1ZKPA

1.5a resolution crystal structure of a metallo beta lactamase family protein, the elac homolgue of bacillus anthracis, a putative ribonuclease
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
251
structure length
251
Chain Sequence
LYFQSNAMKMTVVGFWGGFPEAGEATSGYLFEHDGFRLLVDCGSGVLAQLQKYITPSDIDAVVLSHYHHDHVADIGVLQYARLITSATKGQLPELPIYGHTFDENGFHSLTHEPHTKGIPYNPEETLQIGPFSISFLKTVHPVTCFAMRITAGNDIVVYSADSSYIPEFIPFTKDADLFICECNMYAHQEAAKAGHMNSTEVASIAKDANVKELLLTHLPHTGNPADLVTEAKQIFSGHITLAHSGYVWNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 1.5A Resolution Crystal Structure of a Metallo Beta Lactamase Family Protein, the ELAC Homolgue of Bacillus anthracis, a Putative Ribonuclease
rcsb
source organism Bacillus anthracis str.
molecule tags Structural genomics, unknown function
molecule keywords hypothetical protein BA1088
total genus 76
structure length 251
sequence length 251
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12706 Lactamase_B_2 Beta-lactamase superfamily domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 1zkpA00
3ZQ4A 5EW0A 1YCHA 2BFKA 4F6HA 3T3NA 2BG8A 4RM5A 2YNVA 2M5CA 5EV6A 1K07A 5EWAA 4D1TA 4C1GA 5DPXA 2WRSA 2ZZIA 4ZEJA 5A0VA 3SPUA 4TYFA 2ZO4A 2YCBA 3IE0A 1VJNA 2BFLA 3H3EA 3ESHA 1QH3A 1HLKA 2XR1A 1E5DA 1YCGA 5EH9A 1WUPA 4J5FA 2GFKA 2ZWRA 2FU8A 4ZNBA 5LM6A 4ZO3A 2P18A 5ACPA 3JXPA 2OHIA 4TYTA 5HH6A 4AWYB 4AD9A 3BK1A 3R2UA 2OHHA 4ZO2A 3RKJA 2YNWA 3I11A 1DD6A 3ADRA 4RBSA 4XUKA 2FM6A 4NQ4A 5FQBA 4NQ2A 4GYUA 3KNRA 5B1UA 2YNTB 5HH5A 2I7VA 4BP0A 3AF6A 4FR7A 3SRXA 5HIOA 4PVOA 1X8HA 1YCFA 1BC2A 3FCZA 1WUOA 3LVZA 4FSBA 4EYLA 1MQOA 5B15A 1KO3A 4RAMA 5ACQA 4YSKA 1JJTA 3BC2A 2R2DA 1A8TA 4EXYA 5LLDA 4O98A 2FHXB 4Z67A 3Q6VA 4CHLA 4DILA 4RL0A 1BVTA 4J5HA 1BMCA 2YZ3A 3S0ZA 5ACXA 3X2ZA 2FU9A 2QINA 2Q9UA 3DH8A 5LSCA 5FQCA 2YNTA 3KNSA 5ACVA 4RAWA 3F9OA 3IEMA 3X2XA 3KL7A 3I15A 5HIPA 2QEDA 3ZNBA 3SFPA 2DKFA 4GCWA 5EV8A 2BMIA 2UYXA 5LE1A 2BGAA 3BK2A 2Y8BA 4D1VA 4Z6XA 4EYFA 5B3RA 4HL2A 4D1WA 3VQZA 2YNVB 5EHTA 5LS3A 5EVBA 4Z5ZA 4HKYA 3RPCA 1ZNBA 5AHOA 2BG8B 2NYPA 4H0DA 2BFZB 4EFZA 3PY6A 2BR6A 4UBQA 5AXOA 5EVDA 1KO2A 4XWWA 2A7MA 2HB9A 1XM8A 2DOOA 2Y87A 4KEQA 5ACSA 5K4KA 4C1CA 2P1EA 1KR3A 2OHJA 2YNUA 3I13A 2M5DA 2CBNA 4TZFA 4BZ3A 4YSLA 4P62A 