1ZKPA

1.5a resolution crystal structure of a metallo beta lactamase family protein, the elac homolgue of bacillus anthracis, a putative ribonuclease
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
251
structure length
251
Chain Sequence
LYFQSNAMKMTVVGFWGGFPEAGEATSGYLFEHDGFRLLVDCGSGVLAQLQKYITPSDIDAVVLSHYHHDHVADIGVLQYARLITSATKGQLPELPIYGHTFDENGFHSLTHEPHTKGIPYNPEETLQIGPFSISFLKTVHPVTCFAMRITAGNDIVVYSADSSYIPEFIPFTKDADLFICECNMYAHQEAAKAGHMNSTEVASIAKDANVKELLLTHLPHTGNPADLVTEAKQIFSGHITLAHSGYVWNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein BA1088
publication title 1.5A Resolution Crystal Structure of a Metallo Beta Lactamase Family Protein, the ELAC Homolgue of Bacillus anthracis, a Putative Ribonuclease
rcsb
source organism Bacillus anthracis str.
molecule tags Structural genomics, unknown function
total genus 76
structure length 251
sequence length 251
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12706 Lactamase_B_2 Beta-lactamase superfamily domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 1zkpA00
3X2ZA 1DXKA 3P2UA 2FU6A 3S0ZA 4GYQA 2BTNA 3BV6A 5IQKA 2GFJA 4YSKA 3FAIA 4AD9A 4BP0A 5K0WA 5LLDA 4FSBA 2QDSA 2OHHA 4EY2A 2BIBA 4ZO2A 4Z5YA 4TZFA 1X8GA 1M2XA 4GCWA 4D1WA 3ADRA 2YNUA 1ZNBA 5AXRA 4GYUA 5EW0A 4Z5ZA 1SMLA 5AHRA 4AX0B 4UBQA 3DHAA 2BFLA 2HB9A 3A4YA 2WRSA 2P18A 3SRXA 2BG7A 3AJ3A 3I11A 4XUKA 5K4NA 4RL2A 2NZFA 3KNSA 3FCZA 2I7TA 3I14A 5B3RA 1X8HA 4UAMA 4D1UA 2A7MA 1XM8A 4RAMA 2Q0IA 3SPUA 3ZNBA 3T3OA 3BC2A 4ZO3A 3IEMA 4EYFA 3IOGA 1VJNA 5ACRA 2WHGA 4ZEJA 4Z60A 2QDTA 5HISA 4WD6A 5ACWA 4CHLA 4EYLA 3RKKA 1P9EA 4AWZA 2DOOA 3ZQ4A 4LE6A 3BK2A 1DDKA 2M5DA 4XWTA 4HKYA 5ACUA 4TYFA 5FQAA 4J5HA 4C1DA 3BK1A 4BZ3A 1BC2A 3PG4A 1ZKPA 5ACVA 5HH4A 4Z7RA 5ACPA 3I13A 3RKJA 4F6HA 1A7TA 2AZ4A 4Z6XA 4FEKA 1E5DA 1BVTA 3AF5A 5EVDA 4TYTA 5FQCA 4D02A 5B15A 2NXAA 2ZZIA 5ACQA 2UYXA 2Q42A 2Y8BA 5HIQA 3F9OA 2E7YA 2XF4A 4RM5A 3IEKA 4Z67A 2WYLA 2CBNA 2BG8A 3LVZA 3T3NA 5KIKA 2YNTB 4RBSA 4EFZA 4FR7A 3X2XA 5K4KA 5K4MA 3SBLA 3X30A 3X2YA 2I7XA 3IE1A 3L6NA 4F6ZA 1YCFA 4UWOB 4J5FA 4NQ4A 4YSBA 4V0HA 5ACTA 2BFZB 2BC2A 2BFKA 1X8IA 2R2DA 2FHXB 1YCHA 4RAWA 2YNWA 5EVBA 4TZBA 3T9MA 2OHIA 3SFPA 5LMCA 1QH5A 2YNVB 2OHJA 3DH8A 4DIKA 5EHTA 2BMIA 5HIPA 4C1CA 2YZ3A 4EXSA 4JO0A 