1ZKPA

1.5a resolution crystal structure of a metallo beta lactamase family protein, the elac homolgue of bacillus anthracis, a putative ribonuclease
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
251
structure length
251
Chain Sequence
b'LYFQSNAMKMTVVGFWGGFPEAGEATSGYLFEHDGFRLLVDCGSGVLAQLQKYITPSDIDAVVLSHYHHDHVADIGVLQYARLITSATKGQLPELPIYGHTFDENGFHSLTHEPHTKGIPYNPEETLQIGPFSISFLKTVHPVTCFAMRITAGNDIVVYSADSSYIPEFIPFTKDADLFICECNMYAHQEAAKAGHMNSTEVASIAKDANVKELLLTHLPHTGNPADLVTEAKQIFSGHITLAHSGYVWNS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein BA1088
publication title 1.5A Resolution Crystal Structure of a Metallo Beta Lactamase Family Protein, the ELAC Homolgue of Bacillus anthracis, a Putative Ribonuclease
rcsb
source organism Bacillus anthracis str.
molecule tags Structural genomics, unknown function
total genus 76
structure length 251
sequence length 251
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12706 Lactamase_B_2 Beta-lactamase superfamily domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 1zkpA00
2H6AA 5HISA 1KO2A 5ACXA 2DKFA 1ZNBA 2P4ZA 3RKKA 2BC2A 2GMNA 4RAWA 5HH4A 2QDSA 4XWTA 2Q42A 5AXRA 3VQZA 5ACWA 4JO0A 3BK1A 2BIBA 3IEMA 4D1WA 3DHAA 4GYQA 5IQKA 3DH8A 4LE6A 2OHHA 3SFPA 3IEKA 5ACUA 3SBLA 2XF4A 2NZFA 1DXKA 2BTNA 2I7TA 4EYBA 5EWAA 4C1HA 2BFZB 3I0VA 1WRAA 3R2UA 4F6ZA 5EW0A 5EVDA 2CBNA 2P97A 3IOGA 3T3NA 4XWWA 2ZNBA 3PY5A 2WYLA 4P62A 2DOOA 4CHLA 3X2XA 3X2YA 4Z5YA 2QEDA 2ZZIA 2Y8AA 5HIQA 4TZBA 5AYAA 5B1UA 3RPCA 3I11A 3TP9A 4J5FA 2FU7A 5FQCA 5LCAA 4EXYA 5K0WA 5HIPA 2BG2A 2M5DA 5LM6A 4ZNBA 4U4LA 2YNTB 4FR7A 1L9YA 4GCWA 4AD9A 2NXAA 5ACRA 5EV8A 1XTOA 1JT1A 4AX1B 1JJTA 4C1GA 3F9OA 3P2UA 3AJ3A 4EYLA 1YCHA 3SD9A 4Z6XA 5LS3A 3S0ZA 3IE1A 5HIOA 4XUKA 2GCUA 5AXOA 4UWSB 2ZO4A 2FU8A 4C1EA 4UWPB 2FHXA 4YSKA 4BP0A 3SW3A 1VMEA 2I7XA 2YNUA 4O98A 2YNVB 4D02A 1DD6A 2BG8B 4RL0A 4FSBA 2NYPA 1QH5A 2BG7A 3A4YA 1HLKA 5KILA 3AF5A 4TYFA 5DPXA 1KO3A 1K07A 1X8GA 5LCFA 2BFKA 3AF6A 3FAIA 2Y8BA 5EHTA 4YSBA 5LMCA 2BMIA 5LE1A 2GKLA 2YNWA 2GFKA 3ZR9A 4KEQA 1BC2A 3WXCA 3MD7A 1BVTA 1ZKPA 4C1DA 3L6NA 2WRSA 4HL2A 3JXPA 4RM5A 2VW8A 2BFZA 4RAMA 1DDKA 1P9EA 3DHCA 4H0DA 2NZEA 3IE2A 5EV6A 2P1EA 4DIKA 2YZ3A 5ACVA 4NQ2A 1YCFA 3IE0A 2FK6A 1A8TA 4YSLA 2Q0JA 3ESHA 3I15A 