1ZKPA

1.5a resolution crystal structure of a metallo beta lactamase family protein, the elac homolgue of bacillus anthracis, a putative ribonuclease
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
251
structure length
251
Chain Sequence
LYFQSNAMKMTVVGFWGGFPEAGEATSGYLFEHDGFRLLVDCGSGVLAQLQKYITPSDIDAVVLSHYHHDHVADIGVLQYARLITSATKGQLPELPIYGHTFDENGFHSLTHEPHTKGIPYNPEETLQIGPFSISFLKTVHPVTCFAMRITAGNDIVVYSADSSYIPEFIPFTKDADLFICECNMYAHQEAAKAGHMNSTEVASIAKDANVKELLLTHLPHTGNPADLVTEAKQIFSGHITLAHSGYVWNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords hypothetical protein BA1088
publication title 1.5A Resolution Crystal Structure of a Metallo Beta Lactamase Family Protein, the ELAC Homolgue of Bacillus anthracis, a Putative Ribonuclease
rcsb
source organism Bacillus anthracis str.
total genus 76
structure length 251
sequence length 251
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12706 Lactamase_B_2 Beta-lactamase superfamily domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 1zkpA00
4RM5A 2BG6A 4D1TA 3IEKA 5LCAA 2A7MA 2ZO4A 2QEDA 4C1EA 2BFLA 1BMCA 1QH5A 3ZWFA 1VJNA 3L6NA 3R2UA 3ZR9A 5LCFA 4C1HA 5LLDA 2QJSA 2ZNBA 1KO2A 5FQCA 5LS3A 1X8GA 2P18A 2NZEA 4B87A 4EXSA 3IELA 4YSKA 2WYMC 5K4KA 4FSBA 3A4YA 4TZ9A 2FU9A 1WRAA 4V0HA 3SPUA 2BIBA 1YCGA 2M5CA 5FQAA 3Q6VA 5KILA 3SRXA 4UA4A 3KL7A 3IE0A 3I0VA 3ZNBA 4EYLA 4C1CA 1SMLA 5ACPA 1WW1A 2BG8A 1VGNA 5A87A 3H3EA 5A0VA 2QDTA 3X2YA 4XWWA 4Z6XA 2GFKA 5ACTA 4HL2A 3IDZA 2OHIA 2P1EA 3PG4A 3RKJA 2OHJA 2UYXA 2FM6A 1DD6A 1VMEA 3SBLA 2BFKA 2GKLA 3S0ZA 4GYUA 3DHBA 4TYTA 2Q0JA 4ZO3A 4ZNBA 4U4LA 4WD6A 3T9MA 2R2DA 4UBQA 1YCHA 3PY6A 2WHGA 3ESHA 3G1PA 3KNRA 4KEQA 2FHXB 3IOGA 4C1FA 3I14A 4O98A 5A0TA 4UAMA 5AYAA 5EWAA 3IOFA 5HIOA 3JXPA 1WUOA 3DHCA 2BG2A 5HIQA 5B3RA 4UWSB 2FHXA 1HLKA 4NQ6A 4C1GA 2NXAA 2E7YA 2ZZIA 3I13A 4DILA 3KNSA 3SD9A 2BGAA 5LSCA 4FR7A 4YSLA 1ZTCA 2M5DA 4CHLA 2GMNA 2BG8B 3IE1A 5HH5A 4Z5YA 1A7TA 3AF6A 2WYMA 3BK2A 4PVTA 1KO3A 4Z5ZA 1DXKA 3X2XA 1XTOA 3DHAA 5ACWA 1DDKA 4TZFA 2XR1A 2YNVB 2YNUA 4FEKA 5AHRA 5A5ZA 4EY2A 1QH3A 2GFJA 5EVKA 4Z67A 4GYQA 2I7TA 4TZBA 4JO0A 4EXYA 4NQ5A 1BVTA 5IQKA 2YNVA 4RAMA 2ZWRA 5HISA 4AD9A 3IE2A 4D1WA 1MQOA 5EHTA 4D1VA 5HIPA 2I7VA 3AF5A 2WYLA 4ZO2A 2DOOA 2WRSA 5B1UA 4EFZA 