4UA4A 1Y44A 3PY6A 4AX1B 2M5CA 3VPEA 3SW3A 2WYMA 1KR3A 5HH5A 3MD7A 4HL1A 1WW1A 1BMCA 3TP9A 5DPXA 1WUOA 5A5ZA 2QINA 2I7VA 4UWSB 3IE0A 2VW8A 4TZ9A 1KO2A 1KO3A 1MQOA 2P97A 3ESHA 2Q0JA 5EH9A 4EYBA 5AYAA 5LSCA 2P4ZA 3DHCA 4DILA 3IDZA 4D1TA 4RL0A 2NYPA 4P62A 4XWWA 3IOFA 4PVOA 5B1UA 2P1EA 4NQ5A 4UWPB 3JXPA 1HLKA 5LE1A 3R2UA 1K07A 3KNRA 5LS3A 1DD6A 4AWYB 5AHOA 5LM6A 3VQZA 2ZO4A 1L9YA 1VMEA 4U4LA 5EWAA 2ZNBA 5ACSA 2GFKA 3KL7A 3IE2A 5AXOA 4C1FA 4UWRB 4H0DA 2Y87A 2BG2A 5A87A 2YCBA 4YSLA 2Q9UA 2ZWRA 1A8TA 3WXCA 5EV8A 2QEDA 5HIOA 5LCHA 5EVKA 4ZNBA 4NQ2A 1ZTCA 4KEQA 1WRAA 3Q6VA 1WUPA 2FU7A 2GCUA 5A0TA 2Y8AA 4C09A 4HL2A 4C1HA 2NZEA 1JJTA 3SD9A 4C1EA 2YNTA 1VGNA 4O98A 2QJSA 4EXYA 2FU8A 2FU9A 3ZR9A 3DHBA 5KILA 4B87A 2WYMC 4PVTA 1XTOA 4TZEA 3QH8A 1YCGA 2BFZA 5FQBA 5AEBA 2BG6A 4NQ6A 3ZWFA 3PY5A 1QH3A 2GMNA 2FHXA 2AIOA 3AF6A 5ACXA 5LCFA 2YNVA 3I15A 3RPCA 5A0VA 2FM6A 2BR6A 4D1VA 1JT1A 1JJEA 3G1PA 4C1GA 3I0VA 3IELA 5HH6A 2H6AA 2BGAA 5EV6A 2XR1A 2GKLA 2FK6A 2DKFA 2BG8B 5LCAA 3H3EA 4KEPA
chains in the Genus database with same CATH superfamily
3X2ZA 1DXKA 3P2UA 2FU6A 3S0ZA 4GYQA 2BTNA 3BV6A 5IQKA 2GFJA 4YSKA 3FAIA 4AD9A 4BP0A 5K0WA 5LLDA 4FSBA 2QDSA 2OHHA 4EY2A 2BIBA 4ZO2A 4Z5YA 4TZFA 1X8GA 1M2XA 4GCWA 4D1WA 3ADRA 2YNUA 1ZNBA 5AXRA 4GYUA 5EW0A 4Z5ZA 1SMLA 5AHRA 4AX0B 4UBQA 3DHAA 2BFLA 2HB9A 3A4YA 2WRSA 2P18A 3SRXA 2BG7A 3AJ3A 3I11A 4XUKA 5K4NA 4RL2A 2NZFA 3KNSA 3FCZA 2I7TA 3I14A 5B3RA 1X8HA 4UAMA 4D1UA 2A7MA 1XM8A 4RAMA 2Q0IA 3SPUA 3ZNBA 3T3OA 3BC2A 4ZO3A 3IEMA 4EYFA 3IOGA 1VJNA 5ACRA 2WHGA 4ZEJA 4Z60A 2QDTA 5HISA 4WD6A 5ACWA 4CHLA 4EYLA 3RKKA 1P9EA 4AWZA 2DOOA 3ZQ4A 4LE6A 5AJLA 3BK2A 1DDKA 2M5DA 4XWTA 2CG3A 4HKYA 5ACUA 4TYFA 5FQAA 4J5HA 4C1DA 3BK1A 4BZ3A 1BC2A 3PG4A 2CG2A 1ZKPA 5ACVA 5HH4A 4Z7RA 5ACPA 3I13A 3RKJA 4F6HA 1A7TA 2AZ4A 4Z6XA 4FEKA 1E5DA 1BVTA 3AF5A 5EVDA 4TYTA 5FQCA 4D02A 5B15A 2NXAA 2ZZIA 5ACQA 2UYXA 2Q42A 2Y8BA 5HIQA 3F9OA 2E7YA 2XF4A 4RM5A 3IEKA 4Z67A 2WYLA 2CFUA 2CBNA 2BG8A 3LVZA 3T3NA 5KIKA 2YNTB 4RBSA 4EFZA 4FR7A 3X2XA 5K4KA 5K4MA 3SBLA 3X30A 3X2YA 2I7XA 3IE1A 3L6NA 4F6ZA 1YCFA 4UWOB 4J5FA 4NQ4A 4YSBA 4V0HA 5ACTA 2BFZB 2BC2A 2BFKA 1X8IA 2R2DA 2FHXB 1YCHA 4RAWA 2YNWA 5EVBA 4TZBA 3T9MA 2OHIA 3SFPA 5LMCA 1QH5A 2YNVB 2OHJA 3DH8A 4DIKA 5EHTA 2BMIA 5HIPA 4C1CA 