4B87A 3I14A 1WUOA 3Q6VA 3SPUA 1WUPA 5LSCA 5ACSA 3KNSA 4C1CA 4J5HA 1Y44A 1KR3A 4UWOB 4TYTA 5FQBA 3KNRA 3LVZA 4WD6A 2YNTA 4EXSA 2HB9A 4HKYA 2R2DA 4EFZA 4FEKA 3IDZA 2M5CA 2AZ4A 4AWZA 3IELA 2QDTA 3X30A 3ADRA 4AX0B 1WW1A 4Z7RA 3QH8A 1QH3A 5EH9A 4F6HA 4Z67A 1SMLA 4TZEA 5A0TA 4UAMA 5K4MA 5K4NA 4PVOA 4UA4A 4V0HA 2Q0IA 4EY2A 5ACQA 4GYUA 3PG4A 2XR1A 5LLDA 4ZEJA 3BK2A 2YNVA 2BGAA 3VPEA 3T9MA 3H3EA 5K4KA 4C1FA 4NQ6A 3ZNBA 2BG8A 5EVKA 4D1TA 3G1PA 4DILA 4AWYB 4RL2A 3DHBA 4NQ4A 2FU9A 4C09A 1MQOA 2I7VA 2WYMC 1JJEA 1BMCA 3I13A 2E7YA 4UBQA 1ZTCA 5EVBA 1XM8A 4TZFA 4D1UA 4Z60A 2FU6A 3X2ZA 3IOFA 5HH6A 2AIOA 4Z5ZA 2QINA 4BZ3A 3BV6A 2BR6A 3FCZA 3KL7A 5AHOA 1VGNA 2WHGA 4ZO2A 4EYFA 3ZWFA 1X8HA 5A0VA 2ZWRA 4RBSA 2FM6A 2Q9UA 4ZO3A 5A5ZA 4UWRB 2QJSA 2BG6A 1YCGA 2UYXA 1M2XA 3BC2A 5KIKA 5FQAA 1X8IA 2YCBA 4KEPA 5AHRA 4D1VA 1VJNA 2P18A 5A87A 2BFLA 2Y87A 5ACPA 2FHXB 3T3OA 5ACTA 3RKJA 5AEBA 1A7TA 4PVTA 5B15A 4HL1A 3ZQ4A 2WYMA 4NQ5A 4TZ9A 2OHJA 5B3RA 1E5DA 5HH5A 2A7MA 3SRXA 5LCHA 3PY6A 2OHIA 2GFJA
chains in the Genus database with same CATH superfamily
2H6AA 5HISA 4AXHA 1KO2A 5ACXA 2DKFA 1ZNBA 2P4ZA 3RKKA 2BC2A 2GMNA 4RAWA 5HH4A 2QDSA 4XWTA 2Q42A 5AXRA 3VQZA 5ACWA 4JO0A 3BK1A 2BIBA 3IEMA 4D1WA 3DHAA 4GYQA 5IQKA 3DH8A 4LE6A 2OHHA 3SFPA 3IEKA 5ACUA 3SBLA 2XF4A 2NZFA 1DXKA 2BTNA 2I7TA 4EYBA 5EWAA 5AJLA 4C1HA 2BFZB 3I0VA 1WRAA 3R2UA 4F6ZA 5EW0A 5EVDA 2CBNA 2P97A 3IOGA 3T3NA 4XWWA 2ZNBA 3PY5A 2WYLA 4P62A 2DOOA 4CHLA 3X2XA 3X2YA 4Z5YA 2QEDA 2ZZIA 2Y8AA 5HIQA 4TZBA 5AYAA 5B1UA 3RPCA 3I11A 3TP9A 4PDXA 4J5FA 2FU7A 5FQCA 5LCAA 4EXYA 5K0WA 5HIPA 2BG2A 2M5DA 5LM6A 4ZNBA 4U4LA 2YNTB 4FR7A 1L9YA 4GCWA 4AD9A 2NXAA 5ACRA 5EV8A 2CG2A 1XTOA 1JT1A 4AX1B 1JJTA 4C1GA 3F9OA 3P2UA 3AJ3A 4EYLA 4AV7A 1YCHA 3SD9A 4Z6XA 5LS3A 3S0ZA 3IE1A 5HIOA 4XUKA 2GCUA 5AXOA 4UWSB 2ZO4A 2FU8A 4C1EA 4UWPB 2FHXA 4YSKA 4BP0A 3SW3A 1VMEA 2I7XA 2YNUA 4O98A 2YNVB 5AIJA 4D02A 1DD6A 2BG8B 4RL0A 4FSBA 2NYPA 1QH5A 2BG7A 3A4YA 1HLKA 5KILA 3AF5A 4TYFA 5DPXA 1KO3A 1K07A 1X8GA 5LCFA 2BFKA 3AF6A 3FAIA 2Y8BA 5EHTA 4YSBA 5LMCA 2BMIA 5LE1A 2GKLA 2YNWA 2GFKA 3ZR9A 4KEQA 1BC2A 3WXCA 3MD7A 4NURA 1BVTA 1ZKPA 4C1DA 3L6NA 2WRSA 4HL2A 3JXPA 4RM5A 2VW8A 2BFZA 4RAMA 1DDKA 1P9EA 3DHCA 4H0DA 2NZEA 3IE2A 5EV6A 2P1EA 4DIKA 2YZ3A 5ACVA 4NQ2A 1YCFA 