5AEBA 3RKKA 2Y8BA 4AX0B 2FU6A 1P9EA 1A8TA 1M2XA 2BC2A 2QINA 5K4MA 1X8IA 4BP0A 5AXRA 5ACSA 5AHOA 3F9OA 4Z60A 2GCUA 2OHHA 5EV6A 3ZQ4A 3X30A 1WUPA 3LVZA 4BZ3A 4UWPB 2P97A 5ACXA 3IEMA 1JJEA 2FU8A 3QH8A 3AJ3A 5B15A 4F6HA 2Q42A 4TZEA 2XF4A 3PY5A 3SFPA 2FU7A 4PVOA 3I11A 4RL0A 2Y8AA 4J5FA 5ACVA 4F6ZA 3BV6A 3TP9A 3VQZA 2DKFA 4J5HA 5ACUA 4UWOB 5ACQA 5HH6A 4C09A 3FAIA 1BC2A 4LE6A 1ZKPA 2BFZB 1L9YA 3P2UA 3VPEA 2I7XA 2BMIA 4H0DA 2QDSA 4GCWA 4Z7RA 3FCZA 5EW0A 2P4ZA 4RAWA 2BTNA 2CBNA 3MD7A 4XUKA 5LCHA 1XM8A 2YNTB 4YSBA 5ACRA 3BC2A 3RPCA 2BG7A 1YCFA 1JT1A 2BFZA 4UWRB 5EVDA 1Y44A 4D1UA 3SW3A 4P62A 4TYFA 4D02A 3BK1A 4ZEJA 1E5DA 4HL1A 3WXCA 2VW8A 4XWTA 4AX1B 3I15A 1KR3A 2HB9A 5FQBA 3T3NA 1X8HA 3ADRA 5EV8A 5LM6A 2YNTA 2Q0IA 2H6AA 5DPXA 2Q9UA 2BR6A 4AWZA 4C1DA 4HKYA 2FK6A 1K07A 5AXOA 4AWYB 2AIOA 2YNWA 4RBSA 4NQ2A 1ZNBA 3X2ZA 5LE1A 4DIKA 1JJTA 4EYFA 5K0WA 2Y87A 2YZ3A 5EH9A 2AZ4A 2NZFA 5LMCA 4KEPA 5KIKA 3T3OA 2NYPA 5K4NA 2YCBA 4EYBA 4RL2A 3DH8A 4NQ4A 5EVBA 5HH4A
chains in the Genus database with same CATH superfamily
4RM5A 2BG6A 4D1TA 3IEKA 5LCAA 2A7MA 2ZO4A 2QEDA 4C1EA 2BFLA 1BMCA 1QH5A 3ZWFA 1VJNA 3L6NA 3R2UA 3ZR9A 5AIJA 5LCFA 4C1HA 5LLDA 2QJSA 2ZNBA 1KO2A 5FQCA 5LS3A 1X8GA 2P18A 2NZEA 4B87A 4EXSA 3IELA 4YSKA 2WYMC 5K4KA 4FSBA 3A4YA 4TZ9A 2FU9A 1WRAA 4V0HA 3SPUA 2BIBA 1YCGA 2M5CA 5FQAA 3Q6VA 5KILA 3SRXA 4UA4A 3KL7A 3IE0A 3I0VA 3ZNBA 4EYLA 4C1CA 1SMLA 5ACPA 1WW1A 2BG8A 1VGNA 5A87A 3H3EA 5A0VA 2QDTA 3X2YA 4XWWA 4Z6XA 2GFKA 5ACTA 4HL2A 3IDZA 2OHIA 2P1EA 3PG4A 3RKJA 2OHJA 2UYXA 2FM6A 1DD6A 1VMEA 3SBLA 2BFKA 2GKLA 3S0ZA 4GYUA 3DHBA 4TYTA 2Q0JA 4ZO3A 4ZNBA 4U4LA 4WD6A 3T9MA 2R2DA 4UBQA 1YCHA 3PY6A 2WHGA 3ESHA 3G1PA 3KNRA 4KEQA 2FHXB 3IOGA 4C1FA 3I14A 4O98A 5A0TA 4UAMA 5AYAA 5EWAA 3IOFA 5HIOA 3JXPA 1WUOA 3DHCA 2BG2A 5HIQA 5B3RA 4UWSB 2FHXA 1HLKA 4NQ6A 4C1GA 2NXAA 2E7YA 2ZZIA 3I13A 4DILA 2CFZA 2CG3A 3KNSA 3SD9A 2BGAA 5LSCA 4FR7A 4YSLA 1ZTCA 2M5DA 4CHLA 2GMNA 2BG8B 3IE1A 5HH5A 4Z5YA 1A7TA 3AF6A 2WYMA 3BK2A 4PVTA 1KO3A 4Z5ZA 1DXKA 3X2XA 1XTOA 3DHAA 5ACWA 4PDXA 1DDKA 4TZFA 2XR1A 2YNVB 2YNUA 4FEKA 5AHRA 5A5ZA 1QH3A 2GFJA 5EVKA 4EY2A 4Z67A 4GYQA 2I7TA 4TZBA 4JO0A 4EXYA 4NQ5A 1BVTA 5IQKA 2CFUA 2YNVA 4RAMA 2ZWRA 5HISA 4AD9A 3IE2A 5A23A 4D1WA 1MQOA 5EHTA 4D1VA 5HIPA 2I7VA 3AF5A 