2YZ3A 4EXSA 4JO0A 4UA4A 1Y44A 3PY6A 4AX1B 2M5CA 3VPEA 3SW3A 2WYMA 1KR3A 5HH5A 3MD7A 4HL1A 1WW1A 1BMCA 3TP9A 5DPXA 1WUOA 2YHEA 2QINA 2I7VA 5A5ZA 4UWSB 5A23A 3IE0A 2VW8A 4TZ9A 1KO2A 1KO3A 1MQOA 2P97A 3ESHA 2Q0JA 5EH9A 4EYBA 5AYAA 5LSCA 2P4ZA 4AV7A 3DHCA 4DILA 3IDZA 4RL0A 4D1TA 2NYPA 4P62A 4XWWA 3IOFA 4PVOA 5B1UA 2P1EA 4NQ5A 4UWPB 3JXPA 1HLKA 5LE1A 3R2UA 1K07A 3KNRA 5LS3A 1DD6A 4AWYB 5AHOA 4PDXA 5LM6A 3VQZA 2ZO4A 1L9YA 1VMEA 4U4LA 5EWAA 2ZNBA 5ACSA 2GFKA 3KL7A 3IE2A 5AXOA 4C1FA 4UWRB 4H0DA 2Y87A 2BG2A 5A87A 2YCBA 4YSLA 2Q9UA 2ZWRA 1A8TA 3WXCA 5EV8A 2QEDA 5HIOA 5LCHA 2CFZA 5EVKA 4ZNBA 4NQ2A 1ZTCA 4KEQA 1WRAA 3Q6VA 1WUPA 2FU7A 4AXHA 2GCUA 5A0TA 2Y8AA 4C09A 4HL2A 4C1HA 2NZEA 1JJTA 3SD9A 4C1EA 2YNTA 1VGNA 5AIJA 4O98A 2QJSA 4EXYA 2FU8A 2FU9A 3ZR9A 3DHBA 5KILA 4B87A 4NURA 2WYMC 4PVTA 1XTOA 4TZEA 3QH8A 1YCGA 2BFZA 5FQBA 5AEBA 2BG6A 4NQ6A 3ZWFA 3PY5A 1QH3A 2GMNA 2FHXA 2AIOA 3AF6A 5ACXA 5LCFA 2YNVA 3I15A 3RPCA 5A0VA 2FM6A 2BR6A 4D1VA 1JT1A 1JJEA 3G1PA 4C1GA 3I0VA 3IELA 5HH6A 2H6AA 2BGAA 5EV6A 2XR1A 2GKLA 2FK6A 2DKFA 2BG8B 5LCAA 3H3EA 4KEPA
chains in the Genus database with same CATH topology
3X2ZA 1DXKA 3P2UA 2FU6A 3S0ZA 4GYQA 2BTNA 3BV6A 5IQKA 2GFJA 4YSKA 3FAIA 4AD9A 4BP0A 5K0WA 5LLDA 4FSBA 2QDSA 2OHHA 4EY2A 2BIBA 4ZO2A 4Z5YA 4TZFA 1X8GA 1M2XA 4GCWA 4D1WA 3ADRA 2YNUA 1ZNBA 5AXRA 4GYUA 5EW0A 4Z5ZA 1SMLA 5AHRA 4AX0B 4UBQA 3DHAA 2BFLA 2HB9A 3A4YA 2WRSA 2P18A 3SRXA 2BG7A 3AJ3A 3I11A 4XUKA 5K4NA 4RL2A 2NZFA 3KNSA 3FCZA 2I7TA 3I14A 5B3RA 1X8HA 4UAMA 4D1UA 2A7MA 1XM8A 4RAMA 2Q0IA 3SPUA 3ZNBA 3T3OA 3BC2A 4ZO3A 3IEMA 4EYFA 3IOGA 1VJNA 5ACRA 2WHGA 4ZEJA 4Z60A 2QDTA 5HISA 4WD6A 5ACWA 4CHLA 4EYLA 3RKKA 1P9EA 4AWZA 2DOOA 3ZQ4A 4LE6A 3BK2A 1DDKA 2M5DA 4XWTA 4HKYA 5ACUA 4TYFA 5FQAA 4J5HA 4C1DA 3BK1A 4BZ3A 1BC2A 3PG4A 1ZKPA 5ACVA 5HH4A 4Z7RA 5ACPA 3I13A 3RKJA 4F6HA 1A7TA 2AZ4A 4Z6XA 4FEKA 1E5DA 1BVTA 3AF5A 5EVDA 4TYTA 5FQCA 4D02A 5B15A 2NXAA 2ZZIA 5ACQA 2UYXA 2Q42A 2Y8BA 5HIQA 3F9OA 2E7YA 2XF4A 4RM5A 3IEKA 4Z67A 2WYLA 2CBNA 2BG8A 3LVZA 3T3NA 5KIKA 2YNTB 4RBSA 4EFZA 4FR7A 3X2XA 5K4KA 5K4MA 3SBLA 3X30A 3X2YA 2I7XA 3IE1A 3L6NA 4F6ZA 1YCFA 4UWOB 4J5FA 4NQ4A 4YSBA 4V0HA 5ACTA 2BFZB 2BC2A 2BFKA 1X8IA 2R2DA 2FHXB 1YCHA 4RAWA 2YNWA 5EVBA 4TZBA 3T9MA 2OHIA 3SFPA 5LMCA 1QH5A 2YNVB 