4XWTA

Crystal structure of rnase j complexed with ump
Total Genus 180
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
180
sequence length
543
structure length
543
Chain Sequence
APTLEVIPLGGMGEIGKNITVFRYGDEIVVVDGGLAFPKAHQMGIDLIVPRIDYLLEHQDKIKGWILTHGHEDHIGGLPYIFARLPRVPVYGLPLTLALVREKLSEFGLQDVDLREVTYGDEVRFGQSFVAEFFCMTHSIPDNAGYILKTPVGDVLHTGDFKIDPDVGTGAGIVSDLERVEQAGKDGVLLLISDSTNAERPGHTPSEAEIARNLEEIIKGCRGRVFLTTFASQVYRIQNILDLAHRQGRRVVMEGRSMIKYAQAAQATGHMNPPEPFLTSEEVGELQDQQVLFVCTGSQGQPMAVLGRLAFGTHAKIALRRGDTVILSSNPIPGNEDAVNLIVNRLYEIGVDVVYPPTYRVHASGHASQEELATILNLTRPKFFLPWHGEPRHQINHAKLAQTLPRPPKRTLIAKNGDIVNLGPDEFRVSGTVAAGAVYVDGLGVGDVNDDVLLDRVNLSQEGLLILTAVLHPTPHVEVVARGFARPNRDLELQIRRVALEAVEQGLREKKRLEDVRDDMYGAVRRFTRKATGRNPVLIPMIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Rna binding protein
molecule keywords DR2417
publication title Structural insights into catalysis and dimerization enhanced exonuclease activity of RNase J
pubmed doi rcsb
source organism Deinococcus radiodurans
total genus 180
structure length 543
sequence length 543
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
A PF07521 RMMBL Zn-dependent metallo-hydrolase RNA specificity domain
A PF17770 RNase_J_C Ribonuclease J C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.580 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4xwtA03
3.40.50.10710 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Metallo-hydrolase/oxidoreductase 4xwtA02
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 4xwtA01
5EV6A 1QH5A 4EYLA 2ZZIA 3ZNBA 4V0HA 5KILA 2ZNBA 3SRXA 4UWRB 4YSLA 4AX1B 4ZO3A 3X2YA 3QH8A 3P2UA 2M5CA 2QJSA 5B15A 2P97A 4C1HA 4C09A 5ACVA 2BFLA 3ZR9A 4C1CA 3KNRA 2FM6A 2FK6A 2AZ4A 4PVTA 4UBQA 4AWYB 4TZ9A 1VJNA 5B1UA 4AD9A 1DDKA 4YSKA 2XR1A 4GYQA 3X30A 1ZTCA 3IOFA 4RAMA 2QEDA 2P4ZA 1X8GA 4C1DA 3I13A 3DHAA 2Y87A 2UYXA 2GFJA 5HH6A 3RPCA 4NQ4A 4TZBA 5ACWA 3A4YA 4HKYA 2DKFA 4F6HA 2CBNA 4Z5ZA 2YNTB 3ADRA 5KIKA 2ZO4A 5IQKA 2WHGA 3I0VA 4D1TA 2BGAA 1HLKA 5ACTA 1JT1A 3ZQ4A 2YNWA 5FQBA 5LLDA 3G1PA 5A0TA 3PY5A 4H0DA 2BG6A 2Y8BA 2YNUA 5A87A 2E7YA 5AHRA 5B3RA 1BC2A 4ZO2A 4BP0A 2OHHA 2FHXA 1KR3A 3VPEA 4UWOB 2YNVA 4RM5A 3F9OA 4GYUA 2OHIA 2HB9A 3RKKA 2OHJA 1KO3A 3TP9A 2FU6A 1X8HA 1JJTA 2BFZA 1ZNBA 5LCFA 3R2UA 2Q42A 4TYTA 2BC2A 1WW1A 3L6NA 3ZWFA 4Z60A 3BK2A 1BMCA 4RL0A 1A7TA 5AXOA 3BK1A 3VQZA 1YCFA 4WD6A 1SMLA 4UA4A 3I14A 2Y8AA 4C1EA 3S0ZA 3T9MA 4RL2A 3WXCA 4TZFA 1K07A 3DHBA 3Q6VA 5HIOA 2FHXB 5LS3A 1M2XA 5AEBA 5LM6A 4Z7RA 3RKJA 4UAMA 5ACSA 2NZFA 4C1GA 2Q0JA 2QDSA 5K4NA 5EHTA 3H3EA 3AF6A 4FEKA 3MD7A 5LCAA 3BV6A 5AYAA 1P9EA 5EH9A 2I7TA 3X2ZA 4DIKA 3IE2A 4KEPA 2WYLA 3FCZA 4J5FA 3KNSA 2BFKA 2GKLA 4YSBA 3IEKA 4PVOA 2BG7A 3X2XA 3SPUA 1DD6A 1DXKA 2R2DA 5HISA 4KEQA 2BG8A 3PY6A 2NXAA 2BR6A 5DPXA 3DHCA 5EVKA 4UWSB 1MQOA 4AWZA 1VGNA 1Y44A 4LE6A 2NYPA 4ZEJA 2GCUA 5ACPA 4ZNBA 3PG4A 3IE0A 2M5DA 1WUPA 4NQ6A 5FQAA 4EY2A 4EFZA 1XM8A 3IE1A 4U4LA 1YCHA 4AX0B 4XWWA 3IELA 2Q9UA 4D1WA 3LVZA 2I7VA 4DILA 3T3NA 2ZWRA 2QDTA 1A8TA 2FU7A 4UWPB 1QH3A 3I11A 3KL7A 4NQ5A 1XTOA 4EXSA 4GCWA 2DOOA 1E5DA 5EWAA 2BG8B 5EV8A 3FAIA 2GFKA 2FU8A 3DH8A 2VW8A 4EYBA 2YNTA 1YCGA 5HIPA 4O98A 4XWTA 2YNVB 5EVDA 3SFPA 2WYMC 5LMCA 4XUKA 4F6ZA 4C1FA 2AIOA 2P1EA 4HL2A 5ACQA 2BIBA 5ACUA 2WYMA 5HH4A 2BG2A 1KO2A 3AF5A 5A5ZA 1WUOA 4D1VA 2BFZB 2YCBA 5ACRA 1WRAA 5K4MA 3I15A 4Z5YA 4P62A 3JXPA 2Q0IA 4CHLA 5AXRA 3AJ3A 1BVTA 4B87A 4EYFA 3IEMA 2GMNA 3SD9A 1ZKPA 4EXYA 4TZEA 2YZ3A 4D02A 2H6AA 1L9YA 5LCHA 4RBSA 4Z6XA 4FR7A 4RAWA 2XF4A 3SBLA 3ESHA 3T3OA 3BC2A 2NZEA 5LE1A 1VMEA 5EVBA 2BTNA 5EW0A 5ACXA 5AHOA 4J5HA 3IOGA 2P18A 4FSBA 4JO0A 5A0VA 2QINA 2I7XA 5K4KA 2WRSA 4NQ2A 1X8IA 5LSCA 2FU9A 5K0WA 4HL1A 2BMIA 5FQCA 4Z67A 3SW3A 2A7MA 1JJEA 5HH5A 4D1UA 4BZ3A 5HIQA 4TYFA 3IDZA
chains in the Genus database with same CATH superfamily
3VGJA 1ISIA 4MULA 3N2GA 5H7XA 2Q6IA 1JJ7A 1RE1A 1KHHA 1NSTA 4EZLA 3NHKA 1E8YA 2GVDC 1QHSA 2XAAA 4ZZ2A 2N7EA 1A97A 4O2BF 3IO3A 4D98A 5KOHA 5KTRA 3SXPA 3L2OB 5FF9A 1JAHA 2JGRA 4WZAA 4TRMA 1HFKA 4CIWA 4F1JA 2WIKA 3R7QA 5FWAA 621PA 1N5KA 4F3RA 4OHFA 1BX1A 4AK9A 5G1NA 2DF8A 4FQ8A 5JXVA 2HKIA 4TYNA 4ZI5A 1U1CA 4WT7A 5FPPA 4AN0A 1P45A 1NMXA 5BQ5A 1G63A 2VNKA 4RFSB 1YVEI 5D1NA 1C1YB 3RDPA 1AMOA 1PFVA 2R65A 1JDZA 4QU8A 3ZLJA 2PL9A 1FFYA 2H2DA 1WXQA 3AINA 3OVMA 4BNFA 3ISVA 3TD6A 1MPEA 3H7SA 1NW3A 4C4OA 5C3MA 2H18A 5FBKA 4TWJA 3PU6A 1C0IA 4BMSA 4GGMX 1GZSA 3V2GA 5BT8A 2GLUA 2Z1NA 4GI5A 1VRAB 2UVDA 3VPEA 4PLTA 2B0CA 3UJCA 2GAJA 1I14A 2C9BA 1GAQA 4WK0B 4GYUA 1WXGA 2IPMA 3KZVA 2ASVA 1CZLA 5FPKA 4YMVA 1YJXA 3VTAA 4I66A 2NUPA 2LRWA 1ADCA 3ZI4A 2XKAA 2Q42A 3AIMA 3P0HA 2O2DA 2VF2A 5DTJA 2IHTA 3UMRA 4QO8A 3OKFA 5TPWB 2FZ4A 1J99A 3O94A 5EJ8A 4BO1A 3AEUB 1U1IA 2GMIC 4Q7QA 2Y8AA 3WHKA 1XKLA 5CGQB 4AJWA 4QJIA 4RHYA 1M2HA 5CA0B 2C3OA 1WKBA 4KW7A 1QGUB 4LGMA 4ECAA 4Z8XA 3DWGC 4DLTA 3K96A 3LH5A 4QDZA 2BE7A 4NCJA 3KVYA 4IXMA 4GL4A 2AN5A 3BMCA 3ZTYA 1C5KA 1NW9B 1O0BA 3SYRA 5EDSA 1KFCB 5BNFA 4MJXA 4TMWA 5IKXA 1S8AA 1Z0AA 1QCDA 3LYLA 1EQAA 3DVRX 3VZBA 3HI4A 4IOJA 4MYUA 3GDGA 4ZZ1A 2JA1A 2OM2A 1BEEA 2XYPA 3DFFA 1C41A 3C48A 2HY7A 1W94A 4K0RA 1R4MI 4RTQA 4YXWD 1SHJA 1C80A 