA 4TKZA 1FVXA 4YJ2B 1NR1A 4EUHA 4PANA 3RBVA 1TU3A 4L16A 4Z7OB 1TEXA 3NHAA 1L5HB 3LQYA 4W7SA 5DZSA 2QZ9A 3B3JA 4PCUA 3STYA 1ECJA 2AMFA 3K7EA 2JRHA 3AETB 4JP1A 1LBHA 4PHCA 3F6CA 3GFGA 3SHWA 5AHWA 4N8DA 2Y8EA 4NJMA 4DWFA 4ML3A 1R10A 4ZODA 3QW4B 1RWWA 1SCJA 3LBHA 4BHTA 1RXEA 3VO8A 2F55A 2B7LA 3T0GA 4L8FA 1BKSB 2VLBA 5ETJA 1WMHA 4PG4A 2FHXB 2R86A 2IV2X 5HZMA 4HBZA 1FXWF 2H3HA 1WBBA 5FDFA 2HF8A 4KXWA 3DMPA 1ZL0A 2FWNA 1TE2A 3R3ZA 4N58A 5C3UA 4AURA 2PUWA 2IEDA 1ZLYA 4CM8B 4F8CB 4JIMA 2UZAA 1NW4A 2L52A 4GXRA 1C9DB 1MXHA 3MERA 2F1IA 1RWPA 1GSAA 1DQPA 3AINA 4DVGA 2DERA 2YTZA 3HHMA 2FM6A 3I63C 1JHDA 3UFXB 1ACLA 5EVDA 4E15A 1B76A 3UYKA 2J7PA 4FD2A 1Q0QA 4IFEA 4EVSA 1OGYA 2WB2A 4MH8A 4LV6A 3A6JA 2VRWA 3OVMA 4CHGA 3U6KA 5ED4A 1UM9A 5EPEA 1W7AA 4H77A 4YRDA 1KYQA 3JQEA 1RYEA 1MC4A 2WLBA 3L6RA 1V43A 2VSOA 4BAZA 3CIFA 4R2LA 3GOQA 1I4RA 2BRUC 1H2AS 3EBOA 4AG3A 4QUKA 3QTTA 2AOWA 2HU8A 3HRIA 1OSNA 2JFGA 4JI3B 2IO3B 3VUEA 2QD4A 2DLDA 5J5CA 2KFKA 4MARA 3EIWA 1IHYA 3LP6A 1ST3A 3S7TA 3VC7A 3QEBZ 2VPQA 3R8FA 4LXXA 3GAAA 2C7QA 5EC8A 1A9ZA 1WGRA 3LDGA 3MWJA 2WPDD 3HEMA 1FX0A 3CLSD 1L2TA 4BKTA 1P72A 4HP8A 3RSSA 1F12A 4FFDA 2XUHA 4GDFA 3L5OA 2OL4A 2VJKA 1CB0A 3PEWA 4ZGBA 1KR5A 3A1NA 2C03A 4LTMA 4KQ1A 4PVCA 2IRWA 4POOA 1PV4A 3JSXA 4CCYA 4XJSA 2H48A 3I73A 3IR6A 5F73A 1OWPA 1OEYA 2PKXA 5CHFA 3NVMB 1NQXA 3CU5A 2D5LA 4FSDA 5HXAA 1H85A 4X1YB 1Z56C 1MG8A 2QIOA 3P94A 4PS7A 4ZTUB 4GOOD 4XASA 1DC6A 2GTPA 3H87A 3P2EA 2CEAA 4TWAA 4GLFA 4MEMA 3WKAA 2IYQA 2HRDA 1N5MA 1XLUA 3D43A 3ZU2A 3IP6A 3BBLA 3W06A 3QIAA 1AG9A 5AJLA 3WS7A 1VIAA 4MVCA 4KH1A 2W6PA 5TIIA 3O6VA 3VNSA 4L8VA 5FOUA 4PZUA 2GWRA 3ZDRA 1R4AA 4MS4A 7MDHA 3RT9A 3QOWA 1B8VA 1ZEMA 2ST1A 1CJVC 1S2OA 4ZVOA 1CULC 4EJ0A 1L8OA 3ZWYA 4DKXA 1E90A 4II7A 1U81A 3D3WB 5JHGB 4UBOA 4J0GA 2XDQA 3C5VA 1ABBA 1QTQA 2Z8XA 3USES 3EEYA 3MWEB 5JANA 3QVJA 4IUBS 1VP3A 3TR6A 2YLMA 4WZZA 2A92A 5EPOA 1UDRA 4LLGM 3VH4A 1AK1A 1IWOA 5FB3A 1RAIA 3KHUA 4HZGA 4LTNA 4MSUA 4B9KA 3UQYS 2VRBA 4MH0R 4F11A 4B5KA 2F6RA 3VKFA 2VK8A 5JAPA 4GKBA 2P9BA 1WCXA 1QHHA 1DPFA 1E1QD 4BRSA 2R61A 1YB7A 3PFHA 3QHQA 1QHSA 3ONWA 1LB1B 1U6JA 3TTVA 5TQ0B 2YZ7A 4YAFA 2O8EA 2HIHA 1WF6A 4BWGA 3ZUNA 3L49A 5IDYA 3HR7A 2A0FA 3ORHA 1E1CB 1MV8A 4HUQA 3N8NA 4TT8A 3M3DA 2WWWA 3UINB 2BEJA 3QTBA 4MWSA 4Q1VA 2FMXA 4RDXA 5KYWA 2FWPA 1JTEA 3X2SA 3I6YA 2QYOA 4LDPA 3L9WA 2JHAA 3T5AA 3H0CA 2N9XA 3NFYA 4YI5A 1ZD8A 1ZXBA 3E18A 5IYZB 4TMWA 1NI5A 4J1SA 1MNAA 3DUWA 4ARAA 4N8EA 2A9VA 4MDKE 4EGSA 3OLYA 1GA4A 2YFKA 4P4NA 3WA0A 4QYTA 2CLIB 2J7QB 1KERA 1A9OA 2IUYA 5GONF 3WGOA 5EJ5A 1N32B 4O4LF 2XIQA 3WBKA 3GR6A 1XQXA 1RHKA 3HJAA 3DW1X 4AUQC 3AM1A 3LWNA 5MN5A 4V3CA 2P30A 3DO5A 2YNMC 1Y8RB 1TIBA 2BMFA 2BCGY 2R97A 3ETLA 2VF7A 5E1DA 1BMFA 2WDQB 1FUYB 3FYDA 3U48A 4OB6A 1CUDA 1FP4B 1XXHA 4GC9A 2NO1A 2X41A 3OZWA 3V7UA 4NOMA 3LUGA 5AKIA 1VJTA 1O6FA 5LR6A 2OCKA 2QD3A 1WF3A 3T7KA 3JZIA 4C0AC 2XKAA 3FUWA 4RHXA 3OQBA 2TMKA 1P5JA 3K2IA 3JW0X 1D2RA 1RRCA 4DR7B 1Q0TA 2EXXA 1ELOA 1CS0A 5J5AA 3OOWA 2P4QA 3RYIB 3SS8A 4NU6A 3NU1A 1L9XA 3ZE0B 3CZQA 5DJ5A 5EJAA 5D86A 1MC8A 5CLLA 4BGEA 2EWWA 3WBBA 5C7OO 4MW1A 4BNVA 4OF4A 3IRUA 2H17A 3R40A 2VRNA 3GMDA 2WMDA 3G0BA 2XUDA 3WALA 2QPOA 1SGWA 2XB6A 2LR0A 5GADl 3HBAA 2NX2A 3SKXA 4KAAA 4PYUA 4XPIA 4IGFA 4DDVA 1V1PB 1L7VC 4BECA 4XIYA 1BMDA 2FPIB 3EISA 3F46A 1KO3A 4N59A 3T3GA 4URVR 4TKVA 3DQQA 3ALBA 3EVGA 3PX7A 3M6AA 1T0JB 1MTOA 1A9SA 1WE7A 3OI7A 5L4LA 3FCEA 3PGA1 2OBYA 1G20B 2Q27A 2SKEA 5A3JA 3N2YA 4REMA 2WGSA 1I4EB 