2OHJA 3DH8A 4DIKA 5EHTA 2BMIA 5HIPA 4C1CA 2YZ3A 4EXSA 4JO0A 4UA4A 1Y44A 3PY6A 4AX1B 2M5CA 3VPEA 3SW3A 2WYMA 1KR3A 5HH5A 3MD7A 4HL1A 1WW1A 1BMCA 3TP9A 5DPXA 1WUOA 5A5ZA 2QINA 2I7VA 4UWSB 3IE0A 2VW8A 4TZ9A 1KO2A 1KO3A 1MQOA 2P97A 3ESHA 2Q0JA 5EH9A 4EYBA 5AYAA 5LSCA 2P4ZA 3DHCA 4DILA 3IDZA 4D1TA 4RL0A 2NYPA 4P62A 4XWWA 3IOFA 4PVOA 5B1UA 2P1EA 4NQ5A 4UWPB 3JXPA 1HLKA 5LE1A 3R2UA 1K07A 3KNRA 5LS3A 1DD6A 4AWYB 5AHOA 5LM6A 3VQZA 2ZO4A 1L9YA 1VMEA 4U4LA 5EWAA 2ZNBA 5ACSA 2GFKA 3KL7A 3IE2A 5AXOA 4C1FA 4UWRB 4H0DA 2Y87A 2BG2A 5A87A 2YCBA 4YSLA 2Q9UA 2ZWRA 1A8TA 3WXCA 5EV8A 2QEDA 5HIOA 5LCHA 5EVKA 4ZNBA 4NQ2A 1ZTCA 4KEQA 1WRAA 3Q6VA 1WUPA 2FU7A 2GCUA 5A0TA 2Y8AA 4C09A 4HL2A 4C1HA 2NZEA 1JJTA 3SD9A 4C1EA 2YNTA 1VGNA 4O98A 2QJSA 4EXYA 2FU8A 2FU9A 3ZR9A 3DHBA 5KILA 4B87A 2WYMC 4PVTA 1XTOA 4TZEA 3QH8A 1YCGA 2BFZA 5FQBA 5AEBA 2BG6A 4NQ6A 3ZWFA 3PY5A 1QH3A 2GMNA 2FHXA 2AIOA 3AF6A 5ACXA 5LCFA 2YNVA 3I15A 3RPCA 5A0VA 2FM6A 2BR6A 4D1VA 1JT1A 1JJEA 3G1PA 4C1GA 3I0VA 3IELA 5HH6A 2H6AA 2BGAA 5EV6A 2XR1A 2GKLA 2FK6A 2DKFA 2BG8B 5LCAA 3H3EA 4KEPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3X2Z A;  1DXK A;  3P2U A;  2FU6 A;  3S0Z A;  4GYQ A;  2BTN A;  3BV6 A;  5IQK A;  2GFJ A;  4YSK A;  3FAI A;  4AD9 A;  4BP0 A;  5K0W A;  5LLD A;  4FSB A;  2QDS A;  2OHH A;  4EY2 A;  2BIB A;  4ZO2 A;  4Z5Y A;  4TZF A;  1X8G A;  1M2X A;  4GCW A;  4D1W A;  3ADR A;  2YNU A;  1ZNB A;  5AXR A;  4GYU A;  5EW0 A;  4Z5Z A;  1SML A;  5AHR A;  4AX0 B;  4UBQ A;  3DHA A;  2BFL A;  2HB9 A;  3A4Y A;  2WRS A;  2P18 A;  3SRX A;  2BG7 A;  3AJ3 A;  3I11 A;  4XUK A;  5K4N A;  4RL2 A;  2NZF A;  3KNS A;  3FCZ A;  2I7T A;  3I14 A;  5B3R A;  1X8H A;  4UAM A;  4D1U A;  2A7M A;  1XM8 A;  4RAM A;  2Q0I A;  3SPU A;  3ZNB A;  3T3O A;  3BC2 A;  4ZO3 A;  3IEM A;  4EYF A;  3IOG A;  1VJN A;  5ACR A;  2WHG A;  4ZEJ A;  4Z60 A;  2QDT A;  5HIS A;  4WD6 A;  5ACW A;  4CHL A;  4EYL A;  3RKK A;  1P9E A;  4AWZ A;  2DOO A;  3ZQ4 A;  4LE6 A;  3BK2 A;  1DDK A;  2M5D A;  4XWT A;  4HKY A;  5ACU A;  4TYF A;  5FQA A;  4J5H A;  4C1D A;  3BK1 A;  4BZ3 A;  1BC2 A;  3PG4 A;  1ZKP A;  5ACV A;  5HH4 A;  4Z7R A;  5ACP A;  3I13 A;  3RKJ A;  4F6H A;  1A7T A;  2AZ4 A;  4Z6X A;  4FEK A;  1E5D A;  1BVT A;  3AF5 A;  5EVD A;  4TYT A;  5FQC