4L23A 4CL8A 4YECA 1FYXA 4V24A 1ABBA 5CTJA 4RV9A 2FWBA 2C0CA 3ADCA 4OB7A 2A30A 4M98A 3U9TA 1UDXA 4GKAA 1G8HA 1IN4A 1AMUA 4NCAA 1WIWA 2QYOA 4FOOA 3NRJA 2Z1DA 1A70A 3UMVA 3SBXA 1DQSA 1TKBA 1QBGA 2Q1UA 2N7DA 4EHAA 3G5LA 5ALUA 4CNQA 3H6KA 2XZOA 2GN0A 3QNUA 5GJVC 4A16A 1R6VA 1MW8X 4BO5A 1VCIA 2CF6A 3MTBA 1XG5A 3HV0A 2OGSA 13PKA 4MA5A 1FTQA 2Z0DB 3U7ZA 4B3CA 3EGRA 4L0DA 4EKDA 3FNEA 1CY4A 1Z83A 4JOQA 4BMVA 3R7WB 1IYZA 3HP4A 3EFHA 4A1OA 4DLRA 4ALJA 3GVCA 2V9PA 5ICEA 2KLCA 1AG9A 3T3MB 4H1VA 3EQZA 1AH2A 1Z4QA 5LE1A 3K2QA 4EH1A 1NNI1 1AUOA 5K3DA 2FRXA 1DC4A 3TEFA 5HZKA 4CRWB 1YR8A 2JEZA 3P4YA 1M34B 1GUBA 3GVHA 3C7AA 3NI2A 4B0PA 4ZRQA 2D2EA 3VPGA 4KX6B 2MINA 2W6ID 5TS3A 2IS1A 3ZDEA 5DWDA 1QP0A 3TRJA 2IO2B 4DCVA 1SJHD 2HLPA 3STHA 5JFTA 2EERA 1L8AA 1TVKA 5JW6A 5CD1A 4UQLA 2PE6B 3DMNA 3G0HA 3ODGA 1SQ5A 2QM8A 1QUFA 4QUDA 1R6XA 1YDFA 4BBNF 3IJ5A 2YDYA 3ERCA 4RPIA 3C3JA 2Q6LA 1FSZA 1PDXA 1XCBA 3CNBA 1FFDA 4MQLA 1CQXA 3CZPA 4DV5B 2EX4A 1YB6A 3ENVA 4BNVA 2GN6A 2GYUA 1RI5A 3I5JC 3GJZA 2QD5A 2CXUA 5HFAA 1KLGD 4M87A 1MJ5A 4JYMA 1HV8A 5HPYB 3ETRA 3DV0B 1XRQA 4YTPB 2M32A 2WYWA 1JIXA 5C80A 2YJGA 3W8EA 4EMSA 4MS3A 4KO8A 4EHFA 2R4TA 4E74A 4LMBA 3OM9A 4FSDA 4HEA6 4JSRA 5HUQA 3TTWA 5EXSA 4DWFA 2DKOA 4MUJA 4CO7A 3RU9A 3E7WA 3INRA 3G1PA 2HQBA 2C1EA 4IJ6A 4ZXFA 4KIKB 5AW9A 1K88A 4TMXA 1UZXB 4N18A 5ALHA 4KDLB 2XEXA 2Y1WA 4TS9A 5K45A 1KJQA 2J0MA 3L6EA 3W5UA 3FE2A 1Y7PA 3IQZA 4XGAB 3R6TA 1PJLA 3OAWA 1Y7TA 2X58A 3FJYA 4TTJA 4BKUA 1DRJA 5FK9C 1CEQA 4NFHA 2XYVA 4ZO8A 1XF1A 1ECJA 3C74A 2ZRGA 4EUHA 2NV2B 2R1TB 1QFXA 2HPHA 2QX9A 1CMXB 1XF5L 4RF1A 3ONEA 1CUCA 1G7CA 1GZUA 4BNJA 2BL4A 3E53A 2AMLA 1GCAA 1JQJC 4CCWA 2EARA 1OFUX 5ACSA 1D4BA 4ACFA 3R8XA 3LQQA 1Q3TA 1YJBA 1KZ1A 4BFWA 2R0QC 2TS1A 3JQ9C 4DMUB 4LOHA 1X1MA 1V0JA 2C2ZA 4OX9Y 3PUYA 5U4QA 3BCHA 4UBOA 1ZD8A 2D3AA 3DUFA 4Z8YA 4DBVO 1P9OA 4KEQA 3PXBA 4LCBA 1ZXHA 2DJ5A 2ZCBA 1V7PC 4JP1A 3OQJA 3JQAB 3PUJA 3WKBA 4Z4FA 4QUEA 3O93A 2WFLA 4YV7A 1K3FA 2ZTMA 4I9HA 1W49A 5F1PA 3BWVA 4MQ4A 1VG1A 4AX0B 1BWQA 5I9NA 4GM0A 1Z8FA 2JGDA 2FCQA 2I7VA 3EJ6A 4IDEA 5T6BA 3DAHA 3T6KA 1XMOB 3G8CA 3VO1A 4BLOA 1MP0A 3GLFB 2G4LA 4MUYA 5IYZA 4NF2A 2DBVO 3VXKA 1PBTA 1JJIA 4I4TB 3AB8A 1DXHA 3FYDA 5FNZA 4GE0A 2GZHA 1DEOA 4I55A 1PQPA 5BO4B 4F9TA 4LOKA 3R3YA 2FOLA 5AJZA 3ROTA 1L4UA 4G0YA 1GTL1 4D6YA 3UO8B 4N6EB 5DLDA 2DNFA 4X57B 1O0SA 1RVDA 3NYIA 3BDAA 3WOVA 2B4YA 1M2NA 3I1JA 2IOHA 1C4KA 1NBFC 4BB6A 4F6RA 1OKKD 1V3QE 3MWDB 2R48A 3NTRA 4B0MA 5AQEA 3PNQA 1YFLA 3PVZA 1ZKDA 2R6ZA 4L57A 3PGMA 2WHYA 2V55B 1E79D 4EYFA 3PGLA 2F43A 2AOTA 1L9YA 1QTIA 1X77A 2GZ1A 1OZAA 5HK8A 1WU8A 1LPNA 4BGEA 1V39A 3HMQA 4F04A 3RADC 1EVQA 2YY6A 3VPAA 4MGYR 5LXHA 2QTMA 3ITNA 4W9FA 4ZODA 3U5TA 2X6QA 1N2BA 2GZRA 4AZ0A 5DGIA 5AOCA 2YHEA 4NIMA 5C3UA 4U7TB 4IGKA 4NWIA 1E96A 1SB9A 4BNGA 5HIQA 3ZGXA 5IT0A 2C9WB 1A0OA 5J2UF 1YRHA 1HYGA 3OQBA 2QUHA 1N6PA 1P0MA 4KVAA 1Z6PA 1D6NA 1SQ0A 5BUCA 3L1UA 3IHKA 3AKZA 4ZVQA 2ZYUX 1JMKC 4LTDA 1ZD9A 5KNDA 2A1IA 1YZGA 3ROZA 1G8AA 3BD6A 5CIQA 3RQSA 1DT5A 1D0IA 5JADA 4AD9A 2NN3C 3PWZA 3VU9A 2DSNA 4EOGA 1KH3A 1CDDA 2SKEA 3TLAA 3OC0A 1WB9A 3A9SA 2W98A 1JH8A 1QO9A 2J7PA 3C41J 3C3DA 3WSTA 3EZ9A 1X1CA 2QOEA 5LYJA 1RM4A 1TXGA 4MGIE 1NHWA 1Q17A 1CY2A 4MWZA 1MAAA 3CMMB 2GSWA 4YMHA 4P5DA 5AJWA 2X5NA 5IAOA 3D1LA 1V5OA 3D64A 2X14A 5EMJA 1E1QD 5CYOA 1JQ3A 3DLAA 4URZR 4A82A 2H2FA 3T12A 1ZMXA 3IT2A 4CQLB 3UV6A 1D2GA 1AU9A 2OHXA 3WQBA 2B0JA 4G63A 1D7OA 4RIHA 3T41A 3RT9A 5JMTA 1VIVA 4AP6A 1DJPA 1XE3A 3KLNA 3V7WA 1MENA 1XNJA 2AK3A 4QBIA 4GXQA 3NWJA 3UJNA 1P98A 2B7BA 3BWYA 4DGQA 3TIGA 3PFCA 3JASA 3NT5A 3UT5B 5BV8A 3MJEA 1LBTA 2QYHA 3PD7A 2CV0A 4P3PA 2D8AA 2FN7A 4ZO4A 3HXQA 5LXTB 2HU5A 1EUCA 1AGRA 2Q9CA 5TT0A 3HB1A 4RH0A 1GNQA 3NM4A 1LCIA 4XYEA 3OJXA 2X2PA 5FAKA 1GZ6A 1NQAO 4J0QA 2JBAA 4FYIA 3Q8AA 4L8LA 5BWCA 3R0ZA 3CS3A 1PUIA 5HW0A 1KXJA 4HDSB 5KMGB 3EW7A 4MPPA 3O75A 2XGOA 3PC8A 1DXQA 2P35A 2QRMA 4CTMA 1EZZA 3U16A 3L0ZA 1G6Q1 4XGIA 4CI0B 2WWTA 1PVVA 2FFQA 3LQYA 5IARA 3DF9A 2PWPA 3TN7A 4YSBA 5IJ9B 1XPUA 1S1QB 4ZICA 1C9MA 2YC4C 3N75A 3SHQA 2V8OA 2FE8A 3G9TA 4IF6A 4QHSA 1XNHA 4TN1A 1U2RA 2LR0A 3VSBA 2YASA 2BHLA 1Y44A 1VKHA 1YB1A 4JI7B 3OUTA 3VFKA 3DFMA 3NBFA 3G3EA 2ZI5A 4NQ6A 1JFVA 3BZBA 3O3NB 4LFCB 2C7MB 3IE1A 1U3WA 4C76A 1S3FA 5D3IB 3ZHCA 2ZJ1A 3IV6A 4NENA 3LK6A 2QM0A 1X92A 2QYTA 5BVHB 3U5ZB 2G1EA 4DV3B 3X1ZA 1EP3B 4GI7A 5K0GA 2B94A 1LPMA 1SCIA 5LB2A 3NS8A 3DOWA 3QNWA 4PLFA 3SDBA 3H5VA 3OZFA 3ZK7A 5EHXA 1FSFA 1Z35A 3A6ZA 1XYGA 3OY7A 2ASQA 4HS4A 2FW0A 4KPUA 1UAAA 2PUHA 1J09A 2NZ8A 2QMHA 2DUMA 3KXIA 1OXSC 3ACBA 1F7VA 3Q7EA 5K0ZA 3GFOA 5E6JA 3HA3A 3BB4A 4CWAA 2CUZA 1RWBA 5DISB 1C78A 3K2EA 3U56A 4DBLC 5BWMA 3KXPA 2VDQB 2JAUA 5DULA 3R0JA 3AR9A 4QEDA 3WIVA 3IFSA 1PK8A 3T61A 4M38A 1UKEA 2COUA 1YZHA 2GEJA 4QFCA 4AMZA 3ESHA 4PCLA 4Q4AA 4E88A 4A2PA 1Z4LA 5L9AA 4IIJA 2P18A 1OXXK 5DI9A 4K28A 1MHPA 2Z9BA 3ZKWB 5EXTA 4Q12A 2BQQA 4D8XA 2XJ9A 4BUJA 1JJVA 2XUDA 2E1RA 1Y3IA 3C0KA 1C7EA 3DTYA 4L8GA 4DMCA 5HH5A 3G13A 4BJHB 3OE7A 2I3BA 2FW1A 2DX5B 1LDNA 1RAFA 2O8BB 2KJRA 3L8MA 4DUPA 2BUBA 1NVFA 3RT1A 3GVXA 5KJCA 4TYQA 3TSAA 3CLTC 1G21E 5GM1A 3P5SA 3NHEB 3LJKA 4ZHQA 3OH8A 1JEDA 2YQ4A 3H4MA 4HQOA 5HJEA 4G4IA 2LVPA 