3IE0A 2FK6A 1A8TA 4YSLA 2Q0JA 3ESHA 3I15A 4B87A 3I14A 1WUOA 3Q6VA 3SPUA 1WUPA 5LSCA 5ACSA 3KNSA 4C1CA 4J5HA 1Y44A 1KR3A 4UWOB 4TYTA 5FQBA 3KNRA 3LVZA 4WD6A 2YNTA 4EXSA 2HB9A 4HKYA 2R2DA 4EFZA 4FEKA 2YHEA 3IDZA 5A23A 2M5CA 2AZ4A 4AWZA 3IELA 2QDTA 3X30A 3ADRA 4AX0B 1WW1A 4Z7RA 3QH8A 1QH3A 5EH9A 4F6HA 4Z67A 1SMLA 4TZEA 5A0TA 4UAMA 5K4MA 5K4NA 4PVOA 4UA4A 4V0HA 2Q0IA 4EY2A 5ACQA 4GYUA 3PG4A 2XR1A 5LLDA 4ZEJA 3BK2A 2YNVA 2CFZA 2BGAA 3VPEA 3T9MA 3H3EA 5K4KA 4C1FA 4NQ6A 3ZNBA 2BG8A 5EVKA 4D1TA 3G1PA 4DILA 4AWYB 4RL2A 3DHBA 4NQ4A 2FU9A 4C09A 1MQOA 2I7VA 2WYMC 1JJEA 1BMCA 3I13A 2E7YA 4UBQA 1ZTCA 5EVBA 1XM8A 4TZFA 4D1UA 4Z60A 2FU6A 3X2ZA 3IOFA 5HH6A 2AIOA 4Z5ZA 2QINA 4BZ3A 3BV6A 2BR6A 3FCZA 3KL7A 5AHOA 1VGNA 2WHGA 4ZO2A 4EYFA 3ZWFA 1X8HA 5A0VA 2ZWRA 4RBSA 2FM6A 2Q9UA 4ZO3A 5A5ZA 4UWRB 2QJSA 2BG6A 1YCGA 2UYXA 1M2XA 3BC2A 5KIKA 5FQAA 1X8IA 2CFUA 2YCBA 4KEPA 5AHRA 4D1VA 1VJNA 2P18A 5A87A 2BFLA 2CG3A 2Y87A 5ACPA 2FHXB 3T3OA 5ACTA 3RKJA 5AEBA 1A7TA 4PVTA 5B15A 4HL1A 3ZQ4A 2WYMA 4NQ5A 4TZ9A 2OHJA 5B3RA 1E5DA 5HH5A 2A7MA 3SRXA 5LCHA 3PY6A 2OHIA 2GFJA
chains in the Genus database with same CATH topology
2H6AA 5HISA 1KO2A 5ACXA 2DKFA 1ZNBA 2P4ZA 3RKKA 2BC2A 2GMNA 4RAWA 5HH4A 2QDSA 4XWTA 2Q42A 5AXRA 3VQZA 5ACWA 4JO0A 3BK1A 2BIBA 3IEMA 4D1WA 3DHAA 4GYQA 5IQKA 3DH8A 4LE6A 2OHHA 3SFPA 3IEKA 5ACUA 3SBLA 2XF4A 2NZFA 1DXKA 2BTNA 2I7TA 4EYBA 5EWAA 4C1HA 2BFZB 3I0VA 1WRAA 3R2UA 4F6ZA 5EW0A 5EVDA 2CBNA 2P97A 3IOGA 3T3NA 4XWWA 2ZNBA 3PY5A 2WYLA 4P62A 2DOOA 4CHLA 3X2XA 3X2YA 4Z5YA 2QEDA 2ZZIA 2Y8AA 5HIQA 4TZBA 5AYAA 5B1UA 3RPCA 3I11A 3TP9A 4J5FA 2FU7A 5FQCA 5LCAA 4EXYA 5K0WA 5HIPA 2BG2A 2M5DA 5LM6A 4ZNBA 4U4LA 2YNTB 4FR7A 1L9YA 4GCWA 4AD9A 2NXAA 5ACRA 5EV8A 1XTOA 1JT1A 4AX1B 1JJTA 4C1GA 3F9OA 3P2UA 3AJ3A 4EYLA 1YCHA 3SD9A 4Z6XA 5LS3A 3S0ZA 3IE1A 5HIOA 4XUKA 2GCUA 5AXOA 4UWSB 2ZO4A 2FU8A 4C1EA 4UWPB 2FHXA 4YSKA 4BP0A 3SW3A 1VMEA 2I7XA 2YNUA 4O98A 2YNVB 4D02A 1DD6A 2BG8B 4RL0A 4FSBA 2NYPA 1QH5A 2BG7A 3A4YA 1HLKA 5KILA 3AF5A 4TYFA 5DPXA 1KO3A 1K07A 1X8GA 5LCFA 2BFKA 3AF6A 3FAIA 2Y8BA 5EHTA 4YSBA 5LMCA 2BMIA 5LE1A 2GKLA 2YNWA 2GFKA 3ZR9A 4KEQA 1BC2A 3WXCA 3MD7A 1BVTA 1ZKPA 4C1DA 3L6NA 2WRSA 4HL2A 3JXPA 4RM5A 2VW8A 2BFZA 4RAMA 1DDKA 1P9EA 3DHCA 4H0DA 2NZEA 3IE2A 5EV6A 2P1EA 4DIKA 