A;  4D02 A;  5B15 A;  2NXA A;  2ZZI A;  5ACQ A;  2UYX A;  2Q42 A;  2Y8B A;  5HIQ A;  3F9O A;  2E7Y A;  2XF4 A;  4RM5 A;  3IEK A;  4Z67 A;  2WYL A;  2CBN A;  2BG8 A;  3LVZ A;  3T3N A;  5KIK A;  2YNT B;  4RBS A;  4EFZ A;  4FR7 A;  3X2X A;  5K4K A;  5K4M A;  3SBL A;  3X30 A;  3X2Y A;  2I7X A;  3IE1 A;  3L6N A;  4F6Z A;  1YCF A;  4UWO B;  4J5F A;  4NQ4 A;  4YSB A;  4V0H A;  5ACT A;  2BFZ B;  2BC2 A;  2BFK A;  1X8I A;  2R2D A;  2FHX B;  1YCH A;  4RAW A;  2YNW A;  5EVB A;  4TZB A;  3T9M A;  2OHI A;  3SFP A;  5LMC A;  1QH5 A;  2YNV B;  2OHJ A;  3DH8 A;  4DIK A;  5EHT A;  2BMI A;  5HIP A;  4C1C A;  2YZ3 A;  4EXS A;  4JO0 A;  4UA4 A;  1Y44 A;  3PY6 A;  4AX1 B;  2M5C A;  3VPE A;  3SW3 A;  2WYM A;  1KR3 A;  5HH5 A;  3MD7 A;  4HL1 A;  1WW1 A;  1BMC A;  3TP9 A;  5DPX A;  1WUO A;  5A5Z A;  2QIN A;  2I7V A;  4UWS B;  3IE0 A;  2VW8 A;  4TZ9 A;  1KO2 A;  1KO3 A;  1MQO A;  2P97 A;  3ESH A;  2Q0J A;  5EH9 A;  4EYB A;  5AYA A;  5LSC A;  2P4Z A;  3DHC A;  4DIL A;  3IDZ A;  4D1T A;  4RL0 A;  2NYP A;  4P62 A;  4XWW A;  3IOF A;  4PVO A;  5B1U A;  2P1E A;  4NQ5 A;  4UWP B;  3JXP A;  1HLK A;  5LE1 A;  3R2U A;  1K07 A;  3KNR A;  5LS3 A;  1DD6 A;  4AWY B;  5AHO A;  5LM6 A;  3VQZ A;  2ZO4 A;  1L9Y A;  1VME A;  4U4L A;  5EWA A;  2ZNB A;  5ACS A;  2GFK A;  3KL7 A;  3IE2 A;  5AXO A;  4C1F A;  4UWR B;  4H0D A;  2Y87 A;  2BG2 A;  5A87 A;  2YCB A;  4YSL A;  2Q9U A;  2ZWR A;  1A8T A;  3WXC A;  5EV8 A;  2QED A;  5HIO A;  5LCH A;  5EVK A;  4ZNB A;  4NQ2 A;  1ZTC A;  4KEQ A;  1WRA A;  3Q6V A;  1WUP A;  2FU7 A;  2GCU A;  5A0T A;  2Y8A A;  4C09 A;  4HL2 A;  4C1H A;  2NZE A;  1JJT A;  3SD9 A;  4C1E A;  2YNT A;  1VGN A;  4O98 A;  2QJS A;  4EXY A;  2FU8 A;  2FU9 A;  3ZR9 A;  3DHB A;  5KIL A;  4B87 A;  2WYM C;  4PVT A;  1XTO A;  4TZE A;  3QH8 A;  1YCG A;  2BFZ A;  5FQB A;  5AEB A;  2BG6 A;  4NQ6 A;  3ZWF A;  3PY5 A;  1QH3 A;  2GMN A;  2FHX A;  2AIO A;  3AF6 A;  5ACX A;  5LCF A;  2YNV A;  3I15 A;  3RPC A;  5A0V A;  2FM6 A;  2BR6 A;  4D1V A;  1JT1 A;  1JJE A;  3G1P A;  4C1G A;  3I0V A;  3IEL A;  5HH6 A;  2H6A A;  2BGA A;  5EV6 A;  2XR1 A;  2GKL A;  2FK6 A;  2DKF A;  2BG8 B;  5LCA A;  3H3E A;  4KEP A; 
#chains in the Genus database with same CATH topology
