1ZKPA

1.5a resolution crystal structure of a metallo beta lactamase family protein, the elac homolgue of bacillus anthracis, a putative ribonuclease
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
251
structure length
251
Chain Sequence
LYFQSNAMKMTVVGFWGGFPEAGEATSGYLFEHDGFRLLVDCGSGVLAQLQKYITPSDIDAVVLSHYHHDHVADIGVLQYARLITSATKGQLPELPIYGHTFDENGFHSLTHEPHTKGIPYNPEETLQIGPFSISFLKTVHPVTCFAMRITAGNDIVVYSADSSYIPEFIPFTKDADLFICECNMYAHQEAAKAGHMNSTEVASIAKDANVKELLLTHLPHTGNPADLVTEAKQIFSGHITLAHSGYVWNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 1.5A Resolution Crystal Structure of a Metallo Beta Lactamase Family Protein, the ELAC Homolgue of Bacillus anthracis, a Putative Ribonuclease
rcsb
source organism Bacillus anthracis str.
molecule tags Structural genomics, unknown function
molecule keywords hypothetical protein BA1088
total genus 76
structure length 251
sequence length 251
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12706 Lactamase_B_2 Beta-lactamase superfamily domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 1zkpA00
1DDKA 1WUOA 4ZEJA 2WYMC 5A0VA 5FQCA 4XUKA 1KR3A 2FHXB 4Z7RA 5HIQA 4RAMA 5LSCA 4J5FA 3RKJA 2FHXA 1M2XA 5EW0A 3X2ZA 2BC2A 2OHJA 2BG2A 4Z60A 3SBLA 4CHLA 1XTOA 4TZBA 1KO2A 4P62A 2ZZIA 2Q0JA 5K4MA 4Z5ZA 3SPUA 5EV6A 2I7TA 5HIPA 2NZEA 4U4LA 3SD9A 4H0DA 2XR1A 4C1DA 2FU6A 4NQ2A 4HL2A 4EY2A 1YCGA 4GYQA 1P9EA 4LE6A 1JJTA 3SRXA 3TP9A 2XF4A 5A87A 1K07A 4AWZA 3IEMA 3PG4A 4AD9A 3X30A 3IOGA 5AEBA 5EH9A 4ZNBA 4UBQA 1ZTCA 4EXYA 1JT1A 3T3OA 4TZ9A 3ZNBA 1X8IA 4ZO2A 2AIOA 5B3RA 1BMCA 5EVBA 5KIKA 2NYPA 4TZEA 2BFLA 1X8HA 2YNTB 3AF5A 3I11A 2Q0IA 2YNTA 5LCAA 4YSKA 5AXOA 4D02A 2GMNA 4F6HA 2R2DA 4FR7A 2QEDA 4XWWA 2BIBA 2BG8B 2I7VA 3QH8A 2YCBA 4NQ4A 5FQAA 4Z67A 4YSLA 2BTNA 4FSBA 4YSBA 5K0WA 2GFKA 4GYUA 4BP0A 2OHHA 5LCFA 5K4KA 2NZFA 4Z6XA 4D1UA 4C1CA 4EFZA 1BC2A 3IDZA 1QH3A 4PVOA 2BMIA 4HL1A 5AXRA 3I0VA 2ZNBA 4EYFA 1WRAA 5HIOA 5K4NA 2P97A 4HKYA 1WUPA 4C1FA 3BV6A 5ACTA 4XWTA 4D1VA 5LM6A 1WW1A 2WYMA 2QJSA 5LLDA 4UWPB 4AX0B 4RM5A 2GCUA 3WXCA 3ZQ4A 3ZR9A 3DH8A 5ACPA 2BFKA 2UYXA 5A0TA 3F9OA 4RL2A 2ZO4A 1YCFA 5ACVA 4C1HA 3A4YA 4EXSA 1BVTA 2Y8BA 3RKKA 2M5CA 1Y44A 5ACSA 4B87A 2YNWA 3ESHA 4ZO3A 5FQBA 3BK1A 2FU7A 2VW8A 4UWOB 2BFZB 3KL7A 5AHRA 3H3EA 