2YZ3A 5ACVA 4NQ2A 1YCFA 3IE0A 2FK6A 1A8TA 4YSLA 2Q0JA 3ESHA 3I15A 4B87A 3I14A 1WUOA 3Q6VA 3SPUA 1WUPA 5LSCA 5ACSA 3KNSA 4C1CA 4J5HA 1Y44A 1KR3A 4UWOB 4TYTA 5FQBA 3KNRA 3LVZA 4WD6A 2YNTA 4EXSA 2HB9A 4HKYA 2R2DA 4EFZA 4FEKA 3IDZA 2M5CA 2AZ4A 4AWZA 3IELA 2QDTA 3X30A 3ADRA 4AX0B 1WW1A 4Z7RA 3QH8A 1QH3A 5EH9A 4F6HA 4Z67A 1SMLA 4TZEA 5A0TA 4UAMA 5K4MA 5K4NA 4PVOA 4UA4A 4V0HA 2Q0IA 4EY2A 5ACQA 4GYUA 3PG4A 2XR1A 5LLDA 4ZEJA 3BK2A 2YNVA 2BGAA 3VPEA 3T9MA 3H3EA 5K4KA 4C1FA 4NQ6A 3ZNBA 2BG8A 5EVKA 4D1TA 3G1PA 4DILA 4AWYB 4RL2A 3DHBA 4NQ4A 2FU9A 4C09A 1MQOA 2I7VA 2WYMC 1JJEA 1BMCA 3I13A 2E7YA 4UBQA 1ZTCA 5EVBA 1XM8A 4TZFA 4D1UA 4Z60A 2FU6A 3X2ZA 3IOFA 5HH6A 2AIOA 4Z5ZA 2QINA 4BZ3A 3BV6A 2BR6A 3FCZA 3KL7A 5AHOA 1VGNA 2WHGA 4ZO2A 4EYFA 3ZWFA 1X8HA 5A0VA 2ZWRA 4RBSA 2FM6A 2Q9UA 4ZO3A 5A5ZA 4UWRB 2QJSA 2BG6A 1YCGA 2UYXA 1M2XA 3BC2A 5KIKA 5FQAA 1X8IA 2YCBA 4KEPA 5AHRA 4D1VA 1VJNA 2P18A 5A87A 2BFLA 2Y87A 5ACPA 2FHXB 3T3OA 5ACTA 3RKJA 5AEBA 1A7TA 4PVTA 5B15A 4HL1A 3ZQ4A 2WYMA 4NQ5A 4TZ9A 2OHJA 5B3RA 1E5DA 5HH5A 2A7MA 3SRXA 5LCHA 3PY6A 2OHIA 2GFJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H6A A;  5HIS A;  1KO2 A;  5ACX A;  2DKF A;  1ZNB A;  2P4Z A;  3RKK A;  2BC2 A;  2GMN A;  4RAW A;  5HH4 A;  2QDS A;  4XWT A;  2Q42 A;  5AXR A;  3VQZ A;  5ACW A;  4JO0 A;  3BK1 A;  2BIB A;  3IEM A;  4D1W A;  3DHA A;  4GYQ A;  5IQK A;  3DH8 A;  4LE6 A;  2OHH A;  3SFP A;  3IEK A;  5ACU A;  3SBL A;  2XF4 A;  2NZF A;  1DXK A;  2BTN A;  2I7T A;  4EYB A;  5EWA A;  4C1H A;  2BFZ B;  3I0V A;  1WRA A;  3R2U A;  4F6Z A;  5EW0 A;  5EVD A;  2CBN A;  2P97 A;  3IOG A;  3T3N A;  4XWW A;  2ZNB A;  3PY5 A;  2WYL A;  4P62 A;  2DOO A;  4CHL A;  3X2X A;  3X2Y A;  4Z5Y A;  2QED A;  2ZZI A;  2Y8A A;  5HIQ A;  4TZB A;  5AYA A;  5B1U A;  3RPC A;  3I11 A;  3TP9 A;  4J5F A;  2FU7 A;  5FQC A;  5LCA A;  4EXY A;  5K0W A;  5HIP A;  2BG2 A;  2M5D A;  5LM6 A;  4ZNB A;  4U4L A;  2YNT B;  4FR7 A;  1L9Y A;  4GCW A;  4AD9 A;  2NXA A;  5ACR A;  5EV8 A;  1XTO A;  1JT1 A;  4AX1 B;  1JJT A;  4C1G A;  3F9O A;  3P2U A;  3AJ3 A;  4EYL A;  1YCH A;  3SD9 A;  4Z6X A;  5LS3 A;  3S0Z A;  3IE1 A;  5HIO A;  4XUK A;  2GCU A;  5AXO A;  4UWS B;  2ZO4 A;  2FU8 A;  4C1E A;  4UWP B;  2FHX A;  4YSK A;  4BP0 A;  3SW3 A;  1VME A;  2I7X A;  2YNU A;  4O98 A;  2YNV B;  4D02 A;  1DD6 A;  2BG8 B;  4RL0 A;  4FSB A;  2NYP A;  1QH5 A;  2BG7 A;  3A4Y A;  1HLK A;  5KIL A;  3AF5 A;  4TYF A;  5DPX A;  1KO3 A;  1K07 A;  1X8G A;  5LCF A;  2BFK A;  3AF6 A;  3FAI A;  2Y8B A;  5EHT A;  4YSB A;  5LMC A;  2BMI A;  5LE1 A;  2GKL A;  2YNW A;  2GFK A;  3ZR9 A;  4KEQ A;  1BC2 A;  3WXC A;  3MD7 A;  1BVT A;  1ZKP A;  4C1D A;  3L6N A;  2WRS A;  4HL2 A;  3JXP A;  4RM5 A;  2VW8 A;  2BFZ A;  4RAM A;  1DDK A;  1P9E A;  3DHC A;  4H0D A;  2NZE A;  3IE2 A;  5EV6 A;  2P1E A;  4DIK A;  2YZ3 A;  5ACV A;  4NQ2 A;  1YCF A;  3IE0 A;  2FK6 A;  1A8T A;  4YSL A;  2Q0J A;  3ESH A;  3I15 A;  4B87 A;  3I14 A;  1WUO A;  3Q6V A;  3SPU A;  1WUP A;  5LSC A;  5ACS A;  3KNS A;  4C1C A;  4J5H A;  1Y44 A;  1KR3 A;  4UWO B;  4TYT A;  5FQB A;  3KNR A;  3LVZ A;  4WD6 A;  2YNT A;  4EXS A;  2HB9 A;  4HKY A;  2R2D A;  4EFZ A;  4FEK A;  3IDZ A;  2M5C A;  2AZ4 A;  4AWZ A;  3IEL A;  2QDT A;  3X30 A;  3ADR A;  4AX0 B;  1WW1 A;  4Z7R A;  3QH8 A;  1QH3 A;  5EH9 A;  4F6H A;  4Z67 A;  1SML A;  4TZE A;  5A0T A;  4UAM A;  5K4M A;  5K4N A;  4PVO A;  4UA4 A;  4V0H A;  2Q0I A;  4EY2 A;  5ACQ A;  4GYU A;  3PG4 A;  2XR1 A;  5LLD A;  4ZEJ A;  3BK2 A;  2YNV A;  2BGA A;  3VPE A;  3T9M A;  3H3E A;  5K4K A;  4C1F A;  4NQ6 A;  3ZNB A;  2BG8 A;  5EVK A;  4D1T A;  3G1P A;  4DIL A;  4AWY B;  4RL2 A;  3DHB A;  4NQ4 A;  2FU9 A;  4C09 A;  1MQO A;  2I7V A;  2WYM C;  1JJE A;  1BMC A;  3I13 A;  2E7Y A;  4UBQ A;  1ZTC A;  5EVB A;  1XM8 A;  4TZF A;  4D1U A;  4Z60 A;  2FU6 A;  3X2Z A;  3IOF A;  5HH6 A;  2AIO A;  4Z5Z A;  2QIN A;  4BZ3 A;  3BV6 A;  2BR6 A;  3FCZ A;  3KL7 A;  5AHO A;  1VGN A;  2WHG A;  4ZO2 A;  4EYF A;  3ZWF A;  1X8H A;  5A0V A;  2ZWR A;  4RBS A;  2FM6 A;  2Q9U A;  4ZO3 A;  5A5Z A;  4UWR B;  2QJS A;  2BG6 A;  1YCG A;  2UYX A;  1M2X A;  3BC2 A;  5KIK A;  5FQA A;  1X8I A;  2YCB A;  4KEP A;  5AHR A;  4D1V A;  1VJN A;  2P18 A;  5A87 A;  2BFL A;  2Y87 A;  5ACP A;  2FHX B;  3T3O A;  5ACT A;  3RKJ A;  5AEB A;  1A7T A;  4PVT A;  5B15 A;  4HL1 A;  3ZQ4 A;  2WYM A;  4NQ5 A;  4TZ9 A;  2OHJ A;  5B3R A;  1E5D A;  5HH5 A;  2A7M A;  3SRX A;  5LCH A;  3PY6 A;  2OHI A;  2GFJ A; 
#chains in the Genus database with same CATH topology