1RHUA 4D6YA 1RJDA 4FGLA 4QPNA 1DC7A 1SXPA 2PWBA 3PT5A 4KRXA 2I1LA 4GMHA 2PZFA 4ZU3A 1IXRC 4MGEA 2YR0A 4D9EA 1D2NA 2N7DA 1Z5VA 1X8GA 1F2TB 4RFVA 1A7UA 1YONA 3N3AC 4LRYA 4D8TA 5CR9A 2LUEA 3JZAA 1KO4A 3MD9A 2UAGA 4Z0NA 5IAAC 5EHGA 5DPMA 1A69A 4HGQA 2QRGA 3KBBA 4IIVA 2WICA 2WWTA 1LQUA 2BFWA 4MJ3A 4U2DA 3CB4A 4D0NA 2YDYA 3HN6A 4EVQA 5ILGA 1RQPA 2GXQA 5TF4A 2J45A 1PGAA 5JDIA 3GDHA 5FJJA 1Y63A 1APBA 4NEQA 4CMEA 2PD6A 2C9WB 2XKJE 4ALIA 4DUYB 1HZZC 3ZHVA 3QU4A 1WDMA 2ZSIA 1DMRA 4RACA 4TTIA 2E6KA 3ZGXA 1A2KC 2KWDA 3C70A 2XLCA 3WADA 2GNOA 3JQBC 4UMDA 2J30A 1WBDA 1X94A 4EB0A 2QT9A 3OH8A 1IN1A 1NW9B 1PIWA 3FYSA 1AIPA 2P1RA 4DIMA 4R1PA 4ZAXA 4F5EA 3U7EB 1QMGA 5K01A 2J32A 4PO8A 4A8PA 4EFLA 5K1ZA 2HJ9A 1H3FA 1M6VB 3NXKA 3BQMB 5G3YA 1A9RA 1FRVA 3K1ZA 4B7CA 5DPXA 5LNK1 2WAAA 1AK2A 1OJLA 1ZW7A 1UBEA 5HISA 3BCSA 3DMHA 2GZ1A 5FA6A 2N9KA 4ZV9A 4LX8A 2I71A 2F9FA 3N07A 2FI1A 1E0JA 2YZNA 2QVGA 4RY9A 2Y67A 1DBPA 3KQQA 4BP0A 4RL0A 4O0MA 5T7BA 2P6NA 3UHOA 5KNBH 4EHKA 3LH5A 5HKKD 2VUTA 4UDXX 3ELWA 3DBVO 4JSTA 5DRYA 4JQSA 5CA0A 2XVYA 1D03A 4YLGA 3L18A 4PYJA 2LUMA 2C5FA 4GMKA 2ATCA 5CGQB 5AHOA 3KP1A 1NF3A 2BAGA 4BLVA 3ITNA 1SMLA 2ONQA 4MPPA 4XVCA 4JJ7A 4U4LA 3GNLA 1OGJA 2ZE6A 1RU3A 2PFSA 2IXGA 4FHKA 4IQ8A 3W7AA 1F48A 1JA0A 2I6FA 2C2WA 2WD7A 4HX5A 3OE7D 4A0GA 4QVIA 1P1AA 4J2HA 2OD2A 4BWVA 3G2NA 3CWQA 1ECBA 3BS4A 5FNVF 2OBXA 4ZYNA 3ZNBA 3LVRE 4NCAA 3MB5A 2AR7A 4YRFA 2PJHA 4JP2A 2QZSA 3X1WA 2PMKA 4Q7JB 4MQLA 4K9QA 1W85B 3VYRB 3Q8MA 3OPMA 3EPHA 1KI7A 3EHDA 3KZKA 1ND6A 4WIPA 2ZE7A 3CVXA 1P75A 1W2HA 2OBNA 1L4UA 3R23A 2Z0DB 3QI7A 3RULA 3LC1O 3A11A 4ZD6A 3D5EA 3KJXA 1DEHA 4XYCA 4C6TB 1I6MA 3P9XA 3B2GA 2FP4B 4KLRA 2MH7A 5F9HA 5D87A 1JTVA 2C0QA 3BZWA 4X44A 5EIEA 3U3JA 1LLDA 4XLZA 2OXTA 3ZV6A 1RYFA 3N0WA 4LC1A 3A4NA 2OXCA 3GELA 3LI2A 4DLUA 4ZI7A 2JI7A 3IPCA 2EKZA 4B3MB 3PDJA 4OJKA 5HE9A 3PRMB 3CVWA 5EPUA 4PZYA 4Q9DA 1VYHA 2Q50A 3P0HA 3D6HA 4GVPA 4GX0A 4RO0A 1S2GA 4G01B 2BF7A 1WCV1 4PZ9A 2GPJA 2BEVA 2IX9A 1DIBA 4R7TA 3MRXA 3ZH9B 4NCBA 4RPJA 3D3KA 5EJ8A 3THWB 3OQ1A 2MYPA 2D06A 1DE0A 3ZNID 1JG2A 1H6BA 2QTCA 1WCWA 5REQA 1QQ5A 2DENB 4R98A 4Q02A 1ADYA 1SQGA 5F2KA 4HLUA 2ZIFA 4MAAA 3CLUC 3KJIA 3NRZA 1E3DA 2DTEA 2M17A 3MA0A 5BQOA 5M5BA 5FADA 3MYYA 4HDMB 5KPDA 3SZLA 3DMYA 3AECB 3WAOA 3HZRA 5HS6A 3KHSA 2QLTA 2B83A 4M1YA 5CM8B 1CY8A 2IHZA 4FDMA 2E3JA 1UD7A 1MB3A 3LCVB 4A27A 2G72A 4C1DA 2HLPA 3RU9A 3IXQA 3KLPX 3WL4A 4CI0B 3UK0A 3R3MA 1O5IA 1OYWA 1N7JA 1XAGA 4P3OA 4A0QA 3R24A 4YMGA 2X23A 2W6IA 3NWPA 5C8DA 4G97A 1QVZA 5HH6A 1C7JA 2R4TA 1V2HE 3VPFA 4EHDA 5KCZA 3TI9A 5I7WA 1NP6A 4D4IA 4JWTA 3OJEA 3PGJA 3I32A 2DM6A 1I42A 1LK7A 1NQUA 2HYDA 1B16A 1BMTA 1U1EA 3GCXA 4CMIA 4HYYA 3WRYA 1DAMA 4BQIA 1XD8A 4TWRA 3AE8B 2ZIXA 2NO9A 3I52A 2Q6OA 4EJSA 2V7XA 1QVWA 5FI5A 1JHUA 5CG1A 4LNKA 1ZP0B 5ADWA 3NDIA 2O1WA 2DVMA 5IVPA 2IS1A 2XB4A 5F77A 3I6ZA 1JJAA 1YE3A 1SMKA 2BYVE 2XRYA 2NPFA 3LKVA 1W9HA 3IJ5A 1DOYA 2IK8A 3DCGA 3FKYA 2PVPA 2OAP1 1QH0A 4NOJA 1YS1X 1LPMA 3UOGA 1MX5A 3G8CA 4FADA 2QROA 4KVFA 1CV2A 3CE6A 4BVKA 2RGRA 2VEDA 3KZCA 4HLQB 4BQPA 4I66A 2WJJA 4EY8A 1QP8A 1KO2A 3ABOB 1GYQA 4UNQA 3A1DA 3GF4A 4C5AA 1Z2MA 1QIDA 1GO2A 4I9UA 4RVDA 3PC8A 2EGGA 4HBGA 4AV7A 4LDRA 2ZJ4A 1JILA 3UCXA 3UIPB 5EFOA 3B9QA 1A8UA 3RT3B 3VNQA 3D6AA 1V9CA 3NHSA 1K8XB 3NZSA 2I87A 1YULA 4EDFA 3ONFA 2WM9B 3HPRA 2ZANA 1XNGA 4WJQA 3ZWDA 3COZA 1O1YA 1Q7EA 4DTIA 4GLBA 3KD3A 4H18A 5JMTA 1QE5A 5F7XA 4LYFA 3ED1A 2P91A 2RHTA 5ALDA 3EWSA 2NPIA 4YMIA 1P81A 1QYIA 1QOZA 1YMQA 5HJ5A 