3SBLA 1VGNA 1WW1A 4C1DA 4D1UA 4AX0B 3PG4A 2GCUA 3P2UA 3X2YA 1DXKA 3DHCA 5ACRA 1X8IA 5K4NA 4XWTA 4U4LA 2ZNBA 5IQKA 2WYLA 3A4YA 4EYBA 2Q0IA 5EVKA 2WYMC 3WXCA 3T3OA 2XF4A 2BG6A 5A0TA 1ZKPA 3IE1A 1X8GA 3L6NA 4PVTA 4AX1B 2QDSA 5LMCA 2FHXA 3MD7A 4JO0A 1L9YA 3TP9A 2QDTA 2FK6A 3IOFA 5A5ZA 4Z60A 5A87A 5AHRA 2Y8AA 4C1EA 3AJ3A 3DHBA 2GFJA 4Z7RA 1JT1A 2Q0JA 2QJSA 2I7XA 3RKKA 4UAMA 5HISA 5LCHA 4LE6A 3IEKA 4C09A 4C1HA 4NQ5A 5LCAA 5AXRA 2GMNA 2WYMA 1Y44A 2NZFA 4HL1A 1A7TA 2Q42A 2BIBA 5KILA 2BG2A 4UWSB 5AEBA 3ZWFA 4TZBA 1ZTCA 3AF5A 4DIKA 1JJEA 1M2XA 4B87A 2BG7A 4EXSA 4WD6A 1P9EA 1WRAA 4V0HA 4Z5YA 3I14A 5AYAA 1QH5A 2P97A 5HIQA 2P4ZA 2FU7A 2FU6A 5HH4A 2WHGA 2I7TA 3DHAA 3QH8A 4FEKA 5FQAA 3SD9A 3VPEA 5ACUA 3ZR9A 3PY5A 3IELA 2GKLA 2VW8A 2BC2A 4C1FA 1XTOA 5ACTA 3X30A 4NQ6A 2BTNA 3BV6A 4UA4A 4YSBA 3I0VA 4D02A 4UWPB 1DDKA 2NXAA 3T9MA 4TZ9A 4TZEA 3SW3A 2H6AA 4GYQA 4RL2A 1SMLA 5LCFA 5K4MA 5KIKA 5K0WA 4EY2A 4UWOB 2AZ4A 3IE2A 3G1PA 4F6ZA 5ACWA 4AWZA 3FAIA 2BFZA 2E7YA 1VMEA 3IOGA 2NZEA 4KEPA 2AIOA 4UWRB 3IDZA
chains in the Genus database with same CATH superfamily
3ZQ4A 5EW0A 1YCHA 2BFKA 4F6HA 3T3NA 2BG8A 4RM5A 2YNVA 2M5CA 5EV6A 1K07A 5EWAA 4D1TA 4C1GA 5DPXA 2WRSA 2ZZIA 4ZEJA 5A0VA 3SPUA 4TYFA 2ZO4A 2YCBA 3IE0A 1VJNA 2BFLA 3H3EA 3ESHA 1QH3A 1HLKA 2XR1A 1E5DA 1YCGA 5EH9A 1WUPA 4J5FA 2CG2A 2GFKA 2ZWRA 2FU8A 4ZNBA 5LM6A 4ZO3A 2P18A 5ACPA 3JXPA 2OHIA 4TYTA 5HH6A 4AWYB 4AD9A 3BK1A 3R2UA 2OHHA 4ZO2A 3RKJA 2CG3A 2YNWA 3I11A 1DD6A 3ADRA 4RBSA 4XUKA 2FM6A 4NQ4A 5FQBA 4NQ2A 4GYUA 3KNRA 5B1UA 2YNTB 5HH5A 2I7VA 4BP0A 3AF6A 4FR7A 3SRXA 5HIOA 4PVOA 1X8HA 1YCFA 1BC2A 3FCZA 1WUOA 3LVZA 4FSBA 4EYLA 1MQOA 5B15A 1KO3A 4RAMA 5ACQA 4YSKA 1JJTA 3BC2A 2R2DA 1A8TA 4EXYA 5LLDA 4O98A 2FHXB 4Z67A 3Q6VA 4CHLA 4DILA 4RL0A 1BVTA 4J5HA 1BMCA 2YZ3A 3S0ZA 5ACXA 3X2ZA 2FU9A 2QINA 2Q9UA 3DH8A 5LSCA 5FQCA 2YNTA 3KNSA 5ACVA 4RAWA 3F9OA 3IEMA 3X2XA 3KL7A 2YHEA 3I15A 5HIPA 2QEDA 3ZNBA 5AJLA 3SFPA 2DKFA 4GCWA 5EV8A 2BMIA 2UYXA 5LE1A 2BGAA 3BK2A 2Y8BA 4D1VA 4Z6XA 4EYFA 5B3RA 4HL2A 4D1WA 3VQZA 2YNVB 5EHTA 5LS3A 5EVBA 4Z5ZA 4HKYA 3RPCA 1ZNBA 5AHOA 2BG8B 2NYPA 4H0DA 2BFZB 4EFZA 2CFUA 3PY6A 2BR6A 4UBQA 5AXOA 5EVDA 1KO2A 4XWWA 2A7MA 2HB9A 1XM8A 2DOOA 2Y87A 4KEQA 5ACSA 5K4KA 4C1CA 2P1EA 1KR3A 2OHJA 2YNUA 3I13A 2M5DA 2CBNA 