 2H6A A;  5HIS A;  4AXH A;  1KO2 A;  5ACX A;  2DKF A;  1ZNB A;  2P4Z A;  3RKK A;  2BC2 A;  2GMN A;  4RAW A;  5HH4 A;  2QDS A;  4XWT A;  2Q42 A;  5AXR A;  3VQZ A;  5ACW A;  4JO0 A;  3BK1 A;  2BIB A;  3IEM A;  4D1W A;  3DHA A;  4GYQ A;  5IQK A;  3DH8 A;  4LE6 A;  2OHH A;  3SFP A;  3IEK A;  5ACU A;  3SBL A;  2XF4 A;  2NZF A;  1DXK A;  2BTN A;  2I7T A;  4EYB A;  5EWA A;  5AJL A;  4C1H A;  2BFZ B;  3I0V A;  1WRA A;  3R2U A;  4F6Z A;  5EW0 A;  5EVD A;  2CBN A;  2P97 A;  3IOG A;  3T3N A;  4XWW A;  2ZNB A;  3PY5 A;  2WYL A;  4P62 A;  2DOO A;  4CHL A;  3X2X A;  3X2Y A;  4Z5Y A;  2QED A;  2ZZI A;  2Y8A A;  5HIQ A;  4TZB A;  5AYA A;  5B1U A;  3RPC A;  3I11 A;  3TP9 A;  4PDX A;  4J5F A;  2FU7 A;  5FQC A;  5LCA A;  4EXY A;  5K0W A;  5HIP A;  2BG2 A;  2M5D A;  5LM6 A;  4ZNB A;  4U4L A;  2YNT B;  4FR7 A;  1L9Y A;  4GCW A;  4AD9 A;  2NXA A;  5ACR A;  5EV8 A;  2CG2 A;  1XTO A;  1JT1 A;  4AX1 B;  1JJT A;  4C1G A;  3F9O A;  3P2U A;  3AJ3 A;  4EYL A;  4AV7 A;  1YCH A;  3SD9 A;  4Z6X A;  5LS3 A;  3S0Z A;  3IE1 A;  5HIO A;  4XUK A;  2GCU A;  5AXO A;  4UWS B;  2ZO4 A;  2FU8 A;  4C1E A;  4UWP B;  2FHX A;  4YSK A;  4BP0 A;  3SW3 A;  1VME A;  2I7X A;  2YNU A;  4O98 A;  2YNV B;  5AIJ A;  4D02 A;  1DD6 A;  2BG8 B;  4RL0 A;  4FSB A;  2NYP A;  1QH5 A;  2BG7 A;  3A4Y A;  1HLK A;  5KIL A;  3AF5 A;  4TYF A;  5DPX A;  1KO3 A;  1K07 A;  1X8G A;  5LCF A;  2BFK A;  3AF6 A;  3FAI A;  2Y8B A;  5EHT A;  4YSB A;  5LMC A;  2BMI A;  5LE1 A;  2GKL A;  2YNW A;  2GFK A;  3ZR9 A;  4KEQ A;  1BC2 A;  3WXC A;  3MD7 A;  4NUR A;  1BVT A;  1ZKP A;  4C1D A;  3L6N A;  2WRS A;  4HL2 A;  3JXP A;  4RM5 A;  2VW8 A;  2BFZ A;  4RAM A;  1DDK A;  1P9E A;  3DHC A;  4H0D A;  2NZE A;  3IE2 A;  5EV6 A;  2P1E A;  4DIK A;  2YZ3 A;  5ACV A;  4NQ2 A;  1YCF A;  3IE0 A;  2FK6 A;  1A8T A;  4YSL A;  2Q0J A;  3ESH A;  3I15 A;  4B87 A;  3I14 A;  1WUO A;  3Q6V A;  3SPU A;  1WUP A;  5LSC A;  5ACS A;  3KNS A;  4C1C A;  4J5H A;  1Y44 A;  1KR3 A;  4UWO B;  4TYT A;  5FQB A;  3KNR A;  3LVZ A;  4WD6 A;  2YNT A;  4EXS A;  2HB9 A;  4HKY A;  2R2D A;  4EFZ A;  4FEK A;  2YHE A;  3IDZ A;  5A23 A;  2M5C A;  2AZ4 A;  4AWZ A;  3IEL A;  2QDT A;  3X30 A;  3ADR A;  4AX0 B;  1WW1 A;  4Z7R A;  3QH8 A;  1QH3 A;  5EH9 A;  4F6H A;  4Z67 A;  1SML A;  4TZE A;  5A0T A;  4UAM A;  5K4M