 3X2Z A;  1DXK A;  3P2U A;  2FU6 A;  3S0Z A;  4GYQ A;  2BTN A;  3BV6 A;  5IQK A;  2GFJ A;  4YSK A;  3FAI A;  4AD9 A;  4BP0 A;  5K0W A;  5LLD A;  4FSB A;  2QDS A;  2OHH A;  4EY2 A;  2BIB A;  4ZO2 A;  4Z5Y A;  4TZF A;  1X8G A;  1M2X A;  4GCW A;  4D1W A;  3ADR A;  2YNU A;  1ZNB A;  5AXR A;  4GYU A;  5EW0 A;  4Z5Z A;  1SML A;  5AHR A;  4AX0 B;  4UBQ A;  3DHA A;  2BFL A;  2HB9 A;  3A4Y A;  2WRS A;  2P18 A;  3SRX A;  2BG7 A;  3AJ3 A;  3I11 A;  4XUK A;  5K4N A;  4RL2 A;  2NZF A;  3KNS A;  3FCZ A;  2I7T A;  3I14 A;  5B3R A;  1X8H A;  4UAM A;  4D1U A;  2A7M A;  1XM8 A;  4RAM A;  2Q0I A;  3SPU A;  3ZNB A;  3T3O A;  3BC2 A;  4ZO3 A;  3IEM A;  4EYF A;  3IOG A;  1VJN A;  5ACR A;  2WHG A;  4ZEJ A;  4Z60 A;  2QDT A;  5HIS A;  4WD6 A;  5ACW A;  4CHL A;  4EYL A;  3RKK A;  1P9E A;  4AWZ A;  2DOO A;  3ZQ4 A;  4LE6 A;  5AJL A;  3BK2 A;  1DDK A;  2M5D A;  4XWT A;  2CG3 A;  4HKY A;  5ACU A;  4TYF A;  5FQA A;  4J5H A;  4C1D A;  3BK1 A;  4BZ3 A;  1BC2 A;  3PG4 A;  2CG2 A;  1ZKP A;  5ACV A;  5HH4 A;  4Z7R A;  5ACP A;  3I13 A;  3RKJ A;  4F6H A;  1A7T A;  2AZ4 A;  4Z6X A;  4FEK A;  1E5D A;  1BVT A;  3AF5 A;  5EVD A;  4TYT A;  5FQC A;  4D02 A;  5B15 A;  2NXA A;  2ZZI A;  5ACQ A;  2UYX A;  2Q42 A;  2Y8B A;  5HIQ A;  3F9O A;  2E7Y A;  2XF4 A;  4RM5 A;  3IEK A;  4Z67 A;  2WYL A;  2CFU A;  2CBN A;  2BG8 A;  3LVZ A;  3T3N A;  5KIK A;  2YNT B;  4RBS A;  4EFZ A;  4FR7 A;  3X2X A;  5K4K A;  5K4M A;  3SBL A;  3X30 A;  3X2Y A;  2I7X A;  3IE1 A;  3L6N A;  4F6Z A;  1YCF A;  4UWO B;  4J5F A;  4NQ4 A;  4YSB A;  4V0H A;  5ACT A;  2BFZ B;  2BC2 A;  2BFK A;  1X8I A;  2R2D A;  2FHX B;  1YCH A;  4RAW A;  2YNW A;  5EVB A;  4TZB A;  3T9M A;  2OHI A;  3SFP A;  5LMC A;  1QH5 A;  2YNV B;  2OHJ A;  3DH8 A;  4DIK A;  5EHT A;  2BMI A;  5HIP A;  4C1C A;  2YZ3 A;  4EXS A;  4JO0 A;  4UA4 A;  1Y44 A;  3PY6 A;  4AX1 B;  2M5C A;  3VPE A;  3SW3 A;  2WYM A;  1KR3 A;  5HH5 A;  3MD7 A;  4HL1 A;  1WW1 A;  1BMC A;  3TP9 A;  5DPX A;  1WUO A;  2YHE A;  2QIN A;  2I7V A;  5A5Z A;  4UWS B;  5A23 A;  3IE0 A;  2VW8 A;  4TZ9 A;  1KO2 A;  1KO3 A;  1MQO A;  2P97 A;  3ESH A;  2Q0J A;  5EH9 A;  4EYB A;  5AYA A;  5LSC A;  2P4Z A;  4AV7 A;  3DHC A;  4DIL A;  3IDZ A;  4RL0 A;  4D1T A;  2NYP A;  4P62 A;  4XWW A;  3IOF A;  4PVO A;  5B1U A;  2P1E A;  4NQ5 A;  4UWP