2WYLA 4ZO2A 2DOOA 2WRSA 5B1UA 4EFZA 5AEBA 3RKKA 2Y8BA 4AX0B 2FU6A 4AV7A 1P9EA 1A8TA 1M2XA 2BC2A 2QINA 5K4MA 1X8IA 4BP0A 5AXRA 5ACSA 5AHOA 3F9OA 4Z60A 2GCUA 2YHEA 2OHHA 5EV6A 3ZQ4A 3X30A 1WUPA 3LVZA 4BZ3A 2CG2A 4UWPB 2P97A 5ACXA 3IEMA 1JJEA 2FU8A 3QH8A 3AJ3A 5B15A 4F6HA 2Q42A 4TZEA 2XF4A 3PY5A 3SFPA 2FU7A 4PVOA 3I11A 4RL0A 2Y8AA 4J5FA 5ACVA 4F6ZA 3BV6A 3TP9A 3VQZA 2DKFA 4J5HA 5ACUA 4UWOB 5ACQA 5HH6A 4C09A 3FAIA 1BC2A 4LE6A 1ZKPA 2BFZB 1L9YA 3P2UA 3VPEA 2I7XA 2BMIA 4H0DA 2QDSA 4GCWA 4Z7RA 3FCZA 5EW0A 2P4ZA 4RAWA 5AJLA 2BTNA 2CBNA 3MD7A 4XUKA 5LCHA 1XM8A 2YNTB 4YSBA 5ACRA 3BC2A 3RPCA 2BG7A 1YCFA 1JT1A 2BFZA 4UWRB 5EVDA 1Y44A 4D1UA 3SW3A 4P62A 4TYFA 4D02A 3BK1A 4ZEJA 4AXHA 1E5DA 4HL1A 3WXCA 2VW8A 4XWTA 4AX1B 3I15A 1KR3A 2HB9A 5FQBA 3T3NA 1X8HA 3ADRA 5EV8A 5LM6A 2YNTA 2Q0IA 2H6AA 4NURA 5DPXA 2Q9UA 2BR6A 4AWZA 4C1DA 4HKYA 2FK6A 1K07A 5AXOA 4AWYB 2AIOA 2YNWA 4RBSA 4NQ2A 1ZNBA 3X2ZA 5LE1A 4DIKA 1JJTA 4EYFA 5K0WA 2Y87A 2YZ3A 5EH9A 2AZ4A 2NZFA 5LMCA 4KEPA 5KIKA 3T3OA 2NYPA 5K4NA 2YCBA 4EYBA 4RL2A 3DH8A 4NQ4A 5EVBA 5HH4A
chains in the Genus database with same CATH topology
4RM5A 2BG6A 4D1TA 3IEKA 5LCAA 2A7MA 2ZO4A 2QEDA 4C1EA 2BFLA 1BMCA 1QH5A 3ZWFA 1VJNA 3L6NA 3R2UA 3ZR9A 5LCFA 4C1HA 5LLDA 2QJSA 2ZNBA 1KO2A 5FQCA 5LS3A 1X8GA 2P18A 2NZEA 4B87A 4EXSA 3IELA 4YSKA 2WYMC 5K4KA 4FSBA 3A4YA 4TZ9A 2FU9A 1WRAA 4V0HA 3SPUA 2BIBA 1YCGA 2M5CA 5FQAA 3Q6VA 5KILA 3SRXA 4UA4A 3KL7A 3IE0A 3I0VA 3ZNBA 4EYLA 4C1CA 1SMLA 5ACPA 1WW1A 2BG8A 1VGNA 5A87A 3H3EA 5A0VA 2QDTA 3X2YA 4XWWA 4Z6XA 2GFKA 5ACTA 4HL2A 3IDZA 2OHIA 2P1EA 3PG4A 3RKJA 2OHJA 2UYXA 2FM6A 1DD6A 1VMEA 3SBLA 2BFKA 2GKLA 3S0ZA 4GYUA 3DHBA 4TYTA 2Q0JA 4ZO3A 4ZNBA 4U4LA 4WD6A 3T9MA 2R2DA 4UBQA 1YCHA 3PY6A 2WHGA 3ESHA 3G1PA 3KNRA 4KEQA 2FHXB 3IOGA 4C1FA 3I14A 4O98A 5A0TA 4UAMA 5AYAA 5EWAA 3IOFA 5HIOA 3JXPA 1WUOA 3DHCA 2BG2A 5HIQA 5B3RA 4UWSB 2FHXA 1HLKA 4NQ6A 4C1GA 2NXAA 2E7YA 2ZZIA 3I13A 4DILA 3KNSA 3SD9A 2BGAA 5LSCA 4FR7A 4YSLA 1ZTCA 2M5DA 4CHLA 2GMNA 2BG8B 3IE1A 5HH5A 4Z5YA 1A7TA 3AF6A 2WYMA 3BK2A 4PVTA 1KO3A 4Z5ZA 1DXKA 3X2XA 1XTOA 3DHAA 5ACWA 1DDKA 4TZFA 2XR1A 2YNVB 2YNUA 4FEKA 5AHRA 5A5ZA 4EY2A 1QH3A 2GFJA 5EVKA 4Z67A 4GYQA 2I7TA 4TZBA 4JO0A 4EXYA 4NQ5A 1BVTA 5IQKA 2YNVA 4RAMA 2ZWRA 5HISA 4AD9A 3IE2A 4D1WA 1MQOA 