1L9YA 2BG7A 1JJEA 3VQZA 5AYAA 3PY5A 2WHGA 1VGNA 3MD7A 1ZKPA 3KNSA 4EYLA 1A8TA 1YCHA 4UWRB 2E7YA 2Q9UA 3IELA 4C09A 5LS3A 3I13A 2YNVB 1QH5A 3P2UA 2GKLA 5HH6A 2DKFA 3T3NA 2CBNA 3IE2A 3R2UA 3BK2A 2BFZA 5A5ZA 5EVDA 3SW3A 4TZFA 2YNVA 2QDSA 3SFPA 5B15A 2ZWRA 5HISA 2BGAA 2P18A 4D1WA 4V0HA 4KEQA 4D1TA 3IOFA 2I7XA 4Z5YA 2BG8A 4WD6A 5HH4A 3Q6VA 3IE0A 2OHIA 4BZ3A 4TYTA 2GFJA 5AHOA 2DOOA 2Y8AA 1X8GA 3G1PA 1VMEA 5ACXA 5LE1A 5ACRA 3ADRA 2AZ4A 2H6AA 1HLKA 5EV8A 4J5HA 2M5DA 4JO0A 2FU8A 2A7MA 3VPEA 4C1GA 4AX1B 2HB9A 4RL0A 5EWAA 2NXAA 2BR6A 2FK6A 3LVZA 4UAMA 4RBSA 2QDTA 3IEKA 1XM8A 5ACQA 2WRSA 2BG6A 2Q42A 3BC2A 4GCWA 3KNRA 5EVKA 3X2XA 4DILA 2Y87A 3X2YA 4PVTA 4UA4A 2FU9A 4TYFA 2P1EA 3FCZA 4RAWA 2WYLA 5LCHA 3T9MA 4AWYB 1VJNA 1ZNBA 5KILA 5HH5A 2FM6A 3L6NA 5EHTA 3S0ZA 1SMLA 3ZWFA 3AF6A 5ACWA 5ACUA 2P4ZA 3DHCA 5DPXA 4EYBA 5LMCA 3DHBA 2YNUA 1KO3A 1MQOA 3AJ3A 4DIKA 4O98A 1DXKA 3FAIA 2QINA 3PY6A 4C1EA 3RPCA 3I14A 4UWSB 3I15A 4NQ5A 4KEPA 4NQ6A 2YZ3A 3DHAA 1A7TA 1E5DA 3IE1A 4F6ZA 5B1UA 4FEKA 1DD6A 5IQKA 3JXPA
chains in the Genus database with same CATH superfamily
1DDKA 1WUOA 4ZEJA 2WYMC 5A0VA 5FQCA 4XUKA 1KR3A 2FHXB 4Z7RA 5HIQA 4RAMA 5LSCA 4J5FA 3RKJA 2FHXA 1M2XA 5EW0A 3X2ZA 2BC2A 2OHJA 2BG2A 4Z60A 4NURA 3SBLA 4CHLA 1XTOA 4TZBA 1KO2A 4P62A 2ZZIA 2Q0JA 5K4MA 4Z5ZA 3SPUA 5EV6A 2I7TA 5HIPA 2NZEA 4U4LA 3SD9A 4H0DA 2XR1A 4C1DA 2FU6A 4NQ2A 4HL2A 4EY2A 1YCGA 4GYQA 1P9EA 4LE6A 1JJTA 3SRXA 3TP9A 2XF4A 5A87A 1K07A 4AWZA 3IEMA 3PG4A 4AD9A 3X30A 3IOGA 5AEBA 5EH9A 4ZNBA 4UBQA 1ZTCA 4EXYA 1JT1A 3T3OA 4TZ9A 3ZNBA 1X8IA 4ZO2A 2AIOA 5B3RA 1BMCA 5EVBA 5KIKA 2NYPA 4TZEA 2BFLA 1X8HA 2YNTB 3AF5A 3I11A 2Q0IA 2YNTA 5LCAA 4YSKA 5AXOA 4D02A 2GMNA 4F6HA 2R2DA 4FR7A 2QEDA 4XWWA 2YHEA 2BIBA 2BG8B 2I7VA 3QH8A 4PDXA 2YCBA 4NQ4A 5FQAA 4Z67A 4YSLA 2BTNA 4FSBA 4YSBA 5K0WA 2GFKA 4GYUA 4BP0A 2OHHA 5LCFA 5K4KA 2NZFA 4Z6XA 4D1UA 4C1CA 4EFZA 1BC2A 3IDZA 1QH3A 4PVOA 2BMIA 4HL1A 5AXRA 3I0VA 2ZNBA 4EYFA 1WRAA 5HIOA 5K4NA 2P97A 4HKYA 1WUPA 4C1FA 3BV6A 5ACTA 4XWTA 4D1VA 5LM6A 1WW1A 2WYMA 2QJSA 5LLDA 4UWPB 4AX0B 2CFZA 4RM5A 2GCUA 3WXCA 3ZQ4A 3ZR9A 3DH8A 5ACPA 2BFKA 2UYXA 5A0TA 3F9OA 4RL2A 2ZO4A 1YCFA 5ACVA 4C1HA 3A4YA 4EXSA 1BVTA 2Y8BA 3RKKA 2M5CA 1Y44A 5ACSA 4B87A 2YNWA 3ESHA 4ZO3A 5FQBA 3BK1A 2FU7A 2VW8A 4UWOB 2BFZB 