B;  3JXP A;  1HLK A;  5LE1 A;  3R2U A;  1K07 A;  3KNR A;  5LS3 A;  1DD6 A;  4AWY B;  5AHO A;  4PDX A;  5LM6 A;  3VQZ A;  2ZO4 A;  1L9Y A;  1VME A;  4U4L A;  5EWA A;  2ZNB A;  5ACS A;  2GFK A;  3KL7 A;  3IE2 A;  5AXO A;  4C1F A;  4UWR B;  4H0D A;  2Y87 A;  2BG2 A;  5A87 A;  2YCB A;  4YSL A;  2Q9U A;  2ZWR A;  1A8T A;  3WXC A;  5EV8 A;  2QED A;  5HIO A;  5LCH A;  2CFZ A;  5EVK A;  4ZNB A;  4NQ2 A;  1ZTC A;  4KEQ A;  1WRA A;  3Q6V A;  1WUP A;  2FU7 A;  4AXH A;  2GCU A;  5A0T A;  2Y8A A;  4C09 A;  4HL2 A;  4C1H A;  2NZE A;  1JJT A;  3SD9 A;  4C1E A;  2YNT A;  1VGN A;  5AIJ A;  4O98 A;  2QJS A;  4EXY A;  2FU8 A;  2FU9 A;  3ZR9 A;  3DHB A;  5KIL A;  4B87 A;  4NUR A;  2WYM C;  4PVT A;  1XTO A;  4TZE A;  3QH8 A;  1YCG A;  2BFZ A;  5FQB A;  5AEB A;  2BG6 A;  4NQ6 A;  3ZWF A;  3PY5 A;  1QH3 A;  2GMN A;  2FHX A;  2AIO A;  3AF6 A;  5ACX A;  5LCF A;  2YNV A;  3I15 A;  3RPC A;  5A0V A;  2FM6 A;  2BR6 A;  4D1V A;  1JT1 A;  1JJE A;  3G1P A;  4C1G A;  3I0V A;  3IEL A;  5HH6 A;  2H6A A;  2BGA A;  5EV6 A;  2XR1 A;  2GKL A;  2FK6 A;  2DKF A;  2BG8 B;  5LCA A;  3H3E A;  4KEP A; 
#chains in the Genus database with same CATH homology
 3X2Z A;  1DXK A;  3P2U A;  2FU6 A;  3S0Z A;  4GYQ A;  2BTN A;  3BV6 A;  5IQK A;  2GFJ A;  4YSK A;  3FAI A;  4AD9 A;  4BP0 A;  5K0W A;  5LLD A;  4FSB A;  2QDS A;  2OHH A;  4EY2 A;  2BIB A;  4ZO2 A;  4Z5Y A;  4TZF A;  1X8G A;  1M2X A;  4GCW A;  4D1W A;  3ADR A;  2YNU A;  1ZNB A;  5AXR A;  4GYU A;  5EW0 A;  4Z5Z A;  1SML A;  5AHR A;  4AX0 B;  4UBQ A;  3DHA A;  2BFL A;  2HB9 A;  3A4Y A;  2WRS A;  2P18 A;  3SRX A;  2BG7 A;  3AJ3 A;  3I11 A;  4XUK A;  5K4N A;  4RL2 A;  2NZF A;  3KNS A;  3FCZ A;  2I7T A;  3I14 A;  5B3R A;  1X8H A;  4UAM A;  4D1U A;  2A7M A;  1XM8 A;  4RAM A;  2Q0I A;  3SPU A;  3ZNB A;  3T3O A;  3BC2 A;  4ZO3 A;  3IEM A;  4EYF A;  3IOG A;  1VJN A;  5ACR A;  2WHG A;  4ZEJ A;  4Z60 A;  2QDT A;  5HIS A;  4WD6 A;  5ACW A;  4CHL A;  4EYL A;  3RKK A;  1P9E A;  4AWZ A;  2DOO A;  3ZQ4 A;  4LE6 A;  3BK2 A;  1DDK A;  2M5D A;  4XWT A;  4HKY A;  5ACU A;  4TYF A;  5FQA A;  4J5H A;  4C1D A;  3BK1 A;  4BZ3 A;  1BC2 A;  3PG4 A;  1ZKP A;  5ACV A;  5HH4 A;  4Z7R A;  5ACP A;  3I13 A;  3RKJ A;  4F6H A;  1A7T A;  2AZ4 A;  4Z6X A;  4FEK A;  1E5D A;  