5EHTA 4D1VA 5HIPA 2I7VA 3AF5A 2WYLA 4ZO2A 2DOOA 2WRSA 5B1UA 4EFZA 5AEBA 3RKKA 2Y8BA 4AX0B 2FU6A 1P9EA 1A8TA 1M2XA 2BC2A 2QINA 5K4MA 1X8IA 4BP0A 5AXRA 5ACSA 5AHOA 3F9OA 4Z60A 2GCUA 2OHHA 5EV6A 3ZQ4A 3X30A 1WUPA 3LVZA 4BZ3A 4UWPB 2P97A 5ACXA 3IEMA 1JJEA 2FU8A 3QH8A 3AJ3A 5B15A 4F6HA 2Q42A 4TZEA 2XF4A 3PY5A 3SFPA 2FU7A 4PVOA 3I11A 4RL0A 2Y8AA 4J5FA 5ACVA 4F6ZA 3BV6A 3TP9A 3VQZA 2DKFA 4J5HA 5ACUA 4UWOB 5ACQA 5HH6A 4C09A 3FAIA 1BC2A 4LE6A 1ZKPA 2BFZB 1L9YA 3P2UA 3VPEA 2I7XA 2BMIA 4H0DA 2QDSA 4GCWA 4Z7RA 3FCZA 5EW0A 2P4ZA 4RAWA 2BTNA 2CBNA 3MD7A 4XUKA 5LCHA 1XM8A 2YNTB 4YSBA 5ACRA 3BC2A 3RPCA 2BG7A 1YCFA 1JT1A 2BFZA 4UWRB 5EVDA 1Y44A 4D1UA 3SW3A 4P62A 4TYFA 4D02A 3BK1A 4ZEJA 1E5DA 4HL1A 3WXCA 2VW8A 4XWTA 4AX1B 3I15A 1KR3A 2HB9A 5FQBA 3T3NA 1X8HA 3ADRA 5EV8A 5LM6A 2YNTA 2Q0IA 2H6AA 5DPXA 2Q9UA 2BR6A 4AWZA 4C1DA 4HKYA 2FK6A 1K07A 5AXOA 4AWYB 2AIOA 2YNWA 4RBSA 4NQ2A 1ZNBA 3X2ZA 5LE1A 4DIKA 1JJTA 4EYFA 5K0WA 2Y87A 2YZ3A 5EH9A 2AZ4A 2NZFA 5LMCA 4KEPA 5KIKA 3T3OA 2NYPA 5K4NA 2YCBA 4EYBA 4RL2A 3DH8A 4NQ4A 5EVBA 5HH4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RM5 A;  2BG6 A;  4D1T A;  3IEK A;  5LCA A;  2A7M A;  2ZO4 A;  2QED A;  4C1E A;  2BFL A;  1BMC A;  1QH5 A;  3ZWF A;  1VJN A;  3L6N A;  3R2U A;  3ZR9 A;  5LCF A;  4C1H A;  5LLD A;  2QJS A;  2ZNB A;  1KO2 A;  5FQC A;  5LS3 A;  1X8G A;  2P18 A;  2NZE A;  4B87 A;  4EXS A;  3IEL A;  4YSK A;  2WYM C;  5K4K A;  4FSB A;  3A4Y A;  4TZ9 A;  2FU9 A;  1WRA A;  4V0H A;  3SPU A;  2BIB A;  1YCG A;  2M5C A;  5FQA A;  3Q6V A;  5KIL A;  3SRX A;  4UA4 A;  3KL7 A;  3IE0 A;  3I0V A;  3ZNB A;  4EYL A;  4C1C A;  1SML A;  5ACP A;  1WW1 A;  2BG8 A;  1VGN A;  5A87 A;  3H3E A;  5A0V A;  2QDT A;  3X2Y A;  4XWW A;  4Z6X A;  2GFK A;  5ACT A;  4HL2 A;  3IDZ A;  2OHI A;  2P1E A;  3PG4 A;  3RKJ A;  2OHJ A;  2UYX A;  2FM6 A;  1DD6 A;  1VME A;  3SBL A;  2BFK A;  2GKL A;  3S0Z A;  4GYU A;  3DHB A;  4TYT A;  2Q0J A;  4ZO3 A;  4ZNB A;  4U4L A;  4WD6 A;  3T9M A;  2R2D A;  4UBQ A;  1YCH A;  3PY6 A;  2WHG A;  3ESH A;  3G1P A;  3KNR A;  4KEQ A;  2FHX B;  3IOG A;  4C1F A;  3I14 A;  4O98 A;  5A0T A;  4UAM A;  5AYA A;  5EWA A;  3IOF A;  5HIO A;  3JXP A;  1WUO A;  3DHC A;  2BG2 A;  5HIQ A;  5B3R A;  4UWS B;  2FHX A;  1HLK A;  4NQ6 A;  