3KL7A 5AHRA 3H3EA 1L9YA 2BG7A 1JJEA 3VQZA 5AYAA 3PY5A 2WHGA 1VGNA 3MD7A 1ZKPA 2CG2A 3KNSA 4EYLA 1A8TA 1YCHA 4UWRB 2E7YA 2Q9UA 3IELA 4C09A 5LS3A 3I13A 4AXHA 2YNVB 1QH5A 3P2UA 2GKLA 5HH6A 2DKFA 3T3NA 2CBNA 3IE2A 3R2UA 3BK2A 2BFZA 5A23A 5A5ZA 5EVDA 3SW3A 4TZFA 2YNVA 2QDSA 3SFPA 5B15A 2ZWRA 5HISA 2BGAA 2P18A 4D1WA 4V0HA 4KEQA 4D1TA 3IOFA 2I7XA 4Z5YA 2BG8A 4WD6A 5HH4A 3Q6VA 3IE0A 2OHIA 4BZ3A 4TYTA 2GFJA 5AHOA 2DOOA 2Y8AA 1X8GA 3G1PA 1VMEA 5ACXA 5LE1A 5ACRA 3ADRA 2AZ4A 2H6AA 1HLKA 5EV8A 4J5HA 2M5DA 4JO0A 2FU8A 2A7MA 3VPEA 4C1GA 4AX1B 2HB9A 4RL0A 5EWAA 2NXAA 2BR6A 5AJLA 2FK6A 3LVZA 4UAMA 2CG3A 4RBSA 2QDTA 3IEKA 1XM8A 5ACQA 2WRSA 2BG6A 2Q42A 3BC2A 4GCWA 3KNRA 5EVKA 3X2XA 4DILA 2Y87A 3X2YA 4PVTA 4UA4A 2FU9A 4TYFA 4AV7A 2P1EA 3FCZA 4RAWA 2WYLA 5LCHA 3T9MA 4AWYB 1VJNA 1ZNBA 5KILA 5HH5A 2FM6A 3L6NA 5EHTA 3S0ZA 1SMLA 3ZWFA 3AF6A 5ACWA 5ACUA 2P4ZA 3DHCA 5DPXA 4EYBA 5LMCA 3DHBA 2YNUA 1KO3A 1MQOA 3AJ3A 4DIKA 4O98A 1DXKA 3FAIA 2QINA 3PY6A 4C1EA 3RPCA 3I14A 4UWSB 3I15A 4NQ5A 4KEPA 4NQ6A 2CFUA 2YZ3A 3DHAA 1A7TA 1E5DA 5AIJA 3IE1A 4F6ZA 5B1UA 4FEKA 1DD6A 5IQKA 3JXPA
chains in the Genus database with same CATH topology
1DDKA 1WUOA 4ZEJA 2WYMC 5A0VA 5FQCA 4XUKA 1KR3A 2FHXB 4Z7RA 5HIQA 4RAMA 5LSCA 4J5FA 3RKJA 2FHXA 1M2XA 5EW0A 3X2ZA 2BC2A 2OHJA 2BG2A 4Z60A 3SBLA 4CHLA 1XTOA 4TZBA 1KO2A 4P62A 2ZZIA 2Q0JA 5K4MA 4Z5ZA 3SPUA 5EV6A 2I7TA 5HIPA 2NZEA 4U4LA 3SD9A 4H0DA 2XR1A 4C1DA 2FU6A 4NQ2A 4HL2A 4EY2A 1YCGA 4GYQA 1P9EA 4LE6A 1JJTA 3SRXA 3TP9A 2XF4A 5A87A 1K07A 4AWZA 3IEMA 3PG4A 4AD9A 3X30A 3IOGA 5AEBA 5EH9A 4ZNBA 4UBQA 1ZTCA 4EXYA 1JT1A 3T3OA 4TZ9A 3ZNBA 1X8IA 4ZO2A 2AIOA 5B3RA 1BMCA 5EVBA 5KIKA 2NYPA 4TZEA 2BFLA 1X8HA 2YNTB 3AF5A 3I11A 2Q0IA 2YNTA 5LCAA 4YSKA 5AXOA 4D02A 2GMNA 4F6HA 2R2DA 4FR7A 2QEDA 4XWWA 2BIBA 2BG8B 2I7VA 3QH8A 2YCBA 4NQ4A 5FQAA 4Z67A 4YSLA 2BTNA 4FSBA 4YSBA 5K0WA 2GFKA 4GYUA 4BP0A 2OHHA 5LCFA 5K4KA 2NZFA 4Z6XA 4D1UA 4C1CA 4EFZA 1BC2A 3IDZA 1QH3A 4PVOA 2BMIA 4HL1A 5AXRA 3I0VA 2ZNBA 4EYFA 1WRAA 5HIOA 5K4NA 2P97A 4HKYA 1WUPA 4C1FA 3BV6A 5ACTA 4XWTA 4D1VA 5LM6A 1WW1A 2WYMA 2QJSA 5LLDA 4UWPB 4AX0B 4RM5A 2GCUA 3WXCA 3ZQ4A 3ZR9A 3DH8A 5ACPA 2BFKA 2UYXA 5A0TA 3F9OA 4RL2A 2ZO4A 1YCFA 5ACVA 4C1HA 3A4YA 4EXSA 1BVTA 2Y8BA 3RKKA 2M5CA 1Y44A 5ACSA 4B87A 2YNWA 3ESHA 4ZO3A 