1BVT A;  3AF5 A;  5EVD A;  4TYT A;  5FQC A;  4D02 A;  5B15 A;  2NXA A;  2ZZI A;  5ACQ A;  2UYX A;  2Q42 A;  2Y8B A;  5HIQ A;  3F9O A;  2E7Y A;  2XF4 A;  4RM5 A;  3IEK A;  4Z67 A;  2WYL A;  2CBN A;  2BG8 A;  3LVZ A;  3T3N A;  5KIK A;  2YNT B;  4RBS A;  4EFZ A;  4FR7 A;  3X2X A;  5K4K A;  5K4M A;  3SBL A;  3X30 A;  3X2Y A;  2I7X A;  3IE1 A;  3L6N A;  4F6Z A;  1YCF A;  4UWO B;  4J5F A;  4NQ4 A;  4YSB A;  4V0H A;  5ACT A;  2BFZ B;  2BC2 A;  2BFK A;  1X8I A;  2R2D A;  2FHX B;  1YCH A;  4RAW A;  2YNW A;  5EVB A;  4TZB A;  3T9M A;  2OHI A;  3SFP A;  5LMC A;  1QH5 A;  2YNV B;  2OHJ A;  3DH8 A;  4DIK A;  5EHT A;  2BMI A;  5HIP A;  4C1C A;  2YZ3 A;  4EXS A;  4JO0 A;  4UA4 A;  1Y44 A;  3PY6 A;  4AX1 B;  2M5C A;  3VPE A;  3SW3 A;  2WYM A;  1KR3 A;  5HH5 A;  3MD7 A;  4HL1 A;  1WW1 A;  1BMC A;  3TP9 A;  5DPX A;  1WUO A;  5A5Z A;  2QIN A;  2I7V A;  4UWS B;  3IE0 A;  2VW8 A;  4TZ9 A;  1KO2 A;  1KO3 A;  1MQO A;  2P97 A;  3ESH A;  2Q0J A;  5EH9 A;  4EYB A;  5AYA A;  5LSC A;  2P4Z A;  3DHC A;  4DIL A;  3IDZ A;  4D1T A;  4RL0 A;  2NYP A;  4P62 A;  4XWW A;  3IOF A;  4PVO A;  5B1U A;  2P1E A;  4NQ5 A;  4UWP B;  3JXP A;  1HLK A;  5LE1 A;  3R2U A;  1K07 A;  3KNR A;  5LS3 A;  1DD6 A;  4AWY B;  5AHO A;  5LM6 A;  3VQZ A;  2ZO4 A;  1L9Y A;  1VME A;  4U4L A;  5EWA A;  2ZNB A;  5ACS A;  2GFK A;  3KL7 A;  3IE2 A;  5AXO A;  4C1F A;  4UWR B;  4H0D A;  2Y87 A;  2BG2 A;  5A87 A;  2YCB A;  4YSL A;  2Q9U A;  2ZWR A;  1A8T A;  3WXC A;  5EV8 A;  2QED A;  5HIO A;  5LCH A;  5EVK A;  4ZNB A;  4NQ2 A;  1ZTC A;  4KEQ A;  1WRA A;  3Q6V A;  1WUP A;  2FU7 A;  2GCU A;  5A0T A;  2Y8A A;  4C09 A;  4HL2 A;  4C1H A;  2NZE A;  1JJT A;  3SD9 A;  4C1E A;  2YNT A;  1VGN A;  4O98 A;  2QJS A;  4EXY A;  2FU8 A;  2FU9 A;  3ZR9 A;  3DHB A;  5KIL A;  4B87 A;  2WYM C;  4PVT A;  1XTO A;  4TZE A;  3QH8 A;  1YCG A;  2BFZ A;  5FQB A;  5AEB A;  2BG6 A;  4NQ6 A;  3ZWF A;  3PY5 A;  1QH3 A;  2GMN A;  2FHX A;  2AIO A;  3AF6 A;  5ACX A;  5LCF A;  2YNV A;  3I15 A;  3RPC A;  5A0V A;  2FM6 A;  2BR6 A;  4D1V A;  1JT1 A;  1JJE A;  3G1P A;  4C1G A;  3I0V A;  3IEL A;  5HH6 A;  2H6A A;  2BGA A;  5EV6 A;  2XR1 A;  2GKL A;  2FK6 A;  2DKF A;  2BG8 B;  5LCA A;  3H3E A;  4KEP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...