4C1G A;  2NXA A;  2E7Y A;  2ZZI A;  3I13 A;  4DIL A;  3KNS A;  3SD9 A;  2BGA A;  5LSC A;  4FR7 A;  4YSL A;  1ZTC A;  2M5D A;  4CHL A;  2GMN A;  2BG8 B;  3IE1 A;  5HH5 A;  4Z5Y A;  1A7T A;  3AF6 A;  2WYM A;  3BK2 A;  4PVT A;  1KO3 A;  4Z5Z A;  1DXK A;  3X2X A;  1XTO A;  3DHA A;  5ACW A;  1DDK A;  4TZF A;  2XR1 A;  2YNV B;  2YNU A;  4FEK A;  5AHR A;  5A5Z A;  4EY2 A;  1QH3 A;  2GFJ A;  5EVK A;  4Z67 A;  4GYQ A;  2I7T A;  4TZB A;  4JO0 A;  4EXY A;  4NQ5 A;  1BVT A;  5IQK A;  2YNV A;  4RAM A;  2ZWR A;  5HIS A;  4AD9 A;  3IE2 A;  4D1W A;  1MQO A;  5EHT A;  4D1V A;  5HIP A;  2I7V A;  3AF5 A;  2WYL A;  4ZO2 A;  2DOO A;  2WRS A;  5B1U A;  4EFZ A;  5AEB A;  3RKK A;  2Y8B A;  4AX0 B;  2FU6 A;  1P9E A;  1A8T A;  1M2X A;  2BC2 A;  2QIN A;  5K4M A;  1X8I A;  4BP0 A;  5AXR A;  5ACS A;  5AHO A;  3F9O A;  4Z60 A;  2GCU A;  2OHH A;  5EV6 A;  3ZQ4 A;  3X30 A;  1WUP A;  3LVZ A;  4BZ3 A;  4UWP B;  2P97 A;  5ACX A;  3IEM A;  1JJE A;  2FU8 A;  3QH8 A;  3AJ3 A;  5B15 A;  4F6H A;  2Q42 A;  4TZE A;  2XF4 A;  3PY5 A;  3SFP A;  2FU7 A;  4PVO A;  3I11 A;  4RL0 A;  2Y8A A;  4J5F A;  5ACV A;  4F6Z A;  3BV6 A;  3TP9 A;  3VQZ A;  2DKF A;  4J5H A;  5ACU A;  4UWO B;  5ACQ A;  5HH6 A;  4C09 A;  3FAI A;  1BC2 A;  4LE6 A;  1ZKP A;  2BFZ B;  1L9Y A;  3P2U A;  3VPE A;  2I7X A;  2BMI A;  4H0D A;  2QDS A;  4GCW A;  4Z7R A;  3FCZ A;  5EW0 A;  2P4Z A;  4RAW A;  2BTN A;  2CBN A;  3MD7 A;  4XUK A;  5LCH A;  1XM8 A;  2YNT B;  4YSB A;  5ACR A;  3BC2 A;  3RPC A;  2BG7 A;  1YCF A;  1JT1 A;  2BFZ A;  4UWR B;  5EVD A;  1Y44 A;  4D1U A;  3SW3 A;  4P62 A;  4TYF A;  4D02 A;  3BK1 A;  4ZEJ A;  1E5D A;  4HL1 A;  3WXC A;  2VW8 A;  4XWT A;  4AX1 B;  3I15 A;  1KR3 A;  2HB9 A;  5FQB A;  3T3N A;  1X8H A;  3ADR A;  5EV8 A;  5LM6 A;  2YNT A;  2Q0I A;  2H6A A;  5DPX A;  2Q9U A;  2BR6 A;  4AWZ A;  4C1D A;  4HKY A;  2FK6 A;  1K07 A;  5AXO A;  4AWY B;  2AIO A;  2YNW A;  4RBS A;  4NQ2 A;  1ZNB A;  3X2Z A;  5LE1 A;  4DIK A;  1JJT A;  4EYF A;  5K0W A;  2Y87 A;  2YZ3 A;  5EH9 A;  2AZ4 A;  2NZF A;  5LMC A;  4KEP A;  5KIK A;  3T3O A;  2NYP A;  5K4N A;  2YCB A;  4EYB A;  4RL2 A;  3DH8 A;  4NQ4 A;  5EVB A;  5HH4 A; 
#chains in the Genus database with same CATH topology