1BD3A 4L75A 1C9EA 2HHHB 3MJHA 4K9DA 4P3PA 2V4LA 3LDFA 2BJVA 8MHTA 2D1QA 2ZVDA 5KUTA 2AUNA 4E46A 1QGED 4F06A 1YRBA 4ENWA 1W30A 2JBHA 2G5TA 4HYQA 3X1XA 1IB0A 5FPHA 4IC7B 1WIAA 4PSVA 1M72A 1UJ6A 3A2LA 2IHJA 2CBXA 4RSGA 3K0AB 3NRJA 1TPYA 3VVMA 3QBTA 1YL6A 4N5HX 1T0IA 5KNDD 3MAJA 1LVGA 1CW2B 1SSNA 1JEJA 1CU1A 1PEAA 4PFSA 4P82A 4R2MA 5A4AA 3LVFO 1BROA 1VRWA 1OYYA 1AGRA 3UMFA 5FBQB 4D2IA 1W88A 1SG6A 4JNCA 2QTTA 4MYUA 3M70A 3P2OA 2FW1A 1XL0A 1IOWA 2XUJA 1ZKPA 2XOXA 2G3QB 3OTHA 4D7AA 1ILWA 3IC5A 2W8ZA 1I7QB 2C7MB 5HRCA 1E5QA 4CKEA 1U0BB 1TM3E 3B78A 2GVDC 1GITA 3LLUA 4C09A 4Y67A 1A8IA 2N1WA 1YRHA 2HDWA 2BFBB 3V3KA 1GRRA 1M5UA 4IV0A 4GUDA 5DT2A 4I99A 3I5MA 3Q87B 4UNSA 4FBGA 2ZAIA 2MHJA 1MPXA 1Q7BA 1J2JA 1HFEL 4LK0M 5BQ3A 2PWAA 3EHEA 4TMVA 4BFYA 1VIYA 2YWGA 3OTOB 1CFZA 2FR0A 4CM5A 5EUQB 4E1VA 5JH7A 1JHMA 2AF4C 4FYWA 3UJAA 2HJGA 1E7RA 4W6QA 2B1GA 4DWOA 3VKGA 4F4FA 2NZUG 2FPUA 1U2ZA 4LXUA 2XTJA 3O95A 3UGBB 2WG0A 1OIVA 3VTWA 1N2CE 1J33A 4XB1A 4LSGA 1I7LA 2GM4A 1G7CA 2QJFA 1Z2EA 2CMKA 4DLSA 4MOWA 4MYDA 4W9CA 5EE1A 3VAWA 2WQZA 1XWFA 1WVGA 4IDCA 3ROEA 1P2GA 4NNOA 4D92A 3TW6A 3OMWA 2EJVA 4A8JA 1AGNA 2LCFA 3OFSA 1Y6JA 4D0SA 3N70A 3TD6A 1P6UA 4AJ4A 4UVEA 5AXDA 3EF3A 5FUWA 1JQBA 4XR4A 2FUEA 4P16A 1ZXLA 1Q11A 3C4QA 3PPWA 4KGSA 4KSLC 1Q84A 2CDNA 3A2NA 1E7VA 3B9JA 2Q0JA 2W2PA 2QC8A 3EXFA 3PKIA 2H92A 3TE6A 1J06A 4UD6A 2AG1A 1ZOIA 3T6KA 4YONB 1O7JA 2W0MA 4MI9A 1R7SA 3T1OA 1QBKC 4PNEA 3E5RA 2FEAA 3I2GA 3DVNU 4QJIA 1EX9A 1FRRA 1VMDA 3R8CA 1BG6A 1WUKS 4H3SA 4PTZA 4I46A 4Z9AA 2NXWA 4MUEA 1BH6A 3WNZA 1DC8A 4C7VA 4AJYB 3IYLW 1RLJA 1JA9A 3DUFA 4ASWC 5L53A 4RZ2A 1TTTA 3OWEB 5HZHA 1WW1A 4L07A 3I01A 1D5XC 1KDVA 3DXZA 3Q88A 5ERXA 1GGMA 2DZIA 1FZQA 1I1OA 2J1LA 3QFTA 4U7PB 4W7HA 3O90A 2FJ0A 1NBAA 5E6RB 4JX9A 1V6SA 4DQKA 5C1BA 3TTTA 3HKDB 2P97A 3GD5A 4KQHA 4IO0A 2DYBA 4EZKA 1TLFA 2FV8A 1M1UA 3MILA 1OZHA 1K97A 2O1XA 1MR3F 3RASA 2IPOA 3C41J 2ZNVB 2V6BA 4Q4CA 1HA3A 1MDBA 4Z3DA 3A1TA 1GCAA 3EVBA 1MN6A 3L4KA 3A1VA 4IIDA 2VHJA 1C7RA 3S68A 2CC2A 3WRWA 3PHLA 5GQSA 1K8RA 1TZBA 1PTKA 2CSXA 3FSEA 1DGQA 2BFCA 4G3XB 3H3FA 2ZAOA 4WD6A 3LYHA 4UDNA 3D2AA 2EGHA 2DPHA 2A5FA 5CHVC 1F2RC 5G0UA 4MMZB 1NVEA 1TMKA 3VOAA 2GPNA 1A8TA 2FUKA 5F2EA 3CEHA 1X3SA 4HDQA 5BVHA 1RJEA 4CUJA 3L1IA 5GV7A 1GZSA 3VMFA 2QR3A 1PEKE 5JAZA 4QGFA 3LQ1A 5DLQC 1WEHA 4JYPA 1SQFA 5HTOA 4UE6A 3IDAA 3NAZA 5EJEA 2VDKB 4BY9E 2VZ8A 4MVJH 3E3NA 5B6IA 5ITVA 1N34B 1HT1E 1LC3A 5H68A 2YWFA 2P4HX 3STTA 1Z75A 5EA2A 1ZJZA 3MM4A 4CKBB 5E8RA 5CX4A 5A1JA 3PL1A 4B7AA 2OLKA 4YUAA 1A5AB 2X4DA 4GI1A 2PZKA 1PWXA 4MW5A 5LSCA 4B4OA 3GQBA 1UODA 2QK4A 1TJPB 3ISTA 4XSHA 4H1WA 3Q4GA 1QR2A 3O9VA 3C1OA 2HDNB 2P2CA 3DAPA 3NOOA 1BHSA 4MB6A 3UWPA 1P0QA 2WJ3A 2IHNA 5LE1A 1QQBA 1G38A 4JC0A 3E70C 2QTRA 1QO7A 1P9OA 1RM0A 3GVPA 1Y4SA 4DLTA 2VPIA 1E9VA 2JAPA 3LT0A 1Q1GA 5ES4B 2PMFA 1P9WA 1CCWA 1C1YB 1PJ8A 4LE0A 3FETA 3UHJA 4REQA 3FCAA 1U3FA 3NBQA 1JMLA 1V37A 3U3ZA 2WNMA 3H2SA 3THOA 1UKAA 2NUAB 2DBZA 3HVUA 4V2UA 3HJTA 4R2IA 4RTQA 1USKA 3TLGB 2Q7OE 1LF5A 1K6EA 5MHTA 3E22A 2HYIC 1NY6A 5K4GA 5A5FA 1IB6A 1R5JA 3C8ZA 1EGMB 1UZLA 4KQXA 2SECE 2BYEA 3KXKA 4AY3A 4MW6A 4B95A 4WZBE 4WY2A 3UA3A 3V4FA 2G1AA 2XMCA 4BN0A 1F17A 3DZ8A 2WXLA 1RZRD 4JBLA 4D6PA 1AARA 4K05A 5TGZA 2YWDA 4M7PA 4QUBA 3VDRA 2OBFA 3QE9Y 2A9OA 1MTZA 5G5HA 2V3NA 5JPDA 3R66C 1VLQA 2V7QA 1UIRA 2OLJA 4MZXA 1WX8A 2WWVD 4DUGD 1EYZA 3ZDXB 3IT2A 2CZGA 4RPLA 2PUFA 1T8YA 3RRJA 1Q74A 3R1IA 4I4TA 3DEIA 3ULKA 4WDQA 3FUTA 3PJGA 1HXHA 4NAWB 2HLDD 