4TZFA 4BZ3A 4YSLA 4P62A 3SBLA 1VGNA 1WW1A 4C1DA 4D1UA 4AX0B 3PG4A 2GCUA 3P2UA 3X2YA 1DXKA 3DHCA 5ACRA 1X8IA 5K4NA 4XWTA 4U4LA 2ZNBA 5IQKA 2WYLA 3A4YA 4EYBA 2Q0IA 5EVKA 2WYMC 3WXCA 2CFZA 3T3OA 2XF4A 2BG6A 5A0TA 1ZKPA 3IE1A 1X8GA 3L6NA 4PVTA 4AX1B 2QDSA 5LMCA 2FHXA 3MD7A 4JO0A 1L9YA 3TP9A 2QDTA 2FK6A 3IOFA 5A5ZA 4Z60A 5A87A 5AHRA 2Y8AA 4C1EA 3AJ3A 3DHBA 2GFJA 4Z7RA 1JT1A 2Q0JA 2QJSA 2I7XA 3RKKA 4UAMA 5HISA 5LCHA 4LE6A 3IEKA 4C09A 4C1HA 4NQ5A 4AXHA 5LCAA 5AXRA 2GMNA 2WYMA 1Y44A 2NZFA 4HL1A 1A7TA 2Q42A 2BIBA 5KILA 2BG2A 4UWSB 5AEBA 3ZWFA 4TZBA 1ZTCA 3AF5A 4DIKA 1JJEA 1M2XA 4B87A 5A23A 2BG7A 4EXSA 4WD6A 4PDXA 1P9EA 1WRAA 4V0HA 4Z5YA 3I14A 4AV7A 5AYAA 1QH5A 2P97A 5HIQA 2P4ZA 2FU7A 2FU6A 5HH4A 2WHGA 2I7TA 3DHAA 3QH8A 4FEKA 5FQAA 3SD9A 3VPEA 5ACUA 3ZR9A 3PY5A 3IELA 2GKLA 2VW8A 2BC2A 4C1FA 1XTOA 5ACTA 3X30A 4NQ6A 2BTNA 3BV6A 4UA4A 4YSBA 3I0VA 4D02A 4UWPB 1DDKA 2NXAA 3T9MA 4TZ9A 4TZEA 3SW3A 2H6AA 4GYQA 4RL2A 1SMLA 5LCFA 5K4MA 5AIJA 5KIKA 5K0WA 4EY2A 4UWOB 2AZ4A 3IE2A 4NURA 3G1PA 4F6ZA 5ACWA 4AWZA 3FAIA 2BFZA 2E7YA 1VMEA 3IOGA 2NZEA 4KEPA 2AIOA 4UWRB 3IDZA
chains in the Genus database with same CATH topology
3ZQ4A 5EW0A 1YCHA 2BFKA 4F6HA 3T3NA 2BG8A 4RM5A 2YNVA 2M5CA 5EV6A 1K07A 5EWAA 4D1TA 4C1GA 5DPXA 2WRSA 2ZZIA 4ZEJA 5A0VA 3SPUA 4TYFA 2ZO4A 2YCBA 3IE0A 1VJNA 2BFLA 3H3EA 3ESHA 1QH3A 1HLKA 2XR1A 1E5DA 1YCGA 5EH9A 1WUPA 4J5FA 2GFKA 2ZWRA 2FU8A 4ZNBA 5LM6A 4ZO3A 2P18A 5ACPA 3JXPA 2OHIA 4TYTA 5HH6A 4AWYB 4AD9A 3BK1A 3R2UA 2OHHA 4ZO2A 3RKJA 2YNWA 3I11A 1DD6A 3ADRA 4RBSA 4XUKA 2FM6A 4NQ4A 5FQBA 4NQ2A 4GYUA 3KNRA 5B1UA 2YNTB 5HH5A 2I7VA 4BP0A 3AF6A 4FR7A 3SRXA 5HIOA 4PVOA 1X8HA 1YCFA 1BC2A 3FCZA 1WUOA 3LVZA 4FSBA 4EYLA 1MQOA 5B15A 1KO3A 4RAMA 5ACQA 4YSKA 1JJTA 3BC2A 2R2DA 1A8TA 4EXYA 5LLDA 4O98A 2FHXB 4Z67A 3Q6VA 4CHLA 4DILA 4RL0A 1BVTA 4J5HA 1BMCA 2YZ3A 3S0ZA 5ACXA 3X2ZA 2FU9A 2QINA 2Q9UA 3DH8A 5LSCA 5FQCA 2YNTA 3KNSA 5ACVA 4RAWA 3F9OA 3IEMA 3X2XA 3KL7A 3I15A 5HIPA 2QEDA 3ZNBA 3SFPA 2DKFA 4GCWA 5EV8A 2BMIA 2UYXA 5LE1A 2BGAA 3BK2A 2Y8BA 4D1VA 4Z6XA 4EYFA 5B3RA 4HL2A 4D1WA 3VQZA 2YNVB 5EHTA 5LS3A 5EVBA 4Z5ZA 4HKYA 3RPCA 1ZNBA 5AHOA 2BG8B 2NYPA 4H0DA 2BFZB 4EFZA 3PY6A 2BR6A 4UBQA 5AXOA 5EVDA 1KO2A 4XWWA 2A7MA 2HB9A 1XM8A 2DOOA 2Y87A 4KEQA 5ACSA 5K4KA 4C1CA 2P1EA 1KR3A 