5FQBA 3BK1A 2FU7A 2VW8A 4UWOB 2BFZB 3KL7A 5AHRA 3H3EA 1L9YA 2BG7A 1JJEA 3VQZA 5AYAA 3PY5A 2WHGA 1VGNA 3MD7A 1ZKPA 3KNSA 4EYLA 1A8TA 1YCHA 4UWRB 2E7YA 2Q9UA 3IELA 4C09A 5LS3A 3I13A 2YNVB 1QH5A 3P2UA 2GKLA 5HH6A 2DKFA 3T3NA 2CBNA 3IE2A 3R2UA 3BK2A 2BFZA 5A5ZA 5EVDA 3SW3A 4TZFA 2YNVA 2QDSA 3SFPA 5B15A 2ZWRA 5HISA 2BGAA 2P18A 4D1WA 4V0HA 4KEQA 4D1TA 3IOFA 2I7XA 4Z5YA 2BG8A 4WD6A 5HH4A 3Q6VA 3IE0A 2OHIA 4BZ3A 4TYTA 2GFJA 5AHOA 2DOOA 2Y8AA 1X8GA 3G1PA 1VMEA 5ACXA 5LE1A 5ACRA 3ADRA 2AZ4A 2H6AA 1HLKA 5EV8A 4J5HA 2M5DA 4JO0A 2FU8A 2A7MA 3VPEA 4C1GA 4AX1B 2HB9A 4RL0A 5EWAA 2NXAA 2BR6A 2FK6A 3LVZA 4UAMA 4RBSA 2QDTA 3IEKA 1XM8A 5ACQA 2WRSA 2BG6A 2Q42A 3BC2A 4GCWA 3KNRA 5EVKA 3X2XA 4DILA 2Y87A 3X2YA 4PVTA 4UA4A 2FU9A 4TYFA 2P1EA 3FCZA 4RAWA 2WYLA 5LCHA 3T9MA 4AWYB 1VJNA 1ZNBA 5KILA 5HH5A 2FM6A 3L6NA 5EHTA 3S0ZA 1SMLA 3ZWFA 3AF6A 5ACWA 5ACUA 2P4ZA 3DHCA 5DPXA 4EYBA 5LMCA 3DHBA 2YNUA 1KO3A 1MQOA 3AJ3A 4DIKA 4O98A 1DXKA 3FAIA 2QINA 3PY6A 4C1EA 3RPCA 3I14A 4UWSB 3I15A 4NQ5A 4KEPA 4NQ6A 2YZ3A 3DHAA 1A7TA 1E5DA 3IE1A 4F6ZA 5B1UA 4FEKA 1DD6A 5IQKA 3JXPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DDK A;  1WUO A;  4ZEJ A;  2WYM C;  5A0V A;  5FQC A;  4XUK A;  1KR3 A;  2FHX B;  4Z7R A;  5HIQ A;  4RAM A;  5LSC A;  4J5F A;  3RKJ A;  2FHX A;  1M2X A;  5EW0 A;  3X2Z A;  2BC2 A;  2OHJ A;  2BG2 A;  4Z60 A;  3SBL A;  4CHL A;  1XTO A;  4TZB A;  1KO2 A;  4P62 A;  2ZZI A;  2Q0J A;  5K4M A;  4Z5Z A;  3SPU A;  5EV6 A;  2I7T A;  5HIP A;  2NZE A;  4U4L A;  3SD9 A;  4H0D A;  2XR1 A;  4C1D A;  2FU6 A;  4NQ2 A;  4HL2 A;  4EY2 A;  1YCG A;  4GYQ A;  1P9E A;  4LE6 A;  1JJT A;  3SRX A;  3TP9 A;  2XF4 A;  5A87 A;  1K07 A;  4AWZ A;  3IEM A;  3PG4 A;  4AD9 A;  3X30 A;  3IOG A;  5AEB A;  5EH9 A;  4ZNB A;  4UBQ A;  1ZTC A;  4EXY A;  1JT1 A;  3T3O A;  4TZ9 A;  3ZNB A;  1X8I A;  4ZO2 A;  2AIO A;  5B3R A;  1BMC A;  5EVB A;  5KIK A;  2NYP A;  4TZE A;  2BFL A;  1X8H A;  2YNT B;  3AF5 A;  3I11 A;  2Q0I A;  2YNT A;  5LCA A;  4YSK A;  5AXO A;  4D02 A;  2GMN A;  4F6H A;  2R2D A;  4FR7 A;  2QED A;  4XWW A;  2BIB A;  2BG8 B;  2I7V A;  3QH8 A;  2YCB A;  4NQ4 A;  5FQA A;  4Z67 A;  4YSL A;  2BTN A;  4FSB A;  4YSB A;  5K0W A;  2GFK A;  4GYU A;  4BP0 A;  2OHH A;  5LCF A;  5K4K A;  2NZF A;  4Z6X A;  4D1U