3EFOA 3ZVVA 4LTUA 3F6SA 1XZDA 2ZRQA 3LSTA 1A9XB 4JJAA 2Q4BA 1QMGA 2XOXA 2PLNA 2FZEA 4EYKA 5J2TF 3LB8C 2Z4TA 4J03A 2PUEA 4E5NA 1LUAA 4IH1A 2IKSA 2INNE 1JE1A 3RV4A 3IGFA 2ZIWB 4I50A 2TSYB 4LECA 2VPWA 1RYZA 4KXNA 1SK9A 1P2TA 3WA0A 3M1AA 4X92A 1PT7A 1T5IA 4PZDA 2OUKA 4FEGA 1QWOA 3TL5A 3WRXC 1JT1A 5DBEX 4OJQA 1ONSA 3IPYA 5A0TA 1DFIA 2ABWA 3EGDA 4RZ2A 2DPYA 3VOBA 3KJZA 3K1TA 2VJMB 3PNPA 2AMJA 4HQNA 1WXEA 3Q7QA 1LB1B 2BP7B 3GJ8A 2JJ2D 3DOHA 2F00A 4Y0VA 4I5GA 5K9ZA 4OL9A 2UYCA 2B98A 3U4IA 4B7ZA 1X8HA 1Q10A 1VLHA 4GO1A 3P52A 3A9CA 3HKEA 4ARVA 3B52X 3VJLA 3O47A 4RLHA 3TLGA 4MYRA 4TTRA 3NBZC 5J23A 2B9EA 2GLTA 1R8QA 2XB6A 5IBQA 2ZYWX 1SBHA 3P8ZA 4J0IA 3H4TA 1VIDA 4PVDA 5LS3A 4AF6A 1UWXA 1U5AA 3AXTA 5I51A 3W5JA 3HH8A 3G2MA 4GOMD 3O3CA 4I99A 1U80A 3KJGA 1OPXA 3FVVA 4L16A 2VQDA 3K2IA 5J5VA 4BZWA 4RSRA 1U5BB 2J6HA 2PD4A 2G5PA 1AKUA 4MA4A 1DQPA 2G0TA 4GGQA 3A6LA 3UFBA 1WR8A 1SUSA 2YMLA 2O2JA 4FFWA 3BORA 4KHZA 3QVUA 3PG4A 3EYAA 3L8EA 4L76A 1T2AA 2WWWA 3L4JA 3I3SR 1YUMA 3MHPA 4ZAVA 2VHXA 3AYXB 1MOQA 3TOZA 1PFKA 5ARCA 2VRCD 5DWVA 5A4IS 4NRDA 2XVXA 2CJXA 3UAVA 1PGQA 3L8HA 2WQZA 3V7UA 4RF4A 4KAAA 4EYBA 4A36A 3OQOA 5DV9A 3DLTA 3CUUA 3UNXA 1XIVA 1JL3A 3U3RA 1ZU4A 2G9HD 3PC4A 2Y0PA 5CDSA 1GRNA 1HLGA 4Y18A 3TRHA 3NIBA 2O20A 3E2IA 3RYFB 1PGJA 2RPQA 3K0BA 1ZVKA 3ABRB 2HJRA 3UUEA 4Z5YA 1IBSA 1Z0JA 2I3AA 4NU0A 2C29D 1U81A 3SD9A 3M2TA 4ZYZA 3DVAB 3JAWA 1B9RA 4FR7A 2HMAA 4FMPA 1GPJA 3ROXA 3RSHA 4HKTA 1TPZA 1XLUA 3Q7RA 5FR1A 4ENQA 4TT3D 2PS0A 4P86A 3QPCA 3ZJYA 2O3UA 4MUHA 2C7NB 5CFPA 1VL1A 1OXTA 5TT1A 3JVIA 3TVYA 4R71A 1GLGA 3QLTA 2GESA 3P0RA 1WMHA 1KKUA 1RIIA 1GTVA 2BFDA 2WRZA 4XEUA 3LKVA 3T7AA 1WRDB 5I7UA 4MACA 2VJBA 2IYNA 5AUQA 1UPXA 1O9BA 4NMHA 4DYVA 1XNQB 3VR4D 2EJCA 2HUNA 4JYAB 2NAPA 1TS4A 1Y4AE 5L3ZA 1EZ1A 1II0A 1YX6B 1O77A 3PSAA 1VE6A 3RTDA 2WHXA 5CT6A 1GVHA 5JH7F 2JHGA 3H8VA 4PN3A 1NF9A 4P16A 3HY4A 3FMFA 4L9WA 5C4MA 4DIDA 4UBQA 1GG2A 4F3CA 3A6JA 3UJ8A 3GAZA 4XOUA 1UP4A 4WQOB 3ESDA 2QSDA 1NBMD 1UM8A 3AB3A 4IUCS 3ZWWA 2G82A 3RS9A 2XHEA 2BGFA 5E6OA 1TCVA 4BEBA 5ELXA 4HDAA 1F20A 4Y98A 2QRHA 3WY9A 2DZMA 2PD6A 2ZCCA 3TIVA 1U9IA 2V4LA 4URXR 2ONKA 4KPEC 3FB1A 4GYJA 4TX1A 4C88A 3PUXA 1V8CA 1M8JA 1I42A 3L7OA 1IH8A 3F5FA 4IBOA 2L17A 1T3QA 1A9YA 4XH9B 1GIAA 2IZ5A 3V3TA 1BH2A 4XVRA 4C80A 5DXAA 2Y6UA 3WGNA 1MGPA 2D13A 4URUR 3RS3A 3G49A 2OOSA 3G9QA 3IP9A 2GJAA 3T5AA 2TYSB 4PVCA 3EG9B 3VQZA 1FFAA 2PEYA 3THWA 3B9BA 3ICWA 4IOLA 4CMKA 2LHEA 5H9VA 4ZHSA 3ORHA 1KO7A 2QLNA 3MMNA 3IHPC 3RFUA 1PL7A 2GMWA 1CV2A 1QX3A 3ADPA 5FNVA 2I8AA 5EWMA 3DTVA 4E5SA 1N2OA 2WU3A 4QBFA 2W2TA 2OILA 3EBLA 2P40A 4E22A 4QAQA 5I9SA 4F5EA 3EWIA 2FSSA 3T4UA 2JGMA 4JB3A 3H8SA 4JX8A 5JH5C 2MJLA 3W6UA 3LVFO 4I08A 3S68A 3T8MA 4DB2A 3PPVA 2Z8LA 1OV6A 5EKUA 3IR7A 4MW5A 2O5CA 3ZJUA 1V7QA 2J0JA 4Q7MB 1QMPA 3UPDA 2LUEA 1WE2A 1NP3A 2IXBA 4Y2XA 4DIBA 3OZWA 4CQMB 1GARA 1T9KA 3N86A 3EVDA 3GDFA 3BA1A 1WBBA 4P0QB 3BE8A 1M7GA 4C7ZA 1E8MA 4N8SA 2UV8A 3ORRA 5T4BA 3DYBA 4ZYVA 1QM5A 3Q5DA 4TOIA 3MOSA 1R8SA 2JFHA 4H15A 2OBMA 1KJIA 3LXUX 4IUMB 1V16B 5AUPB 3BUSA 3RVJA 3R3SA 1QFMA 3IAS6 4GPEA 4IWYA 3T3IA 5A7GA 4LNKA 5LDDC 4RCYA 1WCXA 4CGZA 4HGYA 1H0HA 3SOPA 2Z2KA 5CM2Z 3GZNI 2PA0A 3PHCA 2ARKA 1CR1A 2LJ5A 5KNLA 2P79A 2YNVB 2EL7A 1C1XB 1UFQA 3GFRA 2ENWA 3I5YA 3JAKB 3FNRA 1KLVA 2HMYB 3X0DA 4A3SA 3K8ZA 2CXPA 5HM6A 4B48A 1JT9A 1V71A 2ZUTA 3OOHA 2IYWA 5BMIA 2OMKA 3CEMA 1X1QA 2Q3DA 4RMHA 4RPCA 3OX4A 4L0QA 4D02A 3MVEA 4XXHA 3MSCA 3ZNZB 3CZ4A 2HRDA 1B0ZA 4HWPA 1F6BA 2RSLA 1UD7A 1P3QU 2HK7A 2QVBA 2BBTA 4QGAA 1RLMA 3ZGYA 3FPJA 4L2IA 3BN3A 1P7PA 2VHUA 2IJ0A 3L0PA 2NZYA 4EHKA 1UGMA 4C78A 4BIIA 5FQNA 1PJSA 3E48A 2KB0A 4A9AA 1Z38A 3FFTA 4P3OA 1W2GA 5JCOC 3Q9UA 1NQ5A 3QENA 4Q3NA 2CN1A 1L5PA 4JVSB 4WZAE 5DNDA 2QTRA 3PF8A 1R0CA 2JLYA 3OUZA 2QQ5A 2OCYC 2HJVA 2XWJI 3DDCB 1FDSA 3GT7A 4IJ5A 3IP1A 2JLXA 3EC7A 1DKNA 2IEIA 3QUAA 2J0UA 4Y2QA 6ABPA 3QWZB 3ZBPA 3NRZA 2CEKA 4I5IA 1ZICA 4IX9A 4QDTA 4P4UA 5H83A 1PGOA 4M4SA 4F4UA 5A1JA 4F4IA 4XVUA 1SSNA 1RC8A 3S44A 3I9JA 2RAFA 3MPUA 4PAQA 4NULA 1H05A 4QYWA 3PNVA 3ZV4A 1A4IA 4MV3A 2HA6A 1C4OA 2REOA 3RPCA 3VYTB 1LK7A 2PJUA 3E7PA 3X1KA 2WZBA 4YAIA 3T7JA 5BUZA 1ICIA 1GSHA 3HKDA 2A9FA 1Y5MA 3MK31 4A92A 1P7FA 1HE4A 3AOEC 2OPBA 3ZQ4A 1E5WA 3SHTA 2GWRA 3MAJA 4BOYA 3HFRA 1TU3A 1DLIA 4GZ5A 5B3RA 1QYDA 3K4HA 1X7ZB 1OVGA 1OLOA 3RKKA 1RAAA 2R4UA 3LO5A 4KRXA 3FDJA 3GWGA 5A04A 2JAPA 4BQNA 2JLUA 2R79A 3L6NA 4MLPA 1AUPA 2MMGA 4WTOA 1VE3A 1LXCA 1O5IA 2QVCA 3N3AC 5CJJA 4BATA 2EZUA 4I1YA 2DC1A 4WV3A 2JLAA 2VWGA 4D9JA 1JH9A 4MYSA 1RJ9B 2HJWA 3A32A 4ZEXA 4KMRA 3MWGA 3MFGA 4MVWA 2YN4A 4ERNA 3QJYA 3T54A 4BRWA 2NTSA 4OXXA 2HD5B 2F8TA 4Q37A 2IY9A 2QDSA 4PZZA 3NNNA 3PUVA 1G6JA 2XVMA 5AXBA 3A10A 1TEXA 4L8WB 3K5WA 1TA9A 1PJRA 1IEQA 4RA6B 4RTOA 2MHCA 4QASA 3KQTA 1VG8A 3OMXA 3L46A 4GBED 3VPDA 1PE0A 1ML3A 4KSYA 1S8NA 1WZIA 3L05A 2F1RA 5K4HA 1HK7A 1GUAB 2DUJA 4Y1FA 1Q7RA 2XITA 3EZFA 2FPIB 4NQZA 4EEXA 2C61A 1NPTO 2QORA 1AV6A 2X5KO 3BJIC 1M73E 2G1PA 1XWWA 1ENOA 2NCNA 2EZ9A 2WUGA 1KFYB 1E60A 1R7SA 1N5JA 2WDVB 3RC7A 3ZU2A 1NQOA 1DKQA 2YYAA 3KHUA 2BG8B 1C7ZA 3HDJA 1N5RA 4ILKA 1YASA 2Q5JA 4GKBA 3TI9A 4EQZA 1OE0A 4H7DA 4BNUA 2VQEB 1HGXA 4CIBA 2C82A 1QIEA 1V3UA 