2OHJA 2YNUA 3I13A 2M5DA 2CBNA 4TZFA 4BZ3A 4YSLA 4P62A 3SBLA 1VGNA 1WW1A 4C1DA 4D1UA 4AX0B 3PG4A 2GCUA 3P2UA 3X2YA 1DXKA 3DHCA 5ACRA 1X8IA 5K4NA 4XWTA 4U4LA 2ZNBA 5IQKA 2WYLA 3A4YA 4EYBA 2Q0IA 5EVKA 2WYMC 3WXCA 3T3OA 2XF4A 2BG6A 5A0TA 1ZKPA 3IE1A 1X8GA 3L6NA 4PVTA 4AX1B 2QDSA 5LMCA 2FHXA 3MD7A 4JO0A 1L9YA 3TP9A 2QDTA 2FK6A 3IOFA 5A5ZA 4Z60A 5A87A 5AHRA 2Y8AA 4C1EA 3AJ3A 3DHBA 2GFJA 4Z7RA 1JT1A 2Q0JA 2QJSA 2I7XA 3RKKA 4UAMA 5HISA 5LCHA 4LE6A 3IEKA 4C09A 4C1HA 4NQ5A 5LCAA 5AXRA 2GMNA 2WYMA 1Y44A 2NZFA 4HL1A 1A7TA 2Q42A 2BIBA 5KILA 2BG2A 4UWSB 5AEBA 3ZWFA 4TZBA 1ZTCA 3AF5A 4DIKA 1JJEA 1M2XA 4B87A 2BG7A 4EXSA 4WD6A 1P9EA 1WRAA 4V0HA 4Z5YA 3I14A 5AYAA 1QH5A 2P97A 5HIQA 2P4ZA 2FU7A 2FU6A 5HH4A 2WHGA 2I7TA 3DHAA 3QH8A 4FEKA 5FQAA 3SD9A 3VPEA 5ACUA 3ZR9A 3PY5A 3IELA 2GKLA 2VW8A 2BC2A 4C1FA 1XTOA 5ACTA 3X30A 4NQ6A 2BTNA 3BV6A 4UA4A 4YSBA 3I0VA 4D02A 4UWPB 1DDKA 2NXAA 3T9MA 4TZ9A 4TZEA 3SW3A 2H6AA 4GYQA 4RL2A 1SMLA 5LCFA 5K4MA 5KIKA 5K0WA 4EY2A 4UWOB 2AZ4A 3IE2A 3G1PA 4F6ZA 5ACWA 4AWZA 3FAIA 2BFZA 2E7YA 1VMEA 3IOGA 2NZEA 4KEPA 2AIOA 4UWRB 3IDZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZQ4 A;  5EW0 A;  1YCH A;  2BFK A;  4F6H A;  3T3N A;  2BG8 A;  4RM5 A;  2YNV A;  2M5C A;  5EV6 A;  1K07 A;  5EWA A;  4D1T A;  4C1G A;  5DPX A;  2WRS A;  2ZZI A;  4ZEJ A;  5A0V A;  3SPU A;  4TYF A;  2ZO4 A;  2YCB A;  3IE0 A;  1VJN A;  2BFL A;  3H3E A;  3ESH A;  1QH3 A;  1HLK A;  2XR1 A;  1E5D A;  1YCG A;  5EH9 A;  1WUP A;  4J5F A;  2GFK A;  2ZWR A;  2FU8 A;  4ZNB A;  5LM6 A;  4ZO3 A;  2P18 A;  5ACP A;  3JXP A;  2OHI A;  4TYT A;  5HH6 A;  4AWY B;  4AD9 A;  3BK1 A;  3R2U A;  2OHH A;  4ZO2 A;  3RKJ A;  2YNW A;  3I11 A;  1DD6 A;  3ADR A;  4RBS A;  4XUK A;  2FM6 A;  4NQ4 A;  5FQB A;  4NQ2 A;  4GYU A;  3KNR A;  5B1U A;  2YNT B;  5HH5 A;  2I7V A;  4BP0 A;  3AF6 A;  4FR7 A;  3SRX A;  5HIO A;  4PVO A;  1X8H A;  1YCF A;  1BC2 A;  3FCZ A;  1WUO A;  3LVZ A;  4FSB A;  4EYL A;  1MQO A;  5B15 A;  1KO3 A;  4RAM A;  5ACQ A;  4YSK A;  1JJT A;  3BC2 A;  2R2D A;  1A8T A;  4EXY A;  5LLD A;  4O98 A;  2FHX B;  4Z67 A;  3Q6V A;  4CHL A;  4DIL A;  4RL0 A;  1BVT A;  4J5H A;  1BMC A;  2YZ3 A;  3S0Z A;  5ACX A;  3X2Z A;  2FU9 A;  2QIN A;  2Q9U A;  3DH8 A;  5LSC A;  5FQC A;  2YNT A;  3KNS A;  5ACV