A;  4C1C A;  4EFZ A;  1BC2 A;  3IDZ A;  1QH3 A;  4PVO A;  2BMI A;  4HL1 A;  5AXR A;  3I0V A;  2ZNB A;  4EYF A;  1WRA A;  5HIO A;  5K4N A;  2P97 A;  4HKY A;  1WUP A;  4C1F A;  3BV6 A;  5ACT A;  4XWT A;  4D1V A;  5LM6 A;  1WW1 A;  2WYM A;  2QJS A;  5LLD A;  4UWP B;  4AX0 B;  4RM5 A;  2GCU A;  3WXC A;  3ZQ4 A;  3ZR9 A;  3DH8 A;  5ACP A;  2BFK A;  2UYX A;  5A0T A;  3F9O A;  4RL2 A;  2ZO4 A;  1YCF A;  5ACV A;  4C1H A;  3A4Y A;  4EXS A;  1BVT A;  2Y8B A;  3RKK A;  2M5C A;  1Y44 A;  5ACS A;  4B87 A;  2YNW A;  3ESH A;  4ZO3 A;  5FQB A;  3BK1 A;  2FU7 A;  2VW8 A;  4UWO B;  2BFZ B;  3KL7 A;  5AHR A;  3H3E A;  1L9Y A;  2BG7 A;  1JJE A;  3VQZ A;  5AYA A;  3PY5 A;  2WHG A;  1VGN A;  3MD7 A;  1ZKP A;  3KNS A;  4EYL A;  1A8T A;  1YCH A;  4UWR B;  2E7Y A;  2Q9U A;  3IEL A;  4C09 A;  5LS3 A;  3I13 A;  2YNV B;  1QH5 A;  3P2U A;  2GKL A;  5HH6 A;  2DKF A;  3T3N A;  2CBN A;  3IE2 A;  3R2U A;  3BK2 A;  2BFZ A;  5A5Z A;  5EVD A;  3SW3 A;  4TZF A;  2YNV A;  2QDS A;  3SFP A;  5B15 A;  2ZWR A;  5HIS A;  2BGA A;  2P18 A;  4D1W A;  4V0H A;  4KEQ A;  4D1T A;  3IOF A;  2I7X A;  4Z5Y A;  2BG8 A;  4WD6 A;  5HH4 A;  3Q6V A;  3IE0 A;  2OHI A;  4BZ3 A;  4TYT A;  2GFJ A;  5AHO A;  2DOO A;  2Y8A A;  1X8G A;  3G1P A;  1VME A;  5ACX A;  5LE1 A;  5ACR A;  3ADR A;  2AZ4 A;  2H6A A;  1HLK A;  5EV8 A;  4J5H A;  2M5D A;  4JO0 A;  2FU8 A;  2A7M A;  3VPE A;  4C1G A;  4AX1 B;  2HB9 A;  4RL0 A;  5EWA A;  2NXA A;  2BR6 A;  2FK6 A;  3LVZ A;  4UAM A;  4RBS A;  2QDT A;  3IEK A;  1XM8 A;  5ACQ A;  2WRS A;  2BG6 A;  2Q42 A;  3BC2 A;  4GCW A;  3KNR A;  5EVK A;  3X2X A;  4DIL A;  2Y87 A;  3X2Y A;  4PVT A;  4UA4 A;  2FU9 A;  4TYF A;  2P1E A;  3FCZ A;  4RAW A;  2WYL A;  5LCH A;  3T9M A;  4AWY B;  1VJN A;  1ZNB A;  5KIL A;  5HH5 A;  2FM6 A;  3L6N A;  5EHT A;  3S0Z A;  1SML A;  3ZWF A;  3AF6 A;  5ACW A;  5ACU A;  2P4Z A;  3DHC A;  5DPX A;  4EYB A;  5LMC A;  3DHB A;  2YNU A;  1KO3 A;  1MQO A;  3AJ3 A;  4DIK A;  4O98 A;  1DXK A;  3FAI A;  2QIN A;  3PY6 A;  4C1E A;  3RPC A;  3I14 A;  4UWS B;  3I15 A;  4NQ5 A;  4KEP A;  4NQ6 A;  2YZ3 A;  3DHA A;  1A7T A;  1E5D A;  3IE1 A;  4F6Z A;  5B1U A;  4FEK A;  1DD6 A;  5IQK A;  3JXP A; 
#chains in the Genus database with same CATH topology