 4RM5 A;  2BG6 A;  4D1T A;  3IEK A;  5LCA A;  2A7M A;  2ZO4 A;  2QED A;  4C1E A;  2BFL A;  1BMC A;  1QH5 A;  3ZWF A;  1VJN A;  3L6N A;  3R2U A;  3ZR9 A;  5AIJ A;  5LCF A;  4C1H A;  5LLD A;  2QJS A;  2ZNB A;  1KO2 A;  5FQC A;  5LS3 A;  1X8G A;  2P18 A;  2NZE A;  4B87 A;  4EXS A;  3IEL A;  4YSK A;  2WYM C;  5K4K A;  4FSB A;  3A4Y A;  4TZ9 A;  2FU9 A;  1WRA A;  4V0H A;  3SPU A;  2BIB A;  1YCG A;  2M5C A;  5FQA A;  3Q6V A;  5KIL A;  3SRX A;  4UA4 A;  3KL7 A;  3IE0 A;  3I0V A;  3ZNB A;  4EYL A;  4C1C A;  1SML A;  5ACP A;  1WW1 A;  2BG8 A;  1VGN A;  5A87 A;  3H3E A;  5A0V A;  2QDT A;  3X2Y A;  4XWW A;  4Z6X A;  2GFK A;  5ACT A;  4HL2 A;  3IDZ A;  2OHI A;  2P1E A;  3PG4 A;  3RKJ A;  2OHJ A;  2UYX A;  2FM6 A;  1DD6 A;  1VME A;  3SBL A;  2BFK A;  2GKL A;  3S0Z A;  4GYU A;  3DHB A;  4TYT A;  2Q0J A;  4ZO3 A;  4ZNB A;  4U4L A;  4WD6 A;  3T9M A;  2R2D A;  4UBQ A;  1YCH A;  3PY6 A;  2WHG A;  3ESH A;  3G1P A;  3KNR A;  4KEQ A;  2FHX B;  3IOG A;  4C1F A;  3I14 A;  4O98 A;  5A0T A;  4UAM A;  5AYA A;  5EWA A;  3IOF A;  5HIO A;  3JXP A;  1WUO A;  3DHC A;  2BG2 A;  5HIQ A;  5B3R A;  4UWS B;  2FHX A;  1HLK A;  4NQ6 A;  4C1G A;  2NXA A;  2E7Y A;  2ZZI A;  3I13 A;  4DIL A;  2CFZ A;  2CG3 A;  3KNS A;  3SD9 A;  2BGA A;  5LSC A;  4FR7 A;  4YSL A;  1ZTC A;  2M5D A;  4CHL A;  2GMN A;  2BG8 B;  3IE1 A;  5HH5 A;  4Z5Y A;  1A7T A;  3AF6 A;  2WYM A;  3BK2 A;  4PVT A;  1KO3 A;  4Z5Z A;  1DXK A;  3X2X A;  1XTO A;  3DHA A;  5ACW A;  4PDX A;  1DDK A;  4TZF A;  2XR1 A;  2YNV B;  2YNU A;  4FEK A;  5AHR A;  5A5Z A;  1QH3 A;  2GFJ A;  5EVK A;  4EY2 A;  4Z67 A;  4GYQ A;  2I7T A;  4TZB A;  4JO0 A;  4EXY A;  4NQ5 A;  1BVT A;  5IQK A;  2CFU A;  2YNV A;  4RAM A;  2ZWR A;  5HIS A;  4AD9 A;  3IE2 A;  5A23 A;  4D1W A;  1MQO A;  5EHT A;  4D1V A;  5HIP A;  2I7V A;  3AF5 A;  2WYL A;  4ZO2 A;  2DOO A;  2WRS A;  5B1U A;  4EFZ A;  5AEB A;  3RKK A;  2Y8B A;  4AX0 B;  2FU6 A;  4AV7 A;  1P9E A;  1A8T A;  1M2X A;  2BC2 A;  2QIN A;  5K4M A;  1X8I A;  4BP0 A;  5AXR A;  5ACS A;  5AHO A;  3F9O A;  4Z60 A;  2GCU A;  2YHE A;  2OHH A;  5EV6 A;  3ZQ4 A;  3X30 A;  1WUP A;  3LVZ A;  4BZ3 A;  2CG2 A;  4UWP B;  2P97 A;  5ACX A;  3IEM A;  1JJE A;  2FU8 A;  3QH8 A;  3AJ3 A;  5B15 A;  4F6H A;  2Q42 A;  4TZE A;  2XF4 A;  3PY5 A;  3SFP A;  2FU7 A;  4PVO A;  3I11 