A;  4RAW A;  3F9O A;  3IEM A;  3X2X A;  3KL7 A;  3I15 A;  5HIP A;  2QED A;  3ZNB A;  3SFP A;  2DKF A;  4GCW A;  5EV8 A;  2BMI A;  2UYX A;  5LE1 A;  2BGA A;  3BK2 A;  2Y8B A;  4D1V A;  4Z6X A;  4EYF A;  5B3R A;  4HL2 A;  4D1W A;  3VQZ A;  2YNV B;  5EHT A;  5LS3 A;  5EVB A;  4Z5Z A;  4HKY A;  3RPC A;  1ZNB A;  5AHO A;  2BG8 B;  2NYP A;  4H0D A;  2BFZ B;  4EFZ A;  3PY6 A;  2BR6 A;  4UBQ A;  5AXO A;  5EVD A;  1KO2 A;  4XWW A;  2A7M A;  2HB9 A;  1XM8 A;  2DOO A;  2Y87 A;  4KEQ A;  5ACS A;  5K4K A;  4C1C A;  2P1E A;  1KR3 A;  2OHJ A;  2YNU A;  3I13 A;  2M5D A;  2CBN A;  4TZF A;  4BZ3 A;  4YSL A;  4P62 A;  3SBL A;  1VGN A;  1WW1 A;  4C1D A;  4D1U A;  4AX0 B;  3PG4 A;  2GCU A;  3P2U A;  3X2Y A;  1DXK A;  3DHC A;  5ACR A;  1X8I A;  5K4N A;  4XWT A;  4U4L A;  2ZNB A;  5IQK A;  2WYL A;  3A4Y A;  4EYB A;  2Q0I A;  5EVK A;  2WYM C;  3WXC A;  3T3O A;  2XF4 A;  2BG6 A;  5A0T A;  1ZKP A;  3IE1 A;  1X8G A;  3L6N A;  4PVT A;  4AX1 B;  2QDS A;  5LMC A;  2FHX A;  3MD7 A;  4JO0 A;  1L9Y A;  3TP9 A;  2QDT A;  2FK6 A;  3IOF A;  5A5Z A;  4Z60 A;  5A87 A;  5AHR A;  2Y8A A;  4C1E A;  3AJ3 A;  3DHB A;  2GFJ A;  4Z7R A;  1JT1 A;  2Q0J A;  2QJS A;  2I7X A;  3RKK A;  4UAM A;  5HIS A;  5LCH A;  4LE6 A;  3IEK A;  4C09 A;  4C1H A;  4NQ5 A;  5LCA A;  5AXR A;  2GMN A;  2WYM A;  1Y44 A;  2NZF A;  4HL1 A;  1A7T A;  2Q42 A;  2BIB A;  5KIL A;  2BG2 A;  4UWS B;  5AEB A;  3ZWF A;  4TZB A;  1ZTC A;  3AF5 A;  4DIK A;  1JJE A;  1M2X A;  4B87 A;  2BG7 A;  4EXS A;  4WD6 A;  1P9E A;  1WRA A;  4V0H A;  4Z5Y A;  3I14 A;  5AYA A;  1QH5 A;  2P97 A;  5HIQ A;  2P4Z A;  2FU7 A;  2FU6 A;  5HH4 A;  2WHG A;  2I7T A;  3DHA A;  3QH8 A;  4FEK A;  5FQA A;  3SD9 A;  3VPE A;  5ACU A;  3ZR9 A;  3PY5 A;  3IEL A;  2GKL A;  2VW8 A;  2BC2 A;  4C1F A;  1XTO A;  5ACT A;  3X30 A;  4NQ6 A;  2BTN A;  3BV6 A;  4UA4 A;  4YSB A;  3I0V A;  4D02 A;  4UWP B;  1DDK A;  2NXA A;  3T9M A;  4TZ9 A;  4TZE A;  3SW3 A;  2H6A A;  4GYQ A;  4RL2 A;  1SML A;  5LCF A;  5K4M A;  5KIK A;  5K0W A;  4EY2 A;  4UWO B;  2AZ4 A;  3IE2 A;  3G1P A;  4F6Z A;  5ACW A;  4AWZ A;  3FAI A;  2BFZ A;  2E7Y A;  1VME A;  3IOG A;  2NZE A;  4KEP A;  2AIO A;  4UWR B;  3IDZ A; 
#chains in the Genus database with same CATH topology