 1DDK A;  1WUO A;  4ZEJ A;  2WYM C;  5A0V A;  5FQC A;  4XUK A;  1KR3 A;  2FHX B;  4Z7R A;  5HIQ A;  4RAM A;  5LSC A;  4J5F A;  3RKJ A;  2FHX A;  1M2X A;  5EW0 A;  3X2Z A;  2BC2 A;  2OHJ A;  2BG2 A;  4Z60 A;  4NUR A;  3SBL A;  4CHL A;  1XTO A;  4TZB A;  1KO2 A;  4P62 A;  2ZZI A;  2Q0J A;  5K4M A;  4Z5Z A;  3SPU A;  5EV6 A;  2I7T A;  5HIP A;  2NZE A;  4U4L A;  3SD9 A;  4H0D A;  2XR1 A;  4C1D A;  2FU6 A;  4NQ2 A;  4HL2 A;  4EY2 A;  1YCG A;  4GYQ A;  1P9E A;  4LE6 A;  1JJT A;  3SRX A;  3TP9 A;  2XF4 A;  5A87 A;  1K07 A;  4AWZ A;  3IEM A;  3PG4 A;  4AD9 A;  3X30 A;  3IOG A;  5AEB A;  5EH9 A;  4ZNB A;  4UBQ A;  1ZTC A;  4EXY A;  1JT1 A;  3T3O A;  4TZ9 A;  3ZNB A;  1X8I A;  4ZO2 A;  2AIO A;  5B3R A;  1BMC A;  5EVB A;  5KIK A;  2NYP A;  4TZE A;  2BFL A;  1X8H A;  2YNT B;  3AF5 A;  3I11 A;  2Q0I A;  2YNT A;  5LCA A;  4YSK A;  5AXO A;  4D02 A;  2GMN A;  4F6H A;  2R2D A;  4FR7 A;  2QED A;  4XWW A;  2YHE A;  2BIB A;  2BG8 B;  2I7V A;  3QH8 A;  4PDX A;  2YCB A;  4NQ4 A;  5FQA A;  4Z67 A;  4YSL A;  2BTN A;  4FSB A;  4YSB A;  5K0W A;  2GFK A;  4GYU A;  4BP0 A;  2OHH A;  5LCF A;  5K4K A;  2NZF A;  4Z6X A;  4D1U A;  4C1C A;  4EFZ A;  1BC2 A;  3IDZ A;  1QH3 A;  4PVO A;  2BMI A;  4HL1 A;  5AXR A;  3I0V A;  2ZNB A;  4EYF A;  1WRA A;  5HIO A;  5K4N A;  2P97 A;  4HKY A;  1WUP A;  4C1F A;  3BV6 A;  5ACT A;  4XWT A;  4D1V A;  5LM6 A;  1WW1 A;  2WYM A;  2QJS A;  5LLD A;  4UWP B;  4AX0 B;  2CFZ A;  4RM5 A;  2GCU A;  3WXC A;  3ZQ4 A;  3ZR9 A;  3DH8 A;  5ACP A;  2BFK A;  2UYX A;  5A0T A;  3F9O A;  4RL2 A;  2ZO4 A;  1YCF A;  5ACV A;  4C1H A;  3A4Y A;  4EXS A;  1BVT A;  2Y8B A;  3RKK A;  2M5C A;  1Y44 A;  5ACS A;  4B87 A;  2YNW A;  3ESH A;  4ZO3 A;  5FQB A;  3BK1 A;  2FU7 A;  2VW8 A;  4UWO B;  2BFZ B;  3KL7 A;  5AHR A;  3H3E A;  1L9Y A;  2BG7 A;  1JJE A;  3VQZ A;  5AYA A;  3PY5 A;  2WHG A;  1VGN A;  3MD7 A;  1ZKP A;  2CG2 A;  3KNS A;  4EYL A;  1A8T A;  1YCH A;  4UWR B;  2E7Y A;  2Q9U A;  3IEL A;  4C09 A;  5LS3 A;  3I13 A;  4AXH A;  2YNV B;  1QH5 A;  3P2U A;  2GKL A;  5HH6 A;  2DKF A;  3T3N A;  2CBN A;  3IE2 A;  3R2U A;  3BK2 A;  2BFZ A;  5A23 A;  5A5Z A;  5EVD A;  3SW3 A;  4TZF A;  2YNV A;  2QDS A;  3SFP A;  5B15 A;  2ZWR A;  5HIS A;  2BGA A;  2P18 A;  4D1W A;  4V0H A;  4KEQ A;  4D1T A;  3IOF A;  2I7X A;  