4RJ2A 3RTCA 3BM5A 2FHXA 3PWTA 3KU1A 1EM8B 4MVJG 3T99A 4X66B 1QP0A 4B3GA 2WJHA 4AJHA 5FUMA 2A9JA 2HCTA 5I7VA 4HO1X 5C80A 2Z9BA 3E9QA 5HE8A 2FPSA 5FI1B 3ZQJA 1P31A 5KC9A 3D1JA 4J7UA 3LHFA 3M0EA 4P83A 4C20A 4DDID 1AHPA 2VXOA 1OLOA 1U7ZA 1XEWY 4FZVA 2RI1A 3KXLA 4NCKA 2P65A 3TBFA 1V35A 2V74B 3L92A 2R68A 2DG2A 4HRXA 5TQ2B 3EBLA 1N2JA 4FLFA 4RA6B 2VEOA 1JE1A 1BEEA 2WDPA 3UATA 3JARB 2AD1A 1JCKB 2EW8A 4BNMA 3FZEA 2KJ6A 4FCVA 4UARA 1I33A 2YNTA 2OILA 2Q4TA 4D74A 3LY5A 1L7PA 3CO5A 4UUPA 1IK6A 4AF7A 1Z15A 3WNBA 1ZVQA 2O7SA 5KCMA 3NTVA 1EA5A 1WXSA 5A71A 2EKQA 1ML4A 1JHYA 1QTIA 2XMQA 4HROA 4CIVA 2X19A 4BO9A 1NXXA 1W46A 3RPFC 1UWCA 4Z9YA 1JDJA 3T9BA 5HZGA 4I1PA 2IGDA 3I2JA 5HNKA 3IOBA 3BA1A 3OLZA 1QAQA 1XD9A 1F4VA 4ZGWA 1G3IA 2JLAA 2D8AA 2AWTA 1ZA2A 3KPWA 5HGXA 2IH5A 2H65A 1J1UA 4UU8A 2J4FA 5DBFA 2DPLA 1Y1SA 5ALGA 1NC1A 3WGGA 4YV0A 4KBYA 1DHRA 2ZU6A 3L8FA 5ERYA 2IQIA 3V8EA 3WWEA 2L19A 2VAVA 1RYNA 1Y7HA 5IXSA 3T41A 1ZXXA 4JI5B 4W5HA 5AJVB 4WKNA 1JHZA 2NU7A 3ZIUA 5EWJB 1A9QA 3UAYA 1Q7CA 4BBAA 2AK2A 2C8VA 5EMJA 3RANA 1ZITA 1XRPA 2B4TO 4HWTA 4YAKA 2ZJ8A 3GVIA 2N46A 4Q03A 4X1YA 3EEBA 2HA3A 3ZWPA 5C51B 1DQYA 3L4BA 5JRJA 4V38A 5KHOA 4RVGA 1Z2AA 1PFKA 4EI7A 3H8VA 3TJRA 4ENSA 3AX6A 3N0TA 1P1RA 5KQMA 4LBWA 4RK1A 3G0HA 2H16A 3C6MA 3S29A 1IULA 2FEXA 1XRRA 5TVKA 5CFLA 1MVLA 4QKQA 4XIJA 2IYXA 4M3NA 1AURA 1NMZA 4Q1DA 4J7CA 5IC4A 1KDPA 2C1XA 3GE8C 4HXDA 4A2PA 2VQEB 5AJUA 1C3TA 2WYLA 4B2LA 2KMLA 2JGAA 3V1KA 3GGCA 4HXGA 3CF4A 3RVKA 3F98A 1TQDA 4G0ZA 1N2CB 4IX1A 1VIVA 1VZ6A 1NXQA 4X63A 1RT9A 5G0TA 1KJWA 4ZZIA 3MWFA 3GLGE 3M5PA 4FFOA 3RS2A 4HH0A 2EIXA 3P19A 3TFWA 2J3IA 3SE7A 3RC7A 2RDMA 1YVUA 1EVEA 1NJ8A 5BSRA 3STXA 2XODA 4BWYA 1FDVA 1MG4A 2B98A 4BLQA 4GVXA 4GRDA 1GGFA 2VAXA 3L7OA 1PR0A 3J9CA 5JCXA 1DIAA 4Y9UA 1OFFA 4LCJA 4DJDC 5TQ0A 1P0FA 2PD4A 3QJZA 3F67A 4EYGA 3JVDA 4EJ6A 2RCNA 1Z0AA 4JY7A 3R7AA 4CT5A 4JR1A 1P19A 4DLLA 1KFJB 3KSMA 2X8WA 2OQVA 1EA7A 3W6OA 4H0DA 4WKGA 1UMBB 1N2BA 3E9ZA 3TLEA 1REQB 1BIFA 1LSUA 1WS6A 2X6TA 4QPCA 2C29D 2CS4A 3RNAC 4GYWA 1HSOA 2CG2A 4AX4A 1IFXA 5I3ZA 1Y4ZA 1XQVA 2H4FA 4U7GA 3T54A 4EI8A 1WP9A 1O5OA 5T5QA 2EFEB 3P9CA 4UTXA 5BOVA 1P74A 2LZ0A 2QHOA 5GPBA 1FUEA 1H5QA 2J9ZB 2XQJA 3O0DA 2LWIA 5CXQA 4WXRA 3FI0A 2EZUA 1WXHA 3NFRA 1KDZA 2Q6VA 4WAFA 1RPJA 5K0WA 2QL9A 1N77A 2Z1NA 1N3IA 2FOXA 1XZ8A 2ROQA 2FSSA 2C2GA 3CC8A 4KGZA 2GBMA 3PEYA 1JFLA 3MT8A 5ADVA 5JLJA 4OL0A 4COOA 1JR6A 2B5OA 1WXMA 2FUCA 5G2OA 4ZCTA 2ZRBA 2ECFA 3CCFA 1K1EA 1I3CA 4DCTA 4IRUB 1GV1A 3FGOA 1JU3A 3RAJA 2INCC 3MTJA 3I0NA 4PIPA 2JDIA 4KI0A 1MX9A 5LZ5A 1PK9A 3JYNA 1BYUA 1YMUA 4USAA 2I22A 3V2UA 4NV3A 1ODSA 1WVIA 2YUTA 3H97A 2WM3A 2P75A 2OCXA 3LY8A 3C97A 4HWSA 3MD7A 2IO1B 2BW0A 2P0AA 4PG7A 1GSIA 2P9TA 4H6VA 3BXPA 4XWWA 1TVKB 2WQYB 5AM1A 4A0RA 4UBKA 1JHOA 4RMJA 2KDIA 4FIZA 3RYIA 4U2CA 1PYGA 3QU9A 1E79D 4B3XA 2GM9A 4L5IA 1ORVA 2ZREA 3U4GA 2H29A 3H9BA 1JW9D 2OZLB 2Q1YA 2C7VA 4AJJA 2R8YA 2FU6A 1KOFA 2XDAA 1YBFA 5K8JB 4EO9A 2VDMB 4TZEA 1XHEA 1CZLA 3ZGLA 1NR5A 4TV8A 2OHIA 2BS2B 3PD0A 3EDMA 4J6IA 2GAJA 2OB1A 1F2RI 1AXEA 1T9AA 3KEGA 2HF2A 5FTNA 2D00A 1U8UA 3TCAA 1K4MA 4FLHA 3LKBA 4FN4A 5DO9A 1P1KA 1J7KA 4FT2A 2B37A 2FPIA 3NXSA 3JQ9A 2IEYA 2O3SA 2WD8A 3HKCB 2LD4A 3MCWA 1I3OA 2RHCA 5JMPA 1X1RA 2BGAA 3ZV7A 5GGXA 5ACSA 2A0XA 3U13A 1GGKA 5CPBA 1FF9A 4MW2A 1KQFA 2JFZA 2EQAA 4N54A 4QDTA 1Y82A 4E30A 1LV8A 2DWUA 5LS3A 3UOAB 3D54D 4H7EA 2CHWA 4G0VA 2OA0A 1WQ4A 3SXUB 3RVLA 3ZEAA 5J2UA 2JZOA 2CBGA 5CA1B 4KIKB 1V8CA 2HSDA 2VHEA 3SC6A 5BR4A 