 3ZQ4 A;  5EW0 A;  1YCH A;  2BFK A;  4F6H A;  3T3N A;  2BG8 A;  4RM5 A;  2YNV A;  2M5C A;  5EV6 A;  1K07 A;  5EWA A;  4D1T A;  4C1G A;  5DPX A;  2WRS A;  2ZZI A;  4ZEJ A;  5A0V A;  3SPU A;  4TYF A;  2ZO4 A;  2YCB A;  3IE0 A;  1VJN A;  2BFL A;  3H3E A;  3ESH A;  1QH3 A;  1HLK A;  2XR1 A;  1E5D A;  1YCG A;  5EH9 A;  1WUP A;  4J5F A;  2CG2 A;  2GFK A;  2ZWR A;  2FU8 A;  4ZNB A;  5LM6 A;  4ZO3 A;  2P18 A;  5ACP A;  3JXP A;  2OHI A;  4TYT A;  5HH6 A;  4AWY B;  4AD9 A;  3BK1 A;  3R2U A;  2OHH A;  4ZO2 A;  3RKJ A;  2CG3 A;  2YNW A;  3I11 A;  1DD6 A;  3ADR A;  4RBS A;  4XUK A;  2FM6 A;  4NQ4 A;  5FQB A;  4NQ2 A;  4GYU A;  3KNR A;  5B1U A;  2YNT B;  5HH5 A;  2I7V A;  4BP0 A;  3AF6 A;  4FR7 A;  3SRX A;  5HIO A;  4PVO A;  1X8H A;  1YCF A;  1BC2 A;  3FCZ A;  1WUO A;  3LVZ A;  4FSB A;  4EYL A;  1MQO A;  5B15 A;  1KO3 A;  4RAM A;  5ACQ A;  4YSK A;  1JJT A;  3BC2 A;  2R2D A;  1A8T A;  4EXY A;  5LLD A;  4O98 A;  2FHX B;  4Z67 A;  3Q6V A;  4CHL A;  4DIL A;  4RL0 A;  1BVT A;  4J5H A;  1BMC A;  2YZ3 A;  3S0Z A;  5ACX A;  3X2Z A;  2FU9 A;  2QIN A;  2Q9U A;  3DH8 A;  5LSC A;  5FQC A;  2YNT A;  3KNS A;  5ACV A;  4RAW A;  3F9O A;  3IEM A;  3X2X A;  3KL7 A;  2YHE A;  3I15 A;  5HIP A;  2QED A;  3ZNB A;  5AJL A;  3SFP A;  2DKF A;  4GCW A;  5EV8 A;  2BMI A;  2UYX A;  5LE1 A;  2BGA A;  3BK2 A;  2Y8B A;  4D1V A;  4Z6X A;  4EYF A;  5B3R A;  4HL2 A;  4D1W A;  3VQZ A;  2YNV B;  5EHT A;  5LS3 A;  5EVB A;  4Z5Z A;  4HKY A;  3RPC A;  1ZNB A;  5AHO A;  2BG8 B;  2NYP A;  4H0D A;  2BFZ B;  4EFZ A;  2CFU A;  3PY6 A;  2BR6 A;  4UBQ A;  5AXO A;  5EVD A;  1KO2 A;  4XWW A;  2A7M A;  2HB9 A;  1XM8 A;  2DOO A;  2Y87 A;  4KEQ A;  5ACS A;  5K4K A;  4C1C A;  2P1E A;  1KR3 A;  2OHJ A;  2YNU A;  3I13 A;  2M5D A;  2CBN A;  4TZF A;  4BZ3 A;  4YSL A;  4P62 A;  3SBL A;  1VGN A;  1WW1 A;  4C1D A;  4D1U A;  4AX0 B;  3PG4 A;  2GCU A;  3P2U A;  3X2Y A;  1DXK A;  3DHC A;  5ACR A;  1X8I A;  5K4N A;  4XWT A;  4U4L A;  2ZNB A;  5IQK A;  2WYL A;  3A4Y A;  4EYB A;  2Q0I A;  5EVK A;  2WYM C;  3WXC A;  2CFZ A;  3T3O A;  2XF4 A;  2BG6 A;  5A0T A;  1ZKP A;  3IE1 A;  1X8G A;  3L6N A;  4PVT A;  4AX1 B;  2QDS A;  5LMC A;  2FHX A;  3MD7 A;  4JO0 A;  1L9Y A;  3TP9 A;  2QDT A;  2FK6 A;  3IOF A;  5A5Z A;  4Z60 A;  5A87 A;  5AHR A;  2Y8A A;  4C1E A;  