4KREA 2R3SA 2EBUA 2FUNB 3MS2A 3QPWA 1OYOA 1SKYB 4LXQA 1SRRA 3PLNA 1I5OA 4IWXA 4P8RA 5B7NA 2C4KA 1DL5A 2JFPA 2NSHA 4ZI7A 1LLQA 2QTAA 1EP9A 1K92A 2AFIE 3QYFA 4HYEA 1YIAA 3HYRA 4FR5A 1UT8A 1NC1A 2R6HA 5SYAA 3QA8A 2KDIA 1E1YA 4K1XA 3SFEB 4DDWA 1VRWA 1C3XA 1QPGA 2JYEA 3PDCA 1NNLA 2Z4SA 1YJJA 5CRIA 1D5WA 3IMCA 3H2BA 3Q8BA 3GFFA 3ST7A 5GAJA 1LF5A 1O94A 4YQYA 4AN4A 3FRIA 4ED9A 3U7QB 2GGSA 4LVNA 4JWKA 3TQCA 1V6EA 4KVGA 4I8XA 2OD9A 1MFZA 2AD1A 1VHQA 3ESYA 3FF1A 4XCVA 4JLVA 1OFVA 1PDOA 2E4YA 2HHAA 4UMEA 1E1DA 4BASA 3C3CA 1OEYJ 5DM70 1MFPA 1BUIC 1L5MA 2WM9B 5MFZA 3R8FA 8MHTA 2QJSA 3B1JA 5FV4A 1DUSA 1NTOA 3OP1A 1HDYA 4Y3UA 4L28A 1FUIA 1CZUA 1WJGA 2VSYA 7MDHA 3GP8A 5JSYA 1IWBB 4PR0A 2WSSD 4C0SA 5T41A 5FA5A 2AEMA 3RNEC 4R0MA 5EWJA 5JSQA 4INAA 1WSDA 2WIBA 1OWLA 4HLQB 3SQLA 4NG4A 3ZH9B 4FDAA 3ZE1B 1Q92A 1LSUA 3OZEA 3DHAA 4NBTA 4D3YA 1T2FA 4M0EA 3PNLA 1B26A 3EHVA 1DAFA 1Z37A 1RWKA 1JHDA 4IXDA 3JW8A 4UTRA 4DBGA 2O52A 2O9JA 3EAGA 2HTHA 3WO1A 4BCCA 5KOYA 3UMBA 2OBBA 1BOFA 2GK6A 1TAGA 1N5OX 2LNDA 2VJPA 1H6AA 4UU1A 1VLZA 4DA8A 4YY3B 2IZOA 2ZE8A 2CT8A 5L4LA 2OCDA 4A20A 3JS5A 3OX2A 5KNCA 2QTCA 3QVSA 4RTJA 5DOVA 1QOPB 2DB3A 1NM5A 4RVHA 2ZKIA 1D07A 2D7JA 3CFYA 1K27A 3GLIA 1FLAA 1HLFA 5GINE 4I8DA 1AXRA 3MB5A 1ZEMA 3WGTA 1BZYA 5AVZA 3E4DA 1SUCA 3G8YA 1RC1A 4G2TA 1XDUA 1WW1A 3PGKA 4DNQA 3JALA 5MN4A 1U0RA 2QW0X 1KMMA 4YK7A 2J59A 2KS6A 4MI1A 3IPCA 4EYEA 1NUQA 1N6NA 4O1MA 4TV8F 1I6MA 4W1QA 3HY6A 1NLMA 3WDLA 3AP2A 3T9MA 4PWZA 2QMEA 1Y42X 3L1IA 4B4WA 1E0ZA 4AS1A 2BHNA 1VJKA 5GQSA 2NP7A 3IVAA 1SUEA 3MRTA 4FA6A 2BMJA 4A2WA 4DSOA 2VHTA 1VIAA 1BW9A 2JJ1D 1EM7A 1E8DA 2ZJZA 2O6HA 2QRJA 4PZ9A 5EPEA 2CVZA 1E2KA 4CEHB 3QTBA 2CZCA 4QWWA 1RQNA 5ILOA 4FCCA 3OJOA 2PMEA 1P4JA 2NXAA 3CRZA 4OGWA 4YRFA 1X14A 2H7VA 3ICCA 4OG2A 1BN7A 5GV7A 2OEDA 3NGLA 2XHZA 3TLBA 3L02A 1OYVA 1U3CA 2KBFA 2L0TA 3DKIA 3H9EO 4FMDB 3ILXA 3I57A 1P2GA 5CB4A 5EZ5A 2PE9A 2AZDA 4F45A 3WFJA 3LVZA 1CETA 4PGGA 2WP9B 2J4CA 2C83A 2FPGB 1DLJA 1WA5A 2YYSA 2R7NA 3DE4X 4KXFB 3PJRA 2ZRCA 1ZD1A 1OROA 4EJSA 1I0LA 4KKXB 1VTKA 3AG5A 3TTXA 4QEZA 3T38A 1P39A 2VUSA 4OF4A 2OAEA 1V1MA 4AIIA 2HWYA 7MHTA 5LQAA 1KOTA 3L4SO 5KVQA 2B2XA 4JIOU 3UIPB 1OWMA 1CF4A 4HYYA 4HDCA 3VKVA 4C3VA 3QVTA 1E90A 3G82C 1NMEA 1RXCA 1AT1A 2SCUB 2VKQA 4IKGA 4E1VA 4GVPA 1IEXA 1USKA 1TZBA 3VR6D 1YD7A 1Z7BA 3H2JA 3IHWA 2J1LA 4C9BA 3D02A 2RGNA 3NBMA 4GMKA 4HROA 2G9QA 1XAGA 1ZHOA 1XTSA 4UOQA 4J5HA 3GRRA 3I2GA 3UI3A 1BYUA 3DFZA 3A14A 3IPAA 1P8JA 3L4EA 4PZEA 1ZCJA 2VJKA 2ZAIA 4D0GA 4L2YA 5EV6A 1D5MC 1TTQB 3L7JA 3T7RA 3WGVA 4OJTA 5C31A 2GFHA 5J2RA 4JWUC 3URYA 4ZAYA 1OX6A 3R5FA 2PIAA 4Z9YA 4FFSA 4Y9RA 1SC4A 1HEIA 1Y1SA 4HC4A 4H3HB 3CLRC 1H69A 4H16A 2Q1YA 2RGBA 1WNFA 2RAUA 5JOQA 1AUQA 3FSGA 2FM6A 3B8HA 3U44B 1VJNA 2ZBFA 2WXQA 2R6R1 2QMQA 1A96A 5B1UA 1UF0A 4DJDC 3W9SA 5IAGA 1Y1KE 3SZUA 4IHJB 2DG2A 5CXUA 2QEDA 5B53A 4BS9A 5LPNA 1J0BA 4O2AF 3VZPA 1IPHA 3HHPA 1XCTL 3G2HA 4EL5A 2MOKA 1V41E 3V8EA 1XDSA 1NC3A 1ZK2A 3AF3A 1FL9A 4P22A 1U4OA 3H9BA 3MC0B 2G7ZA 1LDMA 2FMTA 4G67A 2BGAA 4O4LA 1YOVA 4MRMA 4MPDA 1BIFA 5K7SA 1XZJA 5HGXA 2LV8A 3L7YA 5CNJA 2G76A 1TQ4A 1H5NA 3GPDG 4X66B 1TMGE 3DD1A 4LSWA 2I6SA 4GD3Q 2OHIA 2YIJA 3WP0A 4FBMA 3EARA 2VDOB 3STYA 3K70C 3BTVA 3V00A 1ZH8A 5I7AA 3UB3A 4ASUA 4BTLA 5CVVA 3VO9A 2Z9DA 1SQ6A 4DEXA 1XMQB 4PYLA 4Q9HA 3FZGA 1OLSB 4CF6A 9ATCA 3OJCA 3ZKAA 3HDHA 4U7GA 3FYUA 1TEVA 1N7IA 2K6GA 1YZUA 3P94A 2W6PA 3FTPA 3AF2A 3ONVA 1FA9A 4RKRA 3FILB 4C5AA 2ORIA 2OC9A 2CFSA 3ZU4A 1YT5A 4QRHA 5IH3A 2X19A 4A5OA 1KKMA 3DW3X 1YAHA 2RI0A 4QOSA 3KTDA 3RVOA 3ZU5A 5BMHA 3VR4H 5JBQA 2HDNB 3BFVA 2G1KA 5ESWA 2B5VA 2DVMA 3LT1A 3OZAA 4A1FA 1IZYA 5DGCA 1NSFA 5IAAA 3FMVA 3I83A 4X20A 1L4HA 1K6MA 4ARCA 1WW8A 2OZLB 3KSMA 4HPLB 3L6DA 4H77A 4ZC8A 4FXPA 1VHJA 3PHWB 4PPGA 3PRHA 1OW3B 1IIBA 3AVTA 3ZLUA 3ZQUA 4Q5IA 4G89A 1NRJB 1NQXA 4U7JA 1Y6FA 4RTKA 3ZTTA 4ODIA 1CJTC 1C81A 4JZYA 2PMWB 1UUPA 5ACPA 4Y6SA 2XE8A 3OI7A 1NFFA 2QL5A 1QKKA 4GKKB 5IKOA 2Q1WA 4N47A 2IPOA 4KGSA 5BN4A 4WE3A 4HQFA 5IW8A 1D2EA 2CG3A 3MOIA 2H57A 4DLYA 4C4TA 1IUKA 2ZBUA 3WLTA 4PZ0A 1FFSA 1MJHA 3BIID 4YJ2F 3V7YA 4PLGA 3N87A 2O0KA 4R8VA 5E9AA 3ER6A 3LG2A 3KKPA 3AVWA 3UMMA 1RNLA 3EPJA 2Q28A 2Z08A 2WWVD 3B20A 1QV7A 1CRQA 3FSEA 2CHZA 1YJ8A 1G5FA 3QX9A 3PVCA 1YA4A 3D8UA 1ATZA 3JD3A 3LY8A 4AROA 2DOKA 3ICOA 5IT5A 1QH8B 3C19A 5JLAA 2JZ3B 2KHZA 2YCBA 4RHTA 4L7QA 1SD2A 3DWMA 1Z6QA 4M22A 1TYZA 3NATA 3TLCA 4P4LA 1XVLA 5CDTA 1MVOA 4RBNA 3HDTA 3PNBA 1IC6A 4YDHB 2YIDA 2JFZA 3UFXA 3K31A 4YAOA 3BHMA 1BE6A 3BULA 5JFOA 2PBZA 2CHQA 2Y92A 2J08A 4RXMA 3R6LA 4PPFA 1TYGB 4MVJD 5G0WA 4G41A 4MWGA 4W9NC 4N7JA 3UH0A 1MT0A 4QTUB 4W6ZA 1ISJA 2BY4A 2BI4A 4RM8A 2O5RA 1X3LA 1EXMA 1FTYA 4E7PA 1E8NA 2J53A 3I6YA 4GMXA 4CCYA 2C0PA 3FZQA 4IP0A 3O4JA 2QY6A 1Y8RB 5E0OA 1Y82A 1Y5LA 1ZOLA 3PNSA 2YN2A 4L74A 4PG5A 3FNFA 1M0EA 2ZXEA 1KYYA 3EASA 4ZO7A 4C56C 3R0VA 3PNMA 4OFBA 3CSSA 4A15A 5TQJA 3N9YC 2W42A 1N1GA 1T29A 5EP4A 2YNMA 5DK4A 3G85A 3HGTA 4DCNA 2X4DA 3L54A 2V5UA 3NV7A 5AKYA 3JSXA 4QXMA 2GNAA 3VZCA 1KO8A 1NE2A 1GV1A 3BMQB 3E70C 1D3AA 3ZCUA 3GJSA 3L17A 2Z57A 3R9XA 1W85B 5IS2A 4MKFA 1JTFA 5KQPA 3ONFA 2WP8J 4NQ4A 3FIJA 4CKEB 2Z3ZA 5EN4A 4Y1RA 1N34B 2B8WA 3D5QA 5KDOA 