4Z5Y A;  2BG8 A;  4WD6 A;  5HH4 A;  3Q6V A;  3IE0 A;  2OHI A;  4BZ3 A;  4TYT A;  2GFJ A;  5AHO A;  2DOO A;  2Y8A A;  1X8G A;  3G1P A;  1VME A;  5ACX A;  5LE1 A;  5ACR A;  3ADR A;  2AZ4 A;  2H6A A;  1HLK A;  5EV8 A;  4J5H A;  2M5D A;  4JO0 A;  2FU8 A;  2A7M A;  3VPE A;  4C1G A;  4AX1 B;  2HB9 A;  4RL0 A;  5EWA A;  2NXA A;  2BR6 A;  5AJL A;  2FK6 A;  3LVZ A;  4UAM A;  2CG3 A;  4RBS A;  2QDT A;  3IEK A;  1XM8 A;  5ACQ A;  2WRS A;  2BG6 A;  2Q42 A;  3BC2 A;  4GCW A;  3KNR A;  5EVK A;  3X2X A;  4DIL A;  2Y87 A;  3X2Y A;  4PVT A;  4UA4 A;  2FU9 A;  4TYF A;  4AV7 A;  2P1E A;  3FCZ A;  4RAW A;  2WYL A;  5LCH A;  3T9M A;  4AWY B;  1VJN A;  1ZNB A;  5KIL A;  5HH5 A;  2FM6 A;  3L6N A;  5EHT A;  3S0Z A;  1SML A;  3ZWF A;  3AF6 A;  5ACW A;  5ACU A;  2P4Z A;  3DHC A;  5DPX A;  4EYB A;  5LMC A;  3DHB A;  2YNU A;  1KO3 A;  1MQO A;  3AJ3 A;  4DIK A;  4O98 A;  1DXK A;  3FAI A;  2QIN A;  3PY6 A;  4C1E A;  3RPC A;  3I14 A;  4UWS B;  3I15 A;  4NQ5 A;  4KEP A;  4NQ6 A;  2CFU A;  2YZ3 A;  3DHA A;  1A7T A;  1E5D A;  5AIJ A;  3IE1 A;  4F6Z A;  5B1U A;  4FEK A;  1DD6 A;  5IQK A;  3JXP A; 
#chains in the Genus database with same CATH homology
 1DDK A;  1WUO A;  4ZEJ A;  2WYM C;  5A0V A;  5FQC A;  4XUK A;  1KR3 A;  2FHX B;  4Z7R A;  5HIQ A;  4RAM A;  5LSC A;  4J5F A;  3RKJ A;  2FHX A;  1M2X A;  5EW0 A;  3X2Z A;  2BC2 A;  2OHJ A;  2BG2 A;  4Z60 A;  3SBL A;  4CHL A;  1XTO A;  4TZB A;  1KO2 A;  4P62 A;  2ZZI A;  2Q0J A;  5K4M A;  4Z5Z A;  3SPU A;  5EV6 A;  2I7T A;  5HIP A;  2NZE A;  4U4L A;  3SD9 A;  4H0D A;  2XR1 A;  4C1D A;  2FU6 A;  4NQ2 A;  4HL2 A;  4EY2 A;  1YCG A;  4GYQ A;  1P9E A;  4LE6 A;  1JJT A;  3SRX A;  3TP9 A;  2XF4 A;  5A87 A;  1K07 A;  4AWZ A;  3IEM A;  3PG4 A;  4AD9 A;  3X30 A;  3IOG A;  5AEB A;  5EH9 A;  4ZNB A;  4UBQ A;  1ZTC A;  4EXY A;  1JT1 A;  3T3O A;  4TZ9 A;  3ZNB A;  1X8I A;  4ZO2 A;  2AIO A;  5B3R A;  1BMC A;  5EVB A;  5KIK A;  2NYP A;  4TZE A;  2BFL A;  1X8H A;  2YNT B;  3AF5 A;  3I11 A;  2Q0I A;  2YNT A;  5LCA A;  4YSK A;  5AXO A;  4D02 A;  2GMN A;  4F6H A;  2R2D A;  4FR7 A;  2QED A;  4XWW A;  2BIB A;  2BG8 B;  2I7V A;  3QH8 A;  2YCB A;  4NQ4 A;  5FQA A;  4Z67 A;  4YSL A;  2BTN A;  4FSB A;  4YSB A;  5K0W A;  2GFK A;  4GYU A;  4BP0 A;  2OHH A;  5LCF A;  