3AJ3 A;  3DHB A;  2GFJ A;  4Z7R A;  1JT1 A;  2Q0J A;  2QJS A;  2I7X A;  3RKK A;  4UAM A;  5HIS A;  5LCH A;  4LE6 A;  3IEK A;  4C09 A;  4C1H A;  4NQ5 A;  4AXH A;  5LCA A;  5AXR A;  2GMN A;  2WYM A;  1Y44 A;  2NZF A;  4HL1 A;  1A7T A;  2Q42 A;  2BIB A;  5KIL A;  2BG2 A;  4UWS B;  5AEB A;  3ZWF A;  4TZB A;  1ZTC A;  3AF5 A;  4DIK A;  1JJE A;  1M2X A;  4B87 A;  5A23 A;  2BG7 A;  4EXS A;  4WD6 A;  4PDX A;  1P9E A;  1WRA A;  4V0H A;  4Z5Y A;  3I14 A;  4AV7 A;  5AYA A;  1QH5 A;  2P97 A;  5HIQ A;  2P4Z A;  2FU7 A;  2FU6 A;  5HH4 A;  2WHG A;  2I7T A;  3DHA A;  3QH8 A;  4FEK A;  5FQA A;  3SD9 A;  3VPE A;  5ACU A;  3ZR9 A;  3PY5 A;  3IEL A;  2GKL A;  2VW8 A;  2BC2 A;  4C1F A;  1XTO A;  5ACT A;  3X30 A;  4NQ6 A;  2BTN A;  3BV6 A;  4UA4 A;  4YSB A;  3I0V A;  4D02 A;  4UWP B;  1DDK A;  2NXA A;  3T9M A;  4TZ9 A;  4TZE A;  3SW3 A;  2H6A A;  4GYQ A;  4RL2 A;  1SML A;  5LCF A;  5K4M A;  5AIJ A;  5KIK A;  5K0W A;  4EY2 A;  4UWO B;  2AZ4 A;  3IE2 A;  4NUR A;  3G1P A;  4F6Z A;  5ACW A;  4AWZ A;  3FAI A;  2BFZ A;  2E7Y A;  1VME A;  3IOG A;  2NZE A;  4KEP A;  2AIO A;  4UWR B;  3IDZ A; 
#chains in the Genus database with same CATH homology
 3ZQ4 A;  5EW0 A;  1YCH A;  2BFK A;  4F6H A;  3T3N A;  2BG8 A;  4RM5 A;  2YNV A;  2M5C A;  5EV6 A;  1K07 A;  5EWA A;  4D1T A;  4C1G A;  5DPX A;  2WRS A;  2ZZI A;  4ZEJ A;  5A0V A;  3SPU A;  4TYF A;  2ZO4 A;  2YCB A;  3IE0 A;  1VJN A;  2BFL A;  3H3E A;  3ESH A;  1QH3 A;  1HLK A;  2XR1 A;  1E5D A;  1YCG A;  5EH9 A;  1WUP A;  4J5F A;  2GFK A;  2ZWR A;  2FU8 A;  4ZNB A;  5LM6 A;  4ZO3 A;  2P18 A;  5ACP A;  3JXP A;  2OHI A;  4TYT A;  5HH6 A;  4AWY B;  4AD9 A;  3BK1 A;  3R2U A;  2OHH A;  4ZO2 A;  3RKJ A;  2YNW A;  3I11 A;  1DD6 A;  3ADR A;  4RBS A;  4XUK A;  2FM6 A;  4NQ4 A;  5FQB A;  4NQ2 A;  4GYU A;  3KNR A;  5B1U A;  2YNT B;  5HH5 A;  2I7V A;  4BP0 A;  3AF6 A;  4FR7 A;  3SRX A;  5HIO A;  4PVO A;  1X8H A;  1YCF A;  1BC2 A;  3FCZ A;  1WUO A;  3LVZ A;  4FSB A;  4EYL A;  1MQO A;  5B15 A;  1KO3 A;  4RAM A;  5ACQ A;  4YSK A;  1JJT A;  3BC2 A;  2R2D A;  1A8T A;  4EXY A;  5LLD A;  4O98 A;  2FHX B;  4Z67 A;  3Q6V A;  4CHL A;  4DIL A;  4RL0 A;  1BVT A;  4J5H A;  1BMC A;  2YZ3 A;  3S0Z A;  5ACX A;  3X2Z A;  2FU9 A;  2QIN A;  2Q9U A;  3DH8 A;  5LSC A;  