1TPYA 4GMVA 4MUXA 2WIGA 4K7JA 4PS0A 1EFLA 3KOMA 1BMLC 3GQBA 4FNAA 3RVPA 3PENA 5EFOA 1BHJA 4OKNA 3V1YA 3MQFA 2CXXA 1MX3A 1PS9A 4G09A 4JDUA 4NMLA 3TXYA 3RVQA 1W87A 4IYRA 4E31A 2Q5LA 4V1CA 1H6BA 2EGHA 3NRBA 1JXAA 3QFRA 1U7TA 4NPAA 2FFBA 4NFLA 4TWAA 1D9ZA 5ALKA 4PHGA 3PDUA 3NALA 3RJ5A 4LN1A 2RH4A 5COAA 4PS1A 5IU6A 2KYRA 1NXOA 3QWBA 3N7AA 5JT1A 1RWNA 3ZXSA 2DCMA 5IHPA 1GPLA 2FPLA 3ZJVA 4LK2A 4LRYA 5G3YA 4E2YA 2ASEA 5CFNA 1OLXA 3EXFB 4U2FA 2TMGA 4ZK2A 3R4VA 2R5FA 1KQGA 2HWUA 1EINA 1B0UA 1MG5A 3K5IA 3K0HA 4JKOA 3WOHA 2MSLA 1UEIA 3EZYA 1EVJA 2H06A 2QZJA 5EJMA 1T9GR 2LZ0A 3R3HA 1XLQA 5K0EA 1XJ0A 4J3OD 2XUFA 4FSXA 4KQCA 4M8LA 5JJIA 3HR8A 5LXIB 4MRRA 1PGNA 3WISA 3GMIA 4TKVA 1LQUA 1UKZA 2BFWA 3I8OA 2YVLA 1XHLA 1DFGA 4JASB 4OMDA 2VF5X 1YI8A 1DJOA 3G8DA 5FL7A 1X1DA 3E3AA 4U2CA 4OZBA 4DJ5X 2PX0A 2R8RA 2A1UB 2BCEA 3MNFA 2SNIE 3PQDA 3O91A 5BSRA 4RQAA 4XGKA 3ROEA 5TVKA 5ARBA 2Z2JA 1MQOA 2R87A 1YA6A 3FTEA 4IO1A 4LQ4A 1ZN8A 1U65A 4GDKA 2ERYA 3FMOB 3N3BC 1QRUA 2QRPA 1FDWA 4EEWA 4US1R 1US8B 1OWPA 5KOIA 2RJOA 4LRXA 3G6WA 1A9OA 1N4DA 2PUBA 1A8QA 1T10A 3EG5A 4G0MA 4O8ZA 2Y93A 3I72A 4PSKA 2WWYA 1YBVA 3UWPA 1RSZA 1NR5A 4YMSA 5COBA 4C14A 4M8IA 1OU0A 2WHIA 1KDOA 3UHOA 3ZD7A 3R9WA 1P4RA 1A5SB 2FPKA 4DABA 3J9CA 5E3JA 2C1ZA 2RGUA 4MS4B 3P0JA 5DTRA 3ZHYA 3OG9A 4B3JA 2BMEA 3AR7A 2IIVA 1GZHB 4M0KA 3D5TA 5J3JA 5I45A 3ZDAA 2OC4A 3VHQA 3QLVA 3ON5A 3PEWA 1T91A 3BJRA 1IY8A 1AVTA 2FVYA 2XCLA 2RIRA 1IM8A 3K0FB 3DOCA 1ZM4A 2R00A 2LVQA 4EFKA 1TJPB 1MB4A 1QU2A 2AN4A 1PIWA 1U02A 1MQ9A 1T5BA 5DYYA 4PLZA 1FTGA 3JQQA 3X23A 5ENVA 3R5SA 1Y3DE 1JQEA 4QXPA 4B4KA 4R3DA 5CFQA 2A59A 1Q16A 3VHLB 3EHEA 1W59A 3CX4A 2R6FA 5K6AC 1Q7BA 3UN1A 5KYVA 1T3GA 5FUWA 1SQFA 3KNZA 1T5HX 5HIKA 4DDVA 3EVEA 4WH4A 3ZUNA 2Y2VA 3ZX5A 3RYTA 1GGVA 3BIFA 4GDMA 4CM4B 2ZYAA 5K01A 1CQWA 4IOMA 1AHPA 4TSSA 4GX0A 3HUDA 5A1TA 3DTNA 1QHFA 5JVDF 1Y8ZA 2QQ0A 1BCSA 1B3RA 5IUJC 5C3JB 1FP4A 1MW9X 4UUPA 4AJHA 1CUUA 5H80A 5GZ1A 1EX7A 3M49A 9LDBA 4BWVA 4EUTA 3FI9A 3C3EA 5BMOA 2EKIA 3HCRA 2MU1A 4L6AA 2EJUA 4AG5A 2QVLA 4AWYB 1XD2A 3GLHE 4AN1A 3U6KA 2LGXA 4G1VA 4LDQA 1TF7A 5B6PA 3HDVA 5EJ7A 2PVSA 4P84A 3UY4A 1VDZA 4OM7A 1XL1A 5DSXA 2EQ5A 1L4BA 2WAYA 4MUBA 2XWQA 1DIRA 4K6GA 2A0FA 3I34X 4Q7EA 2OUIA 4RIIA 1GTZA 1ONBA 2QGFA 1LW7A 3RABA 3LA8A 3B53X 3WK6A 3VO8A 3KLSX 2QX7A 2O48X 4U5XA 4L7VA 3KT0A 4AY5A 2MIIA 3DD5A 1LJUA 4BBNC 2IELA 1X9HA 3NUHB 2WPNA 4HEA1 4LJ6A 2DHQA 4Q7KA 5G0TA 4RTRA 2H2IA 5EYPB 1GKYA 2VO1A 2YHIA 4HAVA 1VYTA 4U9IS 3INNA 4Q66C 4E5UA 2PGNA 2WZDA 4KQHA 4RS3A 3HYTA 2AG6A 1ZSYA 3F9OA 3DKKA 5K3SA 4HK2A 1EP1B 3I6QA 1FW6A 3EVGA 3QKIA 5JXJA 5AW3A 2HMTA 3S5JA 4KZ0A 4NMWA 3KLMX 3ZEIA 3D6TB 4ATNA 3BTOA 4AB1A 3W04A 4HAIA 1U99A 1Y7LA 1YCFA 4M6WB 2W8ZA 1CFZA 3GCXA 2IRWA 3KE8A 1SMLA 4DRYA 4QYIA 1P1CA 2ZB7A 3KKEA 4YJHB 1I6LA 1Y4UA 2Z6QA 4LRQA 5AUOB 1E9BA 1E98A 3ND8A 2KVZA 4Z0HO 3T9CA 4IM2A 3TUOA 3NWEA 3DR3A 2MBQA 4A8TA 3DVLA 3PLAE 2R6DA 4US9A 5LMZA 1YI0A 4L5IA 3IL2A 2IXTA 2VSXA 4MAAA 1UH6A 1F48A 2P4QA 3JQBA 4C2AA 1ILEA 5TR5A 2OFPA 3WVNA 1VL5A 3JAMA 2D8MA 1EZ4A 3F9IA 1KVQA 2O07A 4WDRA 2JGFA 3REQA 4ZIRA 5AWFC 3NZSA 3OPQA 1EDBA 4WNCA 2LCQA 3HKBB 2CDRA 4X3OA 2PLFA 4YREA 4DADA 1UP7A 5AVXA 4EKGA 4HVCA 2PBRA 1JWBD 3VHTC 4CKZA 3M6MD 4FU0A 1WXXA 2OSBA 3QXHA 1ZE3D 3E9EA 3EDYA 2OCGA 3FJOA 1EKXA 3T5BA 4C4VB 1SA0B 1XZGA 3MPOA 3GX1A 1DJMA 5B58T 3W8RA 3FPEA 3RFZB 1Y81A 2BFCA 2ZU0C 1P7EA 2PMCA 1VSTA 2OCIA 3DPSA 5JR3A 5KSOA 1IK4A 1EK5A 5KKAA 2JD0A 3LUDA 3NZUA 3ZDXB 5AI4A 3UWOA 4S1VA 3FAIA 1DQNA 4EL0A 5CNMA 1DADA 4XDZA 1QCCA 4O4HA 4CG2A 3Q3NC 1CUIA 4W8OA 3HU3A 4G1UC 3FUWA 3PQ5A 1XKTA 3NHMA 3OCCA 4BMDA 1XK6A 5KJFA 4M21A 3TG2A 2YXBA 2QS9A 1U5CA 3A2LA 2O7SA 2PRZA 5C53B 1JFRA 3AR4A 3ISJA 3TSSA 3F4BA 3W6NA 2OLEA 5CEFA 3O83A 4CMIA 1TF5A 3C5VA 1VE5A 1UFRA 2KLBA 5EVJA 3SQDA 4ZVTA 5FLYA 2PUGA 3KSRA 3DEZA 1EG2A 2BMVA 4EY5A 1LBEA 2BKVA 4X65B 4PX5A 1GQOA 1EAYA 3F3MA 3HLKA 2N9XA 3WV4A 4QXRA 5K0WA 2I87A 3AX6A 1I1QB 3LGSA 2A7MA 3SFDB 1CTQA 4G0ZA 3FNQA 3LBIA 3WNBA 1XLVA 1RYMA 1OBOA 2D62A 3IVXA 4HNGA 4F91B 4UBIA 2X42A 3EW9A 3PE4A 3Q15C 5B5SA 4F1WA 4PQEA 2D1FA 3GLGE 1K7FB 1DVRA 5HGJA 1SIOA 2I54A 2X0FA 3DL7A 1NWCA 2E55A 2MYUA 1QF6A 1UAGA 2JXXA 4EG1A 2FN8A 4XSHA 2FWAA 4UBNA 3RJZA 4KBFA 1ROEA 4LY3A 4GDLA 4Q1EA 1CP3A 3WV5A 3TXXA 2Z2XA 1Y9ZA 2UZ1A 3OOYA 2GZ2A 4K1RB 5L3SB 2VYVA 3A9JA 3TD9A 4CMJA 1UK8A 4PRZA 1Y9EA 1IATA 1JLLB 3E18A 4MR9A 4CMAA 4TV9B 3A2MA 1S89A 4C1DA 4DUGD 4WBNF 3NAZA 4KYTA 1DCFA 1YJAA 4J0JA 1TTNA 3T0GA 1P9DU 2QG6A 4DDUA 1U7ZA 3E58A 4E13A 1LZLA 4Y2GA 4JR1A 5JEEA 4ISBA 1M1NB 1SHLA 2QR3A 3H0EA 2ZIAA 5IQKA 4MKGA 4YRZA 3CW9A 1KVRA 4DBZA 2A6PA 2C4TA 3KZKA 1SBYA 1U9YA 1MO6A 4I1OA 1WMDA 1KZYC 3T52A 4BAUA 4TZ6A 1SVWA 2WPDD 1M2VA 4CEIA 3VR6H 3E5RA 3B2EA 3F7TA 4M86A 2XI4A 3KH0A 4BKSA 2F3UA 3PX3A 3LUAA 4HS9A 2PLRA 4IIBA 4QTZA 1NRWA 1HFJA 2QL9A 4A8JA 1K7EB 5C8YF 4DR2B 1JIKA 1YR7A 4W9GA 3CTMA 1OI7A 3EQ8A 1G17A 3B9QA 2OXTA 4B0OA 1SHKA 2YMQA 1RZRD 3OA2A 3HVZA 1JPNA 1S96A 4OHJA 3KALA 5TSSA 1P1BA 4IVQA 3IT4B 3HSYA 5FOQA 2QWXA 4WFKA 1SVLA 5CLJA 2GEBA 3BWCA 4EGCB 5JC1A 2C5LC 2LGIA 1F3LA 4JYBA 3UW3A 2HJ8A 4B32A 3I6MA 1N2IA 5IEJA 2V3CC 3NOOA 4CKCB 5HI1A 5K4NA 7REQB 2JEYA 4TVBA 1Z06A 1UC5B 3VVCA 