1ZK4A 4AS1A 4HQKA 1QB8A 2I55A 4JB2A 1O97D 4CEHB 5BXYA 2QENA 3N0RA 4WZBB 3SVZA 1OWNA 3EIOA 1JPNA 2C3MA 2ZZIA 2QSDA 4DIOA 3SM3A 5CLQA 4IX9A 3KDSE 4CMEC 3CX8A 4KLNA 2CKHB 5E6SA 1RWMA 4H3VA 2VRRB 5LPNA 4EZLA 1OILA 3HHEA 3KW5B 2VDRB 3OE1A 3M82A 4TVSA 2Y1CA 4N9F4 5I7HA 2WXHA 4QULA 4KSBA 5HFJA 2QNRA 4OFXA 3CMCO 5EIFA 4PT5A 1IZ8A 1EX1A 1XZBA 4WPGA 3ZJ5A 5HRAA 4AUEA 1LRLA 3A32A 5LQMA 2BS3B 5KWVA 4AY5A 1OZGA 2A7QA 4JLWA 1LDGA 4U7DA 3EPKA 3NVDA 3LRXA 5DBGA 4GBMA 3HCFA 2QJOA 3IUEA 4EB3A 3OEWA 4JKYA 4QEZA 3LTNC 3CZ4A 3QFRA 1F0ZA 2OV6A 3O4GA 1SKUA 1GPLA 4LK2A 1GAWA 4AZSA 1U7TA 1Y44A 2ZPYA 5IBRA 1U2DA 1YDGA 2AK3A 3HVHA 4ITKA 3NIBA 4DA9A 3A4MA 3KPUA 3E58A 4QTZA 1ENYA 1KS2A 4QUAA 4OFWA 3KB6A 5AK5A 2V1UA 5NULA 4DIBA 5D1HA 3F5DA 3U31A 3VYSB 3K0BA 2Y1DA 1P2VA 4W9MC 4BGIA 3G5AA 1R74A 4D44A 4U02A 1Q2XA 2KC2A 1YQQA 3U7IA 1X7YA 5IZCA 4IGKA 4ARZB 3WG9A 5SV2A 1NI4B 1DRJA 1O96A 3FBWA 4R9UC 3K70D 3DHGC 4DM4A 1A2BA 2WJVA 3R41A 2PA0A 3ND9A 4U7JA 4F9FA 5ULLA 3A4SC 2X8JB 4ZYXA 3TFQA 2Z8ZA 3QEOA 2R1ZA 4M9RA 5F76A 3TZBA 4MQ5A 4HRVA 4C6SA 5DNAA 2HCJB 1D5WA 4EEZA 4ZHQF 3W2IA 4RSRA 2PX4A 2VHXA 3H6HA 4EUNA 3STVA 2PKCA 1L7AA 4O63O 3SK0A 2FHPA 3TR5A 2N42A 5BQXA 3AOEC 1X1QA 3ONDA 5HWSA 4NJ7A 4AECA 2BFAA 4HWOA 1Z5NA 5KSZA 1SUWA 1W85A 3VR6A 1Q50A 1NUPA 2YBEA 1CUYA 2GXSA 3LOUA 2HQ1A 4EKIA 3VFDA 2QP4A 3L6BA 1RWSA 1FTSA 3RRNA 1P3Y1 1NTOA 1NYTA 2Y05A 4B4DA 1H9AA 3PGLA 2E4XA 1M76A 1MQ8B 2BFOA 3EPRA 4LZWA 5EJGA 1VRCA 4OX9B 2PD3A 2XQKA 1JLMA 2WI8A 3ISVA 1KEEB 2C8KA 1PT7A 1RYMA 2OC4A 4TMAB 1E3JA 1E7SA 3DQZA 4PSUA 4J2OA 2XT6A 1R0RE 1GU1A 5G4KB 1A5BB 5DNWA 4O8ZA 1JB9A 5JSUA 5ACTA 1N5JA 4GI7A 2FEOA 1H3NA 3B9BA 2O8FA 3UQZA 5DPWA 4OQ4A 2H9AA 2FPKA 5AI9A 1U3DA 4S04A 1AS3A 4A55A 1NM5C 3MHPA 3UJ7A 5FORA 2NLOA 1D2HA 1ZOOA 3GLGB 1YZVA 3KJHA 2P3SA 3L0IB 5IK2A 1IBSA 4UPVA 4KX5A 3K0KA 3WKDA 4FFNA 4W1QA 3THWA 4A6QA 2GBRA 5DXFA 4OXYA 4Z99A 3GAFA 1VJ1A 4WSOA 3RUHA 3BMCB 4TN5A 4I55F 3BMOB 1QYVA 2CXQA 5CVDA 2Q3CA 4HLUC 5EJMA 4F4UA 2PLPA 2Q28A 3BAZA 3L0ZA 1E69A 5H8YE 3LB8C 2B2CA 2Y1XA 4C04A 3O7MA 4IDFA 4BE9A 1EFRA 1AQNA 1N3BA 4YLEA 4G23A 4KITB 1MABA 1ISGA 1HG0A 3QX1A 1ZWKA 5ALRA 5KNCA 1M8JA 4WUVA 4HDMA 2XDWA 4G4IA 2OO7A 4BUCA 3UMJA 5I3CA 2ZS8A 4F38A 1J23A 3BB1A 3BE4A 3VH3A 5IANA 3ES9A 3QELB 3W8EA 4M0KA 1KVSA 3AO0B 4W5TA 1AKYA 2CE2X 3PRYA 1XMJA 1H22A 2ATIA 2W2XA 4HMOA 1IY0A 3Q3FA 2Y76A 1NFFA 5IZ4A 1P5RA 4G5FA 4F5ZA 1Y42X 1WGGA 3OZCA 2JAUA 5C1OA 4I2VA 3ESBA 4XAQA 4D9BA 5FWDA 1VDVA 4L5AA 4O25A 1O08A 3PHCA 1SC6A 3REQA 3CA8A 4C7OA 1PF7E 2UV8A 4CL8A 3VI3B 4NE9A 4S0RA 2P9HA 5DK6A 4AO7A 3WRYC 1P6XA 2QW8A 4EJSC 4JSYA 5DN6D 5K05A 2BCJQ 2KHZA 2YMQA 1J19A 1ILEA 4MB2A 4B9AA 3GA0A 1HY3A 3OAAD 4Z6XA 2QN8A 3JQDA 2FZEA 4FBMA 2GDJA 5E1MA 2XMPA 1I32A 1JFFB 1G59A 1I4HA 4QARA 3DVAB 4WOBA 3TLKA 3H2GA 2EFDB 2BP7B 2QZPA 5J23A 3TRJA 1ROEA 5CVCA 4PC2A 1EP3B 3SR3A 1MAHA 2P40A 4JJFA 3G79A 5KVSA 5K3FB 3V7WA 4H17A 3KQTA 2J85A 1T0BA 1HYQA 4TMTA 4AKTA 1SY7A 3Q2KA 2PEYA 5AI4A 3FDJA 5FTJA 2QX6A 2YMLA 4FGWA 3HCCA 3EQ6A 2GH1A 2HHJA 4MUAA 4HFNA 3DKKA 2YOHA 1LGRA 1WZUA 4QOSA 1NRJB 1OFGA 3G2MA 4A20A 5CIQA 3PC8C 2OBMA 1SJHD 3AB8A 1Y6RA 1XZEA 5KJCA 3Q7IA 2RHDA 1XP5A 2PQMA 5JARA 2IA5A 1CQWA 1SKBA 4M7WA 2FRVA 3IQWA 2W8BB 1ZXIA 4EEWA 4O4JA 4G0YA 1P80A 4AXXA 5CX3A 1PR3A 1D6MA 2JZZA 2IDJA 4E5VA 2LJ5A 1HLDA 3S27A 3NBFA 1VKJA 5P21A 1LX6A 3AHHA 2GZHA 3N9IA 4TV9F 4TLLB 1NT4A 4UOEA 5G3ZA 1DT3A 1RJ9A 2BBCA 4W8GA 5FT9A 1TC1A 2W2TA 1Q15A 4UHEA 2VXCA 5AVZA 1R8JA 2D10A 1E6MA 3IIMA 5HPYB 