A;  4RL0 A;  2Y8A A;  4J5F A;  5ACV A;  4F6Z A;  3BV6 A;  3TP9 A;  3VQZ A;  2DKF A;  4J5H A;  5ACU A;  4UWO B;  5ACQ A;  5HH6 A;  4C09 A;  3FAI A;  1BC2 A;  4LE6 A;  1ZKP A;  2BFZ B;  1L9Y A;  3P2U A;  3VPE A;  2I7X A;  2BMI A;  4H0D A;  2QDS A;  4GCW A;  4Z7R A;  3FCZ A;  5EW0 A;  2P4Z A;  4RAW A;  5AJL A;  2BTN A;  2CBN A;  3MD7 A;  4XUK A;  5LCH A;  1XM8 A;  2YNT B;  4YSB A;  5ACR A;  3BC2 A;  3RPC A;  2BG7 A;  1YCF A;  1JT1 A;  2BFZ A;  4UWR B;  5EVD A;  1Y44 A;  4D1U A;  3SW3 A;  4P62 A;  4TYF A;  4D02 A;  3BK1 A;  4ZEJ A;  4AXH A;  1E5D A;  4HL1 A;  3WXC A;  2VW8 A;  4XWT A;  4AX1 B;  3I15 A;  1KR3 A;  2HB9 A;  5FQB A;  3T3N A;  1X8H A;  3ADR A;  5EV8 A;  5LM6 A;  2YNT A;  2Q0I A;  2H6A A;  4NUR A;  5DPX A;  2Q9U A;  2BR6 A;  4AWZ A;  4C1D A;  4HKY A;  2FK6 A;  1K07 A;  5AXO A;  4AWY B;  2AIO A;  2YNW A;  4RBS A;  4NQ2 A;  1ZNB A;  3X2Z A;  5LE1 A;  4DIK A;  1JJT A;  4EYF A;  5K0W A;  2Y87 A;  2YZ3 A;  5EH9 A;  2AZ4 A;  2NZF A;  5LMC A;  4KEP A;  5KIK A;  3T3O A;  2NYP A;  5K4N A;  2YCB A;  4EYB A;  4RL2 A;  3DH8 A;  4NQ4 A;  5EVB A;  5HH4 A; 
#chains in the Genus database with same CATH homology
 4RM5 A;  2BG6 A;  4D1T A;  3IEK A;  5LCA A;  2A7M A;  2ZO4 A;  2QED A;  4C1E A;  2BFL A;  1BMC A;  1QH5 A;  3ZWF A;  1VJN A;  3L6N A;  3R2U A;  3ZR9 A;  5LCF A;  4C1H A;  5LLD A;  2QJS A;  2ZNB A;  1KO2 A;  5FQC A;  5LS3 A;  1X8G A;  2P18 A;  2NZE A;  4B87 A;  4EXS A;  3IEL A;  4YSK A;  2WYM C;  5K4K A;  4FSB A;  3A4Y A;  4TZ9 A;  2FU9 A;  1WRA A;  4V0H A;  3SPU A;  2BIB A;  1YCG A;  2M5C A;  5FQA A;  3Q6V A;  5KIL A;  3SRX A;  4UA4 A;  3KL7 A;  3IE0 A;  3I0V A;  3ZNB A;  4EYL A;  4C1C A;  1SML A;  5ACP A;  1WW1 A;  2BG8 A;  1VGN A;  5A87 A;  3H3E A;  5A0V A;  2QDT A;  3X2Y A;  4XWW A;  4Z6X A;  2GFK A;  5ACT A;  4HL2 A;  3IDZ A;  2OHI A;  2P1E A;  3PG4 A;  3RKJ A;  2OHJ A;  2UYX A;  2FM6 A;  1DD6 A;  1VME A;  3SBL A;  2BFK A;  2GKL A;  3S0Z A;  4GYU A;  3DHB A;  4TYT A;  2Q0J A;  4ZO3 A;  4ZNB A;  4U4L A;  4WD6 A;  3T9M A;  2R2D A;  4UBQ A;  1YCH A;  3PY6 A;  2WHG A;  3ESH A;  3G1P A;  3KNR A;  4KEQ A;  2FHX B;  3IOG A;  4C1F A;  3I14 A;  4O98 A;  5A0T A;  4UAM A;  5AYA A;  5EWA A;  3IOF A;  5HIO A;  3JXP A;  1WUO A;  3DHC A;  2BG2 A;  5HIQ A;  5B3R A;  4UWS B;  2FHX A;  1HLK A;  4NQ6 A;  4C1G A;  2NXA A;  2E7Y A;  2ZZI A;  3I13 A;  4DIL A;  3KNS A;  3SD9 A;  2BGA A;  5LSC A;  4FR7 A;  4YSL A;  1ZTC A;  2M5D A;  4CHL A;  2GMN A;  2BG8 B;  3IE1 A;  5HH5 A;  4Z5Y A;  1A7T A;  3AF6 A;  2WYM A;  3BK2 A;  4PVT A;  1KO3 A;  4Z5Z A;  1DXK A;  3X2X A;  1XTO A;  3DHA A;  5ACW A;  1DDK A;  4TZF A;  2XR1 A;  2YNV B;  2YNU A;  4FEK A;  5AHR A;  5A5Z A;  4EY2 A;  1QH3 A;  2GFJ A;  5EVK A;  4Z67 A;  4GYQ A;  2I7T A;  4TZB A;  4JO0 A;  4EXY A;  4NQ5 A;  1BVT A;  5IQK A;  2YNV A;  4RAM A;  2ZWR A;  5HIS A;  4AD9 A;  3IE2 A;  4D1W A;  1MQO A;  5EHT A;  4D1V A;  5HIP A;  2I7V A;  3AF5 A;  2WYL A;  4ZO2 A;  2DOO A;  2WRS A;  5B1U A;  4EFZ A;  5AEB A;  3RKK A;  2Y8B A;  4AX0 B;  2FU6 A;  1P9E A;  1A8T A;  1M2X A;  2BC2 A;  2QIN A;  5K4M A;  1X8I A;  4BP0 A;  5AXR A;  5ACS A;  5AHO A;  3F9O A;  4Z60 A;  2GCU A;  2OHH A;  5EV6 A;  3ZQ4 A;  3X30 A;  1WUP A;  3LVZ A;  4BZ3 A;  4UWP B;  2P97 A;  5ACX A;  3IEM A;  1JJE A;  2FU8 A;  3QH8 A;  3AJ3 A;  5B15 A;  4F6H A;  2Q42 A;  4TZE A;  2XF4 A;  3PY5 A;  3SFP A;  2FU7 A;  4PVO A;  3I11 A;  4RL0 A;  2Y8A A;  4J5F A;  5ACV A;  4F6Z A;  3BV6 A;  3TP9 A;  3VQZ A;  2DKF A;  4J5H A;  5ACU A;  4UWO B;  5ACQ A;  5HH6 A;  4C09 A;  3FAI A;  1BC2 A;  4LE6 A;  1ZKP A;  2BFZ B;  1L9Y A;  3P2U A;  3VPE A;  2I7X A;  2BMI A;  4H0D A;  2QDS A;  4GCW A;  4Z7R A;  3FCZ A;  5EW0 A;  2P4Z A;  4RAW A;  2BTN A;  2CBN A;  3MD7 A;  4XUK A;  5LCH A;  1XM8 A;  2YNT B;  4YSB A;  5ACR A;  3BC2 A;  3RPC A;  2BG7 A;  1YCF A;  1JT1 A;  2BFZ A;  4UWR B;  5EVD A;  1Y44 A;  4D1U A;  3SW3 A;  4P62 A;  4TYF A;  4D02 A;  3BK1 A;  4ZEJ A;  1E5D A;  4HL1 A;  3WXC A;  2VW8 A;  4XWT A;  4AX1 B;  3I15 A;  1KR3 A;  2HB9 A;  5FQB A;  3T3N A;  1X8H A;  3ADR A;  5EV8 A;  5LM6 A;  2YNT A;  2Q0I A;  2H6A A;  5DPX A;  2Q9U A;  2BR6 A;  4AWZ A;  4C1D A;  4HKY A;  2FK6 A;  1K07 A;  5AXO A;  4AWY B;  2AIO A;  2YNW A;  4RBS A;  4NQ2 A;  1ZNB A;  3X2Z A;  5LE1 A;  4DIK A;  1JJT A;  4EYF A;  5K0W A;  2Y87 A;  2YZ3 A;  5EH9 A;  2AZ4 A;  2NZF A;  5LMC A;  4KEP A;  5KIK A;  3T3O A;  2NYP A;  5K4N A;  2YCB A;  4EYB A;  4RL2 A;  3DH8 A;  4NQ4 A;  5EVB A;  5HH4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...