4P93A 2PLWA 2AZMA 4D0NA 4JUIA 3PL1A 1NDUA 3T3PB 2LGJA 1OTYA 4A4DA 4R8KA 1MG0A 1RFKA 1I7NA 4FZ5A 3AW9A 3MGAA 5K4AA 2YN0A 4RTLA 4N58A 5IXJA 2PSJA 5JS1A 4X8MA 2H85A 4MICA 1HOTA 4Q93A 3BMNB 1O95D 3IQHX 2EYUA 2R47A 5JASA 1AN8A 1UMCA 4C5CA 1DG1G 1JQKA 1YQWA 2XZPA 4AD8A 3CKMA 4RMAA 2V9HA 1WUHS 5LNK1 4QOFA 3HYLA 4DDMA 1N7JA 4NK5A 2ZS8A 2RPVA 1J70A 3B36A 3QKSA 2DR3A 2R8YA 4JI5B 4DIEA 3UAXA 2WSLA 1H4TA 4ZO6A 3ZXVA 2YBEA 1CIPA 4FLFA 1JLMA 2OKGA 4KWHA 1XALA 1QOBA 1Z07A 1X7XB 3SQOA 1J21A 5C7IO 4NQ5A 4N8EA 4PNEA 2CB0A 4K6HA 4Q03A 1QDLB 4AULA 1J25A 3QY9A 5CB6A 1AKNA 2YVKA 2Q4DA 3I6IA 4GN1A 2HCRA 3H2KA 3N2KA 4G8CA 1ZK1A 4OBWA 3KLOA 2XOKA 5KYXA 4O98A 5EE9A 4OXNA 1XZ8A 5CA0F 1YQUA 2VHCA 2VP2A 4YT4A 3NJ8A 3RASA 1PHRA 3AFIA 1KRWA 2CHEA 2W6CX 3L4BA 1T0UA 5LLSA 5TE9A 1BQ4A 5PGMA 1VLVA 2H7YA 1ZD2P 4P34A 4HLUC 3WR5A 2H2HA 2XB2A 1R8YA 4XUEA 3OAAD 4JLOA 3VU0A 2IYRA 2K1FA 2ZYTX 3IEXA 3TPFA 3X2SA 3OHSX 2GRUA 3ZLVA 5JDIC 4EXYA 4DK5A 3K9HA 1L2NA 3MTIA 3JSVB 2QSJA 3SKXA 1C7IA 5FP0A 2OBLA 2H1SA 3EVTA 2CVQA 3IEVA 5M04A 1ZLYA 5JD3A 3M33A 3F3SA 1E1CA 2M6KA 4RSHA 4KXXA 2BBOA 1TUGA 2GCIA 1X7HA 5K8TA 4D46A 4OXRA 4XRRA 2XRMA 2YIMA 4DC1A 1KMQA 4TM7A 1RJWA 4FW8A 5E7QA 4UHDA 4BQIA 3H84A 3TE7A 4HAWA 4BAZA 1CY1A 5B3LA 2X3UA 2JJQA 1XVAA 3QW2A 1X13A 1OVMA 1HT3A 4RACA 5IM4A 2WMDA 4F1KA 4DVGA 1A50B 3NJTA 1CJSA 3RLIA 5F2OA 4WAAA 3KJHA 4LXTA 3UXYA 2BFLA 2J5KA 1A76A 4RK0A 2AB0A 3U49A 2NTYC 4P54A 1FSSA 2QN9A 4BVEA 3GA5A 4I9NA 3O7MA 1WNTA 3KDAA 3KQHA 4RE5A 3A8TA 5JDCC 1PEAA 2HA3A 2AYYA 2BHRA 3GAMA 5AJTA 2XRZA 1Y9AA 4G3XB 1B43A 4Y2SA 3SOZA 4FD2A 4P98A 1ODSA 3BXOA 3T9LA 4JK3A 3WGOA 3J81A 3IPRA 3ZTDA 3D8SA 2ZRNA 3GLQA 2QT1A 3LT5A 4WOCA 4ZI2A 1U31A 5LD2B 4D9BA 1JHPA 1D3ZA 2CE2X 4DA9A 3VRAB 5JPCA 3Q3JA 1GUFA 2A0UA 4XD2A 4M0WA 4UEWA 2VYND 5AHWA 4FIZA 4G1BA 1RBQA 1G2QA 1ZBQA 3TM5A 3K0SA 1KTKA 2IEGA 3D7LA 1E5QA 4G4SO 4E2XA 1TIPA 3DTTA 1NE7A 3UC5A 2W2MA 3EEOA 4AXXA 5F5XA 5TGTA 3OCJA 3A9TA 1QVZA 1QLWA 1EBBA 3Q8CA 2KNBA 4MVJH 4CIAA 1L7DA 4DLNA 4QQ8A 4XGNA 4ZKEA 1IUPA 1IP9A 5F9FA 4HR7A 1HSZA 4WKGA 3SFVA 2KZRA 4MH0R 2VAXA 3KR9A 1VKRA 2VDMB 5CCBA 2KTRB 1KK0A 3E1KA 5CGZA 3UBMA 3AO0B 4RL4A 4WKPA 1Z5UA 5EXEA 1GRVA 4MEMA 4U0JA 1W581 4QLBA 4R54A 1Z5PA 4MYTA 5HIJA 3B6KA 3DXXA 2AZXA 1KQOA 4PYIA 2PFSA 5DYNA 3U7JA 4NZZA 1STOA 4Q2JA 1E0SA 1NUPA 5KHOA 2EF0A 4KJZA 1R66A 2J6BA 5ISMA 5ITVA 5MGNA 3TL6A 4E1AA 2IT1A 4UTVA 4RAQA 1Y3AA 5KWVA 2C8LA 3C97A 5IP5A 1VSUA 3HABA 2Z2YA 3ONDA 3RN9C 4XQEA 2QVGA 2Q7DA 1R4MB 2VC2B 5JSFA 3IDQA 4OI2A 5FBQB 3VR5A 1CJBA 5IDYA 2HWWA 3UCEA 3ZGNA 3W4JA 1YZNA 3G8AA 1FLNA 4UC0A 5C2JB 5JRJA 2CJOA 5B4UA 4Q16A 2D6FA 3RU7A 5LU9A 2P6RA 5E7JA 5H16A 4LWZA 4C4SA 2HH9A 4TTVA 2DYMA 3ZGVA 1CY0A 4ZV7A 4X54A 1UBFA 2PWZA 1ZIOA 1F8FA 3KKOA 1RYBA 1XZBA 1QHXA 1U7DA 3KBBA 4AYWA 3AU4A 3IBGA 1C77A 4E4TA 4Y2RA 5BNWA 1Z47A 5DCNA 1E4YA 1UXOA 4B3IA 3EAFA 3JXPA 1V9CA 3ZDZB 5A4MS 2F1JA 4S17A 3ZUGA 5FKJA 4KITB 1ECLA 1N2CB 2KFKA 5LCHA 1HC7A 5EOVA 5IJ0A 1NYTA 2CVFA 4HO1X 4U7WA 1FP7A 4X00A 4W1PA 1EFDN 1HDGO 3S70A 1AQJA 1XHFA 4MV5A 3UQBA 2HSGA 2BJWA 4I4LA 2FI1A 2QM3A 3PHLA 2FPPA 1S6YA 1Z2DA 2X9LA 1QO0A 1WS6A 4KQWA 1F4LA 2JRIB 1WR6E 3OP4A 2C2KA 4Y6GB 4JWSC 3RHSA 3C14C 1T9GS 4YVFA 4Z4QA 2XQGA 4QYMA 2MP2A 3QYAA 1U3UA 4AWBA 4I4TF 3FUUA 3P45A 2P68A 2PXAA 2E6UX 1YNOA 3B9RA 3VUFA 2BS4B 3K92A 5HJ2A 3ND6A 3M9LA 1F4PA 4NOJA 1T5TA 4TTQA 3Q3IA 2OQ2A 3JYLA 1SKUA 1TGYA 3WYNA 4FGWA 3EUWA 4AFNA 1SUPA 1FQKA 2OYCA 4EY8A 1DIGA 2I2WA 3NGXA 1ZH6A 1RRGA 3X30A 1IAQA 4DF3A 2W71A 1L5KA 3MBOA 2DT8A 2HA5A 4IUYA 3LDUA 3VBEA 3BFPA 4TS1A 4NAMA 3T7EA 3FYCA 2Y1XA 4LF9B 1QOFA 3F2VA 1G18A 1XMPA 5FLEX 2QTGA 4IICA 1JHVA 2ORED 2NBVB 3SIPA 1IPGA 1OH7A 4DJJA 3R8BA 2E3JA 3ETLA 1XZPA 4WMLA 4B3BA 4F9EA 1U3GA 4YAWA 3STUA 2KXJA 4HDQB 1YN4A 1CC1S 1EM8A 3OT1A 5A03A 4KE8A 4YTEA 2Q7OE 2Q2OA 4GXNA 1QOQB 3H42B 3WWOA 4UWOB 1BE0A 2FW7A 2XRYA 2QYSA 4DCJA 2IP4A 4ES6A 5J4KA 5CXXA 1C0KA 2W6NA 4YO7A 3IDAA 4H27A 4Y2JA 2FPMA 3EDRA 3PFHA 3A70A 3BGWA 1YKGA 3MJSA 1DOHA 4HT3B 5E1DA 5K1ZA 4X7BA 1WB5A 4K1LA 1GY8A 4LSMA 4GGPA 4PX2A 2YVCA 4CFZA 2AFRA 4N8DA 4P4NA 5BY2A 1E6EA 4FFBB 4BCDA 1A27A 1ZM9A 2AH5A 4YJFB 3ML1A 3W5AA 2H8GA 2V59A 1MOZA 3T5PA 4G36A 3OEEA 1FS5A 1GGJA 4M1YA 4URHA 3DAPA 4EHDA 3HJRA 2ATIA 3IJRA 2MR6A 3I2HA 2B82A 1HE5A 4C0LA 5JQGB 3RC8A 4ER3A 2FNAA 5JMOA 3W8DA 5AKHA 3M1LA 4EOYA 3ER9A 1RXIA 1SXGA 1I36A 2J9XB 1DWOA 3DULA 5KJEA 4CMCA 3EVBA 5CFLA 4NHEA 5EHQA 5B2FA 5DPXA 4UCWA 3H16A 2ISSD 1WR1A 4XX0B 1ZMBA 3MT0A 1RQRA 3EWSA 1P75A 4IV0A 5ERGB 3ND9A 4CF5A 2ET6A 5AVUA 8GPBA 1H2YA 5EJGA 1K98A 4II2A 2G4VA 1TCBA 2VNJA 4C6TB 5BVGA 2BTOA 1E6LA 1SCDA 1GSAA 6NULA 4R98A 1Q44A 4MV0A 3PUKA 4ICIA 3SAJA 2YZKA 1ET9A 3NEJA 2X0RA 2EP7A 1E5DA 3GHYA 5LXTF 1R6AA 3IAS1 2WZQA 5TV2A 2W6OA 3ZK8A 1KQNA 2XB4A 1A7AA 1E32A 4K9LA 4DQDA 3QVKA 4FE7A 2D4AA 5HIPA 3IAUA 1CULC 3T7IA 1KS9A 3VUYA 1Z0FA 4FXOA 4HH1A 4CW7A 3MSXA 4ZRKA 4DV7B 1SUFA 4LAFA 1I7QB 1QB8A 4IY1A 2OEPA 5F9HA 2QILA 1MC5A 4XD7A 1NGSA 4HTFB 3EUFA 3AILA 3Q40A 1WCIB 2XBUA 4L95C 2MJDA 4DXDA 2HFJA 3TUJC 1GQ2A 2UYHA 5EJ9A 1E89A 1UH5A 3D3WA 3LF2A 3GB1A 1KYTA 3RROA 2JIZD 1Q0UA 1KH0A 3T3OA 2WR8A 4M02A 4Y1GA 3DE3X 1CT9A 2NU6A 3FCXA 4H1WA 4WESB 2A88A 2FZWA 3UEOA 4OFZA 