4RXUA 4Q6BA 3MS4A 3ICQB 1LVHA 1J2UA 1LVUA 3KYDA 2FK8A 4G5SA 5B7QA 3K6KA 1D3AA 3JPWA 3RVQA 3MLEA 4CQMB 3PXBA 2DECA 2OBLA 3VYWA 3OP4A 3PIDA 1T6ZA 3S2IA 6AT1A 3RARA 4IM2A 5J4YA 4DA7A 3I9JA 4ZXFA 3QSYA 2GM3A 4P84A 1CS4C 5HF9A 1FNBA 1ZLXA 4MKXA 4OATA 3IIEA 1PJBA 3GDWA 5AM4A 3HH8A 1T5LA 1SXJE 1RADA 1JKJA 5FO0A 4ND4A 3N2KA 2AZXA 3DV9A 2PT7A 1GIAA 1JEDA 1E96A 1U0NA 1S2IA 2IF0A 5KWJA 1E9EA 3R0IA 2J0MA 2HNKA 1CR1A 5AYAA 2W4MA 2LXCA 3DF9A 1FE8A 3GFTA 1JWBB 4QPZA 4A0HA 4WCVA 4P7FA 4OLAA 3C0KA 3B36A 2B4YA 3VAAA 1D1SA 5KQRA 1QQ6A 1WYWB 1POXA 2C2MA 1L7EA 5KTTA 3TOVA 4OP2A 2Z5LA 1WR1A 2XCLA 3ANYB 1GQ2A 1R6UA 4GZ3A 4YQYA 2BTQB 1ZO8A 1Z25A 4ND5A 4QT4A 1RQNA 3VR9B 4CM7A 5MGNA 3GU3A 3M5WA 3PJDA 4GM0A 3LPDA 2H4ZA 4TZ0A 3KOUA 5EL0A 1NRWA 4E5UA 3M6FA 2GBJA 4Q3EA 3H5AA 3GV0A 2YC2C 4INJA 2FUG6 4ZMRA 1TZCA 4PVOA 3NIGB 4KACA 4KG7A 5I9IA 3QFCA 4J0DA 3ZHYA 2XY4A 4WK6A 1B2LA 3W8RA 4CN8A 4EFNA 1JMKC 4LPKA 3Q10A 1W4BA 1T6YA 1XCJA 3CN9A 3VSCA 1C3LA 5AW0A 4U6QA 2BEKA 2ZJ1A 4KMRA 2ON6A 1JU4A 1TZ1A 1JEOA 3IKJA 4FNGA 4X8MA 2FB9A 3Q7QA 1E92A 2H07A 3JY6A 2XJ9A 1PD0A 5A4IS 5GJCA 3NIFB 3KWFA 1WRBA 1HDEA 4H31A 2WT9A 2JLYA 1U9YA 1MAWA 5FHRA 2ORED 4YJKA 4CF7A 3ZN2A 4IHJB 4DM7A 1NJ2A 4HWKA 4MV9A 3SW3A 2QXTA 3GG9A 1M8GA 3SYLA 2RH9B 4RJIA 3PNOA 5I9NA 2ZUEA 4QU0A 5CJPA 3LP8A 4ENTA 2MSEB 2ODTX 1L4ZB 4JGIA 3BYTB 4ZQGA 4E12A 3F97A 2QV0A 4XUKA 1P77A 1TM5E 4FYPA 4IYJA 3AF2A 2V7UA 4MKFA 3O8QB 4K87A 1GN8A 2EQBA 1V86A 5EVKA 4RGBA 3NBYC 5ALOA 2AZMA 3SE0A 1PNRA 1QYDA 3T5PA 2D7DA 3D6UA 3ZNGC 4MUFA 1EG2A 2Z59B 3P9NA 1GB4A 2WTXA 3ZC3A 4PXSA 3VZSA 1BA3A 5DNVA 5F21A 5YASA 1VB5A 2DFTA 2K87A 3LYYA 4EG7A 1KH2A 4H3KB 3EZ2A 3UJDA 4RCOA 1JIKA 2LKDA 3JAWA 5L7YA 1BNCA 1KK2A 3CF6R 1F3LA 4YY3B 3FM9A 1ZE3D 1NE2A 3D7KA 2L05A 1WU8A 2X0KA 3WSWA 3L40A 2FDRA 2NSHA 2G9NA 1L7BA 3G8DA 5E6RA 4Y0VA 1JT9A 1OZFA 4EEKA 2HQOA 1NPTO 3LMKA 2G1PA 2I7XA 4CI9A 2XGOA 3PQ7A 4CIYA 4C9BA 3G2QA 1LO5D 3U7HB 5CNMA 1JAIA 3HCBA 3SZ3A 1Y81A 2J0SA 4LTDA 5LD2B 1F5SA 3HYRA 4C0KA 2A5DA 1ZOYB 3VR4A 4Y98A 5DX1A 5A7GA 2HL6A 3KT0A 1HNXB 2Y3AA 1AE1A 2QCZA 1Y5RA 3W0LB 4G3XA 1FFEA 1GPWB 2JFFA 3QF7A 3Q9LA 2VDWB 2W43A 1YTLA 2KYRA 1LLCA 4ARVA 3OE5A 1PV2A 1LBQA 5TLSA 2QX7A 1KQNA 1V5WA 5TC4A 1BZYA 2H31A 1YFZA 1ZUNB 5K3OA 5HZKA 4JMPA 4QUEA 3ENEA 3B3QA 3F7TA 5JNRA 1NF2A 1DKNA 1JEEA 4IJKA 2IYNA 1TS5A 2TSYB 2FN4A 4JQOA 3OU7A 4FM9A 3GJ4A 3V8QA 3QBDA 1QB7A 2N7EA 4FW9A 1YIAA 2X76A 3UCFA 3HUFA 2I4LA 1OZAA 3JATA 4NR0A 3U7ZA 5J18A 2PGNA 1RABA 4XCXA 3NC0C 3ZQUA 2IPAB 4R81A 1YL5A 1GR0A 1RI3A 4JLPA 3L6NA 4S2EA 1P3DA 1K9SA 3PQ4A 3H9GA 1QS0B 4LHEA 3DJYA 3PU6A 4D02A 2YCBA 3HGMA 2ODWA 3ML8A 1UK8A 3HJCA 1JJFA 1T6BX 4BZZA 2AEMA 1G8AA 4HL6A 1UZUA 3GEBA 3RQSA 1HSZA 1VA4A 1ZM7A 4IMIB 1QPBA 3EGEA 2P69A 1WUJS 3VR2A 1RNLA 2X0EA 1W4RA 1QQRA 1SXTA 5I6DA 2IC5A 2C54A 1X0VA 4TSFA 4B84A 1B23P 1H8EA 2QYTA 4BO5A 1HH4A 5H0IA 2WXIA 1ZMBA 5LQRA 3WIEA 3TIFA 1JDNA 1H4VB 1KMMA 2Y1EA 2W6QA 4P3XA 1OYVA 4UAGA 5IUJC 4BRWA 2KDBA 2QS9A 1AZWA 4X9XA 2CMFA 3OHMA 4MTCA 1BVHA 2JARA 4LRWA 3QQ8B 2MA9B 2A33A 5KWIA 4G8BA 1KTVA 4PX9A 3UOWA 5J4LA 1CZPA 4OA8A 3PENA 1FVOA 1ST2A 2WT8A 4HKZE 1Z18A 1C4XA 1O6CA 4C1HA 4KH0A 3S5JA 5IKMA 3ZJUA 4XWKA 2PGDA 4UREA 2PEZA 2CUNA 2ZVNA 3F9CA 1EK6A 4X60A 1N63A 4D1YA 3WRXA 4JX8A 2CL7X 1ZGZA 4RGYA 2YIMA 1U9JA 2E87A 1PJZA 1TMOA 5K8UA 2WJYA 4Z1MA 3RS4A 1OT3A 2PNJA 3M62B 2YMPA 5AW3A 1EM8A 4QT0A 4OJMX 5H4HA 2FWAA 2OQRA 1NVMB 2YEPB 5BMOA 3STHA 1I4LD 3WOHA 2BDUA 4ERXA 5C1IA 1T0YA 4XX5A 4L5YA 3NUHB 2E3TA 2HO5A 3NWJA 