A;  5K4N A;  4PVO A;  4UA4 A;  4V0H A;  2Q0I A;  4EY2 A;  5ACQ A;  4GYU A;  3PG4 A;  2XR1 A;  5LLD A;  4ZEJ A;  3BK2 A;  2YNV A;  2CFZ A;  2BGA A;  3VPE A;  3T9M A;  3H3E A;  5K4K A;  4C1F A;  4NQ6 A;  3ZNB A;  2BG8 A;  5EVK A;  4D1T A;  3G1P A;  4DIL A;  4AWY B;  4RL2 A;  3DHB A;  4NQ4 A;  2FU9 A;  4C09 A;  1MQO A;  2I7V A;  2WYM C;  1JJE A;  1BMC A;  3I13 A;  2E7Y A;  4UBQ A;  1ZTC A;  5EVB A;  1XM8 A;  4TZF A;  4D1U A;  4Z60 A;  2FU6 A;  3X2Z A;  3IOF A;  5HH6 A;  2AIO A;  4Z5Z A;  2QIN A;  4BZ3 A;  3BV6 A;  2BR6 A;  3FCZ A;  3KL7 A;  5AHO A;  1VGN A;  2WHG A;  4ZO2 A;  4EYF A;  3ZWF A;  1X8H A;  5A0V A;  2ZWR A;  4RBS A;  2FM6 A;  2Q9U A;  4ZO3 A;  5A5Z A;  4UWR B;  2QJS A;  2BG6 A;  1YCG A;  2UYX A;  1M2X A;  3BC2 A;  5KIK A;  5FQA A;  1X8I A;  2CFU A;  2YCB A;  4KEP A;  5AHR A;  4D1V A;  1VJN A;  2P18 A;  5A87 A;  2BFL A;  2CG3 A;  2Y87 A;  5ACP A;  2FHX B;  3T3O A;  5ACT A;  3RKJ A;  5AEB A;  1A7T A;  4PVT A;  5B15 A;  4HL1 A;  3ZQ4 A;  2WYM A;  4NQ5 A;  4TZ9 A;  2OHJ A;  5B3R A;  1E5D A;  5HH5 A;  2A7M A;  3SRX A;  5LCH A;  3PY6 A;  2OHI A;  2GFJ A; 
#chains in the Genus database with same CATH homology
 2H6A A;  5HIS A;  1KO2 A;  5ACX A;  2DKF A;  1ZNB A;  2P4Z A;  3RKK A;  2BC2 A;  2GMN A;  4RAW A;  5HH4 A;  2QDS A;  4XWT A;  2Q42 A;  5AXR A;  3VQZ A;  5ACW A;  4JO0 A;  3BK1 A;  2BIB A;  3IEM A;  4D1W A;  3DHA A;  4GYQ A;  5IQK A;  3DH8 A;  4LE6 A;  2OHH A;  3SFP A;  3IEK A;  5ACU A;  3SBL A;  2XF4 A;  2NZF A;  1DXK A;  2BTN A;  2I7T A;  4EYB A;  5EWA A;  4C1H A;  2BFZ B;  3I0V A;  1WRA A;  3R2U A;  4F6Z A;  5EW0 A;  5EVD A;  2CBN A;  2P97 A;  3IOG A;  3T3N A;  4XWW A;  2ZNB A;  3PY5 A;  2WYL A;  4P62 A;  2DOO A;  4CHL A;  3X2X A;  3X2Y A;  4Z5Y A;  2QED A;  2ZZI A;  2Y8A A;  5HIQ A;  4TZB A;  5AYA A;  5B1U A;  3RPC A;  3I11 A;  3TP9 A;  4J5F A;  2FU7 A;  5FQC A;  5LCA A;  4EXY A;  5K0W A;  5HIP A;  2BG2 A;  2M5D A;  5LM6 A;  4ZNB A;  4U4L A;  2YNT B;  4FR7 A;  1L9Y A;  4GCW A;  4AD9 A;  2NXA A;  5ACR A;  5EV8 A;  1XTO A;  1JT1 A;  4AX1 B;  1JJT A;  4C1G A;  3F9O A;  3P2U A;  3AJ3 A;  4EYL A;  1YCH A;  3SD9 A;  4Z6X A;  5LS3 A;  3S0Z A;  3IE1 A;  5HIO A;  4XUK A;  2GCU A;  5AXO A;  4UWS B;  2ZO4 A;  2FU8 A;  4C1E A;  4UWP B;  2FHX A;  