4PE5B 3F5QA 4BKGA 2CNKA 4NECA 4X7PA 1AGNA 3SHOA 3GNSA 4EYSA 4WBXC 3I42A 4M0UA 4TYFA 3FZYA 3VC3A 5D3ZA 3PDIB 3LYAA 4S0ZA 2IYAA 5JSZA 3R7FA 1DPGA 3HPRA 4ID3A 2WICA 3NHYA 1TRKA 1VJGA 4EKYA 1BXKA 4HVTA 1KQ3A 4CTNA 5HNKA 4QPZA 3AKEA 2W70A 1CVIA 2XMQA 3P0IA 1WHTB 3NUGA 4OHYA 2V3PA 5C23A 4UE2A 3NJ4A 4OZAA 1KY3A 1N92A 5K0JA 4MWSA 2DR2A 4K9NA 4PVTA 1UXIA 1VMIA 4IM3A 3HUFA 3IV9A 4PGMA 4MELA 1DDKA 2G9ZA 1T3TA 3HRDD 1F52A 4B5LA 1EFCA 3ZCRA 2V6FA 3NIFB 2YWRA 3U3XA 2YHBA 5G02A 4IRUB 1U9CA 2VTBB 4KHPB 4TQ1A 1ZMTA 2ZROA 1LDYA 3O26A 2K6DB 1OQAA 5IJWA 2ACZB 2WABA 3BWDD 3CF6R 3JQPA 4M9RA 1JYEA 4OHRA 4R3NA 4U1RA 3BY4B 4LXUA 3MQ2A 1E2GA 1NTRA 5IHXA 3L6CA 3EMKA 3VPXA 2NVUI 3SGLA 2BR3A 1KZHA 3TDNA 1F2RI 2R66A 2I6TA 4UHJA 3OLQA 1ZC3A 3HO1A 5TRTA 4FGUA 2Y8BA 4DDTA 3WE7A 1KR3A 1XMJA 2NUBA 2ZPAA 3VTZA 1FFGA 2NUAA 2K2QB 1FDIA 5L3RA 2W2LD 4V0LA 3ZCXA 1EIWA 1VL0A 3DEYX 3ZRFA 5HKBA 3L1KA 3LHKA 4ON9A 4RW0A 3EHDA 4G9EA 5DPMA 4ZPXA 3FGNA 2BWFA 5GTDA 1U04A 1PJTA 4AJEA 1FQJA 3FCOA 4M9XA 3DZKA 1GTSA 3BGOS 2I1QA 4KAXA 5LA6B 1IN8A 1YK1A 1VJCA 3LBFA 4TZFA 4IO0A 2A9JA 1FDVA 3RAEC 1CF9A 1WHSB 4MDHA 3UV7A 4BZPA 4QGSA 1KVTA 1HKUA 1WDMA 3GB9A 2PX8A 1UMBA 2ODNA 3X0WA 4FXCA 4H1HA 3DVGX 4NZLB 4MK4A 3I2JA 4FNGA 2UYYA 1IOLA 3I3TB 4BWGA 3L7MA 1DU4A 3L79A 2OBNA 3EPHA 3RREA 2LDXA 3VH3B 3RRFA 3BB3A 4P2BA 4BQFA 4M1OA 4QVGA 1V1RA 1L7AA 1SJ9A 3JZFA 5CYGA 2VQSA 3GRPA 2MW5A 1AQIA 3S1AA 3DHHC 4EFZA 4TSFD 5M2QA 5FTWA 1E2DA 5HM8A 2FG5A 2DAFA 2HJHA 3A33B 4ZT4A 4HJRA 5DPSA 1UODA 3SXUB 2FSGA 4ZQFA 2P9BA 3Q2KA 1MEEA 3H0KA 3X2FA 4OAOA 1ZMOA 5F1OA 1OZHA 4FFLA 3RYIA 2CF5A 2PH1A 3AE9B 4ER7A 3OEWA 4FX5A 4UXJA 1L0YB 3SLGA 3LC0A 1Z2PX 4W5TA 4XW2A 1P3Y1 221PA 1O4VA 5BYSA 1H0SA 1A88A 3WK7A 3FOWA 5K0TA 2PGXA 4RCOA 4G5GA 1GZVA 3WLQA 3RIHA 2ETVA 1WDKA 2OE2A 2DT5A 4IZIA 1BRMA 1EU3A 5ES3A 1YQ4B 2LCIA 5CHVC 2PKOA 5DNUA 3MWEB 3VAYA 1NV9A 3T1HB 1UKBA 3BJZA 3W77A 3A1SA 1P73A 3AI2A 3R66C 4XYLA 2O05A 2VYQA 2J46A 2YVQA 3O8CA 3KKZA 4TMZA 1S7GA 3RU2A 2VZ8A 5DW3A 2I8CA 5JYEA 4GWGA 3H8JA 3D3JA 3ESXA 1KXZA 4ZQGA 1JG3A 3KBOA 1QG2A 2QQEA 1EFHA 3LDZE 4Q3EA 2Q46A 3EFBA 3V05A 2X9GA 3LUFA 3QYJA 3C16C 3PQFA 5C5EA 3WL5A 2RG7A 5HSGA 2RKOA 2O7RA 2QPTA 4XVQA 3QEOA 1RAEA 3TLJA 3EZ6A 4LBYA 1B14A 2EVWX 3RNLA 2H0AA 4FN2A 4PZYA 3TEXA 1QIKA 4Q4JA 2DENB 2F3TA 4FILA 1U7HA 1QYXA 2NSLA 5SY9A 2PVGC 1C79A 4BB0A 3ABIA 4LFBB 3P2UA 1EXVA 3QW4B 1KOGA 4LOAA 5K5EA 5IBCA 1VJTA 1FZTA 3TZEA 3K35A 4KRFA 4ROTA 1UBEA 3ANXA 1YBMA 1DB3A 4H0CA 1XKXA 3QX3A 3C5WP 4BO8A 1QUEA 2BFMA 3OA0A 4AKSA 1Q14A 2PKRA 4LDJA 2V96A 2IHVA 5EVCA 4N54A 1H6CA 1VC2A 4EQ6A 1FS4A 3UPUA 3WAMA 3HZOA 2V98A 5H3CA 1L2TA 5HKKA 1CQJB 4NZ9A 1C9JA 2VKTA 2QVXX 1K5DA 1U4NA 2H4FA 3QF4A 1EHIA 3EXAA 2Q5OA 5G0VA 2IEBA 2NR2A 3CNOA 3A0UA 5IEBA 3IHLA 1K06A 2J0SA 4HCPB 5C8DA 2P5SA 3WQSB 1KZ4A 1B4DA 1WXSA 3KYCA 2QKYA 2YJTD 1MO3A 3D8HA 3WDSA 3R75A 3ZK9A 1BOOA 2V58A 3SR4A 2N1BA 3FCCA 1UZNA 4WECA 1ZM7A 3TL3A 3U09A 2WJPA 4CLRB 1D6SA 5C8XA 1TEZA 2GTIA 1EUZA 3QI2A 1OAKA 2XCTB 1Z3IX 1NY5A 1JU9A 1FLDA 4KQ9A 1VJ5A 1CFJA 4OREX 2KE5A 2O3JA 1I2ZA 2V0CA 2G06A 2D2FA 2YMPA 3NM6B 3ROFA 1E9SA 3LVQE 1OIXA 4FZVA 1L4DB 3IIJA 4DL9A 1FMCA 4JZKA 5LQMA 2XUKA 1SPBS 1ZUIA 2JANA 3WWCA 5EE3A 4JI8B 2BF7A 2HZBA 2PDAA 1SUAA 4W9CA 2I2XB 2E2WA 5AM4A 4KKJA 4NX2A 3ESZA 3BRQA 3L07A 5E0KB 3I2IA 4RF2A 5D01A 4UAMA 4YRTA 4ALIA 2Q0HA 4AKIA 1HF3A 3KOZA 2RDHA 2AFHB 4NQKE 4LISA 1ODCA 1X42A 5H4HA 4IQFA 1AN9A 1MABB 2IYEA 4ETNA 1DFHA 4UTPA 1AA6A 4ZVPA 1WZ0A 2O1WA 2H08A 4NDZA 5KVAA 3OE5A 2ON6A 3HV2A 3BGVA 4B3XA 4DR4B 1V5IA 3A3NA 4ZOAA 2XUAA 3KOWA 2RHRA 1EFKA 3AEDB 4YAUA 1LRKA 1L7BA 3FRJA 4PLHA 2BZ1A 1X1BA 1G1MA 4YQZA 5TMEA 4QULA 2HPZA 1D1TA 4EF4A 5ALPA 4UWPB 4OZCA 2GF0A 2BEWA 4AZVA 5A6VA 1KI2A 1U3DA 3GGOA 1C1HA 3W7VA 4FW9A 4YHBA 3I9OA 2OV8A 3UWMA 4AQDA 1Z2MA 4CHKA 3UWDA 2HA4A 2DFTA 3DKRA 4Q9DA 2HT6A 1ADGA 1ZUNA 3MJ5A 3E9ZA 3TJRA 3EWNA 4A0HA 1TMKA 3N39C 3NS1A 5B1SA 3PRJA 1DO8A 2I4TA 4DARA 4AUNA 3IKVA 3D7MA 3ESCA 4ABYA 3VU8A 2EFJA 2WG1A 2W0SA 2H5LA 4DS3A 5JSHA 4MR7A 4CKWA 2FEAA 1EDEA 1VXRA 4AUEA 1IEVA 5HFYA 1N6ZA 3PPYA 4COOA 2I9PA 2PXCA 1MCZA 3IQWA 5ICMA 3UBTA 5BN3A 4HSEA 4GOND 1XZNA 3IUJA 1PJ3A 3DOJA 3AEXA 3DNMA 3WZMA 1XLNA 1U2GC 2WUDA 2QE7D 4XJSA 3ODPA 3UMYA 4J90A 3U4HA 3RS2A 1CUXA 4HLCA 5CUQA 4RAOA 2GZAA 3NV9A 4Z0NA 6Q21A 1M33A 4QYSA 4R9SA 3U8ZA 2FETA 2KFJA 2OK8A 1TUIA 5ECWA 4Y6RA 1I3KA 5FUBA 5CBPA 1IBXA 3RTAA 1M2OB 1BJRE 1LPSA 1IUEA 4ENWA 4AMBA 2KN4A 1ST3A 3ZQKA 5DM60 3PNOA 1GL7A 2D5CA 3RAPR 3ZDFA 1UBMS 2RB5A 3QWIA 3BYYB 2HXYA 4L9RA 3DHGC 5C4GB 4NPCA 1U0GA 1L1FA 1X8GA 4XAQA 1OZ0A 3NFRA 2CLKB 5FWYA 4RXUA 4BP9A 4CLXA 1M8GA 1ORRA 2X8WA 4BX0A 1AS3A 2GFJA 4DNOA 4LV8B 1J33A 5EP1A 4D4HA 1B0AA 5EEGA 4Z5ZA 1EF1A 4M8MA 1KSHA 4KTVE 4LJ5A 4DXHA 1MVLA 2G9UA 4GT1A 4X9XA 3TW0A 4G1MB 4NVRA 4RULA 3PV0A 5ELMA 3KC2A 4J07A 2YNUA 1G5IA 1KF6B 3W90A 1D2CA 5BPFA 4JD5A 1DG9A 1OXVA 4KDIC 1PSZA 2JNWA 1QKIA 2EJBA 1CE8B 2QC8A 1XLTC 1EVKA 4K9KA 3ZHXA 3PGJA 4HOYA 2YZMA 5K8VA 3GRAA 3LPDA 2VA9A 2OYSA 3L7AA 3PT9A 4Z3KA 4QUBA 1SD1A 5E6SB 2Z6AA 3N0VA 4FFRA 3UB4A 3MTEA 2CC2A 3C3YA 4LYEA 1E69A 1OQRA 1W34A 4ANVA 2B83A 2Y6VA 2CYBA 3A3YA 4MLDA 2HRBA 2D54A 4WKBA 5DTIA 3SP1A 2B4TO 3H11B 1KFJB 3AOGA 4LV6A 