3VTKA 2BFEA 4WN3A 4WOPA 4K3VA 1CERA 5JPCA 4CCSA 3DFZA 1OF1A 2P9GA 2AR9A 4UPEA 4C4XA 1R12A 2OCIA 3Q8WA 3BYYB 2YV2A 3GJRA 2VTEA 3JARA 4NNJB 3BK7A 4DDKA 5TRTA 1NHGA 3UC5A 3E9CA 5LP6A 4HY3A 1H1DA 5EIXA 1T2EA 4DLPA 3QXCA 3TQTA 4AB1A 2PZGA 5DX8A 3BT7A 4YXFA 2FLVA 1OR8A 5H5JA 2WMYA 4EUSA 3HXQA 4XQGA 4GSLA 3OM9A 3TUZC 4MQEA 1PR1A 2JJ1A 3AEGB 2RGCA 1HE3A 1ZMXA 3L7LA 4LYGA 4OHUA 2JJ8A 3E9EA 3FJOA 3IUQA 5ICFA 1GR1A 3CT6A 4GOCA 4F4IA 4JVNA 4M8IA 2I1KA 1FBNA 1AXRA 4DHZE 1X7XB 2AKAB 4I4IA 1TKRA 3GJ3A 3MMSA 1Q3KA 5EWAA 1BX0A 3P42A 4EPWA 1SXJB 1UJMA 3M6UA 2ZUDA 1KPHA 4HPMB 4N18A 3VVLA 2VK2A 1X7HA 3M2PA 1JR2A 3WLLA 4UQLA 4RJTA 1U28A 4WK0B 3LW8A 4BNKA 4MVYA 2ZBUA 4A16A 1XTTA 3LOPA 4BNNA 2D8MA 1GTSA 2GCEA 1JDSA 1SVIA 4ZFNA 3RC9A 2X5NA 3WLFA 3D64A 3C45A 1M0WA 3TL5A 4BVLA 2HNAA 2J52A 5LMNB 2ZT5A 1XP8A 2EF0A 4LJRA 5CBPB 4Q7KA 3DL0A 2FLWA 3JQ7B 1JEAA 1YJXA 1MVKA 3G5UA 5EWJA 5IG2A 1YJ5A 4WVLA 1H2EA 4TKLA 2PIDA 5KHOC 1YJIA 4F4JA 2BDEA 3TVYA 1V11A 1MP0A 4HQNA 3PG4A 3D81A 3JCZA 1CD5A 5AKKA 4EA8A 4NPHA 4AP6A 2NXJA 1SXHA 1Z7EA 4MV6A 1E1LA 4PGAA 2BT4A 3OLXA 5B53A 4Q4HA 3NHYA 2KXJA 4IGEA 3IPYA 3B1FA 5EKXA 1R15A 4Q4LA 2GAOA 4M86A 2JRCA 5LWHA 4DCNA 1RC1A 3E2IA 3W9SA 5LOVF 2W6ZA 2J67A 2HA4A 3W34A 4H7DA 4ZQHA 3UAXA 2J31A 1L4GA 1VHLA 5HF6A 5EP2A 4BKUA 1N2CA 4AP5A 2GFJA 4MAMA 3BEOA 2QRKA 4CQLB 2ODBA 2ZW0A 4PTLA 3W4JA 2ZVPX 1B93A 4MDEA 4JAVC 2V96A 1G5PA 1ZYUA 5LXIB 2JCBA 3LJKA 1XEAA 2R4UA 2ACEA 3NATA 3ORSA 1UBSB 2Q6LA 4DPLA 4FMPA 4AZVA 3GP7A 3L1VA 5FF9A 2I6QA 2NU8B 1RKVA 3L02A 1QZTA 5MFZA 2ZXEA 1XBTA 3SKVA 2JFVA 2GJAA 4YJ3A 3GZJA 1YS2X 5KNDH 1ZD5A 3I9V1 1CHNA 4ZRDA 1P45A 2O14A 1SQ0A 4S1OA 1FX1A 1NVDA 3LUJA 1RXCA 2AL3A 3WMXA 4QG7A 5T57A 3KWVA 1T25A 3X2EA 1C80A 1ZMOA 4NJCA 1VE7A 2JXTA 3UMVA 4RQAA 1CJBA 5K3CA 3KWMA 2SEBD 4TZKA 2NT4A 4LRTB 4MUJA 7REQB 1OVMA 1UMBA 4BQNA 4ZYUA 4ZGGA 1REQA 4N9QA 4E74A 2WXRA 5AK3A 4RZSA 3AB7A 2HJHA 2YHIA 5F9MA 2L18A 3U4QB 4FE4A 3DVGY 3KLMX 4P5EA 5BO5A 5FUQA 4HGRA 1WNFA 3SJ7A 1CUWA 4A0FA 1HBJA 5T3YA 2Z4SA 2ZZMA 5GZ6A 5G5GA 1EK0A 4G65A 3UJ6A 3WTCA 1LTQA 4OUDB 3FCYA 5LQUA 1FJ2A 3UBTA 4JBNA 4QOGA 1W5SA 3Q3VA 4YROA 4CIBA 3QK7A 3DBRB 2H1IA 4HAWA 4MR8B 1VZ7A 2QGZA 3R2UA 1OX6A 2CJWB 2GK3A 5KMGB 4ZOBA 2JGFA 2P5SA 3QKRB 2IY8A 1VSTA 5H16A 4CHLA 2DRIA 2FYTA 2IELA 4DTCA 1E8DA 1N92A 3CRVA 1H65A 4ENQA 3BDIA 4MM3B 3RWMB 1CR4A 2GKLA 2REXB 3HB4X 2QRQA 3P2UA 1XDBA 1H94A 3MFGA 3VU9B 3S44A 5CK4A 5AYVA 5JJLA 1PLKA 2JCYA 3AF1A 2OYSA 3V8BA 1ADCA 3PICA 1LZLA 3VYVA 2QGNA 3BPSA 1F20A 3MIZA 2A86A 1WPQA 2XA2A 3H9UA 1UPTA 4D46A 4A6PA 3EA5A 1DRUA 3GRUA 3K9HA 1SC1A 2YFQA 3DHIC 4BNTA 3OLMD 3OEYA 3EX7C 1QKJA 1HKUA 2C7BA 5JRZA 5FR2A 2H11A 1X42A 2OYCA 3COYA 3FTNA 1FMLA 5IN5A 2YBDA 3L6UA 4RD0A 2P7HA 1WLSA 2VA9A 4MJLA 4V0MA 5D6OA 2AC7A 4C7JA 4IQ0A 4Q4AA 1DOAA 5J4VA 1KSHA 1SGHA 4BGVA 3SSNA 3PEVA 1U0HC 4YJ2A 1XHLA 2JIMA 4KN8A 4JI0B 3FRJA 1HTWA 4QHYA 4UEJA 2WS3B 3JQ9C 2O8BB 2OAEA 4B5LA 4HJKA 4WCFB 1L5HA 3W5SA 1K3FA 3GG2A 1DP4A 4CDGA 4EKDA 3N7UA 1W4ZA 4Z0PA 4I14A 5AWFC 5DGCA 3AETA 3BQ9A 4R5MA 4RHYA 4EMBA 1AJEA 3RJMA 2YRWA 4KODA 1I14A 3NCTA 5SZJA 1T5OA 1SQ6A 1PAUA 3G2KA 3K0HA 3P4QB 2B69A 2FFBA 3I15A 5HRUA 4K2HA 1X39A 1QH9A 4L4UA 1JHXA 1KEVA 5EXPA 4K40A 3UWSA 2WWYA 2C59A 2QQFA 1I4GA 3LPCA 3HM3A 4OFBA 2OP1A 4KR7A 5CA1A 4KIKA 2PZBA 4JXJA 4JYZA 1XUOA 4NC9A 1PW7A 3AVWA 1Q95A 1FUIA 2W3RA 2DQZA 3DOCA 2OT3B 2AOVA 5JS1A 3IUJA 2JJQA 1VE1A 2ZG6A 4CM8A 2CFRA 2PE6B 4CEHA 1VYUA 3AU5A 3ECAA 3E3LA 5D84A 2HV8A 2FEMA 4ZDJA 4BOYA 3TGWA 