4YSK A;  4BP0 A;  3SW3 A;  1VME A;  2I7X A;  2YNU A;  4O98 A;  2YNV B;  4D02 A;  1DD6 A;  2BG8 B;  4RL0 A;  4FSB A;  2NYP A;  1QH5 A;  2BG7 A;  3A4Y A;  1HLK A;  5KIL A;  3AF5 A;  4TYF A;  5DPX A;  1KO3 A;  1K07 A;  1X8G A;  5LCF A;  2BFK A;  3AF6 A;  3FAI A;  2Y8B A;  5EHT A;  4YSB A;  5LMC A;  2BMI A;  5LE1 A;  2GKL A;  2YNW A;  2GFK A;  3ZR9 A;  4KEQ A;  1BC2 A;  3WXC A;  3MD7 A;  1BVT A;  1ZKP A;  4C1D A;  3L6N A;  2WRS A;  4HL2 A;  3JXP A;  4RM5 A;  2VW8 A;  2BFZ A;  4RAM A;  1DDK A;  1P9E A;  3DHC A;  4H0D A;  2NZE A;  3IE2 A;  5EV6 A;  2P1E A;  4DIK A;  2YZ3 A;  5ACV A;  4NQ2 A;  1YCF A;  3IE0 A;  2FK6 A;  1A8T A;  4YSL A;  2Q0J A;  3ESH A;  3I15 A;  4B87 A;  3I14 A;  1WUO A;  3Q6V A;  3SPU A;  1WUP A;  5LSC A;  5ACS A;  3KNS A;  4C1C A;  4J5H A;  1Y44 A;  1KR3 A;  4UWO B;  4TYT A;  5FQB A;  3KNR A;  3LVZ A;  4WD6 A;  2YNT A;  4EXS A;  2HB9 A;  4HKY A;  2R2D A;  4EFZ A;  4FEK A;  3IDZ A;  2M5C A;  2AZ4 A;  4AWZ A;  3IEL A;  2QDT A;  3X30 A;  3ADR A;  4AX0 B;  1WW1 A;  4Z7R A;  3QH8 A;  1QH3 A;  5EH9 A;  4F6H A;  4Z67 A;  1SML A;  4TZE A;  5A0T A;  4UAM A;  5K4M A;  5K4N A;  4PVO A;  4UA4 A;  4V0H A;  2Q0I A;  4EY2 A;  5ACQ A;  4GYU A;  3PG4 A;  2XR1 A;  5LLD A;  4ZEJ A;  3BK2 A;  2YNV A;  2BGA A;  3VPE A;  3T9M A;  3H3E A;  5K4K A;  4C1F A;  4NQ6 A;  3ZNB A;  2BG8 A;  5EVK A;  4D1T A;  3G1P A;  4DIL A;  4AWY B;  4RL2 A;  3DHB A;  4NQ4 A;  2FU9 A;  4C09 A;  1MQO A;  2I7V A;  2WYM C;  1JJE A;  1BMC A;  3I13 A;  2E7Y A;  4UBQ A;  1ZTC A;  5EVB A;  1XM8 A;  4TZF A;  4D1U A;  4Z60 A;  2FU6 A;  3X2Z A;  3IOF A;  5HH6 A;  2AIO A;  4Z5Z A;  2QIN A;  4BZ3 A;  3BV6 A;  2BR6 A;  3FCZ A;  3KL7 A;  5AHO A;  1VGN A;  2WHG A;  4ZO2 A;  4EYF A;  3ZWF A;  1X8H A;  5A0V A;  2ZWR A;  4RBS A;  2FM6 A;  2Q9U A;  4ZO3 A;  5A5Z A;  4UWR B;  2QJS A;  2BG6 A;  1YCG A;  2UYX A;  1M2X A;  3BC2 A;  5KIK A;  5FQA A;  1X8I A;  2YCB A;  4KEP A;  5AHR A;  4D1V A;  1VJN A;  2P18 A;  5A87 A;  2BFL A;  2Y87 A;  5ACP A;  2FHX B;  3T3O A;  5ACT A;  3RKJ A;  5AEB A;  1A7T A;  4PVT A;  5B15 A;  4HL1 A;  3ZQ4 A;  2WYM A;  4NQ5 A;  4TZ9 A;  2OHJ A;  5B3R A;  1E5D A;  5HH5 A;  2A7M A;  3SRX A;  5LCH A;  3PY6 A;  2OHI A;  2GFJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...