2EEPA 2RFLA 3UH1A 4BV3A 4QX6A 4CR6A 2AUTA 1ZH2A 3RUHA 2DU8A 2C99A 4CM9A 2BSQA 2XK5A 4X1YA 2UVQA 2Q7XA 4YMUA 2L32A 1C3OA 2BEVA 4WN9B 4P3KA 5AUIA 4DJAA 3L0YA 1T4DA 1L6IA 3NVWA 4AWZA 2OYRA 1GCGA 1ZIDA 5HFJA 1C7JA 2NM0A 2APJA 4DDGD 5KTTA 4JQSA 4NESA 1TECE 1TYEB 3ZC3A 4AJ2A 3UAYA 2UUAB 4OK6A 3V3XA 1HT2E 3ZHOA 1T8RA 5DX1A 4UU0A 3OJ3A 1IMJA 3LNCA 2LBPA 3IVFA 3WKCA 1ZP0B 1FXIA 2Y99A 3KLBA 3KUZA 4LNFA 1G9XA 4IG9A 4EX7A 4INPA 2IU0A 2ZSKA 3P71T 3I32A 4KLNA 4BQSA 3U4DA 2D1TA 1GWNA 1A5AB 3U17A 4REQA 2ZUWA 3UGKA 4RM2A 1G4HA 5LMCA 3GZNB 3FR7A 2NIPA 3ZXUB 1WB4A 4PYQA 2PJRA 3PLUA 1GUZA 5A5ZA 1BKDR 3RS0A 2P7IA 3GGJA 2D0DA 1RVV1 2BFAA 3NDRA 4CKBA 3M62B 3FW1A 2MCNB 3UUWA 1QG0A 1JQBA 2KBEA 4ZMBA 1Y8QB 3L43A 3RSZA 1DHRA 4FP9A 5F73A 4KQIA 5EESA 3SBEA 3I61A 2VSFA 1XQ9A 2OB2A 5D1HA 1X7DA 4F92B 3AJAA 2WUEA 3OJLA 1U2SA 2OT3B 2GJ9A 4XC2A 2OA0A 1U4AA 4UCFA 1J23A 3G1UA 4JXKA 4R68A 1SOMA 2GNOA 2WFAA 6CHYA 3JV7A 3VOTA 4RZUA 1Z08A 3G02A 4BC1A 2W5UA 4JLBA 1H22A 2YS6A 2LWIA 4YWGG 5AZHA 3H05A 3GLSA 4ZOEA 4XPIA 2BMAA 1MLDA 1N36B 4YQFA 2RGRA 3E9SA 3WAKA 4P4GA 4G0NB 1EPUA 4B3TB 4MAMA 2WAXA 3WYGA 1P0PA 1DYQA 3AQIA 2ADFA 4GWKA 5FD8A 3HXMA 5B6IA 2JZPA 4NAWA 1V3TA 4G07A 4OB6A 2WX0A 2EHDA 3DBLA 5BN5B 3PFNA 1C2TA 4AF7A 3GT4A 5FI3A 2WNIA 1AXEA 3C43A 3PRMB 3FPAA 2JAOA 2OV3A 2H7CA 2UZ0A 1VJ0A 1VSVA 2A0KA 3D32A 1R0LA 4NJEB 5JAMA 4KR7A 3RSLA 1VYHA 1Y1TA 3WRYC 3PD0A 1XO3A 4NCHA 1QILA 3BEOA 4G8DA 4LWPA 2J3MA 1SU7A 3H1TA 4ZVKA 1OX4B 3LUKA 4ZRPA 5G40A 4R3WA 1IGDA 3I30X 4PN7A 4CEJB 4PNPA 2D2IA 3WNDA 4PCAA 4YO8A 1PEKE 1WXAA 2YLMA 2P65A 2Q8PA 3LY7A 2EOAA 3P9QA 4NDNE 5GVSA 2E87A 5EQTA 2NAFA 3H9DA 1SC3A 1E5LA 3ABOB 4DA7A 2VDUE 2QMYA 3GA7A 4X71A 5DHQA 4GNRA 4WJKB 5DE3A 4KSKC 3MJHA 4BFCA 4LNUB 5L7YA 2NTJA 4AIRA 4XVCA 2N9UA 3PC2A 4AG6A 2R25B 2K9XA 2PPHA 3WQQA 2O5VA 1H2BA 1AOXA 1SCJA 3L4KA 4GIVA 4U39A 3F7MA 2BBCA 3LDGA 3EOZA 4KXQA 1BWSA 5FO0A 1H9CA 1NW7A 4R2MA 3HA5A 1WIAA 3UT0A 4BC0A 1A04A 2CUTA 4Z9FA 4BGDA 1DDGA 2DQKA 5KX5F 5HYVA 4IZ6A 3AJ8A 1NW5A 4YS6A 1Z0IA 3KJQA 2IY0B 1RAGA 2CLHB 1SZJG 2OWEA 1ZUWA 1SWWA 4OUDA 2G63A 4BV9A 5EIHA 3CUYA 3KR2A 2HL6A 2WKWA 4D2KA 4IKOA 5ESXA 1HQCA 3RV3A 4BKQA 3EZXA 4WIPA 1L7MA 2O2VA 4PYKA 1Z68A 2A35A 2A9PA 4J1NA 1PEYA 4D1WA 5F35A 2EMTA 1P91A 1QH1A 1L5LA 5KDDA 1M74A 4NBWA 5JATA 5J17A 2BGTA 2WJAA 3N20C 4WACA 3SU8X 3NASA 3LTEA 4CTKA 4NG5A 5AJUA 2GPTA 1JR3A 3N8KA 2DUNA 3RYHB 5JHBA 1P4GA 1PTKA 1YE3A 4BKRA 5E1OA 5M3BA 4Y6PA 2D1QA 4QD3A 2O6VD 4XWTA 2G1AA 1ETHA 3ZW7A 2YXLA 2GM9A 1DBRA 3W7AA 4QLOA 3EIWA 3A0RB 4XZ4A 2LIVA 3A9RA 4NBRA 2X1HA 3CRNA 3K0KA 2P2NA 3GUYA 2IEAA 1ZSNA 1WQ4A 1SXJA 1TS2A 3KHSA 5E9QA 1EJBA 4PLWA 3ZU6A 3H5RA 2Q0XA 4CHLA 1K7XB 1FP1D 1XC7A 4FIDA 4EFMA 2J5RA 3ILSA 2JHCA 3A1VA 2B36A 4H0NA 2HIAA 2XZDA 1N60A 1OASA 1XROA 1R37A 2JPDA 3F7OA 4B40A 2QINA 2GYWA 2EHJA 1YS9A 1Z82A 4RZHA 3ILYA 1R4NA 4FMDF 2COEA 1L5ZA 5E1BA 2Q5CA 1G5HA 2QPAA 4NFYA 4OJYA 4R7GA 3LA6A 5DYTA 1JLRA 1Q57A 3IOMA 3L41A 1E0DA 4PFKA 1QH5A 2OJRA 3CONA 5EMHA 1YGYA 2NU8A 4PXAA 3TEWA 4KQKA 5IVDA 1N0VC 3IT0A 4L5YA 1DOAA 5E7IA 3A04A 5BNTA 4OQ4A 3VVMA 3B6ZA 3W9CB 4MW1A 5BQPA 1WU7A 5HKOA 1WUJS 4UW9A 4BAGA 4DC9A 3TZLA 2ZBGA 4YV0A 4LY0A 4B34A 3AZQA 4HX9A 3AIOA 3KP1A 4NTZA 2HLDA 4GLLA 3DEFA 4I6NB 2OQIA 4WUVA 1E4EB 1XJWA 5JCXA 2WD7A 1JQAA 2XD4A 3FLMA 1GYRA 1P3DA 4AL4A 4F5YA 1ZA1A 4D0LB 1V45E 3N58A 3GMTA 2WSIA 5FI1B 1JKFA 4RS4A 4MUFA 1RC0A 3PZDA 3QKWA 5LOVA 3TCAA 3KJIA 1I4QA 4J0GA 4F60A 2W22A 1ZD5A 1H4RA 3AHHA 1QQTA 1BC2A 1KIAA 1QE5A 4BLTA 3OT5A 2BYVE 3TBHA 1EBUA 3WGYA 4JL9A 3JATB 4BRSA 1F8XA 3QPBA 1UPUA 3MBIA 2JLCA 4YCBA 1KO3A 3R8CA 4IIUA 4DW8A 4JHXA 3FUTA 4OD0A 5T4EA 1EK6A 2WDZA 4CIDA 3UINB 3IR5A 3JQ7B 3AK4A 3NDJA 2NPTB 3I4FA 4XVHA 1PR0A 3KQNA 2FWPA 2IOQA 1GGEA 3BBPA 2QIPA 4RY8A 5TQ0A 3RD5A 3DHBA 1M7BA 4JUBA 4O8CA 1Y34E 1PN3A 1VSQA 1M94A 3B9PA 3QHPA 2GRJA 2R1VB 3TW6A 3F47A 3AL0C 1P1IA 3EZ2A 3UYLA 3ELDA 2RGWA 3GOHA 1MNQA 3QOXA 4GAEA 1MG8A 1WCWA 2WK1A 4MJLA 4WXPA 5L53A 4WKCA 1HH4A 1IY2A 4K3UA 4OI1A 4GL2A 1ZVMA 3TWOA 1NBOA 3AERB 3ELWA 5L8VA 5JUWA 3ZDDA 4ZREA 5ALJA 1JEYA 2XGGA 4HDRB 4UDYX 3GUCA 1Y9JA 2CFIA 2RH9B 1T3LA 4RJLA 1VP3A 4Z7JA 3MGCA 2R86A 2NXEA 2C07A 2V0GA 3EXG1 5I7RA 1D7AA 5LP1A 3LI2A 2P0YA 4DKXA 3EOAI 4OA8A 5ITZB 5KHQA 3O1HB 5A4JA 2ZZNA 4BKPA 4AYXA 1UJCA 1SVNA 3IP3A 5GVRA 2N1MA 4NBVA 5LWHA 4BE7B 3BH7A 2L82A 1SVUA 4HNVA 1XYVA 3CE9A 3MCWA 4X6YA 1WJ6A 2IU6A 1EWCA 2C77A 4MI3A 4H6WA 5L95A 3H9UA 2ZTHA 2VW8A 1JEQB 1K6JA 3GP5A 4D0RA 2FG6C 3A4TA 1A4XA 5DU2A 3X43A 3PSHA 4F8CB 1HDRA 2ZUCA 3B2QA 2CCJA 4KAFA 4C3OB 3FUCA 1TE2A 1PVDA 1YRAA 2JF0A 3HL4A 2XMDA 4HGRA 1EK0A 4FJYA 1JWBB 3B5EA 3UMJA 4HL6A 4YRDA 4IUBS 3V7FA 4PHCA 1BVTA 1QVAA 2V6GA 1X7YA 1AQUA 3HKCB 3RGGA 3U3DA 3O1IC 1TM5E 3M6XA 2GBLA 2YJ3A 1NKTA 4EGFA 3K8OE 2Z56A 1KFKB 3HBJA 3DJFA 3URKA 3VZQA 4ARSA 3GLIE 5JZOA 3GS2A 2ECFA 3WQHA 1ZGBA 1JDVA 4A6EA 2J3HA 3I1YA 5JROA 2JI7A 4G24A 3D1VA 4IL5A 1U2PA 2ZIUB 4BO0A 4L3OA 4EPYA 1RM0A 4B46A 4V0HA 2QHXA 3ZXRA 2ZNBA 4O4JA 3T9DA 4DQLA 2WF7A 2CGEA 1ISRA 3A6EA 5FTJA 5B1IA 1DAOA 4RDCA 5A3JA 1OIVA 4KGRA 4K3CA 2WP0A 1L4GA 4XR4A 2PZLA 1XB2A 2Z83A 2R8PA 3MUFA 4KV2A 1M83A 1USUA 4I3GA 4P7BA 3KLPX 1FMJA 2POQX 1UOPA 3WMXA 4YYEA 2VCEA 1R0KA 1KSGA