5FQC A;  2YNT A;  3KNS A;  5ACV A;  4RAW A;  3F9O A;  3IEM A;  3X2X A;  3KL7 A;  3I15 A;  5HIP A;  2QED A;  3ZNB A;  3SFP A;  2DKF A;  4GCW A;  5EV8 A;  2BMI A;  2UYX A;  5LE1 A;  2BGA A;  3BK2 A;  2Y8B A;  4D1V A;  4Z6X A;  4EYF A;  5B3R A;  4HL2 A;  4D1W A;  3VQZ A;  2YNV B;  5EHT A;  5LS3 A;  5EVB A;  4Z5Z A;  4HKY A;  3RPC A;  1ZNB A;  5AHO A;  2BG8 B;  2NYP A;  4H0D A;  2BFZ B;  4EFZ A;  3PY6 A;  2BR6 A;  4UBQ A;  5AXO A;  5EVD A;  1KO2 A;  4XWW A;  2A7M A;  2HB9 A;  1XM8 A;  2DOO A;  2Y87 A;  4KEQ A;  5ACS A;  5K4K A;  4C1C A;  2P1E A;  1KR3 A;  2OHJ A;  2YNU A;  3I13 A;  2M5D A;  2CBN A;  4TZF A;  4BZ3 A;  4YSL A;  4P62 A;  3SBL A;  1VGN A;  1WW1 A;  4C1D A;  4D1U A;  4AX0 B;  3PG4 A;  2GCU A;  3P2U A;  3X2Y A;  1DXK A;  3DHC A;  5ACR A;  1X8I A;  5K4N A;  4XWT A;  4U4L A;  2ZNB A;  5IQK A;  2WYL A;  3A4Y A;  4EYB A;  2Q0I A;  5EVK A;  2WYM C;  3WXC A;  3T3O A;  2XF4 A;  2BG6 A;  5A0T A;  1ZKP A;  3IE1 A;  1X8G A;  3L6N A;  4PVT A;  4AX1 B;  2QDS A;  5LMC A;  2FHX A;  3MD7 A;  4JO0 A;  1L9Y A;  3TP9 A;  2QDT A;  2FK6 A;  3IOF A;  5A5Z A;  4Z60 A;  5A87 A;  5AHR A;  2Y8A A;  4C1E A;  3AJ3 A;  3DHB A;  2GFJ A;  4Z7R A;  1JT1 A;  2Q0J A;  2QJS A;  2I7X A;  3RKK A;  4UAM A;  5HIS A;  5LCH A;  4LE6 A;  3IEK A;  4C09 A;  4C1H A;  4NQ5 A;  5LCA A;  5AXR A;  2GMN A;  2WYM A;  1Y44 A;  2NZF A;  4HL1 A;  1A7T A;  2Q42 A;  2BIB A;  5KIL A;  2BG2 A;  4UWS B;  5AEB A;  3ZWF A;  4TZB A;  1ZTC A;  3AF5 A;  4DIK A;  1JJE A;  1M2X A;  4B87 A;  2BG7 A;  4EXS A;  4WD6 A;  1P9E A;  1WRA A;  4V0H A;  4Z5Y A;  3I14 A;  5AYA A;  1QH5 A;  2P97 A;  5HIQ A;  2P4Z A;  2FU7 A;  2FU6 A;  5HH4 A;  2WHG A;  2I7T A;  3DHA A;  3QH8 A;  4FEK A;  5FQA A;  3SD9 A;  3VPE A;  5ACU A;  3ZR9 A;  3PY5 A;  3IEL A;  2GKL A;  2VW8 A;  2BC2 A;  4C1F A;  1XTO A;  5ACT A;  3X30 A;  4NQ6 A;  2BTN A;  3BV6 A;  4UA4 A;  4YSB A;  3I0V A;  4D02 A;  4UWP B;  1DDK A;  2NXA A;  3T9M A;  4TZ9 A;  4TZE A;  3SW3 A;  2H6A A;  4GYQ A;  4RL2 A;  1SML A;  5LCF A;  5K4M A;  5KIK A;  5K0W A;  4EY2 A;  4UWO B;  2AZ4 A;  3IE2 A;  3G1P A;  4F6Z A;  5ACW A;  4AWZ A;  3FAI A;  2BFZ A;  2E7Y A;  1VME A;  3IOG A;  2NZE A;  4KEP A;  2AIO A;  4UWR B;  3IDZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...