5K4K A;  2NZF A;  4Z6X A;  4D1U A;  4C1C A;  4EFZ A;  1BC2 A;  3IDZ A;  1QH3 A;  4PVO A;  2BMI A;  4HL1 A;  5AXR A;  3I0V A;  2ZNB A;  4EYF A;  1WRA A;  5HIO A;  5K4N A;  2P97 A;  4HKY A;  1WUP A;  4C1F A;  3BV6 A;  5ACT A;  4XWT A;  4D1V A;  5LM6 A;  1WW1 A;  2WYM A;  2QJS A;  5LLD A;  4UWP B;  4AX0 B;  4RM5 A;  2GCU A;  3WXC A;  3ZQ4 A;  3ZR9 A;  3DH8 A;  5ACP A;  2BFK A;  2UYX A;  5A0T A;  3F9O A;  4RL2 A;  2ZO4 A;  1YCF A;  5ACV A;  4C1H A;  3A4Y A;  4EXS A;  1BVT A;  2Y8B A;  3RKK A;  2M5C A;  1Y44 A;  5ACS A;  4B87 A;  2YNW A;  3ESH A;  4ZO3 A;  5FQB A;  3BK1 A;  2FU7 A;  2VW8 A;  4UWO B;  2BFZ B;  3KL7 A;  5AHR A;  3H3E A;  1L9Y A;  2BG7 A;  1JJE A;  3VQZ A;  5AYA A;  3PY5 A;  2WHG A;  1VGN A;  3MD7 A;  1ZKP A;  3KNS A;  4EYL A;  1A8T A;  1YCH A;  4UWR B;  2E7Y A;  2Q9U A;  3IEL A;  4C09 A;  5LS3 A;  3I13 A;  2YNV B;  1QH5 A;  3P2U A;  2GKL A;  5HH6 A;  2DKF A;  3T3N A;  2CBN A;  3IE2 A;  3R2U A;  3BK2 A;  2BFZ A;  5A5Z A;  5EVD A;  3SW3 A;  4TZF A;  2YNV A;  2QDS A;  3SFP A;  5B15 A;  2ZWR A;  5HIS A;  2BGA A;  2P18 A;  4D1W A;  4V0H A;  4KEQ A;  4D1T A;  3IOF A;  2I7X A;  4Z5Y A;  2BG8 A;  4WD6 A;  5HH4 A;  3Q6V A;  3IE0 A;  2OHI A;  4BZ3 A;  4TYT A;  2GFJ A;  5AHO A;  2DOO A;  2Y8A A;  1X8G A;  3G1P A;  1VME A;  5ACX A;  5LE1 A;  5ACR A;  3ADR A;  2AZ4 A;  2H6A A;  1HLK A;  5EV8 A;  4J5H A;  2M5D A;  4JO0 A;  2FU8 A;  2A7M A;  3VPE A;  4C1G A;  4AX1 B;  2HB9 A;  4RL0 A;  5EWA A;  2NXA A;  2BR6 A;  2FK6 A;  3LVZ A;  4UAM A;  4RBS A;  2QDT A;  3IEK A;  1XM8 A;  5ACQ A;  2WRS A;  2BG6 A;  2Q42 A;  3BC2 A;  4GCW A;  3KNR A;  5EVK A;  3X2X A;  4DIL A;  2Y87 A;  3X2Y A;  4PVT A;  4UA4 A;  2FU9 A;  4TYF A;  2P1E A;  3FCZ A;  4RAW A;  2WYL A;  5LCH A;  3T9M A;  4AWY B;  1VJN A;  1ZNB A;  5KIL A;  5HH5 A;  2FM6 A;  3L6N A;  5EHT A;  3S0Z A;  1SML A;  3ZWF A;  3AF6 A;  5ACW A;  5ACU A;  2P4Z A;  3DHC A;  5DPX A;  4EYB A;  5LMC A;  3DHB A;  2YNU A;  1KO3 A;  1MQO A;  3AJ3 A;  4DIK A;  4O98 A;  1DXK A;  3FAI A;  2QIN A;  3PY6 A;  4C1E A;  3RPC A;  3I14 A;  4UWS B;  3I15 A;  4NQ5 A;  4KEP A;  4NQ6 A;  2YZ3 A;  3DHA A;  1A7T A;  1E5D A;  3IE1 A;  4F6Z A;  5B1U A;  4FEK A;  1DD6 A;  5IQK A;  3JXP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...