4FB4A 2P2SA 4B3CA 3FBGA 2LUOA 3VC3A 3WNVA 1R9GA 5BSKA 1IWBB 5JAIA 4RMHA 3LY9A 1NBHA 3QYFA 1IBXB 3SLKA 3UFXA 1U02A 3BXEA 1Y3BE 1YMHE 4YASA 2WJGA 4O2BF 2WUWE 1EWKA 2BH9A 3N74A 4XWOA 2AN3A 5DHTA 2JBAB 1DXOA 3B70A 4ZTBA 3K6RA 4R1NA 4YMWA 1A5RA 1GG9A 5C7LO 1PFDA 3QE4A 1S2DA 1KOLA 2A6PA 2GBKA 1IUPA 2P2LA 4JXXA 1OD6A 1Z4QA 4NCIA 3V97A 1CQIB 1Z4NA 2I6SA 1IPEA 2YJ3A 3WISA 5BWOA 2O06A 1U2DC 4TWIA 4URFA 1K4YA 4Q9NA 5EWMB 3AEBB 4XEUA 3MD0A 5BSHA 1AKVA 4XJXA 5AW6A 1VR9A 5T3UA 4UDUC 4DEYA 1ODKA 1D2MA 3L1UA 3PRHA 4IJWA 2NBVB 1KAQA 4YCLA 4P36A 1FEHA 3QIVA 4DBLC 4G4JA 4DA6A 4QECA 3ITKA 1C4KA 5DTMA 5IU6A 2XQGA 3NHEB 1LWNA 4BX9A 1O6BA 4P7KA 1WSDA 4Y2QA 1F6BA 2ZRHA 1SU6A 4DR1B 3PRPB 1FNVA 4ZJPA 3AFIA 4LHSA 3FNEA 3K0EA 2C2OA 4KZPA 5IZCC 3AI7A 2W48A 3DKVA 4QUGA 1CUFA 5CEEA 3AJ8A 5F64A 4FLEA 3WXMA 1V8PA 2JHGA 4RM5A 2CXPA 1ZIPA 3FOEC 4ESOA 4BAXA 3W3AD 3DTNA 3KLSX 2V3WA 4PVDA 4DHZB 4MICA 5C32A 1ZH4A 3M5CA 3FWPA 4TM8A 4WJPA 4R9NA 1FNUA 5EE5B 4BKSA 2FGJA 3N30A 1QFXA 1J21A 1Z2OX 3R5HA 1TUGA 4N82A 2ZI9A 4ZRIA 1SEPA 3HBNA 1N8KA 4LJYA 1IUEA 1V2YA 3L01A 2YRXA 2IXAA 4KQGA 1D04A 4PIVA 3PCTA 3KYJB 3HV0A 3CNHA 2RGEA 4MUYA 1Q7GA 4MKIA 3D3WA 1H69A 1C7ZA 5IEBA 1QR6A 5BYSA 1P5FA 2VJMB 4N1AA 3MWEA 4D9MA 1TLLA 5EVJA 3H5IA 4OIFA 4XGKA 3KL4A 2QVYX 1T5HX 4XI9A 1B6GA 4EKNB 4FYVA 2FR8A 1TIKA 2R11A 5C53B 3WAKA 4G4SO 1TMYA 3OJ0A 2XIJA 1DD6A 4OQPA 2R8RA 2X5XA 5JT1A 3WGHA 2GVZC 1UWMA 3A9CA 5CT8A 2XEDA 1KEEA 3S4YA 3ZQKA 3WFIA 1T1IA 4O4IF 5EIWA 1GV0A 3VR3D 3LFUA 1J25A 2XRMA 3TRDA 2FEKA 4E5SA 4LISA 3RS0A 1TVCA 1VLJA 5AD1A 1Y3FE 1TY2A 1LPOA 4B0MA 3HYNA 1WB9A 3RFTA 1KKUA 4J9VA 3LS2A 1E1CA 2VDLB 2WHPB 2H1FA 3RSHA 2ZAYA 5BVGB 2IYEA 2AVNA 5DSXA 1SUEA 4M1KA 1RYBA 1SIUA 4KR6A 1WV0A 2VA8A 4TM7A 2OCYC 3V42A 3H9DA 2KNBA 1IG3A 4HAVA 1OC4A 5IYZA 4MI1A 1SELA 5J47A 1UL1X 2ZWRA 4EY6A 3WHKA 4KQKA 4HZUB 2UUCB 4Z8XA 3L8DA 1NXSA 1EX7A 3BMCA 4P3YA 1JYEA 3H1AA 1VCIA 5FOQA 2WYWA 4CMKA 4P3KA 5AXCA 1M7HA 4EHIA 2PKRA 3U37A 3JRXA 3FMVA 5KJEA 2X4IA 4K26A 4DNQA 4FYMA 1KYVA 3DTVB 3CX3A 2EEZA 1G19A 1RWKA 2WU5B 1U6KA 2HJ8A 5BSGA 3FPJA 2RCYA 1Y8RA 4AUMA 4BQEA 3WK7A 2VQFB 3IVFA 4F56A 3SBEA 2EYQA 4AN1A 1Z29A 2QTBA 1NMSA 4UBIA 3BXXA 2QI9C 1FP4A 3VRAB 1Q17A 2P1DA 3KK0A 4DARA 2ZNBA 4FYXA 1BVYF 1E9CA 3EG9B 2I34A 1DKOA 2LV8A 2ZLBA 3C14C 2UXCB 2Q9BA 3PDWA 1M6WA 3SMVA 3B1WA 1BMLC 1QRRA 3NOBA 1HO3A 1Z22A 4UBLA 1QLBB 4OI1A 2QU7A 2OXEA 3YASA 5HTKA 3ZCQA 3N53A 1AKUA 1DQZA 1WWTA 3S2SA 1L9KA 2WILA 4S2UA 4HWPA 4DCOA 3CCCA 1E3QA 3AXSA 3URMA 3KTFA 3LBNA 1X92A 2AC2A 4RSMA 4LJSA 5KX5B 3S1AB 3TSSA 1BN7A 2HA0A 1MHXA 4CKWB 3H1UA 4X97A 1JGTA 3F4LA 1EBUA 4F0JA 4RVCA 4NCHA 1H8HD 3ZTWA 3DVAA 4M38A 2Y4NA 2ZIGA 4JA2A 5IW8A 3W1EA 5KQPA 3HDGA 1QE0A 2FE8A 1S3IA 4B43A 3TSYA 2JNWA 1IMOA 2IXFA 3ITEA 4KAFA 5K4AA 1UKZA 4IJ6A 4F60A 4YGXB 1EP2B 3HGTA 2EHJA 1V1PA 3HSYA 1IEWA 2K6DB 3I92A 5AI0A 4OQDA 4V0HA 2JEYA 2DZKA 1EWQA 4N4AA 3G9ZA 3G02A 3OF5A 1UWLA 2XMZA 3HB1A 1JWMD 5EGNA 3ZD6A 5IVDA 2VWPA 2GCIA 3MTDA 3DGFC 4DLBA 1Y1PA 2A9RA 3NJ4A 1KK1A 3SHVA 4DV0B 1AD2A 5C3JB 4AG6A 1BMQA 3S2ZA 1G20A 4GYKA 1T34A 2BCEA 2J6BA 1CEQA 3IBYA 1UOQA 4IXTA 2X40A 1I3KA 3EDCA 2Q5JA 2W8BA 1VE9A 2FN9A 2FCNA 3LRTA 5EKUA 2FG7C 1YOVB 3VUWA 2BHSA 4KR9A 3CCBA 4YUVA 1PS8A 3I37X 1F2TA 4X91A 1V81A 4NBWA 5ALWA 3C16C 3G2OA 1JALA 3L4EA 4G89A 1YZFA 1AZTA 4NECA 1F60A 3L1HA 5EW0A 1T5BA 1WXFA 2FNAA 3HDVA 5JDIC 4ZU6X 3JQCA 1Z38A 1M5RA 1XDUA 1Q83A 1W49A 1Y4AE 4ABTA 4YWJA 4C5BA 4M9ZA 1JJTA 3DT6A 2Y5BB 2GKGA 4TZFA 5DYTA 1XPJA 5HKOA 2EBUA